5DK2B

Fc heterodimer e356k/d399k + k392d/k409d
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
208
structure length
208
Chain Sequence
GGPSVFLFPPKPKDTLEASRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYDTTPPVLDSDGSFFLYSDLTVDKSRWQQGNVFSCSVMHEALHNAYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 208
sequence length 208
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dk2B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dk2B01
2IH1B 3KDMB 5ALBL 1BQLL 1AO7A 1NFKA 1T1YA 2BY3A 1DR9A 4U6YA 3VWJC 5HYSG 4EQ2A 4ALAH 1ORQA 3PV6B 4L8SA 1J87A 1NGXA 2JB5L 1JL8A 1NQBA 4JM2C 2X4NA 2BOBA 4DQOL 1NUGA 2QHLA 5GGVL 2ATKA 3OJ2C 1A3QA 3M1BA 3SDDC 1A0QL 5D2LE 2DICA 4CVZB 4NM4H 4CUCA 5I1AA 3H3BC 3Q6GL 3BUYA 4NN6C 4S1DC 5CFHA 1NBVL 3Q48A 2OMBA 2F54E 4P5MA 5IW6A 2VDLL 3BOVA 3GFUA 5TGBA 4JDZA 1TZGH 1LP9E 3H42L 2LFGA 3MLZL 5FV1L 1TJHL 4IMKC 4NC0B 2H6PB 4O5LH 1XIWB 5IJVB 3MJ6A 1MHHA 2EDNA 3D1MC 3ARFC 4IIQC 1KJ3L 5CD5D 3FO9B 4XNZB 5J9PB 4PTUB 2QTEA 3MV9A 1IQDB 1KXTB 4GG6E 4Z7QE 1PY4A 3ZE1F 5J6HB 5FYJD 5IHUL 2VRAA 1P5VA 4OCLC 3BE1H 4DGIL 3RWEA 5BJTB 4MDJA 2RIKA 1KYOK 4L29A 5AG8A 4WY7L 4RFEA 1RHHA 2VXTH 4G8IA 2ERJC 4NZRL 4Y4HC 3U0TB 1TNNA 5D7LB 4LDLB 4NGHL 3QDGB 1BOGA 3GZKA 3VXRE 3AAZB 2FX8H 3BVNA 2IQAA 4LEXH 1UM4H 4MQXD 4ODTL 4RWHA 4OFYD 5HYFA 1E6OL 5ESVB 3WLWD 3MBXL 4LLUB 5GRJL 4G42B 3IFNH 3OJVC 3MJ7A 3IKCB 4KTDH 2QKIA 3S35X 2XWTA 4HSQA 4G5ZL 2PYEB 4IDLA 5FO7B 4JY4B 2F5AL 1ZS8B 5I1HL 3L7EA 1RJYB 4P4KC 3RVXD 5HGHB 5I18H 3WHE0 4Z77A 3QZWB 3QH3B 3SOBH 3D2UB 1DVFC 4NIKB 4IRJD 4HPOH 2ZOLB 5EU7E 2DQCH 4YJZL 2XA8L 5KTEL 1NGWA 1T66D 1VFOA 4F33A 1LE5B 2VLJB 3MLRL 1EHNA 4NC2B 2PKDA 1IAIH 1VKXB 4PP1C 5KVEH 5J12B 4X6DB 3DYOA 3PP3K 5FECB 1OCWH 3CSPA 3RP1A 1U3HD 1HHGB 2HLAA 1G9MH 2F19L 4ORZC 3V0VB 4LRIA 3S34H 2JB6A 3SBWA 4QHMB 2CLZB 1IGMH 4M1DH 3LEYL 3MRHA 5DC0A 3EYFB 5CJQL 5KSVB 3U9PL 2QSQA 4URTB 3SDAB 3F7YB 1XCTA 2C3HA 3RU8L 3L3JA 3WJLC 5JDSB 2CQVA 2H3NB 3DIFA 4JN1L 1P7QA 4MAUH 2HH0H 4FQHA 5I0ZA 3ULVE 2ADGA 5CJXA 5ICXA 1MHPL 2CMRH 4C59B 4MD5A 1ITBB 4O02L 4PV8A 5F72S 1A1OB 1SYVA 1HKFA 5BW7A 4M5YH 5C71A 1KBGL 2GYSA 1U3JA 5EWIL 1HEZB 2NY6B 4D3CH 4G6KL 4Y4KA 1KIQA 5I8EA 5E00A 2VLKA 5B39B 3L3GB 2XACC 3I3EA 3VXSB 1G9NH 4FFZL 4E5XB 3VXPA 2EDOA 3MFFB 2AABL 1QSEB 1VEPA 2VJXA 3O2WL 2EO1A 2D03L 1SBBA 1I1AC 1EXUA 5DD1H 4OUUA 1QSVA 4QRPA 5SX5H 4NUJA 4F3FB 5FDWB 3VI4E 5CD5C 3REVB 5EULV 4PD4K 4JFPB 4AMKH 4DVBB 4CVUA 3U1SH 5FUCC 4X6FB 5BXFB 5EBMB 3P9MB 5F9OL 1JVKA 4IDJH 5D1QD 2ORBH 1LEGA 5T1KD 3S37H 1RZJH 3NCEB 4C58B 3AU1A 3OKKB 1F42A 2VZ3A 1IEBB 5LKNA 5CJBA 5AZEL 4YR6B 4PLKD 5CINH 5EOTB 4MQXC 4NQSB 4ERSL 3KJ6L 5INCB 3WLWC 1BMGA 1MCNA 4Y8AA 1QUNA 3KXFE 4JZOB 3HG1E 2NY1B 4N0CD 1RFDH 3RGVA 5HHOE 2FX7L 1ZA6A 2NMSA 5L2JA 2LV4A 3N1FC 2BNQA 4MA8L 1CK0L 3ZSSA 1J10A 1UVQB 5DK3A 1T0NB 1F00I 1FPTL 1AHWA 5HDQH 3NZHL 4XP5L 4KKNA 4NJ9H 5IOPA 1CU4L 4WDIB 1BZ9B 1QRKA 1KELL 3PF2A 4I0PB 4HIEB 3MRDB 4R0LA 4BSWB 4QXGH 4JRXA 4CNIA 3ZYOA 1DUZA 3OKNB 4RNRB 3CFKB 4XNQB 3Q2CA 1QLRA 3FJTA 2DDQL 1LK3H 3V4UL 3RPIA 3GBLA 1JPST 2LABA 3ARDA 3VCLA 3QWOB 1KCRH 3QG7L 2XA3A 3T2OA 5IVZB 4PJGF 1RVFH 3CH1A 4PJHB 5C09A 1QFPA 1JMXA 5BRZA 5HPMA 2QEJA 5D70H 3MQIA 3DBXA 3C2SA 1BVZA 1AGFB 3QNZA 3TVMD 2JCCB 1I8LA 1N4XH 4N0FB 3MRIB 4OGAD 4WFFD 3ZDZF 2DAVA 4JFDD 1TPXC 4W81A 3C2AL 2V7HA 3EHBC 2MKWA 3INUH 2DL2A 3MRBA 3JWDC 4N0YH 4WI8A 3CSGA 2R29H 5EC2B 2ZP0T 3QXDB 4LPUA 3U4BH 3ILQD 2FEDD 1EFQA 5L9DL 4JLRB 1J86A 5DUBB 1IMHC 5EBWB 4XCNB 4UT6H 1RZFL 3FCTB 3SGEH 1MREH 2ZUSA 4NWUH 3HE7D 4R2GB 5C0AA 3C09B 1K6QL 1BVKA 2UZXB 5D7JD 1E28A 3G6DH 1CN4A 5DQDL 1URLA 4R97C 3EAKA 3CDFA 1IC5L 1EK3A 4MA1B 1TZHB 1JP5A 4XPFH 5D7IF 3TNNB 3BJLA 5IQ7L 1CD9B 4TUKH 5INDA 1HHKB 1YQVL 3N06B 3L3HB 4XWGH 4NQTA 1TENA 1I3UA 2X4OB 2D9QB 4Y5YC 3RL1A 2VWEC 4OIIL 3CC5A 2JJSC 2B7DT 5CD3B 4U7SA 1MRCL 4PGBB 1XZ0A 4RSVA 2V2XB 3EDDA 4S10A 4EVNB 3D85A 3QB7C 4EI6A 5I19L 2H8PB 4EN3A 2QSCH 4E42A 4Y1AD 4J4PC 5E6IC 3O3AA 3TIDB 3Q1SH 1Z9OA 3VG0L 1JV5B 5JPMA 4F7EA 1WTGT 4FQJH 2D0HA 1J8KA 3EYSH 4GXUM 1FL3A 4E0RA 5C08A 3FKUS 3MACL 3PP4L 4WO4C 4OLZH 1QBBA 5KVFH 1MHEA 1MCDA 4N90E 1MFCH 1LHZA 2X4SA 2BVOA 4NT6B 2Z91B 2D7PA 1KCUH 2B0SH 2HTKD 3KPQA 1MJUL 3FONA 4CJ1A 1T3FB 4YEEA 3BPCA 2FL5B 1OP5H 3VGBA 3BGMB 5HYEA 2YC1A 5A16A 1I8KB 2WANA 2NW3A 2MCPL 3EYUH 4LIQL 5IT2H 3JTSB 2GAZA 5K9QG 1FJ1A 3VFGL 5HDLA 1TVBB 4LCCA 5J11B 4O2EA 5C0CD 1CFNB 5DQ9B 2DQUH 4QXWA 4UNTA 4TUJA 4GMSL 1MFAH 3P0YH 5EG6C 4Z95L 3MGTB 2AJYL 4ONHA 3BP7B 1YEIH 2L4OA 4YHKL 3LEXB 4RGOL 3ULSA 4HC1L 4ODUA 2QADD 3IDIB 5DJDB 2XXMB 3EOYG 1S7RA 3X11B 3DX8A 5F7NC 3W2DH 5LBSH 1V8HA 3HMWH 5F1OB 4HXBL 1NC4D 3P40A 5TF1L 1FO0H 2V9TA 1W2KT 4ZDHA 4PJXA 3FQNA 4OGXL 3TVMC 1YEJL 3SDCD 1R24B 4PJXF 5I76B 1P7KA 3NIGF 4U1NA 4G9DB 4KK9D 5I15L 1UGNA 3IAQA 3VFNA 4Z76A 1SJVA 3M17A 2Q6WB 1CIDA 1QFOA 2DBLH 3CVIH 4L5FL 3ILQC 2FEDC 3QEQE 2PYFA 4FFWD 4L9LA 4QHKJ 2AV7B 1ZT4B 1ZHNB 4X7TA 2V5MA 3TCLA 1I1FB 4G8FA 5JIPA 4GAYA 4BFIA 1JPGB 4RAVA 1IEHA 5SWSD 4JO1H 1J8HB 1TJIL 2X1OA 1KNOB 4OKDA 1IGTA 32C2B 2J7LA 3BQUC 