3FONB

Crystal structure of the class i mhc molecule h-2kwm7 with a single self peptide vndifeai
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
100
structure length
100
Chain Sequence
MIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC
publication title Predominant occupation of the class I MHC molecule H-2Kwm7 with a single self-peptide suggests a mechanism for its diabetes-protective effect.
pubmed doi rcsb
source organism Mus musculus
total genus 14
structure length 100
sequence length 100
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fonB00
3F58L 1KJ2A 1E4JA 4FABH 1G7HB 1L7TH 3TN0A 3F12B 1BX2B 4YQXL 2I9TA 4OT1H 4MQXC 1A7BA 2IG2L 3VFOA 3WUWA 5ACZB 3AVEA 3C60B 1MRCH 1F00I 1HHJB 5FGBC 3UZVB 2MKLC 4JRWA 3QAZC 4HBCH 3RVVD 3RWDA 4JO2L 5CCKH 3VFGH 1OPGH 3WS3B 3K8MA 2YA2A 3L3HB 4XNQA 3IF1A 4P4KA 3VDCA 4BM7A 4WENB 1NUNB 2FO1A 2AEPH 3UBXB 3D0LB 4PYHA 2ZUVA 3PP3K 1N64H 3FO9B 4XNUL 1NLDL 4MQXD 1BJ1H 4O2CA 1KV3A 3IDNB 3DRTB 2DWEB 2NTFB 1DEDA 1TPXB 1H3UA 1A21A 1JHKL 4DZBB 3RDTB 1JP5A 1FG2A 4B7IA 1Q94A 4LSVH 4GXUN 1G6RL 1KLGA 1J0HA 2FZ3B 4LP5A 3S97C 4J3UA 3LV3B 2E8YA 2YXFA 1JMXA 1MWAB 1U8IA 3Q1SH 3S5LB 4R4NC 3M17B 2XQBL 2YD7A 4PJIA 3ZDXF 1NCAL 4JCMA 1AJ7H 1MEXL 2W65A 1HNFA 1EERB 4OCWH 3DHMA 3MXWH 2QSQA 4R9HA 5I66B 1XGQB 5F6HJ 2C26A 1GGCH 4EEEA 4Z7UA 3QUYB 4HDIA 4U6VH 2VWEC 3U7AA 4HV8A 4CU7A 4K23L 4N9GB 5DC4B 4R4ND 1CLYH 1FNSH 2DQUH 4OGAC 1NC2A 2NY3B 3GRWA 4Y2DB 4UILL 1NCDL 1EJOH 3NIGF 1G9NL 4HKXA 1L0YA 3VD5A 3ZDZE 3HC3H 2BNQA 4XMLL 4OLVL 3BEVA 2AKRA 3SE4C 2NNAB 3V6OA 5D7LD 3U6RA 1JV5B 4KQ3H 1GHFL 4R7NB 3WKMH 1E6OH 2H8PA 4GW1B 1F13A 1FNEB 1F6LL 3CDGA 5GSVB 4E0RB 3QUMH 4NUGL 1PG7X 1SVCP 2AERT 5C08B 6FABH 4OLZH 1DBKH 5I1AA 5HVFB 2R8SL 4H88H 1YN7A 1T89C 1ZA3A 1NMBL 3QFDB 3HNTH 4JZJA 3PABA 1N5AB 1RU9H 1EGJL 2X70A 4NGHL 3KPOB 1SYSA 4R8WH 3JVGA 1MCRA 3O3AB 5IG7A 4O02L 4OF0A 4NKMA 1NDGA 4QXUH 4NYLB 3LKPA 4AL8L 1BECA 1S7RA 5EO0A 3UJTH 5FYKH 4M1GH 2OYPA 4EUPH 1C5CH 1KB5L 2FJGA 2Y5EA 4PG9B 5EUOF 1RK0B 1S7UA 2CKBB 3QG6A 4U2ZA 3MRPB 3NAAH 3MBEA 2FHBA 2Y5TA 1RULH 1N7ML 3IFLL 3KHOA 4W4NA 3L5XL 3QCVH 3RWHA 3GGWB 1D7FA 1MFBL 1QLFB 1QRKA 1QPXA 1MQ8A 3LQMA 1CD1A 2Q1EA 2B5IC 2Z35B 3X11B 2VDQH 2H6PB 3F7VA 1MF2L 4Z7QF 4ZSOA 4N0UB 2AXFB 4KJWC 4I0PC 5TDNB 1RHHA 5EA0L 3K46A 2AJZB 1OTUC 1FFNA 1DEEB 1UH3A 1H3XA 2VAJA 3T3PE 4NRYB 5BXFB 2BVYA 5FO8A 3IDXL 3O2WH 4WI7A 4XCNA 1CE6A 1R3KB 4NKDB 5I18L 5EU6A 5IJKA 1YQVL 5L88L 5ESAB 3ARGA 3O4LA 1BD2D 3VJ6B 2D7TH 3ZT6A 3O4OB 2YBRA 2EZ0C 4HFUL 5I17A 3V5DB 4BSWA 1U8JA 1Z0MA 1T5XA 3ILQC 3QPQC 4ALAH 5I6XB 4KJWD 5DQ9B 1N6UA 4PGJA 1BZ7B 1FNGA 1OTUD 3MRQA 1G6RB 5KJRH 3UJIH 1AGEA 3IRPX 3CD4A 4PG2A 3V7MA 5J57B 3LMJH 5A2JH 4LCUB 1YNKL 1U8QA 3CVIL 1CT8A 4HPYL 5D96C 4HK3J 4MWFB 1AD9A 4M8QB 3JV0A 3STZB 2FL5A 3A0OA 1IZJA 4I18C 3ILQD 3QPQD 5C0EA 1NMCB 5D9SA 1I4FB 5C0CD 2HRLA 2DRUA 3GK8L 2A74B 1UM4H 5CD5D 2NZIA 1RUKH 2HFGL 2IADA 1W0VB 3FONB 4JKPH 1C5BL 1MJ8L 5BQ7A 1A6WL 1JWUA 1JGDA 4QHUB 3MUZ1 4JM2C 3AFLA 3STLB 3HZKB 3EAKA 4X4ZA 2E7CA 1EZVX 5DHXB 3CCHB 4ODTH 4R4BB 1OCWL 4UV7H 1SHMA 3I9GH 3OKDB 1SM3L 3PQYE 3K1DA 4X6EB 1LP9A 2IBZX 5FUZL 4RAUA 3FB5B 2OTWB 5CEXB 1FV1A 2GKIA 1HILA 3U7YL 3WUWG 3GMPA 4IBLT 1I8KA 4XP5L 1JI2A 4I1NB 3NACL 4Y1AD 2N1KA 1OB1A 3WNKA 4JM2D 3NIFE 3KYOA 1FG9C 2D9QB 3LIZL 4MGXA 1WLHA 3M1BA 3JV4B 3DTXA 3MRIB 1G0XA 3TM6A 3WHXA 5F7DB 3QDJA 3FL7A 4WW2A 2OL3L 3MLZH 3X12A 1L7IH 3CSGA 1TCMA 5DMIH 2Q8AH 1AKJB 1CXEA 5C0BA 1I3UA 3HZVB 4XWOC 2YPLE 4BFEA 3TA3C 3GO1L 4MD4A 4X4ME 3U4EA 5DURB 2HWZL 4M5ZH 3VFTB 4NDMA 4RGOH 5D2NB 1ULVA 2XWTA 4PTUB 1O7VA 4R3SA 3ZKSD 1B4RA 1CICC 5D7JC 1G0DA 4G8IA 4BH8A 4KXZH 1MFDH 3O9WC 4M48H 4W6XB 3S3JA 5DK2B 3QZWA 2DJSA 4TUOA 4EXPX 5HI4D 3HE6A 5DZOA 5FHBL 4ONFH 3LAFA 1ZLVH 4XWOD 3LKNB 4FN0A 1UWGH 1A7NH 1X5JA 1D5IH 1RJZA 1ZLWK 2UV3A 4GKZA 4RISL 1CICD 5D7JD 3RX7A 1B0GB 4AYFA 4WWKC 2KZ1B 4LLYB 3VXRD 3EOTH 2NMSA 4HS3A 2IAND 3EO1A 3ISWA 1D5MB 4IRZL 1OP5K 3I2CH 2FSEB 3PUCA 3FB8A 3GI8H 3BIKA 3FFDB 3MBXL 1T1WB 4WUUD 4MB5A 5J6HA 5IVXF 3M45A 4Y0GA 3G5VA 3MUHL 2HH0L 4I0PB 4RSVA 4J2XA 4K8RC 1OHQA 1BFTA 2O61A 4WWKD 3UPAA 32C2B 1HHIB 1V8HA 3RI5F 5T1KA 1SEQH 3WE6B 12E8L 3QFJB 3MJ9L 1GGYA 1JF6A 1JHTA 1G7QA 2YK1L 4U1MB 1WC7A 5SWQB 3H6JA 1WIUA 5EFIB 3BN9C 1HQ4B 1U8LA 2V2XB 2YPVH 4MA8H 4NQSA 4YHOH 2XXCB 2GSIA 3VXNA 4M3KB 4WU7A 1FQ9C 3SJVB 4Z7OE 2ESVA 3DX7A 4NUJB 4PGEB 3ULVH 3O2DA 4K8RD 1WBZB 1B2WH 2Q6WA 2G9HA 1RMFH 1T20B 4PUBL 3D85B 1L6ZA 2ICWI 4K8RL 2NXZD 3VH8A 5BS0D 1E28B 5E8NB 4JR9L 3CH1A 4XHQA 4C56A 5K9OB 2FEEI 1AP2B 3IU3B 2A9ML 3HN3A 3WIIH 1S7SB 1YQ2A 4PV9A 1U3HA 4JPWH 1HH6B 3AU1A 1BBJA 5IB5B 1A9BB 3GKWH 4Y5XC 4I18B 4JRXE 5HHQB 3MUGB 2BNRA 4AIOA 3MUY1 3BRDA 1S9YB 1YNLL 2JE8A 1OAUH 2W60A 5A3IC 3KPRD 3V5KB 4JFHE 4M6OH 1ZT7A 3MCLH 1H5BC 2CUIA 2OL3B 4E9LA 1N4XL 3U46A 3DUSB 4PJBE 2AJXH 2ZCLL 1KJ2H 2E7LC 1FGNL 3BAEH 4KK6C 4OIBA 4JEGB 4MXWL 1T1YB 1WVZA 4HXBL 43C9B 5BRZE 5MP6L 2QADD 5MERA 3PHSA 5T3XH 5SWZE 4Z0XA 4E5XB 5L7XL 4FRWA 5DK3A 5IKCA 5CSZA 3X3FL 1BJ1J 5IQ7L 4PRIA 4N8CH 4GW5B 4JVUA 3VXPA 2UZYB 3G6AB 4GG6E 