2FTAA

Structure of cu(ii)azurin with the metal-binding loop sequence "ctfpghsalm" replaced with "ctphpfm"
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
122
structure length
122
Chain Sequence
CSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTPHPFMKGTLTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Basic requirements for a metal-binding site in a protein: The influence of loop shortening on the cupredoxin azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 31
structure length 122
sequence length 122
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ftaA00
3WIAA 1OF0A 1J9TA 1BAWA 3KW7A 1HAWA 4GXFA 1A3ZA 4YSUA 4BK5C 2JFCA 4HZ1A 4YVNA 4AZUA 1NTDA 3SBQA 3IEAA 2GI0A 3TASA 4DP5X 2I7SA 3NJIA 1ASOA 2FJSA 2PPEA 4MFHA 4YSDA 1IKOP 2YAOA 1BQRA 1PZBA 4DP6X 1N68A 3CDZB 1SDDA 1L9OA 4E9WA 4A66A 1OV8A 1SF3A 2UXGA 3QJUB 1AOZA 3ABKB 3MBWB 4N8UA 3NJMA 5I5JA 2CUAA 3H56A 2YXVA 1V10A 3TBCA 4F2FA 3H4HA 4DP1X 4WTQA 3OMIB 2ZWNA 3UACA 2TSAA 4YSCA 5B3SB 1NIFA 4BWTA 3QJVB 3QPKA 1KBVA 1QNIA 2RACA 2WO2B 3FQ1A 1A4AA 1JXGA 1J5CA 3PCYA 2HX9A 2FQFA 1DZ0A 3QJTB 1E5ZA 4GP5B 1JOIA 4F7KA 1AQ8A 3HEIB 2YARA 1OE3A 4G70B 1ASQA 2DY2A 4E9TA 2IH8A 3OMNB 4BWUA 1GYCA 1SHXA 3NJJA 4AKQA 1ZPUA 3SBRA 4DP9X 4DP7X 4BXSV 2H3XC 2DWTA 1AG6A 1WA2X 4AKOA 3EH5B 4KO9A 3BVDB 2IDTA 3DTUB 1L9TA 5B1JA 4ENZA 5I6NA 5D4JA 2YAQA 2R7EA 4F2EA 9PCYA 1NDTA 2EIJB 2WSDA 3NJKA 4YSSA 1OCCB 1ET7A 3H4FA 1TU2A 3AG2B 3IN2A 4CSPA 2X88A 3UABA 4NAJA 1NINA 2BO0A 1ZIAA 3FU7A 3RYMA 1ET8A 2UX6A 1ILSA 2QPDB 3BQVA 2BP0B 3CVDA 4QLWA 1FWXA 2UXFA 2IWKA 2VSMB 1SJMA 2GSMB 1JERA 2IDFA 2P80D 3FSWA 4YVUA 3ABLB 3GYRA 3ZX1A 4KO6A 2GHZA 3ASNB 4AX3A 1DYZA 4K9JA 3AG1B 1W6LA 3L45A 1EHKB 1JVLA 2VSKB 5IY5B 1NIDA 1VLXA 4N4YB 4DP8X 5B1AB 1WA0X 3OMAB 1V54B 4KNSA 7PAZA 1A65A 1JZHA 3T6XA 2OV0A 1E30A 1IBYA 2XU9A 3N55A 2UX7A 5D4IA 5E9NA 1SHWA 1PLCA 2GIMA 1XB8A 4E9VA 2XUWA 1BXAA 5TK2A 2VM4A 2DYSB 1CURA 1OE1A 2PP9A 2EIMB 3IBOA 1AANA 1JZIA 2PLTA 3FSAA 2PP7A 3NJFA 3V9EA 1E67A 1F56A 4EF3A 1SDDB 1T5KA 2IAAC 1GY1A 5B7FA 3V9CA 1ASPA 3WNJA 3S3BB 6PCYA 4JHUA 3NJGA 4DPBX 3IE9A 3IN0A 3SQRA 4WKXA 1E5YA 3AW5A 3FYIB 1PF3A 1IBZA 1MZYA 3PAUA 2IH9A 4HCGA 3FSZA 2XV2A 4A2EA 4E9SA 2AVFA 4KO7A 3ZDWA 5AFAA 2IWEA 1GSKA 2Y69B 3WG7B 4W1TA 1XB3A 3NP3A 4HCIA 1HFUA 1HAUA 1OOWA 5EHFA 3PAVA 2OCCB 3FPXA 2BZ7A 2PP8A 1MZZA 4DP4X 2IWFA 4G7RB 1MDAA 4NB7A 1GS7A 4BDVB 2FQGA 2HLEB 1NZRA 1GS8A 1OCZB 1AZUA 3AG4B 2FQDA 3QJRB 2UXVA 4Q89A 2E86A 1ET5A 4FA7B 1A4CA 2XVBA 3PAZA 1JVOA 4M3HA 1B3IA 1KDIA 3FSVA 2CBPA 3NJLA 4UANA 2FT6A 1NPNA 3AG3B 3FU7B 3FU9A 1KDJA 1AIZA 3WI9A 1NWPA 1ETJA 2B08A 5PCYA 3S3DB 1TKWA 3FS9A 3OQRA 4E9XA 5TK4A 1RZQA 2HRHA 1PY0A 2XX0A 3TU6A 1YLBB 2Q9OA 3OD3A 2QDWA 2I85A 2HRGA 2BZCA 1WS8A 4L0PB 3CDZA 1BXUA 4NERA 4A2FA 1IUZA 1AZRA 1BQ5A 1NICA 4BXVA 1JZGA 1PZAA 2ZOOA 3GXUB 4FAAB 1J9RA 1NIEA 1AZCA 1SFDA 3MX0B 2YAFA 1OCRB 3DIVA 4HHWA 2PPCA 3UAEA 3X1NA 4G71B 2GB2A 1OE2A 1X9RA 3PPSA 4E9RA 1AG0A 2JXMA 3U25A 3X1GA 4ZK8A 3PLYA 2BHFA 3T71A 1KYAA 8PAZA 3FT0A 2XLLA 2UXTA 2IDSA 3NP4A 5I26A 1AR1B 1W6WA 4YSOA 1AZNA 4RH4A 1TEGA 1R1CA 2QDVA 2XWZA 3WNIA 2AFNA 1L9RA 2CAKA 1SF5A 1PAZA 4P5SA 2VW4A 2W8CA 5B1KA 2MTAA 4TXVB 3ZIYA 1RZPA 1AAJA 4HCFA 2BP8A 2YAHA 2EILB 2QPEB 1FA4A 1BQKA 2EIKB 2PPFA 1RCYA 2J5WA 1CYWA 3NYKA 1M56B 4AI7A 1CYXA 1BYPA 5B7MA 3CVCA 1CUOA 4UAHA 1A4BA 1AS8A 2Y1AA 1JZEA 1JZJA 4G72B 1WA1X 5I6MA 3WKQA 3EH4B 2B3IA 2BP0A 2CALA 3CG8A 1TEFA 2VMJA 4DPAX 1EZLA 2VW7A 4KNUA 1J9SA 4E9QA 1M9WA 3CVBA 3QQXA 2YAPA 2XV3A 2ZXWB 3X2QB 3NSDA 2FQEA 3S8FB 2XXGA 1J5DA 3N2JA 4G7QB 2BWDA 1NIAA 3T6WA 1NWOA 5LDUA 3G5WA 2FWLB 3FPYA 2HXAA 1ZDQA 5D4HA 1L9PA 2A3TA 2XV0A 1NPJA 3ZBMA 4GY4A 3FQYA 1URIA 4AKPA 7PCYA 3NSFA 3ERXA 3AZUA 3ABGA 4W9ZA 2VN3A 4KNTA 3FQ2A 2PCFA 5PAZA 3X1EA 4G7SB 4YSTA 1I53A 1MG2C 4YSRA 2IDQA 4CSZA 5A7EA 1PLAA 3WKPA 3TBBA 2J57A 3KW8A 2DWSA 4YSAA 3DKHA 2R7EB 3UAAA 1GR7A 4A68A 4P5RA 2EINB 3ABMB 2GBAA 5AZUA 1FFTB 4GP8B 1RKRA 3T6ZA 1ZV2A 2FT7A 2PPAA 1QHQA 2N0MA 2CJ3A 2Q5BA 2BW5A 2LLNA 3NT0A 2BW4A 4KOBA 4PCYA 3NSCA 2NRDA 5B7EA 3CZUB 4KO5A 4HALA 1ZIBA 3QJQB 3FU8A 2ZONA 3PXLA 1PNDA 4GYBA 5I28A 2P80A 5ANHA 4BWWA 2YAEA 3S3CB 4JKNA 1BEXA 5F7BA 1KGYE 2XYBA 2GC4C 4HAKA 6PAZA 2YAMA 3HB3B 4BDVA 2AZUA 1JZFA 4X4KA 1IC0A 4DPCX 4A2HA 2WO3B 2BWIA 3NJNA 2DYRB 2BP8B 4HHGA 4DP2X 1AACA 2HX7A 1SFHA 1E65A 5I6PA 1PMYA 5I5IA 3T6VA 2VW6A 2I7OA 4YSQA 4HIPA 1GW0A 2H47C 5I6KA 3T9WA 2J55A 1GY2A 4DP0X 2VM3A 1AZBA 1ZDSA 1WS7A 3X1BA 4A2DA 1OCOB 2AZAA 3UGEA 4PAZA 3ASOB 1NIBA 3GDCA 2XXFA 4Q8BA 3SBPA 4E9YA 1JXFA 1JXDA 2XX1A 1XMEB 3D12B 3EH3B 2PPDA 2FNWA 1MG3C 1V55B 3NJHA 3UADA 1KV7A 2IDUA 3S8GB 1J9QA 2YXWA 1WAEA 3FYEB 2AANA 4YSPA 1XB6A 4A67A 1W8EA 1AS7A 4KOCA 4M4RB 3X1FA 5I6OA 2YQBA 5FC9A 5AKRA 1CC3A 1ADWA 1KBWA 1PCSA 3OM3B 2TSBA 2W88A 3C75A 2H5UA 4QKTA 1PNCA 2FTAA 3QJSB 1ID2A 1X9UA 4YL4A 1ILUA 5B1BB 5I6LA 3NSYA 1PZCA 1BYOA 2CCWA 2HZHA 3EHBB 1N70A 2J56A 1M57B 3EF4A 2OJ1A 4GP4B 1QLEB 2PCYA 4JHVA 1PLBA 1L9SA 3AY2A 1AS6A 3TA4D 4A2GA 2GC7C 4UF7C 4YSEA 2FT8A 5I5MA 2MRYA 2DV6A 5B1JC 2HX8A 2QT6A 3JTBA 1L9QA 1KCWA 5F7AA 3JT2A 2JKWA 1SNRA 1BXVA 1GS6X 1A8ZA 1UATA 1KCBA 2X87A
