2FTAA

Structure of cu(ii)azurin with the metal-binding loop sequence "ctfpghsalm" replaced with "ctphpfm"
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
122
structure length
122
Chain Sequence
b'CSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTPHPFMKGTLTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
molecule tags Electron transport
source organism Pseudomonas aeruginosa
publication title Basic requirements for a metal-binding site in a protein: The influence of loop shortening on the cupredoxin azurin.
pubmed doi rcsb
total genus 31
structure length 122
sequence length 122
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ftaA00
1MDAA 3H56A 1AOZA 2YAHA 3AZUA 4A2FA 1JZHA 3OM3B 2FNWA 3TASA 2YAFA 3NJIA 5A7EA 4BDVB 4A2HA 4RH4A 3FSZA 4W1TA 1A4AA 4YVNA 1PZAA 1JOIA 1KBVA 3N55A 2PPCA 5IY5B 1ILUA 3ABMB 2BZ7A 1SFDA 2MTAA 3BVDB 2YAQA 1ZIAA 4GP8B 4M4RB 3FT0A 2UX6A 4KO7A 1CC3A 2OJ1A 2X88A 2XX0A 3ZDWA 2IDTA 4P5RA 2FWLB 2BO0A 4BWWA 4E9TA 3AW5A 1MZYA 1PNDA 1OOWA 2PLTA 2CJ3A 2AVFA 2BZCA 1BEXA 1E65A 3FU9A 4KNSA 1AZNA 1ZPUA 3T9WA 2BW5A 2AFNA 3ASOB 3QJUB 4F2EA 5D4JA 2BWDA 2EINB 3S3CB 2YXVA 5AKRA 4YSQA 3AY2A 3S8FB 4QLWA 1E30A 1TEFA 3NJJA 2EIMB 1SDDA 3TBCA 1KBWA 3FQ1A 5I6NA 1W6WA 3NJLA 1VLXA 4AKQA 3EH5B 1E5ZA 3FYEB 2VW4A 3CVCA 3NP3A 1PF3A 2YQBA 3PAVA 1AG6A 3QJRB 4N4YB 4YSUA 3S3BB 2UXFA 1SF5A 2HX9A 3NJGA 2GBAA 1OCCB 1KGYE 1NWPA 1JVLA 4YL4A 1ETJA 2BP8A 3FYIB 5B3SB 2I85A 2HRHA 1JZFA 2XV0A 3U25A 2VMJA 3AG2B 1W6LA 1GY1A 4JKNA 1V10A 1PZCA 4DPCX 2VSKB 3WKQA 1ET5A 1ZDSA 4AKOA 1UATA 1AS6A 1NIAA 1J9SA 1A3ZA 3IEAA 1N68A 1J9QA 2H47C 3FSVA 5AZUA 1OE1A 1IKOP 3L45A 1L9RA 1PAZA 4HALA 1R1CA 4YSRA 2P80A 2IH8A 3CDZB 5B1AB 2E86A 2BP0A 2HX7A 2FT7A 2XV2A 6PCYA 3WKPA 4GY4A 4DPBX 1V55B 2VW6A 1MG2C 1CYXA 4AKPA 4G7QB 3FPXA 3X1GA 3CDZA 1J9RA 3EHBB 2GB2A 2XYBA 2GI0A 1A4CA 4F2FA 3C75A 1SDDB 5D4IA 4DP2X 3FU7A 4NERA 1I53A 1AG0A 1WS7A 1CURA 4AZUA 3NP4A 4KO9A 4HCIA 1RZQA 3FS9A 1XB6A 2IAAC 2YAMA 2DYSB 2ZOOA 1GW0A 2VM4A 1DYZA 2CAKA 4E9RA 1SHWA 3NYKA 2CUAA 2H3XC 3UGEA 1ET7A 4E9WA 1JZJA 4BK5C 5I6OA 1WA1X 2FT6A 3QQXA 1ID2A 1JXGA 4YSOA 4YSDA 1M9WA 1ZIBA 2GIMA 2FJSA 4UANA 4E9SA 4HHWA 1A65A 2FQFA 2CALA 1W8EA 2EIKB 5B1BB 1PY0A 1M57B 1OCRB 3G5WA 4HIPA 1NINA 1ASOA 3V9CA 3ASNB 2DY2A 4GP4B 3NJFA 4DP5X 1L9OA 5I26A 3H4FA 3NSYA 4EF3A 3SBQA 3IE9A 4KOBA 3TU6A 1QLEB 3DTUB 1SHXA 1PMYA 1NIDA 4ZK8A 1PLCA 7PCYA 3WIAA 3JTBA 1ZDQA 1QNIA 2UXGA 3NT0A 3S3DB 5B1JC 1GS8A 5I28A 2DYRB 1KV7A 3AG4B 1WA0X 1AQ8A 3ZIYA 4A66A 1MZZA 3T6XA 5B7MA 4E9VA 2R7EB 1JXFA 2IH9A 5I5JA 2VM3A 2J57A 1DZ0A 1ET8A 1SF3A 2YAEA 4N8UA 2XUWA 3UAAA 2XLLA 1TEGA 4G7RB 2PPEA 1JXDA 5PAZA 3X1EA 2I7OA 4E9XA 3OMNB 1IC0A 3ABGA 4A2EA 1NIEA 1F56A 3FPYA 3HEIB 2QT6A 1KDIA 4W9ZA 3T6WA 2TSBA 4QKTA 3OD3A 4KNUA 3T71A 1T5KA 2FQEA 1TKWA 2AANA 1OV8A 3FSAA 2Q5BA 1AIZA 1L9TA 2I7SA 3EF4A 1J5DA 3MBWB 4CSZA 1M56B 2WSDA 1AR1B 4NAJA 4YSSA 2WO2B 2PPFA 2HXAA 4PCYA 1AZBA 3FU7B 4DP1X 2PP7A 1BAWA 1AANA 2X87A 1EZLA 1NICA 2ZONA 4WKXA 2WO3B 2FQDA 2AZAA 1V54B 3WI9A 3ABLB 1BQ5A 1FFTB 3IN2A 2PCFA 5F7BA 2XVBA 3KW7A 3PAUA 4E9YA 2IDQA 1AZRA 2EIJB 5I6KA 1BXUA 1KCWA 4FAAB 4GP5B 3WG7B 1BQRA 3GDCA 3X2QB 3CG8A 4FA7B 1GS7A 1KCBA 3GXUB 2HLEB 2CCWA 3CVDA 1HFUA 1AS7A 4YSTA 2XV3A 4A67A 1E67A 2DWTA 2HX8A 2IWFA 3BQVA 1JERA 4DP7X 2PP8A 3T6ZA 2RACA 5PCYA 4YSAA 5I6MA 1HAUA 1NPJA 2BP8B 3EH3B 1J9TA 1OCOB 2J5WA 4K9JA 3UABA 1SNRA 1SJMA 4A2DA 3PXLA 1BYOA 2YARA 1L9PA 2PP9A 3FQ2A 3JT2A 3X1BA 3DKHA 1AS8A 3AG1B 4HCFA 2LLNA 3PPSA 4UF7C 1PLAA 1NZRA 3EH4B 5I6LA 4Q89A 3HB3B 1FA4A 1SFHA 1RCYA 2AZUA 2Y69B 3GYRA 4WTQA 2B08A 4A2GA 3QJVB 1OE2A 1X9UA 1ZV2A 3NSFA 4CSPA 2BW4A 1RKRA 1B3IA 1YLBB 2EILB 3N2JA 1GSKA 4HAKA 2XXFA 3NJMA 1WS8A 4NB7A 2JFCA 4DP9X 4DP8X 2IDFA 1OF0A 2J55A 2UX7A 1AZCA 2GSMB 2YAOA 3S8GB 2P80D 1HAWA 1IBZA 3D12B 2XU9A 4YSEA 1JZIA 4Q8BA 1GR7A 3PLYA 3IN0A 1CYWA 2R7EA 3NJHA 4UAHA 1EHKB 3NJKA 3V9EA 3WNJA 3NSCA 1A8ZA 1MG3C 2CBPA 2YAPA 4G70B 4A68A 3PAZA 1BYPA 2PCYA 3NSDA 2N0MA 2QPDB 3ERXA 1ADWA 2IWKA 1PNCA 2TSAA 4F7KA 1URIA 2W8CA 2B3IA 5ANHA 5FC9A 3OMIB 3TA4D 3WNIA 1GS6X 4MFHA 2A3TA 2ZWNA 8PAZA 2XXGA 4GXFA 3QJSB 1OE3A 1X9RA 2VW7A 2GC4C 2GC7C 4JHVA 1QHQA 3NJNA 3X1NA 5TK2A 2XWZA 1NIBA 3FU8A 1GY2A 4GYBA 1AZUA 5F7AA 1WA2X 4YSPA 4AI7A 1XMEB 5I5IA 1E5YA 1A4BA 3DIVA 3H4HA 3OMAB 1N70A 1WAEA 1JZEA 2VN3A 1AAJA 1ASQA 4JHUA 4L0PB 3CVBA 4BDVA 3FQYA 1OCZB 2UXTA 5B1JA 4E9QA 3RYMA 2OV0A 3OQRA 4TXVB 5E9NA 3UAEA 1KYAA 2UXVA 1XB3A 6PAZA 4BWTA 1NIFA 2J56A 2JXMA 1L9SA 2YXWA 3UACA 3QPKA 4X4KA 5I6PA 1PLBA 5TK4A 1TU2A 5B7FA 2QPEB 1ILSA 2PPDA 1JVOA 2XX1A 1KDJA 2W88A 5I5MA 1CUOA 1RZPA 4HHGA 3TBBA 2IDUA 3SBPA 2ZXWB 7PAZA 4BWUA 2VSMB 2FQGA 4KO6A 2FTAA 3MX0B 5LDUA 4HZ1A 1NTDA 2BWIA 2H5UA 5EHFA 3UADA 2HZHA 3KW8A 9PCYA 1BXAA 1NDTA 3QJTB 4AX3A 2IWEA 4ENZA 3AG3B 2QDVA 1PCSA 1BXVA 2GHZA 2BHFA 4DP0X 4HCGA 1L9QA 3T6VA 2DWSA 3SBRA 2IDSA 2OCCB 2QDWA 4YSCA 3IBOA 4BXSV 1GYCA 1AACA 3ZX1A 4G7SB 4YVUA 2NRDA 5AFAA 1NPNA 4P5SA 3CZUB 4DP4X 1J5CA 4DPAX 2HRGA 2MRYA 2Q9OA 5D4HA 4M3HA 1IBYA 4PAZA 4KOCA 4KNTA 1NWOA 1PZBA 3ZBMA 4DP6X 3FSWA 2Y1AA 2DV6A 1JZGA 5B1KA 3X1FA 4BXVA 1ASPA 5B7EA 2PPAA 3PCYA 3QJQB 4G72B 1IUZA 2JKWA 3SQRA 4KO5A 3ABKB 2BP0B 2FT8A 1BQKA 1FWXA 1XB8A 4G71B