2CRIA 3MZTA 2XZZA 3PDOB 1MCKA 2PO6C 4EI5A 4B5EA 3PNWB 1P7QA 1NANH 3E1F1 4LSTH 3X14A 4NSKA 1T1XB 4KK6D 4R26H 1BFOB 2ADIA 4ODVH 3IFNL 4P46B 5TE6H 3UZEA 2E8ZA 2Z4QA 4PGBB 4EDWL 1AGFB 2DTMH 2ZCKH 3QG7L 4O4YL 2ZSVA 3TA3B 1DBBH 3HZYA 4G7VL 3JV5A 4RWYH 1CR9H 3BP7A 4CVUA 1JNLL 3SN6N 2QQQA 1BIHA 2PO6D 3EYFB 3P0YH 4KK9C 4NO2B 3D3VB 5GGSB 1JPSL 3VFUA 1FH5L 4DGYL 3UPRA 3O9WB 4ZFFB 3DVFA 1HDMA 4N8PA 1P4BL 5J89A 4N90E 4YHYB 2JK5A 4GOSA 3WL9A 4OZFH 3V4VL 2Z93A 3ZZ1A 4KMTH 2JJWA 3QA3B 3ZT5A 2YWYA 4EVNA 1KEGL 4L1HA 4NKQB 5T3ZH 3EDDA 2HJLA 3CUPB 1TZHA 2ADJB 4OLXH 2YUZA 4OQTL 5EZJB 3GSOA 3NPSB 3S3SA 1OAQH 3VFWA 4GBXD 4KK9D 2XRAH 3GRWH 4Z0BL 3MRFB 3BP4A 5D1ZB 5KVFL 4LQ1A 3PWPB 1QLEL 1SY6A 2GTWB 4DUVA 1G1CA 1ZGLB 3NH7H 1QSFB 4JGUA 1ZANH 2DQIH 5ECJE 1I7ZB 4I2XA 4XVUD 2XKNB 1GGBL 1CLCA 15C8L 1F3JB 1LE9B 1SJEA 2Y23A 4U0RC 2C4FU 3GSXA 1DQLL 1MPAL 3SGDI 1DBMH 5EWIH 4ODHH 4F9LA 1R5WA 4QRRD 3UTZB 1NGQH 3CSBA 3EBAA 4NWTH 4WFEE 3F5WA 1FSKC 2Z0BA 5K59F 1WWWX 3MRJA 4MAUH 3P9MB 3B6SB 5DJ8A 5LGHH 5GGVH 3GSWA 4PRBB 1MLCA 2NY6B 3IRZA 1XR9B 3L3KA 3QZWG 5E9DB 5HGAB 5C0AB 3O8XC 1EFXD 3TLRA 5ALBH 1MCLA 1TQBB 3SEPA 2Z8WC 3I3DA 1DFBH 5F8QC 2M26A 1UZ8A 1WTLA 4OJFL 1DQDH 2W1NA 3IDJB 3OF6A 4OF3A 1NQBA 3V0WL 4CVXA 2A6IA 2EIEA 2Z92A 3O6ML 4JHZA 3MR9A 4UT6H 1ZHBA 2Q76B 1T21A 4L4VD 4QRQB 2MFNA 4X80L 6CGTA 1YY8B 2UWEF 2F15A 2V9QA 4XBGB 4FTVE 4OCYL 4TULH 5AYUH 3DVGB 1MFCH 2E6PA 2DIJA 2X1XR 4JFFE 4Y5XB 5JHDD 5F1KC 2PR4H 5ISZA 8FABA 4PP1C 3OKEB 5LXGL 3DX9B 2DS4A 2W0PA 2IJ0C 1W0WA 3H42L 3V5HB 2A0LC 4KZEL 4WHYG 1DBJL 1T6VN 4OZHA 1ZSDB 4QEGA 1CDBA 3ARDA 3RIFF 4DN4H 4CVZB 2GJ6B 1FZOB 4IOIA 3QO0A 4GUPB 3I02A 3FFCA 2A6DA 4GAGH 1H5BB 4WFHE 4OSUL 1NBVL 1IRAY 1A4KA 4MD0B 3GSUA 1MI5D 1R3IL 2KQNA 3B9AA 1IQDA 3SDXA 3QIBA 4KHXH 3W9EB 3S34L 1I3GL 4PP1D 4L3CA 4Y88A 2UVFA 4D8PB 4Q2ZA 4M6AA 1TZIB 2A0LD 4YLQT 3GFUA 1OAYL 3ZL4H 3VH8G 1LEGB 3HNSL 4LPUA 5GRYA 4JFQA 1J1PH 1VKXB 4LEXH 4WTZA 1H3PL 2IPTH 2J8UF 2YEZA 2DDQH 3FRUB 3J7HA 3MJ8B 2Y4SA 3D9AL 3MV9E 3TZVA 4PRHA 4XVSH 2MCPH 3CFBA 1AY1H 5DSCB 3WN5C 1S9XB 2DQCH 4AQOA 5KSAA 3FTGA 1NC4B 1MELA 1HH9A 4B50A 3I6LE 3LS4L 2BVQB 4XCCL 2CK0H 4XMPH 4DKAA 1JNNH 4JLRB 1EK3A 3RJQB 3ZE1E 3VXQB 3VFNA 3ROLB 1CGUA 1TNNA 2VIRA 3H9YA 2OCFD 3QWRD 5J0BA 4ODUB 1JPGA 4OKVB 1DVFC 5ID0A 2G2RA 2LE9A 2WMPA 1U3JA 4FQXA 5DUPL 4E41D 1IC4H 2F5AL 5INDA 1OAZL 5SWSB 5D1QA 3TBWA 1UKTA 3O3DB 1CQKA 3C6LA 4CJ0A 5JA8B 1P69B 3WMSA 1VADA 4WIQA 2BVPA 4YHZL 3ESVF 4PJDE 3D87B 3SDCC 9CGTA 2R0LL 1MCIA 5CJOH 2ATPA 4PREA 4ZPTB 4YR6A 1VHPA 3V6ZB 1J87A 3QEHB 5KSVA 3UTQA 4OZIF 4O2EA 4D0DB 1H8SA 1QTYT 4HMDA 4LLVB 1MCWM 5DA0B 1DVFD 1I9IL 5FECB 5I16B 1BMGA 2ZPKH 3GSNL 3W82A 5D6CA 4ISVA 3JZ7A 5D93B 3TWCH 4QHMB 5CGMA 2X40A 4RMQA 1V3LA 1BWMA 1QOKA 3DSNA 5FYLL 1QQDB 1FJ1B 4FS0A 4XCFL 4U0RB 3SDCD 4GRLA 4JFZL 3AY4C 3MRHB 5JR1H 4OTXL 5EN2B 3RU8L 5F7EL 3L5IA 1EO8L 3OAUH 1N6QH 5GGSY 4FQQB 5DQDH 4HS6B 2YC1B 3VXSE 4XVJL 5KN5A 3OKNB 3KXFD 5J7CC 1RJYB 4QTIL 4Q97A 4DGVL 3RZCD 3SQBA 3O3BA 4MQSB 3O8XB 2FWOB 4JGMA 3MLUL 2AJYL 1CDYA 2XQYK 4PLJC 2JB6B 3GSVB 2HG5A 3VCLA 3AB0C 3FT4A 4UV4H 1IKNA 2YZ1A 4JJ5B 5CHNB 2VLJE 2XZQH 2YZ8A 4GW4B 4TSCL 1A4JA 1BP3B 2DBLH 1CGWA 1F4YH 5JO5A 3OXRA 2G5RA 3DROB 4JFYA 3WFDH 1V5JA 5C92A 4GRWE 4KK5C 4LSPH 1LO5A 4PLJD 4XMKL 1INDL 1OP3H 2IPUK 4BQCA 1H3VA 3IJSA 1C08A 4Q7DA 3SDDD 1REIA 4KZDL 5C8JB 4UUJB 4NNXA 3L3DB 4OZGB 4YO0B 3D2UA 5KVDL 1OARL 3R8BB 1XF4A 4ZFOL 5KW9H 4V1DB 3V4UH 7CGTA 1TQCC 3BDYL 4WHYH 3SGEI 1CFVL 1ERNA 3SE8L 3DXAB 3N85L 4TRPL 4KK5D 3HCVA 1CYGA 3VD3A 3T77A 1MCOL 3D39D 1CFQA 4U6HA 1PSKH 3SKNB 1WICA 5IR1B 1MJUL 4K55A 3KVQA 3O2DH 5DK0B 4CL7A 1ES0B 3IXAA 1P4LA 2ZCHL 4JFOA 5BVPL 2ORBL 2E27L 4OCNC 1IEBA 4J8RA 4UIMB 4XC1L 1H0DA 2F58L 3T65B 3ZDXE 1U8NA 4LF3A 2IQ9L 1PX4A 3LKRB 5DT1L 5EOQL 5H94A 2BRQA 4YDIL 2VXVH 5FYJH 1U58B 1CL7I 3F7QA 4TVPH 4APQC 4MJIB 1RUMH 4Z95L 2YD5A 1E4XL 3VG0L 2QKIB 1HSBA 2FCBA 1T0NA 4HUVA 1SMAA 5GGVY 1IM3A 1HN1A 4KDVA 2BERA 3NABH 2DF3A 2EH7L 1T1ZA 2FJFB 5SX4H 3D25B 2EKJA 1FVCB 3MV8D 3NA9H 3IJYA 2Y25A 1KJ3L 3L3GB 2IAMA 5HI3D 1KOAA 5HYQB 1CU4L 1M7IB 4KI5F 1QSED 3PGFH 3QUZB 5HYJA 4JO1L 2BSRB 4PJAB 3RWCB 3NIGE 4RIRB 4U2YA 3SKMA 2HT2D 2VLRE 3TIDB 2D7QA 3TT3L 3QIWB 4APQD 3D48R 1CVSC 5I76B 4M9PA 5INCB 5C86A 3U9UA 4UDTA 3VG9C 1RURH 2MPAL 4P59H 1U8MB 4RA3A 4RGNB 5E6ID 3T0VA 1V3KA 1KTKE 1C1EH 3VGHA 4CUCA 4WTZG 3PQYA 1U91B 1DN2A 2X4SB 3EYUH 5J1TC 3T0XA 4PJ5E 5BZWB 4OCRH 1R3JB 1N2RB 3S37H 1URLA 5DI8A 3T0DA 5CJQH 2OP4L 4NZUH 5EULV 1TJHH 3BWAB 1A6UL 4X99A 5IB4B 3WFEH 1RZGB 5JQ6H 1R0AL 2CR6A 3EJZC 1ZEAH 4KJQC 3BPOC 5GSRB 4UT9L 2IMNA 5GHWL 2FEDC 1A22B 2Q8BL 5LGJA 4FABL 1OSZB 3RWIB 5I0DA 1L7TL 4G42B 1FVEB 5EC2A 4IM8A 5HYSA 4OT1L 4TNWK 4PRPE 1WITA 5T1LD 2ITDB 2UZXB 4X4MA 2R9HC 1PKQE 3QQ9C 5JW4N 1MRCL 2CLRB 3RL2B 5IW6A 5C0FA 4HBCL 4Z7QE 1Z9OA 4IS6B 1WWBX 5CCKL 3P4OA 3PDDA 4GG8A 1OPGL 3VFGL 3WS6A 4XP9H 1LE5A 4ZFOB 3DV6A 3I3EA 1DQJA 3UTSB 2FEDD 5D7KD 4FNLH 1BIIA 4GAYB 4HT1H 4JPVH 4LLQA 5DRWA 4JKMA 1N64L 1CGTA 2X4UB 4RNRB 5C6PB 5J6GB 3QXAB 3R0NA 1NCNA 3EOAB 1SY6H 3IJHA 4U1LA 4ZNCD 