chains in the Genus database with same CATH superfamily
2OMTB 4Z5RB 5DTFA 3CAFA 1NEUA 2YBRA 3KW7A 4FG6D 4MMXB 4WWPA 1D7DA 1JPTL 3H9HA 1ND0B 2DDQH 3IGFA 4P8QA 2ED8A 4CW1B 4TSAH 1CE6B 1GAFL 1F6AB 4ZFGL 1JZDC 2WK2A 4YSDA 2WQ8A 3HG1B 3LVTA 4LARH 5I18L 3CN2A 1BQRA 3EZ8A 4OCLC 3MYJB 3CFBB 1WBZB 5DURD 3ATBA 1SF3A 2FHFA 3TLRA 1AOZA 4PG2A 5I8KH 2WNWA 4Z76B 3ABKB 1F45A 1BLNA 3UZVB 4PRHB 3LS5H 1QOKA 1BF2A 4WENB 4APQA 1FZJA 5LBSH 1ZOXA 5TDOA 1LO0L 4OCMC 2VNCA 4P4KB 2XQYK 2GKIA 2VDRL 1QI4A 4BZ1H 5ISZE 1EJFA 2X6UA 3LRSB 1XXFC 4FDWA 2R29L 5T3XH 1A4AA 3NABL 3FUMA 3MRHB 4GB9A 5ITFB 3ZHKA 4LXFA 3WELA 5IREA 1KJ2L 4NZ8A 2A99A 7TAAA 4OFVA 2OSLA 3S34H 3FFDB 1CR9L 3KR3H 4AH2B 1IBHA 1ZA3A 1D5XB 3BESR 3MLSL 1ETZA 1C1EL 3LYRA 1UA6H 2AP2A 4WGKA 2VN6A 2OYKA 5D7IB 2Y5QA 1Z9NA 3TFBA 2V7NB 4JRYD 5IFAH 2RMNA 4Z3GA 4KK6D 4MJHA 3GIVA 5ILTH 1U3NA 2B20A 3VXUE 2F7RA 4IMKC 5D1XA 2R1YA 4QTHB 1A7OL 1TFPA 1WA2X 2VLKE 4KO9A 3TFKC 3U0PA 5C0DA 2EVHA 1Q8MA 1DJHA 2FIKB 4N8PA 2AQ3A 4ALAC 2NZ9C 1KMGA 3ETTA 4K3DH 2WXQA 2R0ZL 3AS3A 1BVZA 3T2LA 5LHDA 5IQMA 1OY3B 2NZIA 4I77H 4MDJB 1UB6A 2QJDA 1TU2A 3AG2B 4CSPA 1BFTA 4JFXA 4QDGA 3LQAC 3RYMA 4QLWA 5I19H 5C0JA 3CVDA 4F8QA 4JJ5B 4UQEA 4X5PA 3MU3A 1JERA 5B38A 3HI1A 3HZMB 4FNUA 4P46B 4X7TA 1EA9C 4CNIA 5LJYH 1IBGL 1K6QL 1VKXB 3S5LB 2P7TB 2AK1L 4LSQL 5BZWA 3V4UL 5GRUH 3APDA 5LGKA 4S1RL 1UA7A 3IRCA 4G1EB 2ZF9A 3O8XA 1YN6A 1DE4A 2VZVA 5DHVA 3DBXA 1PLCA 3F12A 3KH3A 1AQDA 3BSZH 1INEH 5JHDE 2XUWA 2K70A 3HFMH 5D71L 5TK2A 3U36A 3NH7H 2DYSB 5INCA 1QFPA 2IH3A 1E5BA 3QNXB 5CWSA 3QXTA 4KHTH 4XNXL 4EIUA 3BZFA 1JPGB 3MRBA 4XAKD 3E9UA 5FYJL 1F86A 1G1KA 3P02A 2FJHA 4KK5C 1JZ5A 1MREH 1F02I 4RMRA 3W2DL 3NESA 1TTCA 1A02N 3BUDA 2AAAA 3MLTA 2WLLB 3M8OL 1UD4A 1DQML 1E4WL 5H37H 2W07A 2A6JA 4YDKL 5F6HI 4JFDE 2V37A 3FFCE 4X6DE 4XBPB 4Y2OB 4YQXL 4O9HH 2E59A 3I9PA 3PWUB 4FQ2L 1WHOA 1IQWL 5HP5A 2BSEA 4HCGA 2V3FA 1IGIL 1G0XA 2SEBB 2ZUTA 4B9IA 3MRGA 4Y16A 2XKSA 5DO2D 1G5AA 2IAMD 1NJ9A 2Q6WB 5HHVH 4FKHA 2GW5A 1U8NB 2R83A 3KJ4B 2CM5A 2P5WB 5DI8B 1ZSDA 3C60D 3SY0A 2J88L 5L88H 3KDPB 3EYUL 2BZ7A 4N0FB 5FGSA 1MZZA 3TTYA 5C0CD 4MZIA 1YEJH 2F5BH 3NZ8A 1E6OL 3GMRB 3LXAA 4JDZB 4JQIL 4ZUVB 2GJPA 5K9OB 5I16B 1P53A 2KZKA 3VYPA 4FTVE 3HTLX 4J7RA 4QRUA 3DK0A 5DLML 5DYOA 1KB5A 2CMRL 1KGIA 1D6VH 1NEZB 3MGTB 3US0A 5EOQH 2X4PB 4UNIA 2XICA 5KVGL 3MREA 5I76B 3VFGH 2D31A 3IAPA 4EKJA 4U7MA 5SV3A 4N90D 1RLBA 3VVVA 1FRGH 4I0KA 4APXA 2X4QB 4OD3H 3JTTA 2QHLA 4UTBH 2CKBB 2QSCH 3FU7B 3WOVA 5GGSY 2HFGH 3V10A 3S96B 5D7JC 1NWPA 4KTEH 2VR3A 4B50A 1KWKA 3ROLA 5EU3A 2DMHA 2HMID 4O4YH 1MVYA 3O6MH 4PFEA 2L7UA 2Q86B 3AU1B 4L5FL 2HKFL 3EFDH 4APQD 4Z7VB 2BZCA 4YHZH 4L0PB 5FCUL 2XXMB 4M8QA 4MAYB 4HJ0D 2EC9T 1DZBA 1BQHG 5B3JE 3OKMA 2W81C 1NCOA 3K6SA 4NQSA 4H44C 4PJXB 1ZANH 3PQYE 1OD9A 1U91B 4BK5A 1A6AB 3ES6B 3QNZA 3SE4C 5HDBF 4RNRB 3DYPA 3ZE0B 5FYJU 4GIOA 2PPCA 2AQRA 3ZQ9A 5IVXF 4GKLA 2OK0L 4AQAA 3GMMA 1ML0A 1CS6A 1OAKH 5E2VH 5ADPH 4ZODA 5D1XD 3LVEA 2WXPA 3M86A 4LF3A 4MMZC 2W9EL 2FWUA 2CIIA 5DJAB 1NA8A 3MNWA 4N2EA 3T8XB 1O9ZA 3UPCA 1PG7W 3MPCA 5HYEA 5E2WH 1BVNT 3BVXA 2AFNA 2AQNA 1MFNA 5CJBA 3A24A 4H1LA 1E40A 2YLHA 4KK6C 3TEWA 2IPKB 3DGGB 1UXSA 1ZVSA 4OW6A 4AL8L 1XF5A 4H5SA 3TA3A 1CF1A 43C9B 3UJJH 4AYMC 2NXYD 4MKMA 5F6IB 1XIWB 1FA4A 3L3KB 1IBBA 4KHXL 1NPUA 2MWCA 1LWHA 1MHEA 1R3HA 2HJLB 1MW0A 2NYYD 3D18A 4PI2A 1CYXA 2Q7AA 4JPIA 3BCDA 4DGUA 1IE4A 1ORQB 3ZKXB 4NZTL 4C4UA 1WA1X 5BUPA 1XF3A 5KVFL 2X38A 1NCNA 2W9LA 5DVNA 3A67L 4QRRE 5AOJA 4CMHB 3KGTA 3VG9B 3CG8A 3CHPA 3O8XD 1S9WB 2JKLA 3U46A 4UILL 5MEOB 1QACA 4GRWE 5EC1B 1UGNA 1R3JB 1TZOA 3MLZL 4NWTH 4Z7QE 3BX7C 4KI1A 3FOMA 5DMYA 3MLXL 4OZGA 4PI0A 1IAIH 3NSDA 1WZLA 4FJ6A 2PN5A 5LXGL 1P4IL 4QNPF 5IQNA 2ITDB 1FNFA 4X80H 2CLVB 2HKHH 2V5MA 4WI0A 2EDRA 1GYWA 3O6FB 4JDVA 3K8KA 3TC9A 4Z1PA 1CVRA 3IJEB 4LIQE 5CZVL 1W80A 2DJSA 3KGUA 1JZ8A 1CGTA 4X6CE 2DQMA 2VQTA 3C6LA 4A7GA 1UG9A 4PRIE 3BMVA 1XGYL 2YMXL 3A6CL 3ZRSA 3KWUA 1YYLL 3X1EA 4LO9A 2OZ4A 5KVEH 4G7SB 1CL7H 2CNZA 1MG2C 2F9BT 1N19A 4QHMA 3GIZL 4G1MA 2G5RA 2P52A 2ATPB 1T2JA 4HCRA 5KBMA 4Z7UB 1A7NH 2BSED 4A7UA 1JNNH 5JW4R 1NOAA 1WF5A 2X5PA 3CIAA 3VD5A 4RAUB 4JMNA 4RGMC 4Y16D 4RQQB 3IF1B 5JPNC 4F7PA 2HTLD 4Z7WE 1CFQB 4GP8B 4P2QB 4R8WH 4HOXA 2EDNA 1B4JL 2FT7A 4X4ZA 1AKJB 1JD7A 4PV8B 1KGCE 4XXCC 3WIHL 3MJWA 1SJHB 2CO3A 5CLTA 4N0CD 5AKVA 3CZUB 5I1EL 5DO2C 4GXUN 4JX0A 5KW9L 1T1ZB 5G4OA 3BO8B 3L5WB 2OXHB 1LD9B 1S7RA 1ONQA 1S9XB 4N0UB 4CU6A 5C3TA 3C60C 1HSBA 1XGPA 3TJEL 4OLWH 1EFXB 1UYWH 1MLCB 4NZUL 5EBLB 1BGXH 5D2NC 2XG5A 2GC4C 2Q1EA 3CFIC 3I6SA 3OXRA 3MCG1 1JZFA 2FO4A 2RBLA 4IDJH 5ACZB 3VX0A 4A37A 1B4LA 1RIVH 5T5FH 1ZPLA 4S1SH 5J6SA 2D3VA 3ZJAA 3NG5A 4E36A 1HNYA 2BP8B 1GCFA 3BEVA 2ZP9A 3OKDB 4K5OA 1NDMB 1F00I 2P43B 1MLBB 5J3HD 1K5NA 4J23A 4HKJB 1GW0A 3CDFA 3QUHA 3G5VA 2DIEA 4H8VA 1GY2A 1XCQA 5EUOB 4DP0X 5HGDB 4AEHL 2ZQKA 5KYWA 3GLEA 4A2DA 4D8PA 4AZ8A 4P2RE 4GQ9L 1M9SA 4TOYL 1FL6B 2VC2H 1NIBA 4HJSA 5LKNA 1HXMB 1WBYB 4JGNA 4ZNEE 4LCCB 2EVFA 4NQVB 5ANMB 3M07A 4JVWA 