2FTAA

Structure of cu(ii)azurin with the metal-binding loop sequence "ctfpghsalm" replaced with "ctphpfm"
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
122
structure length
122
Chain Sequence
CSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTPHPFMKGTLTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Azurin
publication title Basic requirements for a metal-binding site in a protein: The influence of loop shortening on the cupredoxin azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 31
structure length 122
sequence length 122
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ftaA00
1PLBA 1E65A 2PP8A 4KO6A 2IWKA 3X1NA 1V54B 2FT8A 5PAZA 2AANA 4YSUA 5I5MA 2I7SA 3S3BB 3TASA 2XV2A 1J5DA 4L0PB 4AZUA 6PAZA 5LDUA 3PPSA 1AS7A 2B08A 4DP9X 4YSEA 2EIMB 2BW4A 2XLLA 1DZ0A 1BYOA 3AZUA 5I26A 1AZCA 4KNTA 1ZDSA 4W9ZA 4FA7B 3NJIA 4NERA 2PPAA 1V10A 1DYZA 3ABKB 2P80A 1KBWA 1XB6A 1MZZA 3EH5B 2W8CA 2IAAC 3X1EA 2TSAA 2HZHA 1GY1A 5I5IA 4KOBA 1KBVA 3ERXA 1ASOA 4HZ1A 1AACA 2CALA 5E9NA 3FSWA 2XXGA 5I6PA 4YSTA 1X9RA 1TU2A 1CUOA 2NRDA 1BQRA 1KGYE 1GY2A 2BWIA 3FU7B 4BWTA 1ADWA 1SHWA 4JHUA 4FAAB 3FYEB 1ET5A 3AG2B 1JZGA 3X1FA 5B1JA 1BXUA 1N68A 2IWEA 2DV6A 3ASOB 3IE9A 1AIZA 2JFCA 3DKHA 2YQBA 1SFDA 3D12B 1YLBB 5B1JC 2W88A 1OCOB 1MG3C 4X4KA 3AG3B 3KW7A 4Q89A 1ILSA 1SNRA 1GW0A 1AZRA 1KDJA 2FQDA 2XXFA 4BDVB 4HCGA 2OJ1A 1J9RA 4KO5A 3FS9A 4DPBX 4KO7A 2N0MA 5TK4A 4DP4X 4HHWA 2YAOA 8PAZA 1BEXA 4YL4A 3QJVB 4BXSV 4UF7C 1NWPA 4A2GA 3EF4A 4A66A 2XX0A 3ABGA 4DP2X 4A67A 3OMNB 4CSZA 2QPEB 1ASQA 3HEIB 2XU9A 4WKXA 1A4BA 2GC7C 1PNDA 2WSDA 2BP0A 1WA0X 1ETJA 3CG8A 1A3ZA 5ANHA 1J9QA 3IN2A 1JERA 4BK5C 1TEFA 2QDVA 1KV7A 2AFNA 1PAZA 1ET7A 2HX8A 3T6ZA 3UGEA 2YAHA 1E30A 3S8GB 1NDTA 2E86A 1L9PA 1CYWA 1RZPA 3PXLA 1NPNA 3OM3B 2DYRB 2HX9A 3CDZA 3ABMB 3H4HA 2IDSA 2PPEA 2ZONA 5D4HA 3MX0B 3WI9A 4GP5B 5I28A 1JXFA 4WTQA 4N4YB 1HFUA 3NJHA 2DWSA 4DPAX 1PMYA 2HRGA 3ABLB 4JHVA 1GYCA 2PPCA 2XV0A 1JZJA 3NJKA 3H56A 3PLYA 2ZOOA 3ASNB 4DP8X 1AQ8A 2RACA 3IN0A 1L9QA 5B1BB 5F7AA 1AZUA 1AZBA 1ASPA 4F7KA 2BWDA 2EINB 4KNSA 1KCBA 2R7EA 2X88A 4G72B 3UACA 3PAUA 4QKTA 5AZUA 3X2QB 2BZCA 1GS7A 1BQKA 2HLEB 1PZBA 2XX1A 1PF3A 3MBWB 4DPCX 3IBOA 1R1CA 3UAEA 2PP9A 3FU8A 2CUAA 5I6LA 1JZHA 1OF0A 2LLNA 2FQEA 1GS8A 1NIBA 3NJNA 2CBPA 3FT0A 1TEGA 1CYXA 1WS7A 1J9SA 3QQXA 1OCCB 2GSMB 4GYBA 3QJRB 3T6VA 1M9WA 3NP4A 2DY2A 1J9TA 2X87A 2YAQA 2IH9A 1EHKB 1OCRB 1QHQA 2CJ3A 3SBPA 4AKPA 1URIA 2AZUA 5B1AB 3OMIB 1WA1X 3T6XA 4HIPA 3NYKA 3CZUB 2VW4A 4M3HA 3NSDA 4YVNA 3FQ1A 4BWUA 3L45A 2Y1AA 2PLTA 3NJGA 5B7FA 1ID2A 2VM4A 1BAWA 1A4CA 3BVDB 2EIKB 1IUZA 2BP8A 3FQ2A 2YXVA 2ZXWB 2YARA 2XWZA 5I6NA 1E5ZA 4PAZA 2OV0A 1E67A 3EHBB 3FSZA 3TU6A 3G5WA 1SHXA 1IC0A 2FTAA 4YSAA 2BP0B 2HXAA 1TKWA 1XMEB 2UXVA 3UABA 1AR1B 4AKQA 5A7EA 4G7SB 1GSKA 2HRHA 3NJMA 3CVCA 4G7QB 3T9WA 4AI7A 2PCFA 2PPDA 2MRYA 2GI0A 5I6MA 4AX3A 5B7EA 3QJUB 2EIJB 1NIFA 4YSOA 4P5RA 1OV8A 2BHFA 5D4JA 1MG2C 3V9EA 4HAKA 3CVBA 2XYBA 9PCYA 1JXDA 4DP6X 6PCYA 2UXGA 4W1TA 1OE2A 3U25A 3ZX1A 4HHGA 1OOWA 3NT0A 1A8ZA 1ET8A 1NPJA 2PP7A 5EHFA 3TBCA 2OCCB 2QPDB 1MDAA 2IDQA 3WIAA 3X1GA 4G71B 4NB7A 1L9TA 2Q9OA 2AZAA 2XV3A 3OQRA 2R7EB 1JXGA 2WO2B 1HAUA 4G7RB 4EF3A 2WO3B 1JVLA 3WKPA 4GP4B 4E9WA 2J56A 1IBZA 1AS8A 1A65A 1WA2X 2XUWA 4E9YA 3SBQA 3SQRA 2FQGA 3V9CA 3FSAA 3NJFA 3OMAB 4HCFA 2BZ7A 2VM3A 1FFTB 3JTBA 4KO9A 2FWLB 2AVFA 1MZYA 4A68A 3S3DB 2I85A 1N70A 2GHZA 3QPKA 7PAZA 3TA4D 1JOIA 1SF5A 3SBRA 1FA4A 3PAZA 4JKNA 2HX7A 3IEAA 1NIAA 3OD3A 3WG7B 1SDDA 1UATA 5AKRA 1V55B 5I5JA 1IBYA 2CCWA 2FT7A 4RH4A 5I6KA 1PCSA 2BW5A 4GY4A 4KOCA 3NJLA 2VSKB 3UAAA 3S8FB 3WNJA 3QJQB 1JZIA 4ZK8A 1AOZA 3N2JA 2PCYA 1NICA 3GYRA 3ZDWA 1SF3A 1W6LA 3AY2A 2YAPA 2JKWA 4TXVB 4E9QA 2H5UA 1B3IA 1ZIAA 2FQFA 1CC3A 1VLXA 3C75A 4CSPA 2BP8B 5D4IA 2IDTA 2UX7A 3DTUB 3EH3B 3AG1B 1RZQA 3S3CB 4AKOA 4YSSA 1J5CA 1XB3A 2Y69B 1JVOA 2IWFA 1AS6A 2I7OA 2IDFA 2BO0A 2VW6A 5FC9A 1ILUA 4YSDA 4Q8BA 2H3XC 3EH4B 1RKRA 1OE1A 1SJMA 4YSRA 3AG4B 1PZCA 4HCIA 3GDCA 3NSCA 2J5WA 2FNWA 1QLEB 2P80D 2Q5BA 3RYMA 4GP8B 3T71A 1NWOA 2J57A 2QT6A 5PCYA 2GC4C 4E9RA 2PPFA 3KW8A 4GXFA 1OCZB 4E9SA 1GS6X 1AG6A 1NIEA 4A2EA 3QJTB 4MFHA 4E9VA 3NSYA 3ZBMA 2ZWNA 3BQVA 4DP0X 3NP3A 3ZIYA 4A2HA 1OE3A 1FWXA 5F7BA 2H47C 2J55A 4A2DA 1ZIBA 1X9UA 4F2FA 1BYPA 2XVBA 3JT2A 3FU7A 5TK2A 3AW5A 7PCYA 3QJSB 1JZEA 1KCWA 3CDZB 1BXAA 3HB3B 2IH8A 1E5YA 2UXFA 2YAEA 4YVUA 3CVDA 3NJJA 1AANA 1BQ5A 2GIMA 3H4FA 4DP7X 5B7MA 1PNCA 1W8EA 4N8UA 1BXVA 1NIDA 2IDUA 3T6WA 3WNIA 4YSPA 2EILB 4HALA 4UAHA 1ZV2A 2QDWA 4PCYA 4G70B 4K9JA 1WAEA 1AAJA 1NINA 4QLWA 5B1KA 4BDVA 2VMJA 4KNUA 1PLCA 1ZDQA 1XB8A 2CAKA 2VN3A 4M4RB 2VW7A 2UX6A 4DP1X 2TSBA 1KYAA 2YAFA 1ZPUA 1SFHA 2JXMA 1F56A 1NTDA 3N55A 1EZLA 3TBBA 1PY0A 3X1BA 4P5SA 5I6OA 3FU9A 4BXVA 3GXUB 1KDIA 2FT6A 3WKQA 1QNIA 2GBAA 3FPXA 2YXWA 1SDDB 4A2FA 1JZFA 1L9SA 5B3SB 2GB2A 2DYSB 4F2EA 4E9XA 3FQYA 4DP5X 2DWTA 1L9OA 1PZAA 5IY5B 1HAWA 3UADA 1AZNA 4YSQA 2MTAA 3DIVA 1AG0A 1GR7A 1NZRA 4BWWA 2UXTA 1A4AA 1W6WA 2YAMA 3PAVA 3PCYA 4NAJA 4UANA 4ENZA 5AFAA 2A3TA 1CURA 1L9RA 2B3IA 2FJSA 4YSCA 1M56B 1M57B 1RCYA 3FYIB 1WS8A 2VSMB 4E9TA 3FPYA 3FSVA 1IKOP 3NSFA 1PLAA 1T5KA 1I53A