1CDUA 5DJ6A 1QO3B 1NFDA 4H26B 4CADB 1IQWH 4LSVL 3AREB 3L5WB 4P2CG 4Z9KB 4ZUUB 5ICZA 3W39A 3Q1SL 3CSYA 4XGZB 1FFRA 1NJ9B 1LQSR 3OKOA 1TVHB 4R0LC 4F33B 3U9PH 1LD9A 3NPZB 5BW7C 3BGMB 1OW0C 1AJ7L 4L8CA 1AXSB 4S1RH 3RVTC 1TQCB 4PBXA 2CDEA 1JL8A 3ROOB 4ZUTB 1KSRA 3MXWL 3OXSB 1TCRB 3ECBA 2XTJD 3N1QC 4M7LT 3V6BR 1GGCL 5IHUH 2V5YA 4U6VL 4IHOB 5M7QA 3HE7A 5I74C 1I8MA 3AGVA 1ZLVK 3BZEB 1CG9B 1CLYL 1FNSL 1MJ7H 2BFVH 2DQUL 2PYEB 3CLEH 4PBWD 3ZTJG 4A2MA 1T04A 2DQJH 1M4KA 4CAGA 1EJOL 3HS0A 4J6RH 5CJ8A 1YMHB 1Y0LB 3HC3L 2CUHA 4R2GC 2P49B 2V5MA 3RVTD 5KSBB 4KQ3L 3VXOA 4WO4D 2X10A 2OXGA 3OJVC 2VLKB 2NX5E 1KT2A 3BD3A 3WKML 1E6OL 1IFHL 4NQED 1KLUA 1YY9C 1QR1A 3QUML 2EXWC 3ARRA 4ZUVB 3MNWA 4WI4A 6FABL 4OLZL 1DBKL 1DP0A 4PJ8C 4H88L 2GFBB 1G9EA 1ZHNA 4L8DA 5D2LB 5KZCB 2YD9A 3HNTL 2K7QA 4PLNC 1S7QB 1B6DA 4Z78B 2DIBA 4IRJA 4R2GD 1FN4A 1RU9L 5FYKD 1NBYB 1ZMYA 3ZLQC 4R8WL 4GMTH 5FUOH 1YEKH 3FCTB 3FQNB 4QCIA 4QXUL 3FKUS 3EDKA 4Y16B 3QUXB 3UJTL 4X5WB 4EN3A 5FYKL 4M1GL 1VGKA 1YY9D 3MLTA 4JRXA 5HHNA 2EXWD 3QEQA 3SGJC 1ZWIA 1C5CL 3C87A 5C3LD 1J8HE 3EJYD 4QRSB 3MRCA 4NN5B 2HT4C 3H9SE 1FL5A 3UTPE 2GUOB 1FP5A 3K7UA 1X7QB 4NBZB 4JDZA 3VRJA 3RP1A 3NAAL 4JFEB 1CDCA 4UAOC 3SPVB 2X4QB 3IU4H 1KCLA 1RULL 4UQ3B 4JVWA 4D9QE 3QCVL 4S1DC 4IMKC 4PJBA 1DL7H 5DS8A 3QYCA 2VDQL 1X5KA 1X5FA 3VXME 2DM7A 1RIUH 3SCMA 5HVHC 2P44B 3KNBB 5SWZA 5AEAA 5E2VH 2MQ3A 2F54A 2EXYD 1U95A 2HT4D 3MREA 4QF1A 1MCPL 2D7OA 3O2WL 4NM4H 4LKCB 4GG6A 2A9NH 4L8BA 1NUDA 5FV1L 1H9VA 3MLVH 1TENA 1FPTH 4S1DD 3HRZB 3UTTA 2D7TL 1EDQA 3MACH 2Y72A 3RL1A 1BQUA 1MFEH 4LDOB 5L2KD 1G7MA 3ARFA 4WCYH 4ALAL 4P2RD 1A9EA 3DMMA 3JSSA 4EDXA 4G8GE 4LSRH 3VRIA 5KJRL 3UJIL 2X4OB 1FIGH 5IP4A 3LMJL 5IVXE 2EYSB 2B1HH 1R5IB 5GS1C 1VDGA 3CFCH 1GPOH 1F58H 4P49A 2JIXB 2YUWA 4G9FE 3IKKA 4AH2A 5JUEH 3VU2A 1D5ZA 5I75C 3CU7A 5FA4B 1TJGH 1UA6H 3B9KA 3TVMB 3V2AR 2QQKH 4JN2B 2EH8H 5FUCE 1MCFA 5MHSD 1ZT1A 1LO4H 1UM4L 3K81A 4F3FB 5C6TH 2XN9E 1D9KB 5A2FA 1RUKL 4PR5B 4JKPL 1Z6JT 3H8NA 4OF5A 2LTQC 4NQCE 3T2QA 3IDIB 1QACA 3B9DA 4P2QD 2BY0A 4RDQG 1S7VA 1I1YA 3RY4A 2Q7YA 3ARUA 4ODTL 2FECL 5D5MB 3BD5A 4UV7L 4F80A 4R0LB 5I2IB 2AXGA 2R1WB 1A3RH 2P5EB 1E27B 4NKIH 3I9GL 4OLYH 5MI0B 5DYOA 5I8OH 1JWSA 5HYSG 4HKJB 4DFHA 1F11A 1CGXA 4PV8A 1R3HB 2P48B 4XP4H 3RPKA 3QH3A 5D4QA 4OAWA 3I6GB 4FQPA 4LIQE 1MIMH 4NPYA 1KPUB 5L8JB 1YN6B 2ZSWB 1EIBA 1P1ZB 4X4XA 1JZ7A 3S35H 4ZO9A 5E94A 5LVEA 3ZTJH 4TPRH 2GEEA 1VFAA 4TYUA 2D31B 1AIFB 1FLTX 2IPKB 3MLZL 1L7IL 4PFEA 1CZ8H 4JRYE 3DX8B 5DMIL 4EUPB 2Q8AL 4P2YA 2RFXB 3OAZK 4NO0D 4QRPD 5GQBA 4XCEA 4HD9A 1SYVA 3ZE0F 1IAII 3BEWA 2RGSA 4S11A 2MCG1 3P30H 4M5ZL 2DAVA 2VZTA 4RGOL 5A1AA 5MEND 5HXMA 4NQDE 4PJ8B 2EDQA 1MFDL 4LBEB 5C0IB 1MUJA 4M48L 4YJZL 3VGFA 4Z7VE 5JDSB 4FTVA 4MJ6B 1PQZA 2AJ3B 4ONFL 1ZTXH 2HFFA 5K93A 4KKCC 3EOBA 2BRRH 4JFFA 2A6JA 4G8FB 4YDKH 1F90H 4X6FA 1L6XA 1UWGL 1I9RH 1ITCA 1A7NL 3NFSH 4MNQE 4A6YL 1D5IL 1KXVC 4YNYB 4TUJB 3KLAA 2ATKA 2EDRA 4KUZH 1J1OH 1X5AA 3Q0HA 2CDFA 1DQQB 5E5MA 4P5TA 5D7IB 4KROC 2VDNH 5EU3A 3EOTL 1Z5LB 5ACMA 3I2CL 4ZS6D 2H41A 1S78D 4XAWL 3GI8L 4KKCD 1HYSC 1OGAD 3ULVC 5DJAA 2BK8A 3QHZH 4X9IA 3HZMA 5FDWB 1NGWB 3VFPA 2AXHA 4IIQA 3OAYH 4ZFGH 4FXGB 5HGHB 3GB7A 5L8KB 3MCKB 1V7MH 4I4WB 1RUQH 3V7AE 5ELIA 1YDPB 5C09E 1XH3A 3E6HA 4KROD 1SEQL 4LFHG 3W0WB 1HI6B 2I25N 3BRFA 2XA3A 3VE0A 1SJHA 5EU7C 2EIBA 1HYSD 2YPVL 4MA8L 3MV9A 1I7RA 4DUXA 3ULVD 1HHGB 5D1XB 3S4SB 2IFGA 4CN6A 2DYPA 4KKNA 5DFVD 3HG1E 4JDVA 5HDQH 3ULVL 1YECH 2GT9A 4C59B 1B2WL 3VXTA 3WLWD 1UWXH 3GSQB 1RMFL 3BWUC 4HFWB 3MRGA 1HXMB 4HGWA 1DLHB 1EEZB 2PTTB 4KMQA 5IFAH 1VB9A 3FJTA 2C9AA 3PL6B 2AK1H 2OJZH 3D5OF 3CIQA 3WIIL 4D9RD 5I75B 2JKXA 4Y8AA 4LMQI 3CDCA 2GITB 4JPWL 5E8PB 1BEYH 3IS1X 3GKWL 3UBXI 4Q9CA 1DLFH 4AENB 1OAUL 4EI6B 5TQ2H 3LSOB 3T0BA 2JCCB 2VAAB 3WXWH 4P4KC 4M6OL 3MCLL 5CWSA 2C3XA 1WFOA 1XR8B 3WFCH 3TN0D 5GRXG 4V2BA 5DJCA 2XWJB 5IBUB 1TIUA 2AJXL 5ETUB 3H9ZA 4WU5A 1KJ2L 5T3XD 3BAEL 1UJTA 4WEBH 1KGCE 4YEFA 1CE1H 3KG5A 2UWEE 5T3XL 4HJGA 2NYYD 1CFSB 1S7XA 2G5BB 3BI9X 3W2DH 2XA8H 4U1SB 4N8CL 1CVRA 4NQVA 4P4KD 4XXDB 5CFHA 2WINA 3RAJH 2VKWA 3K2UL 3VXSA 4MVBC 3CZFB 2EDXA 1NGZA 1X5HA 2OX5A 2VE6B 1Q0YH 4UNUA 4X9BA 4LSTL 3MFFA 3REWB 2IH1A 4R26L 1HHHB 4ODVL 3ORJA 4F7EA 5TE6L 2DTML 2ZCKL 4A6YB 4WV1A 5IV2A 4X9GA 4L9LA 4U1IB 1DBBL 1AO7B 3QCTH 2APWA 2VLJA 3DYMA 5LBSH 1ACYH 4RWYL 1CR9L 4Z6AT 2H3NB 4JFPA 1ORSA 5D7SH 2BOCA 3P0YL 4MVBD 4G80B 3V6OC 1SVZA 2XIDA 4OCMC 4PJXF 4XH2B 3U0TA 4HH9A 3GIZH 3FT3B 2B39A 4MNGB 4JANB 4OD2A 2J8UE 5T3ZD 2UVEA 4KMTL 4UBDC 4PJCB 2QQLH 5I1HH 4YHKH 3P4MA 3VI3F 1G7IB 1NC2D 5T3ZL 1OP9A 5TJWK 2VL5A 3MJ7A 3J8F7 2VQ1B 4OLXL 4G5ZH 4JZJC 4KTDH 4CRPA 1OAQL 1YNTA 3C9NA 3MRRB 2BNQD 2WUCH 2XRAL 3GRWL 5MEQB 3P9LB 3ULUF 1B0RA 5CJBA 1KNOB 2OTUB 5DRNA 3ZSSA 5DEGA 3JVGC 3NH7L 3OGCB 4XBEH 3FB7A 1ETZB 3VMOA 4WFFD 1IVLA 35C8H 1ZANL 2DQIL 2ZUXA 1MLBA 3ES6A 1A02N 4KRPB 4UBDD 4Q9BA 1HOCB 5F1IB 1DBML 5EWIL 4ODHL 4HAFA 1U2CA 4XBPA 4DAGH 4JO3H 1NGQL 3QIUD 4NWTL 4PTTA 4HULB 3MV7D 1Q9LB 3MBEC 2AW2A 4MAUL 5IMKB 2R0KH 3JTSA 1ZVSA 5HY9B 5LGHL 5EH1A 3DOSA 5AD0B 