2QPUA 2HMIC 2Z93A 3NJHA 4AJWA 4GQPH 3RY4A 2QKIA 5JUEL 3VI4A 1Z6JT 2C9AA 2UWEE 2M1KA 4APQC 3KXFA 3P30L 3HS9A 3MACL 5F3HB 3RFRA 5ICUA 5K9JH 4ILDA 3UCRA 4WEMB 4HJ0C 1CC3A 3CQPA 1D2OA 5KTEL 1NFIA 3AT8A 2TSBA 3JWDL 3VFVB 1VRSA 5D7KD 4UUJA 5CIPH 1H6FA 5HI5D 3T3PF 5HHOE 4OF8A 4YL4A 1FUNA 4PWHA 3P3UA 1AQKH 1S3KH 2ZAIA 4GFTB 2CSPA 1Z32X 4NRYA 5T8IA 4DN3H 3QI9A 5D72L 3GXTA 1NGZB 2CCWA 3QJZA 3VAEA 1V3LA 4ESKA 1KSRA 3QQ9D 4K7PH 5EC2B 1IEBB 3N44F 4LOEA 1K8DB 4Z95H 1ZGLP 4KKCD 5D1XC 5F3BB 2BIMA 2BZDA 2RGSA 3PGFH 5EWIL 3TA3D 1IX2A 3D39A 1LO5A 4JZJA 4YE4H 4U6XB 4YUEL 2DWYA 3CFJB 4WTWA 4JFZH 1QFWH 1YJDH 4TM9A 5B4MD 3HUJA 5JW3H 1JZ7A 4UOW0 1CFSB 1H5BA 2B9BA 2HFEB 5HHPA 3ZKND 3TCLB 4JDTL 2X87A 1OF0A 4XT1C 3VI3A 5BRQA 2DPKA 3SODB 3V6OE 2NXYC 3IJ8A 1ASOA 2YBGA 2PPEA 2FWOB 1M3JA 1OSPL 2BSRB 1U6AH 2QQNH 5IB4B 1ZJBA 4EVNA 1I1YB 2FWSA 3FUHA 3L3JA 3IGAA 1RUKL 2J8UB 1FHGA 2NYYC 4FYTA 1OV8A 2UXGA 1R24B 3QJUB 3DRTB 3T3ME 5DJ6B 1XR8A 4U05A 1J18A 3NJMA 2CUAA 4P04A 2YSSB 4PV9B 2MIZA 1YMMB 1P5VA 1ZY9A 1OM3H 4QHUB 1KELL 4JL1A 3ZMNA 3DHMA 3GMLA 2V4LA 4BWTA 1J5CA 3UTZB 5A2AA 1PEZA 3C6LD 2MCG1 5F89B 5E5MA 2HAZA 1KIRB 4N9OB 4BE5A 1D5ZA 1ASQA 3IDGA 4HWBA 3SJVB 2EH7L 3TIDA 3HZVA 4K4KA 1F4YH 4Z77A 3T77A 1Y1UA 1YDPA 2WANA 3BZEB 1QPPA 5GS0H 3TEZA 1LK2A 5AD0B 5HPMA 1PZ3A 3JVFC 1YNTF 4XR8C 1SOXA 2E9WA 3E6HA 5LDSA 4IBWA 3O3AB 4OJFL 4KY1H 3RHWK 3CXHK 4G7YH 1KYOJ 4XWGL 5IQ9B 5B39A 3DVFA 4PWIA 5DEZA 4BCYA 5D2LB 5JHBA 4L4TE 3IMVA 2A77H 2EVIA 4E41E 2E7DA 3IRZA 4PJFB 3IDIB 4FI7A 4OKVA 1LNUB 4PVMA 3U30C 5IJVA 1NAKL 3C8KB 4W9JC 3QXAB 5G4NA 1KOAA 2AJSL 1YY8A 2UZPA 5D70H 3GMOB 4Y16C 4EQ2A 5HYJE 3UABA 3D4YA 4HH9B 4OD2B 2HTLC 2QV4A 5J7CC 1QR1A 4AG4H 4KVNL 2WXJA 2QPDB 4QJ3B 1QZ1A 2BP0B 4JN2B 5EO9B 4CN1A 1CDYA 1MH5B 1ZEAL 2DQIH 2Y7NA 3B2MA 3H9SB 4YVUA 4PJ8B 3K2IA 2ZCHL 4M1GH 4OCYL 5KSAB 3TT1L 2WB7A 3FT9A 1YUKB 4NJ9L 2NY5L 4LASH 4OGZA 1JVLA 3DMMA 2OMYB 4WI3A 1NGYA 4QHKI 3OXSB 1BQHB 3P4OA 2GBUA 1WT5A 4DP8X 1S7TB 5LG1A 3CFKA 3H53A 5T1MB 1MRDH 4B7IA 1Q9KB 2YK1L 3MV8A 5CJXA 1N8OE 2XZAH 2QR0A 3O0RL 5AQ0A 1J1XH 1NBZA 5CGYD 7FABH 3N55A 2Z4TA 2HVKB 1RIHL 3FU6A 4B0MB 2YKLH 3BRDA 2FE0A 2FECI 5FA3B 1L5GB 3T3MF 5BO0D 4UYQA 5AOKA 1OGPA 5C0IB 2JKSA 2UVEA 2ZX9A 3JV6B 4G3YL 4MMZB 3SKOB 3UH8A 3Q8AA 2P24B 1PLGL 2A7BA 2ZOUA 5EU7E 2P5PA 3V4VA 1YHPA 2J1YA 1F6FB 5BS0A 1E67A 2IG2H 4FHJA 5HJGA 4L8BB 5J3HC 2OAAA 4GAYB 4NIYE 3NACL 2VDKH 1J8HE 4OJAA 5CP3H 2F8XC 3KXFD 5DEGA 3AUWB 4HWZA 3OG4B 2K3TA 3FT2B 3GJFB 1NM4A 3CVHH 1JPSH 3EJCA 4ODWA 4MB1A 3IN0A 5IWLA 3U9UA 2DQUH 4GAFB 1KGWA 4EDWL 1EEYB 4Y7OC 1E4JA 3BW9B 4NNPH 1XCTB 2RQ8A 3L3HA 1PYWA 4QJ4B 5I74C 2H1PH 2ITEA 2ZPKL 3QI9D 4ANKA 1XB3A 1WBXB 1UVQB 1DLHB 3CHOA 4HT1L 4C55A 4LSUH 2CDEA 3BD4A 2OS7A 4DESA 2VIRA 5ADOH 1CD1A 5E2TH 3WKML 5HI5C 3D39D 1XMWA 4FG2A 2EJ1A 2DIAA 1ZWIA 4PJ9A 5LGJB 3K5RA 2BK8A 3PJSB 2OMZB 4XOEA 2WIIB 3EBAA 1QI3A 4Q89A 2PABA 5GJSH 2VR8A 2N0KA 2LTQC 3QQ9C 1Q0EA 2VT0A 4BYHA 4IYKA 5DR5H 4O02H 4MNQB 3H42L 2YD2A 1VCBC 4EBQH 5JPMC 3FT4A 3TA3C 2LAGB 2O4EA 4LVOC 1AXSA 1DCLA 1S78D 2H0JA 3AUVA 4R4FH 2Y07L 1MCPL 4L23A 4I87A 3ATAA 5B4MC 4X5XA 3BZ5A 6FABH 3FU9A 4S1QL 5HVFB 3ZKNC 4Y7MA 5E5RB 1MCCA 3RTLA 3B4NA 2Z3FA 4NRZA 1YEGH 4IOIA 4DQOL 2NY3B 2EUWA 5C7XL 2BVQA 3AAZB 4UT7L 3WJLA 1BV8A 2BVTA 3ECVA 3VFOB 4ES9A 1AHMA 4LKCB 4WFFD 4RGMB 3CTTA 3JWNG 4L1LA 2AAVA 4PJAA 5KN5B 3DO7B 4GAGH 5GRZA 2BIPA 4DGIH 4GKSA 4AOFA 4UOW1 2FVNA 3GXUB 3QG6A 4PJ5E 2VQ4A 3L08A 2KMWA 5CCKL 3GSOB 1RP9A 4AVJA 5GISL 1P9MC 1MWAA 2X2JA 3LNEA 4NN7C 4ZMQA 4HIXL 1USQA 2GB2A 2EAEA 5DHYA 4G59C 1XH3B 4R3SB 3ISYA 4G7VH 3C60B 3C6LC 3P11L 2BHFA 4ONFL 4BHUI 3U0WH 4K0OA 4Q58C 2Z4QB 3NOIA 5C0CB 3QHZH 5HYQA 5D2NB 3GSQB 1IKFH 1N0LB 1ZLUH 3IXTA 3HLAA 5I26A 3MI6A 5E8PA 4H88L 4LPYA 4YS4A 1T0NA 1U8IA 1ZXKA 2PYEB 3RWJB 4PJBB 4NAQA 5FKPA 4OQTL 3HJ0A 2DTSA 5AAWA 4LLVA 4AEIH 2Y2WA 2C4XA 3V8OA 1YYML 3CVIL 1EEZA 1FC2D 3H9HB 2ZAGA 3WV0A 3SKJH 4NFDA 1WZ1H 4LT7A 2G3MA 3BZDA 5EUKB 1R34A 1WHPA 4KQ3H 4GSQA 4N2KA 2A73A 1UM6L 1FH5L 3AGVA 1BZQK 3FU0A 3B2DC 2HLAB 4IIQB 2EIZA 5M7QA 4F8NA 3DMMD 1SLWA 1AS8A 3NQKA 3F04A 5IM7B 4A55A 5DT1H 3MMEB 1FBIL 5DJ2A 5I6MA 2YA0A 4M7JL 4EEEA 1YPZB 3P69A 1RHFA 3K4AA 4IMLA 3MV8D 4Q6KA 4XX1E 1T7ZA 6CGTA 2VW7A 4OY9A 4E9QA 5EPMA 5BVJA 3DUUB 1WICA 5KOVC 2EDEA 3CVBA 4HXBL 1N7ML 1KZQA 1RZ7L 2Q8BH 3U0TA 5CHNB 4PR5A 4PG9A 4G8FB 3HI6L 3LKRB 3GBML 3S8FB 2CO7A 4L2LA 3BPNB 4EN3A 5DDHA 4G6AC 5KYUA 5EEWA 4E0RA 1BWMA 2OSYA 2FWLB 5FW7A 3MBEB 5BS0D 5C0AE 5CGYC 1L9PA 5GPRA 3HN5A 5FK9B 1RAMA 2KQNA 3KCWA 3GIVB 4BHUA 4LVNC 4WW2A 3B2VL 1LEGA 1OSZA 2R1YB 1TJIH 1RMFL 5CZRA 1SLVA 4WAFA 3MRDA 3ZZQA 1FZMA 5GZOA 1JGIA 4X4XB 4G6ML 4MCMA 2O30A 1WRFA 3NFPA 3P0YL 4XPAH 4X4YB 3PFQA 4MA8L 1Q0XL 1K8IA 1WDAA 3D05A 1DANU 4TVPL 2JMRA 2QKIC 4B53A 1FZOB 3QJHB 4MCYB 1TU2B 1YZZA 4XPGH 4XVSH 5C0JB 4FL4C 4K3EL 5B38B 5FLVA 3HI1B 4X7TB 4XBEH 1KCSH 5IEHA 2NRDA 4LNVA 3MRKB 4PJ9D 4AYFA 2H6PA 32C2A 2ZONA 3PXLA 4C8XA 2J6WA 1KBGL 3H3BC 1HOCA 4MJID 4GSDL 1PEWA 1E7UA 2O5NA 1JWUA 1YN6B 2Q2LA 4CADA 2RFXB 1UJ3A 1BEXA 5K39A 1UCBL 4FJZA 2CM6A 2OCJA 3N3EA 4HZLB 