4LBAA

Crystal structure of a conjugative transposon lipoprotein (bacegg_03088) from bacteroides eggerthii dsm 20697 at 1.70 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
106
structure length
106
Chain Sequence
SYPFTVEVMPVPNKVVKGQTVEIRCELKKEGDFSGTLYTIRYFQFEGEGSLKMDNGITFLPNDRYLLENEKFRLYYTAAGDEAHNFIVVVEDNFSNSYELEFDFNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conjugative transposon lipoprotein
publication title Crystal structure of a conjugative transposon lipoprotein (BACEGG_03088) from Bacteroides eggerthii DSM 20697 at 1.70 A resolution
rcsb
source organism Bacteroides eggerthii
molecule tags Structural genomics, unknown function
total genus 22
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2410 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4lbaA01
2L7QA 4LBAA 2L3BA
chains in the Genus database with same CATH superfamily
4RGMB 1YG9A 5JQ6L 1AZCA 1SHMA 3RNKA 2WBKA 3MRRB 3PL6A 1H3WM 1YNLH 2BVUA 2I69A 1TTUA 1LP9B 4YHZL 2DQUH 4NIYE 3X2QB 4OJFH 4H13C 4WTWA 5EZLB 2TRHA 4BWUA 3ZTJH 4FKKA 3NA9H 1TQBC 5C7XH 1DQJB 3IDNA 4HJSA 4JQXC 3FU3A 2J6WA 3IETB 4HUXA 4S1DD 2AABL 5IV2A 2YLKA 3IKKA 4DP5X 3NSCA 1FNGA 2ICWA 5FS5A 2Z31D 1XEDA 1FZMB 3G6AB 3G5XB 4JHBA 2KZKA 1IVLA 4L3CB 2IWFA 1FPTL 3LHPL 4JRLA 3HC4H 3PHSA 5GSRA 4YO0B 3T3PF 1XEUA 4JO2H 1GZHC 1OT2A 3BPCB 2BDNL 5AL0A 5LB1A 3ILDA 4YEEA 4XO5A 5D7JA 4ZFQA 4OQTL 4A7GF 3CD4A 1AGDB 1SBSL 1DTUA 5ABAA 3WS3B 1CFMA 1TCMA 3LH2L 4NLAA 5A1AA 5BXFA 3MKGA 4HXAH 4YE0A 4HPOH 1E9OB 3G5ZA 2V9QA 5LN4A 1FUNA 2APTA 2DWEB 1U8HA 4K4KA 1PGRB 1P0SE 3RAJL 3EGXB 4MAYC 4YDKL 1TVBA 3P4LA 1IVTA 5IZ7A 4N8VB 3EOBB 3ZZSA 5E99H 1WCBB 5HJGA 1EDHA 5HJBA 3HLAA 2O4EA 2J12B 3H2PA 1FIGL 1FWXA 3AQXA 4GW1A 4JRFA 5B39G 1MLCA 3PWLA 4ELMB 2HPTA 2JJSC 4OH2A 4LARH 4TNEA 1KCLA 2YD5A 1ADQA 3APNA 1P5VB 1S9YB 3CVDA 3RIAF 2EAEA 3OG6B 5AOMA 1KTKE 1NCNA 5CJXA 1VADB 4NQEE 4HV8A 3D3VD 4PREA 5CD3A 1OQOA 2WINA 4NXKA 1MCHA 3E9UA 4XBGB 3D8MA 5FYJH 2EUWA 2HH0L 2NY2C 2VKWA 4WW2C 1OY3B 5AZ2H 2R29H 1H5BA 2F74B 2X89D 2V9TA 3QFJE 4G7YL 4JAMB 4NDMB 4ZX5A 1KLUA 5E1GA 4R2GD 4G6AD 3LS4L 2CZNA 1EANA 5I1EH 3UTSB 4PVBA 3UBFA 1RK1B 4XWOC 1EXHA 1MJ8H 4QEGA 1CFSB 4DF9A 3QHFH 4GW4A 4U3CA 2EEBA 3N43F 4FXKA 3WI9A 3VXRE 1WDAA 4KROB 4PB9L 3TYGL 3U4BL 1MI5B 3VA2C 5IVZA 4JGMA 1N7MH 2R15A 3FN0H 1C08A 3IDMA 2EXYC 4ISVB 5KAQF 1ETZA 1U0QA 1R47A 5JXAL 2ATPA 3F65A 3GLZA 4V2BA 4YHPA 4BSJA 4TNWK 4F8NA 1OVZA 3FT1A 4DSYA 4HC1H 1L6ZA 5FLVA 3L9RB 4HLZH 2UVFA 2P42B 4NQED 4L3AA 2GCYA 5E5MB 5K9OA 4MNGA 2YK1L 1X5AA 1KEGH 4BZ1H 3DVNA 3D25A 4X4YA 2EADA 3TA3A 5C07A 5AZUA 3ZTJG 1N26A 