1KJVA 2C7UA 1M7DA 5GGVL 3RVXC 4LVOC 5ALBL 4PJEB 1B3JA 1NAMA 4YBHA 1ZHLB 1RI8A 1DFBL 3Q3GA 4KHTH 1ADQA 1KIPB 4OZGF 5I8CB 3OR7B 1KIQB 1YJDH 1WBYB 5C07E 1RHFA 1DQDL 4LEOA 4WTXA 1F4AA 4PJHE 5JOPD 3MBED 2ZOKA 3ZYIA 2YKLH 3UYPA 4G9DA 3E6FB 4LMQE 5IJKC 3X3GH 5CKAA 3ARGC 3RVXD 5IQ9B 4UT6L 2VDOH 3EOYG 4PB9H 2VLRA 5DHYB 2CLZB 1C5DB 1ONQA 3ARQA 4TULL 5AYUL 4Q6IB 1MFCL 3RKDD 5E24E 4JY5H 3DRQA 3VFMA 3WUWB 2W9DH 1Y6KR 2Z91B 4HUUB 3TCLB 2PR4L 4PG2C 1KACB 5CZXC 1UCTA 4G6JH 3QXDB 1AD0A 3C6SA 2CUMA 2O5XH 1JN6B 5EU6D 1CBVH 3S36H 2L4OA 3R1GH 3IVKB 3O4LD 5FKAB 2BNUA 3GJFK 4LCWB 4U1HB 4XNQB 4DN4L 1JGVH 4GAGL 3KLDA 4PJ5A 3MX0A 5I15H 3MRNA 3QNXA 3RIAK 2CMRH 4KHXL 4MA1C 5IB2B 3EYOB 5CBAB 4ZYKA 3FOLA 1HZHH 5CZXD 5EUOA 1KLGB 4PJAF 1DUYB 2C3WA 2AQ2A 3ZL4L 3NMEA 3NCBB 2YD6A 2VN7A 4PP2B 2F74B 1J1PL 1AFVH 1UXWB 4LEXL 2IPTL 3HR5A 5TFSH 2DDQL 3MJGX 1JYWA 1WCBB 2DM2A 5H2BA 4OZFB 1PKQA 4YBQC 5B21A 4XVSL 2MCPL 1AY1L 5E7FA 3LQZA 1MRFH 3BQUA 4J12A 2DQCL 4N0RA 1FFPB 3FB6A 3VXRA 3V52H 4KY1H 2GSGA 3GIVA 2IANA 3TNNA 2F53D 2CK0L 3RY6A 4XMPL 3T4AB 1JNNL 5DD1H 3RWGB 5ICXA 2QSCH 2IWGA 4WUUA 4HKXB 4WW2C 2V7HA 3LZFH 1JK8B 3PWNA 3PWUB 3KPSD 2ARJB 4R97B 2ENSA 5JW3H 4YBQD 5EOCH 1IC4L 3PHOB 4YK4C 1FNHA 1Z9SA 1X3DA 4ONHA 3DX6A 4K3GA 3DURA 3FQTA 1DZBA 2L7JA 5CJOL 1FGVH 4NJAH 4FHBD 4PRAB 2GTZA 4P2OB 5KS9F 4J23A 4DCQB 3GMOA 1JZ8A 4V2CB 2R23A 3FOMB 4GAFB 3HE6C 4N0UE 5C0BD 2ZPKL 5IEKB 1KCUH 4KI5E 3MMEB 3TWCL 4YE4H 5F7FA 4ZUSA 3LPGA 2ERJB 4BFGA 5GGRB 2AEQH 5CJXA 4WI6A 5LGKA 1S7UB 4UOW1 5DD0H 4AEFA 5BCAA 5B38A 3NIDF 2I60H 1O0VA 3QHFH 3OAUL 1N6QL 1NSNH 4XWGH 1FZMA 4ZDHA 5DQDL 3VGGA 4BZ1H 3CVHA 4ZOBA 4PYGA 1CGVA 4DUWA 1PDKA 3NOIA 5T1MA 3RWHB 3S37X 1WSST 3FT2A 1JGUH 4KRNA 5DEFA 3N1FC 4FXLA 3FHQA 2R39A 2PETA 8CGTA 1J88A 1I1AA 4L3ED 4ZSOB 4U6TA 2WP3T 1ED3B 1TDQA 4P3WA 3B2UC 1RHHB 2DL9A 3HPLA 3IXTA 4HJ0D 1FFNB 4UV4L 5IB3A 4KVCH 4HK3N 2XZQL 3L7EB 1T66D 1QBLH 3BH9A 3BUYA 1YEHH 1OM3H 4XCNB 5J1AB 5JIHA 2DBLL 3PF2A 5E8OB 1F4YL 2W07A 1LEKA 1U8OB 3ARGB 4JFDB 2ICWB 2VABA 4C55A 3WFDL 3LKQB 4HJJL 3TC9A 4LSPL 4P5KA 2NW3A 3H9SA 4OFDA 2APBA 5F7HA 5T5NF 1FNGB 5KSBF 5C2BH 5HGBA 2HYMA 5T1KD 3KWWA 3AAZA 4XNYH 5KW9L 5C3TA 3V4UL 3QDMD 3PXJA 1CT8B 3MYZA 3KYAA 4P23B 3VXMA 2DLFH 2VISB 3ILPA 4DK6A 4BQ8A 3RTQA 4CMHB 2PXYB 1AD9B 1RK1B 4K94H 1Y18B 2ESVD 2XACC 3KPLB 5FF6B 1UC6A 4LVHC 4LCCA 5HGDA 1N5YH 4CNIA 3RNKA 1PSKL 1ZOXA 1VGEH 4L4TD 4LVNC 3PGCA 3AMKA 4MA1B 2EYTB 4M1CC 3TBTA 3O2DL 4OFVA 1YUHA 1U9KA 4YC2B 3ZHDA 1GOHA 1P2CA 3TBYB 1JWUB 1JWMA 4C56D 4X6CB 5J4MA 4JZOB 3HMXH 4TVPD 2V6HA 1U3HD 3QI9A 3SKJH 2VXVL 5FYJL 3KAAA 5HHMB 4TVPL 4EBQH 4G8GA 1CXKA 3DGGB 3QEUB 1RUML 2BNRD 4RAUB 3KPMA 2NQCA 4WEUD 5D2NE 3GMPB 5IVXA 3NCYP 4GBXA 4JQVA 2NW2A 4M1CD 1TETH 1II4E 3NABL 1OB1B 2D7NA 3NA9L 4EI5C 3PGFL 3DTXB 4F37K 3WHXB 4YPGA 1PKOA 4I5BA 5DTFA 3QDJB 4WW2B 2BVUA 3P77B 1T2QH 3OG6B 5E5UB 1QRNB 4M7KH 1FYTB 5AWNH 2YSSB 2BMKB 1GAFH 2XN9A 3SKOB 3KS0J 4NFCA 2A2QT 1RURL 4PIRF 5IMLA 4P59L 4JDTH 1S9VB 3PIQA 3U4EB 1T7VA 5C6WH 4LP4A 4NDMB 1Q9KA 3O3EB 1FLRH 1INQA 2RBLA 3DI2B 3HA0A 2W0FB 5FOBA 4EI5D 3EYQD 1FZKB 4BH8B 1C1EL 1P7QD 5DO2D 4WRLA 3QJHA 2AGJH 4NZDA 3FQUB 4XP1H 4LGRB 4N68A 3Q5YA 4OCRL 3HE6B 4PJDB 3S37L 3G5XA 2PTUA 3PJSB 5ACLA 5CJQL 5DGQA 4F7MB 4OBRA 1NGXB 1F3RB 4NZUL 4PJ9C 1TJHL 1QPPA 1QBML 4O58H 2BP3A 3WFEL 1BF8A 2VN4A 5JQ6L 3T2NH 3QFJE 5I1JH 4P57B 2ENYA 4NFDA 2RJMA 4AEIH 1JVKA 1KTDB 2X7LA 1OWRM 1G9MH 5CEYB 4HS8H 5IFJA 1IT9H 3FQXB 1UB6A 5HHOD 4ZOCA 4JRYA 1IGCH 4HS3B 4ENEC 5IBLC 2WIIA 3QXUA 4LARH 4FXKB 3SJVE 1XAUA 4F15B 2E9BA 2NTSP 3BIKB 5HPMA 3ETBF 3CLFL 4X7EC 1FAIH 2VLMD 2G60H 4F9LC 2LVCA 4MA7H 3ARBA 4Y4KA 4XP9L 1KFAH 5HTSA 2EIZA 3IGAB 1I8IB 1EHAA 4D0BB 4FNLL 4HT1L 4BKLA 4JPVL 5JOFA 3BHBB 2BVOB 5IBLD 5ERWA 2V2TB 1SY6L 3B8SA 1DDHA 4ZTOH 1NFKA 1X5XA 5EUKB 1IQWL 2H2PC 4MJ5A 3EHBC 3QEGH 4WU7B 1F02I 4J3VA 5FO7B 4Y1AE 5FCUH 5B38G 5ITBH 1QSZA 3U9PL 2G9HB 5C0GB 2EDOA 1U6AH 1OGTB 3VWKA 2Y7QB 4S1RL 3OJMB 3INUH 3FO2A 3TP4A 1XCQB 3I84A 3TIEA 3VFSB 1FFOA 5HYEA 2VDRH 5IHUL 4NQTA 1A2YB 2QHRH 5A16A 3EHBD 1NAMH 2JJTA 2G75A 3KYNA 1ADQH 4LVHB 2CSPA 3OF6D 3DI3B 1MJ7L 2C3VA 3CLEL 2BFVL 3GM0A 5DJZB 3TESA 5C09A 4LVNB 2DQJL 5IK3B 4OF6A 4MA3A 4KRMB 4J6RL 1MIEH 4ZXBD 1G6VK 3E3QC 2Z8SA 3ARDC 1CXFA 4MQ7A 3CK0H 1MJJA 1ZT7B 1IAOB 2PW2A 1T5WB 4WHCA 3QXWA 2DLTA 1S9KC 3HG1A 2XICA 1PG7H 3L5JA 3PP3H 3S35X 2HT3C 3QIBC 5D7IF 5ISZD 1Z0NA 3MXVH 3QULA 4Y4HB 1R3LA 5MERB 2XG5A 4TQEH 3RWEB 4RBPH 2YPKA 4UDUA 3IKCB 1UG9A 4BK5A 1TFHA 1VACA 4AJ0A 4K2UH 3OAYK 4PRIB 3D3VE 3FFCD 4LPWA 4ONGH 4GMTL 5FUOL 1YEKL 1T22A 1LEIB 1HEZB 1OSPH 1DR9A 1QVOA 1AQDA 1Z3GH 1A8JH 2GCYA 3TZVC 3VGEA 1QR4A 3H3KA 3QIBD 4K07A 1CK0H 1UM5H 5ESQB 4CW1B 5KSAC 5B8CA 5KOVC 4C57C 2ZSVB 3ZE0E 3HZYB 3IU4L 4OGZA 5F1NA 2I26N 4Z76B 1Z9MA 3MO1B 3R8QA 1OTTC 4JFXB 1UWXK 2I07A 1FO0B 1RV6X 4K7FA 3DVNB 1DL7L 4RA0C 1QSFE 5IHZB 3B2VH 4HF5H 2WSKA 1HDMB 3TZVD 1RIUL 4PRHD 5IMMB 5HDOA 4FQXC 5EZOH 5BZDA 2JK5B 5D1QC 5E2VL 4OM0H 1VESA 3WL9B 4YXKH 3UYRH 1K8DA 5IVZA 1WCQA 4MCZA 3C6LC 3MLSH 5KSAD 4L8SA 2Z93B 3U79A 5JIKA 2NXYC 3WUZA 