chains in the Genus database with same CATH superfamily
2HUHA 1KJ3L 4KO6A 5JTWA 2AV1B 2WLLB 1N59A 1V54B 4LXFA 3QULB 2ICEA 3N40F 1QMUA 3S3BB 3TASA 4LL1A 1IGTA 3F01A 1UWEH 4X7TB 1CGTA 4FFYA 2V6HA 1BZDA 1D5MB 4YSEA 4YGVB 2ZWSA 1AGFB 3MRLB 3OB8A 5AOMA 3T4YB 1JD7A 5CWSB 4A2MA 4QYOB 3AT0A 4OZFG 1F6FB 1HIMH 3L2NA 5G5DA 3RU8H 2RAMA 4NUGH 1Q9KB 3QCVL 3KYNA 4U7KA 4ZAKA 2OZ4A 1NUDA 3FHAA 1NBVL 3GS7A 3O41B 4XPFL 4Y5YA 3GMPB 1MQKH 4TSBL 3SE9L 5IG7B 3B37A 4PMEA 5EFIA 2HH0L 1TEYA 1GY1A 5IW3A 3KCPA 2A4ZA 2ED6A 1T6BX 3LKNA 3KXFD 1QPXA 5EO1B 1KT2A 4D8PB 1ZEAH 4NKIH 3OPZL 3I85A 4YHZH 3VDCA 4D9LL 1L4IA 3TTYA 4A1RA 5I0VA 4V33A 2AJXH 5EZLA 4NKMB 1SN5A 5A3ID 1EJOL 1EANA 4JHUA 3SQOL 1S7UA 5EOTB 4ODWA 4PJXA 5ID0A 4LLMB 4HS8H 1P2CB 2F53E 5BVJA 4XXCC 1U3HB 2Y6TE 2ZXBA 4PRID 4RFNC 2CDFA 3BP6B 1SVZA 3D12B 2J8UF 1JRHH 4K9EC 4NRZA 3V95A 2Q6WA 5I1EH 4JAMB 4HCRA 5KYXB 1J9RA 3VSQA 1IEBB 4XP5L 4AEFA 1KENL 4JGMA 4XP6L 2YQ3A 4JRYE 3RZCD 2G2NA 2PO6A 3GI9L 4W9LC 4AJWA 2X3CA 1BD2B 2YMXL 3LQAH 2QPEB 3GZPA 1DSYA 3LKPA 1AE6L 3PDDA 3RUGF 4B95C 2AXGB 4WKXA 3U4EB 2DS4A 4OLXH 3JV4B 1GAFL 3FBKA 4U1IB 2YJQA 1AY1H 2OXHA 1ZOXA 5D6CB 3GRBA 1MF2L 4KVPA 4L8SC 5CHNB 4L48A 4UUJA 5AW8B 2R56L 1A64A 4PCKA 1D9KD 1VPOL 2HX8A 4GAYB 4F8PA 4UYQA 2O6CA 3S8GB 4U6HB 2E47A 4DTGH 5IW1B 5I0XA 5FAAA 1KB5L 4QTIH 1ZWIB 3SQBB 3GFUA 5EU3A 4JM0A 4QNPF 4ZO7A 5I6XC 4OIIH 3KL0A 1BEYL 3QCUH 4GUPB 1U92B 4OD3H 2OYKA 1FJ1A 4MA3A 5IESL 3MLPA 1MDTA 1T66C 4JFZH 3T2LA 5HYQA 1AGCA 4BFJA 1S7TB 1EDQA 1PLGL 3TYGH 3HB3D 3DPBA 1XAKA 5ETUB 4JFPB 3ULAB 5KBPA 3IT8D 1XGQA 3PAYA 2DJUA 2DLFH 1X5YA 3M1BB 4QXUH 3UBFA 4AENA 2RB8A 5M94B 3RX5A 2D9QB 1WAPA 3V4PH 4MSWA 3CDYA 1WBXB 1QRKA 5HHOB 3TA3B 1UM4L 1XF2B 3BUQA 3BVVA 5GGRY 3BT2H 3L3IA 4FZEH 3MRDA 2ATKA 3K8KA 4PRDB 3DXAD 3NPSC 5DO2D 3TJEL 3X13B 2VDKB 2KZKA 3Q44A 4NENA 4N2BA 3B2UD 3S34H 3NG5A 1PF3A 4JUSA 4WK4B 2MKWA 5DUPL 5F6IC 4AE1A 4WWPA 4URTB 1H3UA 3HE7C 3WSQH 4YFEA 4ZQKB 4AEHL 5JDSA 3MRJB 4MJIB 5CLZA 3FT0A 4WUUA 2PXYB 5EO0B 5E4OA 1M1SA 5I1GH 3GEFA 3RVXD 2Y7LA 2PKDA 2SEBA 2YAQA 1WJ3A 3MRBB 1KTLA 4I9WE 4KMLB 5DEGB 1FHNA 1OSPL 4J6IA 5DHEA 3SBPA 1CGYA 3OMIB 4Y5YC 1WA1X 3G5VA 3QR2A 4KI5E 2I25N 2LLGA 4OJDH 4RDQF 3FQXA 4MNHA 3KDPB 3HZYB 5G4MA 1FL5A 1L7IH 5C0IB 3Q2LA 3OPUA 3S36H 1JK9B 4C58B 4EVNB 1ID2A 1H19A 4DERA 1MCQA 3L1OL 3UC0L 4NNYB 4LSVL 3T8VA 1DLHB 1F1GA 4LB8A 3SGKC 1DN0B 2G0KA 1KLFA 4UYPA 4Q0XH 2ZXWB 2YARA 3KPRA 2NUPA 3AXLA 3AM8A 1IAIL 4HG4J 4WK0B 2CUMA 5E00B 1S9XA 3H53A 1RIUL 1L0PA 3K4DA 4HT1L 2DWEA 4X8XA 4RMUA 1DQQB 2RA1A 3P54A 2R39A 2BP0B 3MV7D 4YDNA 5EWIL 3E9UA 4PM1A 1E5CA 2BY3A 6CGTA 5K9KB 3DYMA 1A6AB 2P5WB 2LQRA 2V9UA 2AJVH 2AEIT 1UA7A 1CFTA 3JWDC 3FO0L 2K1MA 4XNMA 4FQCL 3NA9L 5IJDC 5JW4R 4NQDE 5DMKA 1K8IB 5DRZB 3UPRB 1WUNT 5FFOA 3RQ3A 1IKFH 3HLAA 2YR3A 4U1LB 2O5ZL 3ZU8A 2CO2A 5KVEE 1Z9NA 3B4NA 1FBIL 1S5IH 3NT0A 4XPBL 5JNYB 3QDJA 3BAIA 4W9GC 2IPTL 5FECB 3FQ4A 3CLFL 4QHNA 2DL2A 1IAIM 3FFCA 3ZYZA 3PFQA 2XN9D 2Q7YA 3JYBA 1DE4B 4XVSH 3G9AB 4NQTA 3QIBB 3RDTB 1MJ7H 2Y07L 4Y89A 1Z0MA 1JGDA 4JHWH 3VFRA 2Y2TA 2DD8L 2FEEI 2HLFD 3BD3A 1GGBH 4DVBB 2HT4C 2FD6L 2IXQB 2VMFA 2NY7L 3Q3GA 4PD4J 2GSGA 1S9VB 2WO3B 4QOKE 4Y5VB 1EXHA 1T89C 1IBZA 1LQBC 4DK6A 3FBQA 4WI4A 3SQRA 2E7LC 3QRFM 3L5XH 2UY7A 3VFWB 2F58H 1SEQH 3C09C 4K3EH 4WGWB 2WWKT 4XH2B 4TN9A 2FWLB 4RMQA 5C0BD 1MCNA 1FYTE 1IFHH 3D51A 3LSOA 1Q72H 3QPKA 1N0XH 4UU9B 3ZYIA 4RMWA 4M9OA 4GT0A 2FZ3A 4K71C 3EKCA 1MFCL 1FIGL 1YNKH 4NRYA 3POHA 4Z3IA 2WLHA 2YRLA 4CVUA 2AGJL 4JS7A 2C7UA 4LCWA 4U31A 3QJZA 3LKQB 4XC3L 5IOPB 2CR6A 3O81A 3CVHA 2BW5A 4F2MB 2JVUA 2V2TB 3DX9B 4I3GA 2IBZX 2I07A 4K7PH 3L95A 5KVEH 1D7DA 4YX2L 5EN3A 8FABA 4WWNA 4G5ZH 5GIRB 4JZJB 3DBXB 2E9BA 3HC3H 3O2DA 3ZKQD 2YFNA 3QNFA 5HJ3B 5L2KB 1L0QA 3MRCA 2VYRE 4QRFA 4QRBA 4HK0A 1QUNB 1EO5A 3EYUH 5IBUG 4HUWB 3ATDA 3K2KA 2WB7A 1Q38A 3QNXB 2R2EB 4K23H 1F11B 3QJOA 3D0LA 3FB8B 3DIFB 3I6GB 1QHPA 1SJHB 5IW6A 3LH9A 4NQCD 5IK3B 1XBDA 2IDCA 1CE6A 4APQA 2BO0A 3L4WA 1XGPA 2VW6A 3TO2B 1I9IH 1WZAA 2EVIA 5FHBH 5SWZA 4MQTB 2CO6B 4WZ9A 4HJ1A 1R3KB 4OM1L 1BOGA 4HLZH 2A6JA 4M1DH 2Z7UA 2AMGA 3W9DB 4QEGA 1QLEB 3TN0D 2DLHA 3OWRA 3FT3A 4HWBA 4N8VA 1BOYA 1MHPH 4YHNA 1Z3RA 4R7NA 1YAIA 4S1DC 3SKJH 3RL1B 4XPHL 1TO4A 5PCYA 4BE6A 1HQ4A 1F42A 1A25A 3FDWA 4MNQD 1DSFH 2LVCA 5ITFA 4S10A 5JUEL 2OP4H 1KPRB 1ITCA 3X14B 4HJSA 2JB5L 1N64L 4JRXA 1MEXH 2CR3A 4JREC 3BSZL 4OCRL 4JVPA 1UFUA 4XNQB 5HJGA 4S2SA 1IAOB 2DEYX 3CD4A 3L9YA 3EUUA 4HETA 1BYPA 4TPRL 1C12B 3S88L 1CFVH 2FWSA 4GW5B 3FU7A 5TK2A 5E6ZA 1L6XA 2EIZB 4HZLB 1OSEA 4L8DB 4DGIL 1SM3L 5GS1B 2H2PC 3EJPA 1CGSH 4XE0A 3OB0K 2DQEH 3VXUA 2WQAA 4XNDA 1TZAA 3NJJA 4X5PA 2ZSVB 1UB6A 3C5ZA 1AANA 5DJZB 2CO4A 4N8UA 4HWEH 2XWJB 4I77L 1HVXA 1UWGL 2E6JA 3I9GH 4HHAB 1JPTH 2B39A 1OD7A 2RQEA 2YD3A 4K9JA 4ZTEA 5FYJL 1AAJA 3SPCA 1Z5LA 4U3CA 1PU0A 1CL7H 3RA7H 1FZJB 2BSSA 4Z95H 3SKUD 1QFWI 3EHBD 4NIKB 2DLEA 4XGZB 1OGAA 3Q6GL 2JK5B 1E40A 3QO1A 3L7EB 1RPQA 4AXWA 3TBSA 5A2JH 4MDIB 2YEVB 3RPKA 2HTLD 2ARJQ 4AT6A 