4XZ4A 3HAEA 1MHEB 2B2XH 1X7SA 2Q7NA 4U1IB 1GS8A 3QFJD 1AHMA 4E5XB 3UTQB 1E5CA 3RI5F 3GI8H 5GGQH 1I8IA 2OP4H 2DQJL 2GJRA 5JW5B 4JRYA 3KBEA 4I9XA 3HE7B 3H4HA 1ZXKA 1AOZA 4D9LL 3FQ4A 4NZRH 5I15L 1Y07A 4PCSA 3SDAB 2V2WB 1MAJA 2IGLA 4MNGE 4DWHA 4LHJB 1M3JA 4ZMVA 3QXVA 2WMPA 1K5NB 2XACC 5T8IA 3VXRD 4NAQA 4JY6A 5C07E 4QRTB 1KEMH 4KK9D 1FRGH 25C8H 4ZDHB 3ZDZE 1A6TB 3KPQA 1XF1A 1INQA 5DS8A 4EVNB 4J6RH 3CSYB 1UD3A 4XNDA 4M5YH 2X4SA 1NGYB 2G5BB 4RCAA 1ZDSA 1GZPB 1ZHNA 1KCUL 3AXIA 3I6LE 1MJ7L 2V4LA 1UACL 2HRLA 4ZXBD 1OE1A 2H0PA 4HLJA 4OGQC 2MCG1 3L3HA 4FHBD 4ICWA 2VW4A 5IVOA 4HBCL 3MNVB 5L7XL 1FN4A 3FB7A 2A6KB 3S37H 3HR6A 3P4MA 2FQEA 3MOQA 4AKPA 4F7TA 4LVNB 1D7CA 3D08A 3NBNA 3ELQA 4MA8L 2MNUA 3MNDA 3HS0A 3K6SB 1QVOB 3QULA 2XSKA 4D3CL 1KELL 1HOCA 1SPDA 3WE1A 4OLYH 3JVGA 4EI6A 5HHMD 3IM1A 2SEBA 3NJGA 4R5TA 2W0FB 3OAYK 4N2AA 1R3KB 1QFHA 5A2AA 3DJZA 1ZAGA 4HAGA 4XNBA 2EUVA 1QRND 4BSVA 4Y4KD 2KL6A 3D9AL 5I1IL 5FO9B 3MV8A 3J2PA 4WDIB 5LGHH 3SGKC 4FA6A 5IBLD 1GYWA 1BEYL 3O6ML 4LAQL 5LGYA 3QXAB 3BLBA 2H9GA 1Q8MA 1EXGA 2X4PB 5I16B 2L7EA 1YMHB 1XGPB 3WUWB 5IFHL 2Z35A 4QXGL 1UQSB 3F85A 4NGHL 2HKFH 3QCUH 4PIRF 3ZKND 3ULUL 3BMVA 4DZ8B 1AKPA 2FECL 1T83C 1EX0A 2NYKA 2YPKB 4JDTH 4QHUA 5TE7L 1J5OL 1MRCL 4EUPB 4AGOA 1QFWM 4CL7A 2OJZH 1RU9H 1SYSB 4GQZA 4N68A 2OXHB 2ZWNA 1U2HA 1C16A 5T1KB 3CH1B 1FFNA 3RVXD 2WQXA 3NIGF 4XN7A 3CFKA 3MV8E 1CCZA 1MH5B 5F9WC 5KYXA 2DD8H 1NFDB 4TQPA 3U30B 4BH8A 4ODVL 4LDEB 3TNNA 1E4JA 3ULVD 3VD1A 3MRKB 5SWZB 1XGUA 1PVHA 2FAUA 4DKDC 4XNXL 3GSXB 5JW4N 1DBAH 1ZLDA 3RWIB 3WEXB 3LRKA 4HLZG 4B5EA 1B3IA 3EFOA 1EZLA 1S7UA 1G9MC 1YCSA 5DFTA 4JKKA 1AQDA 1MXDA 2FBRA 5DHVH 1QI4A 3DMMD 3WDHA 5LGJB 3P3SA 5JPMC 5KVDH 3ARBC 4CILA 2XPGA 5DJ6A 2ZXBA 3ZUNC 3GXNA 4CN6A 3Q3GA 5DTFB 4JPKH 4Z0XA 2JCCB 3LZFL 3QIWB 4KO7A 5L6YH 1A02N 4G80B 2KZWA 2DJ4A 2HN7B 2I5YH 3D85B 3FQUA 4P57B 4DN3H 2LTQC 4KKNA 5AW6B 2R8SH 5F7DB 5B1JA 4WSGA 2XBTA 1K2DB 3I9GH 5ECJE 3T5WA 1RZJC 3WY4A 4NCC2 4K9JA 1E4XI 1OZUA 4E9XA 2UZXA 3NDZE 4WNJA 3NAAL 2E6JA 4AM0Q 4BDVB 4PEEA 1UA3A 2DI7A 3ZSTA 5KYWA 4XVUC 3GF8A 1IM9A 4FQJH 4GPVA 4J8RA 1NC2B 3DARA 4QOKE 4ABQA 2I9TA 2EXWD 3KYOB 2I85A 4S1QH 3BKML 5EBMB 2F8XC 3DETD 4RRPM 3NSDA 4WAFA 4JM2B 1XB8A 1GL4B 3SGJA 3U83A 1M71B 4ANVA 1X7TA 2EC9T 4OGYL 5HDWA 3L2MA 1QHQA 1RP8A 2R2HA 1KMGA 3KPOB 3WN5C 1UCBL 1HCVA 4NSKA 2RIKA 2YXVA 1OTUC 1PQZB 2G60H 1QWUA 2ZT9C 3BSZA 3N44F 4DUXA 3WTTA 2P80D 2HAZA 5B3JF 4JUTA 1KDIA 3OJVC 4NN6B 3BVDB 4OZFA 3V0VB 2VLLB 1DDTA 2A9ML 2OMTB 3MV7B 1FL5A 5ID0A 1DVXA 1MFCL 1NGWA 3DTXB 2QADC 4FNPA 4NPYB 5AVTB 5IW3A 1EHLH 4L4JA 5DHEA 1C1EH 1I7ZA 