4UTAH 3CXDL 3UPCA 4PJ9B 1DE4A 4QGYA 5HSFA 2A9NL 5C7XH 1FPTL 4FG6C 1TZHB 3KPQB 5GGUA 1S8DB 3VFRA 5BS0E 4TVSa 3MACL 3T0EB 4BSJA 4RMRA 5E9DE 3T0AA 4P4RB 5E00A 3TH4T 1MFEL 5DR5H 5EZIH 2AK4B 5GGQH 3A6BH 3CXHJ 4WCYL 4FQXD 2BY2A 5J11B 3SDDA 4AM0B 4PB0H 4P0DA 2I27N 3G08A 4DKEH 5BOPA 2JCCF 2R4SH 3C6LD 1XGPB 4LSRL 3O6FC 4I2XB 1VA9A 3C5ZC 3Q5TA 2AJVH 1FIGL 4WVRA 3GNMH 4GRLC 2BVEA 2B1HL 3RVUC 3TFKC 4H8WH 3SGEH 1JF5A 2ADGA 1G7LA 1R5WB 3CFCL 4XX1E 1TNMA 1GPOL 4FG6D 1F58L 1JNHA 2FBJH 5IEHA 4PLKD 2ICWJ 3DV4B 4PRPB 3MRJB 1PVHA 5JUEL 2R2HB 1MVUA 4PD4J 5DJ8B 3I75A 3VDAA 4OF8A 5BVJA 2IEPA 1TJGL 4U6YA 1UA6L 2W38A 2WIMA 1MLCB 2J8UA 2QQKL 3CJJA 2EH8L 3N50A 1F4HA 3HHRB 3LQAH 5ID1B 1LO4L 4G43A 1PY4A 4TTGA 5C6TL 3RKPA 3OKKA 1E4WH 3BXNB 4GRLD 1FHGA 3RVUD 3TFKD 1IKNC 2H45A 4DK3A 1NAKH 2V9RA 2GJ6E 4S0SD 4L9DA 1A3RL 2NR6C 4NKIL 4OLYL 2X6MA 5IHLB 2H32A 2A77H 2MWCA 3MR9B 5I8OL 1ZHBB 4IRSA 4QRTA 4R7DB 3CVHH 3HC0B 4XP4L 1RZ8B 5FYKU 3GMLB 1JNJA 1EAJA 3QUKA 3BZ4A 3LN5B 2AS5M 4I48B 1A6PA 5IB1B 4MAYA 4F7PB 3BISA 3S35L 4ZS7H 1PW3A 5TGBB 3OHXB 4TPRL 1G7HA 5CBEA 2NR6D 5LCVH 3F12A 1BX2A 1N8ZB 3HPJB 3ARDB 1CZ8L 3MYJB 3QO0B 4OZIA 4WEMB 4PGDB 3C60A 4X6BB 1HHJA 4O00A 5LJYH 1KCKA 1YMMB 3IETB 5T33H 1QFWI 5E6IA 4C54A 3P30L 1EJ6A 1T80A 3L3HA 4ZMAT 3D2UD 1PZ5B 3UBXA 3LY6A 1EHXA 3QRFM 2WQ8A 3FO9A 4J1UB 3T04D 1I3RA 1SJXA 2UZIH 2P43B 2DWEA 2NTFA 1KB9J 4PGCB 2C3HA 3G6DH 4TTDC 1AH1A 1ZTXL 5DVMA 4DZ8B 5SWSE 2BRRL 5I1LB 2FZ3A 4NO5B 5CEZE 4YDKL 3RRQA 1F90L 2DJUA 5F9JB 3O2VH 1Q9OB 1I9RL 1MWAA 3S5LA 1S9WA 3GMNA 3M17A 3NFSL 5FM4A 1KBGH 1J1OL 5ALCH 2YD1A 4PJFB 4WW1A 5E95B 4PJEF 5ANME 2QV2A 3MRKB 4UOW0 2IAMC 2VDNL 3MRDB 3RVWC 1NKOA 5I71B 4N1CA 1J8HB 5I66A 1XGQA 4TTDD 3TCXA 1MRDH 3VWJD 3QUYA 2QL1A 3QQ3A 7FABH 4Y2OA 3QHZL 1JPGB 3OZ9H 4GAJL 3ZKMD 3PP4H 3VA2C 3PV6A 4FQIH 1EXUB 4Y2DA 5D1QB 4NC2B 5F7NC 1UT9A 2X42A 3F7YA 4ZFGL 3VXUB 1V7ML 5HJ3B 1RUQL 2NXYB 2NNAA 3EYVB 1EEUA 2IAMD 4GKSB 4KWUA 3DLQR 3RVWD 3VI3E 1JV5A 4ESKA 3TO2B 5HYJD 5L0QC 5F9WB 2D0HA 1FNEA 4LLUB 5GSVA 4E0RA 5E70A 3SGKA 3ULUE 2YUVA 1QKZH 4EZMA 3OBAA 5C08A 4R90H 4HAGA 3EZ8A 5F89A 2ZUQC 3N0PB 2I9LA 3QFDA 5FKPA 3O6FB 2OK0H 4LLMA 3C5ZB 1N5AA 3EZJB 1MQKH 4FFZH 3JWNC 5M95B 1KCVH 5IFAL 3O3AA 3PQYD 4NYLA 3V6FB 1JHLH 2AK1L 2J4WH 2OJZL 1VERA 2C4FT 4OCXH 1LHZA 4Z8FH 2KL6A 3N1PC 1RK0A 4MDJA 5KN5B 1BEYL 5B3JE 2X05A 2CKBA 2W59A 3CC5B 1OP5H 3MRPA 3SBWC 2CIKB 1M6OB 1DLFL 3MROA 3U4AA 1GXEA 4XPAH 1RJLB 4OZGE 5TQ2L 3BPLB 3ALPA 3WS6C 3GGWA 3WXWL 1QLFA 3FT4B 4V1DE 3RPIB 1MY5A 4NJ9H 2Z35A 2EDLA 3L3OA 3DXAE 1A1NA 5C0DB 3WFCL 4HUXB 2HLFD 4N0UA 4PRDB 2AXFA 2YPLD 1J12A 5JO5B 2AJZA 4JREC 4WEBL 1DEEA 3OXRB 2LU7A 1CE1L 3LDBC 5A40E 4NRYA 1BJMA 3LHPH 5DJDB 5EC1B 2XY1A 4QXTB 1HKFA 3S36X 3VD4A 1R3KA 4NKDA 3I3BA 5D72H 4ZNEE 3W2DL 2XA8L 1C08B 2FH8A 5ESAA 4JAMB 1RZKH 4U7KA 1E4XI 2J1KA 3HC4H 1FL3B 3VD7A 1NBZB 3V5DA 3RAJL 1NGYB 1JTPA 3CXHK 3BGFB 2VZ1A 2DMBA 5DQ9A 2P5WB 1J7VR 4M93B 2HN7A 4XCYA 1NBQA 3O6KH 2CIIB 4MJIE 5I1DB 4Z5RB 1EHLH 3WFZA 5JMRA 3HE7C 5I1GH 4ZFZB 4LCUA 4ZPVA 3QCTL 5L9DH 5LBSL 3RA7H 1ACYL 2EE9A 4MWFA 5D7SL 4U3HA 1MNUH 4NBYB 4PD4K 3TF7C 5F7MC 4M8QA 1P4LB 4FQCH 4PJAE 1IEBB 1M1SA 2A74A 3GIZL 2LAAA 3STBA 5F3BB 3ZYZA 5FYLE 1W0VA 3HE7D 3KPPB 4QHUA 2QQLL 5I1HL 4YHKL 4RGMC 4RGNE 3HZKA 3CCHA 4R4BA 4HUWB 4G5ZL 4KTDL 3QCUH 4Z7VB 2WUCL 4IRJC 2O5ZH 3X13B 4JVPA 5DLMH 4X6EA 4PLOB 3SDAB 5I1EH 5T5FH 2OTWA 3FB5A 5CEXA 5IF0B 1SBBA 3P0VH 4LNRB 4XBEL 4MNQB 4EN3C 1T7ZA 35C8L 1OF2B 1YJDC 2P7TB 2GYSA 4HK0A 1TMCB 4KV5E 4LLWB 3U9UB 4DAGL 4F8TA 5BV7H 4JO3L 3DYOA 5D8JH 3JV4A 2YD4A 3MRIA 3C5JA 5F7DA 4LFHD 4HIJA 2R0KL 3UBXG 2FYYB 2OSLB 3CFDB 4LNVA 2PTVA 1AKJA 3PWLA 4EN3D 1OAXH 1U93B 4JRXD 5L0QB 3SE9H 3QEQD 3SCMC 5K9JH 1MAKA 2CGRH 4KHTL 5D2NA 4P2QA 4PTUA 3T08A 3LEXB 4LOUD 3S5LG 4JY4B 1YJDL 4LPYA 4ERSH 3BKYH 2IFFH 4HWZB 3AS0A 4JFHD 4QT5B 2YKLL 3UTSE 3B4NA 2R2EA 4JM4H 3X3GL 4H0IA 1WT5A 2AI0H 2FB4H 1KB9K 2YD2A 2H26B 2UUDK 2FJHA 2VDOL 1MH5A 3NIDE 3AMLA 4PB9L 3P11H 3E8UH 4I3GA 5BRZD 3LKNA 3ARFC 3SCMD 5C9JB 5HYSB 5SWZD 4M4PA 3WNNA 3DMMC 4JY5L 1OD9A 2W9DL 4MCYB 1I3VA 4X6CF 2FLBT 2B8OT 2X4RB 3WO3B 3KLHC 4G6JL 5C0FB 1O7SA 2O5XL 1OT2A 2B20A 2W9LA 1CBVL 1D5MA 3S36L 3R1GL 3BD4A 5GRVL 4JG0H 3CFJA 3CDFA 2HFEA 1H3GA 5EOTB 4JPIB 4WJ5B 1AQKH 1FORH 5CAYB 4NO0A 2VSDA 1JGVL 1T1WA 4X4YB 2WBWB 1IAIH 2Y07H 3B9KC 2EICA 3CZJA 2Z8VC 1MCCA 5MENA 3DMMD 5I15L 5B39B 3SY0B 4XTRC 2I5YH 1NFDB 2CMRL 1R24A 4G6FD 3LDBB 4Y19B 4AZ8A 4GRMB 4NKOA 1CFBA 1HZHL 32C2A 1HHIA 3IFOB 2XQYG 3KLHD 3WE6A 3QFJA 4GKOA 3W39B 3BW9B 5ENWB 2VH5L 3PWJA 5EU5A 1F42A 1EUUA 2P8LB 1AFVL 5KSBE 1K2DA 1HQ4A 1LD9B 1FC2D 4N90D 2VLKE 1QSEE 1K8IA 3B9KD 5TFSL 1RZFH 4L8CB 4PGEA 2CDEB 4XTRD 3OKMA 2OMNA 1WBZA 3SO3C 1MRFL 3IFPB 1T20A 1LILA 3D85A 1JGEB 3V52L 3HUJB 2X1OA 4KY1L 4RMSA 1E28A 5D2LE 1WZMA 1UFUA 1MCBA 3KR3H 1WAAF 1KTRL 5I9QC 5DD1L 3NA4A 4U1GC 5K9OA 3HLAB 5GZOC 3IU3A 1OGAA 2QSCL 4PJDF 1S7SA 1DANT 1CFTB 3LZFL 1HH6A 3MJ6A 5IB5A 1A9BA 3U0PB 4I18A 4U05A 3S98A 1EAPB 5HHQA 5JW3L 3D6GA 3QDGB 5E03A 2ILLA 5EOCL 2H32H 5IBTH 1S9YA 3OJDA 4QY8B 1CTOA 1QR1B 2PYFB 