1AQDB 4FYQA 4JFHE 5DMIH 5E95B 2ERJB 2Y7MA 4PEEA 4HOMA 1BZDA 3IJHB 2HTKD 1KG0A 1Z9SB 4GG6E 3VXPA 3BZFB 4Y4FA 2QVFB 1H5BC 4PRAA 3D69B 5KAQF 3IMBA 5TQ0H 3MRBB 4HKBA 2OW6A 5IHUL 1X6NA 2CUIA 2CCLA 2I7OA 3KPRB 4MQSB 2XWTA 3RNQA 1TNMA 2NX5A 1UOLA 2J55A 1S78C 4NC2B 2VM3A 1ZDSA 4HXAL 3U1SH 4NQXB 2O6EA 1WS7A 3UP1A 1FYHB 3JQOB 1MNNA 2IBGA 3BKJH 1UZ6E 4FQPA 3D85A 3BXNA 3GDCA 2XXFA 4ZD3H 1EZSA 5CEXA 2C3GA 1G7HB 4NC1C 4OFIA 1A6PA 4S2SA 2WZ0A 3UG5A 3U30B 1E8YA 2GAZB 1KV7A 5SWQA 1LXMA 3QZLA 4X6FA 3F58H 5DZVA 5LQBH 4Y16B 2PTVA 2JF1A 4F1SA 3WFDL 1NJ9B 3VWJB 3TONA 3P77B 2YQBA 4FF9A 3VFWA 3GMNB 4ZO7A 4AGMA 3Q48A 2LR4A 1ZSDB 1NL0H 5DJYB 3SY0B 1OAJA 2WKOA 35C8H 2FLMA 4FFVD 1ID2A 3CFMA 1ILUA 1AY1L 4GQZA 4QCIA 1RPKA 4I3RH 1BYOA 4MSWB 4MQ7A 3VDAA 4KTDL 3UP6A 5DYOB 5HHQA 1M57B 3EF4A 1ZE3C 2AEPL 2G2NA 2KLRA 4KI5D 2PCYA 2NYZA 3BPOC 1NKOA 1NBYB 5DK2B 2DM2A 3AABA 3TURA 3AM8A 4QEGA 5B39G 3FQWB 3AQXA 1VENA 3TNNB 4PRPD 1JUFA 3IETB 1V7ML 3JTTB 5DZPA 2LHAA 3MA9L 3FO2B 3JT2A 1LO3H 2MH4A 4M6NH 3ZW3A 3AFLA 2H2SD 3RPIB 5J13C 4IIZA 5DA0B 1AIFA 2NCMA 4GXFA 5IESL 5M94B 2XACC 2JFCA 1CDUA 3DSNB 4OJCA 1NTDA 1KC5H 1RP8A 2OBGA 1DBKH 5J5EA 4JO3H 3MGAA 4PGCA 2DQCH 3MA7A 4IS6B 4Z18A 4WHYH 1D5IL 2JB6A 1M71B 1N68A 1BG9A 4A66A 1KBBA 3DMMC 3RTQA 4L3CA 2CBMA 3ARGA 3P0VL 1WT5C 4Z3FA 4EN3D 1I1FB 1MNUH 3N06B 1IGMH 4H8WL 5CJXC 4BELD 4Z8FL 5D7LA 3TWCL 5F9JB 5SWSA 5IBLD 1G9EA 2ZSWA 5E1AB 5E99H 3KEDA 1PG7L 3DX0A 1NIFA 5ESQA 4AQAB 1KBVA 2Y3AA 5F9WC 4ZDHA 2HX9A 2G9HA 2VDML 4EUPA 1UT1A 3EHBD 2E56A 2OFQA 4RDBA 3VD1A 1O9VA 4AM0Q 2AJXL 4O2FB 5GZOD 3V52L 5FDYA 4XPTL 2RCSH 4G6FD 4V1DA 4AVHA 1SHXA 4XP6H 5HDQL 1MCIA 2LTQB 2X0VA 2XWCA 1ZVSB 5EZIL 2IQ9L 3GLDA 1D5RA 4M7KL 5HDLA 5JPMB 1XF5B 4N2HA 3EH5B 3LQZA 1UEYA 1CGYA 1LJMA 4UV7L 1E9OA 4WUKL 3B9KA 3EYOA 3MVSA 4TRPH 2D7TH 5GGVY 1J8SA 4PH8A 3QIUA 3WS3A 1BVKA 4M1DH 4Z7VF 4IKJA 2XSKA 4AIZA 3MUGB 5GGRY 4OD1L 4BKSC 5EIVA 4H40A 5ESAA 2ADFL 3IFNH 4JKWA 4N1CA 1XF3B 1NGWA 2UX6A 4PJXF 3IFOB 3ZUNC 3D3VE 3PWPB 4HC1A 1ZGLM 2VSMB 2IDFA 5BZXA 3ZE0F 2XY1A 4YDLC 3ABLB 5KSVA 4NFCA 5LLIC 5AZEH 4D9QE 1W9XA 5TF1H 1S5IL 5BO1H 2Y5TB 4N2AA 5IB5B 1B2WL 3FOMB 5ICYA 1JHTA 1UASA 4PJ9C 4N4YB 3UBHA 3QGVA 4ZUWA 1JK8A 4N8VA 4NO2A 1V54B 3LH8A 4Y4FD 1JN6A 4FZEH 4NN7B 1HL4A 1EHXA 1B88A 1FAKT 3IS1X 1DFBL 4XRCB 3M88A 4DW2H 4TNWK 1AC6A 2NX5D 4DHLA 3V4VH 4NHCL 3C2AH 5I1JH 3C6LB 2X0UA 4Y89A 2GG1A 2HTKC 1HZHH 1C8QA 4M6ML 2VB5A 5HHME 4MXQD 3HZKA 3D85D 4P23A 1EAOA 1U8OB 1EHLL 2B2XH 5TDNA 2NNRA 4Q0XL 2G60L 2DKSA 3G04B 1OAYL 1UM4L 5HGBB 1WVZA 2HB0A 3B7UX 4M5YL 4LP8A 5FYKL 1O7DC 1Q0YH 3C9NB 4U3CA 1GY1A 3PF2A 4IJ3C 3CFDA 4H25B 5FGCB 4NQCB 2AEIT 2YPVH 3MJ9L 4WWNA 5DZLA 1DFXA 4OZIB 3C87A 1CF8H 5DGRA 5EZLB 3QNYA 1E5YA 4IKIA 4ZT1A 1AMYA 1XBDA 1F18A 3AW5A 1A7QL 4A7QA 3PAUA 3TCTA 2XFXA 4HIEA 1FO0A 2E75C 2R2EA 1ZT1B 5ID1A 4F5CA 4JFVA 1YEFL 4YDVB 5EFIA 1HAUA 3AREA 3PREA 5CLZA 1C9SA 1ZTXL 1S2EA 1XGPB 3ZT6A 3SYOA 2A6DA 4WWOA 3OJ2C 3BQUA 3CDYA 2CLRA 3OXRB 4UQBA 1THAA 1NZRA 3GRWH 3HLKA 4MB3A 4RWYH 4KU1A 2DM3A 3SE8L 3QJRB 3GINA 2UXVA 1DBJL 1VESA 2G2RA 4HUNB 1MHCB 4X8GA 5T33H 1MEXL 2Z91A 3LRLA 4XXWA 4FA7B 4C56A 5AAWC 3JYBA 2AS5M 5HY9B 1X7QA 1G9MC 2IPUK 1L3NA 3MRLA 4JDEB 3LZOA 4AWJC 5I1IL 1Q94A 1MI5E 4JO4L 1BOGA 2BXYA 3EDDA 1DBBL 4LVNB 1XCQB 2WIMA 1H8OA 4BFRA 5JR1H 2RA1A 3HC3H 4D8PB 2X4UA 3MJ8A 1NPNA 4L05A 5I1DB 1TVHB 2WGXA 1TKWA 1WAAA 2X53A 3DTXA 3GSNA 4WK4B 3RTQD 3ARGD 4JFFA 3VXSA 1ZGLA 3QT2A 3MNVB 5CCJA 4XVOA 3QUKA 5ICZA 1G7PA 2LQRA 4QRAA 2BWQA 2Q9OA 4MD5B 5D7LD 2YUVA 5SWSD 4DEUA 3T1WA 5ES4B 4NERA 1BOYA 1REIA 4Y5XA 2W95A 3L5XH 5ACLA 3WTXA 3DUSA 1AI1H 5MENE 1MWAH 3QA3B 4IRSB 1U93B 4FL4B 4GO6B 2DWXA 3G6DH 1NFIB 4MCNA 3U7AA 1LL1A 4EN3C 4F57H 5I71C 4J6IA 5CR8A 4RFEB 4ISVB 2NW3A 1S7QB 3UBXI 3QJFB 4G71B 5IBLC 4V1DD 1G7IA 4K7FA 3CDGA 4PB0L 5FYKU 1MVUA 4WW2C 4RA0C 1Y6KR 3D48R 3T71A 1MFCH 4KPHH 5HYSG 4GMTL 8PAZA 1JNLL 3LQMA 4KZEH 5IW6B 5I30H 3Q5TA 4YJZL 1X5FA 3D50A 3D25A 5IR1B 3JWOH 1KIQB 1L0YA 2VXQL 4WK2B 3V4PL 3ZQWA 4N0RA 4BQCA 1B0IA 5EUOF 5F71A 1WFNA 3HUJB 3DXAA 4NM4H 1N2RA 2JQMA 1H5BB 5KBNC 3SY6A 3QIUD 3LNDA 3VDCA 2VQ1B 3HBGA 3GZOA 4DEPC 2XHNA 4WF7A 2I9TA 1SYSA 2MNUA 2VLRE 2YEZA 2K45A 1TF4A 1PGRB 1YUHA 5KVMC 3DX7B 1SMAA 3LSOB 3QUZA 3T2PA 3KNBA 4JFYA 1NKGA 3QBTB 1OAZL 4YHMH 2R69H 25C8H 3IGAB 2FSDA 1CUOA 1A4BA 2V5RA 4ODBD 4OFYA 4HKZA 5F0PB 1DQQB 1NCJA 3PIQB 3M46A 4Z3JA 1WFTA 2EIEA 3EYVA 1P5VB 1MXGA 1UA3A 2JELL 5GGTL 3F7LA 4JANA 2QL1A 5BV7L 4KKPA 1HNFA 2C5DC 2DQDH 4HU2A 4CN6A 3WTSA 2B1OA 1RK0A 3U2SB 1W0WB 1X4XA 1ESOA 4AGQA 2V17H 4FFYH 4XPBH 4PRPE 4P23D 2B39A 1PKQB 1DUYA 1HE8A 3GGWA 2J5LB 3K6IA 5DJXA 5E51A 5TPWH 3UBXA 4Z77B 3T77B 1TVBA 5D1QE 4M7LH 2XDHA 5DFWH 5KS9A 3WO3B 4HMCA 3QCTH 4Q9RL 2EZ0D 5BZZA 5HPMB 4AKPA 2AV7A 5E1QA 3AZUA 4PS7A 5JLZA 1RJZB 1EGJA 2X4TB 5DYFA 1ZHBA 4QHPA 4ZYKA 5IT2H 1A1OB 3QDGB 4MXQC 4DWHA 1BEYL 3HPJA 5HSFA 1KFAL 4YSRA 5B39B 3AY4A 2J57A 1RZ8B 4R97C 3D2UA 4FABH 2B59B 1FV1A 2VAAB 1PG7X 2VDOL 4QHLB 4CKVX 2XQYA 2XRAL 4NPYA 4OF3A 5IJVB 5T3XL 3BIAX 2AXHA 2GYSA 5J13B 1IGTA 1JP5A 3LH9A 2J8UF 5A2KH 5LAPA 3S34L 