2O6FA 4FQIH 4QOKD 5C0CA 5G4NA 3UYRH 5D2LB 2GITA 3LQZB 1BDYA 3ARGB 1WJ3A 5H4ZA 5ICXB 4JS7A 3LV3B 2XV0A 4LXFA 1DJGA 1KZYA 4F80A 4HUUB 2N56A 1Q72H 1T22A 1AS6A 2YAQA 2V3FA 2CHWA 3GXDA 3NPZB 2P4AB 4E9QA 1M7DB 2ERJC 5DK3A 3ZQWA 1SN0A 4XB8A 4PP1C 2VLRD 1D5ZB 1P1ZA 4LPCA 1JV2A 1LEKA 3G04B 1G1YA 3UJIH 3L17A 4XBPB 4L8SC 1LMKA 1NDMA 1Z9PA 3AY4A 5IROA 4E9SA 3GFUA 1JZJA 5HVHC 1ED3A 4UQ3B 1Q0XL 5CP3H 4KJQD 2QQLH 5D70L 4ZUSB 2DWXA 1LMIA 5KSUB 2OAAA 3TNMA 2NUPA 4M4RA 2LVEA 1CE1H 5I8OH 3EOTH 5CEZL 3S9DB 4U3SB 4HK0B 1OT1A 5KVMC 1M6UA 3V6FA 3EFDL 2YD7A 5E8PB 1HXYA 1OQXA 3AG4B 4HU8A 4Z23A 5HGBA 1S9VB 2YSSA 4NOBA 4AQAA 2IEPA 3V4UH 4I4WA 4GRWB 5GRVL 1QLRA 5DC2A 4L9LA 1AFVH 4WHYG 1QI5A 5IEKB 4X0NA 3MOAH 5GS1C 3V5DA 1WVZA 2YZ1A 4WY7H 1NAMB 4XPAH 1G7PB 1MVUA 4X6CB 4C57C 2YUWA 2Q8BL 4R0LC 1QBLL 5KOMC 1HZLA 3Q6GL 1N64L 1IGML 3BP7A 2WNGA 4NFCA 4QRQA 4XE0A 5A2BA 1E50A 2Y5TA 4EOWH 3L5HA 2G3NA 4AH2A 1QKZH 2GSGB 4YDLB 4JQIA 5DUPL 3LEYH 1NCCL 2C3VB 5CGTA 2WBXA 5HJDA 2ZX8A 3SQBB 1BQSA 3VX0A 3WTYA 3MRFA 3GWJA 1F41A 3ABLB 3IFPB 4BQCA 4Y9BA 4PJEF 2DQHH 5FYJE 3BX7C 4XP6L 1D9KC 3AGWA 4BK5C 3AS3A 2OS7A 2R1XB 3QR1A 4O4YH 4IJTA 5I1LB 1PAMA 4Z7UB 3WXVL 2OX5A 1RPKA 2XN9A 1IEBA 1X5LA 3EO1A 3MBEC 1P84K 2ZSWA 5GZNA 1V5JA 2Y06L 3ZKXC 2XPYA 3SPIA 1T04A 1KNOA 3GIZL 2BP0B 1UJ3B 2VH5H 4CU6A 1N6UA 3UG5A 4NPJA 1EXUB 2J3SA 5B8CB 3BQUB 4FTVB 3IGLA 3QXWA 3MO1A 3S36X 3SKNA 2XZQL 4X98A 3WEMA 2CIIA 1R0AL 1DANU 1I8LA 1PW3A 5D5MB 1GGTA 3B9KD 1B4JL 3ZKQD 3PHQB 3M8OH 1AXSB 1X4ZA 3IMBA 1GZQA 5HSFA 1W80A 4KJWC 4J3XA 2XN9E 4M56A 1ULVA 4UUJB 2MJWA 3A67H 3QZOA 3FRUA 2UXGA 4GAYA 1L6XA 3ESVF 1YECH 1ZMYA 4RLDA 2NNXA 3HC2A 4HHAA 4KUZL 4ODXA 3APMA 4MYWB 4KXDA 4BELD 5K59F 2VRAA 2WIIA 1KTLA 4ZPVB 4JHAL 3A22A 3ARVA 3FUNA 5SWSD 2E8ZA 2CO3A 3VCLB 3NQIA 3PREA 4DP6X 3N9GH 4OFDA 2BX5A 3IXTB 4H8WH 3LKNA 4IRSD 4NC1C 5ADOH 3T4AA 3INUL 3U48A 1ACYL 4A7GA 4M00A 3GUTB 2WVSA 2EYSB 3KBHE 2Z92B 3AREC 4HFUL 1HH9A 4HUNB 2EDMA 3DX7B 2OMUB 3AB0C 3UBGA 1DQML 4P2OB 3S6CA 2XY1A 1I8KA 5ILTH 4L18A 1BQKA 1CICB 3VXMA 1BWMA 3LKQA 2F7QA 2WWNA 5DQJB 3NOIA 1XGTB 3F6LA 1QZNA 1T0MA 3C8HA 1WBYB 5HHNA 2IC2A 5C0GB 2ENYA 3P9MA 3RFZC 1CGTA 3T3PE 4L9DA 5E9DE 2WXQA 1HKLL 4DAGL 3EIFA 4G7VL 1UB6B 2HT2C 3I6KA 4LCYA 4U6TA 4A2EA 3BRFA 3Q8EA 1KXVA 1WYJA 4UOQA 5HY9B 3BP6B 3K72B 4MDJB 1UASA 3BISA 3BT0A 4XP1L 1S6NA 5JYMA 4EQ3A 4IRJA 1M05B 1M57B 2XOTA 3L7FA 3SDCB 3ML8A 3DX2A 3FO9B 3CV5A 1IGTA 4Z7WA 3VXME 4HEPG 4R7DB 1LO0H 4FC3E 4XPHH 4XAKD 4R8WL 4X80H 3E38A 2ZKMX 4NKDB 4YHLH 4ZNEE 1KG0A 2BNUB 2NZ9C 5D7SH 3MPCA 4R7VA 4Y5XA 2EO1A 4XT1C 4ODWB 5B3NA 1KN2H 4PJ8D 4HEME 3TN0A 