chains in the Genus database with same CATH superfamily
4NJAH 2PNDA 1MDAA 3QZWB 4ZAKA 3WJLC 3AZUA 1R3KB 1JZHA 1AGBB 1KN2H 2A9DA 2OMXA 3C6LC 4BDVB 3SCMC 2Q7NA 2WVVB 3OQ3B 4YDKH 4AVHA 2VDPH 4R4BA 1UQSA 1FVCA 4P59H 4XOBA 3X3FH 4RFEB 1U8LA 3MRKB 4RBPK 3GS7A 2F9BT 3FL7A 1RK1B 3EGSB 2WQWA 1OTUC 2NY6C 4Z7OF 3J8F7 1SFDA 2MTAA 4JPQA 2V2XA 5TDNA 2RALA 2YKLL 4MJ2A 4DOHB 4PRBB 4M6MH 4M9PA 4G83A 5IROC 4IOFC 4LQFL 4P5RA 1P5UC 4BWWA 4P23C 1M53A 1CD1B 5AG9A 3N40F 2XZQH 2PLTA 3L9EA 3B5HA 4ZD3H 3BDXA 3HBPA 3GSRA 4GPVA 5A6IA 1OHQA 4OZHB 4UNIA 3ZDXB 4BHUA 3VWKA 3UTQB 4EZJA 1DVFB 3CHXA 1SRDA 3QJUB 4KJYA 1G7IB 4ERSH 4HG4K 1WBYB 1W72A 3CJJA 5AKRA 2Y06H 1SPDA 4QLWA 4JMXA 1I85C 2VDLL 1UD4A 3BUYB 4M02A 3P4MB 3IPFA 1GJIA 1C08A 2XWTB 4OH2A 3CQFA 4LU5H 4X6BA 4GSDL 7TAAA 3DJTA 4AQZA 3NP3A 5EBWA 4KVNL 1IM9A 5FHAL 1AG6A 5KVDH 3PXJA 4L23A 1DR9A 5GGVY 2ZWSA 1J8SA 3ZE1E 1PD1A 3ARFB 3WTUA 5E6ID 1UM5H 2M8XA 2GBAA 1R19A 1H3PH 1JVLA 5AW9B 4MAUH 3L5WB 4A7SA 3TCLA 5EA0L 1RFDH 4YDJB 1LO2L 4H2AA 2X2IA 2CO3A 3S4SG 1PZ5A 2A6KA 4FFVD 2CK0H 1A3RL 1TZGH 3TM6A 5D7LE 4MCYB 1A0QH 3QISA 1EGJH 3MGAA 5EO1A 4LDCA 3UPAA 4QRFA 2VDNB 4EXKA 2EUVA 3HE6C 3LZPA 1T1ZA 3IE4A 2BY3A 1YRKA 3NH7H 5EOCJ 2BFVL 3RDTC 3SKOA 1OQXA 3IKCA 5D2LF 5I75C 3BIAX 3O11A 1MH5A 2YPKA 1FDLL 4TQ8A 2CM6A 3HZ3A 5GS1C 4HJGB 3QQ9D 4M3JA 4HS8L 4LOUD 4P46B 2HN7B 5FAAA 4Z7OB 1CYXA 3AU1A 2AMUA 5CP3A 1U8HB 3O4LA 3QUXA 2GEQA 4DTGL 2C3HA 3KPSA 3UTZB 3LS5L 5DUBA 3JUZA 3BH4A 4DP2X 1NM4A 2VXSL 3DYMA 2PABA 3DYPA 3VUAA 5EIQA 2VDMB 3K4ZA 4O02H 4R83A 1TZHB 4I88A 1U3NA 1A8JH 3IJSB 5DWUH 4YIQA 2WVUA 3A6CL 1T7YA 3EJTA 5DC2A 3BN9D 2P5WD 3EO1B 1RXLA 1ED3A 4NQVB 2NNCA 1QZNA 2HVJB 3BQUB 2W95A 3GKWH 3HI6L 4YMPA 2K0RA 1N64L 3O4LE 3FRUA 4OD3L 3SYQA 4AEHH 5IVZA 3W5MA 5GGVH 5HI4D 3BD5A 3L9BA 4ZPVB 5A2LH 1LWRA 1RJCA 2AAVA 4Q6IC 1DQIA 5I0XA 5ID0B 2CALA 4N2MA 3VFPB 3QG7H 4PTTB 4Z3FA 4R26H 3UBXA 1NEUA 3HC3H 4IJ3C 3ASNB 5EV7A 2P26A 2G2RA 2EEAA 3BT2H 4JQVC 2AXGA 2YD4A 3NZHH 4Z7NB 1MCWW 1QATA 3CWGA 1VDGA 3NSYA 4MJID 4QRQA 5DHVB 3LXAA 3GSVA 1ZEAL 3IFOA 5D72L 4E42A 2JJTA 2WYTA 3LZOA 4AQEA 2R0WL 2C1OB 1A7PL 1QEXA 2WTOA 1CVSC 1BD2D 2BHYA 3FH5A 5MHSE 3Q1EA 2DMBA 2R9HD 5EC1A 5CZXC 2DTSA 2P5WA 5K1VA 1NCAL 5CJOH 5FV1L 3CZLA 3FQTB 1UM6L 2B0SH 3ECBA 4JFDA 1DBBL 2NT0A 1JTPA 2EXSA 2P8PA 3DUUA 5FM8A 2K8MA 1ZT7B 1ZS2A 5DO8A 4KRPC 5IV2A 3T08A 4XOCA 5C0CA 3UH8A 2N01B 4OLXH 4ZS6C 3VXME 4J6RL 5E99H 2VMDA 3SOBH 4CDHA 1WTLA 4LHUG 2QFRA 3B2UC 5CEYA 4LLUA 1YYML 3SDCC 1EQWA 2J44A 3DURA 1CWVA 5F72S 3SY0B 4U4IA 2FBJH 3ZE1F 3OGCB 4XX1E 2YAEA 3W2DH 3JV0A 4WO4B 1A7RL 5DD6B 3ZKMD 3SGDH 2PXYD 1TEGA 1AMYA 1EXUB 1OIOA 4NQEA 3X14A 3L3GB 2QQNL 4JPKL 2ZX8A 2MTPA 4ZUTA 5IFJB 3U48A 4D0BA 4M1DL 4W9ZA 1J5OL 1FZOB 1GSMA 1P4IH 1PW3A 3WO4C 1IB5A 3CZFA 2WLZA 2Z4TA 2FQEA 1FH5H 4NO5B 4GG8B 1PX4A 3FSAA 4ZW3A 2ADJB 1NM9A 4GKLA 4XO4A 1ZV5A 1TZHA 1OGPA 2CIKA 3MBWB 4JKPL 2DBJA 3CZEA 3HZVA 4ODSH 3HC4H 3GEWB 2XA8H 3C08H 4H1LB 5E9DB 4A7UA 2PPFA 4JFZL 1FVDA 1CGUA 3D52A 4TVSa 2OMZB 1LEGB 3FUHA 5I1EH 1J0ZA 4P3DA 5IB5B 3ATDA 4U2YA 4I9WD 4EI6B 3QJHB 3R1GL 4NSKA 1NLBH 1VFBA 3FTUA 3JWDL 1UH3A 3FB8B 3IKKA 5I0WA 2JKJA 1F86A 5HHVH 4PRHB 2P9RA 3G6AA 4PS3A 1ND0B 1ZTXH 2QJDA 2VR3A 3K8LA 5LN8A 1Z0MA 1JZ7A 2JQZA 4AGQA 2AK4E 4L8BB 4UILL 3X2QB 1S3KH 4HK0B 2ITFA 2X4TA 1FCCA 3UCRA 1Q8MA 1SMOA 2KT6A 3MNMA 1QVOB 2B5IC 1BQHA 1DZBA 2AGJH 2EYRB 1HE8A 1VIWA 1WCQA 4QWWC 3P9LA 4MXQD 4YSAA 3KJ4C 5DFTA 4F37K 3NIDF 1SXCA 3CFUA 1HAUA 4P49A 4P4RA 4B53A 2OK0H 3FOLA 4RNRA 4G59C 2VDMH 2BOCA 2O5YH 3A24A 3KPRE 3GRBA 4KX8A 4A7TA 4MMXC 1HEHC 5F9OH 2EECA 2OZ4L 1FL6B 1WDAA 4ZNEA 3VE0A 2HMID 4GH7B 4LZKA 3WU1A 5AAPA 5KYYB 4UV4H 1HKLH 3IJYA 5D71L 3AACA 4MNGB 1H3TA 3WJJA 3ZKND 2DMKA 4EE2A 4LVHB 4UT9H 3QWQB 4XAKD 5ACZB 5A16B 3U7WH 2WWKT 2DQTH 4AGPA 1DBJH 5CZKA 1RKRA 3RNQB 3HC0B 3WS6C 1PEZA 4JRWA 1PDKB 5HYJE 1FCGA 5HI3D 1WZLA 4G8EB 4P4KA 1U3JA 4M1GL 3W39B 2WVVA 2X3AA 1Q9OA 1JFQH 5J11B 3HC0A 2YPVH 4PLKD 4YSEA 4FNUA 5HJBA 4HU8A 1YUKB 1Z9PA 2YUWA 4J3UA 3T0ED 2NQDA 4N0CD 4TULH 2YMXH 1CK0H 4OZGB 3T2NL 3NJKA 2Y36L 3B4NA 3B83A 4QRTB 3WEMA 4LSPH 3IJYB 4J3WA 1BBDL 3TEXA 2X4QB 4WO0A 1T7ZA 2GUOA 3DGGA 5IM7A 5AAWA 3CH1B 3WTTA 1J8HD 2FYYB 5E6RB 4FP8L 2H32A 1LTXA 3OAYK 4D9LH 3O3BB 3EJSA 1YNLL 1NQBA 3C60B 4M62H 2ZWNA 4CNIA 3QULB 5GZNA 2WLYA 1X9RA 1MCBA 4L8BA 3BP7A 3T09A 3RGVA 3V0GA 3FU0A 4R7DB 1CO1A 5EORH 1LO0H 4XVTL 3H0TB 5FYKL 2WBJA 3MRBB 3S35H 4L5FL 4ZFZB 4WUUB 1H5BA 1SEQH 5AOIA 3V4VL 5C9KA 2CPCA 3FQWA 2GJRA 4FFYL 1BW8A 2P8MA 4N2AA 4WTXA 1OALA 3FT2A 3CXHJ 1VGEL 2A1WH 1FIGH 3GSNA 3PABA 1AQKH 3FTWA 2IMMA 1NCBH 4ZQTA 4AYFA 2QEJA 3EAKA 4P2OD 1XF4B 3VDCA 1CFVL 2VN7A 1XF1A 4M1CD 4MLSA 3UAEA 2J71A 2UXVA 5HPMB 5HDOA 4XP4H 5AD0B 1P2CB 2ZUXA 4LCCA 3TZVC 2HJFA 1EAJA 2B1AH 2JJTC 2VXVL 3E8UH 1RUQH 5CD5C 3QDAA 1WFOA 3K81A 3M7OA 1CFNB 1HHKB 3CFDB 3APDA 1CQKA 3QEHA 3KHOA 1PSKL 3JZYA 3W11D 5E6ZA 5AZEL 2BC4B 1WZKA 3D08A 4HHGA 1T0NB 3VFSB 5HYSB 1A6UH 3SBPA 5D6CB 