1QR1B 1FFTB 3WNMA 4QXTA 5IMOB 3ARED 4PJGB 3COOA 4POZD 5DJCA 1UA6L 1A9BB 3KBEA 3QO0B 4ELMB 5E8OA 3BP4A 3RWEA 5FYLD 3GLAA 2C3XA 5IFAL 2BW5A 4ODXB 4ZMAT 4KRNA 3RDJA 4KK8D 4M5ZH 2C9SA 4WRLA 2QLYA 3BQUD 3DMMB 5IK3A 3U1PA 1NGYB 3FU8A 4JRYE 4JRWA 2XWXA 5FM8A 5IFHH 4HGWA 3THMH 3CFKB 4XODA 2JK5B 3HC2A 2NDGA 3I9GL 4MJ6B 5L2KB 1DN2A 4C56D 2QR0B 1NBZB 1TITA 1O75A 1DANT 3DIFA 3KM2A 4U4IA 4KK9D 5DK0B 3AM8C 1I9JH 3HN3A 4I77L 4FQIH 5F9WB 3D6GA 3LNFA 2JJTA 4OF7A 3QEHB 2F53A 1LMIA 3IMWA 2QKSA 3QWNA 3ULUD 5I19L 4DP2X 2CRMA 1UKQA 5BS0B 1VFAA 3N40P 2B1HH 3G6AA 2VDPH 3GTNA 4JFFD 3VXSD 5D2LF 2VL5B 2N3JA 4X5WB 1MDTA 4K7PY 2XIBA 3ESVF 3SE9H 1QBBA 5SX4I 2H45A 1HWWA 4HX1B 3H7LA 1TQBB 3V0WH 5F9OH 2I5YL 3UZQB 5DEGB 5KUKA 2BX5A 2ZOLA 4Y1AA 5JHLL 2F1AA 3KYOA 3AWFA 2JIXA 2QELA 3AC0A 4E9YA 1I85A 3O81A 1CQKA 4H0GA 3RTQC 2WUBL 5DD3H 3SDYL 3ARGC 5FCSH 3F7YA 1O6TA 1EV2E 2KI6A 2OX5A 4Y9FA 3UADA 2WUCL 4XNAA 1TG8A 3KE0A 4TTGA 3NH7L 4I88A 1DQDL 4YSPA 4W6WB 2VDLB 1F4HA 5HJDA 2VDNH 2OYPA 1YNKL 2HFTA 4YHOH 2IALA 3CPLA 1AO7B 2BCMA 4RZCA 3L95A 1M6UA 1N6QH 3OV6A 4LLQA 2CDEB 1E4HA 4M8RA 4YHKL 4W4OA 4R2GD 5FUZL 4UQAA 1TQWA 3RVXD 1ZWIB 3PDDA 3NDYE 4XCFL 2E27L 4PBXA 2OXGA 5F8RC 3V0IA 1JF6A 3DXAD 4O9HL 3LRKA 4IHBA 4J2XA 4M61A 4NJAH 4KZDL 2NY4D 3PHSA 1F4WH 4TLTA 5CU5A 3PJLA 4LP5A 4U1GC 1P69B 3A3YB 2VJ8A 1OK8A 2VLJB 2DV6A 4KMTH 3X13B 1TJHL 3QUZD 4ERSH 4KGJA 5HHVL 3B9KC 2OSXA 5L8JB 3EGDA 3FCUB 4PB9L 4XVTL 1E4XI 5JO5B 4QGTA 3IPFA 1OOAA 4KUCD 3QIUC 4NXSA 3UX9B 3SGEI 4JHAL 1F3JB 4OFYD 5IJBC 2VUYA 4AY0A 4R6UA 2BJMH 2WTRA 2AK4A 1TTBA 1KJMB 1JHKH 2BS8A 3NIDB 4XMLH 4UT6A 1E9PB 3FTZA 5AVVB 2MHAB 3I6LD 3U4EA 1RUQH 4B9YA 1D6VL 2VUOA 1HZLA 4E9WA 3H3KA 2NT1A 4LEOA 3VW3L 4UM8A 1BVLA 2YD6A 3EYSH 3QG6B 3A4EA 3OAWA 4XPFL 3G5ZB 4J3UA 2WBKA 2FX7L 1UWGH 3H1ZA 1LTXA 3HVNA 2PXYC 3T6QC 3F3HA 2KZWA 4HGKC 2I27N 1FNSH 2CRIA 4AITA 3VTAA 3ECUA 4N90E 3KPPA 4EUPH 2H9GA 1JG9A 4KKNA 1NCIA 2HFGL 3FTSA 5DQDH 4PJCB 1HEJC 4KTEL 2CXKA 2LFEA 3JTSB 4F7KA 3GXNA 3QPXL 4QRFA 4JE4B 1B4RA 1QG3A 5A2IH 4O4YL 5BOJA 2B4CC 2GUOA 2DY2A 3QULA 4P23C 1HSAB 3HLAB 3IXTB 5HDWA 5TFSL 2H2PD 3D2UD 1WISA 1GYCA 3R4DA 4EZJA 1YQVH 3BWSA 2TAAA 4K73A 2G9KA 4UDTA 2EZ0C 4MWFB 1IVLA 4PMFA 4TLKA 3F64A 3R1GL 4LGPB 4F7EA 2OMUB 5H8DA 4AEEA 3BMWA 2R29A 1ZLVH 1TLKA 3EGSB 3LXBA 4IK7A 2ZXQA 4JKPH 4PJ6A 2BNQA 4XNBA 3TL5A 3L8QA 3QUXB 3I84A 2F54A 1NANH 3TF4A 1KYOK 3CX5J 4H2AA 5IIEA 5L4FA 4TQIA 3WSQH 5IHZB 3M45A 4BKLA 1INQA 1QRKA 1NCBL 2X88A 1DLFL 3L7FA 4TNVK 1G9NL 1QUNA 3ZPDA 4FQCL 2FNBA 1LEKB 4NHUB 2W0PA 1E5CA 4DH2A 1ZS8B 1YC8A 2JB5L 1MPAH 4MJJA 4K5MA 4POZC 5D1XE 1GJIA 2V6HA 4F91B 3RJOA 3AG1B 3J07A 4P0DA 4KK8C 3A23A 3BWZA 1PZ5B 3BKYH 4R5TA 3BQUC 4HIIA 4PG9B 4TF4A 5D5MA 3GO1L 2F53D 3D0LA 3QRGH 3E8UL 4YDNA 1MCDA 4I2XA 4HUVA 4U7KA 1Q9OA 5DDHB 5I71B 5KYUB 4OGYL 2X1QA 5D96B 2Y1YA 4XXWC 5F1NB 4AGPA 4FXLA 3DO4A 2AVGA 1S7SB 4KK9C 4E2OA 1BM3L 3HE7C 2VM4A 3UTSA 2DM7A 2OYLA 1FGVL 3EG9A 4WW2B 1JIBA 3DI3B 3NCYP 5EZPA 4FD0A 4PJBF 1JZIA 3T5WA 4RGNE 2EDJA 3HI5L 4I0PB 4Y1AD 4LBEA 2Z1KA 4CAGA 2JIXD 3IT8D 2OMXA 1JNHA 3BYTA 4ABVA 1F56A 1F41A 3O3EB 4X6EA 3KYAA 1CGSH 4NWTL 2JI2A 2IAAC 3K6OA 2J8HA 3AQZA 1CXFA 2EDHA 4A7TA 1HH9B 1XV8A 4M43H 1V5JA 1PU0A 3NJGA 4Y5XC 2AEOA 2BSBA 2HKHL 3L1EA 4LHQB 4DPBX 5CEZL 2OQJA 5DD6B 1KNOA 4M00A 4GUPA 1D9KB 1BBJA 2VZSA 4PGDA 5EBGA 1Y0LB 1EFQA 5IEHB 1NMCB 4HW6A 4MNGB 3CLEH 1PY9A 1P4BH 4W1TA 4WUUB 3NP3A 1IL1A 32C2B 3JV4B 1ZA6A 2DYPA 3F7VB 5EHFA 5KVEL 3BP5A 1ETA1 3ZHDA 2PW2A 2K8MA 1A6VH 3ULAB 2IH1A 4NPJA 4RIRA 1B0GA 5CZXD 2IWFA 1A7NL 1JNNL 2LW3A 2X9ZA 2Z8RA 4R2GC 2VR7A 4PP1D 5J11C 3QUYB 2AKRA 4QHNB 3EUDA 1FHNA 3RVXC 5DEFA 5DC4B 5FF6B 3W9EA 3O4OC 3MRJB 5H35B 2PWDA 4OCXL 3FB7A 3Q8CA 3QIWA 3UC0H 5LCVA 1A4CA 1U92A 4GINA 4GPVA 1BFSA 5EA0H 2CXGA 2K0RA 4JHZA 4RFOH 5I5RA 2APTA 4XMVA 3ULUH 3RNQB 4WEBH 1KDIA 1L7TL 2AK4D 5ICXB 4ABUA 1YSOA 4JQIA 3QUZC 2XQBH 4NCDA 4NDMA 3ULVD 3BXNB 1AGFA 1U8CA 2XT1B 2BHZA 2EDXA 4ZTPH 5PCYA 2WXKA 1NCAL 1UYWL 4OLWL 4R97B 3RLSA 5FECA 4WHCA 3IJSB 4OCNC 4HUXB 3K6FA 4S2SB 2PTTA 2FX8L 2QDWA 3C6EA 3DUHA 5GJTL 2CPCA 1RZJC 5F70A 4GRLA 3QZWA 1ACXA 3GPEA 3LIZA 1PBYA 2YQGA 4FAAB 2I9LA 2F58L 1I8LC 4JREB 3MX0B 4E5XG 4IRJA 3T0EA 3DIVA 2E4FA 4DTGH 2RR3A 4G5ZL 4OGXH 5E24E 2WSKA 2ADGB 3KPQB 4CDHA 1P6WA 4HA1A 4LHUG 1AP2B 1LEIB 2VC2L 4S0TD 4XN1A 5E1IA 5J8OA 1WWBX 1AHWA 3BDYH 3N85H 2AJ3A 4UZSA 3OLIA 1P5UA 3TBVB 2UXTA 3NSXA 4IEFA 2BY1A 1GW6A 4R4BB 2BNQD 1XZ0B 2ZYHA 4JM0A 5DUBB 2G4GA 3AY4C 2H2PC 2F54D 3UERA 4Z7OE 5CINH 3NZHH 2CGYA 5CD5D 1SVZA 5FW8A 2H8PA 5B1KA 4AVIA 3X14A 1AIFB 3V5HA 1NBCA 1DVFB 4JFOB 3UOAB 4FQ1H 4YC2C 1AQKL 1PCXA 2P44B 5ESVA 2DB8A 4OUUA 4A6YL 2J5WA 3WMPA 4J6RL 4PGCB 4ZW6A 4JG0H 4HF5H 4G8EB 1OQXA 3FOLA 4L8SB 4UT9A 1XGRB 1NCCH 3IDMA 5C08A 4YXHH 1DEEA 2ADIA 2FEEL 3RTQB 1QO3A 5K33A 1KENH 4PHXA 4X9BA 1D7BA 3GSWA 4YE4L 3MODH 4JFZL 1N3NA 1QFWL 2MMXA 3LHPH 3NRFA 4J39A 5JW3L 4YIQA 4N20A 4XI5C 5JQHC 2ZSWB 1QRNB 4N2IA 1IC1A 3DA0A 3UTSD 1TETL 5J57B 1TZHA 4JR9H 3N9GH 1OSEA 2K7PA 3B2XA 3WIFA 1HOEA 1TT6A 2F7OA 3HG0A 4G7QB 5E5LA 4YZFF 3T6WA 3CE1A 3QJXA 1AYRA 