4HF5H 2GJ6D 2V5TA 1KENH 3DHPA 3NRQA 3QRGL 1WZ1H 5E4EB 1ZGLB 3BDBA 3B3BA 3IMWA 1DBBL 2BXYA 3PV6B 1AO7B 2P5WE 3ZJAA 3BKYH 5KVFL 3IS0X 1ACXA 1CGVA 1CGUA 1Q9KB 3QDJD 4PJHB 3SE4A 4WV1A 1NWPA 4MAUH 4MNQA 4UV4L 4Z95L 4G71B 3RBSA 1B3JA 4QIRA 5CD5C 5L8JB 3RZCA 1G7JB 4PRIB 5E9DD 4R90L 3TO4B 5ACLA 3EO9L 1KGCD 4JDEA 3DXAE 5JLZA 1U93A 2WUCL 3MRBA 2XZCL 3T0EC 2NY5L 4A39A 1G9MH 1U3HC 3CU1A 4LLVB 4P2QD 2ID5A 2WKOF 2X6MA 4MDRA 4JFFA 4Y4FB 3MYJA 1D2PA 2GG1A 3CVHL 5DHVA 1V05A 3D7PA 4LSQH 4N3UA 1KIPB 1O5PA 2DJSA 3NTCH 3G5VB 1QYGH 1B0RA 1WBZA 1CI3M 1I1FB 2ICEC 2O5YL 3L3IB 3PAVA 2XQYG 3FMGH 1EVTC 4X42A 5EORH 3WMQA 4DOHB 1YEKH 4Z1PA 3PUUA 5H37H 3UZEC 1NM4A 2YMTA 4IOIA 1OOWA 1P7QD 3QUYD 2WCPA 1T7XA 1UFGA 1LQBC 2YUXA 3ZT7A 1HN1A 5AAPA 1ANUA 3JYCA 4PQXA 5JPNC 4HJGB 2P5WD 3U6XA 4DH2A 3L5XL 4JFFE 5CR1A 3G9VA 1FVEA 4ELKB 4JM4L 2VABA 4XR8C 2JNZA 2YN5A 5KVDE 4FQ2L 3QCVH 3C5ZD 4H4NA 3QZLA 4GSDH 2BZCA 4HIHA 2CO1A 4ZX6A 1NGXB 2DL9A 4JVUA 3QISA 3C60D 2W65B 2Q1EA 4ORGA 4MB3A 1KDJA 3SCMA 4TQHA 5ITBL 4KK5D 1EGJH 1UZ8B 4AYEC 3S4SG 5F2FA 3KR3H 3ULAB 2DIAA 1N2RB 1H0DA 4YR6B 1QFUH 4ANKA 5L9DH 2A5UA 1BGXL 1DJXA 2D9CA 35C8L 3L48A 4JFOB 3E3QE 1QFWL 4UOW0 3T1FA 4OZHB 5KW9L 1JZHA 5DD3H 4JG0H 5I6KA 1J11A 1TMCB 1CVSC 4XODA 3RNQB 1ILUA 1JNHB 1XGRB 2FYYA 3QO0A 4GI6A 4QXTA 2ICWJ 5E2VL 5LNEA 3GMOB 4KZEL 3ARQA 2DOCA 1N19A 3UPCA 3KPPB 4J7RA 1FYTB 1ZT4B 1MW2A 2BFGA 4XXCC 1D6EB 1JHTA 1TYEB 1EEYB 5K9QI 2E7LC 4LNRB 4X7SH 1NAKL 1AI1L 4LAJH 1AS8A 3L95A 1J8RA 3MJ9L 3SJVB 1VPOL 4Q9RH 2JKXA 3HI6L 4TULL 1CL7I 4M61B 1JI2A 1H3TA 5HDBF 2LR4A 1KT2B 4KBPA 4TUOB 5JOEA 5B1BB 2D3JA 2XA8H 2ZXWB 3SQRA 2ITDB 2WOBA 4EE2A 3GXIA 2NRDA 4F37K 1BF2A 4GY4A 1TQSA 1BVKB 3TZVA 2DM3A 4G8GD 3FRPA 2ADJA 5TH2B 3TV8A 5GS0D 2J55A 2LAAA 3H9SE 2BY2A 2YKLL 4HWEH 1JNLL 4RMQA 5AW5B 5DZLA 1L0YA 3O6FA 1MHPL 3L4WA 1SEBB 1SF3A 3PXLA 3RY4A 2CM5A 2HX8A 2H0FA 1HJBC 2WSPA 3PGDA 5GRJL 5G55A 5KYUB 3TF7C 4LPTA 3EH4B 2QSQA 1Z9SB 4OCSL 1AGEA 1N0XL 4YWGL 2BSRB 1S7RB 1X4YA 3QE5A 3CZFA 4MCZA 4Z76B 4DK6A 1U8MA 1TZHA 3HG2A 3VU1A 3FSOA 4YLCA 1DHKA 5CP3A 2WLMA 2H8PA 4Y0GA 1XGQA 2IPKB 3QEQA 1A3RL 2KQMA 3FQRA 2QSTA 3ASWA 1BYOA 1PU0A 4BFEA 1A4JB 4MQ7B 2FSEA 1S3KL 2FBJL 3CMGA 2LE9A 4Y16C 3W9DA 2X70A 1AIZA 1KJ2B 3AM8C 1KV3A 4DTGL 2APFA 3BD5A 3DHUA 1VF5C 1ZD6A 3TVMC 1K8IB 3WFEH 4AQ1C 1MNUL 4HEPA 3IU4L 5H37G 5MEPB 4RFNC 3CMOH 4OD2B 4YLQT 1IAII 1CLZH 1F3DJ 1KPRB 3H9SD 2MQ0A 3NIGE 1HT6A 5I1DB 4GQ9L 5FFOA 3Q2LA 2FEEL 5C3IA 1SFHA 2B5IB 2ATAA 1COBA 1KYAA 3SDDC 4ZT1A 5FCUH 4HX1A 4KKQA 2VMCA 5DEZA 1EZUA 1T7YA 3V6ZB 3GZOA 2NY6B 3DGDA 4YDZA 2C26A 3BYTA 4Y2DA 4G70B 4JFDE 4NQTA 