4AITA 2C9PA 4J3VA 4YAQB 4HA1A 1MW1A 5DTFA 4BV1A 4HS8H 3DX6A 1HQRA 2Q2LA 2RMNA 3D1MC 1DP0A 1UVQB 3IXAA 1QLFB 2KPWA 4Q6IA 4ZS7L 2VC2B 2VLKA 5AW0B 2PKDA 4AUJA 4NRXB 3S5LG 1N12A 5JZ7D 1RULH 2DDQL 3RTQC 1OLZA 3P9MA 2GHZA 2BHFA 2XXCB 3BLKA 4LLUB 4P8QA 4JANA 3IWUA 2YPLD 3A21A 4I2XE 5I8EA 1NGPH 3B2PA 1B6UA 1X3DA 4LHUB 4QJ4B 4XO8A 5B38A 5IBUG 2NRDA 3DSFL 1HS6A 1R3IH 2IDCA 2OMNA 2QZQA 1BD2B 2MRYA 3DMMA 5LG1A 4LRIA 4HS6A 4U1GB 3AY4A 5ESAA 5HHNB 5FKAA 3B1UA 3KLSA 2ISDA 4AJWA 2HJKA 4KNTA 1EVTC 2VLJB 5DR5L 2Q8AL 3EYVB 4NWTH 3TGXA 2J1WA 4KZEH 2MPAL 2DQFB 4PJDB 2KL6A 5C2BL 5D1ZC 3B2DC 3VMNA 3L08A 5B7EA 1NGXB 2QGBA 3QUGA 5IFHH 3VXOB 3VFWB 4AQ8A 1KTJA 5KVFE 2BM3A 3HE7D 4RX4A 4G82A 2ITDA 1NL0H 2BP0B 1DL7L 1ZLEA 3C6LD 3MNWB 2ZWKA 3JWOC 4LAQH 5AEAA 3MV9D 3CFTA 3LD8C 1EJOH 2JI3A 4IMKC 4B3EA 1QWUA 2AKRA 3FSOA 3SGDI 1OTUD 2FNWA 2NY6D 3L7EA 3BVVA 1VFAB 4GW4B 4JPVL 2V3FA 3DBXA 4A2HA 4ELMA 4QRQB 3RLSA 2VH5L 3VH8B 2VLJE 5DJAB 3BMVA 1JOIA 3GMMA 4FTVB 4HSCX 1BJ8A 4LF3A 5JXAL 3ORJA 2JKNA 5ETUB 4N2GA 3FT9A 5ILTL 3RWHA 1WZAA 1HEZA 3OHXA 3MO1B 5KSBA 5KTEL 5DWPA 3MRNB 1I7ZB 3ZKXB 2X6MA 4K3EH 3W9EB 1CQYA 2BVTA 1NC4D 5I1LA 1RUKL 4XVSL 3M88A 4NN7C 3V6OE 1S9XB 1WVZA 2NR6C 3NGBC 3UGXA 2Q6WB 4AT6A 2WN2A 3OHMB 1X7SA 3GRWA 4PJ6A 3IU4H 1ETB1 1A02N 5CJBA 4JY6B 5MEQA 4YUEL 1MWAB 3DBXB 5DC9B 1I3GH 1NMBH 1TMCB 1LO5B 2E8YA 3C5ZA 3K4DA 4HKXA 3V0JA 2ZE0A 3NJJA 4FFWC 2AERT 3FF8A 2AKRB 3IU3A 2W9DL 4YR6A 3BRFA 5BRZA 5I71B 2MH4A 5JW3H 3QEQB 3OC5A 1KC5H 1RZFL 1Z5HA 3BDBA 1PF3A 1Y1DA 4HPYL 2GFBB 4X4XB 1ZMYA 4NT6B 4ZNEE 1YDPA 1D2PA 5FYKE 3FQNB 4Z7AA 5CBEA 4L1LA 4NQUA 5JLZB 1P7QD 5B22A 3WGVB 2K3TA 4YE4H 3TPKA 5CFAA 4BQCA 4K23H 1HCZA 1CGTA 4RFNC 1RHHB 5E5MA 2PW1A 5FA3B 3T1FB 1MCKA 2WY3B 1PKOA 4PRIE 4PRPA 1JK9A 3ZOAA 1Z9MA 4HIJA 3IDIA 1I9RH 2X10A 4LLVA 3SKJH 5JPNB 5IBTH 3KLHD 1BSIA 3QFDA 1KIRA 1L9RA 4X6EA 2JJSA 1PKQE 1B4LA 1T4KB 2CRYA 1X4XA 2B4CC 4J3XA 3CDZB 3ZTEA 1HXMA 5C0BB 4R9HA 1EAPA 1JUFA 3D2UB 2AQPA 4TS6A 5FM5O 3BC9A 1TLKA 3QDGA 5DLMH 3TJHD 4HCRL 4XRCB 4K8RH 5FK9B 5T1KD 3UPRB 4OCRL 3UBXG 1BFVH 1OW0C 3CDZA 3B56A 3DV4B 3EHBB 3RKDD 5FGRA 1RJZA 5DUML 2DW5A 1XTMA 4AV0A 4Z78A 2ZF8A 3TFKC 3JWOH 3ECUA 4XVUD 3VWKD 3RPKA 4YHOL 4ODTH 5KVMC 1CURA 3NP4A 4AIEA 3ARZA 4TQHA 1E9OB 5EOCL 1U8QB 1KT2A 1FYHB 2X4RA 3MJ6A 5HI4C 4Y2DA 1MN4A 3MRFA 3DOSA 5FA3A 1ZLSH 4NXSA 1AR1C 4K15A 2YPKB 1ACXA 1BM3H 3R7RA 3TO4C 3U7WL 2CUAA 1U8JA 2ZUQB 4NENA 1MRFL 5D55A 1N8ZA 4PGCB 1XF4A 3MCYA 3ZTCC 5LAPA 4S0TD 4DERA 1ID2A 3GJFK 4LE8A 1DDHB 4MGXA 1JXGA 1E5BA 2XTJC 3TS8A 1L3NA 3BEVA 1KG0A 3U6RA 4OCWH 3VWJB 4UTBH 4YGVA 1J10A 1JYXA 3IDMB 3OTTA 1FUNA 5EZIH 5EU6B 2WWMD 12E8L 3OPZL 2QMKA 4ZFOB 3RI5K 3G7TA 3BJLA 5H37H 4J2QA 4ZMZA 3FOMA 4ZAKB 4NRXA 1EANA 3MV7D 5F9JB 1EO8H 2TRYA 1U93A 2UXGA 4P57A 3RU8L 4P06A 3U30B 3GUTA 3EJJX 5CCGE 1NC2D 2PF6A 5KYWB 4N8VA 4A63A 3GXIA 1T66D 3T4YB 1WWWX 3NK3A 1SYVB 1U4FA 1II4E 3GBNL 4ZSOA 2E7HA 5JW4M 1MI5D 2RBLA 5T1MA 1LJMA 1A1NA 3SJVD 3S5YA 1OP3H 4FHBD 1W72L 2J2ZB 5SV4A 1HKLL 5D71H 5F7EH 2OW6A 5KBLA 5MENA 1ETZA 3RU8H 3TZVB 2XLLA 5HDRA 1IZJA 4M48L 4ES8A 4F92B 1TCMA 4D0CA 4G5ZL 1EEYA 1N6QH 3MROB 1YYLL 3KYOA 3N04A 4ZSOB 4AK1A 4NNXA 1MCFA 3QUMH 4P2QD 4Z0XA 1F3JB 1NUFA 4K5MA 4FMKA 2Y7QB 3W57A 3S0PA 3R0MA 2OTUA 3DMMD 3PAYA 2XICA 2I7SA 3RZCC 5CKGA 5IOPB 1AD0A 1FV1A 1WF5A 4JZJA 3SDXA 2WVSA 2JB6B 3SE9H 1BV8A 3DVGB 3DPBA 4AVIA 4ANWA 1JF5A 5TQ2L 4LCYB 1K8IA 3DX9A 2D7PA 3QUML 3SHSA 4D8OA 3SGKC 4TSBH 1BQ5A 2XVBA 3KW7A 1U8MA 5E6SB 4PIBA 3UJIL 5EWIL 1FFQA 5I23A 5E8NA 3QXAB 5I6KA 3VI3F 2A74C 3IDGB 1U3HC 1MCIA 2XQBL 4GP5B 3X3FL 2XBTA 4G8GD 4JAMB 3LIZA 3O2WH 4K3DL 4QWWD 4B96A 1IZKA 4NKDB 1QKZH 4FRWA 5TTRA 5FYKH 4NZDA 1HSAB 1HFUA 5FGBA 1TMQA 3D9AH 4YNYB 3TIEA 3MRMB 3VO0A 4A37A 5GRUH 1AD0B 2EH7L 4JZJB 3KGTA 4ZW8A 5PCYA 2CZNA 5EU4A 3EUUA 1CFQA 2P24A 3VG9B 2K6ZA 3O3AB 4XPBH 1NPJA 2IAND 4FXGA 4OIAA 1MREL 3Q8AA 2J5WA 5IVXA 1KCRL 2J1YA 1KCSH 2J6WA 5GRYA 4DKFH 1UWYA 3CFCL 4RZCB 1HWGB 2WXNA 4PD4J 4NGHL 4Y4FC 3V52L 4FTVD 1WJ3A 1KCVL 2FEDC 5BJTB 4PJFF 4U33A 1HJBC 3TIEB 2YK1H 5HPMA 4ZO9A 5M7QA 2H7WA 4PWKA 5DJ0A 3TPUA 2LU5A 4C4BA 5JOFB 2P8LB 2A0LC 1T5WA 2VN6A 1KELL 1C16B 2XFGB 3KDPB 4Q89A 4EI5D 5F3HA 2Z8WC 1AD9B 3C5ZD 4M03A 4S1QL 4O58H 2HT4D 3O8XB 1E4WL 1E8ZA 5CMAA 5HHQA 3FCBA 3HHMA 5AWNH 3GNML 1DQKA 1TITA 3NCXA 2AI0L 3QJVB 4UQ3A 1IE4A 2IH1B 4Z0BL 2DQDH 2CE6A 5BS0D 1SVZA 4LLWA 2VZ1A 3T4AC 5D7IA 1YLBB 4HIJB 4QDGA 4BZ1A 5H4YA 3KD4A 4PQXA 2YEVB 1MAKA 1WS8A 3BYTA 4P2RA 1D6VL 4K71B 3ZDZE 3F65A 1Z5YD 3GXPA 5JHAA 3F6LA 4XR8C 4KZ0A 5AW2B 2TAAA 1IL1A 1YC8A 5DO2D 4OGZA 1JNJA 3I84A 3T0EA 4YOKA 1XDTT 3TFBA 2D3VA 4UM9B 5FF6A 1JMXA 1EHKB 2FDBP 3REVB 2DQDL 4P23A 1PPIA 2EXYD 3PWNA 4A68A 5AAMA 3F8UB 1JPTH 4IGBD 1QFOA 3HN5A 1BYPA 1I31A 3WY3A 1BAGA 4U1MB 1P9MC 1QRNB 5D1QC 4C56D 3HHRB 2ZNWA 5BMFH 4CW1B 2CKBH 5IB5A 1HL9A 5D7IF 1KCUL 1QRKA 3VXSE 4JG1H 1XGZA 1J18A 4Y9CA 3RAJL 3RWJB 4X6CA 4YZWA 5IFHL 2FBRA 1TYEB 5FO2A 2XXGA 3P0YL 3E1F1 2JB5L 1LK3L 3IFNH 2OW7A 1OCWL 3WYRA 4QRRB 5TK2A 4RVBA 1U8JB 3G6JF 2BRQA 2NY4C 2R0KH 3L3JA 2EUXA 4RAUA 2HKFL 5A40E 3DIVA 1O5DT 2JE8A 1Z9SA 