3M07A 4YDZA 5DUBB 4ADIA 3OZKA 4N24A 3T6QC 3X1BA 5LCVH 3POCA 1IIIA 2VXQA 3FU9A 4K7PY 1GJWA 2H6PB 2WVVA 4LLDB 3FPXA 4ZRGA 3K80A 5FYJU 3TCLB 2VLME 5FPIA 1TPXB 1INDL 5DZPA 5T3XE 1XF3A 5D2NA 3BP7B 1NFDE 3KYMA 1QBBA 43C9B 5I1JL 1PZAA 3HBGA 4WI8A 5DK3A 4UTAL 4UM8B 1A6PA 2D2CC 1MCRA 2X4PA 4HIXH 1AG0A 4HKJB 5KSBA 2JCCE 3SDYH 1ZSHA 1G7JB 1JJUA 2VLLA 3EYVA 2HG5B 5JIHA 3R18A 5D93B 3CMOH 5CINL 3DGGA 3OGCA 2DMKA 1FC2D 3PP3H 5KW9H 1HI6A 5D1XA 3FSVA 3CZFA 3TH4T 3GMOB 5FYLD 1MVUA 4CN6A 4G8GD 5CLYA 1MXGA 2DI7A 1UM5H 2CIIB 4H5SB 3CIQA 4GKSB 5DMGC 4YH6A 2X89D 2AANA 2ZCLH 5IEHA 4ZO6A 3WJJA 4GS7C 2ADIA 4MGXA 3SDDC 3WMQA 1L7TL 1U58A 1UXSA 3VFGL 4L8BB 2PR4L 3GHEH 5CSBA 3KJ6L 5E1HB 3BRFA 1YY9C 3N40P 3MRGB 2EIMB 2ESVD 2VDRH 3B7YA 2HN7A 2X41A 1L6PA 2XG4A 1H15A 2J6EH 1P4IL 2Y25A 4HKXA 3N85L 4APXB 4BZ2H 4FZ8H 2C1OB 2UWEF 1JHKL 1MZZA 4APQC 4F7EB 4OQTL 5TDOB 2OKMA 3HZKB 1VFUA 4F15B 3IKCA 3O6LH 4HUXB 2FH6A 4QHKI 2IPUK 1CFSA 4KOBA 4YHLH 4F58H 5DJ8B 1OGTB 4O58H 4OCYL 2QQKL 4NZRH 5KANI 2CM6A 3NRQA 1EWHA 1YO4A 3DX1A 1M71A 1S9KC 3MV9B 2ORBL 1R46A 4PJXE 2DBJA 4I0PB 1OK0A 1ADWA 5KJ4A 1RHHA 1QSEB 2WZPD 4DQOH 4IRSD 2F7IA 4PV9A 8CGTA 4O2EB 3DOSA 1N68A 1QNZH 3EJYD 3PP3K 4F27A 2ETWA 2BY2A 2CHDA 1UD4A 2FB4H 4AVKA 2VQTA 4K5PA 4Y16D 1YLBB 5JHLA 2WZAA 1ZLVH 5I9QC 1NDMA 3HG3A 5JA8B 5HHPA 3RZCA 1ZS2A 3N9GH 5F1NB 3U0WH 5HDQL 4ABUA 2IJ0C 1I1RA 5IVXB 2ITEA 3N5AA 4LQFL 5ESAA 1QWNA 3IGUA 1Q9LA 3IB4A 8PAZA 3GS0A 4BFBD 1LE9A 3U6XS 4A2GA 5CM1A 1OCWH 3DMMB 1AJ7L 3IDGB 3MI6A 2FHFA 3AABA 4TVUA 5FDWA 2YPVA 2B1HL 3TBWA 5E9DA 2A5UA 3DHUA 1ETJA 5F3HA 1KJVA 3MRPA 4PBDA 4UDTB 3HR6A 4V1DA 4LU5H 4KJQD 1TEFA 2VLRD 5JMOC 3HZMB 1FH5L 4RMTA 4F92B 3ROOB 1VB9A 2VISA 4X6CA 1ZS8A 1F90H 3ARTA 5D7IF 3HNVH 4JFOA 3ZE1B 1GYVA 4GMSL 1N2RB 5LLIC 1GGIH 1BFOB 3ZRSA 1FL6A 1TZ8A 1OEZW 5D7JD 2HPTA 2NSQA 1PZ5B 2PPEA 4AQEA 4F8TA 2OYPA 4TTDC 5K9JL 3I3EA 4L5FE 4PVBA 4FQLH 1VSCA 3MGOB 4H8HA 2BHZA 3BH4A 4ZQTA 3BRGC 3D85D 5GGSY 3VG9C 4YPGB 3NOIA 4RSVA 1H3PH 43CAB 3IM1A 4Y19A 3PLYA 3VXPA 1HINH 3LEVL 2E0PA 2DQ6A 1L9QA 4LLWA 4JFWA 3BIAX 3F58L 1S7SA 4M56A 1RHFA 2K70A 4PEEA 3DX6A 4QO1B 5ECGA 1T5XA 2EINB 1ONQB 4QJ5B 3HCVA 1JZ7A 5ESQB 3STLA 4JQIH 5GZNA 2ZJSL 1UA6L 4XOEA 1D6VH 4ZZKA 3MLYL 1XEUA 4ZS6D 2IFFH 4AQ8C 3SB3A 2CSPA 5D1XC 1B4JH 2J43A 5AB9A 3PHQA 3LB6D 1XX9C 5DHXB 4KQ3H 3HJ0A 1KELL 5E70A 4JFHE 5A1AA 1JF6A 2NXYD 4WUUE 4ONFH 4IYKA 4NC1C 3WHXB 3DSNB 3DJTA 3WJJC 2EUVA 3K72A 2IANB 2HKAA 5IMMB 2G3NA 3HLKA 1TEGA 1M05A 4ZUWB 2GSMB 1Y1DA 1EUUA 2YSSB 1LWJA 4UINL 3BZDA 3DECA 3TZVA 4WTXA 1JD9A 1WWWX 2WINA 3GXMA 4I3SL 2AQSA 3TH3T 1A0QL 3FTXA 4YZFF 4M8QA 4HWUA 1W91A 1DVFD 2F68X 1J0JA 2X1XR 4KJPD 3WJMB 3ARBA 1D7FA 3QQ3B 3KPTA 4MJ5A 3GMQA 4FXKB 5JW4M 1P1ZA 5IHBA 4POUB 2VW4A 5I8EB 3GZOA 3VI3F 1XL6A 3DX0A 2VITA 3CXDH 2G30A 1ZY9A 2R0ZH 1TCMA 1DJZA 3W0WB 2F53B 5DS2A 5A3IC 2R2BA 5IMLA 1Q0YH 1J8HE 5DMJB 4P59L 2CGYA 3T4AA 1TJGL 4MX7A 1YQVH 5D1ZD 4R83A 3VFNA 4HOXA 3KVDD 1NSNH 1Q1JL 4XAKD 2J4WH 5IHZB 2IC2A 3CLEH 3WMSA 5LJYH 4OJYA 3S5LA 4JPKL 2CE6A 2XWDA 3GXFA 2FJHB 4EI5A 4PJIB 3RGVD 4JRYB 2DQGH 5ID1B 3QIWB 2FTAA 2GSIB 5GZOA 3MTXA 4PJ5D 5I16A 4P9HH 2GEQA 3RZCC 4B60A 3L4ZA 4P3WA 4L3CB 4UQEA 3UABA 4XVTL 3WAKA 1P5UB 1AD0B 1CE1H 2OTPA 4FKEA 1ETZA 1G6RH 4OUUA 3D4YA 2VJXA 3KAAA 4ORGA 2FSEA 4H1LB 4KRNA 5LAXB 4YSOA 4P5RA 2BHFA 3VM7A 2WTRB 4OD1L 1D7BA 4OZHE 4Z0XA 5BW7A 4O2FB 1A1OB 4HAKA 5CJXC 4HJGA 5EPMB 1J1XH 3QDJE 1D9KC 3IGKA 2P47B 3UIYA 4IBQA 4OZ4A 1N0LB 5F0PB 4ZXBD 4XNYL 2UXGA 4Y0GA 1YEIL 2ID5A 2YGQA 3QG7H 4M5YL 2X9YA 4OZGF 4MD5A 1GYUA 2H3KA 1G7IA 3KGUA 3V0GA 1WD9A 1QKZH 4XRCB 1GXEA 1OPOA 2N01B 4AUUA 1IO4C 4NKDB 5KWYC 32C2B 3BIKB 2APWA 3HB3C 4EUPA 3FQTA 1L9TA 1DQLH 1MVYA 4BKSC 4X8JB 5CBAA 1IVTA 2WLMA 3GB7A 2UZIH 4U33A 2WXJA 2FBJL 4AL8L 1WA2X 3DRQB 1BZOA 3ET9F 3CFMA 4RNRA 3BAKA 3MV8D 3MNWB 2EUXA 2WZ6A 1JGEB 5CIPH 1ORSA 5E2WL 3ARDB 4IOSD 1U93A 5LXGL 3IFLL 1XZWA 3NIFF 3GJFA 4K8RH 5IROA 5AW4B 2GFBB 2WWKO 5AG8A 3WLWC 2VLKD 1HE8A 3ZDYE 4LSDA 1PD0A 2NX5A 5DO2C 3VMOA 2XI9A 4LCWE 4NS0A 2XPZA 3B2UC 5E5RB 1NCNA 5MI0B 3RL2A 4OLYL 5JPNA 2X0VA 1U3YA 1NCCL 3OD3A 4MJHA 4W6WB 5I24A 1L3WA 3C2SA 3OG4B 1U8LA 4BJLA 4Z3JA 4I1PA 3PWPD 1LD9B 3DHJA 5EU6B 4A55A 5FGCB 2BK8A 4BQ6A 5CD5D 5L8LB 4HS6A 2JV6A 3FU5A 3RVXC 2DTMH 5DEJA 1KTBA 3VX0A 4NHUB 3VAEA 2NW2B 1YEWA 4HEMA 4R7DB 2E7BA 1CZ8H 3CN4A 4X5XA 5FCUL 3O45B 3WD5L 3BKYL 3FOLA 3SO3B 2IVFC 3EJZC 5C6WH 4R3SA 3MO1B 3ZQWA 3QJHA 2WXGA 4E9QA 2AAAA 4EI6B 5FA4B 2QQLL 4ZMLA 5JOFB 4LAQH 3ETSA 1L9NA 1RZKC 5GZOC 3K2IA 3HI6H 2IIJA 1GVIA 4NSKB 4OM0L 4G43B 5IQNA 4Z7VF 5H2BA 4XB8A 3TVMB 4Z7OE 1OGPA 2JLPA 4HPOH 3GUTB 1GIGL 2VC2H 5SWZE 2C1PB 1NGZB 4P57B 5F7EH 2O1AA 2CG9X 2I27N 1EAPB 4Y7MA 1R17A 1LVEA 4NQUA 2FJFA 1ZXQA 4XNAA 3CHQA 3RJOA 2EABA 4AQOA 4HBCH 2E9GA 4NO2B 1ZGLB 3BPCB 4P3CH 3T4AC 1V7ML 5AW0B 3OXRA 2D3LA 3S8WA 4NJ9H 2I9TB 3NFSL 2PCFB 3IRPX 3QIUA 4XNBA 2D7TH 4D2NA 3NSXA 3PNRB 1IKNC 4MXVE 4ATWA 3P30L 3K6SA 4ZUVA 4K5NA 3QJTB 2X1QA 2H8PA 3VJ6B 1YEEL 4J3OD 1W0VA 1WK0A 2ZX9A 3GUFA 1WZLA 3NCWA 1XGRB 4PRHD 3M17B 1U8OB 3UZVA 1D3CA 2WJ7A 2VLJA 4HC1L 2CIKA 3RNQB 