1TQSA 2BSCA 4WSJA 4OLVH 5IB1B 3X3GL 3O0LA 3GI9L 1SVBA 2ITCB 4DGVL 1RVFH 2OI9C 1DVQA 1E27B 1EDHA 4NXKA 4J3VA 4FA6A 5A2BA 1PD0A 3NFSH 4K94H 5EORH 3B37A 4J27A 5ISZA 4GIPD 4U1GB 4YSTA 5JOPD 2ZG3A 2IDQA 4ODHH 2YMOA 3OSVA 1F4XL 4OZGE 3BH4A 1I85C 1R5IA 3K46A 2YLKA 3MLVL 3Q2LA 1QX1A 4GEJA 4GS7C 4YHPA 3B9KB 3S8WA 3T4YA 1AZZC 3WLBB 5FYJD 1XF1A 1SJEA 5FV1L 3WIIL 3QIUB 1U3JA 3WS3B 1BVKB 2OR9H 3BPCB 2AJUL 3C09C 1KTRL 3BGFC 5ESAB 4FMFA 3VXUA 2DYPD 3DX2A 2R0WL 5TE6H 1F4YL 1NGWB 1WFJA 1DBML 3MNZA 3ZT5A 2VLKA 1VF5C 2Q5BA 3C6SA 4QRPA 5KSVB 4HSCX 3K80A 1ED3A 1FF5A 2XN1A 3B6SB 4W4OC 3OTTA 4KO5A 5FOJA 4XP4L 2HUEA 5SWZB 5ICYB 1JHTB 1XBRA 4BBWA 1FORH 2XN0A 2PXYB 1RULH 4XX5A 1BMZA 3T8MA 4OFDA 1TJGH 2YAEA 5BZDA 15C8H 1I3UA 4XO4A 1C12B 3IFPB 2Y24A 3LEXA 4FG4A 3S0PA 1OP5H 5ALCL 4PP1C 4F8OA 4PJDA 4OTXH 2DEWX 4DPCX 4W68A 2FB4H 3N0PB 4Y5YA 3HJEA 2G30A 3TNMA 3HZKB 4XP9H 4F7MB 3TVMB 3WKNA 4I1RA 1JI1A 3TV3H 4NUMA 2W92A 4XB8A 4HVBA 2A9ML 5ERWA 1GGCH 3QSKB 3UPRB 4M1GL 3T0AA 5I17B 2NY2B 1XGUA 5I6KA 5KZCB 5FUCC 3CFNA 2OMWA 3LHAA 4LASL 2ZXGA 4NZRH 3W9EB 5KBDA 2W0KA 1ZLSH 1HILB 2YGOA 4JPWL 3SDAA 4ZFOL 4K8RL 5JHDA 4B97A 4WGVB 4GRLD 1MRDL 3Q6FB 1FLRH 1JXDA 2DL2A 2WOYA 2XZAL 1J1XL 4DEWA 2VLLA 4IRJD 3T0ED 5C0GB 4EOWH 1QQDA 2ZKMX 3L1OL 3LEYH 1P84K 2YXWA 3KHOA 1N5AA 3BT0A 5L6YH 2IADB 3QDMA 4M4RB 5DA4A 3TZVA 3X1FA 5EFIB 5I8CB 5AKRA 2YZ1A 1XDTT 2R23B 4HV8A 5CILL 5FS5A 3FRPA 3V0HA 3ZDZB 3OM3B 4PJIB 2DTML 1AD9A 3GK8L 4X6DA 1KEMH 5AWNL 3MLUH 5FA4B 2X89A 2VDKL 43CAA 2A6DB 1JS4A 4NUGL 4PN6A 4U1KB 2XXCB 4NM8H 4YH6A 1OGSA 5C09B 3SSGA 1EZVY 2J56A 4AW4A 4TNGA 4DOHE 1AR2A 1GJWA 4A7GF 3CVHL 1JPSL 2G2RB 3FH7A 5FW6A 2J72A 3FT1A 4FLRA 3VI4E 1HCZA 4JQXA 4J3WA 3KXFE 4PSRA 3VQ2C 4ZTOH 2Q87A 4IBZA 4DERA 1X7QB 3KDMB 4NNPL 5J6GB 4U6HB 3MRLB 4N0YL 4FNPA 2ZXDA 3HE7B 1RQ5A 4FI6A 4NKOB 1ZJAA 3MBXL 1FN4A 1W72A 2QT6A 2BOCB 1B90A 3JTBA 4PJEB 5HJ3B 1QFHA 1P6AB 2Z9TA 2X4UB 3S9DB 4ZX4A 5CD5C 4UCFA 4H13C 3BVNB 3AWEA 1P1ZA 4FTVA 4XCCL 3KLDA 3TO4B 5CLWA 1BAWA 1WD9A 5C08D 1E4KA 3K1KC 2KDYA 2KT6A 4OBRA 4JFFB 3VXSB 3WFZA 4EI0A 5LXVA 3IEAA 4MCZA 4HOWA 3OJDA 3ULVH 3HZ3A 3HNVL 2ATAA 3N5AA 3U9WA 5DLLA 4F3FB 4JY4B 3TYGH 3D39E 4XBMA 2R0KH 1E2ZA 2UYLB 5DR5L 4P2CG 4RMQA 3QC5X 4XNYL 1SMOA 2GJ6E 3DGCR 4YFLF 1ZT7A 1GAFH 3SHSA 3ZE2B 5I1AB 3EJRA 4ZFGH 4AE0A 3CSTA 4AM0B 3VI3E 4EAEA 4RCAA 3EYQD 5I18H 1ICTA 1CDJA 3SGDI 4J8RA 4XXDA 2AJVL 2AF2A 1FZKA 3ZZLA 3QJVB 2IANB 5A2LH 2NQ3A 3CDGB 3BWAA 4YGAB 1YNLL 5LVEA 2DLEA 3L81A 1I31A 3OG6B 1M2OA 3CBJB 2XKNB 1NAML 1UT9A 3I6GB 1JK9B 2FYVA 1G7MB 5J11B 1T6WA 3PQYA 4PS8A 4NC1E 1T6BX 2O61B 2VDRH 1Q9WB 3T1FA 2VM9A 1S4IA 3O4OB 2EKSB 2JKTM 3DXAB 2CHXA 2R29H 5IOKA 4WFFE 3GB7A 4QYOB 1KJ2H 2H3XC 2ZP0T 1AG6A 1RZIA 1CR9H 1E7VA 1MCFA 1SYSB 2VGLM 2I9TB 3BVDB 3DOSA 3MLSH 3VXUD 3VA2C 3U2JA 4HEPG 2V2WA 1YUHB 3FB6A 1AQMA 3O11A 1QLFA 2YAQA 3QUZB 2VLKD 3GXIA 2ZX5A 4GI6A 1K9TA 4QRPD 1N9PA 1IC4L 4IKLA 3QXUA 3NJKA 1IQDA 3A6OA 2FGZA 1A7OH 3U0WL 4HQQH 4L1DA 2BO0A 4HKZB 3QHZL 4L2YA 4R7DA 5GIRB 3VJ6A 1IKFL 1QFOA 4IQHA 1Y18A 1CGWA 1KCVL 3IDNB 1TMQA 3GNML 3QWRA 3SN6N 4ZMPA 2NY0D 4X4ME 1UHVA 3DVNA 4G8GA 2XBZA 4L1HA 3L45A 5F7KC 4KKAC 5EF2A 1OM9A 5EO0B 5AEAA 3FUKA 3FB5A 1W0VA 4DP1X 4WNQB 1TPXC 3ZDXB 1BP3B 5FO7A 2ZAHA 5J6HB 4E5XB 3QHFH 3QIWC 1DUYB 3GGWB 2WYZA 5DJXB 2NSQA 1HHHB 2YC1B 5I15L 2GITA 1IBGH 3QDJB 5GGSA 2X3BA 4QRRA 4NO0A 2GIMA 2NY6D 1DVXA 1QA9B 2AK1H 2LV4A 1NLDH 3JWNH 4LHUB 4LSQH 3MN8A 4KMLB 4OZFA 3V4UH 3FC8A 3HUJF 1OE1A 3NCXA 2AV7B 2DQJH 3B3IA 3SDAD 5FDWA 3EO1A 4GKZA 4S1RH 4ZYKB 5JHDD 1KPRA 4DIXA 2C9XA 4LCUA 3OZLA 5E7BA 3VM7A 5F7LB 3D2UB 3ROOA 3PL6B 2BIQA 1RPQA 3IFLL 3SYPA 3OAUH 1RURL 5D71H 1HTYA 2Q8BL 3MV8E 3VNZA 1T5KA 3AB0B 4PTUA 5AW8B 3ZKQD 1IGTB 3IDJA 2OMVB 3MR9A 1BQSA 3TZVD 3QDMD 4X6CA 4B9FA 4Q97A 4GRLC 4PRIA 3IE9A 3QEQB 4NI3A 5D93C 1DDHA 2A6KB 3K74B 5DJCB 3LDBC 1FVDA 3ARVA 5E8OB 3W2DH 3VD2A 4IRJC 1XGTB 3FSZA 3EJQA 5FGRA 4ETQB 2X89D 3LPGA 2P45B 4U1MB 1DQMH 5L2JB 3OKNB 3T65A 4YDKH 5CSBA 5IK3B 1TJIL 2EADA 3BOVA 5BUGA 4YQXH 4UB0L 1OOWA 1FNGB 2Z31B 3SD2A 4HGWB 5GGUA 4F2MB 1AHWC 4FQ2H 4M6OH 4MGXA 5I73C 1IQWH 4XNQA 4ZQKA 4WU5A 1OAXL 3O3UN 1P5UC 1IGIH 4AGOA 4WQOA 1QI5A 4H26B 4LESA 5GS2H 1D7CA 1KZYA 2ZNWA 2H26B 1XR9A 3QDAA 2FQGA 3EOAA 1TFHA 2CR3A 2HLEB 5MEPA 5J1AB 5DSCA 4XMXA 4MA3B 3B56A 5DJZA 4XPGL 3BH9A 5J1TC 2J88H 4FTVD 1HQRB 4JG1L 2DMBA 4O51A 5CJQL 2H0EA 4WFHD 4M3HA 1VFAB 3ZTCC 1E6OH 3G6AB 3ZKSD 4KDTA 1F4AA 4XBEL 1KGJA 3D52A 2R15A 3OX8B 1GC1C 4TS6A 5DLMH 5DS8B 1E28A 3BP6A 4X98B 5JHAA 5DJ8A 4LCYA 3NAAL 3WY2A 4Y1AB 5KVGH 1ETJA 5E94A 4JJOA 4GS7B 1RZQA 1U8MA 4PJGF 4DUVA 4Y1TA 4AL8C 4UU9B 4MJIE 4ZMVA 4ELMF 2RALA 1X5HA 4GW4A 1EX0A 1Z0MA 4G9DA 2BHYA 3RBGA 1NICA 4B60A 5TQ0L 4GUCA 2Q8AL 3EOBB 1S6NA 3FTXA 4CGUB 1BZ8A 2CK2A 3ARBB 3BIBX 1EDQA 4L5FH 3MV01 2HKFH 4ZNEA 3A4AA 1JNJA 3INUL 3PQYD 3EYQC 5FCUH 3BKJL 4YBQD 5F1KC 1WCQA 2CNYA 3VXRA 1JDCA 3PNWB 1ZSHA 4BFGA 3U25A 3M17A 3VFNB 2KHAA 1SUHA 3HMXA 4TYUA 1OTSD 4U1HB 5ENWA 4PJAE 5G5DB 4PY8J 3F58L 4G83A 2JSFA 2OK0H 2AMUA 3WNIA 1FJ1A 4L9LB 1QLRA 4P5KB 5JW5A 3EGDB 2WMPB 4PWFA 4P57B 