3P0GB 4PJFA 4RSVA 4NQSA 3MN8A 2DLGA 3SGEI 3VWKB 4HUWB 4NN7C 2Q76A 4ZUTB 1OGAA 1W72B 5GHWH 4D94A 3IDGA 1LEGB 1QP1A 3P4OB 1MHCB 2VXQH 3L3DA 4N0YH 2APXA 3RQ3A 3ZT6A 2IALA 1BPVA 1D5MB 5JQHC 1SDAB 2E86A 1KV7A 5AZEH 4QCIB 5HHXH 4XP9H 2NUTA 4X9GA 3ZMRA 4L2YA 1MFBH 1AP2B 1CUOA 4JZOB 5AKTA 1H6EA 4WCYL 3NJKA 2WBJA 1UURA 4HUVB 5CINH 1OGAE 2CUHA 3H9ZA 4WNQB 5HDRA 1NCIA 3QWOB 5FKPA 4EIUA 2YRZA 4FP8H 4KVNH 3REVA 1NIEA 4GAGL 4IDLA 1FHGA 1T4WA 3FAXA 5JQIB 4WO4C 1TO5A 5E8NB 2CHDA 2PLTA 1T5WA 2F58L 5IB2A 4P4KD 3V5HA 3VSQA 3VFNB 5D1QB 1EJFA 2KPNA 3ALPA 2QKIB 4ZUVB 3RWHA 3KYNA 3T6XA 2IAAC 4X6DB 5JIPA 4LPWA 2XXFA 4JL1A 4X5XA 4ZFOL 2VN6A 3ARZA 2VDQL 5B3JE 1DLFH 4JFYB 1HL4A 2QQNL 2VDLB 4UANA 1JAEA 3ZKSD 2VDLL 3S4SA 3VVWA 2VZUA 1RJLB 2PP8A 4PSRA 3R0MA 3F00A 3DUUB 5CHNA 2FK9A 4XC1H 3UZVA 4HG4J 5ISZE 1JCVA 3PNWB 2B0SH 5KJRL 5DZ9A 1A7QH 2FDBP 2EXYD 5EF1A 2D7TH 4XVJH 4BHUI 3RWJB 2PWDA 3P3YA 4WKZB 3IT8D 4Y8DC 1KJMB 1GKOA 3LMJL 2DEYX 4QO1A 3T77A 4AIOA 2NW3A 4G6FD 2YD8A 4Q9BA 4YHYB 4KMTL 1K4DB 4XPFL 4GNKB 3DBXB 4XPGL 4Y1TA 1R3IL 5BO1L 3QAQA 1X9LA 2X4OA 1J9CT 4CNIA 3OKKB 4NO0B 1JGDB 4XE5B 5E6IB 1K85A 5D1XA 1KCSH 2JI3A 4K23H 3ZHFA 4RZCB 2A9NH 3ECQA 1PX3A 4KJPC 3K71A 4LU5L 4OLXH 4L4TE 4JFHD 3ZE2B 4ZS7H 1H3VA 1IC4H 2OM5A 4KXAA 2P24A 4UT9H 5KVGH 3S96B 2V17L 3V10A 3D39A 5HDQL 1ZWIA 3IJEA 3RA7L 2B9AA 2X4NB 4G9FA 2YKKA 1UB5B 3HPJA 1ETJA 1T2XA 1F8TL 3PPSA 3ME0A 1M53A 3RX9A 4HWBA 4DUWA 1R3JA 3T4YA 4LQ1A 1V27A 3ES6B 3U9UA 4A6YL 2I7OA 1AHWB 4XOCA 5AVXB 2WJ7A 5AOJA 3BPOB 2PMZA 4G7QB 5DJ8A 2H2SD 4FNTA 4OIFA 1G1KA 3BAJA 4CA4A 3RYMA 2VITB 3MRGA 4IIQC 1AGBA 1KTRL 3ZMEA 1BP3B 1YDPA 2MFNA 3WY2A 4ELDA 4X4ZA 1JHKH 5CILH 1C5CH 5CMAA 2O5ZH 4LQFH 1NDGB 3FCBA 1J05A 1L7TL 4N2KA 3FCSB 1XMWA 4LCUA 2ARJB 3F58H 2GIMA 5AAMC 4R4NC 3QG6A 4PJEA 3EBHA 5GQBA 2I25N 2YOAA 1YQVL 1CU4H 4QTFA 4OI7A 1IC1A 4WHCA 2HFEA 1KCVL 2G75A 4MJJA 4JQVC 3SE8H 3LJ3A 1F58H 3PHOB 4L4TD 3VXPB 1ZRUA 4TL5A 2AV7B 1LEIB 1DBMH 1CYXA 2PW2B 1FNHA 2YBGA 3AS0A 4JPVH 3PWVB 3H6JA 4YSEA 3L3JB 3V4VB 4R7LA 2A83B 4OVUA 4OCLC 1CFTA 4N2MA 4YPJA 3V4VL 5DF0A 2G2RB 2VN4A 2X38A 4GO6B 5ICZA 5I73B 2EYTA 1DQDL 1GGBL 1ZEAH 4PJEE 3LEXA 1RJCA 1PKOA 3W0WE 3BUIA 3N40P 3PJLA 4N4YB 2NW2A 3V52H 1BLNB 2O6CA 1F00I 4OGXL 1RZIB 1NBVL 5FECA 4MXQC 3DHMA 1DE4B 3PRZA 2DQGL 5FYKU 3N42F 5PAZA 3JZ7A 3SYCA 3DTUB 4EKJA 4KTYA 3AACA 4J4PA 3LN4B 2IBGA 1NMBH 4M6MH 4Z7VB 3FONA 4E41B 2HVJA 8CGTA 2ROYA 5FKAB 4OIAA 1NANI 4YUEH 4K5PA 5I18L 1ONQB 4YHNA 4U49A 2O30A 3GSNL 1OAQH 4XCNA 4IIZA 4DO5A 4WZ9A 3SOTA 2HRPH 3I2CL 3MLYL 3ZMNA 3ZE0E 2DWDA 4F2ME 3GM8A 4HPYL 5J57B 5K1NA 3BW9A 1RPQA 4GXFA 