5MEOB 1OLLA 3VXUE 3GMNA 3FXIC 1L9MA 4ZMZA 3JT2A 2FWUA 4FCHA 4P46D 1CLVA 5JIPA 5ACLA 2F5AL 2CZNA 3MNDA 5J13B 1UHVA 1Z66A 2GIMA 3GWJA 1E5UI 4WFHE 1QHOA 2GTWB 3FCSA 2DQTH 1YMMD 5HGBB 2Q8BH 2XIIA 3MACL 4J8RA 4Y2NA 3SJVD 5EB9A 3IVKB 5F7DB 3KJ4B 1SLVA 2BSDA 5DLMH 3VXRD 1FNEB 3BVTA 4I13B 2L7EA 2DM4A 3SCMB 4KNUA 1FN4B 1GMIA 5EA0H 3FQRA 4RAUB 4FQQA 3JZ7A 2O5NA 3ZHDA 3GSWB 1KC5H 2Q3AA 1G7MB 2GIXA 3BFQG 1EZLA 4FYSA 4XBPA 4FI7A 5I30L 1YYLL 4JHBA 4XMUA 3TBBA 3WY2A 1KWGA 4D9RD 1CGVA 3PJNA 3IJYB 1GGTA 1AVAA 2AI0L 4M6ML 1XGUA 4CMMA 1RZJC 5C3LD 3WKQA 4N0CD 5D2NE 3SDXA 3P9LA 1JTTA 4HIEA 3FCBA 4P2YA 5CCHE 2VQUA 4BH8A 1A02N 4FGMA 4ZS7H 5AW7B 5TDNB 4GRWF 3ZVVA 2HJKB 3GMLB 3P77A 5KSBE 2DYPB 4Z5RA 1INEH 4NO0D 1VGEL 3OQ3B 1DUYB 4U6TA 1RUKL 2H32H 2D73A 2NY5L 3T8XB 1E4WH 2BNQD 4ENZA 5D1XE 5AFAA 3U7AA 3ZTJG 1WYJA 5JPNC 1GZPA 1PW3A 1XDTT 5EF2A 1C5DB 3SDCA 4I9XA 3CFCL 2WLZA 3WFCL 3NZ8A 5GS0L 3WEXA 1NM9A 4ODTH 4JY6B 3PYCA 4DVRH 1FPTH 4KJYB 2AS5M 1U3JA 2X09A 5FUCC 3VFUA 5F1SA 1PAMA 2UYLB 2KLRA 1RSYA 5HD8D 3CFDA 5I5MA 5BZWA 4LEXH 2EDMA 1I8MA 3OC8A 4RAVA 4J2XA 2DKMA 2OULB 4K07A 2WZ0A 1WCBA 3D08A 4QD2E 3DUHA 4B27A 3QAQA 2V7HB 4UIKH 1KLUB 2RCSL 1G43A 2XLLA 3FH8A 3QZOA 1QFWH 5D8JH 3RWEB 5LNGA 2XT1B 3DJ9A 3KGTA 3U2SA 3KXFE 1NEZA 2G3XA 3N0AA 3ARFB 3RWFB 3AWFA 2DQDL 4D0BB 1AXTH 4UNVA 1IGJA 2BXYA 1EO8H 1N8ZA 4KHXH 4MNGB 1MUJB 2ICWA 3B83A 3PY9A 4M7ZB 5DR5H 1F4HA 3TN0C 3BN3B 3HRZA 1NBYB 2BVOA 5CU9A 4TNVK 4JFEB 5C07A 4DETA 1ZHKA 4G1MA 1OK8A 3MJGX 3Q43A 1CUOA 2VZVA 3GC3A 4H8WL 4HWNA 3HOGA 1JV5B 3ILPA 3K0YA 4M3KB 4FOMA 4PW4A 4Z78B 2VNCA 1SYVA 4OGAD 4LFHG 3THML 2WQSA 1UEMA 2DV6A 5IQ9A 1AIZA 2CLRA 2JFCA 3QZWG 4J12A 2VL5A 4XWGH 1XO8A 4Z3TA 1OCOB 5E6ID 1S46A 4PJBF 3JYCA 3NH7H 3QVAA 3N1PC 3C6EA 4TVPL 1JN6B 4XE5B 3IFOA 3M88A 3VWKD 4NCDA 4OD2A 4TOYH 1FZMA 4JKLA 4PGBA 4ZD3L 1VKXB 1G9NL 5DS1A 3HMXA 5E9DE 4DP2X 4ZPTA 2ZKMX 3LKSB 1P53A 3R0MA 4P2OA 4CC4C 1J5OL 4V1DE 1EHXA 3ELAT 4UM9D 4QRQA 3FRPG 3D0AA 4IHOA 4AK1A 4D8OA 3QSKB 3EHBC 5ANHA 3U0PA 1RIHH 1WICA 4LF3B 4XX5A 2AITA 3TCTA 2HTLC 3BGFC 3TP4A 3TPUA 3WEBA 5CMAA 2QZQA 4F93B 1JE6A 1BGXH 1H8OA 1NDTA 1WEJL 5DC9B 3ZE2E 3NCJH 1I8KA 4GW4B 4NNXA 4JO1H 5GSRB 4CAGA 3QK0A 4Q97A 5AOZA 1NFDB 1YMHA 2YD0A 2NNRA 2VSDA 3N43B 4LPWA 4RWYH 3QP3A 3ZKSD 1WD8A 1UD8A 2CCVA 4FULA 4ZBJA 3IJ7A 1ZT1A 4WTQA 3BE1H 1HC1A 4Y19E 2JCCB 1UQSB 4ODVL 2BY0A 4YLCA 2DM3A 2PPCA 1T2JA 1TJHH 5AW5B 3H56A 5C08A 1YEDA 2NNFA 3ISWA 1T7VA 4HUKB 1FG2A 1BQSA 4PG2C 5ERWB 1N59B 2ICEB 2WN2A 1MIEL 5F7AA 1HSAA 3WDHA 2CH8A 5DFTA 1MRFL 4DKEL 1N6QH 1F4WL 4Q6IC 1IGTB 2X0UA 4A7UA 3MLTA 1LO4L 4ABQA 1WIPA 3LY6A 4G72B 3U9WA 2FJGA 4U2YA 1BVOA 3WGUB 4P4KA 4HDIA 4PJEF 1NC4A 3B8YA 3LIZA 2WLKA 4X7SH 5G5DB 1BIHA 1OIOA 4ZAKB 3KYNB 1UD5A 3U0TA 4JM2D 2XPGA 3AQZA 4GUQA 2BVTA 2D9CA 4Y4KA 1MFDH 1NCBH 1Z9MA 2EYRA 4S0TD 1U42A 4WU7A 2PP9A 5K59E 5AOKA 1MCJA 3MXVH 4Y1SA 1OARH 3NN8A 1EEQA 4N6RA 5EFIB 3VI4A 1XFPA 2DI9A 3GRWH 4LRIA 3LKNB 3F7RA 5GRYA 1KT2B 4I89A 5L7XH 4A6YA 1DFBH 4JN1L 5LN4A 3APMA 1LO5A 5HYJA 5D1ZI 1ZGLM 3RLSA 1S7UB 1MLCA 4PJXB 1AGEA 1NMAH 5ID0B 2OL3L 3D2UD 5FS5A 4W68A 4WNSA 1ZLUH 4C83A 5BVPH 4M6OH 3VTTA 3HRZC 1AMYA 2CDFB 5LGHL 4J3WA 4IRSC 4ONHA 1M7DA 4NRZB 3BVNB 3MCLH 2ZXAA 1YQ2A 4PGDA 3EJYC 3RTQD 2OI9C 3OKNA 3PGCA 3QORD 5DQJA 3TESA 5ANMA 4YXLH 4Y16C 5T5NG 2BFVL 2PO6B 4H8VA 4MQ7A 3UJIL 4LE8A 1B88A 1SEBB 2NT0A 3GXDA 2KPWA 1SMDA 4ZX3A 1IM9A 3LKPB 1A66A 5JHMA 5IBLD 1MRCL 1FG9C 2JI1A 1WFJA 1ZJAA 1N19A 1ZVHA 4IRZL 1TKWA 5IB4A 1Z32X 1U91A 4UUJB 3KHOA 5CGBA 2EH8H 3L6FB 4KKNA 2VQ1A 5AENA 1R3LA 1RZKH 1SMAA 3SYCA 3ZL1A 3EYFA 1Z9SA 2ED8A 3GF8A 4KKCD 5LG1A 2YKLL 5EU3B 2UZYA 5DF0A 5DZOA 3C5SA 2VDQB 4QTHA 4KJQC 3UYRL 2BOCB 1FJ1B 4MA3B 4DP6X 4XVUC 3W57A 1AGCB 5BO0D 3GEWB 4HHGA 4AVJA 2PP7A 1CTMA 3DPBB 3WFHA 2ZP8A 4LIQL 1XGQB 5D7JC 1ZLUK 4A7GA 4N0RA 1F3DJ 4G9FA 3M8OH 4PLJD 4AENB 1IM3D 4N0YH 5GGTL 2FHCA 3ALWA 3QDMD 4MSWB 3S5YA 1YZZA 4I0CC 3BSGA 3BDYH 3P4OA 3OKEA 4DPRA 2FR4A 1JHLL 3LHPL 1F4XL 1JXGA 4FP8H 4G6FB 4KGLA 1ZLEA 1Z5HA 3EXLA 1HAUA 3PDOA 3L3IB 4I18A 3MRDB 3UZEA 2ATKB 1AQMA 2B1AH 2P45B 3T0VA 1B0GA 4FABL 5D2LA 4NENB 1CK0H 2I5YH 3AMKA 5AYQA 2BZ7A 3TNNA 4W9EC 4ETYA 2NX5E 4PCTA 3ARZA 4NM4H 2QR0A 3KWXA 1RZFH 4PUBL 1IGCL 3N42F 4QRRD 1N70A 1NUNB 4W4OC 5J06A 1SBSH 4DO6A 3MRMA 3TA4D 1JOIA 1SF5A 1Q94B 5JDSB 1GCFA 3ELQA 4ZW6A 1TQUA 3LB6C 3FO2A 3UOAB 2GUOA 3OAUL 3MGTB 4P4KC 5CGTA 4FL4C 4GBXA 2NXYC 3QUYD 4GQPH 2CCWA 2SEBB 2BZDA 1PCSA 3L7FA 2X53A 3QWRA 3BAWA 2XZQL 1KTLB 1A6WH 2ZF9A 3BDBA 3SPVA 1E7UA 3TJPA 1JF5A 1CCZA 1RZ7L 4PJGA 4KVNH 4Y4KC 2DH2A 2NXZD 4HEME 5C7XL 2GJZA 1E6JH 4XBEH 1U8NA 3EJRA 3FQXB 2PCYA 4MNHB 1T1WB 1URZA 4IKLA 1MFAH 2IAMD 1WT5A 3K74B 1FL5B 3QHZH 5GGQL 3PE9A 3AY2A 3C5XA 4W93A 2A9MH 2BC4A 4PVNA 5JW5A 1PX3A 1DVFC 1JXJA 3GLDA 4LRIC 2J88L 4W9CC 4KJPC 3UG3A 3TURA 1B3IA 1A9EA 3CDGB 1I31A 1ECZA 4HP5A 4P23D 3MKGA 4RESB 4F33A 4K3JL 2WLNA 3BC9A 1HCZA 1RZJH 4EZJA 4X4XA 4HIIA 3R7QA 3KPRB 4YLQT 1PFOA 5EOQL 2EXWD 2NUPB 4MS8D 1E4XL 1HCFX 5E1IA 1S9XB 3IMUA 5TE4L 4NFCA 5MHSE 1TZIB 1ILUA 2DWEB 1PPIA 3FTYA 4JPSA 1JTPA 4XMVA 3RFZC 