2F8IA 1ITBB 1J5HA 3MRMB 2FR4A 2W80C 1AXIB 5C6PB 1RZPA 2NTSP 4JRXB 35C8L 1HI6B 3CLWA 5EV7A 5EU5A 1XO8A 4MXVF 1NOFA 4L29A 1F2XK 5DF0A 2EILB 2AK4B 3QWRD 1ZLUK 2BXZA 3MOAL 1X44A 3WDJA 2WBXA 4G8GD 3TBWA 3U4EB 5L7XL 4QOKB 3MOBH 2ED6A 4O2EA 3EYFA 4X2UA 1KTDA 3QK0A 4UM8B 5T1DH 1BVLB 1GJUA 2JJUA 3KPNA 3EH4B 4IBSA 2B3IA 3LN4B 3TTSA 2FO1A 5F7HA 4OQTA 4YO0A 4KI5E 3SDXA 3E6FA 4PHZA 1H3PL 1HT6A 4X8JA 4RMWA 3RG1C 1DTUA 1EZLA 1XL4A 2UY6A 4Q14A 3KLAB 2NY0C 2ZICA 1M9WA 3FF7A 2C1OA 2VABB 4DZBA 4QRRD 2H9GB 4NO0D 3V6OA 2X70B 2ICEA 3MRNA 1WEJL 4NZTH 3CWGA 5KVFH 1C8PA 2ZCZA 1HYRC 1EMTL 1ERNA 1J5DA 1R4XA 3UMNA 2GUOB 5LDUA 4BKTC 3IMRA 2PCPB 2VXVL 4QXWA 2QADD 2FHBA 1VADA 2A4ZA 2XV0A 3PHQA 4LPTA 5CAYB 3MLZH 2NY6C 1DO6A 1DJYA 4Q74A 3ESUF 1IE5A 3IGLA 2NY1D 5H4YA 5LXGH 5LG6A 4F7EB 1P4IH 4TSBH 3J7HA 3SDAC 5KJRL 1FP5A 1WIPA 1JCVA 1IGML 4GSUA 5KSBB 4CSZA 2VDOB 4JFPB 4PRID 2BNQB 3KW8A 4M8VA 3GXFA 3L3OA 3NBNA 1KPVA 1XSOA 5AW4B 3LKOA 3NIDF 4ZPVA 2GK0A 3PWLA 4KRPD 2RAMA 4BKLB 4PJAF 1N5YL 2YMXH 3A6CH 3VH8A 2CH8A 2OMNA 4NWUL 5A1AA 3S4SA 4I3SH 1QUNB 2XNAA 3TZVC 1G6VK 2EDKA 2F74A 3DTDA 1BBDH 2RCSL 1QHQA 4PRNA 1LVEA 4BSWA 3IE4A 4YX2L 2XN9E 2BW4A 2N7SA 5JW4Q 2DQGH 4IGBA 2EDMA 2LE9A 1I75A 1FNHA 2K6ZA 4F15C 4NC0B 5D5MB 1JV2B 1KGCD 3B9EA 1XT5A 3GSRB 4P05A 3A4DA 1GIGL 1RJYA 2A74A 1USZA 4N28A 4XPHH 4WU7B 1B4JH 3MYZA 2DQEL 3HCVA 4HUVB 5HYJA 3O3DB 4P9HC 4RRPM 2ZYIA 4JQXC 3L4XA 4TRPL 4Y5VA 4WI9A 5F7BA 3WIHH 4Y19B 2WD0A 3PWVA 3ARDA 4M1DL 1HJBC 3FSOA 3KWWA 4BDVA 2AZUA 1WD8A 4PJ7B 5KW9H 3RFZA 2BWIA 5EDXA 4MASA 3IKCA 1HL5A 3KWVA 2Z7WA 1JRHI 3G9VA 1SFHA 4FXGA 1IAKB 2PNDA 3TJEH 1F0LA 2E9GA 1BF5A 1JNHB 1TR7A 3LD8C 3MUY1 4UIKL 2GHWB 1KTBA 4OAWB 1E4KC 1EPFA 1MFBH 4X6EB 2EDLA 3C5JA 3ZE1E 3QEGL 1R5WA 2LU4A 4DVRH 4BH7A 3CX2A 2X1XR 2BY2A 3RWIA 4AQ1A 1EO8L 1BJ8A 3ESOA 4OJYA 1KYFA 2QZ5A 4Q8BA 4FZEL 3SBPA 3MDJA 4HISA 1JXFA 3L9RA 1KNOB 4PGZA 4G43A 2FNWA 1MG3C 5AOLA 3ARSA 3VVWA 2X4OA 4BZ2A 2JKXA 2P3YA 5LBVA 1WAEA 3RWCA 3VXMB 4GQ9H 3UZEA 1X3DA 4KOCA 1V7NL 3Q7JA 4TOYH 4JFEA 3QORC 1IL1B 2NX5E 1ZA6B 1TQTA 2DYPB 3VXRD 4GUQA 2OR8A 4KXZI 5J1SC 1M7DB 1HHJB 4LLMA 2EXYD 4YDZA 4LCIL 1FG2B 2CR6A 5IHHA 4JGJA 5JUEH 2BNUA 3QR2A 4KC3B 3K71A 2WBJB 3P30H 1M4KA 3TBSA 1N59A 2AKRB 1UOWA 1TPXB 2YPVL 2JWYA 3APNA 5DEFB 5E4AA 2OJ1A 4WW2F 4MJ4A 4HS6A 3L4TA 3FB7B 3HB3D 2HH0L 1PLBA 3QIWB 3JWDH 4Q6YA 4CVXA 4JJHA 1AGCA 3KPTA 4UINL 3UEQA 1O5PA 3KVPA 3ORJA 4NN6C 4YSEA 5D72H 4F1ZA 4GSRA 4PJHB 2JKWA 5I8EA 4ZW8A 5E56A 3H6JA 2YJQA 4LGSB 2NNAA 1T1WB 1NGPL 1KFGA 4GFXA 2PTTB 3NJIA 5LUMA 2XBTA 2BNRE 3SKMB 2W0FB 1PZBA 3P3RA 4JDTH 5IQ7L 4GRLB 4M02A 3OR7B 5K9KB 5EBMA 2WZ6A 5D93B 2I9LB 4FQLL 1DVYA 1HEZB 3LDBB 1FPTH 3SZKC 3LPOA 4RRPA 5IG7B 2ATKA 5E6YA 1CFVH 3RDTA 3IGKA 1OSPH 5JR1L 1V3MA 2EDYA 3BUYB 3GSVA 1T04A 3DWTA 2QVIA 3KYKL 2D73A 3OLDA 2V33A 2BIHA 4FCAA 2YD0A 1YC7A 4FERA 4J1UA 4AMXA 1AHWB 4XP5L 4PGBB 2N59A 3QJTB 2AJ3B 5I0DA 4U3SB 1P5UB 1AGDB 1DJIA 4M7ZB 1FAIH 2X41A 1T1YB 3APCA 3Q8BA 2ZKWA 4IEFB 1RJLA 5C1MB 1CDHA 2G0KA 4BWUA 2QADC 4HUCA 5F9DC 2G2PA 3L5XL 3FQUA 1AI1L 2CKBL 1MCBA 2J1WA 3QUMA 2E6JA 1JCKA 4PRBB 5D7LE 3LEVL 4BK4A 4XZ4A 5SWSE 2NY1C 3G6DL 1A7RH 1MFVA 1L6ZA 2XA3A 3GSXA 4RMBA 4BH8B 2K6WA 4AIOA 1WC7A 1XEUA 2YD9A 2A9NL 5D6CA 4ENZA 5D4JA 5F0JB 2I07B 3KPSB 4OUUB 3QXWA 3T04D 1HHKB 2YO3A 2ID5A 3QARA 1MHPL 3WO4C 3FOLB 3RZCB 1HEHC 4XHJD 4KRPC 4IGBD 3IDMB 1MFCL 4OJFH 3CX5K 4V1DE 5AZ2L 5DQ9A 1QO3B 3QAZC 1Z9MA 2JJSA 3IGUA 3BJLA 4Z7AA 3TBYA 5I30L 1HYSC 2BVEA 2IWKA 5HYJD 2QFRA 3JWOL 3QFDB 3O45B 1RV6X 3GYRA 1OAUL 2WJ7A 2HYMA 2Y2TA 1L9MA 4NM4L 3D51A 4YIQB 1NAKH 5CEYA 1EHKB 3ARDD 1NIDA 4LDLB 4E9LA 1EAPB 1KJ3L 3ILEA 3ZIMA 1VLXA 5MEQA 1YEWA 2IIJA 3N1MC 4KVNH 4XZUB 3V6ZA 3ZOAA 3DJZA 3WIFB 1ZEAH 1P0SE 5J89A 3D2TA 3MLYL 1T0PB 2ZCHH 4OCYH 4OZFH 4R26L 3TT1H 3PGDB 2N7BA 4YHML 4NJ9H 2R69L 2W38A 4KDTC 25C8L 4NPKA 3RE0A 2YXFA 1P4LA 2AXFA 4ZTEA 2CK0H 5ISZB 4LLYA 2C9UA 2YK1H 2KPWA 5CFHA 2Y36H 1H3VA 2D7MA 5AUMB 1RIHH 1X5KA 1QEWB 1R5IB 2GJZB 1JF1B 3MNMA 4GW1A 4L3EA 3WEXA 3I9AA 5HVHC 3ZSSA 3QS3A 1HH6A 4G3YH 5CP7B 4W9DC 3O2WL 1BMGA 1FNLA 1D5MB 2PWFA 3B83A 3LZQA 2JTYA 4XB7A 4XO3A 4JFED 3KS0H 3VXUB 4HUWB 4MBRA 5TPWL 1KBKA 3EFOB 4M7LL 4MJ5B 3MNZB 3BWUC 2IC2A 2VLKB 4KH2A 3NACH 2BHUA 3C6SB 1S7XA 3VSTA 2GIYA 5BRZA 3ZDWA 1SUJA 4F9PA 5IVZA 2OR7A 2Y69B 3IK2A 2EDDA 4P2OA 5IT2L 1LE9A 2BDNL 4QY8B 3QWOB 3RWGA 4D0CA 3D34A 2AC0A 2F7IA 4YBLB 1HHGA 1R3IL 4EDWH 3MJ7B 4K07A 2EXYC 2NY0B 4XCEA 3MJ9A 4B7LA 4NOBA 3BAXA 3BP7A 4K9EH 1D2PA 1VFBA 4M48H 2ZPKH 2EE0A 3SYCA 4Y2DA 1GS8A 2PYFA 4UQ2A 4KY2A 3AWGA 4F5CE 3HB3C 4Y4KB 1JF5A 3GZPA 4ZFFA 3WKMH 4WKZB 4X0NA 3LPFA 4U1SB 1RZGA 1XGUB 2MPVA 2NY6B 3G3LA 3H9ZA 2EYTA 4NO5A 5AVYB 5FYLE 1HINL 4ZX5A 3MJ6A 3THML 4AJVA 1D7FA 1R3KB 3Q5OA 5JHDB 3T08A 4OZ4A 3S3DB 5T1KB 3CN3A 2H41A 5A16A 4GG6A 3VRLE 3P4MB 1HJCA 3H2WA 2EEBA 2UVFA 1VAHA 1BIIA 5DQJA 4BFBD 1QQDB 2Y07H 3LKPB 5KWYC 3RDTD 4C56E 2LVCA 1N5AB 4S1QH 3KL0A 3R19A 1UD3A 1O0VA 2CWRA 3FN0L 3REWA 3V6OC 1OKEA 2ICEC 3KPMA 4DQOH 5KBLA 1J9RA 4HV8B 1T03H 5C7XH 2Z7YA 2B1HL 4GO8A 2B9AA 4JFDB 1TMCB 3FFCB 4X6DB 4YMPA 