3OMAB 4M1CC 4NYLB 4U6YA 1JZEA 3DJSA 1LLAA 4P2OB 3DROB 2A4EA 3FQYA 5GS0C 1H8LA 3TZVD 1LO4L 2UXTA 4KKAD 4EZKA 4KXZH 1CG9A 4NDMB 1I1YA 5FUOH 5G4MA 3VFRA 1XGQA 2VLRE 3VXSB 3VD4A 4AEHL 3DYOA 1WG3A 5TE4L 4Y5XB 2FECL 4KC3B 3L3OB 3VNYA 3HHSB 3OAZK 3O41B 1C1EL 2FRGP 2EC9U 2P48B 2ZCKH 3LKNB 4AEEA 4MNHB 4NQDE 5J6HB 1WAAE 1FJ1B 1N4XH 3KCPA 5CJ5A 4R4NC 4HK3N 4TRPL 3N50A 2LQRA 2Z31D 3L16A 2E4FA 2VYRE 2YD7A 3GLDA 2GJPA 4APQA 1NLDH 3F12B 4PG2A 2VSMB 1XL4A 2HVKA 4GRLA 5D72H 5DVMA 5JQ6H 3O4LB 1MLCB 5F7FA 4A39A 5A6MA 3KPTA 4L37A 5KBPA 3PGDB 4KKRA 4X9YA 2VDNL 1X7TA 4PRPB 4X7DC 3BKML 1I4FB 2VLRB 2C3GA 3AG3B 2WK2A 2QDVA 3O2DA 4CKVX 4GIOA 4HCGA 3F5WB 4XCEA 2DWSA 1KXVC 3EG9B 4JKMA 5FUOL 5DD0H 1CTMA 3P1VA 1C5BL 2G4GA 4U05A 4ETQA 4Y9BA 4Z7NE 2ZSVB 5E8EA 3MREB 1FO0A 3CZUB 2FCBA 4OSUL 1DQTA 5I9QB 2HUHA 4NT6A 1BJ1H 4FLHA 4M3HA 4Q6YA 3DC0A 1WHPA 3KJ6L 1AGCA 3BN3B 3ETBJ 3IWVA 4KOCA 3VFMA 1URZA 4FABL 5M94B 2PUQT 2DV6A 3OV6A 3WNKA 3T3MB 1ASPA 4NQED 3UC0H 4H13C 1ZT4B 4OUUA 3RY4A 2Z7ZA 5KYNA 1YEFH 3JSSA 1H0DA 3O3DA 1NCJA 5KSAC 2V4LA 3CX2A 3O9WD 2ATKA 3LXCA 4FNSA 5EBWB 4HBCH 1JRHH 4E0RA 1OSYA 3S34H 4V2CB 5HDQL 2WXQA 2DQJL 3L9RA 4LRIC 4PPTA 1KIRB 4FULA 2BFGA 2OSYA 3MLYH 3ISYA 4PCTA 3HC2A 3MV7E 3OJDA 5F44A 2L7EA 3G04B 2A74B 4XCYB 5JXEC 2ADIA 4JVPA 3SKMA 5CR1A 5EIVA 4FQQA 1OSEA 4BGDA 1H3UA 3NAAL 1A4AA 3O8XD 4XN9A 2BCKA 3LKOB 1YEFL 3N55A 3VNZA 5IJBC 2OJEA 3BD3A 3WIFA 4LOEA 3D18A 2ZD0A 2YAQA 2VDLB 2WB1A 5BRPA 5CEXB 4BCZA 5C9JA 1DBBH 3BFOA 5G2NA 4JRFA 1HWWA 3L7EB 4GW4A 4P2AA 5CHNA 4E9TA 3VFNA 5T5NG 4GG6B 4HKJB 1ZLSL 2BOLA 3L3DB 1G7QB 3RZCB 1WUNT 5L6YL 4HGMA 3RGVD 3D85D 4OZIB 1NCCH 4F27A 1P9MA 1A6AB 1MRFH 2GHWB 1AP2B 1YYMH 2X1XR 3GC3A 5AKTA 4PJ5E 4EKJA 5E9DD 2ITCB 1RH8A 2AJSH 4L29A 1U3ZA 4NQCB 3GTTA 4GW1B 4R6UA 3EGDA 3HG1D 4HGWA 5AB1A 5IHWA 3ATEA 2DQEH 2FJHB 1JNHA 1YJDL 2QKSA 5C0GB 4IJTA 3ARRA 1IM9B 5CLTA 4X9FA 3O2VL 5C92A 2XBDA 5J3HC 4PS8A 4PTTA 1QZ1A 1LE9A 2YQBA 1K4CA 4L3CA 1BZ9B 2VOTA 3SDYH 1TZAA 3HFFA 5EMYA 4FKKA 4M43L 1JYVA 2BP3A 1KGYE 2D7TL 2P45B 3L1EA 5LCVA 5B3SB 5LDSA 3F01A 1YN6B 5DJYA 2YD8A 1GGCH 2FR4B 2A9MH 1T7XA 4KK6C 5I8EB 4LQFH 3QZLA 4FFTA 3A67H 4N2FA 1GY1A 3VFTA 3RPIA 1ZHNA 4KTGA 3REWB 2IQ9L 4XPHH 2XQBH 4RGMB 3MRJA 3K71B 4YHIA 4MTMA 4AG4H 2CBMA 1MJ7H 2HWZL 3IETB 5CAYB 1EHXA 1DN0B 3KYAA 3ZJAA 3OJVC 4UMGA 4D8PB 1DBKL 43C9A 2APXA 3O6LH 4U3XA 2ARWA 3WTWA 1CE6B 5EO9A 3EBAA 2FLMA 4FFZL 2E27L 2BP0A 1HOEA 2DEYX 2UVFA 2VXQA 4JLRB 3ZZ1A 4FOMA 3HE7B 2E74C 4KDVA 5HGBA 1F3RB 2ARJA 1CIUA 4P5KA 1P7KB 5ADPH 1G0XA 1OGTB 4NUJB 2NXYC 5AVVB 4X7SH 1HI6A 4EIBA 1OM9A 4P07A 3SCMB 2AQSA 3K1KC 3K72B 5FUZL 5GISH 4EEEA 4AYDC 4AZUA 2JKSA 4MA3A 1HSBA 3FS9A 2RTTA 4JRYB 5CSZB 4IOSD 3B7RL 2I07A 4KJPD 3IGLA 1V7NL 4JFHE 3WS3B 5B38B 3P3YA 4GAGL 1E4WH 2MOQA 3N5AA 4WJ5A 1ET7A 3QEQD 4JGUA 2J5LC 5I6OA 3QQXA 5IF0B 3K72A 2NUTB 1MFEL 2FYVA 4OGAD 4XCCH 4Z76B 1M9WA 2ICEA 4NQDD 3KAAA 1UJ3A 4JKLA 1A65A 3CFMA 2C9UA 4IMLA 1W8EA 3O6MH 4ODXA 3LXUX 3QNYB 4Y4KA 1K72A 2A9AA 3WS3A 4YE0A 1KENH 4LLWB 3CC1A 1M71B 2LABA 3D0LA 1I3VA 1N8OE 1R17A 4KVNH 5LBSH 3ZDXF 4D94A 1RZJL 1G5AA 5IB3A 1KBBA 3H2WA 3UOAB 5F0PB 4FQXA 1B90A 5GZOC 4AMKL 5JPNC 2F2HA 4JFFD 3NACH 2VDRB 5BCAA 1LEGA 4QHUA 1AXIB 1NIDA 5JPMA 1ZHKA 3TT1H 2N7AA 4N5ED 4PJXE 1ML0A 1SXBA 1OAZL 3B1TA 3D4ZA 5FO9B 4BKTC 3BP6A 4QHUB 4UMSA 2YBRB 2EDHA 2ICEB 1WA0X 1XF3A 3C2SA 3MGOB 1KWKA 5IVXB 4FXKC 2Y7SA 1ZHBB 4MMZB 4MA7L 3SDAB 1W0WB 1DQVA 4ZUUB 4CGTA 1YNKH 5I1KL 4JQXA 1Q4NX 4WY7L 5A2KH 4RLDA 2DI8A 4FQ2H 2FIRT 3QEUB 1SF3A 4DT2A 1JDCA 2MSPA 1VF5C 2BSED 2BY0A 1G84A 5I71C 4R0LC 1F13A 2NNXA 9CGTA 3FUJA 1BZOA 4XXDA 5F0LB 5C08B 4D0DA 2F8IA 2E76C 4JFDD 3HN3A 3VXMB 1IQWH 3V0DA 4F57H 3NZUA 1RIHL 1KFAL 4H8VA 5KAQG 5SWZA 3GSWB 2PWHA 2VL5A 1OAZH 3T3PB 5C08D 4Q74A 3QUZD 3QXDB 5GXBB 4FN0A 4WFGE 4I3RL 4Y5VB 1ZSDA 1AR1B 1MFCH 1KUMA 4NAJA 2EACA 4UZSA 4HUCA 5CUSH 5ICZA 3EYUH 2FATH 1XZ0A 1KYOK 1JPST 3VM7A 1RUQL 2FQDA 2FEEL 4LHUD 3BUDA 1WSST 3OB0K 3RGHA 3JV4B 1BAFL 1UCBH 4LOFA 1EDHA 1A14L 1UB5B 1TZ8A 2BNQD 3HS8A 1SBBA 3FN3A 5FYKU 5CEZH 4HOXA 1QPPA 1CLOL 4JFUA 4NQTA 3D3VD 4FAAB 1A3RH 1KGJA 4OIFA 3T3PE 4R26L 4HKZB 3FHQA 1HDMB 3HI6H 2WD0A 1NFKA 4FA8A 1PU0A 3L2NA 1QYGL 2APVA 1Q1JH 3ATFA 4JDEA 4Q14A 1YVLA 2WCPA 2XV3A 3FCGA 4K3EL 4IU3B 1QUNB 5DHMC 4W4NA 3U1SH 1XV8A 5EPMA 1UKQA 1MY5A 4WDIA 1NCAH 5C0GA 5CCHE 3HJ0A 5I76A 2V9RA 3E9TA 4RNRB 1PL3A 1HCVA 3EYQC 1T5XB 1S2EA 4JDZA 4ZOEA 4Y2OB 3ZL4L 5CM1A 2BZDA 3UYRL 2B2XL 2BFVH 4POZC 3WENA 3DV6B 1BZEA 1A7PH 5D1QE 1TJIL 1J86A 3QT2A 4U1GC 4KZEL 1BZ9A 2NZ9D 2VXSH 4PIRF 2HT4C 4B6ZA 1NSNH 1JE6A 3H2PA 4DW2H 5F9JA 3HN8A 2QVKA 3FQXA 4J3OG 4RMVA 3TNNB 2HPTA 5TFSL 3QWRA 3RILA 3UDWA 1JF1A 2R2CA 4PV8A 4PJCF 2FIKB 4G6FD 3DIFA 4GQZA 1JGEB 5F97E 2AJ3A 2ICEC 3CVHH 5KUKA 5DEGA 4NENB 1ND0A 2G3NA 2EEDA 4YBHA 1AXSB 1R6VA 3RWGB 5FEBA 3N2JA 3GPEA 5BZWA 4GOSA 4CVUA 3MUY1 1G7QA 3RZCA 1RZGA 1F42A 2RJMA 3KDMA 1MHPH 2GSMB 3O6FB 4PWHA 2EXYC 3RURA 1PZ5B 1UOKA 3U1PA 2MHAA 1BLIA 1LYQA 1J9CT 4IGBC 2J8UF 4AEIH 1QSFB 1G9EA 4NN7B 4NO0D 5T3ZL 3QA3B 3NMEA 4PU2A 4X7CC 2HJLB 2PWFA 4PJGF 1FNLA 1MG3C 4P04A 