4U6VL 2LLLA 2R0KL 2Y22A 4HCIA 3VFTA 2OYLA 1MHCA 3V0HA 5I8CA 1PZ3A 2X40A 1ZAGA 3FCTA 3RGVC 4WJG3 3QFGA 3T71A 2CJTA 1R6VA 3WBDA 2P5EA 1CFTB 3I75A 3J2PA 4XNMB 2NY3D 4ES9A 1QBLL 1EQWA 5LQBL 3WHE1 1U41A 3QUXD 2MMXA 4ZOBA 4AC2A 5DMKB 5D1QA 3NSYA 2VLJE 4OGQC 4FYRA 2FGWL 3HLAB 2MPVA 4Y1AD 3ZIYA 2DJ4A 2LOEA 4K2UH 5C0AD 1IGYA 4N8CH 4M7JL 3FUJA 5H94A 4KK8C 3QDJB 4O2CA 4Q9QH 5E5LA 2Q86A 4QHNB 5T3ZL 3P4MA 3ULUE 3FFCB 2XWRA 1WFTA 2Q7YB 1KTCA 4LVNB 2V8MA 4DN4H 3GLAA 2MIZA 3F5WA 4GI6A 4HJTA 3SJVA 4ZXBC 1NLDL 4DP7X 1BXVA 1BZQK 1R3IH 2FECI 3FRUB 5C3TA 3VFRB 2LTQB 3ZDZE 4BFGA 4HLZG 1TCRB 2DTSA 2EILB 5DD1L 3TGXA 3X3FL 2HT2D 3Q3GB 5DURB 5C97A 3B9KD 1YCSA 4EN2A 5L0QB 1LLAA 4S0HA 5D6DC 2VW7A 2UY7B 3UAFA 2NY1D 4N2MA 2HFGL 1SFHA 3LSOB 4R0LC 3BYYA 4UNUA 5FLUA 2XQYA 1KZQA 2FZ3B 1NQBA 1LO2H 3RB5A 4HUVB 3GKWH 4I88A 1IFRA 3BT0A 5FHAL 3CQQA 4NRYB 1PSKH 3O3BA 3EJUA 3EFFA 2CBMA 3MRFA 4I18C 4O4YL 2ZUQB 1I8UA 2C7UB 4N90D 3RB7A 4RIRA 3II3A 2OW7A 3H9SD 3VD3A 3D69A 3CVHB 1T3FA 3KDMA 3EYQC 3ESOA 3RNKA 4CRPA 2VUKA 1HAWA 2I07B 3L95B 5FYLE 5A16A 4G8GE 4YIQA 4JPIA 4MHHG 8FABB 4YK4B 3UYPA 3TBYB 1W0YT 2MJWA 5DUML 3O4LD 1M56B 1TVHA 5CD5C 5HVFB 1GTNA 4WFGE 4X9BA 3FOMA 4HK0B 3HUJA 3BP4A 4JG0L 4XCCH 1U8QA 2NR6A 3F85A 4ZFOA 4OFVA 3D0LB 4R2GB 1DJSA 5I23A 5IW6B 1I3GH 2MPAL 4Y2OA 1KGUA 25C8L 4DEPB 1CE6B 1KGJA 4LP4A 5CEZE 3ECBA 3V5HA 1XGPB 3NTCL 4Z7OB 2J7LA 4OBSA 5CJOH 5DVLA 1YEGH 1QUPA 3V0IA 3ZE0E 4JHZA 5SWZB 2ATPA 5F88A 3MCG1 2MWCA 1BOGB 2A6JB 3C08L 2IPUG 2VDQL 4PIRF 1DLFL 1G4MA 2HRPL 4N8VB 3FT3B 4FA7B 1L3NA 1TNNA 4R7NB 1V10A 3WTTA 1A5FL 1FSKC 1LK2B 3RVTD 3FK3A 5FDYA 1X4XA 1XB6A 1HQ4B 4XX1E 2IQ9L 4UOW1 1UEYA 4MAYB 5ITFB 3MOAL 5C07E 1O9VA 4GRMA 5T1KD 4JRXB 3QARA 4U49A 2NY6C 2A6IA 2FX9H 4OI9A 3HPLA 3ARSA 3G6JB 4S2SB 4Z23A 3HHRB 2QSCL 3ARRA 4OJEH 1A14H 5FYLH 5HYSG 1G7PA 1KGYE 4FQXB 5FWRA 3FU7B 2QTEA 4BELD 3UERA 4J3OC 3RBGA 1MCCA 2EC9U 3OAZH 3UBGA 1Z3GL 2ZOLA 3N04A 5B1JA 1H9VA 2VQ4A 1UB6B 3C5ZB 4PI0A 5D1QC 5KVGH 1NCGA 4WV1A 4QRPB 5JLZA 4NZJA 2Q8AH 4DOHE 4UQ9A 4P46C 2EDHA 1EHAA 5HBBA 2F1AA 1YY8B 1BW8A 1Z5LB 3V6FA 5JIQA 4UIMA 2BSSB 1E2ZA 2CBTA 4HCGA 3SOBH 2C9AA 2LFEA 2FEDD 3HN5A 5JA9A 1OGAB 2IH3A 3QO1B 2VLRE 4BXSV 4UF7C 4LOEA 3TBSB 4AXWB 1FGNL 3EF4A 4ZMOA 2AABH 2NOYA 4AT6B 4GXVH 2MCPH 2QMKA 2O72A 4BD4A 3K6IA 3PQYD 5IWLA 2Q0ZX 3P3TA 4K3HA 2WVVB 3VFVA 1TT6A 2JKRM 1RU9L 5I18L 2XQBH 1NAMB 2OW6A 1V8HA 2GIYA 4LL9A 3V6BR 4AQAB 3Q8AA 5D2NB 3KYMB 3MBXH 1UJTA 5F1IB 1MRDH 4OF3A 4N0CC 2X4PB 4NRXA 1FE8L 2X4OA 3ABMB 5KSBB 5J12B 4LPCA 4LARL 3WUZA 3RAJL 5I28A 4KROB 4KAQH 1DEEA 1VERA 4YR6A 1TZGH 3EYVB 1U8IB 5C08E 4F8NA 2XJLA 3DGGB 3OGCB 4N4YB 1RZIA 2R4SL 3C60A 5GPRA 4AEIL 1HI6B 2BS71 2HRGA 3ABLB 3CZFB 1GYCA 4U05A 4F57H 1MVUB 4KZCA 3MLWH 1HHHB 2HFFB 3M46A 2P52A 1FLRL 4LSQL 3MUUA 4R8WL 3SPHA 5IEHB 2VZ3A 3ILDA 4HD9A 4X80H 1U58B 4JFXA 1M7IA 1UXSB 4NKOB 4Z7UF 5AZUA 2D8KA 1J0KA 4PJAF 3WXVL 2HN7B 1J88A 2XG4B 1DBAH 4JDZA 1H15B 4KXCA 4BFIB 4HKXB 4J3TA 3VI4E 5DRWA 1S3KH 2OR9H 2G9HB 5CD3A 4AH2A 3U7WH 1I3RA 5F0LB 1LDPH 3NEXA 1CB4A 3IKCB 4A39A 4Y4FB 1H5BA 4O02L 1CFSB 2FLMA 4HS3A 1K6QH 1FAKT 2E3VA 3TF7C 3CQPA 2JLLA 2Q1EA 5E1AB 2IV8A 3SGJA 2FEJA 1UACH 2BX5A 1M71B 1J9TA 2X87A 3LH8A 5GS2D 4TS6A 4NGHH 1LO3H 3F04A 1RHHB 2PYED 1S7XA 4BZ1A 2E4TA 3L4TA 4PV9B 4H0LC 2AJ3A 3DX4A 2R1XA 3DOSB 4YDMA 2UVEA 4XAKE 5C71A 4L9LA 1XXFC 3FQUA 3MRQB 4TQEH 4X99B 4PGEA 5CEXA 3B8SA 4L18A 2WQXA 1EMTL 2PCPA 2PW2A 2J44A 5BS0D 1NCIA 2VM4A 2H26A 3PWNA 4QHUA 1CDUA 1NDMB 2RQ8A 2WXKA 4H8QA 3AROA 3GHBH 3CHXA 4JZOA 5HHPB 3SZ6A 5A43C 5ANME 3LZFL 2BP8A 5JORA 2YXVA 1B2WH 4OGAC 5DRXA 1CN4A 3G5XA 5ESAB 3P11L 3AY4A 2C3HA 5F6HJ 1BAFL 1Q9LB 2YC1A 2OJZH 1LE9B 4PAZA 5E6IC 5DT1H 5CO1A 2EDJA 2IADA 3T2QA 5FDWB 3TBWB 5F0MB 4BH7A 5BQ7A 5J1TC 5E9DB 1DDHA 5GGUA 2EE3A 5F3HB 3VWKC 1U3NA 3MRPB 4JM4H 4ZODA 5BCAA 1AR1B 4V1DB 4QHKJ 5KYYB 3W39A 15C8L 1H6TA 2P42B 3IU4L 2VISB 3US9A 4X6CB 3ZN6A 5T5FH 1ZS8B 2EECA 1RK1A 2VN6A 1Z2KA 4PJ6A 4X4MA 4PP2A 2B20A 4D3CH 4PVLA 5EF3A 1FL6B 4KH9A 3QUML 4Z7NE 5IWLC 4KBPA 1NPUA 2ZF8A 4AQEB 1BMGA 1E9OA 2K9UA 2VDLB 3QEQA 1WFOA 3KYOA 1SXCA 4G9FE 5AVYB 1OOWA 4KXDA 4J6RL 3CFTA 4Y19B 4MD4B 2R83A 2E27L 3VXPB 5I73B 3UBXI 2JJSC 3QUZA 1E4HA 4HXAL 4FC3E 3GSNL 1S7SB 1ADQA 4BHUA 1G7HA 4MJ6A 2ZAGA 3LEXA 3MLZL 3ZHFA 3ZO9A 3HCVB 2ZUTA 3STLB 3LV3B 5I1CH 1MCKA 2VLKE 5D2LE 4OKDA 4TNGA 3VYOA 3BWSA 4A7SA 3ROLA 5ALBL 2XFGB 1BD2D 2ZXEB 4P2CG 1MPAH 3PHQB 3Q05A 4XN9A 1NUGA 5ICUA 5C09A 3C6LA 4KRLB 4R84A 4JHAH 3CK0H 4ZUSA 3O6ML 3S3DB 5DCCA 3PWPE 2A73A 3FAXA 3NZUA 2DIEA 4OLWL 3T09A 4JQXA 2EEDA 3K72B 2DQHH 5KSVA 1DANU 1YNTF 3D50A 3K7UA 5EIQA 1M05B 3SKOA 4WO4A 4JM2C 1TTUA 5EUKA 1QTYT 4NOFA 4PJGE 4TQHA 3TZVB 3V6OC 2WINB 3AC0A 5I6KA 4P0DA 1UVQA 1KULA 2Y24A 4M8QB 3NABL 5AYUL 3ARBB 4MJ5B 5BV7C 3GMQB 2DQCH 3VRLE 1P1ZB 2B3RA 1TZOA 1RUQL 2BRRH 3QISA 3JZYA 1FO0A 4XAWL 2F74B 2VITB 3N41B 2CKBH 2R2BB 2KL6A 5IMLB 2VM9A 4S1QH 1KWKA 2NCEA 3MJ9H 2YEZB 3UL4A 3LN9A 4WW2A 2UX7A 3VFNB 2ICES 3JUYA 2YXMA 1KXVA 1V05A 4EEEA 4AKOA 1ZHNA 4KY1L 1WG3A 5HHOD 3TA3D 1OAQL 1X5JA 5HDWA 3N3EA 3O2VH 3Q8FA 3S5LB 5KEZA 