3RA7H 5D2LA 3U6RB 4D0DA 1HE7A 2XTJD 3EW3B 2EO9A 2F54A 4LNRB 2J1KA 2PCPA 5FCUH 3RZCB 1INEH 3GSNB 4WU7A 4TUOB 1KIRA 1LP9A 1VFAA 3BD5A 5CEXA 4H1LA 1YMHA 2GFBA 3NPSB 1TTFA 4YUEL 1FRGL 1S7UB 1NEZA 2PETA 3KLDA 1KLUB 4YGAB 3BGFC 1LO3L 2VDPH 1DBAL 4JFOB 1YEKL 2X4TA 3BIKB 4TSAH 3ZT7A 1S7QA 3LRHA 4MAYC 4POUB 1KV3A 5EU6E 2VLRB 3GSQA 2GIYA 4X9HA 5HI4C 2VZSA 3RDTD 2VDNL 1MCFA 4NFDA 1AFVH 4X6EA 4JEGB 4LQ1A 2VN4A 3EFFB 3TA3D 3D3VE 4RISL 5GSRB 1GIGH 4OCRH 1YN6A 4WHDA 3DUSB 1EUTA 3AB0B 3VXRA 1QLEH 3W11C 3QEGL 3UJIH 1A9EB 4WWKD 4U6XA 4CADB 4UIMA 1U8HA 2XN9B 2Y5TA 4XPAL 3LD8B 1U8QA 4V1DE 3PDOA 4ELKA 3PQYE 5EZJA 4XWOD 5B21A 4JQVA 2F53E 5I1CL 3R0NA 2VDKL 4ZO7A 5DHYB 5C0BB 3DO7B 5FYLE 2ICWA 3NFSH 3RUGE 2C9AA 2BVQA 3OKEA 3OGCA 1NDGA 4ACPA 1HSAB 1LO2L 3DXAE 4M5ZH 4JY6B 1H15A 3A6CH 2IALB 2UWEE 3VGAC 4XB8A 3PWUA 4KJQD 3C6LB 5F6HI 1T2XA 5F7DB 1JHKL 3CX5J 4X98B 3H0TB 1IKFH 3B3IA 3VWKA 1F3JA 5I1LA 4CMHC 2A1WH 1I7RA 4AEHH 3ARED 5EC1A 2AJSL 2Y07L 3MTRA 3K4AA 4OZGB 4G8EA 5F44A 4LGRB 4OLEA 4PRDA 3MLUH 2AEPH 5FOBA 1B0RA 1HQ4B 2HVKB 3RWGA 4KKAD 1U8KB 1WV7T 2VITB 4PJ9A 3OGOE 2FNBA 4MNHB 4ZFGH 1LEIA 4G9FE 4MHHG 3DYMA 5E5MB 4HBCH 3TH4T 4KK9C 1I9JH 3WNMA 2BZDA 3BI9X 2OJZL 2IMMA 1NGYB 3GSOA 5FUCE 3N85L 3O11A 3FB5A 4TYUA 2HJKA 2X4RA 1MWAA 5CJOH 2AXGB 5T1MB 4OI8A 3HR5B 4P2RE 4XMPH 2ZJSH 5J1AB 2RFXA 1U8NA 5HHMB 4I3SL 1ZLWK 1G6RB 2R69L 4G7VL 4MJ6A 5GSVB 5AD0A 7FABH 2IANE 1LO5B 4JO3L 4OB5L 3IXTB 3T77A 5IR1B 4NN7C 5DYOB 1K3IA 5JR1H 1QFHA 3SKNA 5MEOA 1XR8A 3VFTA 1CDYA 1HQRA 3MLTA 1PG7H 3GIZH 4TVPH 2P48B 1A6AA 3OXRA 3UPAA 5E2UH 1UZ8A 2XTJC 2EDLA 4OF0A 1RUKH 4PRNA 4CMMB 2G9HA 5B8CC 5F3HB 1BJ1H 2XNAA 4WHCA 4KGJA 3LDBB 2YXFA 2D7TH 1LEKA 2OL3H 1AR2A 3O2DA 5C6TH 2KDGA 4LSSH 3V5KA 2I9LB 1YEGL 5EOQL 3V52L 4YXLH 2YEZB 4PJBB 3AS2A 4P2OB 1EBAA 5AAMA 5FIEA 4IRSD 3CFDA 4K94L 3S96B 1YNLH 1EGJH 1KCSL 4JKKA 4ISVA 2NY2D 4TSCH 3GSNL 3OKDA 4Y4FB 3TA3C 2DB8A 3F7RA 3PP3H 4Q6IB 4X5LA 1R3HB 3SQBA 2C1OA 4YHPA 1J0ZA 3B9KD 4NJAL 4YHZL 5FA3B 1D3CA 4WWKC 1BVLB 2DLFL 2VH5H 1WEJH 1WAAE 1NAMA 3B4NA 1YUHB 2R2CA 3KXFA 5D1XD 3HG1A 3LIZH 5GS1B 2ZSWA 1OM3H 3QUYB 4XWOC 4EXKA 2NPLX 5HHOA 2ZOKB 1ZHBB 3VFPA 5J1SC 4YAQB 1ZWIA 4S1SH 5EIIB 2A6IB 3QJHB 2YN5A 3LPGA 2SEBB 3AXLB 5GRUH 2LU7A 2WBJC 4JO2H 2AK4A 3T8XA 3C60A 5K9OB 3PWVB 1AKJA 1A6UL 5C07D 2FIRT 4KJQC 4HKXA 3NABH 4NKQB 5D1ZB 1AY1L 1J0IA 1KPRA 4Z7WE 5ACZB 1IC7H 3QIWA 5JHDB 2JE8A 1AJ7L 2GTWA 4M6AA 2Z4QA 3W5NA 1MH5B 1P84J 3BRFA 3DUHA 4GQ9L 1UCTA 1D9KC 4DK6A 15C8H 3RY5A 3MA7A 4WI9A 1QFWI 1U8IB 1F11B 1NC2B 4P46A 5EO9A 5F7YC 3GBNH 5I8KL 5TE4H 2IFFL 1I4FA 3EGSA 3RWJB 4FZEL 2IPUK 2W65B 1SJEA 1KB5H 1N64H 1Q9LB 1RUPH 3G9VA 2NTFA 2VC2L 3MRNA 1DUYB 5TDPA 3RAJH 2Q7YB 5ICYB 5FHBL 2F15A 2N1KA 2VWEE 4QLRA 1OP9A 1QBLH 5LWYH 5TQ2L 4AIZB 5DJYA 1WC7B 5F88B 4JHWH 4X9BA 5GJSL 4E41A 4U2ZA 1Q9WB 4PJDB 4MNQE 1WIUA 5AAWA 3QXAA 3BJ91 3PXJA 1SEQH 3MLWL 3PGDB 3VRJB 1U8LA 5E99L 1T04A 2R23B 1A14H 4M93B 3QUMH 4H8WH 5FGBA 5C0FB 1UM5H 3OQ3B 4EI5A 2P5WD 1TNMA 4GQPH 3VA2C 2AJZB 3JBG7 4K55A 4ONGL 1XF2B 1YEHL 4ZFFB 4MVBD 4RMTA 5C2UB 1X5IA 4XC3L 2BSRB 1U91A 5KAQF 3UCRA 2AKRA 4X80L 4LF3A 3RTQC 1INDH 2Q76A 3MRGB 1IT9L 3DMMC 2MJWA 3KWWA 1TLKA 1AO7B 1S5IL 3KHOA 5DA0B 4JQIL 3P0VH 4U6YB 1C5CL 3FQUA 1ORQB 2GUOA 1DL7H 4L8SB 3SN6N 2HKFL 5HYJE 5GGUB 4JKLA 5DMYA 3K4DA 1DBBL 4HFWB 4JFEE 2ZCHL 3GRWH 4YO0A 4IRSC 1HDMB 1PY9A 1QQDA 5I1AB 2W9EL 3BUYB 4QHLA 4JCLA 3HRZA 1WCBB 5IW6B 5TGBB 4BFBD 2NY2C 4JDZB 3LQAC 4M61A 1MCWW 1NMBL 1CG9A 4HPYH 4PYHA 1MNUL 3HPLA 1YEDA 4OQTH 3CMOL 3VI3F 4KJPD 1YEEL 1MHHB 3DVNA 1EO8L 4FNLL 1CBVH 4DKEH 2ESVD 1I3RA 2GITA 1A9BA 2WP3O 1NJ9A 4NQED 3BKCH 5D1XC 4MZ3A 3GSXA 3C5ZA 5MENE 4Z18A 4J6RL 2DJUA 4O58H 1BZ7B 3K0WA 4RFEB 4G8IB 3QCUL 2E9JA 2EIZA 3GSWA 3TGXA 5EOCL 3VFOB 4MXVF 1BOGB 3HC0A 4YIQA 1MSPA 4BSJA 1U6AL 1CDGA 1V7NL 3LKPA 3AY4A 4XMKH 3UPCA 1F6FB 3A6OA 1S7SA 1K8DA 2EDDA 2OS7A 4CVXB 3DPBA 1CE1L 1MCJA 4JPKL 5E03A 4R26L 3Q6FA 1NFDE 2AK1H 2A9ML 5F89A 2Z35B 2QKIB 3C6SB 1GGYA 1CGSL 1J1OL 4QY8B 4UTBH 3UZEA 4YQXL 4G6ML 2AW2A 3HA0A 2DQJH 2E5EA 4YE4L 3NIDE 2AJVH 4XC1L 4JM2A 3QIUB 5MEQA 1YMMD 5JZ7D 1LK2A 2XY2A 4ZSOB 3SDDA 3CXHK 5CBAB 4KRLB 4Z77B 3S8WA 1CXFA 4PGDB 2OTUB 4LSPH 5IBUB 1LDPH 2KQMA 1T1ZB 3LCYA 2NXYB 3BZFB 3T1FA 1MCRA 5F3BB 1WWCA 2YSSA 4RMVA 2FGWH 1MIEL 3GSVB 1NGWB 2VERN 4IMKA 2C26A 4F33B 3CAFA 2YUXA 4KY1H 1RU9L 1CL7L 4LFHG 1N6UA 3ARFA 4IIQA 3MRCA 4FQ1L 2UVFA 1S7TA 1U36A 2AI0L 5BV7H 5HYQB 1MCLA 3H3PH 1L7IH 4MNGB 1P4BL 4WHTA 3SKMA 4LBEB 2H9GA 1QFWH 2EDRA 1AGBA 1KACB 3MRHB 3QEQA 4AIXA 3MROA 1OVZA 4Y4HA 4UDUA 1E4WH 4UUJB 3HI1A 6FABH 1OP3K 4POZC 2XZZA 4MVBC 3IJSA 3Q5OA 3GI8H 2FCBA 3MRKA 1I7ZA 4YHLH 2DQHH 1P7QB 4JPIA 4XNXH 5GS3A 3T3MF 1C8PA 1P2CB 3CK0L 1HIML 2GSIB 1A1MB 3Q3GA 2I60H 4HG4J 4YFDB 4FQHB 2R2HA 1FL5A 2ADGB 2MKLC 5ICXB 4UQ2B 4JRWA 3S36H 1IRAY 2NY3B 1JNHA 1M7XA 4MD5B 4PV8B 1RZJC 4K3EH 3TBTA 1SYVB 1WBZA 4UIKL 3GDBA 2F8OA 4HKBA 4HUXB 2VDRL 2ZCLH 4P57A 4P4KA 1JGLL 5I8EB 1KIQB 5MEPA 5E00B 1T1WA 2NR6D 4YDVA 4Y19D 1DVFA 1TVDA 3G6JE 3G5XA 5EU6A 4BSVA 3RNKB 1FVDA 1LO0H 