4KK8D 3MJWA 3X13A 3Q8BA 1DTUA 2QPUA 4JKPH 4O2CB 1IGJA 5I6XB 3W37A 1BCIA 2VQ1B 4LCUB 4GQ9L 3CFNA 2DQEL 4LL4A 2MKWA 3D05A 3HTLX 2C3XA 2I9LA 3U0TB 3CBJB 2VLME 5IHZB 1RSFA 8FABB 4YFLF 2BY2A 5I0VA 4Q9BA 3CDFA 4F2ME 2P4AB 1JWMB 3KPQA 2HFGH 4A6YL 3WIHL 4ZMQA 1GYVA 3O3DB 2B4CL 4QXUL 5CZVL 2E6PA 5IQNA 5FLUA 5TDOA 1X5MA 1WFUA 4GUPA 4XH2B 1KYDA 1WC7A 2XQYG 3F84A 2NLJB 3VQ2C 3MOAL 2EIZB 4OQTA 4JHZA 5MEPB 2EUZA 1CGYA 2BVUA 1LEIB 3QG6B 1NGWA 5IJVB 4YFDB 4XTRD 2C4XA 3LX9A 1CD9B 1DVZA 1RU9H 3A67L 4MQTB 4PJHB 4IMKA 5KSVA 1JWUA 4GAYB 3CZSA 5KEZA 3G08A 4PB0L 4ENED 3FUIA 2HFGL 3LKRB 3O45A 4A6YH 4GQPH 4GG6F 2EDYA 1ZD6A 3SY6A 4DK5A 1NCGA 4KAQL 3AWEA 2FH8A 2R23A 2OX5A 3GRWH 1TU2A 2HA1A 3BAWA 3HFML 5DMIL 3VRIA 4HOZA 4D9LL 1KB9K 2XX1A 2MFNA 5ABZA 2OMUA 1WO2A 2W88A 1XGPA 1DJWA 2K6YA 5J11C 1HYSC 5JR1H 3MUHL 3VD7A 5DRZA 2NY4B 4TM9A 2OXGB 3RX5A 1DVXA 1TCRA 1CXHA 4N25A 5EEYA 4KFZC 3X3GH 1ACCA 1AY1H 1XGQB 2OYLA 4ZTOH 2Z4QB 3UEQA 2WJ5A 3CN1A 1WFJA 2UZIH 5AAMC 3MODH 1EFXB 5ANMA 2JTYA 1M05B 1QTYT 3VSQA 4CKQA 3OAZH 2COVD 3BIKB 1F4XH 3ZQXA 3PWUA 1EIBA 5TE7L 4JY6A 3LPWA 3C6LA 4FYRA 3STLA 3RTQA 2YZ1A 4DP4X 3QCUH 4Y4HD 1AJ7L 3HBQA 1UXSB 4GAGH 2XRAH 5D4HA 4ATTA 2WKOF 3BLPX 3DTDA 4JJ5B 4NNYA 5DYOA 5LQBL 4LVEA 4ANXA 1INDL 4F5CE 2Q76B 3NEXA 1D7FA 4PG9A 3ZBMA 5I1DA 4X6CB 2MOGA 5IW3A 5KSAD 3UTSE 2LTQC 1NOLA 2V17H 3UYOD 4U2ZA 3SJVA 4G43A 5ETUA 1A7NL 4MQSB 4M62L 3QJQB 4UOQA 3F2LA 2NY5L 1BWWA 2P7TB 4HMEA 3JV6A 43CAB 4KO5A 1O9WA 2VM9A 1UA6H 3LNGA 3TBTB 5DFWH 5B8CB 1U8KA 3NIGE 1JPSH 1HTYA 4HXBL 4BFRA 3O8XC 4AMKH 4BSWA 1N3NA 1YNLH 2VR6A 1T89A 2R2BB 3ZVVA 3GZKA 2J21A 4AZ8A 1YY8A 1UT9A 2FZ3A 2R2HA 5IF0A 4IKKA 2V2XB 2VIRA 4H26A 4N6RB 5IY5B 2GJ6B 4YQXL 4YBLB 5C3TA 5CZRA 1W80A 2Z8RA 3OKOA 3QJZA 5EDXA 1NCTA 2WYHA 5DQ9B 2A9NL 4M4RB 5E2VH 3J2PA 1CC3A 2XX0A 3NN8B 1QOKA 1X9QA 2R83A 2Q8AH 3VD0A 2RQ8A 1ZAGA 1UG9A 3O6KH 5JW4R 1Q0XL 4JO4L 1YYCA 4EDXA 5I16B 4QUOA 2QBWA 1E6OH 4JKKA 4ZMTA 4JB9L 3HVNA 4ETYA 1CLVA 3O4LD 3BPCB 1BG1A 4YN3A 2GUOB 5IM7B 3SIKA 1XX9C 2BP5M 2AFNA 4TQEL 4KROB 2F8VA 4K7PL 5DFVC 4HUXB 1KLGB 4JKWA 4XMKL 3UO1H 5J3HD 1MLBA 1TEFA 3A0OA 4Y2DD 3QNXB 4ORGA 4R97B 3U79A 3P2TA 1W72B 3PDGA 4KROD 4PBWD 5J7CC 4WO4C 5FYJL 4P9HC 3CVCA 4OZHA 2JB6A 2WBXA 5D7LA 2AV1A 5T1LD 2IANA 1W0VB 2VLJD 2ZOLA 3P77A 4ODHL 3SDCB 3SE3C 1R4XA 5LNGA 3LXBA 3CZJA 3QSKB 1N67A 2JQAA 4YXLH 4XC3H 4MJIB 2H9GB 4ZPTB 2DL2A 2O6DA 5GZND 3B9VA 4O2EB 5F7DB 4FFYH 2F7IA 2FSEA 4PRBA 1FF5A 4JFYB 2I85A 3B3BA 5CP3H 4LK4A 4BUGA 3VU2A 3BPNC 3CXFA 1SXZA 4KKQA 5ACZA 1CZ8H 4FI8A 4S1QH 1I9IH 3QEQE 3NRPA 4NO0A 1W16A 1R3IL 3APFA 3C9NB 3QUYD 4OCXL 2AXJA 3FO2A 4TSCL 3L4TA 5IQOA 1OLLA 3L13A 1NIAA 4DKEH 2CO6B 3VRLE 1HL5A 1JGLL 1FHGA 1A3ZA 1P5VB 3PABB 3VXQA 4YHMH 3OKDB 3KBPA 2L7UA 3NA9L 3BZDA 4KKNA 4K9EL 5DJYB 1R1CA 4Q9CA 1XR8A 2FJHA 3APCA 4M5TA 4U6XB 2G5BB 3QYNA 2L04A 1NKGA 3GHBH 3MV8D 2QGDA 2F54E 3LQZB 5JW3L 4TUOB 2YPVA 4PY8I 2Y7QA 4MD5A 1NC4B 1J9RA 3K5SA 1ZVHA 3NIFE 1MHCB 4QD2E 4KX7A 5A2CA 4WU7A 1OTTC 1ZVNA 1PJWA 4KMLB 3MSPA 2O5XH 2AEIT 3DPBB 2H32B 4NERA 5DZOA 1D7BA 4H5SA 4I7ZC 3LPGA 4IKIA 4MRBA 2V7NB 2OTUB 1YQVL 3D18B 3L5XH 4KJWC 5EG6C 2DYSB 4IBLT 2VLKE 2WCGA 4NS0A 3UTPE 1TTCA 4DGVH 3EKCA 1T03L 1SYVA 1FAKT 4XPTL 4NSKB 1N5YL 3ILPB 3NPSB 2VMFA 5E8PA 2X05A 4AENB 2WMPA 3CBKB 1ZGLA 4P3CH 3NCWA 4O9HL 1CLZL 3PL6D 3ZT5A 3NIFB 3ZHLA 3ZMNA 1MFDH 5EZJA 4ACTA 5J1AA 3BKCL 2FX7L 2W9DH 1FBIL 4QXWA 2BPBA 2VZTA 1UD3A 4EZLA 5IMMA 4FERA 1H0DB 2E9JA 4MHHI 4ZX6A 5EOQL 1KLUB 3GO1H 4N22A 4B0MB 1XF2B 1TG8A 4E41E 3SBQA 4UOZA 3S88H 1CFMA 5B4MD 4KK9C 3SGEI 3EZJB 3DTUB 4ZXBD 3P9WB 1C1EH 2ZCKL 3CLEH 2IADA 4M8VA 5EU5A 4B5EA 4O02L 1COBA 2I9LB 3U0TA 1VCBC 4OFDA 1A3QA 1HIMH 3SQBB 1YN7B 4KRPB 2WYZA 3GXMA 1KC5L 1RZFH 4PJ9C 1NFAA 3TBWB 3WN6A 2Y6SD 2F5AH 2C4FT 4NO3A 2MQGA 3RP1A 4WO4A 5DD6A 4JPIB 4HLZG 4MD4B 4EN3B 5E24E 3AB0C 5C2UB 1GJWA 3AG4B 5TDPB 4NUGL 2YLKA 3JTTA 4KU1A 3HMXL 1BXXA 2AEPL 2ZJSL 5LBVA 4LNVA 5JHDA 5EBLB 2ZAIA 1QSFA 4HUNB 4XAWH 5C70A 2YRPA 1IAOB 1CGSH 3WAKA 2H3NA 3QIWA 1HOCA 1OGAE 4GQRA 4KKLC 3L3DA 1C5BH 1GOGA 3UAAA 2X53A 4XNQB 5KG9B 1JXDA 3LPFA 1G87A 3CVHL 2R8SH 3QZBA 3AXLB 4NI3A 5BRZB 5IK3B 5DURB 2IEPA 2OMZA 1M6UA 4FFVC 1M1XB 4PB9H 3O6FC 3QQ4A 4X7TA 5DEGB 3VCLB 4AXWA 4AQEB 4K07A 4U1IB 3TNMA 3TBTA 3PJSB 2IOIA 4RFNB 4M6OL 3IDJA 1TTFA 5J6HA 2XZAL 1QASA 5MERB 3FB8A 3ARBD 2AXGB 4XXCC 3CZFB 2WCSA 5C0NC 4PRAA 1TQTA 2COQA 3WO3B 2HXAA 4GLRH 1IGFL 3KLAB 4UDTA 4CADA 1BAWA 1W9XA 2BNRE 2VUKA 4G9FA 3US1A 2Y2YA 1MRDL 1CE1H 5FOBA 4TKWA 2WLMA 3KWWB 1DQJA 3FAWA 4JUTA 3IAGC 3W0WD 3QNFA 2AK1L 4C4UA 2WXGA 4JDTH 1OO2A 3OG4B 3S36H 3B9EA 4MNQA 1BEYL 2A73B 1T1XB 15C8H 2WP3O 5IQ9B 2K70A 5FKPB 4UIKH 4RQQB 4GI9A 3WLBB 5DJAA 3QA3A 1CL7I 1MWOA 5BOPA 1HHIA 2QGCA 2NR6A 1M05A 1IBBA 2WZ5A 3L3GA 4UQIM 1G1OA 1GGIL 2PR9A 2WTRA 3MVSA 2CHDA 5CJQH 3ZL1A 2Z4QA 3KLKA 3MRNA 1QEWA 5CLXA 5EN2A 2EIEA 4NI6A 3WMPA 4JFWA 2DWTA 3INOA 1SEBB 5KYXA 2EE9A 3KWTA 3US9A 2FB4H 3L3JB 5KZCB 4JFEE 4UV4L 5FV2A 5CN3A 5LB1A 3WXWL 2IGTA 3EFFB 4TTDD 1D7CA 3WFEH 4WW2B 1NC2B 1YUHB 4YDMA 4RSVA 4QYOA 1MNUL 3KPOB 3C5XA 5DXWA 5IHUL 2JF1A 1XIWC 