1BBDH 3QJXA 1KPVA 2IOIA 2OTUB 5C0BD 3TFKC 4LLDB 2WLKA 2QZQA 3ARBD 3MRDA 4I18B 1XIWA 3W0WD 3LIZH 4PRAB 2G5RA 5AVUB 2FUTA 3X1FA 4NP9A 4ONFL 4KX7A 4OCNC 4NNYB 4JMNA 1MFEH 1OHQA 4UINL 5BJTB 2NXYC 1F5WA 2BCKB 2CBTA 3JTBA 4XOBA 4JL2A 1LK2B 3L4ZA 5L0QC 4N2BA 4YHOL 2P9RA 1M2VA 4XN4A 2GYSA 5HYSG 3RWCA 3ATFA 2WN2A 4WWID 2ZONA 2XVGA 1I1RA 4MJHA 3F7KA 4ZMTA 4JB9H 1U8QB 3N0AA 1G7QA 2YRPA 4XVUD 1MCFA 3C6EA 3NUKA 4A2LA 1A3ZA 1FZKB 1RP9A 4P5TA 1Y0LB 4LBEA 5LLIC 3DX8B 1AR2A 1AKJD 2BSTB 1H15B 3MQIA 1YEEH 3QH3B 4X6FB 5I66A 2IH8A 1INEL 1KFAL 2BIOA 4W9LC 4E9YA 5E4IA 3US0A 1SJHB 2JB6B 5FK9B 3O6KL 4ZFGH 5DQ9B 2ZZUT 3GXUB 3DRQB 3QZWA 2F19H 3I3EA 2VR9A 1P5UB 3FO1B 4MB5A 4W4NA 3FTXA 1L9PA 3AMKA 1HWHB 4LCCA 3X11A 5C92A 2EIEA 2BNQD 4QHLA 5F1IA 3WIHA 2W9EL 1N3NB 3F7RA 4XH2B 1TLKA 3I6GB 2K3HA 5HGAB 5EEVA 3MXVH 3V0JA 2J20A 2W1NA 2ZPKH 4W9GC 5B38A 3HNSH 5DJ2A 1A4BA 4W1TA 3F05A 4HH9A 4UQEA 3VG0H 4EI0A 3QFDA 2AEQL 3S34L 3DLQR 2WKOA 2QADD 2AJVH 2FT6A 2B08A 2HMIC 3RWGB 3HPLB 1CXIA 4TUKH 4XMVA 4G1MA 5A7BA 3X1EA 4IOSD 3KNBB 4I0PA 4PRPD 3CLEH 4YLBA 4BWWA 5MP6L 1T6VN 2XWBB 3SDAC 1K8DA 3UO1L 5F3BB 4S2SA 5F3HB 4R96B 4D2NA 1SFDA 3B8YA 4AT6B 4N6RB 4XMZA 3VI4B 3TCLA 3QIBB 5T5NF 2MOVA 2HA1A 2XBZA 5K39A 1GS6X 1OAUL 1DVYA 2AMUA 4OUUB 1IKNC 4RGOL 1UWXK 3OTTA 4AYID 3PABA 3OLEA 2IBZX 4NRYB 1PKQB 2C9UA 3U6XS 4PP1D 1LP9F 5F7HA 3KPLB 1RK0B 3B3IB 3BGMA 2AZAA 1FLRH 2X4QA 4ONGL 2QV4A 5SV4A 3Q1EA 3HZMA 3HMXH 4HIIA 4BFKA 3P0YL 1E4KA 4O9HH 4P3DB 4PBWD 4PJGA 2W60B 1NCAH 1LHZA 4N25A 1XSOA 1NGZB 4NS0A 4PTUA 2BIMA 4QHMB 5C6PB 2F1AA 4LVNC 1CD1A 2ZKWA 3WXWL 1T89C 5D72H 3BWAB 2GEQA 4XMTA 4PLJC 1G9NH 2EP6A 1KWGA 1PZCA 3EBIA 3HC0A 4IQHA 3VMOA 3NJLA 1J0IA 2CJUH 4RISH 1MQ8A 2Z31A 3BEWB 4XGZB 3F12A 4LEXH 1U2YA 1T1ZB 4BE5A 4LK4A 3PGFH 3M45A 3WJJA 4DERA 5J6HB 1QABA 4LGPB 1X9UA 4L4VB 5J13B 4PGDA 4V11A 3V4PB 2IMNA 2RFXB 3WIAA 4IKNA 1RLWA 1S5HB 3KVQA 3F7YA 2FIKA 1LK3L 1BAFH 2Z91A 3TJEH 2ED7A 1CF8L 2A73B 1N5AB 3MLVL 2WM0A 3T0WA 1UYWH 3MRMA 3O2VL 4HISA 2B4CH 3UTPE 2E6PA 2V5MA 2WVUA 3F3HA 5LXGH 4KTEH 1NCGA 1CS6A 3L3GA 4YH6A 1NLBL 5C0DB 2L7QA 2WLLB 3PFUA 3T8MA 3ISWA 3FAWA 1P4LA 4DKTA 4D0BA 4UT6A 5I71B 1OE2A 2YD4A 3FPYA 3O45A 2GJPA 3FT0A 4JKWA 4OI9A 3NH7H 4OJEH 4PJIA 3S5ZA 3RTLA 3IAQA 4XPTH 4PY7A 3U30C 1C12B 4RAUB 4NRZA 2YUVA 5EEYA 1U95A 3C08H 5HDBE 1JXKA 1OGTA 5BMFH 2HJKB 4JY5H 2QDVA 2K4AA 2DLIA 3NJJA 2W0PA 1D7BA 2K9UA 1OF2A 3AG2B 2R23B 3VRIA 3W37A 4GUCA 3EJJX 4X8JB 1I1YB 2MIZA 2PXYB 5GGSA 4G8AC 5T3ZH 3LSOA 1KBVA 1U8NA 2VZVA 4NWUL 4PJIE 2X4TB 1ECZA 3D3VA 3EF7A 1ZVSB 5E1AB 1G7IA 4ADJA 3QIWC 3FHEA 3H7BB 2J88H 2H5UA 3QEGL 