3VDBA 1CLZH 4KJPC 5IM7A 3B2VL 1T1XA 2NXZD 2EC9T 2IPTH 5EU3B 1NKOA 3D3VA 2VSCA 4JGJA 3SE9L 3MV7D 4I1NB 1Z5LB 5E9DE 2V5RA 3FT3B 3GMPB 1INQA 4XPBH 1PKQB 3GM0A 4X83A 3HLAB 1S9YA 1LEGB 4Z0XA 1QHPA 4KUCF 2HKHH 2NY0C 4PTTA 3DVFA 1JMZA 4OFDA 1JZ4A 3RPKA 1BLNB 4XP1L 4V1DA 4OT1H 1TZIB 3PQYA 5CZKA 4PP2A 4HQQH 4XCEB 3LZFL 4ZFOB 5I8CA 2F53A 1FVCB 3WJLA 5F7FA 4LLAA 5B3JF 3RUGA 5DGQA 5GRZA 1ACYH 3HAEA 5FYJL 3PJSA 4QOKD 3G08A 4PB9H 3DXAA 3RGVB 2UWEA 3IGAB 1ZA6B 5L2JB 2BNQB 5IESL 4KHXH 3TJEH 3GM8A 3FN0H 4H0HB 1BQLH 1B2WH 1MFEH 4FZ8H 3T0AA 2XICA 5SWSE 1GZPA 3D39B 1AHWB 1A4KA 4LSQH 4ZOCA 3KYNA 5F7EH 3OAUL 2XTJE 4P3WA 1KN4L 5FUZL 1TITA 2CXGA 4IMLA 5E24E 4K23H 1YECH 4R0LB 3Q6GH 4JRXB 1I1AA 5ECJE 4U1HA 5AWNL 5TH2A 4RGND 1QFUH 3MUGB 4DWHA 3P73B 4G9FA 5C92A 2AJ3B 3DRTA 4KPHL 2PXYD 4K7PH 1ZSDB 3O2VH 4GLRI 4YBQC 1IGIH 4PJGB 4MGXA 1RI8A 4ZFZB 4P2RA 2VDML 3HMXA 3NZ8A 3NVQA 3RWIA 1OSPH 3ZSTA 3UZQA 4BKLA 3IDMB 2KQNA 3V5HB 3TF7C 5DTFB 4A2LA 5HPMB 1MPAH 3RI5K 2IANA 3DBXB 1QYGL 2UZYB 4DGIH 2HRLA 2P8LB 5D96C 3KPNA 2OR8A 1WUNT 2MHAB 4JFDB 2IBBA 4WY7H 4M00A 3QYCA 2BERA 3FQTB 4LKCA 1A1NB 3THML 4MWFB 2CLVA 1BD2D 2V7HB 3TCXA 4OFYA 4EEEA 3KVQA 5CP7A 1ROWA 1SHMA 5IQ9B 5E6YA 1KPVB 1CI5A 2X42A 2WUCL 4ODTH 4JFFE 5GHWL 4FXGA 1KSRA 4HCRA 5CLWA 3QUXB 5GRJH 4J2XA 5KVDL 3WIHH 3FFCB 1HXYA 4JFYB 5DUPL 1NKRA 5IJKC 4G5ZH 1UCBH 1S8DB 2NR6C 5C0AB 1MUJA 3SKJL 1BVKB 4PJCF 5I1HH 5D7IB 3V6FB 5FFLA 3NPZB 5HY9B 4KRPD 2K3TA 5JW3H 2EDQA 3MBEB 2Q86A 2V17H 5E94A 1X5GA 2R4SH 1EAPB 2L7JA 4X8XA 5T1DL 1KIUA 3VH8B 4S0TD 5DK2B 1CFVL 3CC5B 2JELH 2XA8H 5IVNA 2XQBH 5BZWA 1SYSA 1BOYA 1I8IB 4M4PA 1G1CA 2V2WB 2Y72A 3D85B 4EN3B 3C5JA 4M7LT 3MRFA 1PSKL 1WAAA 1MCBA 4F7EB 3QO1B 3K3QA 3RWDB 1FL3B 2Y6SD 3RX5A 5T3ZL 1R5WB 1B0GA 3A67L 5CJQH 5FB8A 3U9PH 1MHEB 3GMLA 4YEFA 4LASL 2HFEA 2BVOB 1OTUD 2H32A 2B2XL 3KPLA 1ZEAL 3BXNA 4KMTH 3S9DB 4JB9L 4NHUA 4WEBL 5DRNA 4B41A 4Z7WA 1H0DA 2YC1B 3JV4A 5E2WL 2J6EH 2KL6A 5DD6B 2VO5A 4ZFOL 1RUQH 3CU1A 4HH8A 2GAZB 1RJZA 1FJ1B 3S5LG 3MODH 5EWIH 4L1DA 4GAFB 2P49B 3DETC 5FYKH 3VG9B 3T65A 3VFRA 4FFZH 4RFOH 4XXCC 5HYSA 3RY6C 5E8DL 4ONHB 4OSUH 1JZ3A 2D03H 1OT1A 2ED8A 2HFTA 4X4ZA 4Y5YA 2PXYC 3ULSB 2HJLB 3OX8A 2JJSA 4A6YA 4I5BA 2ICWJ 5EN2A 3BDYH 4PS4L 3O6LL 4NBXB 3S98A 3DX8B 1JRHL 1RIVL 1SM3L 5C2BL 4TVPD 1K2DA 2JTDA 4X99A 1EO7A 1NMAH 4KU1A 1JWUA 2EICA 4J4PA 5E6IA 1FV1B 4MNQA 4N8CH 4ZDHB 4PJXB 1NMCB 4LCWE 5EH1A 2ZSVB 1QPPA 1GYAA 2HLFD 1P7KB 4MJ4A 1CVSC 4U1NB 5DLML 4OZFA 1A7BA 2Z0BA 5C0NC 3FN9A 4WO4A 1L7TL 1MJ7H 5AZEH 4DN4H 2BCKB 4HMCA 4HS8L 5DJZB 3T0XA 1F97A 3KJ6H 4LVHB 5IF0A 5JOFA 2EKSB 2ICCA 2PYFB 4Y7MA 5CCKH 4GJTB 5C0RL 1VPOH 1R3LA 2K7PA 1X7QA 4X7TB 2FX7H 1ZVSA 4G8FB 2BX5A 5CMAA 1HK6A 5HYJA 2P8PA 1CK0H 2VABA 5IWLC 4K7FB 1CICD 2P1YA 4JFEA 3QCTL 1V7MH 4WFED 4ZQKA 1IGTB 3GB7A 5EU5A 5BS0B 4RGMC 1WGOA 4D0DB 5FEBA 1PBYA 3C5SB 1CT8B 2F54B 2XKSA 2PCPB 1KELH 1KIRB 2I9TB 4QXUL 4R96A 1A3LH 1FQ9C 1X44A 1YMHB 2EDJA 2YUVA 4U4BA 2FATH 5HGBB 4V2BA 1MAKA 3MJ9L 3MV8B 1AD9B 1NEZB 1S78D 2DI8A 2ITCB 2WSKA 5ISZA 4RDQF 2QQKH 1DLFH 2X4TB 3MMEA 5KJRL 1S7QB 4N5ED 5JPNA 4JRYD 4PLOB 1ZLSL 1EO5A 3VXTA 5FM5M 1NBZA 4GRLD 1GSMA 5MENA 2Y6SC 5TQ0H 2XZCL 5F70A 1YC8A 5CGMA 1U8OB 4UV7L 4C4KT 4K9EL 4WW2C 1YN6B 4HIXL 4QHNA 5E8EB 8FABA 4NNPL 1KULA 3UTPD 5DJAA 3WNKA 4DN3H 3VXRB 5HI3D 1FG2A 1OTUC 4N0UB 4YK4B 3NFPA 3QAZB 2HWZL 5E2VL 5CUSL 4U6XB 1QKZH 4UIMB 1U8HB 4PJIE 1EHXA 3D5OF 1BM3L 4NRZA 1BQHG 1NFDA 3TPUA 3PDOB 5KANI 5CP3H 2CLRA 5F1KC 2BRRL 4TULL 1NFDF 3DSFL 1XCQB 5ESQB 2BVQB 3NA9H 5C6PB 2Y36L 3OGCB 3CX5K 1NDGB 2AGJH 1T0PB 3BQUA 4KRNA 4M62H 3LAFA 1UXSA 3PWUB 1OWWA 2WZPD 3KLAB 1KJMA 1ED3A 1D5XA 2IBGA 3UTSB 5HHQA 5J13B 3B3IB 3IVKB 1F3JB 5I1LB 4UDTA 1BECA 1I7RB 4DUXA 5EC1B 4DK3A 2G75B 2PTUA 3NACH 3RJDA 2CRMA 3A0OA 3S35H 1E27B 2OK0L 4LPCA 1OPGH 3LY6A 5ITBL 4MAYA 1B0RB 3JWOL 3RWGB 4X6CF 1J7VR 1H8NA 4PJ9B 2F8XC 3DV4A 5DO2D 2EDTA 1UA6L 5GGRB 5I19H 2R0WL 4OIAA 5M7QA 3MUZ1 2YOCA 3GBMH 3VD3A 4PJ5D 1XGRA 5D6DC 3VG0H 3MA9H 5ANME 3RNQB 2RAMA 2ESVE 2X1PA 1C16B 4I18B 5FGCE 3O11B 1IBGH 3KG5A 1M71A 2Z8RA 2X4RB 3OJDB 3QCVH 5I9QB 5IBLD 4UAOC 3WUWB 4DUWA 3WL9A 3BDBA 2P5ED 3ZYJA 4QRSA 1X5YA 1Y18B 2RFXB 4YHNA 1U8NB 1HHJB 4MJ6B 4HEPG 5AD0B 1SY6L 3BPLB 5GZNC 4L8CB 3T77B 1MJUH 3I6LD 1ZTXH 1EEYA 5GGTA 5MEOB 1XR8B 1XGYH 2YPVL 3VFTB 3L95A 5DMIL 4OLWH 5CWSA 1WZKA 5F7WC 2VQTA 3MLTB 3L5HA 1H3PL 1A6AB 1UZ6F 5DSCA 4QNPF 5C7XL 1QRNE 1S9XA 4ENEC 1KC5H 3MCLL 3ARYA 2HT3D 5I6XB 2DYPD 3G6JA 1PD6A 4F7TA 4OLXH 1NFIA 1ZGLM 4GXUN 3MXVL 1A6TA 3UP1A 4DVRH 1UXWB 3VRLF 1YMME 3FT4A 1IKNA 1A7OL 4MJ2A 2FO1A 1XH3A 4BUHA 4PR5A 3V5KB 1X6NA 2GJZA 4KMLB 5JIIA 4HC1H 5E9DA 3CFDB 3QPXH 1CGUA 4UINH 2PO6D 3L5JA 4LSDA 4EJ1C 1T2QL 4GS7B 3OKDB 3GMOA 1CDHA 3OR6B 4Q74A 1O7VA 5TF1H 4K71B 3TN0C 3UYRL 5CAYB 5HI3C 1GGBL 3WFDH 4WGVB 3HS0A 3FRUA 1F8TH 4AM0A 1KB9J 4GAJL 1NAMB 3KXFB 1D5IL 2ICES 3W82A 3FB8A 1OL0A 4ZUWB 1OP3H 3IF1A 4L4VB 2W59A 5DJ6A 1ZWIB 3L1OH 3CFJB 3I9GH 5IMOB 5SWSA 3TNMB 3LN9A 2AK4B 3EIFA 5T1LD 4LAQL 3SCMD 1AKJB 4KI5D 3LKSA 2FRGP 1ES0A 1FE8H 4D0CA 1P84K 1TJIH 