2Z9TA 4WI2A 1NAML 4N0UA 5CLWA 4EI5B 4L9LC 3ULVE 3SE8L 4J23A 1BFTA 3VU1A 2N7SA 3HVDA 3L5WA 3RTQC 5I16B 4H26B 2WAQA 1NMCB 3RRQA 2JKNA 4TRPH 2ZOWA 2A9NH 2P5EE 5EIIA 2WOYA 5HI4D 2R27A 3C12A 1ZGLP 1JXKA 3B7RL 1ETZB 3QNZA 3H7BB 4OUUB 4Z7WF 5JHDB 3GSQA 1NCUA 2FBRA 4PB9L 3V8CA 5IBLC 5D1QE 4MJID 1BVKA 3RJDA 2JELH 2FSEB 1IZJA 2ZOKA 3GO1H 3KWWA 1CIDA 2PXYD 2XACC 3EFDH 1T1YA 1EEZA 2R69L 4ZNCD 2DB8A 4Z0XB 3WEMA 3QZPA 2WP3T 4FKKA 4DP0X 4HJGB 2J20A 3GGWA 4W81A 4NN6C 1U4EA 3UJJH 4EBQL 5EBMA 1XSIA 4FKHA 4LHUG 4OZ4B 3CHSA 5K1VA 3S36X 2PCXA 4FHBD 4CN4A 2GJRA 4KKCC 4F2FA 4TMPA 1CO1A 4GW1A 1D5RA 2G3ZA 2BH0A 3SJVE 4JY5L 3U36A 1NLBL 1XBRA 3CDZB 4AYEC 2DIJA 2ERJB 3AWGA 2A74A 1XCQA 3B2MA 5KVFH 4UQAA 1T5WB 5GGRB 4DKDC 1E50A 2XWCA 4EUPB 3T0DA 3T6WA 3E6HA 2VMEA 5AZEL 5CBAB 3GZKA 3JQOB 1YJDL 1NCDH 1SOSA 1TETL 4PLJC 1WAEA 4JFTA 5I74C 1NGPH 2XA8H 1E5BA 4GQ9H 4QR7A 1FORH 3WUWG 2EYSA 2GT9A 3O6FA 4Q9CA 4QJ4B 4X6DF 3ZYOA 4DK5A 1G1YA 1MCLA 1HOEA 3LKOA 1KYAA 5F7WC 3SKNA 3P73A 1U93B 5KVDH 2MTPA 2WK2A 2ZUXA 2GPZA 3SYAA 4X7DC 3GJFB 3BLBA 3QUZC 1YPZE 3C2AL 4J3OH 1BF2A 3ETBJ 1TLMA 4XNZB 5K9OA 2XWBA 1IQDA 2NX5B 3ZHKA 3HG1A 5EZJA 1MNNA 2BHYA 5FYKL 4JO8A 2P8MA 5E5UB 3RL2B 2P5WD 5JPNB 1QNIA 2GBAA 5LWYH 4ODBD 3BKJL 2ADFH 4KX7A 4XP9H 4LBAA 3VGAC 2ZD0A 4ANWA 1U8LB 4F7CA 5B3SB 3E1ZA 4R97C 1FV1A 1QR4A 2BIHA 5JHLL 3CX5J 1SVBA 3IGFA 5IEKA 4P5TB 1MFBH 5IY5B 4NO3A 3I3DA 4HS6B 3O4LA 1BJ1J 3AT9A 1YAZA 5FV1L 4ZI8A 3QUYC 5E99L 3VXOA 4CNIA 1BG9A 5FOBA 3HUJE 5FB8A 4X5XB 5BRPA 2A3TA 3FOLB 1CURA 1F8TL 5FYKU 4FNPA 1OY3B 4R3SB 5T1DH 2NXZC 1WS8A 4P48A 3IDUA 3NJVA 4UB0H 1FAIL 3QIBD 3IDJB 4B9CA 4L9DA 3RDTD 1I7RA 3BPNB 2IAMC 4JPVH 3U1SL 4JRLA 3MRIA 2ENQA 3V0WL 5H2BB 4EZKA 4OTXH 4FA6A 1ACYL 2X2UA 5CEYA 2C9UA 1XZ0A 3G6DL 4P23C 2QADB 5LDUA 4N8PA 4I1NB 5HDOA 2A2QT 1P7QA 1OM3H 1SY6H 1AS7A 5IVNA 4IBZA 2EXWC 4MS8C 4IOFD 5AVSB 3E8UL 3OXRB 4N1CA 3C8DA 3SE3A 5K9QI 2VDNH 2WV3A 4WW2C 5F9JA 1CMOA 5K93A 1GJUA 1R3HB 2EKSA 3NJIA 4BE5A 3MJ8B 3QIUB 5DDHA 2VDLL 5B8CA 5IGXH 3DK0A 3VXSB 2WNWA 2X4NA 4GKOA 5GHWL 4E42A 4GKZA 3K6SB 4K7PX 3D39A 4ZUVB 4EN3A 2H8PB 4O9HL 3S6CA 1CR9H 4O51A 3V0JA 1W0VB 5DSCA 3A4FA 3SKMA 1XXDC 4IK7A 1GYAA 1L0YA 3LJ3A 4OAWA 3UZVB 4B5ZA 2ZT9C 2NY3C 1LWHA 1IBDA 4MAZA 3EOYG 4KDWA 1HL5A 3E9TA 2NRDA 4M48L 4MZRA 1JMZA 3Q2NA 1KB5A 4FAAB 4EIBA 4PJ7F 3ZTNH 3CJJA 2EC8A 2HUEA 3ZK0A 1WVZA 4TULH 3L3DB 2IWEA 5L2KD 3LX9A 1RD6A 2R0LL 3MBEB 4HJUA 5HTSA 1MCFA 3WDIA 1OHZA 3DURA 3FCSB 5J1AA 3WEOA 2OMTA 1AHMA 1JGVL 1UZGA 3CZKA 4ONGL 5DZNA 4J8RB 5TDPA 2BNUA 2WSPA 4IDLA 3ZDZB 3NCCB 2BWQA 3RBSA 3NIGF 4GAGL 3FUDA 2Y7OA 3AU0A 1P6AB 2ZPKL 4FI6A 1OAZL 4XC1L 2HT2C 4XBPB 3P0YH 1JZ8A 3B9KC 5EC2A 4BK5A 4RGMB 2WSDA 2OJEA 3OJVC 5D71H 1XGUB 2R23B 4CMMB 2V3EA 3ATAA 3SDXB 3P9LB 3EDJA 4BH8B 3TT3L 3V9FA 5MP6H 3O6FC 2XTJE 2AEPH 4BFFA 1P7BA 1BBDH 3CN2A 3HMWL 3P77B 4S1SH 1P4LA 3VGFA 5T1JA 1JYNA 4Z5RB 2CJUH 2DYRB 2NLJA 1U2CA 3M45A 4N25A 3X12A 3MR9A 1A1MA 4HSQA 3VSUA 3L17A 2ZUSA 4GP5B 5JPMA 3MLRL 5T8IA 1EBAA 1JDAA 1GZPB 3IPEA 4XO9A 4ELDA 5FK9A 3ZDXE 2R0WL 2XY2A 4YUEH 1JYWA 4TLKA 2VDMB 3SDCB 1AXIB 1UD3A 5DD3L 1XCWA 3QPXL 4HFWB 4U6YA 3NZ8B 1HS6A 1A7PH 1VZGA 2XKSA 5IVZA 3WEXB 4EKJA 3NJKA 3HKZA 4AC4A 2BSBA 4RGOH 1S7RA 3KS0J 3VFUB 1U6AH 1PZUB 1ID5I 3A6CL 1KCUL 3CFDB 3AUWB 2FLRT 4WU5A 2AQ2A 3K91A 4RAVB 1WCBB 3PAUA 4QKTA 4D7BA 1RUMH 1KGCD 1XF4A 1A6ZA 1CQKA 1Y6NR 4MA1B 4NZTH 3ZE0B 2Z93A 2HPOA 3VSVA 3FUMA 1GS7A 3U2SB 1KXTB 1NEZB 1PZBA 2HLEB 1BJ8A 3UG5A 4N2EA 1UWEL 2EADA 3WL9A 1P6WA 5IIEA 3S3SA 2P28B 1N8ZB 5DYOA 2ICWB 5KANG 1HIML 1QSFD 3RU8L 3WKYA 2X4UA 4WHDA 4NUGL 5D7KE 4C8XA 1LL1A 1VEOA 2WBWB 3QQXA 2QKIA 1I3VA 4KPHH 3S5ZA 3T6VA 2PYEA 1HHKA 4JX0A 3RVTC 5C07B 1MQKL 2BFGA 3CFIC 4G1MB 5BJTA 3SE3C 3GSVB 1EZUA 2J1WA 2IH9A 1GZHA 3HS8A 4BV1A 4ANXA 2HAZA 2CJ3A 3NDYE 1P84J 3WN5A 4P07A 3ILPB 3U6RA 5HI5D 5B1AB 3TO4D 2PTVA 4HJ0D 4K3DH 2AC0A 1ZEAL 4HIPA 4NKIL 5MEPA 1N5YH 4YHZL 5FX3A 4B9IA 4EN3C 1SYVB 2V3DA 4H44C 5IQ9B 2AV1A 2CLRB 2HFEA 4Z6AT 5BPPA 2AJXL 2VL5B 2A9AA 4HSAC 4XT1C 1Y18A 2ZKHH 4K4KA 1U8JB 2V5TA 2W65A 3VXTA 2EIKB 4HS8L 4A37A 2LV4A 5I0ZA 4DOHB 2A9DA 3ZQXA 1ZTMA 3N1GC 3VD9A 1KCRH 3IFOB 3CSPA 4J3UA 3WTYA 4OD2B 1FZMB 1BQHA 4PGBB 2RFXA 1JRHL 1E67A 4ZPTB 1T7ZA 1HT6A 3O41A 3OXSA 3J07A 1BFVH 4P2OB 4Q2ZB 4WIQA 5I1EL 1ES0A 1SHXA 1HNFA 1UURA 4QRQB 5BV7H 3TPKA 2BJMH 4IHOB 3FB6A 2FEDC 2J8OA 4UT9H 1XMEB 3P0GB 3U0PB 5FGBA 2UWEA 3EO9H 5T1LA 3RDJA 5A7EA 2IF7A 3LQAL 4U0QB 4X4ME 3CVCA 5J7CC 3DX2A 5CMAB 4WGVB 2GI0A 4OLXL 4LBEA 5AKTA 3MNVA 1AY1L 2EACA 3DTXA 1X4ZA 4XMZA 1KV3A 1U8HB 4XMWA 4DUWA 1I8KB 4UOZA 1X5IA 4HUUB 2ED7A 3QEQE 3K4ZA 3IMRA 1YMHB 3MV9D 1I85A 3QDME 5F3FA 5I8KH 1U3HA 1VDGA 4HK3N 1MAMH 4DTGL 1QSED 3RWCA 4QTIL 2Y2WA 1VFBA 1PKQB 5ADOH 1LDSA 4OIIL 5IJBC 1DTUA 3QCUL 5HDBE 1ZVYA 2VDOH 4OD3L 5C08B 1YEDB 5I0WA 2EVJA 4JFZL 1FG2B 5KYXA 5H35B 3S3CB 3H8NA 3TYGL 2WO4A 1HSAB 4PW9A 3HTLX 2Q9OA 3JVFC 4MZ2A 2YA1A 2DLFL 3MLTB 2KDGA 1PD1A 4QXUL 2XOTA 2FJGB 5E4EB 3UCQA 5C09E 4WY7H 2ENYA 4HDIB 1NC4B 2K0RA 4JJHA 2W94A 3V4PL 4AGOA 4FD0A 3BESR 2WYZA 4HQQH 2W92A 1AQDA 4JO4H 2SODB 2XJKA 