4NC0B 3VGDA 4WFED 4YDVB 4JFEE 3ZYOA 1J05B 3SOBH 1IAIM 3V5KA 1A7QH 2NY2D 1HWHB 1OOAA 1FGVL 1UQSA 2OL3A 4NJAL 1ZHNB 4Y5VB 5GZOD 3WDHA 4DN3H 3JTTB 5TF1H 4ZQKB 4Y7MA 4IRJB 4UU9B 1FN4B 1T1YA 4NRXA 2FGZA 4XPFH 2Z31B 4XAKE 1KCUL 4QCIB 1MAMH 4YE4L 4E5XA 2B1AH 3GUTB 5HHNB 1HQRB 2AEQL 2WUBH 1ZWIB 4H25A 2AV1B 5AUMA 3MRCB 4GW5A 5I1CH 3U30C 3MTRA 1IM9D 3G6AA 2VZOA 5DD0L 1PEWA 4DVRL 2VLLA 5L6YH 1FL5B 3PDOA 5EIIB 2I60L 3DUUA 1YEIH 4P5TC 3QHFL 4U1KB 1NSNL 4XWGL 1F45A 4BZ1L 4U33A 4FFYH 3RWFA 5JXAH 1T1XA 5CZVL 1WZLA 1BFOA 2VC2H 4FTVD 3O3UN 4P46A 3NCYS 1JGUL 4PGBA 2OXHA 3KYMA 1AGFA 4JFFD 1FZJB 1DBAH 4MSWB 1J10A 1DSFH 1JJUA 3IDMA 3TA3A 3S96B 4IIQC 4YGVA 3BP6A 3OMZA 2F54B 3MREB 1I75A 1CD9B 1MWAH 1B88A 4KVCL 1CLOH 5DUBB 4GRWF 3EYFA 1S5IH 4NO2A 4NRZB 3D3VA 4P5TD 5GGSA 1QBLL 3O9WA 1YEHL 2MQ0A 5E99H 1OM3L 5DDHB 4ZFFA 5FK9A 1W72B 4WFHD 5TH2B 2R0WH 1C16B 4MNHB 2AEIT 2WWKT 3UTTB 1JIBA 2CRYA 3L3JB 2BCKB 4K94C 5I1IH 3RL1B 4HC1A 5C07B 1G7MB 3BZFB 3GBNH 2VO5A 4PJHB 3ARFB 1L0QA 3WKNA 3CUPA 2R1XA 1A9EB 4BFIB 4XVTH 4EDXB 4AIXA 3IT8D 4N5ED 5EZJA 4PRNA 3VRIB 2NY1C 5C2BL 4IJ3C 3MRFA 3Q2CA 5D1ZA 3PWPA 2O26U 4NZJA 5D5ME 4XHJC 4S1QH 4XNYL 4QYOA 2MMXA 1CLZH 1LMKA 2P5EE 4HHAB 1ZGLA 5F88A 4RBPK 1QSFA 2R1YB 5E2UH 2XKNA 5GRUH 3MV9D 1F3JA 1LE9A 3QT2A 3U0WH 3D18B 1G9NC 25C8H 3U82B 3WIHA 1A6VH 4K94L 2DYPD 4TSBH 1FIEA 2P46B 1N5YL 4QTHB 3UTZA 5J13B 2ICCA 3MGOB 1VGEL 3RUGB 2NY1D 3R06B 3P9MA 3B6SA 5IIEB 5DC9B 4XHJD 4ZO6A 4PRBA 1QP1A 2VZUA 5HGAA 1XR9A 5E9DA 1A7PH 5C0AA 5CJ5A 3HMXL 4KXZI 4N1HB 3FRPA 2AXGB 1C7SA 4F2MB 1KXTB 5MEPA 5HHXH 1UACH 2H2SC 3SKJL 3MNZB 4EBQL 1JWSB 2V5SA 3IDJA 4PV8B 4HWNA 4ZD3H 3BIBX 2CKBH 1LDPH 1AGCA 1TETL 4JKWA 3ALXA 1ZLUK 4KVNH 1QFOA 4YDJB 4QHKI 2Q76A 4HIXH 2WP3O 3SE3A 4HCRA 5E94B 4RX4A 4YFEA 2OTPA 1QZ1A 4JN1H 3LVEA 4XBGA 5F93C 3UYOD 3UAJD 3VRLF 5MEOB 1Q72H 1CFNB 2H2SD 3DVGA 4X9HA 3P9WB 3RZWA 2WBJD 1GOFA 1T2QL 3TBVA 4K3JH 4M7KL 4Y5XA 2AQ1A 5AWNL 1WBXB 1GAFL 2FLRT 3QIUA 1EFQA 5FGCB 3OKEA 3MV7A 3DX9A 3Q48A 4WV1C 4JDTL 4L9LC 3V5HA 3BVNB 1SJVA 5JLZB 1G9MC 3DARA 1ACZA 5D7IE 4CVZA 2GJ6A 4D9LH 1FZOA 1FLRL 5FCSH 1AC0A 2DIAA 1H5BA 3VXSD 2BXZA 2DKUA 1XZ0B 3MQIA 4QOKB 1N59B 2AGJL 4MD0A 4XP1L 1MUJB 1YZZA 1U3ZA 3W9EA 1K6QH 1PQZB 1TVDA 4P2RE 4PY7B 5IHBA 4OZ4A 4LU5H 1TZIA 4M43H 2D0FA 4JJHA 4O58L 2VLJD 4LDEB 1LEGA 4W4OA 2OJEB 4NOFA 3T2NL 5DXWA 5I1JL 3U30B 1VKXA 3W0WE 3LD8C 2A73B 1BFSA 4AEIL 2DQGH 1G9ML 4M9OA 4HS8L 4P5MB 3FRUA 1IGCL 2NY4C 1I1RA 4J3WA 4RAVB 2V7NB 3EO9H 4ZAKD 5HD8C 4LARL 2HLAB 4MLIA 5DSCA 5I1KL 2ZUUA 1S9XA 3KJ4C 4XPHH 4KKLD 4Y89A 1G84A 1UB5B 1NC4A 5DJAB 4QLRA 4Q9RH 1UEYA 5MHSE 1F3DH 4D3CH 1A6ZB 1XIWD 1FAIL 1ZAGA 3VFPB 5LWYH 2BVQA 2G60L 1ZHKB 4JLRA 4MA7L 1D5BB 2J8HA 3VXQA 5HHVH 1JZ4A 4GLRH 3VW3H 1KFAL 4EKXA 3QJFA 3U4BH 3ROLA 3MOAH 2VUOA 3MODH 1I8LA 5K33A 4ODUA 3W5NA 2APTA 4OKVA 2NY4D 1D3CA 5HD8D 5SWSA 5CD5C 4PBVC 3BP5B 5DD5H 5EG6C 4CMMB 4ZTOL 1XGRA 1CDIA 4H1LB 5FYJU 5H37G 3QAZB 1JE6A 1T4KB 3EFDH 3QEGL 2W91A 2CD0A 4GJTB 1DCLA 4JB9H 4M6NH 1NMAH 4H5SB 1EEYA 4ZPTA 3SKUD 2GT9B 5FCUL 3V6ZA 2JCCE 2LQRA 5GIRB 3QEHA 2DKSA 3EO0B 5ITBL 2EYRA 3DJ9A 4IJ3B 1U6AL 3MRGB 1TVBB 4HGWB 4IDJH 2Q86B 5FECA 2DQFB 3AS1A 4NN7C 3INUL 3CFKB 4X5LA 3D0VB 4QHMA 5CUSH 5I19H 4PJXA 1QQDA 3T2OA 4Z77B 2VDRL 2F53A 5DD6B 2QHRL 1K5NA 1C7TA 1NAML 5DVLA 5EN2A 1ADQL 1UH2A 4OI7A 1BGXH 2IC2A 5FOJA 1O5DT 4HS6A 2YC1A 3KPSA 5FFLA 1MIEL 5D7LB 3OKNA 3NZ8A 1LO3H 2VR5A 3CK0L 3PHQB 4WNQB 5IUSA 2VLRD 3ARWA 2IALB 3O8XA 4FFVC 1AE6H 2FWOA 2BC4B 4Q0XH 1BLNB 3IS0X 2JB6A 5E1AB 3GSVA 1KN2H 4PJFF 1PG7L 3GBLA 2VJXA 1AO7E 1T0PB 2HJKA 3MXVL 2VR9A 5CHNA 5DQJB 4OLEA 4TQEL 3IDXH 3RHWK 1CIUA 4M6MH 1XGTB 1JPTH 4BA8A 4K2UL 2RB8A 5HI4C 1XEDA 3ZKXC 1XF5B 1KB5B 4NIKB 2P8PB 3DROA 2X4NA 4CN1A 4ONGL 4FFVD 1FC1A 2WINB 4PJ5D 1OSPL 3PV7A 1Z3GL 4MNGE 4XT1C 1NGZB 3G5ZB 3A67H 4YBLC 4X6DB 5ITFB 2WAHA 4PJCE 1CK0L 1UM5L 2QLVB 4UUJA 4OD3H 3RI5K 2V2WB 3BQUC 3L3DA 4RQQA 1GZQB 4ORZC 1NUFA 5AZ2H 4WV1B 4V1DA 4ETQB 2A6KB 1X44A 3DXAA 1ORSB 4XRCB 2OM5A 3FRPG 1GZPB 4L3EA 3HI5H 3B2VL 3P4NB 4ORGB 2F8VA 4O5LH 4HF5L 3U0TB 3EKCA 3TYGH 5CINH 3SKNA 5IR1A 5EZOL 3ULVE 2C5DC 5E8EB 4OM0L 5GGTA 4OD2B 3BQUD 4YXKL 3UYRL 3MLSL 1K4CB 4H8WC 5DK0A 4ZNEA 1ES0A 3TYFB 2IF7A 4UTAL 3RHWF 3ZTNH 3P4MB 2M1KA 4EOWH 4UIMA 4JQIH 3T1FB 1BD2B 5C7XL 1J0IA 2VL5B 2BSSB 3MJ7B 3T65A 1NEZB 1WIOA 1HCVA 2B5IB 1U2HA 4RZCB 3GHEH 1YNTB 3GSRB 1MHCB 4XZUB 1CD0A 2V9TA 3ARVA 4OFPA 5E6YA 5IT2H 1B4JH 4PJEE 5DR5L 5EZIL 5F9DC 4YHMH 5GGQL 1AGBB 3LQAC 3A6BL 3RX8A 2VQTA 3U7YH 4PB0L 5CMAA 4MX7A 4DKEL 4B7LA 3DETD 2R4SL 5CJXC 2NXZC 3KJ4B 2FJFA 2AJVL 3D25A 1UWEH 1FVCA 3GNML 4HPOH 3QDMA 1MCSA 4H8WL 3LIZH 1H3WM 1F6AB 5HYQA 1M7IA 2FBJL 3QUZA 2WK2A 4PJAA 3RWCA 4RIRA 4LHUD 1ZVSB 3TIDA 1N3NB 3R0MA 3QIWA 1KJVB 2C7UB 2F19H 5C0CB 4DW2H 1ZS8B 3DECA 5INCA 4BQ6A 4L4TA 3O6LH 1QNZH 2FIKA 3LQAL 1U8MA 1IZKA 3WBDA 1I1AC 1E4WL 2ZUWA 3Q3GB 5H37H 5LQBH 5IESH 3P73B 1Q8MA 5AG9A 2IBGA 5D96B 1NAKL 4TNVF 1N0XH 1RIHH 1U91A 4LCWE 3QNZA 4G9DB 5IW1B 5E2JA 4MXQC 3CNKA 4RFEB 3TBSB 2NX5D 3GJFA 5BZWA 2A77L 3HRPA 2QADC 1R3JA 3KLSA 1N2RA 1C12A 