4QGYA 1LNUB 2C1PA 4HKXB 4KI5F 1KIPB 1IJ9A 3QEUA 4XVTL 5A2IH 4N9GA 4ZPTA 5B8CA 3DRQB 5GGRY 4B7IA 2MPAL 2Z4QB 1I9IL 2R0ZH 3VMNA 4AG4L 3IT8D 2I26N 4NSKA 1UADC 3SJVB 3MA7B 2DQDL 5EO9B 1FRGH 4Y19E 1BFOB 4NQCD 1YNTB 2DQIH 4BFGA 3EGSB 4YXKL 5ID1B 3WFEL 4GKNA 5DO2C 1LO3H 1SJEB 3BYYA 5FDYA 3T4AB 2A9NH 1MJJB 4L3ED 3C8KB 2OZ4L 4JG1H 4U1IA 2NTFB 3MRNB 5IIEB 3TFKC 2VE6B 2VDNH 3TA3A 4N8VB 2DS4A 1QSFB 3MV7E 4Q0XH 4XCFL 1L6XA 1WBXA 5DJYB 3O81A 4YX2L 1VSCA 4RISH 1YJDC 3EBAA 1MJ8L 4NUGL 4XBGA 4E41B 5F1NA 1YPZF 3RL2A 3V6OA 2EXWD 3MRJB 1WIOA 3QXAB 5CGYC 4K3JL 1BQUA 4OLVL 4S1QL 4TN9A 4JFFA 1BGXH 2J3SA 1U8LB 2P47B 2YD6A 2RBLA 4EI5B 4WTZG 1P7HL 1QO3B 3CXDL 1T22B 5MP6H 1F02I 1Z0NA 4QOKE 2WBJA 3H7LA 3D69A 3TYGH 3TIEA 3SEPA 3QEHB 3UTTE 2HT3C 3O41A 1L6ZA 2AKRB 1FBIH 4WHYH 2AEQH 4NM4L 1AXIB 5JIKA 3QUZD 3C9NA 1LO2H 3DURA 5E4EB 1G7PA 3FQUB 4Y5XC 5GS2H 4PGCA 4LVNB 1TZGL 4ZUSA 3QXWA 3ZO0A 7CGTA 1OSZB 2BNRD 1D9KA 1E4XH 5IV2A 5ETUA 5SV3A 3PWPE 1A2YA 1MRFH 2Y07H 3RRQA 2A6KA 4WW1A 4QHLB 1KJ2A 4PRBA 4QHKI 4R8WH 5HDBF 2OTWB 4J3UA 4G6AD 3VFWA 2NX5D 3HZYA 1Z2KA 4BQ6A 4MD0A 3P9LA 4M61B 1K5NA 1YEDB 3BE1L 4Z7VE 5KSBE 1JZ2A 5F1IA 1A02N 2VXTL 2YPLD 3MC0A 1YYMH 2XWJA 1I3RB 1B88A 2GSGB 4O51B 2GITB 1A9BB 1E6JH 1NJ9B 2FX8L 4XBEL 43CAB 1MEXL 2IQ9L 4B0MM 1M7IB 4LEXL 1UM4L 1C1EH 4H26A 2G5BA 3BP6A 3H9SE 2DLIA 4HIJA 4JZJC 4I3SH 2I07A 4HV8A 2R69H 3IFNL 2O61A 4KTDL 4ZXBB 2B20A 4JO3H 4OB5H 1BD2E 3HC0B 4LVOB 1G6VK 4OBRA 1F6AA 4NQVB 3SCMC 1W8NA 1TQCC 2AP2A 4KV5E 3U0WH 1K8DB 3LN5B 3D87B 4HT1H 5FK9A 1NAML 3Q6FB 3RTQA 5I18L 5IEHA 1JPTH 3DMMA 3NGBB 1IC1A 5F89B 3SOBL 2J8OA 4HPOL 1GZQA 2DQCL 4PJ7F 3B9AA 4OUOA 3VJ6B 1DN0B 5MEQB 1A6VH 1ZT1B 5DJ8B 3U30B 1LK2B 4RWYH 1IAIL 3N50A 1C08A 2R1XA 5KVEL 4NPYA 5EOQH 2I5YH 4PRPD 4P9HH 3U46B 3GMRB 1OLLA 4HK0A 1G9ML 4FG6D 5ESAA 4LAJH 2YSSB 3A6BH 5DFVD 1MCWM 2D3VA 1KCSH 1RZGA 4JY5L 4LCWA 4W4NA 1CFBA 1IGML 1WCQA 4FQIH 4LHUA 4M1DL 4ZUVB 3MXWL 3GSNH 1WITA 1DEDA 4IIQB 4WUKL 3W5MA 3QWQB 1WWAX 3MRCB 4HUWA 1S7TB 1KCKA 5T3XH 5D1XA 4NJAH 5E5UB 4MAUL 4YHZH 3WN5C 2CO6B 4PLNC 1AGBB 1F3RB 5EA0L 3IFPB 1ADQA 2O26U 2HH0L 3IRZA 3QEQB 3TLRA 5ILTH 4HJGA 5D9SB 4TPRL 1DQJA 4UDUB 3QZWG 3HI1B 3WYRA 5I1JL 1AGCA 5EPMB 1KTRL 3IJSB 2BOCA 2B4CL 4JANA 3MRKB 3QFJE 1I7ZB 4M5YL 4JPIB 2E9WA 2ARJA 5E8NA 5E1HB 1WISA 3O6KH 1U8PA 4D3CL 5L8KB 5JW4M 4XVSH 1V3KA 1G9NL 2AVGA 1FL5B 2B1AH 3AM8C 5DVMA 4WI2A 1WBZB 4JPWH 3QR2A 3MSPA 5DD1L 1AJ7H 4HKBB 4MJ5B 4DFHA 1DBML 2IPKB 3IDXH 4P57B 4P4KB 1UB5A 5MEPB 1EFXB 4YDVB 3CNKA 4G6AC 1DVFB 1N0LA 4GW4A 3G5XB 5EU6B 3SGDI 4BSVB 4X4YB 5I8KH 1BF8A 4R4ND 4TTDD 35C8H 4FZEH 4IDJL 2X7LA 1MAJA 1T1XB 2BHYA 2NXZB 2ORBL 2WWMD 4XAWL 3S37L 4P5TD 2CDEA 3D3VB 1R5VB 3EO9L 1I9EA 2YZ1A 1X6LA 1H8OA 2VUOA 2J8UE 4JREC 4JDTH 4IOFD 5CINL 1QR4A 3DWTA 4LPVA 2ARJQ 4QWWC 5EU4B 3MFGB 4R9HA 1T5WA 4KXZI 1WZLA 2HP4A 4PJIA 3KPOB 4H0IA 1P5UA 1G7QA 5B39G 1XR9A 1RFDL 4PJIF 2BY1A 4Q58C 3IFLH 4OF3A 2F53B 3B2UD 3NFNB 3OWEA 4O2FA 3WFCH 1JK8B 3O6MH 2X4QA 5EO1B 3IU3A 4LOUD 5HDQL 5HHNA 4XAKE 4ONGH 1YEHH 3HAEB 1UACL 5E8OA 1X4ZA 2QQNL 4WEUD 3F65A 5LAXB 1QOKA 4JR9H 4LPTA 4QXGL 1JCKA 1S5IH 1G6RH 1GZPB 1YYLH 2FWOA 4JJHA 1HH9B 1WBYA 1R3JB 4UT7H 2HKFH 5JOPD 3JXAA 4NO0D 3PNWA 3W9DB 3WLBA 4M3KB 3BWAA 4D8PA 1DBBH 5J56B 3ARWA 1Q38A 3P4MB 3F7QA 3UMTA 4IMLB 1JF1A 2ZCHH 2EH7L 1XIWD 4FA8A 5BCAA 1T7XA 1CXKA 3O3UN 1UC6A 2P24B 5DFVC 2W9EH 3UBXI 1KCRL 1AE6H 4U1HB 4QF1A 2NLJA 1X5XA 3FB7A 1DE4A 5EUKB 3VFVB 3GMMA 1RVFL 1R3IH 1PZ5A 2X4PA 3JTTA 1MNUH 5D70L 3DRTB 3CMOH 1AGEB 4XH2B 5ANMA 4OLYL 4PGJA 2ESVA 1N4XL 1XGUA 1YEEH 3R4DA 4N1CA 4F2MA 5ITFB 4P2RB 3EO1A 4YXHL 1AXSA 3NZ8B 5D7LD 3RWIB 4XTRD 4YHYB 3QDGD 3JV5A 4N0YL 4PJFE 2R29L 2BMKB 4MQ7A 3PHOA 4OCYH 3I6KA 2IANB 3U4BL 4PJEE 3UTPE 4J6RH 4RZCB 2WWKO 5J89A 2DQEL 4X7SH 4EXPX 1VACB 4D2NA 3BT2H 4LKCB 3X14A 2CLVB 4UT6L 3OPZH 1ZHKA 4RIRA 5IVXE 4NWUL 1V7NH 4MB4A 3QIBB 1X5LA 1QRNA 2PYED 2Q7NA 4FXGB 3G6DL 1RK1A 1CE1H 1YNKH 2Q20A 2DLHA 4R26H 4XPFL 3PHSA 4RMRA 4TUKL 4XPTH 2A9MH 1B6DA 3DGCR 1LMKA 3D2UD 4PJCB 1I3GH 1J1OH 1YMMA 4G6MH 1RZKL 4XRCA 2IBZX 5JQ6H 3E2HC 4M8QB 2VLJD 4R4NC 1MLBB 2L7UA 4TTDC 3KLHD 3HR6A 2R15A 1N6QH 4P48A 2VQUA 2QSCL 2ATPB 5GGQH 2DD8L 2FZ3A 2XY1A 4X6DF 4P5TC 3Q1SL 1C12A 4MB5A 4OZ4A 4FQJL 3TM6A 5IP4A 3EYSL 1C5DA 2EEAA 5BZWB 1SYSB 2DI7A 4IOFC 3O8XC 4MB3A 4QYOA 4OLZL 3VU2A 4F7PB 1IL1B 5KVFL 4UOW0 3AGVA 1W72A 4KVCH 3SDAD 1MFCL 1DBKL 5E4IA 3D25B 1I1CA 1UWEL 1KCUL 4PJ5E 5EZLA 2B0SL 3QA3B 1SEBB 3MYZA 2MWCA 3W9EB 3K8MA 2CPCA 3S3SA 3SGDH 1FZOB 3B2UC 4DTGH 5ERWA 4LOUC 3MOBH 1IAKA 2Z8SA 2HFEB 3MR9B 2PTTA 1HOCA 2NW2B 3P77A 3EYUL 1RUML 4UU9A 5IT2L 2H32B 5H8DA 3IS1X 4YBHA 2BSTA 1OAUH 3I6LE 2EDKA 2NY6D 1K9TA 2DN7A 2DQUL 1H0DB 2GCYA 4WI7A 2X6MA 3VXSD 5CSZA 4J3XA 3JV4B 3P0YL 3G6AA 3MGOA 1ZANL 3D18B 1QSED 2GW5A 1JFQL 2R2BA 5IJKA 5I30H 4UIKH 4JKPH 1RJZB 5ENWA 4Y19A 1XIWC 5L0QB 3DTXA 1JGLH 4TQEH 3W2DL 3T65B 5LBSL 1NPUA 2CRYA 3HMWL 4WHYG 3O3BA 2X1WL 1GXEA 4X4ME 4NP4H 3MV7A 5DS8A 4PRAA 4A6YB 4I5BB 1A5FL 3S4SB 1U93B 3SE9H 2FJHA 5I71C 2IC2A 5F6HJ 3EOAB 2R56L 5GIRB 4XTRC 5K59E 