3TONA 1IL1B 3ARFC 3KWVA 3KBEA 2Q6WA 4AT6B 2XFXA 3ZDXE 4P2RB 5GRVL 1A9EA 1NZRA 5EFIB 1GMIA 2CJTA 2VDQH 3IGAB 4X50A 3ZUNC 2W91A 3GSWA 3MLUL 4NM8H 1MJJB 4QLRA 1HHJA 3FO9B 4KVCH 4AYEC 3MKKA 3QFGA 5IBLC 1L4IA 2EDNA 5HGDB 1KNOB 3VM5A 1VJSA 3Q43A 4HAKA 3UZEA 4GUQA 2AEQH 5L8KB 4FHKA 1GH7A 1DVFC 3HZMB 4LKCB 2IDFA 2WW8A 2J55A 5DJDB 1AZCA 4DETA 4WV1B 3BRGC 4XCNA 5ICXB 1V05A 3SDCD 1C5DA 4MA1B 5TJWK 2V2WB 3VD3A 4UT7H 3W82A 4J12A 3B9KC 1A7QH 1P5UB 1IGTA 1NEZA 3T65B 3V9EA 4TVPD 1PX3A 4GI8A 3UG4A 3K2MC 1I7RA 1ECYA 4JM2F 2C26A 2CBPA 1KB5H 1CT8A 5C0DB 3EJRA 4G2AA 3TC9A 4RMBA 3HS0C 4PJIE 3S37L 3VWKB 4XCFL 4Z3HA 5EF3A 3ZDZB 4CN4A 3D69A 4MMZC 5FC9A 3OGOE 2A6JB 4LIQL 1WBXB 1MRCL 1IJ9A 2LLGA 3IJ7A 2DWYA 1HZHH 4U31A 2Q2EB 4FQPA 4NKDA 2E46A 4GFTB 4PCKA 5FO7B 2GTZB 4UOW0 4ZTEA 4K3DH 1X5JA 4ZX3A 4OQTL 3QORC 4UTAH 4JMNA 4GYBA 2Y3NA 2V5YA 1SBSH 4JL1A 4NRYB 5ADOH 1NKOA 3QIBB 1P4LB 4AEFA 5TPWH 2VN3A 4LVNB 1NGZB 1TOXA 4DN4L 2PCPB 2BDNL 5CU9A 3RX7A 2WXIA 3EFOB 1NBZA 1J0KA 3P9MB 1A6WH 3WJLA 4LCWE 1F6LL 2GK0A 3GINA 2C9XA 3H9SB 5DS1A 5C07E 3VGEA 2W5PA 1A5FH 3DGCR 2A6KB 3O0RH 5A3IC 3B5TA 2EVGA 4YO0A 4ZFZA 2OMWB 5E4EC 1RPKA 3QP3A 1ADQL 2QVIA 3QDMD 3UACA 4HFUL 1RK0B 1INQB 4X4KA 1K4DA 4FQ1H 5IQ7L 1NBCA 2CA4A 1DFXA 1DQQB 4PJGE 4WI2A 2OQJA 5E8OA 1IE5A 2X28A 4HD9A 1CUOA 1E9QB 3DX9B 3FFOA 1XCQB 1XCWA 3L3KB 3NPSC 4NBXB 5ECJE 1R0AH 1AXTL 2FX9L 2XG4A 4FD0A 4NUJA 1OAUH 4C56B 3CH1A 1CGXA 5EC2A 2AXFA 1TQWA 3DHUA 2VJ8A 3LH2L 1OP4A 2IWEA 1W0YT 2DWDA 2IG2L 2LOEA 4KY2A 4TUKH 3GT6A 5C07B 4NWTL 1UADC 1W8NA 4DP0X 4H8WH 4KRNA 4QTHA 1IQDB 2AI0H 4G6AD 4AM0B 2VSCA 2BMKB 4MDRA 4LCCB 2BINA 4ORZC 1YEEL 3WJMB 4PJCE 2Z34A 4F9PC 3EOTH 1NPNA 3EJZC 1YEGH 2DQGL 3FQUA 3MNVA 1ORQA 5DC4B 3P4NB 1NDMA 1ZS8B 1M7UA 3CDCA 4Z76A 7CGTA 3QS2A 3S37X 2VQ4A 4IRSA 4H1LH 4J28A 1ZGLP 2RD0A 1XCQA 3ARQA 3LV3B 1MJ8L 1JZGA 4U1HB 4JRXB 3PWUB 5DVOA 4BXVA 3ARBA 4D9RD 1E9QA 2EXWD 4RGMC 5A1AA 5HI3C 2VDOL 3IMVA 2YN3A 5GSVB 2JCCA 4K94L 4HULB 3WDJA 3V52H 4LGPB 3NGBB 5L8LB 1S6NA 3ABKB 2EDRA 1AGDB 1P4BL 2MMXA 4JHWL 1KXTB 3AY2A 1SN0A 4M5SA 5F1KC 4G1EB 4X5PA 4OZFH 1YPZA 4WI9A 4ADGA 1ODUA 3RVVC 5AVUB 2N0KA 3T3ME 1DDHA 1T83A 2AQQA 2PCPA 2WANA 5FGCB 4W1TA 3EYOA 4MMXB 3BVTA 4PJ8D 5HP5A 5LO7A 5JOEA 3MUJA 4MNQE 5C0JB 2AP2A 3KZ8A 5BNXD 1XSKA 1X5LA 4OBSA 1X5AA 1Y6NR 2BZ7A 3DXAA 3LEVL 4FQJL 4J3OF 3ARBB 4R84A 5CN1A 2NW3A 3WN5A 1IGIL 1QVOA 5D1XC 1NA8A 3E38A 4P5TD 3KJ4B 1EX0A 3VDAA 2ED9A 1WGOA 1QPKA 2FWLB 2F15A 1I9JL 5I19H 3THMH 1QR1A 4PRID 1CICA 5GS0H 3AADB 1EWHA 3DIDA 1KIPB 4HAGA 4JFSA 4WWNA 4Y2DC 1R5VA 2B5IB 2X9WA 4KJQC 5EU3B 4LEOB 5TE6H 5C09D 4KROC 3HR6A 4FG2A 3Q01A 1GC1L 2E7DA 5D4JA 4YSQA 3AREB 3Q2CA 3MA7A 5JPMC 2Q8BL 4WWPA 4P48A 2ZYIA 5HDQH 3AMLA 2AK4B 4MZRA 4S1RH 3TT3H 5C07A 3FUEA 1YHPA 1CN4A 2PO6C 1KBWA 1Z0NA 3ILQD 4PGBA 2NDGA 3N44B 1QD0A 5F6HJ 3QFDB 4M8UA 3EFDH 1E5ZA 1M7DB 4IKJA 4KXCA 3ARYA 4NNYB 5DYOB 4RGOL 4M56A 4GUCA 1JK9B 4N4YB 1KPRA 2ESVE 3IRPX 3D2UA 2EO9A 5E03A 4B3VA 1Q9KA 4K7PX 3DHJA 5C0CE 3ZRSA 5CJXA 2HX9A 3NQIA 1EFXD 3ECQA 4ZUSB 1QBLH 3QG7L 1BZ7B 1JPEA 2XKNB 3D4GA 3QR1A 4LMQI 4QY8A 4WJ5B 5DHDA 5BO1H 2ZXEB 2C3VA 1NH6A 3NZHL 3CH8A 4HPOL 1PZCA 4OVUA 5BZDB 4PBVC 1WZ1L 1N59B 4CJ1A 3RDTD 1YDPB 1CTNA 1ZDSA 4AKOA 3TVMC 3CDGB 4LNRA 3STBA 4CA4A 1WD8A 4GG6A 1VFBB 3CK0H 4N85A 2PW1B 2R2HB 2YGQA 4NKIH 1BHGA 2H3KA 3ML9A 1O7DC 2G9KA 2HKHL 3EJQA 5JOPE 1VACB 3G6JE 2R2BA 1PYWB 3UTSD 1JHLH 1JNNH 1IGYB 3B37A 1U30A 3EH1A 1BOYA 3C5SB 3G6AB 4PRHA 1I82A 2B0SL 2G9HA 4UV7L 1A7OH 1FORL 2QLVB 3F85A 4KMQA 3VSTA 4C8XA 4JCWA 1OTTD 4QNPE 4HMDA 5G5DB 4ZMLA 5EF0A 2AJXL 4WSKA 3ML8A 1D5BA 2BCKB 4GY4A 2VW6A 1XBRA 3H42L 4PHXA 4L37B 2H6UA 4KPHL 2P5WB 5D1ZD 3QCVH 4CU6A 2WINA 5DZ9A 4I2XA 4WHYH 1OL0A 4JFVA 3NOIA 1BECA 5IB2B 4F91B 3V55A 2X70A 3O3EB 2P5ED 1NLDL 2I5YH 1DSFL 1A3LH 2RR3A 2EXTA 2IMNA 2YPLB 3TYFA 4X9HA 4XNZC 2ADJA 3G6JB 4NQVA 1BFOB 1V3KA 2AJXH 4I18B 3SGEH 1JPFB 1KCLA 4PJ9A 1L5GB 4CRPA 3HAEG 3HMXA 1GGBL 5C8JA 1SHWA 1T4KA 1W15A 4QEGA 3UGEA 3SYPA 4B50A 3POCA 4IBZA 1MJJA 3I50L 2FT6A 2WXFA 4WHTA 4HAFA 5JQIB 2CR6A 1S9YA 3JTSB 4YSDA 4QT5B 3IGAA 1YO4A 1HDMA 5HHMD 5LBGA 3WFCL 4E9SA 5BXFB 4XP9L 3PHOA 1LE5B 3QPXH 2EABA 5AZ2L 3L5JA 1DQDL 5C0CD 1S7QB 4PP2A 3VFUA 4MWFA 2YPLE 3I75B 5KS9F 4QRRA 3EYFB 1IU1A 3NCYS 2GTQA 1JRHL 4IIQC 3TU6A 2OMYB 2Y6SC 5CBEB 5ITBH 4OGYL 2WUCH 2QL1A 3UTZA 4P5MA 1AVAA 2UWEF 4MWFB 4OLYH 1FAIL 2I24N 4LRNH 4TSAH 5K9OA 2X89A 3KYKL 3VA2C 5LWYL 4FCHA 3O0LA 1N59A 1RZIA 2WXJA 3E0GA 3LNHA 4XT1C 1YUHA 1ZTMA 1CGVA 2X4OA 5T3XL 4XNZB 4DFIA 1QSED 1UXWB 2HSIA 2PXYC 3H6AA 4KTEL 1PYWA 1MFEH 1MCEA 5KBMA 3T0BA 4JUSA 3MODL 3GHPA 3NAAH 3BESR 1U6AL 1O7VA 2IPTL 3S48A 3WFHB 3KPMB 2YUZA 5F9DC 2WOBA 5GGSY 4E9XA 2WQ8A 1NMCB 5TQ2H 1T0OA 2BSRB 1OSPH 3FTSA 1G6RL 3ABGA 4V2BA 4YZFF 1NIEA 2CDEB 3ESOA 3LZFL 2VWEE 1FP5A 1TF4A 1GTNA 3SGJA 4PWIA 1MCQA 2AEOA 4UTAA 3PU7A 3FPYA 5GZOA 1YA5A 4UCFA 5FB8A 4JN1L 1N0XH 5LWYH 1ONQA 4JVWA 3TT1L 3AGWA 3PHQA 1T1YB 4IGBB 4PREB 5EPMB 5EU7C 2B1HH 1WWBX 1MFBH 1X6LA 2PN5A 3QGVA 5I18H 1ZT4A 1NBYA 4BFBD 1IFHL 3TVMB 4PRNB 3MRIB 4YH6A 4J8RA 2DICA 5K9JL 2BC4A 3V95A 