3U0TB 5CHNA 4F3FA 4F37F 2XPGB 5TF1H 1FFTB 1SBBA 3JTBA 1NANI 2AVFA 1AFVH 2EYRB 4YFLI 3BT2L 4FZEL 1GZQA 4OZFH 5C8JA 2Y6SD 2LHAA 2RJMA 3HS0C 4S0SD 3NN8B 3PGFH 4N6RB 1EEYA 3SBRA 3VI4B 4Z7AA 3BLKA 5KS9F 3IMBA 3S34L 3TV8A 3WTXA 5D7IA 5DFVD 1U92A 1BQLH 5DHVA 4LMQI 3WSQL 1ZA6A 4DGYH 4J4PD 1LO5B 5HYJB 1S7TA 3UTQA 1DQMH 5I1GL 3CSBA 1C5BH 1AOZA 3CFBA 1MLCB 4HBQA 3LD8C 4KY2A 5B21A 1AGEB 3M1BA 1M6OA 3GTVA 5E9AA 1NICA 3BSZA 3GYRA 3ZDWA 1KTJA 2XBDA 4C83B 1SF3A 1MCDA 1OAYH 2WUCH 1WIOA 1GW6A 4XBMA 3QZMA 4JY4B 4NP9A 5GSVA 4ONHB 3TA3A 1M7DB 2MOVA 4XVJH 4ZMVA 3QAZB 1S7VB 2LR4A 3QXDA 2PMZA 1E2WA 3LQMA 1L7IL 4PGDB 1NAKH 4N0UE 3S36L 3OKNB 1J5CA 3PGCB 5DQJB 2P44B 5ANMB 3LRHA 1W80A 1JZ6A 3I9AA 2IDFA 3D18B 5TH2A 3DSFH 1IM9B 3FU6A 4Q0XL 2WXMA 4UI2A 1F45A 1FNHA 2VGLM 3WOVA 5B1CA 1TKWB 3GDCA 5EOCH 3WKMH 1DVTA 4JGJA 1U91B 5C1MB 1LP9E 4Z1PA 1R5VA 2KC0A 3EH2A 3V55A 1DSWA 1BF5A 4NC0B 2VQ1B 4HZAA 4UNIA 3T04D 2W1NA 5D7EA 3EYFB 1Z9SB 3D3VA 2W0PA 5LBSH 1YHPA 4L1HA 4PLKD 4QTHB 2ZWNA 3R1GH 1J1OH 1DR9A 1OE3A 1HZHH 2AJVL 2WXPA 3QEGH 2WP3O 1QZNA 5INCA 5EZOH 4Z7NB 1JK9A 3WIFA 4X5RA 4IMKA 3LS5H 3ZZQA 5A6MA 3VI3A 4UTAA 1IKFL 1R0AH 4G9FB 1DLHA 4FQ1H 2QJDA 5KBKA 3L5IA 1UASA 2F53D 2AQPA 5EU5A 1S5IL 2VXVH 4IKIA 2R2CA 3BHBA 5J6HA 3D06A 3EAKA 3OKEB 1I85C 1EGJH 2CRZA 4B9GA 2FR4B 1U3HC 1ZV2A 4XVSL 1YN6B 2AHIA 3L1FA 3B6SA 2LW3A 1DDTA 2F54A 1MJ7L 4N9GA 4JHWL 5EBGA 1B0GB 1QEWA 2YZ1A 5IMKA 4M4RB 5D2LB 2K45A 3HAEH 4MASA 2MCG1 1GGBL 4JRYD 5D7SH 2B0SH 1J5HA 3TNNB 3KPQA 3QIWD 2YAFA 2DLIA 3HG1E 3CN1A 1E3FA 5IQ7H 1SDAB 4Y2DA 3MRMB 3K46A 2BM3A 3COOA 3L5XL 5E8OA 2F58L 1SEQL 2Z8SA 1F97A 1OSZB 2C9QA 3FO2B 3GXUB 2GUOB 4K3EL 3ARGA 4YWGH 3UPRA 4MDJB 1OZTG 5TJWK 3FONA 4GBXB 4NBXB 3SGDI 1IFHL 2WANA 1Q72L 1N0XL 3L7FB 3O4LE 3LXUX 4R5XA 4XPGH 3QI9A 3SPVB 4X4ZA 1CLOH 4OF0A 4PJGB 2YGOA 4OQTA 1YNKL 3MOQA 4DKTA 3M7FB 3BDXA 2FLBT 3UTPD 5KJRH 2GJZB 2L4OA 4N68A 4TF4A 3GJEB 1U8NB 5DJ0B 5DK2B 4MWFA 1E43A 2CK0H 3FZUD 4BWWA 3PCYA 4N2OA 4OZGA 2BC4B 4F1SA 2W0FB 3ZJAA 5JW5B 1W72H 2DIBA 4LVOB 5DK0A 4K7PL 5KVEL 1A9EB 1FYHB 4F33B 4G5ZL 1WFNA 1T20A 4PS4H 4X4XB 2XKUA 4HIIB 3HC3L 4Y8DC 5IMOA 1TR7A 1TF4A 2CUHA 2IFGA 4HV8A 3QW9A 1AZVA 3GM8A 4NP4H 2I7SA 3EYUL 3PJSA 1TLKA 1SOKA 4K23L 4ZX5A 5DC2A 5IV2A 2Y1YA 3GMMA 4UU9A 1A7RH 1I8IA 3TA3C 1U33A 3ARDD 3VFTB 3OZ9H 1MCEA 4LLVB 3VD5A 1MHCB 5AB2A 3ZR6A 3D33A 2APVA 3FCTB 1I9IL 3MBWA 3D39E 2LU4A 3SDAA 2JI2A 4AJVA 3LKQA 5FHBL 3VU2A 3I75B 1E90A 2X3BA 4M1DL 2E7HA 2W8CA 3DX9A 4L3EA 2KZ1B 5HI4C 2G75B 4JG1H 1ML0A 2DQJH 2F6AA 3BUBA 3OC5A 2A77H 1MHPL 1ZPLA 3O3UN 3SKJL 3N50A 1AR2A 2BS8A 1IGYB 3Q8CA 5EU6D 5I6PA 1FFRA 4OF5A 2PXYC 3VRIA 1DSFL 5H94B 4O2CB 2OP4L 1PG7H 4RDBA 2Q86B 3QRGH 1WQVT 1P9MC 3P4MB 4I9WD 3QEHA 1MEXL 1QUNA 5F97E 5T5NF 4KV5F 2R2EA 4KI5D 3F5WB 4PJ9A 1SJHA 4AM0Q 4PJHE 3F7VB 2A7BA 4RAHA 2LU5A 2YQBA 1CFVL 1QLFA 1R34A 2Y1VA 2ARWA 1JNHA 2KDYA 1JIBA 4FEMA 4Z7VA 1CGSL 2OMZA 2DQEL 3TVMD 1ILSA 2WQWA 4YHOH 2Y0SA 3PXJA 3QXAA 4KU1A 1R3KA 1Q0EA 3KPMA 4HWEL 4LCCA 3FS9A 3I9GL 1JPTL 1W15A 1X5XA 2V5YA 2YAOA 1KENH 3QFJA 4XP6H 5JYLA 2FUQA 4DESA 3HNSH 4XB7A 5KUKA 4LNVA 1JWSB 3CBJB 3PIQA 4P2RA 5JQHC 1TDQA 3RL1A 2OX5A 1CL7L 3HEIB 4LRNH 3RA7L 4Z95L 3QCTH 2CNZA 2Q7AA 1WA0X 4WW1B 3NCEB 4HVBA 4FLRA 2BSEA 1R47A 2Y2YA 3O3BB 3K6NA 4P2QA 4RIRB 3G5ZA 1IAOA 3D69B 3H3BC 5JQ6H 3B5HA 1A7OH 1QAWA 4NAMA 3LZNA 5LCVL 3RNKB 1HEZA 1MJJA 3TTSA 1C12A 4BFEA 4PJDE 4ENED 5ABAA 1GOGA 4JCLA 2QHRH 4JPIB 1QLRA 2JQAA 3MUZ1 3O0LA 1P5VA 4F80A 2ZSVA 3UYPB 1O9ZA 5IT2H 2VN7A 2W9LA 4HHAA 3PGDA 1RL1A 2EXTA 3BI9X 3BUDA 3MA7A 3HUJB 3BP4B 4HIXL 1UH2A 4E9LA 1U8QB 3CXHK 4ZFOB 5I1LA 4GLRI 3SDYL 2WBJA 2XTSA 1OAXH 4LCIH 1A3RH 2ZWZA 4U3XA 3CMOL 4Y2OB 4OCLC 3CC5B 5KW9L 1E3XA 2JK5A 1Z1WA 1J9CT 3ECBB 3V5HB 1KY6A 2QGCA 2K9FB 4Y1TA 3QIBC 3LS4H 3RDTC 1X9LA 3SCMD 1UM5L 4GQZA 3A3YB 3X2QB 1EDHA 4CSTA 2ATPB 5F88B 3U1PA 4EE2A 3N44B 2ZCLL 1V3JA 2EE0A 2OZNA 1ACXA 2HVKA 5B4MD 4HX1A 4Y5VC 4C57C 1YNLH 3QGVA 3OHXB 3GHEL 1YYCA 1WISA 1NA8A 1FYTD 4NCC2 2VDRL 1HESA 2PYEE 1I8LA 1NIBA 4GRMB 4AEHH 3LPWA 2J6EL 1QX1A 1N10A 1J9SA 4JLRA 1RURH 4BZ2L 1LGVA 2PNDA 1DUZA 4FZ8L 4HKJA 2A6IB 3L16A 3HPLB 3UO8B 2XV6B 3RY6A 2WLIA 3FTVA 1G7PB 5DGRA 2C5DC 3O6LL 4F58L 4YHLL 4QY8A 2GYSA 4O58L 4Y5XB 4NZRL 4MQSB 1MELA 2ZOLB 4XXWC 4GH7B 3HNTH 4WV1B 2V7NA 5JLZB 1OOAA 3B9AA 4MCYA 4DQOL 4JZJC 2AEOA 2FUTA 1C8PA 1EHLH 1YECH 3ETTA 1ZVNA 3V6FB 4L8BA 3FQ2A 4WTZG 1UKSA 2A9BA 2FB4L 2XWZA 4F9PC 1AHWA 1KTRL 3MOBH 5EBLA 5I6NA 1YEFH 1E5ZA 2C7FA 2IH3B 5GJTH 3A0OA 3N9GL 2VDPB 3U0WL 2VR6A 1MW1A 2UWEE 4F7EA 1M6UA 3FCGA 2NTSP 1J7VR 3OX8A 3VFVB 3MVSA 5E8NA 3ARFD 2I69A 4WQOA 3TEXA 1OCWL 3WFBH 3OV6A 2EH7H 4G7SB 5EN2A 3P02A 1KN2H 3P9MA 2QV4A 4PHZA 1EPFA 5E95B 3HI1B 1T2QH 4I0PA 2XTJB 3QS2A 2K3TA 4JFED 4LU5L 4NRXB 4OFPA 1UT2A 2WVSA 2X4OB 3H3PH 5J6GB 4HMCA 4XP4H 2A99A 2A6KB 4GG6F 4DGVH 1UCBH 1UD6A 3RPBA 1F90L 4YR6B 1DEEB 3HNVL 3DYPA 3C5JA 4IOIA 1GGIL 1RZIB 3FFOA 3C60B 4AG4H 4WO0A 3TBCA 1QYGH 1T83C 3EYOA 3D25A 5DJXA 5ECJE 4RX4D 4AIXA 3SPIA 2EEXA 4FQLL 4XN1A 2CO3A 4U1JA 3WIAA 4JL2A 3VTMA 4PJBA 3KNBA 5GS1C 3W9EA 1LMIA 4G71B 