3RVWD 1K4DB 5E6IB 4J3TA 4MNQB 2DBLL 4ESKA 2YPKB 5LG1A 2BC4A 1CFTA 1U8MA 1EHLL 1VA9A 4OZFB 1SJHB 2NY1D 2CDFA 3HCVA 4WO4B 5LGKA 3KYOA 4XP1H 3UTQB 3GGWB 1DJSA 3LVEA 3SKOA 1DFBH 1Q9KB 3LZFH 3O3DA 3JV0A 4P49A 4QOKA 4ODXB 1H9VA 5ICZA 2GY5A 4PUBH 4XVUC 3UTTA 5JOFB 3LRSB 3RA7L 2W38A 2ADFL 1FO0A 4PBXA 5IVOA 5FCUL 1INEL 1ZVSB 4JZNA 3BW9A 4I0PD 2UV3A 5CMAB 4UQ3A 1HHIA 2VABB 1YQ2A 1CICB 1G7LB 3LS4H 4JFEB 1FZMB 5C9JB 3PWPA 4MA3B 1S5HB 3KLHC 4YDKH 2VDPL 3OAUH 5J12C 1J5OL 4TSAL 4ZNCD 1AH1A 4M7KH 4ETQA 2FH8A 5DJXB 2OJEB 4OFIA 2H1PL 3IYLW 4R96B 4XXCA 3RY6A 3OKMA 4MYWB 1AFVL 5C8JA 3R8BB 4OD2B 3ZE0E 4NQCE 2PXYA 1NANH 1EZVX 3BP5A 4Z7VA 5KSBA 5ISZB 2W60A 1CD1B 3TT1L 1GAFH 5A43C 1KTKE 1KXVC 1GIGL 4OCRL 1EH9A 5D5ME 4Z7VF 2X9WA 4JRYB 4L3EE 5JPNB 4HX1A 5MI0B 3SDAC 4UV4H 1UKQA 2CXKA 2PW1A 3OZ9L 3P9WB 3VXTB 1NBZB 3HRPA 3B6SA 3UJIL 3ULUH 2YA1A 1CE6A 5HJ3A 4UOJA 4C83A 1JHLL 5MENB 2BHUA 2FSEA 4R3SA 3SE3C 1ZLVH 3H9SA 1KXQE 2OCFD 4Q7DA 4QHNB 4Q2ZB 2V9RA 3CJJA 5DJAB 1BD2A 3GHBL 3V4VH 2DTSA 5BVPL 1FG2B 4CJ0A 1VESA 3NFPB 1CD0A 3NFSL 2WV3A 4HJ0D 3THMH 2IBZY 1BJMA 3LMJH 4M1GH 2UZIL 4GKOA 1EEZB 2F74A 2NY6C 4M5ZL 4NRZB 3A6CL 1NFDB 3TPUB 4R2GD 3VXUE 2DRUA 5DK0B 1FFOA 4AZ8A 3OKYA 4KI1A 3G04A 3W39A 3MYJA 2NZ9C 3QUKA 3SE8L 2HVJA 4WEMB 5IWLA 1NGZA 4AEHL 4HEME 2XKUA 5DUPH 3BQUB 3GKWH 3ZDYE 3DGGA 4S2SA 1NLDL 4J3OC 1KCVH 3HZVA 3MLUL 2AEPL 5JORB 4GG8A 3BYTA 1KJMB 4OCWH 4PRIA 2IJ0C 4LLWB 3EDJA 1G1YA 3P4NB 5TJWK 2Z31B 4HXAL 4ZFGL 4APQB 3OHXB 3FAWA 4IOIA 4GRMA 5DWUH 3QUMB 4POYA 2IG2H 3CLEL 4HBCL 4H25A 3BGFB 4X6CB 1XGPB 5IW1A 4MAYB 1F4YL 1CR9H 4OGZA 2X70B 2XKNB 3WFHA 4GW5A 2ZJSL 4PY7A 4JDVB 5FM5O 7FABL 4OI7A 1DDHA 1KJVA 4D0BA 4WW2A 1FGNH 3O6FC 5GS2D 4PB0H 5JR1L 3PWJB 3R06A 5T3ZH 5IROC 2KPNA 2C3VA 5HHVH 2HMID 3A67H 3QFJA 1N59A 3EJZD 2BVPA 4LDOB 3WL9B 4QRSB 4PGEB 1PG7L 3GIZL 4TVPL 4YHNB 3D0LA 5I16A 1W0WA 2FB4H 4HUUB 5E2UL 3IDGB 4DKFH 4DOHB 1F90H 3WNOA 1RUKL 5I17A 1CZ8H 1EEYB 1G7IA 1ZEAH 2R0KL 3VMOA 1EBPA 1BQSA 3MCG1 3O4LA 5CWSB 3BHBB 1R3KA 5TDNA 2OL3L 4MZ2A 2FIKB 3P3YA 4HKJB 5C6TL 5DSCB 4LSSL 3CX2A 3AFLA 1LD9B 3EOTL 2O5ZH 3E1F1 1S9XB 3GJEA 4NFBA 3MNZB 1FZJA 4YXLL 2HJFB 4KDWA 3G6JB 5SX5K 2OP4H 1YNLL 3ZTNH 1PJ9A 3RI5F 4Y2OA 1J0HA 1JTTA 3FT4B 4CMHB 4TSCL 1Y0LA 4Z7OF 3OF6D 3W0WE 1XH3B 1KGCD 5E8DH 2GJZB 1MQ8A 2ICEA 4XGZA 1CLCA 2J8UA 4PRPE 5E9DB 1OY3B 3HC3H 3HB3D 5EO0A 2BP3A 4PS4H 4L4TD 2J8UF 3O6LH 2GJ6E 5AYUH 1GOFA 2PW2B 5T5FH 1MCQA 5DHVA 2WINA 1NCUA 2B5IB 2VH5L 1WEJL 1QTYT 3GMOB 5E95B 3LIZL 4HIHA 5D6DA 3U4AA 4S1SL 1WF5A 4IRZH 4FMFA 3FRUB 2CO7B 4NCC1 5GRUL 1L7TH 4JO2L 4L8DA 5KS9E 4D9QD 3RVVD 3QI9C 1AP2A 1NGQH 2APFA 2P7TB 4J8RB 4R2GC 3C09C 5HGDA 1EGJA 1UEMA 4AIOA 1J8HD 1P1ZA 3NABL 5D6CB 2AEWA 1NCBL 3R8QA 3O9WC 4MA1C 5C0RH 1IILE 3GUTB 5JXED 4ORGA 5GISL 1BBJB 4R7NA 2H26A 3KNBA 3RZCD 3SO5A 15C8L 3ARGD 1P4LA 3LKSB 2YA2A 4D0CB 2Y23A 2C1PB 3ZHDA 1OTTC 5TE4L 5BV7B 1KFAH 5T3XD 4L1HA 3KR3L 5H37G 5B22A 3ZHKA 4HUVB 3N1PC 3KPSB 2N7BA 5ADPL 1RUPL 5HVWA 2VLRD 4LMQE 3RAJL 1JYVA 5DMKB 4HZLA 4QXUH 2R2EA 1UFUA 1I85C 5B3NA 4UT9H 3VGDA 4XP9L 1OB1A 1IAOA 1I7UA 2QV2A 2IWGA 3O4OC 5DT1H 4GKNB 4ONOA 3BH8A 4OCSH 3LRGA 1FLRH 1QG3A 1DN2A 4PJFA 5E8PA 1SEQL 3TN0A 4LCIH 3NIFE 1WBXB 4PJEA 2XZCH 2XN9D 4OCXL 3LB6C 1YPZB 1A14L 4UV7H 4P2QA 3QUML 3CFEB 4H8WL 4CW1B 2FGZA 1AI1L 1UM5L 4K9EH 4PJEF 2HMIC 2PF6A 5EFIB 4XBGB 5L88H 5F1NB 3UTZA 4ZAKC 4U7KA 1DBJH 5IVXA 3F6IA 5C0BD 1KLGA 2XT1B 1TXKA 3MO1B 4GAGL 4QEGA 1HH6B 5E2VH 4JFFB 1T21A 5CUSH 4GFTB 5K9KA 1J0KA 3D9AH 2ICWI 5SWQA 1EEQA 1U2CA 3P0VL 1DSFL 2P8MA 3OV6A 3VGEA 3ZKXB 5B38A 2EDFA 1DL7L 1FDLL 4KROD 2NZIA 3C6LD 1GGTA 2BRRH 4TULH 4A2MA 1JHTA 2WBJB 3FOMB 4G6FB 3D69B 5DVKA 2IF7A 4Y2DB 4GOSA 4XCCH 2CIIA 3O41B 4PRHB 3GRWL 2NY4C 4R4FL 3NCBB 2Y36H 3BZEB 3QUZB 4JCMA 3EYQC 2CR6A 4PGCB 3WSQL 1ONQA 4QGTA 4XCYA 5IMLA 4QHUB 1NCTA 4ZUSB 2RCSH 5JOPE 4DGYH 1MF2L 4PY8I 1D9KB 4OQTL 5IV2B 4RAHA 5K33A 2XZQH 4LLVB 2AXFA 3V8OA 3S5LA 2A6DB 2A6KB 4WW1B 1A3RH 1C7SA 1CBVL 2OK0H 2IGFH 5GGSY 3VFWB 5CZVH 2OQJA 3HZYB 3BKCL 5IUSA 1K5NB 2E7LC 2YZ8A 3VD7A 4PJ5A 1UA6H 4WUUE 4MXWH 5AZ2H 3ESUF 4O58L 4F37K 3UAJC 5HHMD 1MLCA 3QDHA 4P3DB 2OX5A 3IU4H 1DP0A 3QDGE 3HZMA 2DOCA 3TBVA 1KF9B 2HFFB 4P5KB 4GKSB 3NCCB 2RB8A 4H26B 2G5BB 3VRIA 4QRUA 1BFSA 1XAUA 4K94C 4XI5C 2X4UA 3IDJA 2AK1L 1L9NA 3C87A 3KPRB 1F6AB 3RZCC 2CKBA 4P2YA 4YHIA 2WIIA 1I9RH 2DQJL 5DMIH 2PYEE 3UYOD 3L9RA 4UI2A 1B4JH 2ADJA 3GMQB 4WFHD 4KMQA 3STZA 2J2ZA 2DYPA 3RJQB 5IEHB 5C7XH 4J1UA 2BNUB 4PJ7B 3E6HB 1B0WA 4WRLA 1VADA 4F58H 1E4KC 4P2OD 4Y5XA 1ZLUK 2P4AB 4PJBF 1F4AA 2FGWL 1A8JH 4PBVC 4X4MA 3UPRA 1KT2B 4JM4H 3ZDXE 5EZOH 1IZJA 4KY1L 4WVRA 2VLJE 1A7OH 4M1CD 2R1XB 5EB9A 1HYSC 3VFSB 1T80A 4AH2A 3TO4A 3LQZA 3AB0C 5ESAB 5BV7L 3IDNA 3H3PL 4KJWD 5A3ID 1RZGB 1VGKB 3WHXB 1QFWL 3OAYK 4LCWB 4LHUB 1XF4B 1PGRB 3U9UB 4MXQC 3GK8L 5IGXH 2FEEL 4H1LH 3GJFA 3LD8C 3QQ9C 2ZUTA 4DGVH 4DZ8A 6FABL 3UJJH 1F58H 1FNSH 3QUYD 3BP4A 3P2TA 5JNYB 2MNUA 3GI8L 4XPHH 1MQKL 2W0LA 3BWUC 1SVCP 4J23A 4YHLL 2DQHL 1KG0A 4PJ8C 1OAYH 4JFHE 4XNXL 2YA0A 3P0GB 4GAJH 1L9MA 4G3YL 1CGYA 