5KVFH 3EOBA 3IPEA 1G1KA 1EBPA 2IALA 2YRLA 3ABLB 3ARGA 3GSNB 3OF6A 4OF7A 3EW3B 1HHKA 1RD6A 3L4ZA 5F7BA 4TNEA 2JCCF 5SWZE 1OB0A 3VXUA 4CVXA 2CXKA 3QIWB 3HRZC 3EDDA 3VWKC 3L4UA 3LZQA 2CDFA 4XPHL 5L2KA 1D5MA 4X5WB 3ARVA 1QO3A 2BSTA 2A9BA 3ULUH 1L7TH 5EO1B 5CEZE 1KLFA 3NA4A 2FWSA 1F2XK 2OL3H 4ANKA 3TH2T 5CCJA 2VSDA 3GXUB 2EADA 4EN3A 3G5VA 3UERA 5F3BB 1J11A 4FEMA 1PVHA 3U2IA 1UZ6E 2FYYA 4C58B 4X98B 4JFEA 1LD9A 1PG7X 5MI0C 4HEPA 4BFIA 3S6CA 4YDJA 4Y19D 1U92B 4PJBB 4JRXD 1XIWD 3D34A 2X9ZA 2YXMA 4IQHA 2E6JA 3TN0D 1TTAA 5HHOA 1XD1A 5CGMA 1AD9A 4OGQC 4ZO8A 2GQHA 4OIIL 5MP6H 4TL4A 4JEGB 1DLFH 3IDUA 3ROOA 4DZBA 3K80A 2C9AA 4IRSB 3ULAB 2ZOKA 4P5KB 4FQ1L 5C6TL 1DLHA 2KZKA 5IIEB 2X1PA 5IBLD 4MYPA 3NFNA 3FONA 1KPUA 3HB3B 1DHKA 3GSOA 5AW1B 1G7LA 3EJYD 1DVFD 2OYPA 3BGMA 1ES0B 2P5PA 4LCWD 5DQJB 4J3OC 3BZ4A 3HAEB 4PJEB 5AD0A 3OAWA 2KH2B 5TF0A 4HJ0C 3MRLB 1IBGH 5I8OL 1T66C 4FQJH 1D3CA 3V4PA 4DP8X 1ADQA 1OF0A 1RFDL 3CPLB 5DHVH 3VFGL 4B9PA 2W59A 1RUPH 1U8CB 3C2AH 2J88L 3FDWA 4XZ4A 3RBGA 2AK4D 1HAWA 2X4SB 2Y1VA 4H20H 1WICA 2XU9A 4NM4H 1A6ZB 5HJ3A 3KBHE 1UXMA 4Y16A 4A6YB 1L0YA 1LK3H 3IFNL 3DXAB 3UYRH 4MVBC 4TVUA 1FG9C 3SQOL 1H6TA 2J8UA 1JIBA 1F6AA 1GZHC 1UYWL 3L7FA 1A8ZA 4KHXH 4TNVK 1M9SA 2IGFH 2R0KL 5SWQB 1JHTA 1P6AB 1OM3H 2BVPB 3EYOB 4MMXA 4PRIB 5DZPA 3MCKB 2UZYA 2R1YA 1M6OB 1FNFA 4I3RH 1OGAA 4R0LB 3VXRE 4FZEH 1QP1A 4YPJA 3RIFK 3II3A 4HUVB 1V5JA 2A4CA 1NANH 3HLKA 3WEXB 2CCVA 1QSFE 2D03L 2XNAB 1S5IH 4AVKA 4ERSL 8PAZA 4JFFB 4PRDA 4TNWK 1PLGH 2VW7A 4EDWH 2GC7C 2IPUG 3NJNA 4MS8C 4HP5A 3X1NA 3E6HB 1NIBA 3K6IA 3FU8A 4FXKB 5DR5H 3K2IA 3FFCA 1S7XA 3BAIA 4PWJA 5HYFA 5BVPH 2G3MA 2EYSA 3CMOL 4NPYB 2ZCLH 3VSUA 1S7TA 5HHOE 2ARJQ 5CSZA 4R8WL 2PCXA 1T1WA 5I17B 5ISZA 3VW3L 5DJCB 1PCXA 4KKPA 4MQXD 4AZ8B 3NSJA 2MNJB 1U91A 4U3HA 4TXVB 4KH2A 4F1SA 1DE4A 4B9CA 3DVIA 1Z6JT 4UZGA 5FWRA 5GS1B 1OZUA 2XTJB 5BJTA 2VDNH 1G1YA 3M6DA 4UB0H 4Z77B 3QPKA 5E2UL 3RDTB 3DWTA 1MJUH 5JW5B 1ILSA 2XPGB 3SJVB 4H25A 4HHAA 4UDUA 3RNKA 3A5VA 5JZ7C 3U7AA 5I1GH 3GMOB 2XWRA 2P24B 5C7XH 1SUHA 3K6SB 1FVEB 3NA9H 2WLLB 5AKSA 3VE0B 3DDGA 4W4OC 4WNSA 3KR3L 3B34A 2X12A 4Z7UB 1R46A 3ZUCA 1GC1H 5FK9A 3PFUA 5DJDA 3VRJA 5DA4A 1T6VN 3WLWD 4ILDA 2MNWA 2NY0B 3UTTB 3WHXA 2CHWA 1BXVA 4OCNC 2GCYB 1MLBB 3OLDA 3QORB 1ZK9A 2F0CA 4MAYB 3BPLB 5DD5L 5HY9B 4YSCA 1INQA 5EUKA 3T0XA 3TV8A 1J48A 3KPNB 4BHUI 2CUIA 1TQBC 5T3ZH 4EI5C 4OFYA 4LVOB 3CBRA 4PB0H 2HRGA 2NXYB 1BQHB 2EXWC 4NN5C 1U4EA 2YA1A 3F00A 3HJEA 4E9LA 1I3UA 2GTZA 2QV4A 3Q6GL 4X8XA 4AW7A 3L5XL 4PCSA 3HE7C 5AYQA 1H3WM 1XF5A 1LWJA 1T7VA 1N3NB 2OMTA 4ZW7A 1K3IA 2HTKD 1DL7H 4YK4C 3SKNB 3V0WH 4I9WE 3SODB 4NRYA 3SOBL 5INCB 3UTTE 2J43A 1EJOL 1LQBC 3VXUB 4CVXB 1GTFA 1U8QA 4W4OA 1MEXL 3VFUB 3QUKB 3BDYL 2D7NA 5JYMA 1FC2D 3EOBB 4PJ8C 3V0IA 4DQAA 1Z5LB 2BNQB 2CMRL 2GJZA 2YAHA 3BWAB 5F1OB 2XWJB 4Y0GA 2A6JA 4LRNL 4H8WC 2YAFA 4NAMA 2ODIA 4WHTB 3CZNA 3GSXA 3TF4A 2VDRH 3ZTJG 1CXIA 4P5TC 5F8QC 4LESA 4LCVA 5TGBA 2VDOB 3BWSA 2DBLL 2NTFB 3M1BA 4XMLH 3C6LB 4WFFE 3F58H 3BEWA 1RPQA 3CFBB 5GGUB 3LKSA 4ELMB 2QMJA 4KJQD 3MBXH 4G6FB 1CVRA 2AABH 2IDTA 1MZYA 4X8JB 3DOHA 4H8UA 1JVKA 1T21A 5D7SL 3MACL 5B1CA 1BEXA 4YHYC 4FLQA 2APBA 3T9WA 5GS0D 1NCIA 2GJ6E 3V8OA 3VGBA 4X4ZA 1UHVA 4KKAC 1QUPA 4ZMVA 4CVWA 5E51A 3X11A 2EDBA 2YXVA 3GRWL 2BVOA 2OP4H 1NBVL 2YR3A 2H1XA 1T0MB 1T83C 2ZX6A 1YCSA 4J7RA 4W9GC 3TBCA 4EN2A 1VLXA 1T0PB 2IPKA 4LASH 4WFFD 1UGKA 2GFBA 4X4XA 4XX5A 3OWRA 3FYEB 4XNAA 1C7SA 2JKRM 2YRBA 1A6AA 4MBRA 3VWJA 2QSTA 3SE6A 4AG4L 4I1RA 1MW0A 1Q9WA 4U1LB 1MDTA 5DK0A 1BLNB 1J7VR 3FFDA 5EULV 3W2DL 3F7YA 3D0VB 4EIZC 1DJHA 2XIBA 4S1DC 5CHNB 4N9GB 5ERWB 2XWBA 2GIYA 3K4AA 3TVMD 3U9UB 1INDH 2XSKA 5HGHB 1L0XA 5FYLL 5EB9A 2QHLA 3U6XS 4HXAL 4E68A 2FIKA 1S7QA 5FKAB 3O45B 1XCTB 4HQQH 2ICWA 4RWYH 1UATA 2DIBA 4LLDA 2DQ6A 4F7MA 2FHCA 2XN9B 4KV5F 4U6HB 1L7TL 4IIQB 4O4YH 5EIIB 4JFZH 3RZWA 3UTOA 4MJ6A 3TJHC 4X8GA 4QY8B 3RL1A 4OCRH 3PNWB 1I8KB 4FKEA 3EDFA 4WI3A 1UM4L 4IU2B 4A04A 2YSSA 2IH8A 5KW9L 1KJ2L 1UWEH 3I6LD 4JVUA 3VTMA 5T5NF 2DLFL 1CBVL 4FMFA 1G9MH 3MRRA 2WXKA 4K3JH 3DRTB 1MG2C 4XVUC 3GZQA 2NQ3A 5DD3L 3RB7A 5ALCL 3FUDA 3VACA 4BD4A 4NBYB 3LCYA 3PDOB 5F88B 3V7AG 1RPUA 1JFQL 4F33B 1W2KT 1SDDB 5IK3A 3II1A 1ZHLA 2DPKA 3KLAA 3MHZA 1XH1A 5IROA 3WXWH 4LCUA 2EH8H 4R2GC 4A7GF 4AENA 4F20A 3P30L 1OAYH 2SODB 4FXGB 1MFBL 5GJSH 1OWWA 3PWPD 5C0BD 1YECL 3HAEH 2J72A 1D5BB 3IDJB 2ZOOA 4NKOB 4EN3C 2CAKA 4G42B 25C8H 2YD5A 1INEL 1M2VA 5JXED 4R7VA 4L1BA 4ZG1A 1SLWA 4M7KH 4BK5C 5IREA 1WA1X 3L3HB 3OC8A 2OFQA 4BQ9A 2IFFL 2WWMC 4G80B 4W81A 1MKFA 2HTLD 1I3RA 4NC1C 4JRLA 4DVBB 5D7IE 3KXFE 4ZMNA 3QXAA 4PUBH 2A99A 1Q72H 5DJ6A 4JREB 4DP5X 2C3VB 1DQML 1F4YL 2L4OA 2Y72A 4ABWA 5L4JA 4AH2A 2D7MA 1DN2A 1EO8L 1Z9OA 3HOGA 1T89C 3N91A 1YMMA 2ZYRA 1CYGA 3QORA 3QB7C 2OTWA 1EJ6A 4M4PA 1E43A 5GS2D 4FJYA 3RIAF 3VRJB 1TPXB 1B0IA 2Y24A 3WD5H 3CV5A 3VRLF 2VXUL 3S3DB 4TTGA 2YD2A 4K7PY 5JNYA 3H9SE 1WHOA 1VERA 5GSVA 5F1SA 1KGIA 3N40P 2R29H 4Z7QB 5F89A 5D7IB 2ZZUT 1S5HB 1ZLWK 1CXEA 4UT6H 1OEZW 4Y4HB 1JV5A 5CGYD 4OT1L 4GXUN 4WI0A 4MAUL 4FFZA 3MLTB 2ZCHH 1ZHBA 5I5JA 2DWEB 