4BZ2L 5I1GH 3U0PA 1OAKL 4KJWD 5IHBA 4TLSA 2X89A 4UIMB 3C8KA 1E40A 4D7BA 5IQ7L 3KGSA 3OJDB 1GXEA 3L1OL 1OSZB 2GI0A 3BESR 2YC1A 4HHGA 3DURA 1AGFB 5FOJA 3H2WA 2F53B 1U8OB 4DQOL 3UGEA 3ESOA 1KC5H 2CKNA 3LVEA 3PGCB 3P4NB 3BAIA 3OHMB 3MXWL 3B5TA 3IJHA 3FOMB 2DKMA 2TRYA 4H25A 4HUMB 4U6YA 4W4OA 3P3UA 3VFUB 2NNCA 3KPRE 3B9DA 1OCCB 2FQFA 4MXWH 1TPXC 2I9LB 3EYSH 4QRRD 1LO4H 5DJAB 4RIRB 3FBQA 1E4WL 5DDHB 4GG6A 5KVGE 2W9LA 4E42A 1U58A 3ARED 5DURD 2IH3B 2XVLA 4RFEA 2MKLC 3PPEA 5JQ6H 3PIQB 1MFNA 3HHSA 2AQPA 2G9HA 2QELA 3MCG1 3CK0L 3O4LA 1PTZA 3KLHC 4NUGL 4PJCA 3MR9B 3KPSE 4HJ0C 4L3EA 5ALCL 3T6WA 3V0GA 3VSVA 1YMMA 1G0XA 1UTDA 5HYJA 2Y07L 4JJ5B 3T1WA 1WA2X 4KPHH 5E51A 4WU5A 2AABH 1WCQA 2XTJC 3NABH 3PE9A 2FJGB 4MMZB 5T1MB 4IBTA 4GG6E 4X0KA 2RB8A 3WHE0 2OQJA 2UXTA 3KJ6L 1FPTH 5BOJA 3LHPH 1Q4NX 3ZKMC 4FNLL 3QO1B 5GGUB 1CN4A 4PB0L 3OMZA 1D5BA 2BDNH 4WENB 3W9EB 1H19A 4U1MB 5DK2A 4LKXB 2H6PB 4X7FC 3QEHB 4AYGA 1SBSH 4V1DD 3TS8A 2IAMA 3EG9B 5IHZB 1KBWA 3LH2H 2I60H 2FHCA 2PKDA 2VXTL 2ZP8A 4N3TA 3KYKH 1MY7A 5HGGS 3SGDI 4MD0B 1DUZA 5ID1A 5JIMA 1CB4A 3D0AA 1W6WA 1ZSDA 4LDOB 4M8UA 5DR5L 1A4KA 5BV7B 1DCLA 3N41B 2Q20A 1E9PA 2HRGA 2B3IA 2VL4A 4B7LA 3RAJH 4O2CB 3SDXF 2WLNA 4BCYA 3MJGX 2RCSL 5C08B 3VD4A 4XNYH 4GEJA 3N1QC 2CBQA 5FO2A 2Z3FA 4YXHH 3CLFH 1SLWA 5CD5D 4NUJA 4XB7A 5G4MA 2WWOA 5L2KB 4P5KA 5D1ZB 3X1NA 4GXUM 2CJSA 5IK3B 3VGDA 2VLJA 4XCYA 3VJ6B 4N1CA 1FIGH 1OANA 2AJUL 2PCPB 4QR7A 4WFED 1YY9C 2PO6A 5GIRA 3UTTB 4QT5B 3ETBF 1QFOA 4U05A 4Z7QF 3T0ED 1U3HD 3U7YL 5HHOB 2GTWA 4LIQH 2EC8A 1AD9B 2ATKB 1IO4C 2M83A 3L7EA 1ZA3A 2V2TB 1PZ5B 3L54A 4HK3J 5FOBB 3CHQA 1UENA 2ZX5A 1IM3D 2YZ8A 1QRNA 4HCGA 4Y4KA 4A63A 2JKRM 3SBRA 4JNXA 3OX8A 4M29A 2VAJA 4H8VA 1TVDA 2EVGA 2VLJE 2GAZA 4XN5A 1TTAA 1ES0B 3CN4A 3T0DA 1MELA 4PRBA 3IF1B 3A0OA 4YL4A 4FNQA 3QJHA 4F91B 1CXHA 5BZWA 2F0CA 4BWTA 2ENQA 3LS4H 1KBGH 1NFDF 3CFCL 1KIRA 2HCZX 3HRZB 3Q8FA 4XX1G 3LQMA 3FU7B 5FYKL 3S36H 1BXVA 1EAPB 4X9IA 4FEIA 1QATA 2XTLA 4N5UA 1PZDA 4O02L 4WI3A 3CVCA 2WXMA 3U4BH 1E4XL 3GXTA 2AJXL 2YD9A 5F70A 1WC7B 3IJ9A 4L8BA 4GBXB 1AACA 5F97E 3CZLA 4H1LA 4IBQA 4XB3A 3SHSA 1L9QA 2PF6A 5CBAB 2FWLB 2JCCF 1L9NA 3L6FB 4TOYH 1MCPL 3RDTB 4DVRL 2JJWA 2AAAA 2Q7YA 2YK1H 2ZX7A 4N85A 4UNUA 3ZTCC 1FFPB 1GKEA 3B2PA 3FT3B 5C0FB 2AJYH 2CALA 4FQXC 1XF5B 1JGUL 4LDLB 5E70A 5EU6B 5AVZB 3VXNA 2CDFB 3M7OA 1QW9A 5IIEA 3VI3A 5J9PA 4G59C 3VGFA 1TXKA 4JFEE 4QRPD 2H32H 3RTQC 5C0AB 3ZYOA 2DQJH 4MLSA 4QKTA 5F1SA 4YS4A 2WLIB 4HZ1A 4D9LH 5CJ5A 1G0DA 1SYVB 1IAIM 5KVEL 3GMPB 3AG3B 2UY7A 3P30L 4OLVL 3WS6A 2X7LB 3ARPA 2L8AA 4XCCH 4DW2H 2XYBA 1KWKA 3HZKB 4JM2F 3QXUA 