3QDJD 4CAGA 4JZJA 5DJ0A 4K2UH 3DX7A 5IBUG 3CH8A 1TIUA 5AG9A 3C6LC 1PVHA 3CCHA 2BOCB 3QDMB 3RWCA 4JANB 4K3EL 4P4RA 5D1ZD 1ODAA 5JHDD 3PL6C 4OBSA 1YN7B 2ZCLL 2DWEA 1U95A 2VSDA 1S9VA 1U8PB 5TPWH 4LAQH 5C0EA 3TZVD 4KK8D 5FM8A 2EDBA 1BQHA 4KQ4H 3TO2A 3VXSE 3ZL4L 1TCRA 4LSUL 5CHNB 1RZ8A 3DX6A 4XVTH 1CLZL 4MX7A 2R9HD 1I9IH 1Z9MA 4FN0A 4NQCA 1EAJA 1MFDH 2IPTL 5C0IB 1QLFB 3VW3L 2YHGA 3WIFA 2IAMB 5D5MA 4XMLH 4FFYH 1CFQA 4L3EA 2YBRA 4HWEL 3VA6A 4I9WE 4B7LA 4XPBL 3V2AR 4JHBA 3UEZA 1HI6A 2X7LB 2OZ4H 3WO3B 5BOPA 4F8TA 3K2UH 1U92A 4YNYB 3V4PL 2RQ8A 1YY8A 4QO1A 3WEXA 3TBYB 4QXTB 4JFXA 4K7PY 4LIQE 1T5WB 4NUGH 3WN5A 4TTGA 1OARL 4NN5B 4PJIB 1I8MB 4NQDB 1BHGA 1XR9B 1U41A 2D7OA 3VXUA 1MCOH 3MLYL 4WV1B 4KHXL 3TJEL 1WWWX 1AGDB 1FP5A 2LAGB 3FN0L 1B2WL 1MFEL 4FZ8L 5KG9A 2X4QB 1AO7D 1BBDH 3P30H 4KJYB 1X4YA 3CXDH 3LDBC 2R39A 3AMLA 1ORSA 4LSQL 4LU5H 3L7FA 2JJVA 5F7EL 5E8OB 4OF6A 3QBTB 2ZUVA 1MWAH 2V2TA 3BO8B 3L6FA 2MOVA 1O5DT 4YDJA 4K23L 4P2OC 3AM8A 4MCYA 1YECL 4LEOB 2BY0A 3I6GB 5HPOA 1HYRC 1OGAB 1WBYB 1QFUL 3VDAA 4NO0B 2VNCA 4NM8L 1JUFA 2Z92A 3OKOA 4Y4FC 4Q6IC 1TFHA 2C3XA 3UBXA 3KJ4C 4XZUB 5F7KC 2Y06H 1JF1B 4K7PL 3ET9F 3HZKA 3UTOA 2NY5H 3O2VL 3HC4H 4R90L 3V79C 4KKBC 2XRAL 4KJWC 3RGHA 1IGIL 1PZUB 4QF1B 2NLJB 1OSPL 2CGRH 1DE4B 3FB7B 3RHWF 4FS0A 3GMMB 2XI9A 2HTLD 3GI9H 4EBQH 2X4PB 1MPAL 3BRDA 4PJHE 4XXDA 5GS1C 3CVHA 3ZKND 3BGAA 3AS3A 3MUJA 4NCC2 4G8GB 2JCCE 4X9IA 3BD4A 5FGCB 4NWTH 4F2MB 4YGVA 3RWHA 1VFBA 4XBEH 4MQ7B 5CSBA 5BOZG 5DEFB 3C08H 2A83A 1UG9A 5ACLA 1MEXH 2IQ9H 3I6KB 5IFAH 5LQBH 1ZVHA 4KFZC 5IEKA 5E2TH 4U1MB 1FN4A 3DNKA 3IJYA 5D1ZC 3ALXA 4NCDA 3OKLB 5DUML 3RBGA 3WIHL 2FH6A 1WFTA 1ZHKB 9CGTA 2DJSA 2K9UA 3UXFA 2ITDB 1FYTE 1UCBL 4JGUA 4M9PA 4K8RL 1QRNB 2WM0A 4PIRF 3ARBC 3K8KA 3G9AB 2YD5A 3QIUD 3V7MA 5DMGD 3WNNA 5JW3L 1ADQL 1NAMH 3C8HA 2V17L 2R4SL 5C0GA 1FFQA 3ULUD 3LKNA 3F7VA 1RK0B 4NFCA 2R9HC 3ULUF 4LQFH 1IGJA 3BFOA 3W0WA 2NXYD 1NCDL 5ID0B 2JELL 2IADB 5CEYA 2XQBL 4YWGH 5H94A 3RBSA 4HGWA 5JW5A 4PRPA 3ARVA 2GJ6A 5BMFH 1UQSA 3GIVA 1AIFA 4NZUL 2FZ3B 5MERB 1C12B 2DQFA 2EYSA 5JHLL 4K3HA 1T0MA 5GRVL 1RJLA 4JY5H 4IBLT 4PFEA 1YC7A 1UYWH 4QYOB 3MXWH 1A4JA 2JLLA 5A2JH 1UB6A 4OLUL 1RZ7L 4WUKH 3PHQA 3RIFK 1W72B 5IB2A 1HKLL 4QTHA 3T0EC 5KS9A 2I24N 4FQXB 1FNEA 4I3GA 5DD3H 5EZLB 5L6YL 1B9ZA 2EKJA 5JTWA 1P7QD 1TVHB 5EA0H 4KMTL 2B8OT 3MLVH 5CZXD 4TSBH 5ERWB 2VXVH 4TPRH 4TNVK 4J3WA 4ODWB 5SWZE 2NNAB 2ID5A 5I1JH 4PG9B 3ROLA 2J6EL 3VH8G 4L8SC 4EDXA 2PTTB 1M05A 1HOCB 1RUQL 2NY3D 2B4CH 4UU9B 4NDMA 1N6VA 1XGQA 2DM4A 3MODL 3STLB 1KPUB 3FHQA 4XNMA 2GK2A 5FYKL 4QRQB 3LKRB 4Y4KD 4YC2B 3EO0B 4H88L 4P2CG 4RFOL 5DJ2B 3MNWB 3MX0A 5DJCA 3G6AB 5EBLA 4WTZA 3QNYA 4OSUL 4EKXA 2WLYA 5GXBB 4HMEA 2CK0H 3SO3B 5D4QA 1DBMH 2F58L 4QRPD 2YD9A 3BDYL 5T3ZD 3DTXB 4LRNH 1M6OA 3IJHA 1SMOA 3O3BB 3DVGA 2APVA 4F7MB 2X9XA 4LDEB 1NMAL 4PGZA 2BVUA 3MJ8A 2PUQT 4P5TA 5GRXG 5KSUA 4N8CL 3MRQB 5I1GH 5DS8B 4OTXH 4PRAB 1CGVA 4XAWH 5MHSD 1J88A 4PJAE 4C56B 4LKXA 4Q9QH 3O8XA 3EO9H 1LDSA 1XF5A 5BVJA 4LLYA 1MJ7L 5JW4N 3N1QC 5DGRA 4DN4L 3DHJA 4GMTH 4U0RB 2GKIA 3CSYA 2V5TA 2JJUA 3I2CH 1VFMA 2CIKB 4LARH 5CCKL 2BC4B 1VPOL 1JGVH 3I02A 1QNZH 2IH1A 5GJTH 3KDMA 1J9CT 4FRWA 3HCVB 2C4XA 3CFCH 3RGVD 5GQBA 3NH7H 4D9QE 5A2KH 3PV6A 2BNQD 1D5ZB 1OTSD 4Z8FH 1V7ML 3D39D 3UTTB 1I1RA 3QIUC 1J8HE 1CQKA 5ALCH 4HS3B 3RVXC 1UACH 1PG7W 2OYPA 4CVZA 2QQNH 3GKZA 4GBXB 4DW2L 5KVMC 5TE7L 1FVEB 1FAIH 1WT5C 4IRJC 1HHIB 2NXYC 1A3LL 1T6WA 1HILA 2FATL 1T66C 4JRXD 4NO5B 1S3KH 1XIWA 2QQKL 5DD0H 1RQ5A 1G7JB 1DLFL 2EEBA 1WK0A 1H3GA 1U3HC 5J9PA 3MCKB 2EH7H 5IHZB 1D5BB 2C7UB 5J6HA 4LRIC 2JIXB 1FNAA 4U1GC 4WUUA 3T2NL 5TQ0L 3OL2A 3BP5B 3SBWC 4Z7VB 5KSBB 1JWMB 2W60B 3FQXA 1FIGH 5C0DA 2AJXH 1E4JA 1PLGH 5FXCH 3U0TA 5DXWA 5IB3A 4DN3L 4OLYH 2PW1B 3SDXE 3QDGA 4KVNL 3B6SB 3AAZA 5HHXH 1VENA 1CE6B 4M6NH 1QKZL 4YXHH 4BYHA 2FSEB 3H9SB 4YDIH 2XN9E 1J0YA 5ABDE 1JPSH 3U0PA 4Z5RB 4LLUA 3TJHD 2E27L 4G42A 3VXQB 1UENA 4Z7NF 5TDOB 2DQEH 1ZHLB 3QUXD 5C0BE 2LTQC 4OZIE 2PYEA 5FO7A 3NA9L 3HPJB 1NEZG 5DRXB 3FFCD 1RJYA 2AGJL 2F74B 1JN6B 3QJFB 4ZNEE 4L3AA 3BDXA 4M62L 3S6CA 5BQ7A 1IM9A 3BN9D 4OIBA 5HGHA 5C0AD 5JW4Q 3D0VA 1JF5A 4TRPH 3QZWA 5DC4B 3KPPA 3QH3A 3ZTJH 2ZOLA 3MBED 1BIIB 3QUKB 1FGVL 4KK6D 2XFXA 1LE5A 4HWNA 2K7QA 2VLJA 3NACL 2WNGA 3LEVH 3DGGB 4YFLI 3S35L 5F71A 1RZKH 4OZGE 1VKXA 2DWDB 1OPGL 4HWBL 3P11H 1KLFA 3X12B 4PRIB 3IDUA 1H3XA 1OF2B 3L3OB 3GSRA 3V0VA 3D85D 2LQRA 5D1QC 4EN3D 2DD8H 3K1KC 3GBML 4F8QA 4QHMA 3QXUA 2CLZA 4H25B 4S11A 3MA9L 5IW1B 5KSVA 2R8SL 4WI6A 1IBGL 3SDAA 8CGTA 3QCVL 4NKOA 4LP5A 4PLKC 4GKZB 3O3EB 4Z6AT 1QP1A 4MJIE 4NHCH 3L3KB 2AV1A 2H3NA 4FTVE 4PY7B 3SE3A 1DBKH 4KGLA 5HHME 1KJVB 2IH3A 1UWEH 1GGIH 4N0CC 3VXMA 1ZTXL 3EYVA 3R06B 1XGYL 4OLWL 3MNVB 2C3VB 1U58A 2BVPB 1MCCA 1OTSC 4KUZH 1FCGA 5I16B 3QPQD 4YHOL 3D0LB 1P6FA 5DZLA 1EEUA 1Z9SA 5SX4I 1KC5L 1RUMH 5I17B 3IFOA 3B9DA 5LJYH 1UT9A 3VXSA 5DRZB 5I1KH 4E5XA 2EE3A 1G7IB 4OLXL 3MFFA 2APXA 3O4LB 3RWFB 4HUNB 5DHXB 5KOVC 4Y16A 2QJDA 4DVRL 1N2RA 1ZANH 2AERT 2HT4D 1JFQH 4OF8A 3GJEB 3HTLX 1ZGLP 5FYLH 