4XBPA 4PJIA 3Q0HA 1DZ0A 4PJGB 5DMYA 2Z7WA 1I9IL 3UMNA 2Q3ZA 1KSRA 4LO9A 1KIUB 3UJTL 2EP6A 1ZVYA 1C9SA 3PIQB 5GS3A 2PPEA 3GGWA 3EYUL 2VDKH 1MIEH 1H3XA 2HB0A 2NTSP 5JPMB 2CO2A 1F56A 3O9WA 3N1MC 1G7MB 4KWUA 1MQKH 1S7TB 2NW3B 3EOAA 4AGNA 3T3MF 2O5ZL 5DD1H 1K5WA 3DVNB 4XO9A 2EEBA 5EUOF 5LGHL 3NFNB 3KL0A 3JT0A 3E6HA 1M71A 3LKPB 1ZJAA 4KTDL 1BFSA 1HNGA 1RZJC 1BIIB 2E9BA 1D5ZB 1G0YR 3B2XA 4MDJA 4PJCB 2V9UA 5D7JA 4AYGA 4YXKH 3U4BH 2B15A 4KBPA 2ZONA 4X6DB 1F2QA 3MBEB 3S96A 3BZEB 1YEWA 2EZ0D 1G6RB 1OTSC 2X41A 3WI9A 4TLSA 3P69A 3QIWD 1CS6A 4LLMB 5HHMB 1BF5A 3KNBB 1XQ4A 2NXYD 2GJJA 3IGFA 5B3JE 1MPAL 2IDQA 3C9NA 4M29A 3OAYH 4YGVB 4MDIA 3RFZB 3VI3E 3DUSA 4AJYV 1FFRA 1A7RH 5T3XE 2E9IA 1F0LA 1RJLA 4N6RA 5H35A 4S11A 1QTSA 3OJ2C 1UM5L 3WG7B 1K9TA 3CCHB 3D25B 4ODUA 5CKAA 1O6TA 3BUTA 3WNLA 1GS7A 1MCWM 2K9UA 4FLRA 3CX5J 3FQUB 5F96H 4YSTA 1E67A 3CVHA 3IMUA 3GQFA 3BQVA 4DP7X 1MFCL 2PP8A 5DCCA 4LSUL 4UIMB 4OGAC 2PYEB 1FL5B 3A6BH 3IM1A 4LSVH 4AQ1A 4Y4FD 5C0DA 5DQDL 4BYHA 1BVNT 4N28A 4N0UB 4QO1B 1JZ5A 5IW1A 1XF3B 4H8QA 4XP6L 5EF1A 1J0IA 3BUPA 3VI3B 1KLGA 4DZ8B 5IB3B 1BYOA 3GKZA 3MXWL 1RJYA 1I3GL 5BW7C 3EJYC 3C8HA 5ICXA 5C0IA 4L8SA 1J88A 1ETZB 2XQYK 4LCCC 3TZVA 4J3OD 5I0YA 5I6LA 2L7JA 4HJJL 1B88A 1RZ8A 1FA4A 3GD1C 2R69L 5C0BA 2Y69B 4RMWA 3V5KA 3DX8A 1LL1A 2B08A 5J13C 4WCYH 3BVWA 4L4VD 1OE2A 4OLZL 2CO7A 2LAGB 4WUUA 5DO2C 3T8XB 4AJ0A 4QOKA 4F7MB 1CGSL 3M45A 3W1ZA 4OM1H 1E6JL 4WV1A 4FNQA 5FHBH 4KTYA 2WBJC 4OF5A 5GIRB 1UB6B 2CG9X 3B6SA 4TL5A 4AWJC 4PVLA 4HK0A 3FB7B 3GPSA 1JZIA 2FWOA 4LCYA 4OD3H 35C8H 3C60A 2WNWA 1AQDB 1HE7A 1IGCL 4WKZB 4HJIA 4MDJB 5IB4A 2JSFA 2XDHA 3KPRA 3S4SA 3F7VA 1FNSH 2ZX7A 1KXVA 1CE1L 4WW2A 4N86A 3SDXB 2HLAB 4NRZA 5CZVH 2W60A 2VIRB 4TN9A 1XGTB 3G3LA 4CL7A 4QRTA 1U2CA 4ZMWA 4XXWA 1DEDA 4MS6A 1OGAD 3CSYA 2F58L 3OMIB 3TA3A 3KYOB 3TA4D 5HJ3B 3AAZB 4IBVA 4Y9EA 5CWSB 1T0MA 5TF1H 5FYJE 1BBJB 3GB7A 3KPPA 2EDXA 1TO4A 2XVKA 3P11H 3AFLA 3BVNA 4JHVA 3HZYB 4XAWL 5E0QA 4YSPA 2NSQA 1QFWL 2GSIA 1N70A 4PLJD 3GJFB 3KYNB 4LMQE 3C6EA 4U3SA 4AL8H 1YMMD 2OMVB 1JK8B 1PY4A 2ZXAA 3A22A 3OX8B 5TF1L 4OD2B 2BXZA 1N0LB 1GZQB 2CUHA 3L17A 4KXZI 4NZUH 3WNOA 2FL5A 4CADB 4N0RA 3QDJD 3REWA 1TCRB 4WWID 2NTFA 4LARL 5DMGC 1AY1L 4Z3EA 4Y7MA 2KKQA 3GRGA 1M7XA 4U4BA 3WEOA 2IF7A 3VWJC 5B7FA 1EXHA 5C0AE 3SZKC 1H9VA 3LVEA 1LDPL 1IGFH 3I6LE 1GPOH 1I8KA 3WV0A 1DEEB 4KKBD 3KS0J 4WV1C 3QCTL 1AGEB 3RY5A 5A2AA 5EIIA 3QARA 2Z92B 4V11A 1FHNA 3PQYA 4UQCA 4PRAB 4APXB 4PV9A 4PTUA 4NQEE 1F00I 3D0AA 1BA9A 4X99B 2NZ1A 1G9NH 4AL8L 4EBQH 4PJHA 4OLEA 4PGEA 2NZ9C 3NCFB 3DO4A 3ZYJA 3QPQC 4MHHG 2H26A 5D5ME 2BRRH 2AJZB 5DHVA 4FNLH 3QHTC 4UM8B 3V6FB 2OAAA 4NIYE 2XZCH 2C9SA 1YC7A 2R0ZL 3HI5L 1AQKL 2MIZA 3KEDA 3ZX1A 4NFBA 4YVUA 1EHLH 2Q3XA 4ICWA 2JKXA 5ESAB 2HTKC 1IM3A 1QLEH 5D2LB 1QNZH 2CLVA 3EHBC 5DK0B 1S9YB 3RJOA 3MV8E 3LKQA 5IVXE 1QWNA 3FSWA 4HF5H 3GLEA 4PN6A 2ITEA 3ZSSA 1LHZA 1BQLH 1KWGA 1F90L 1OW0A 3L5IA 3DXAD 4IBUA 3C6SA 3NFPA 2J5LB 2PTTA 4L4VA 4XMTA 5TDPA 3TN0A 3U82B 5BV7C 2YQGA 1GIGL 3HG1E 4KVPA 5D2NB 5D8JH 4IHOB 3IJSA 4UUJB 1E4XI 1FYTB 1JWMA 3KPQB 1QHPA 5E1GA 2HJLA 3C6SB 3D9AL 2IO5A 5FM5M 5DRXB 2VERN 1XSIA 4I87A 5C08E 4PGBB 4A2FA 2B77A 5FW6A 2WINB 4ZOBA 1K5NA 1BF8A 1IFHH 1F90H 4OZFG 3MV8B 1DO6A 3L4VA 4CVZB 4F1ZA 2ZYSA 4UNTA 2CCLA 1BPLB 1MI5A 2R15A 1X9LA 1RV6X 4XWGL 3LSOB 4U1KB 3BAKA 4ZFOL 1E4JA 2E3VA 5I1CH 1OKEA 4Y4FA 4HJSA 1ZKAA 3MLUH 4K7FB 3RGVC 5IJKA 1OAXL 1SUJA 3HG1B 1B4JL 3FT0A 4YEEA 1KELH 3LKQB 1AO7B 3WTVA 3OF6D 4U6VH 3LS4L 2Z35B 3LRKA 5I82A 1HH6B 4J3TA 1PNDA 1H5BC 4L4TA 4A2MA 4CN6A 5C1MB 1X5GA 2BNQA 3GNMH 3CFQA 1A6TA 1O6SA 1KEMH 4NZ8A 5FS5A 2ZUWA 3BCFA 3P73A 1BQHG 1W8OA 4ZFGH 4F8PA 5L9DH 4N2HA 4RBPH 2CBQA 5SX4I 3F5WA 4XCEB 5CCKH 4JQIH 3H3PL 1SOXA 5FECB 4CU8A 4OI7A 5DZAA 4OFIA 5ESVB 3L3IA 1N6QL 2YC1B 4XXDB 4ONHB 4LSPL 4HBQA 1V8HA 1AI1L 3OJMB 2R1XA 1LM8V 2MKLC 3N1QC 4MXVF 1WIPA 1UWXH 5J1TC 2IFGA 4MAYC 3ZRCC 3D39A 1LP9F 3O6ML 3DSNA 4YL4A 4PJDE 5GRVK 1Q0XH 2XV0A 4JO4H 1JD7A 5LGKA 3MO1A 5KSBB 4HWNA 2ZUUA 3GF8A 2IWGA 4EXPX 4NLAA 4WW2C 1EZVX 5IHBA 4OQTH 4UTAL 4PJ9B 2VSKB 4PV1C 2FJFA 3I3DA 5JORB 3NESA 3FAXA 5FUCC 4XN1A 1U58A 3MXVL 1WBZB 1SEQL 4DJMA 4LPCA 4OT1H 4Z95L 4YHLL 1J5HA 3QDJB 1N68A 2H8PB 2R2EA 1Z3GL 1IKNA 2DQCL 5I8OH 5AZUA 3OKLB 4B9KC 5C97A 1PAZA 4HALA 4UNUA 4ZQKA 3TXAA 3QK0A 1U8HA 4YWGH 3NBNA 3Q9PA 3NCMA 5EZOL 2OS7A 3IDXL 2DH3A 1UEYA 1Z9LA 4TVPE 2OULB 4FTVE 4OCSH 4J6IA 1ZA6B 1R0AL 4OFYD 4UIMA 1W0VA 3RGBA 5T1JA 2IV9A 4DAGH 4JR9L 4BK5A 5D1ZA 4KUCD 3F83A 3LZNA 4GXVH 4OAWA 4DUXA 3VX0A 2VZ3A 2B7DT 1L3WA 4KI5C 4KJPC 4GAAA 3DNKA 3MJ7A 2DM2A 4PRPD 2B3RA 1AG0A 5BOZG 5BMFL 4YHKH 4WHYG 1QBBA 5BW7A 3RWEA 4G6KH 3U36A 3V5HB 1XGUB 1LMIA 2K9FB 3TTSA 2J8UE 5E95B 4JDVB 1KIQA 3Q6FB 3P9LB 1GW0A 3DXAE 4I89A 5KSAB 3NFSH 4E9RA 1XD0A 4EIUA 1TXKA 5FW8A 2X7LA 1XGUA 1RL1A 1DCEA 4GRMB 4JY4B 4Y1AA 3ILDA 1IGIH 1UJ3B 5GSRA 1MCJA 3UG3A 4XI5C 4J1UB 3TEZA 2AMGA 1NUGA 1QSZA 1RZ8B 2UY6A 2FJSA 1NGZA 3CFIC 1TZGL 2X7LB 5FHBL 1Z1WA 2AHIA 4ELMF 3KH3A 4HIPA 1ACYH 2VLLA 1QW9A 1QTPA 1WFTA 2CO7B 2DY2A 4PEEA 3NJFA 5I9QC 1GMEA 4H8PA 2HKFH 1ETA1 3KBFA