1H3PL 2GCYA 3DMMA 3GIVA 4RWHA 1M7IB 4FNSA 2VJ8A 1HINL 1U2YA 3WKPA 5F89A 2BSTA 3VD4A 2YUZA 4JDZB 3NJFA 2XPYA 4JQIL 1D6VL 2FO8A 5DRWB 5B38A 4FQJH 5IHLB 5CD3B 3ROOA 4C56A 3T0WA 3KR3H 1MZYA 4AH2B 1I3RB 2IFFL 3CH8A 1J5IA 7PAZA 5D7IE 1HZLA 1B4JL 1N2RA 1JZ4A 3PAZA 1H5BB 1DVQA 2J2ZA 4HS3B 4KQ3L 1KB9J 4KXBA 2OYMA 2AJZA 3RPIA 5BRZA 1IC7H 1AH1A 3DWTA 3Q01A 3ARYA 2VLMD 4LSRH 4ONFL 1KGWA 5T3XD 1HCVA 4L2YA 1IAKA 2JJVA 3Q9QA 4LMQE 3W37A 3N6YA 1A1NB 1AOHA 1S7XB 1TPXC 3QJQB 5K69A 2DDQH 4HLJA 5AB0A 2AJ3B 43CAA 2R1XB 2EC9T 3BJLA 5AL8A 5ABDE 5CEXB 3FQUB 4UT7H 3BKCH 2J1XA 4IGBA 4KXZI 4HC1A 2PCPB 1CXIA 2PW2B 3GTTA 2WVUA 3PWNB 2H26B 3HFFA 4QHUB 4QO1A 3JTTA 5HI5C 1ZIAA 4JZOB 4YDVA 3C75A 4WWKB 1WFUA 2BP8B 1KJ2H 5CN3A 4J3SA 5D93C 5DRXB 5DEZA 3LZPA 3CXDL 3G5XB 4N2GA 1PIFA 1NM4A 2QL1A 2R0ZL 3ATBA 3AMLA 1Q0YL 2VRKA 1AS6A 5T3ZD 1QASA 4DKFH 4PJEA 1JTOA 2XFXA 4ZFFA 2IADB 1YQVL 2WYTA 4QWWD 4ZDHB 4BH7B 4Z3HA 2BMKA 1NSNL 4RBPH 2ADGA 3SYOA 3WHXA 1DDHB 5GGUB 3DSNA 2J4WL 1SJMA 3CLEL 4ZAKD 3KPSB 1EXGA 1G87A 1PZCA 1AD9A 1JBJA 2IANA 1CYGA 4CVZA 2YSSA 4H13C 3D3VE 4G82A 3VVWA 3AU1B 2DQGL 3G5YB 2ENPA 4H25A 4IM8A 1OHQA 4P9HL 2QFRA 1RK1B 2VSCA 4E9RA 2ZOUA 4GXFA 3M1CA 4KUCF 1U0QA 4YZFE 5C0DA 4PP2B 5CCKH 3VWJA 4FG4A 1CE1L 1V5JA 1G6RL 2VUYA 3BQVA 1R19A 4FXKA 1M2VA 1KG0A 1E9OB 1OKEA 4AL8C 3VI3E 3QEQB 4HU8A 1OM9A 3K5SA 3KYOB 5BZXA 1P6FA 2PWHA 1YC8A 3W0WA 4AV5A 2YS4A 2FHBA 2V9RA 4L1SA 2EEAA 4OCNC 2OR8A 1J1XL 5BMFH 5IREA 1ZD6A 3SHSA 4OFYA 5SWSB 4M93B 2KMWA 2YAEA 4I0PC 1U4FA 3V6ZA 2GABA 3Q48A 2E75C 2J8UB 3QUZB 3QG7L 4F7PB 2XTLA 4PRBA 5B3JE 2VDKH 3MLUH 1G7HB 2F54E 4MJ6B 3LEXB 4BGLA 1R24B 4X6BA 3FT4A 1BM3H 3RWJA 3WLBA 2GG1A 1QKZL 4GSXA 3QZLA 2FIKA 4CW1A 5LGYA 5C86A 2D7PA 2PO6D 2EIEA 2QKSA 3ROLB 3WKNA 3K0WA 5CS7A 2E7CA 1DQLL 5C09B 3RUGB 4DP1X 2XQ0A 3C6LB 1EIBA 4MYWB 1F00I 1KXHA 4RBPK 2UZIL 2WN3A 4MLIA 1NTDA 2R4RH 4ZUSB 3T0EE 1P69B 1I9EA 2N4IA 3O6KH 2A73B 4R9HA 1HJCA 3PV6A 4DH2A 4YE4H 3DMMC 4DGWC 1KPVA 4WO4B 5C3IA 3STBA 4B41A 2AK4A 4K8RL 1JZFA 4AQZA 3IGLA 4OV5A 2Y6SC 1N0LA 2CCLA 2DH3A 3NGBB 1UVQB 3I02A 2AAVA 4E9XA 3FQYA 4K94H 5I71B 2EDDA 2XSKA 2CGZA 3GMRB 5E2VH 3L3OA 1MWAH 4CBPA 4OZGE 3VD2A 4FADA 2HT4D 1QFPA 4GEJA 4PS8A 4LEOB 1CGWA 4J4PC 1EHNA 3VVVA 5H37A 32C2A 1M57B 1M53A 3BIKA 3MFGB 5G55A 1YDPA 2G2RA 2MEJB 4ODHH 1LILA 2DTML 2Y7SA 5ACZA 4NZUH 2HKHH 1OP4A 4XCFH 1CZ8L 3LVEA 1ZHNB 4UNTA 3DRQA 4RMRA 1IGMH 4J3OG 3VGBA 1HN1A 4YNYA 3MNWA 4G6FD 1A6UH 4LAQL 5D72H 4DFIA 4N0UB 5EDSA 3HI6L 4YDIH 3H2WA 2PF6A 1DVYA 3ULSA 4HG4K 3L5WB 2F15A 4GRLA 3CX2A 1MW3A 4HPOL 2QZ5A 5ICXA 3QQNA 3FN0H 2LFGA 2FEEL 2VC2L 3MCKA 5F7EL 2DM2A 2AXHA 2J5LB 2GVYA 3S37H 2XN1A 3GSQB 4JFHD 4X7CC 3ABKB 1A8JH 1BVKB 1KCLA 2P80A 3QA3A 4HBCL 2ZYHA 2ZOKB 3KWWB 4P3CL 1T1YB 1LD9A 1MNUH 3OR6B 3EOBB 2WD0A 2LU7A 4NJ9L 3NFNA 1GHFH 3JWNC 3JWOC 3GGWB 1ASOA 4HZ1A 2D7TL 3SGDH 9CGTA 5EBMB 2NW2A 5FKPA 4R7DA 2H2SD 4KK6D 3HFMH 3DLQR 3ILEA 3IDIA 4GW1B 4M6NH 4EI6A 5J89A 2IBGA 5JOFA 4PLKC 3DNKA 4P05A 3NBNA 3U36B 4B53A 1MJ8H 5TE6H 1P4BH 3IJHA 4UTCA 3TEUA 4L4JA 3X1FA 1KIRA 2A74B 5EV7A 4UBDD 4Z7VE 4OZFA 4DO5A 2W9EH 5DHYA 2AJSH 3OSVA 4FXKC 4UT6H 2XN2A 1QP1A 2W88A 2YPLA 3LIUA 5E6UB 3KPRD 4R4ND 4X4KA 4CGTA 4LVHB 3QFJE 1OZUA 2Y4SA 4HGMA 1NJ9A 4KO5A 2G3MA 2EYSB 2GT9B 1HSBA 3O6FB 4G8FA 4P2RE 1ZGLA 2DQTL 1ZA3A 2IH1A 2O30A 1CFBA 2Q8BL 4PD4K 3LKOB 3SKNB 2D2OA 4AITA 1I9RH 1V3MA 2VJ0A 2NY5C 4KDVA 1B4RA 4A66A 1NMBH 3V4VA 4A67A 2DPKA 5DLML 5LKNA 5A6LA 5F70A 1A7QH 5K9OB 2XWBB 1IQDB 5EA0L 5HVHB 4B9KC 3IETA 4N3TA 1UYWH 3HG1B 4JRFA 2BERA 1OO2A 2P8MB 3IN2A 4WSJA 3VB8A 3T3MF 3QIWC 1DANT 1SPDA 1BYNA 2H2PD 2QGBA 4JEGB 2COVD 1FV1B 4D9QE 2QSVA 2W0LA 1P5UC 1A9BA 3VNYA 1CVRA 5MEOA 5IEKB 1I3UA 4ZUTA 2AJUH 2K8QA 4NO3B 1JDCA 4LGPB 3ECQA 1G1KA 1MQ8A 4KX8A 2IDSA 4ZS7L 4G42A 4M8RA 3VXOB 4CNIB 4QRAA 4JGNA 3QDJD 5FB8B 5FOBB 1SYSA 2NPLX 3BUTA 1XIWA 1UGKA 3FFCD 4ODXA 1INEL 3KWTA 1HFUA 2MOGA 2GY7B 3PP4H 1BLIA 2R1WA 1KGCE 2YFOA 4WEBH 4X0KA 2VXSH 1E4WL 1I7RB 1T0MA 4XHJD 3KYKH 5F7UA 5FO8A 4OH2A 1PIGA 3MRIB 4GAAA 2OL3A 3WDJA 3L3OC 2ZYIA 4TQ8A 5CEYB 4X98A 1AC6A 1QTPA 4DN3H 1XZ0B 1QLEH 5DURD 4KMTL 4ODTL 4X0NA 1P7QB 4DVRL 1FPTL 5I19H 5L4FA 2V17H 4AMKH 5FEBA 1CT8A 3DOIA 1MCIA 1KCSH 3LNDA 2Y3AA 3CE1A 5K39A 4ABVA 5IB5A 5JHBA 3PS6A 4LEXL 5F9JB 3MJ6A 4OF7A 2EKSB 4KFMA 3JSSA 4Y9EA 5DDHB 3QUGA 5B8CB 1C08A 3IBOA 2MOQA 4ZW8A 4UIKL 4QGTA 4GRWE 2X4NB 2CUAA 4ODSH 5FF6B 3BEWA 2HJKA 3GMLA 3HG4A 1QFWL 4E42B 3D39B 5D8JL 2DYPA 3O3EA 4O51B 3H2PA 4IRZA 5DSCB 3SKMB 2YRBA 1USQA 3VGGA 3MKKA 2YRPA 1AXTL 4OAWB 1EO8L 1KGIA 1ZANH 3APNA 3NZSA 4KHXL 4QI3A 4NI3A 4MXQD 5MI0C 1OVZA 1OCRB 1NUFA 2YMOA 5DR5L 1C5DA 1T03H 1JZ3A 1J11A 4KRMB 3S4SG 1GGCH 1TMCB 3MV11 4KJYA 2GJPA 1NBZA 3VQ1C 1DBMH 1R9FA 4P5MA 1ORQA 4EMZA 3DURB 4PQXA 2BVQA 5J1AB 2I26N 1FL3A 2OMTB 1VENA 2AW2A 4WUKH 1C5CH 4R2GD 2EEFA 5TDPB 4OZIF 4OZHF 4FQHA 5IZ7A 3L4CA 3ZL4H 4KI5C 3SO3C 4GLRH 2ZXQA 1VRSA 5ES4B 4N28A 4JQVC 4APQD 1KPUA 5GGTA 4OIBA 2XN9B 1E8YA 3Q8BA 4XWGL 4YAQA 3D34A 1QFWM 4HAGA 1B9KA 1T7WA 3NH7L 4WSGA 5SWZD 3RWFA 3BAEH 2ZWKA 4FHJA 4UDUB 3TVMC 1B3JA 1GC1H 5ENWB 1RVFH