4AENB 5FDWA 1B4RA 4U1KA 4FQPA 3REVA 1ZLUH 3QPXL 1LGVA 3OG4B 3HAEH 4UINL 4X6FA 1QACA 1MIML 3WUWG 3P9MA 4WU5A 2QHRH 1Y0LB 3G5ZB 4MDIA 5IMMB 4MD4A 2ICEB 4LVEA 4PD4J 4YZFF 4XGZB 2Q8AH 2J8UB 3W81A 2DQGH 3NN8B 3FOLB 3LN4B 1A5FH 4L4TB 4OGAC 1I8LC 1IGCH 1Y6KR 4NKMB 5EO0B 3VD5A 1Z9LA 3WFDL 3E8UH 4Q9CA 1HSBA 3QFDA 4YR6A 3JUZA 3OAYH 1MRDL 5DHVB 1F8TL 5EOTA 2R56H 3PE9A 4NQSA 2B1HH 1N0XH 3NAAH 4HIHB 4Q9RH 4JZOA 1ZXQA 4JKWA 4U6TA 5L8LB 4N8PA 5FF6B 4WFGD 3O6FA 1WFOA 1JYWA 1ZT7B 3L1OL 2BY2A 3I9GL 3I3DA 5IROA 3QUXC 4MCZB 5IB5B 1EHLH 4HS6B 3U4EB 4L8DB 4G6JH 4NQXA 1T5XB 3HE7C 4YDLC 1FE8L 5D7JC 3ORJA 2R4RL 3HMXH 4WDIA 1BZ9A 3EYOA 1D5MB 4LLDB 1IGFL 3BPOB 4OAWA 4RX4D 4HIEA 4TVSa 3MBEC 1L0QA 4OJFL 5BS0D 2ADFH 2CD0A 4ORGB 3MRDA 4R7NB 4BSWA 2H26B 5JHDE 2R0ZL 5D2LF 4M3JA 2F54D 3OKNA 3ARGB 4K9EC 4BA8A 4XNQA 3MV8D 1LP9F 3T0WA 3MRPB 2DQIL 2E9IA 4LPXA 5EBGA 4ZO9A 1W0VA 3HE6B 2A9NL 3F12A 1TQBB 1J5OH 1VB9A 4JG1L 1H8SA 4GG6A 4WENB 2KBGA 4HCRH 4ODSH 1T20B 2H1PH 1HWGB 1S9WA 4GG6F 4Q0XL 4PJHA 4Z7QF 4NKDA 1MI5E 1RURH 1PQZB 2ZWLT 3S7GA 3TT1H 4I4WB 1IAOB 1AGFA 1I7UB 2HRPL 2JCCA 4LNVA 1TETL 4QRRE 4N0FA 3MRIA 3BH8B 5F7LB 4PV9A 2A73A 4UOW1 5F1SA 3OZ9H 3VXRD 1LWRA 4PJDE 4BH8B 3T0VA 2HTKC 3TN0B 1BGXL 1JHLH 4M48H 3QXDA 4PJEB 3DOSA 4H5SA 3BMWA 2GY7B 4Z0BH 1A6ZA 4P2QB 4Q6YA 1F45A 3ZE2E 1CIUA 2HT2D 5MP6L 5DUBA 3GHBH 3T0EE 5BVPH 5IVXB 2FR4A 5AUMB 1FYTA 1AQKL 3QI9A 3TYGL 2E3VA 1KLGB 4KQ3H 4HFUH 1FIEA 1WICA 1FBIL 3V95A 1OWRM 1QBAA 2AEQL 2UZIH 3V5DB 3JWOC 5SWQB 3O9WA 5B38B 1AO7E 1TZHA 4KROB 3TNNA 5FO9A 1BFVL 1FSKB 1HHKA 3QO0B 1K85A 1X3DA 3L3HA 3I75A 1MVFA 4N8VG 1E4XL 1W0YT 4HZAA 1BWWA 3SE8H 3UTSD 2V7NB 2X4OA 2QADC 4AEIH 1LQSR 1MRFL 3JWDH 1WTLA 4GSDH 4S0SD 4R8WL 3TYFA 4PGBA 4M43H 1DZBA 2H32H 2W0FB 4BQ8A 1NLDH 1ONQB 4EVNA 4M6ML 2H8PA 3VFUB 5FO8A 4UTAH 3TIDA 4PJ9D 4XHQA 4HXAH 4WJ5A 1JV5A 1NMCC 2AXFB 4G43A 1I85A 3SDCC 4GRWE 4ZUTA 4YPGA 1YYML 5DA4A 3CLEH 3BH9B 1F5WA 3I3BA 1G7MA 1IAIM 1E6JL 2A0LD 4LGPB 5GRVK 5FYJE 5KAQG 1F4YH 3TWCH 5FUOH 3LHPH 1UEYA 1ZAGA 3TBSB 2QR0B 1C1EL 2AQ2A 2ZCKH 5EUOE 1U9KA 4FFWC 3U36B 1JNNH 2GTZB 4ONFH 5LXGH 1WQVT 1MLCB 2FL5A 5SWZA 5IMKB 4A6YH 1D6EB 3WIIH 3TBVB 1NLBH 4ZAKA 4R4BB 1XMWA 3ULVF 5EZIH 5CEZL 3U0WL 1I8KA 4HT1L 2VOTA 3LKOB 4HH9B 3JTSA 3IAGC 4JHAH 1XF3A 5B4MD 1JPTL 5L2KB 4P23A 1GC1H 1NCWL 4UMGA 4UBDD 2CKBB 2R0KH 1LILA 3L9RB 1A6VL 3QQ3B 3BP7A 4OZFH 2ADJB 5FA4A 4RWYL 4IJ3B 3IDIA 5DJDA 4ZSOE 1EERB 3EOTH 2I5YL 1JIBA 2EIBA 3X11A 5KSAB 4P9HL 3SQOH 1BAFL 1OQOA 2R1WA 3RDTC 3VI4F 3OF6A 5IFJA 3A6BL 1XEDA 3WE6A 4JG0H 1S7XB 4ELME 3UPRB 1IEAB 1N8ZA 4EUPA 4FQIL 2Z8VC 5FKAB 1B3JA 2CJUL 3BZ4B 4PJAA 1R24A 2VKXA 3Q5YA 5I76A 2WIMA 3TO4B 3LQZB 4G9DA 2UY7A 3LPWA 5T3XL 1MCPL 4JAMB 5KVGH 2E7LA 4JHZA 4MNGE 1H3TA 4QRTB 3QAZC 5ILTL 1J05A 2NCMA 3CDYA 3MOAL 3KXFD 1HCFX 2HT2C 3GJFB 1EJOH 5J7CC 1ZOXA 1KUMA 1ZT4A 3BP4B 4L4VD 2YRZA 5JXAH 5HHOD 1OAXL 1CXIA 1MFNA 1ZHNA 5H35B 4ZUUA 1KG0B 4AK1A 3M8OL 1JPGA 2E6PA 1CDCA 4HF5H 4O2CB 4I0CC 2EDYA 2KH2B 3QDJB 1J8HA 3O6KL 5M95B 2BJML 4R6UA 2V6HA 2AK4D 4JZJB 4XVSL 5I74B 1AKJD 2B1AL 1JTOA 3DX7B 4ZYKB 4LNRA 3RWCB 3RZCA 3GSNA 1NCBH 2VKWA 4JPWL 1TQCB 2XWBA 4IS6A 5J13C 5GISH 3IDXL 2YWYA 2DWEB 3AREC 3UO1L 1U95B 4I2XE 1S9VB 3LSOB 1UJ3B 3TZVB 2HA1A 1NAKH 3DX9B 2FJFA 4OGYH 3SJVD 1KLUA 4JFOA 5DEGA 1RZ8B 5J3HD 1AR1D 1E4KA 3BIKA 4KKAC 35C8L 3KR3H 4M7ZC 4LLQA 2E9BA 3NBNA 5ADPH 4MX7B 3ZT5A 3ZTJG 3T2PA 5T3ZE 4Y0GA 2AQ1A 4XHJD 1QSFD 4JDTL 3R1GH 3OG6B 5I73C 5K9JH 1JTPA 3SDXA 4XP9H 4I18C 5HVHB 3H6JA 5I9QC 1PKQE 4OZHE 3SDXF 1A9EA 1MOEA 4E41D 3VE0A 1ZGLB 4CADA 5MHSE 1UH2A 3IDYC 1U92B 4X6BA 1YY8B 3IFLL 4UILH 3ARUA 5C9KA 2RR3A 3HUJE 3WFCL 4OCXH 3O6ML 1AI1H 5DHYA 5C0BA 4OZIA 2OXGA 3WN5B 4EI5D 4PJ8A 4FQLH 4CVWA 2V5YA 5B4MC 4ZNEA 4MMZC 2N56A 1HSAA 4GAGH 1XGTA 2BVYA 4FQQA 5I6XC 3C6LA 1RHFA 4JR9L 5KG9B 1G6RL 3N1GC 1T1YB 1YYLL 1PYWA 2D7NA 1DSFH 4X98A 3H0TA 3D39E 5IHLB 1FDLH 3PL6A 3L7FB 4UT7L 1NGXB 1ZMYA 4YBLB 4AT6A 3IB4A 2J4WH 2X4NB 4OM1L 2BOBB 3L6FB 4F9PC 2ATKB 2DBJA 4FHBD 2ENYA 2X44D 3M1BB 4R4FH 4MCYB 1T83C 5IKCA 4XBPA 4XX1G 3QHFH 4XPGH 2HVKA 1AE6L 2Y7QA 4P5MB 1U8KA 4XT1C 2EDWA 4H0GA 3WSQH 5K9QI 1R3IL 4GS7C 5GGTH 3T08A 2Z92B 3OKOB 1MF2H 2BSED 3UBXB 5D7SH 1OAZH 1GGCH 4K71C 4ZG1A 4CBPA 1NGYA 3B9KC 3VFMA 2YUWA 4PJGE 1QZ1A 3MV9B 3UYPA 2AXGA 3ZKQD 4MJIA 4F7CA 5GPRA 3HAEG 4FTVA 3FO2A 3ESVF 5J1AA 4OCYL 1J0JA 4N90D 2VYRE 3CVHB 3RWEB 4MDJB 5GSVA 4JREB 2W0PA 4L29B 3OAZK 4LHQB 2YD3A 3IXTA 4FP8H 4WFFE 4HD9A 1RHHB 4X7SL 5IR1A 4JFDE 3BT2L 3RWHB 4ZXBD 4OV5A 3OPZL 3K7UA 5DQJA 5I75C 3BVNB 2A83B 2IQAB 1Y6MR 43C9A 2YKLH 4HK3J 5IEKB 1XF1A 2EE6A 1YNKL 1FN4B 2LAAA 4U0QB 4CDHA 1G9MC 5KZCD 2Z93A 3IJYB 3S97C 4CMMA 4XPTL 3MJ7B 5F3HA 3KYKL 4NKIH 4X5XA 1RMFH 2XWTB 3VWJA 1I3GL 3FFCE 5ACMA 1Q0YH 3L7EB 4L3CA 4JN2A 5JQ6L 5D7IE 1AR1C 2PNDA 4M6OH 4JM2F 1TJGH 5C0GB 2DIAA 3LKNB 1N6QL 1VEMA 3S96A 5GGQL 2ZUUA 3ZMRA 1IGJB 5TFSH 3MRRA 4Y4FA 5F9WB 4ZOEA 4Q6IA 1FC1A 4HGWB 4HLZH 4O4YL 4BM7A 2B4CC 3NCYP 2ED9A 2GJ6B 3B9EA 1UQSB 3GIVB 1AIFB 2HN7A 2M1KA 2HLAB 4KVCL 1EMTH 1RZIA 5FA3A 4Y1AE 5C86A 4P0DA 