3CVHL 3WSQH 2EDYA 4P3CH 5TE7H 3D1MC 3BWAA 1I1AD 1WWAX 5DHVB 4Y1AB 4I77H 3JV6B 3T2PA 1JRHH 1RZGA 4JM2B 3WLBB 1TTGA 3K4ZA 1VSCA 2ED7A 5GSRA 4B41A 3GM8A 4ZS7L 3MLPA 2FATH 2C1PB 4DOHB 1OSZA 3DGCR 4KAQH 4MXQD 5CILH 4G42A 5LCVL 3F6IA 2MTPA 2COQA 2ITDA 4PJ7B 2JELH 1AGDA 5KS9A 4MS8D 4NQXB 1SEBB 3SQOH 2CLRA 1XF3B 1U8PB 3RL2A 3H9SD 2ZOLB 3UTPD 2VXQH 4LCCC 1CDJA 4HC1H 4NOBA 5T33L 4Z7VF 3QNXB 4KU1A 1IC7H 2PNDA 3TT1H 4OUUA 1UXSB 3UTSA 1T7WA 4NCC2 3FOLB 4YHLH 4D9QD 4HX1B 1IGMH 4LVEA 4TSAH 2X4UA 4RNRA 5J6GA 3OX8B 5CP7B 3QXAA 2BNQE 2UZIL 3EOAA 3EW3B 1IKFH 3VXMD 3NCMA 3ZKXB 1QO3A 2X2YA 2N56A 3RTQD 2AABH 3BOVA 3G6DL 3HR5B 4U7MA 4LGSB 3QI9C 1P6AB 1RZIB 5IROA 3AREA 1S7TB 4ZUUA 3V4PH 4X9FA 3O2VL 1CDGA 4POZC 3B43A 2NY0D 5DJYB 3WIHH 1CICB 2XPGB 5D7JB 3BE1H 4XGZA 3MLWH 4GBXC 1TVHA 3LQZB 1KBGL 4YHIB 5JPMB 5HHOA 3FB6B 5ALCL 3VXRB 3BGMA 1VEOA 2IANB 4FZ8H 3QNYB 5TDPB 1AXSA 1ORQB 1UZ6E 4AT6B 2GK0B 4TUKH 4HIEB 4XVUC 5ICXB 1TCRA 4WUUB 3BYYA 1MRDL 2WANA 3QI9D 1MCEA 7FABL 5JTWA 4G8GD 3CMOH 4POZD 1CD8A 2GAZB 3OZ9L 4U1JA 3BZEA 1VEPA 1CG9A 2FD6H 3PP4L 2PYEA 4FQIL 2WM0A 1MFNA 4QRUB 4ONHB 4WWKB 5TF0A 4N0YH 1UVQB 5IMOB 3OAZH 1YMHA 2XNAB 2WQRA 4JHWH 4G9FD 4Q6YA 1KEMH 2E5EA 2DWDB 4KJYB 3MNVB 1A14H 1IGYB 5KSBA 1BVLB 1HNGA 5KTEH 3BPNC 3QO1A 2VLKA 5HDBF 2RQ8A 4HCRH 5A2KH 5KG9B 4ZUVA 2R23B 1Y6MR 4ODWB 1QKZL 3O11B 4YHPB 5FO9B 4R90L 2XN9D 4OV5B 4LCIH 4ZSOE 1VENA 2IGFH 2WZPD 4NQCD 3WNMA 1JI1A 3BT2H 5JW5B 1ND0B 3FMGH 1ZGLM 4LKXA 2OK0L 1S7QA 3RIFK 2NXZB 3ZDYF 3QQ4A 4Z78A 5BS0B 3KJ6H 1MQKL 4FFZL 1MSPA 5CD3A 1MHHB 1KCVL 4YFLF 3FCTA 3FQNA 1XCTA 4Y16A 1B6UA 3QUXA 4JFDE 1JHLL 2GY7B 1KIUA 2J4WL 4X5WA 1YA5A 3AUVA 4ACPA 3VFVB 4MD5A 4MMXC 4OCXL 5HDLA 4QRSA 1R5VB 4Z8FL 5HVWA 4HLJA 5DUMH 3KPTA 1I7TB 2GUOA 3HNVH 1X7QA 2YHGA 3HB3D 4JFEA 3SPVA 2X4QA 3TEUA 1RZKC 4ZXBA 1JF1B 4UQ3A 3KPRB 4XPAL 2X41A 3ARBC 4Y4KC 2OI9C 4GMSH 1HE7A 5FA3B 2B2XH 3E0GA 4U31A 3BJ91 3TO4D 2DI9A 4NJ9L 3PXHA 1F3DJ 4ELMB 2HAZA 4JRYD 1NGPH 4AEHH 3KNBA 3HUJF 2QADB 5KSUB 1KYOJ 3MGTB 3C09C 3LHPL 2GQHA 2OR9H 5DRZB 2IQAB 4NQDD 4P5KB 2NW3B 4LKCA 5EO9B 3ARBD 5D72L 4Y4KD 3GDBA 1GGIH 4NNYB 1RZKL 3HRZA 4X7FC 1RJCA 2EEDA 2C1OB 2R29H 3HC4L 4X6CE 5HGBB 1HINH 3VWKC 4F57H 2VXSH 5SX4I 2DQDL 3I6KB 3TPUA 4JPKH 5HHME 3U7WH 1QEWB 1XGYH 3O6KL 3DUHA 3ILPB 1LP9E 2X4OA 4M02A 5DA4A 1BOGB 3AM8A 1EHLL 5CEZH 2EYSA 3H3BC 2JJTC 5I1GL 1I7UA 1JFQH 1R5IA 1W2KT 2QR0A 4S2SB 5HGDB 5L9DL 3L7FB 3K1KC 2JIXA 3RA7L 4DKFH 4Y4FD 2PO6B 3PGCB 1XFPA 3OG4B 1JPST 1MNUL 3TBTB 1BZQK 1BQSA 3VWKD 2J88H 4WHDA 1D6EA 1Q0XH 3DBXB 4YHNB 4FQCL 3TVMA 3QDJE 4FZEH 4JN2A 1QRNE 4KH2A 4F3FA 1FYTE 1D9KA 1KTLA 4PR5A 3OSKA 4L29B 5BV7C 3DO7A 3IDIA 1CF8H 3OWEA 3WJJA 3H0TB 5C09D 3QWQB 4GBXB 2AEWA 2NW2B 2NY7H 2VDPH 2R1WA 4R0LA 3MOBH 2P5EA 1E27A 3QCUL 1K85A 2FO4A 1CQYA 2O5ZL 5DLML 1A1OB 4N1EA 5I1EL 4HKJA 5T5FL 1WAAE 1R3HA 3P0VL 5CGTA 3M8OH 1AHWA 5EU4B 3I6GA 5DTFB 1J9CT 3HG1D 3H7BB 3ULUH 1YN6A 2ZSWA 3HAEB 4QRRB 1P1ZA 4M7JH 4K7PH 5CSBA 5ANMB 1QFHA 5BV7L 5D8JL 3O41B 4XNZC 1T03H 3H9HA 2FHFA 1T3FB 5HHPB 5E1HB 1KPVA 3FHAA 3RZCC 4ZOAA 1NDMA 4XB8A 4PJHF 4AEEA 1C8PA 1EFXB 3H3PH 4EUPA 2Z9TA 2KPNA 5GISH 1PAMA 3QJHB 3LEVH 2GJJA 1OAXL 1UENA 4BYHA 3SE9L 3WEXB 5K9JL 2CGRL 4JKLA 4D94A 2VL4A 4G8EB 3ARYA 1NCTA 3G6JB 2FX8H 5KVMC 1FSKB 3Q6FA 4ERSL 4L8SC 2X4TB 4PJ8A 3S7GA 3BKYL 2IFFL 2LABA 4LBEA 5C0IA 4JM4L 4XNXH 4LSSH 3FN3A 4HMEA 4L4VB 2AI0L 2FB4L 4R6UA 4TOYH 5JDSA 3DO3A 3WFHB 4LGPB 3P11L 3E8UL 5IFJB 4D0CB 1NCCH 2MJWA 5FM5M 1KGCD 4G8FA 3RUGF 2ZZUT 4J3TA 3SDDC 3B3IB 2OQJB 5SX5K 5JHDB 4YNYA 4TUJA 3LN4B 4AIZB 1QA9A 4HIIA 5K9QI 1DQQA 1E4KA 5GGTH 3ARSA 4NC1E 1I85A 5D7IA 1CDHA 1Z5LA 5T5NG 3MA7B 4JG0L 4IMKA 4BFBD 2E7BA 5TPWL 1AQKL 1FORL 5TE4H 3MV01 1FE8H 1NCWH 4BKLB 1MCNA 5JOFB 1QFWH 5FYJE 1E0OB 1IAIL 2Y07L 1X4XA 1MI5B 4ZUWB 1NGWA 4I3RH 3OPZH 3NGBC 2I5YL 1LO0H 1IC5H 5HGHA 4YAQB 2BNRE 4I4WA 4MJ5B 4HIHB 1YDPA 3B9VA 4QHNB 5GJSH 2Y36H 5C70A 4KKAC 3W0WA 1I1CA 5IW3A 1EZVY 1FL6B 2WLZA 4YIQB 1HI6A 1QFUH 1EO7A 1J0KA 4LQFH 3LKOA 4EIGB 1IGFH 5D1XA 3AS2A 4W70A 3S4SA 3S9DB 5EZLB 4IRSC 3UXFA 5IVOA 4GXVH 1FFQA 5BJTB 3FQWB 4R96B 4XNMB 5FB8B 4K71C 5GPRA 3GSQA 3MRLB 3HFMH 4HFWA 1HXMA 1DLHA 4KKAD 1EEZA 3CPLB 5HI3C 5DRXB 2PTTA 4MAYC 4Q9QH 3RU8H 5FHAH 1X5IA 3QXTA 2C3VB 4LSQH 4OCSL 4PRIE 3IDYC 3CDYA 2HT2C 3PL6A 5F71A 3VWJA 3C5SA 3MLRH 1IL1B 1AXTH 1RZ7H 3O45B 2GITA 2FH6A 4JY6B 5E8PA 4N8VB 4IRSD 3ET9F 4MQ7B 4QTIH 4E41B 4KUCF 1NKRA 3C60C 3GJFH 5IBTL 3WN5B 1YYLH 3RGVD 2YUXA 5EO1A 5C71A 5E6IC 5F44A 4EI6A 4XPGH 3SOBL 1QFWM 2JCCA 2VAAA 4PPTA 4MAYD 1A7QL 4I3SH 1WZ1H 4OCLC 5D70H 1CIDA 3VMNA 3GSNB 1XR8A 1RFDH 5I8EA 5T1DH 4DN3L 4WHTB 5TF1L 3GMMA 4JG1H 4X98B 5ETUA 1DVFB 2XZCH 4LPXA 3L6FB 2KKQA 1KYOK 3C60D 4XPFL 1T22B 4M61B 3K8LA 1MAML 2B1AL 2CRMA 3VRLE 1CWVA 4K3DH 3OR6B 1CFSA 1WJ3A 2FX9H 2G5BA 2WUBL 3SDCB 1KIRB 4U1SA 5DJ0B 1KN4H 5I1CL 5L6YL 3BKMH 1FVDB 1YEIL 3CZFA 5L2JA 2VE6A 4WDIB 2FR4A 3EUUA 2UYLA 3T0EE 3RGHA 3KXFB 4FFYL 3REWA 5JXAL 3C08H 1CGSH 3RZCB 2VC2L 2AK4E 4WUKH 3TGXA 2I07B 3RDTD 4HBQA 3QUYC 5D6DA 1P7KB 2CQVA 4A6YA 1KG0A 5E2TH 1DBAL 1DSFL 