4BFJA 1I9RL 3ULUE 3RNKB 2FDBP 3GMPB 2ZKXA 2HT3D 43CAB 3K2UH 2FH8A 4ZUTB 1WCBB 1KN4H 3QPQD 3V0WL 3X1NA 4F15B 5BRPA 4NKQB 5BXFA 3KGSA 2W65A 2ORBL 3U9PL 3VFRA 4NFBA 3CFEB 3D5OF 2ICWA 1B0RA 2Q76B 3F62A 3L48A 4A1RA 5CCKH 4R7NA 5G2NA 2W1NA 5GISH 2XWJB 5IQOA 2XBDA 1SEBA 3DROB 4JY6A 1R17A 1I3GH 2NLJA 1G6RL 3ARZA 3CZJA 4RH4A 5GGVL 1KN2L 5JORB 1MCEA 2QDVA 3L3OC 4YHOL 1L9RA 1SF5A 4U31A 1QUPA 1V3KA 2J4WL 4UQIM 1N6QL 4KUZH 4FTVB 4MD4A 4ONFH 2J3SA 5F21B 4ALAL 1T21B 4MYWB 4X5QA 5DRXA 4Z6AT 3VSQA 3ZXAC 4Q2ZA 4UTCA 4P3CH 5D1ZI 3V7AE 1MAJA 4MCZB 5DMKA 1BQKA 3GF8A 1YY9D 3NYKA 2F1EA 3F7PC 4WTZA 1G0DA 4P4RB 1W16A 1B9KA 4QO1B 1ZLWH 4BFIA 1ZHNA 3W9DA 2PMZA 5B7MA 3V4PA 3LQAL 3Q3GA 4OQTH 2F7PA 4XHJC 4IGBC 4F37K 1YYMH 4WNSA 1IGYA 4ZXBB 1K4DA 1F4WL 2GSIB 2E8YA 3KCPB 3J2PA 4GG8B 3ZDZF 4PJIF 1HWHB 3KD4A 3P4LA 4LPCA 1HL9A 1IGJB 1UM6H 3FO9B 5I66A 2OTWA 1FH5H 4B9PA 4Y5VC 3QORB 4J4PC 1QD0A 2YAPA 1NFDE 3TH4T 3ARDC 3O41B 3VFSB 3BWAB 3FQTA 3NK4A 1IC5H 4AMKH 4M7JH 1GZQA 1A6TA 3ETBF 3RFZC 1L0PA 2BJML 3EZJB 4FXTA 4NUJA 2R39A 3NIFE 3WN5C 1ZT4A 5CN3A 4FXGC 3PQYB 2BSDA 3I02A 2YRLA 3EGXB 4HXBH 3T1FB 1N7MH 1X5IA 1RZ7H 2FGWL 4L3ED 4PJEF 3FH8A 3Q2CA 1SRDA 5ALBH 5E6UB 4LSVL 5GGTA 2B14A 5E4IA 1QNZH 2N7AA 4NN6B 1WAAF 3WKPA 4ZOBA 4HBCH 5E03A 1TO5A 1LDPL 2G5UA 3VRJB 3FB6B 2AHIA 5EU7C 1YEIL 2FEDD 3INOA 4MRBA 2ZJSL 1GR7A 2IV8A 3K2MC 2QTVA 5BRZD 3B2VH 1IQDB 3CSYB 4WW1A 4N6RA 1P7BA 4HLJA 2JKJA 3WDIA 5CGMA 4P2OD 5KS9E 5FYKD 1JMXA 4EI6A 1EXUA 3MRPA 4ZMNA 1ECYA 2PPAA 3ZE2F 2XZQL 3P0YH 5EZOL 1YEHL 4JLRB 3NCJH 1Z5HA 3DVNB 4LQFL 1XSKA 4TVPH 5LBSA 1H6TA 1DSWA 2EABA 1Z66A 4BZ1A 3IXAA 4Y2DD 2HT2D 4CILA 4UTAH 3U1QA 4BFEA 4TUJB 2E6QA 5FO7B 5I5IA 1LILA 2VMCA 5LN8A 2ZCLL 1UD8A 4K3EH 1MSPA 5IB3A 3VCLA 2KQMA 4IK6A 1JZ2A 5GGSB 2ZX8A 4QRRB 3D3VA 3IRPX 1PDKA 2NW2A 4AUJA 3H2QA 5DMGC 3HKFA 2E6PA 4GRWB 4WHTA 4B96A 3B3IB 1A6ZA 1KBGH 3WU1A 5I6XB 2W60A 4GSDH 4Z7QB 1KPRB 5DVLA 4ZO6A 1F11B 1MPAL 1B0WA 4LBAA 2OZNA 2DEYX 1OGAA 4LSSH 3SCMA 4KMQA 2CR0A 3NUKA 2VYRE 1A25A 3ILQD 1AHKA 1PZSA 4B5EA 1U21A 2CIKB 1Z9LA 4Q56A 4XNUH 2PW1A 5L4JA 3NA9L 3QFJA 3V0DA 1FFPA 1CICA 3IDJB 2F68X 4KUCF 1S7VA 3MR9B 4X6CB 3VUAA 4PRIB 3II3A 4AC4A 1XMEB 5E9DA 2F53E 1DDHB 1I1AC 1IJNA 2Q3XA 4I9XA 1X5YA 3WO4B 5TJWK 1NC4A 3CZEA 4WHDA 2WTPA 1MIEH 2A83B 2ADYA 3T65B 2BC4A 3HW7A 3P9WB 1R33A 4AENB 3QAZB 5E6IB 3REVB 3K72A 5DHXB 4XN5A 1ADWA 1NBQA 4MDIB 3ZDXF 1LHZA 3N1GC 4LDCA 2QQKL 1PTZA 3KPLB 4O00A 4QKTA 4AYSA 4NLAA 2OL3L 4WU5B 4NNYB 4X99A 4Z7WB 1L6PA 5B1BB 3WNNA 3MUZ1 1R19A 5F1IA 1CXLA 2HT3C 2X4NA 5J12C 1YEKL 3QPQC 3TO2B 3WFDH 4ANUA 5MEPB 4JZNB 4M43L 5DSCB 5F97E 1ORSB 3BH9B 1JXJA 4G8IA 4H8WC 3RWDA 4QAMB 3HRZB 4BE6A 2JVUA 1CT8B 4O51B 1O9WA 1CE1H 2X6BA 4UQ3A 1FL3A 4PYGA 3RIFF 5CLYA 1AY1H 5GGRA 1BZOA 3RRQA 4AQZA 3I3DA 3CLEL 2NNXA 1L9QA 4PYHA 1KCWA 3S37L 3M1BA 4TTDD 3V6BR 2E4TA 1G84A 2ADJA 3LNIA 5EOTA 5H37A 1A6VL 3VWKC 2KL6A 5E94B 4LLDA 1U8MB 2ZG1A 4HZ1A 3R7QA 3ELQA 3K4DA 4QHKJ 3ZK0A 2CHZA 3TJHD 5HVHB 2QMKA 5JNYA 1YY9C 1F1GA 3KPOB 1V7MH 4FFZL 5GS3A 3MA9H 4P3DA 3SE6A 4HUMB 4KV5E 5D9SB 1NDGA 4LLUB 3AROA 2J1KA 3MROA 4J3OD 1OP4A 4XCYA 2K7QA 2AERT 4P2RB 1L0XA 3MBWB 2BOBA 4RFOL 3MFFB 4BFOA 5I1GH 2DH2A 3CK0L 1NQBA 2W91A 1KULA 3N6YA 4AUYA 3V5DB 1AD0A 3PXHA 3NEXA 5F7MC 3TBCA 1BXXA 2FK9A 1RSYA 2ZWLT 1HXYB 5FUCE 3ESPA 5I2IA 2WO2B 2IF7A 2EC9U 4ZTPL 2WLIB 2UWEB 3P0VH 1J05B 1A47A 1OE3A 4NZDA 2CJTA 3ULVE 4Z8FH 4J28A 2YPLA 3VFMB 3TWCH 3D0VB 4M6AA 4LLWA 1SN0A 3S97C 5IMLB 5DRNA 3NJJA 3QQNA 4AKQA 5HHOB 1QLRB 1A1NA 1F58H 1BJ1H 4NLHA 2ARJB 4UTBA 4DGWC 5C0EA 2DWTA 4DTGL 1GYVA 4OGXL 2AJXH 5EU5B 3V52H 3EFFB 4XPTH 5F1OB 4L29B 2DOCA 2IEPA 3S5LG 3BVWA 4QTIL 4UAOB 5FGBA 1ZVYA 5HDQH 2R7EA 3C5ZA 2Z0BA 4F2EA 2FEDC 1DVTA 3WE1A 4YSSA 5EZIH 4F9PC 3F2LA 3IN2A 4M7KH 1QEXA 3VD3A 1QSEE 4K3JL 1LQSR 4P2OC 4WLCA 3UIZA 5FO8A 4OLUL 2ZOTA 4UV7H 5T3XD 1ET8A 3BQVA 3VYOA 4TL4A 3G08A 4FQHB 2UXFA 4YO0B 3E6FB 4K2UL 4WUKH 5I9QB 5I75B 1U8QA 3RU8H 1IAII 2X2UA 1T1XB 3EBIA 2YA2A 5C0BE 8FABB 2EEDA 5KYNA 2XWDA 1EQWA 2C1OB 1IM9A 4DZBB 4XP1L 3D3VD 3LY6A 2VKXA 2ICEB 4OD1H 4OH2A 2EKJA 2ADFH 2F54E 1XWVA 2CRZA 4Y2DC 2H3NB 1VFMA 3C08L 1OL0A 2HT2C 3OMAB 2WVUA 4OI8A 3E1F1 1S7WB 1MHHB 4FQ1L 1FL5A 1NFKA 4TNFA 3T3MB 4M3JA 4R96A 3CHRA 5E8EA 3FN9A 5D4IA 1BQLH 4HF5L 1OGAD 5DUMH 3OKEB 1VADB 3SCMD 1U2CA 1RSFA 3PHQB 3R18A 5GRJH 3CXDH 1B2WH 4RFNC 4YXHL 5C9JA 3QFJD 4HS8L 1CICD 2XG4B 2FEJA 2YUZA 1WTGT 3CUPB 1DFBH 3ILPA 5ETUA 3W39A 5E9DD 3L3OB 1KPVB 1T7WA 4EF3A 2WY3B 4JHBA 4I2XE 1TQCC 3ILQC 1CVSC 3IS0X 4NHCH 4ZPVB 5AVWB 2GK0B 3PWLB 5D1QA 1T2XA 3N9GL 3RWHA 3KJ6L 1Y7VA 3VMPA 3S4SB 2GTWA 1EHLH 2HFFB 1ZHLA 4Q0XH 3A47A 2G60H 3LXCA 3UTSE 3ZTJG 4X7DC 4JFSA 2DMGA 4GKNB 4PRNB 3IKKA 4YHNA 4BSWB 5ELIA 2AVFA 2K9FB 4E9SA 5IMMB 4L1SA 2Y1VA 4L4TB 3DPBA 3VD9A 5EORL 4K94L 4PCSA 2V9UA 3VXTA 2P8LA 4HCIA 4E41B 1HFUA 5C97A 3MJ9H 5EU4A 1XF4A 5EIIG 4LSRH 2V2XA 3ARFB 5HYJB 1UXWA 5AG8A 1A7QH 1KYDA 4PD4J 1X5GA 3PGCA 3B8YA 3VXNB 4KTYA 2K6YA 1QABA 4XNZC 3ARDB 1GS7A 1YEFH 4BDVB 3PDOA 4PGEA 1WPCA 1BD2A 1XZWA 3IDXH 1ZVNA 4N2OA 4A39A 3PU7A 3PXJA 4JEGB 5FYJE 4I13B