3E6FA 1YUHA 2ZUQB 2JB6B 1G9NC 4OFPA 5GS1A 4ODBD 3K4ZA 4YLQT 4DTGL 5D72L 3QEQD 5D2NC 3FQRA 2YK1H 3GK8H 1ZHBA 2MCG1 4YAQA 5C70A 3PHQB 3MOBL 2A6IA 5EIIA 3QJHA 1XCTB 3MUY1 3L3JB 1IC4L 3LKQA 1FNEB 2SEBA 3ZZ1A 1MQKH 3BEVA 3DIFB 12E8H 1JI2A 3PWVA 3IRPX 3WDHA 1WFNA 1JGDA 3FRPG 1OAUL 4G3YH 4NRXA 1EX0A 5A2FA 1IAII 4HKZA 5D1ZA 5ACZA 5JHDA 1EVUA 3ROLB 3MLPA 1BX2A 5A2LH 4EDXB 4LVNC 1M05B 5I30L 3U7WH 1XGQB 4JKPL 2GHWB 3ARBA 3DO3A 2V9QA 1F11A 1NC2A 1CLOL 4Y4KB 1EVTC 4P4KD 4TQEL 5C0CE 2VLKB 3DVIA 2ZKHH 3RWJA 3L5IA 1EFXD 3VXPB 3ZL4H 4LSUH 1U3YA 1DVFD 5EU6D 3DUUA 1FZKA 4F37F 1DUYA 2VN7A 4NP4L 1EXUB 3EFDH 2XQYK 5KOMC 2Q7YA 4KH2A 5ICYA 4OUUB 1ULVA 4QRPB 3E2HB 1MI5A 4NUJB 4QRRA 3D3VD 3VW3H 2DJ4A 3MGAA 1M6OB 3G5YA 3CUPA 1SJXA 4HWEH 3PABA 3KS0J 2DI9A 4PJDA 3QG6A 3UJTH 4KUCD 2ZG3A 4RFNB 3NIGE 4AEFA 1NCNA 3O8XB 3SE4C 1NEUA 4Y8DC 3VRJA 3V4PH 1XF5B 3AU1B 5BVJB 2R23A 4ZXBC 4ZPVA 3CZFA 1B90A 1DFBL 4LVOC 3PQYD 4FQCH 3T0EA 1XF2A 2F53D 4LSTH 3QULA 3WO4B 4MHHI 5FYLD 3WXVH 4PUBL 1OARH 2JJWA 2BSRA 3I02B 3BUTA 3RUGF 3MRGA 1WIPA 1N7ML 3NGBC 3DXAD 3CVHL 3OR7A 3V0AC 3MLYH 2M26A 2WQ8A 3ELAT 5D93B 2UWEF 3FT2A 1CXEA 5GGUA 4HAFA 3LS4L 4WTXA 4PYGA 4HFWA 5JZ7C 5FYKU 3U30C 3S4SG 1H3WM 1HDMA 4YDKL 1DCLA 2ZPKL 3PIQA 5IOPB 5BS0E 4FQ2H 4M7KL 4WNQA 5T5NF 2WW8A 4LSRH 4YPJA 1WCBA 1HILB 3NCMA 4KDTC 4LCYA 1I1AD 4CNIB 3FO1A 1DUZB 3MV8E 5CLTA 2CR3A 1GAFL 4I77H 4NM8H 1QLRB 4G9FD 4GW1A 2YMXH 1N5AA 4OZFG 3KGRA 3RPIB 4UV4L 4GRWF 3IAPA 4R90H 3LH2H 2XRAH 3ARDB 2ZZUT 3VCLB 3ULUL 4LPWA 4WUUB 4P2RD 4WI3A 4HLJA 5EUOA 3FQXB 1OHQA 3CH1B 4MA7L 4U2YA 2OI9C 5C09B 5C0DB 5BRZB 5JLZA 1BZ7A 2RGSA 5EUOF 5I71B 2YR3A 5IB3B 2IAND 4RCAA 3QNZB 3V4VL 3VFOA 3AC0A 2NY7H 1RZKC 4N0UE 1BPVA 1F3DJ 3LMJL 4M1GL 3BSZH 3MRBB 4XP4L 1JGEA 4CVXA 3U0PB 3LQAH 3QIBD 3CSBA 4X9GA 4EDWL 2Z35A 3C6SA 4NNYA 4NO3A 5DD5L 3S88L 2DMCA 4QY8A 3VD9A 1VDGA 1NL0H 4RDQG 4YHMH 5DUMH 3DSNA 5F96L 2DF3A 4TOYH 3QIUA 3GKWL 4KZEL 4BZ1H 4ZSOA 5BQ7B 4K8RH 1IM9B 5CBAA 1KCVL 3D0VB 1E28B 3KPPB 4PGDA 2OTUA 1WT5A 4IRJA 4OCWL 1ADQH 1T1ZA 3BZFA 4ELMA 5INDB 5F3BA 3UTSE 3CXHJ 4WCYL 2XFXB 4YFLF 3GSVA 2NXZC 5DWUL 2Q3AA 4ELMF 1HHHA 2IG2L 1V3LA 2R0LH 3RL1B 1NCDH 5TE6H 1T03L 1U3HA 2CDGA 1XZ0B 1CR9L 3GSRB 3PG2A 5HYQA 1RULL 4EI6B 4MNGA 4E42B 4XB7A 4NZUH 2F5BH 4LBEA 3SGEI 3O3AB 4DZBA 3DHMA 4M02A 1J11A 5JPMB 4JPVH 5JHLH 1FGNL 1WAAF 1LE9A 2LVEA 2RHEA 4UUJA 4PB0L 4YH6A 4E0RB 2D4DA 4NKOB 5HHVL 5C08B 2Q3ZA 2N4IA 4OFKA 4OLUH 1RZ7H 3X3GH 2AV1B 2FLBT 2FB4L 1HKLH 3U2SA 4WI4A 1P2CA 1U8JA 3EHBD 2X4SB 2ARWA 4DKFL 5I1IH 2IH3B 1F90L 2GSIA 1A1MA 5L6YH 3AS1A 3RFZC 3KPQB 1OAKH 3FONB 3QRFM 3VXMB 3EYVB 1CZ8L 1NBYA 3IETA 1T7WA 4M7LH 1IFHL 3BPCB 4W4OC 4UQ2A 2WUBL 1U58B 4IM8A 5A16B 4RMWA 1UJTA 4HUXA 5L7XH 4Z7WF 4I2XA 2NW3B 3ARPA 3FO0H 4OFVA 2O5ZL 4P3CL 1KTDA 3IFOB 3TV3L 1Q72H 4LCCB 2OP4L 4O2EB 4W68A 3ZTNL 4Z78A 3RNKA 3WMSA 4TUJB 1OW0C 4Y16B 4H88H 1FNLA 2HFGH 1N2RB 4RGNC 3GSUA 3T3PE 4F57H 3QQNA 5EU3A 1CDIA 1DQTA 4U1KB 4ODUB 3HC3L 1Z5LA 2F58H 1VHPA 1S7RB 4RRPG 3FT3A 5AYUL 5T5FL 3GMPA 4WU5B 1PKQA 4OZHA 4MDIB 5D1QA 4YHYC 2G60L 3HLAA 4MD4B 5T1KA 3U83A 4J4PD 5E6ID 4OZHF 1YDPA 3FQNB 4MNQD 5DZOA 1L4IA 2XIDA 3B9VA 1BLNA 1GL4B 5JA8B 1TZIA 1NCCH 3HUJA 2Y4SA 4IRZL 1HSBB 3QFDB 4XCEA 5DURB 4ZFOA 5JMRA 1FVCA 5IK3A 4OD1L 2VXQL 1RIHH 3BKJL 4WO4D 2X5PA 3HUJF 2GI7A 4PY8J 4N1EA 3VFNB 4Z76B 1NGQL 4TNWF 3M17B 2YRLA 3QIBC 3BX7C 1SMAA 3O6FB 2QQLL 25C8L 4L4VE 4L9LB 1HWHB 3IGAA 1R0AH 4GLRH 3EDEA 5H2BA 2W0KA 3D39A 3TCLB 4NQXB 4GAYB 4BFIB 1AC6A 2AK4E 5I1EL 1VCAA 3GMNA 5HYJD 4RAVB 5C07E 1UH3A 1MCHA 3B5GA 1NBQA 3SY0A 3MLSL 4JFED 4KRPC 1KFAL 3KAAA 3EYOB 3HI5H 5D2LB 5BZDA 4OAWB 4DW2H 5TE7H 4WU7B 1WJ3A 2EDHA 4IHOA 5C3TA 3VXNA 1LP9B 1VFAB 5CEXB 3MUGA 3QWRD 1MY7A 4H1LB 1F4XH 2GFBB 3SJVE 3P73A 5JO5A 2AJ3A 2J12B 4UT9L 3RIFF 2AAVA 5IFHH 1CGTA 1ZSDA 5ISZD 5DT1L 1W0VB 4OCSL 3WDJA 2X09A 3F12B 5CGTA 3KPTA 4PJGA 4GG6B 4ZFZA 3GSQB 1D6VL 1FLRL 2XPGA 3GNMH 2GJJA 1S9WB 5DVNA 3IDMA 3V5HA 5DTFA 4NKDB 3UDWC 4TNVF 4NO2A 1QSFE 4LCIL 4O9HH 1CF8H 4X6EB 3T2NH 5MEND 1DEEA 3TVMA 2P8LA 2MHAA 4JFDA 4PV9B 2A73B 4CU8A 5L8JB 5L88L 1R5IA 4HLZG 2H2PD 3FQTA 1A1NA 2YD4A 3HFML 4MWFA 4E41E 2FJGA 1DBJL 4KVNH 3KYMA 5IQ9A 1KPVA 4M9OA 4H5SB 2W07A 2Y5TB 2YUZA 2ZUYA 1A6ZB 5D2NE 3D9AL 1ZV5A 3QUXA 2KZWA 1U8QB 2P5WE 4ELKB 2E27H 5EZJB 3MJ9A 3FFCA 2FR4B 1FYTB 1HZHL 3QI9B 4JFYA 2ICWB 3HE7A 4XCCL 1S8DA 3OKEB 1CTOA 5D7JA 1FNFA 3GJFK 5D7IA 1W72H 1KENL 3V6FA 5HY9A 5L0QC 3NIDF 3BQUD 1H15B 4XNYH 3O9WB 3MBEA 5FO9B 1EAPA 2RCSL 1MCIA 4DGYL 3I75B 3VH8A 2UUDK 5DK2A 3WKNA 1FGVH 1BEYH 2XZQL 3VWKB 2Z31D 1KOAA 4APQD 4IEFB 1A7RH 1A3RL 4G8EB 1I8IA 2O5YH 3B43A 2IGFL 4PRDB 4JJ5A 3TYFB 4HWBH 5CZVL 2V2WA 5FOBB 5DEZA 4MAYD 4Y1AA 3RQ3A 5HI4D 3VI3E 5FO8B 3E0GA 4WJ5B 4MXWL 1GC1C 4FABH 5AZ2L 4G43B 3IXAA 1LEIB 3QO1A 4ZUTB 3RWDA 4YPGB 2HLFC 3O4OB 1QHOA 1R5WA 3IU4L 1G7MB 1FCCA 3GSOB 4NQEE 3M45A 2R8SH 3FB5B 5LCVH 2HJKB 1ACZA 1MWAB 1YEFH 4OF5A 1VFUA 3W11D 3OAZH 1SBSH 3FHAA 4MXVE 4AQ1B 1QFWM 2P46B 5SWZB 1J1PH 3OBAA 1T7ZA 1A7PH 3QRGL 3SKNB 3T09A 1I9RL 4ZAKB 3EOBA 5DD6A 5E0QA 1CICC