4I2XE 4U1IA 4YFDB 1AO7A 3VMPA 1YEGH 3IDGA 1TZGH 2NY3C 4Y2DC 1DN0B 5SV4A 1J0YA 1MWAL 2K9UA 1CLOL 4L8SB 3DIFB 1IAKB 1S5IL 4I0KA 5EORH 1XF2A 2XKSA 1A1MB 1DE4B 5E99L 4XH2A 1A5FH 2YPLA 4XC1H 4BH7B 2X4PB 4LHJB 2R0WL 1EMTH 3FT3A 4MNGA 4KK8D 4JANA 2YD8A 5I1IL 3QUYD 4M7LH 3SGKC 5CIPA 1UKQA 5E00B 3LRHA 5J1SC 3GBNL 5J3HC 1G7IA 1VFMA 3AB0B 3SDDB 2NY3D 4Y2DD 2VQ1A 4E42B 2W0LA 3G08B 4XVTL 3RWJA 2SEBB 2AEPL 3MRRA 5MEQA 2R56H 3P9LA 5F97E 4GH7B 4FFWC 4S1QL 3WJLA 1KNOA 2OTUA 2ADGB 1CLZL 2JJUA 1XGUB 3OGCA 2XTJC 1ETZA 4EUPG 3WO4C 1LNUB 5E2UL 5GRUL 1MVUB 5JORB 2F5BH 3UX9B 3U0WL 5C08D 25C8L 1HOCA 3D39B 4TSBL 4NWUH 5J3HD 1BVKB 1LK2B 5DMKA 4O2FB 3GKZA 4K3EH 1FBIH 5JMOC 3NGBB 4OGXH 2A83A 5IMKA 3OKKB 3SO5A 3ZYJA 5AD0A 4WO4C 3IAQA 4FFWD 4OCWL 5DFWH 1A7PL 3U83A 4X6DF 5AYQA 4PJEA 1KXQE 1BVZA 1ZHLA 3FFCE 4K7PY 1UACL 3OR7A 1SBSH 2EDKA 4XPTH 1KIQA 1YMME 1WBYA 3W9DA 5BO1H 4M7ZC 2GHWB 2VUYA 4ZD3L 5J06A 1K4DB 2J2ZA 3MOQA 1LDPL 3QUKB 3WNOA 4K71B 3MV8B 3E6FA 2A1WH 4OM1H 2APXA 1W8OA 4KVNL 2Y06H 1GYAA 1WFUA 4NT6B 1QSEB 4HIXL 5F1OB 1UEMA 5HI5D 3O4OC 4NHCH 2EIDA 2CLZA 4X7TB 1C5DA 5DHYA 3IDYB 2VXTH 4FQHB 1I9EA 2PW1B 4JN1L 5ILTH 3EJYC 5CBEB 5I6XC 4KI5D 1Q72L 3FQRB 4KGLA 4WFGE 4ZODA 4APQB 4Q6IA 1IEAB 2MHAB 3NZHH 4K3JL 4OD1H 2Z91A 3TCLA 4HUUA 1TLKA 4OZIB 4PRHE 5GS3A 2WWKO 5ESVA 1P9MA 4HKBB 3QXDA 3L1OH 5DD3H 5JNYB 4LDLB 1A6AB 1JN6A 5E6IB 5DGRA 2F8OA 3BO8B 1OTSC 4PJFE 3IVKA 5FKAA 3VA6A 2YRLA 4LCWA 4MHHG 4U1HA 4D9LL 5KAQF 1ZT4B 1PFCA 5KVGH 4KTEH 1NMCC 1HXYB 1I3RB 2B4CH 2EXYC 1VFOA 3S4SG 5FM8A 5K9KB 1DUZB 3JBG7 3VG9B 5JDJA 1HSAB 1K6QL 5IB2A 3EYOA 2ARJQ 5CBAA 1MCDA 3NTCH 5IOPA 3BH8B 3VGAC 4LU5L 2N7AA 4M43L 1DUYA 3VXUE 2DM4A 1OTSD 1S9WB 3GMNB 4LASH 4PP2A 2YWZA 2F74A 1UXWA 1VFBA 2EC9T 2DQGL 5BRZA 4WW1B 4YUEH 3CFEB 4O9HH 5F3HA 1WCBA 1PBYA 4OZFA 5T1LB 2HP4A 3EO9L 3LRSB 1HHKA 1L9NA 4XPHL 1FFPA 3QQ3B 4N0FA 1B9ZA 5J9PB 4IMLB 4Q9RL 2X1WL 1GIGH 2W9EH 4D3CL 5LWYL 1ZA6B 3T4AA 2M8XA 3BPOB 3PV6B 3RWGA 5HHVL 1QHPA 3VW3L 1U8KB 3U4BL 3F7YB 2R2BA 5DC0A 3MOAL 1JK8A 3PWUA 3MODL 4P3DB 3UDWA 2ARJA 5IBUG 3LOWA 4U3CA 3FN0H 1U92B 3K4AA 3KGRA 2P24A 4JM2F 3PHOA 2GJZB 4ODXA 3QWOA 4NM8H 1IFHH 5DD5L 3L95B 4W6WB 2AVGA 1YPZB 5D2NC 3EFDL 1X5LA 3VGBA 5ICYB 4JB9L 4M6NL 1NMAL 5F89B 4OGAD 1JPFB 4GQ9H 4PRAA 4UQ2B 2VITB 3ZMRA 4P2OA 2I9LB 4PJ7F 3NN8B 5FKPB 4LLMB 4DCQA 4Z7WB 1WT5C 3FOMA 4IDJL 5F8RC 2D3VA 4NZTH 1AKJD 5IEKA 3MMEA 4ZO8A 2XTJB 3WHE1 5CUSL 5I19L 3WO4B 4F7CA 1T2XA 2GK2A 3U1SH 5DURD 5GGRA 2ARWA 3ULSA 2P42B 5HPOA 4MDJB 2OZ4A 4HWEH 3RFZC 1D5XA 3UJJH 4YFLI 5F96H 3QISA 1PG7W 1BGXL 3MROB 3IAPA 1H15A 4NHUB 1EVTC 1MHEB 4WO4B 1LO3L 3QUMB 4LLDA 3ARTA 1KJMB 2YD3A 2P5WE 1AE6L 4NQEB 5E0QA 3GI9H 3L3OB 1A1NB 1J86A 2HKFH 4Q0XL 3UO1H 5I74B 1ED3A 5C9KA 1KN2L 3HI1B 4YGAB 2EDDA 43CAB 4M7ZB 1MCPH 1FRGH 3L7EA 1KPRB 4M6ML 5J1AA 1JPTL 4R2GB 5E8OA 1VCAA 1U8OA 4JFDA 2QSTA 4HUNB 2ICWA 4G6MH 4C83B 1UYWH 3LKQA 2CDGB 3A67L 4I0PD 4YXLH 5EBWB 3LEYH 1IM9A 2HN7B 3BSZH 4XCYB 5F1SA 4OD3L 4XB7A 2L0DA 3G9VA 1QLRA 3QDHA 5AZ2L 3QFJD 1YEDB 4CJ1A 1PD6A 3L9RB 4WY7H 4JE4B 2MKWA 4ZPVB 4B53A 4IOSD 4LAJH 4ZS6C 1S78C 4P23A 3BESR 2VISA 3ZKQD 4OFYA 2EZ0D 4X5XA 2PXYA 1RK1A 1ZVHA 5HYJE 3SJVD 1CGYA 1Y18A 4GFTB 3KPLA 3HI5L 5FF6A 4O5LL 4O51B 3TYGL 2HJFB 5CINL 4H0HB 3AROA 4RAHA 2P8MA 2PF6A 4JHAH 5IJVB 5FGSA 4F7TB 2EYTA 4UAOB 3D85D 3GBMH 3TBYA 3PGDB 3VGAB 3ZTNL 4HEPG 4X6CA 4EOWL 4JQIL 5KANI 4JZOA 3GHBH 1UCBH 3N1MC 2J3SA 3GHEL 4ZG1A 5L2KB 3CU1A 5IT2L 3BRGC 1B4JL 5HVHB 4P2RB 1DQMH 4YHML 5DFVC 1I1FB 3G5YB 3DGGA 3QEUA 3AXLB 3LKSB 3BX7C 3WLWC 1OY3B 2ICEA 4PJGB 3X17A 4HK0B 2HMIC 1UWEL 4XPBH 4HPOL 4ELMF 3NFPB 2XG4A 4PS4H 4U0QB 3F65A 2JJVA 3UZQA 3C5JB 4JKKA 4YHOL 4HIJB 2ZKHH 3P77A 1GJIA 5EBLB 2D4DA 1QRNA 1M71B 4DW2L 1FYTA 2F19L 2YSSA 2BMKA 4P46C 3SKOA 5AAWA 5H35B 3PWLB 2HVKA 3O6LL 5HDBE 1F2QA 1QNZL 5EPMB 4YXHH 1QUNA 1S9VA 4XP6H 2X89A 3F6LA 4KDWA 2HMID 4HZLB 1GH7A 5GS1B 5LQBL 2W0KA 4FQLH 4P2QB 5IESL 3O3EA 1FYHB 2W0FA 2QQNH 1FZKA 3TN0C 3PWVB 4Y5YA 1N0XL 1RIHL 2BOBA 3FQUA 3S3PA 1WAAA 3ZDYE 2R2EB 2CXKA 1NCBH 4YHYC 1GGTA 1WZKA 2EDNA 4OZFG 4P46D 5DJ2A 3K8KA 2XTLA 4PJDA 3UMTA 1G1YA 2FJHB 3WSQL 1MH5B 3PJSA 4GSDH 4KDTA 2NYYC 4KGJA 4N0CC 4P3CL 1NGXA 5TE7L 4F7MA 4JZNB 5AZEH 1NFDE 1ZLSH 3TA3D 4YX2H 3T8XA 4NBXB 4Y19E 2LTQB 4I77L 2MNUA 4A6YH 1JRHL 2X9XA 3T4YA 4P57A 1J5OH 3NPSC 1KTDA 3D3VD 3DPBA 5CEYA 5D1ZC 1RUPH 3FQXA 3O9WD 2FATL 2WBJA 1V3JA 4KAQL 5CILL 3U36A 1UGNA 3OB8A 2J7LA 2FHCA 4DVBB 4FXKA 3NFNB 3CFJB 2HFEB 2JELL 4XAWH 3V0AC 5E7BA 4M00A 1A6TB 4QRPB 4N0CD 4NO0B 3SQOL 4JGJA 5CIPH 2VXQL 1KLFA 4HC1L 3IDUA 5H8DA 5MENB 3HUJE 1IC7L 3KS0H 3TT1L 1R24B 2DLHA 3IGAA 5DJXB 1I8IA 4YHLL 4NKOB 5D1ZD 4D0BA 3PWPD 2NCMA 4JHBA 1IGML 3BHBA 3G9AB 2BVOA 4HQQH 2APFA 2P4AB 2NY6C 4TSAL 3OB0H 4ELKA 3PWJB 5EU5B 1QSFD 3IAGC 3G04B 2V2TA 2CJUH 1IKFL 1TQBC 2DLEA 3REVA 1K2DB 3V95A 5FEBA 5EUKA 3QDGE 2AABL 4NO3B 1TXKA 1K8IB 2Y6SC 3K4DA 3V4PL 3WIHL 3OKMB 5FO7A 3BE1L 4U6XB 3MLWL 5IFHH 5CSGA 5C0GA 1OGTA 1DQTA 2AV7B 2Y7QA 3CX2A 4FZ8L 2NY6D 5E9DD 2Y1VA 5GJTH 5C0AD 1KELH 4ZAKA 3SE3C 1K3IA 1PLGH 4J4PA 4CDHA 1XCQA 4TUKL