2WSKA 4FG6C 3GB7B 3M1BA 4AJYV 5F96L 2QTEA 3VFWB 3VI3E 1QG3A 3T2NL 3GT6A 1B4TA 2EDFA 2NNRA 3U7AA 4YIQA 2YAEA 4LLMA 1A6AA 2QSCL 2VGLM 1XDTT 3AADB 4XMPL 3ZLQC 4MJIE 4AYFA 1KCUH 1VB9A 4QXUH 1KGYE 1RZFL 1RFDL 2WQSA 1IBDA 4CJ1A 4EQ2A 5CBEB 1T4KA 1RK7A 1MWAA 1EFXD 4HBCH 3V5KA 5L7XH 3GSVA 1UXLA 4QHNA 4BQ9A 4N8VG 3ARRA 1U3YA 4G6KH 4JFED 3PL6B 2OMVA 1NGQL 1XB3A 4MA8H 3SKJL 1DQIA 1W0WA 2R56L 1QI3A 4LOEA 3MUGA 4AMWA 3BRGC 4LCVA 2ZKHH 2XV3A 3CVIH 4NKOA 4WHTA 2IBBA 5D2LF 3IDNB 4GSXA 3WNLA 1F4WL 5IV2B 1A14H 4HUXB 1JDAA 4PW3A 1Z2KA 4JEGB 1SGKA 1E3FA 2BFVL 5E5LA 1FNGB 2ICWB 4F9PC 4V33A 3NIDB 4WFFD 1RQ5A 4Y16D 3P0VH 3DK2A 4UDUA 1HIML 3GRWL 4K9EH 5GSRB 1BEYH 3MV9A 4XOEA 4B3VA 1DO5A 4A68A 3WSQL 5LG6A 1DVQA 3ORJA 4S1SH 4MJID 1LO5A 5D7JB 5IFHH 2K1MA 4QXGH 4NGHH 2A74A 2ITEA 3UJJL 3HUJA 1J5OH 5BXFB 3JUYA 2VLME 1M7XA 1PLGL 1XL4A 3G5ZB 3SDDD 4AE0A 4AEEA 1HVXA 2EDJA 4LLUA 2XZAL 4NKQB 3CN2A 1U8HB 4Q89A 1A1MA 4P2RE 2NSMA 1P2CA 2CA3A 2NOYA 3A4FA 5I9QB 1QD0A 2DKSA 4ODVH 1TVBB 3FTSA 5E23A 5BO0D 2VDOB 2OMWA 5F6IB 4WWNA 4M7LH 1JD7A 5EO9A 4XNXH 4J39A 3Q43A 3HLAB 3WD5L 3P11H 4JN1L 4F8TA 5CJBA 4FA8A 4AQ8A 1UD4A 3VO0A 2E46A 4GW1B 1MLCB 4W70A 3KJ4C 3PWLB 1G9EA 3RP1A 3FUKA 1NKOA 5TE4L 3LQAH 2DS4A 1GGCL 3NCFB 4GSRA 4Y4FC 5EULV 3U2SA 4IGBC 4HV8B 3WNKA 1JYXA 2ESVA 3BH8A 4LVOC 4OF5A 4PREB 2F54A 4E5XG 5CD3B 2WINB 2APVA 4OCRL 5GS2D 2Y69B 2VLMD 5INCA 4EO5A 1CGYA 4LHUA 4WNSA 2EE6A 1H5BB 1TOXA 4WI8A 1C5DA 1J0ZA 3FTYA 5L4IA 3CN0A 4MDIA 1DQVA 4NO5A 1KLUB 1MJUL 2VQUA 5HI3C 4M8RA 5EUOA 2V7NA 4W6YB 2MCAA 1UKTA 3Q2VA 5KJ4A 5ABZA 5T3ZE 2X6AA 3BKMH 2K7QA 4XHJC 2ESVE 4PU2A 1G7LA 2C1OA 4Z7UF 4GW4B 1DVSA 2K8MA 4AUYA 3RX8A 3FFDA 2VKXA 2BCMA 4FXKB 4OR1A 3ILQC 1GC1H 5D2NA 3QIUA 5IVZB 4U4BA 3BMWA 1I1AA 2CPCA 1C08B 3IDMB 1CMOA 1ETZB 2D0HA 3E6HA 2ATPB 2MWCA 4ORZC 4YHPB 1UCBH 3DOHA 4NRXA 2WUBL 1X5GA 5GISL 5BS0A 5KYYA 1NOAA 4KGLA 5D5MF 3UERA 2WXNA 2BHFA 5K9OB 2GCYB 4Z3JA 4XX1E 1L0XA 4MNGB 3WKML 4ZBJA 4K2UL 1AQKH 3DVNB 3D25B 5I6PA 4X4YB 3TA3B 1IFRA 2X28A 5CJOL 5C07B 1IC5L 1SOKA 4XNMA 1FAKT 2A9MH 2J56A 3HAEB 3C6LA 3ZDZB 1MFCH 4F92B 4UT7H 3D48R 2EXTA 2IWEA 2B16A 3APCA 1VESA 4XN8A 4UTBH 1I8IB 4FQHA 2X53A 1TJGL 2R4SL 4JRYB 1OP5H 5BS0E 4U33A 3O6LH 4JREC 4BKSC 1YC8A 3QPKA 2OSXA 3K8KA 4I89A 3VSTA 1PLAA 3CSGA 4KJPD 4NWTL 4TUJA 5FHBL 5L4MA 5IW1A 1BQLL 2WMPB 1LP9E 4OQTA 4E9RA 4JY6B 3O3AA 2R2BA 4KFZC 1D5IL 4FYQA 5D71H 4NM4H 1E9QA 4IKLA 2VNCA 1Q9WA 3KPQB 3BLPX 2JKIS 1HZHH 1INQB 5DS8B 2VDPL 3UBXI 1J9QA 2X4SB 4IRSA 1ZHNB 3FT2A 4DPAX 5IQMA 1M42A 3ECBA 3EH5B 3GO1H 3VXSA 2JQAA 5B7FA 1SHWA 3LRSA 4BK8A 3EGXA 5F7YC 3E0GA 3L3HB 5DHYA 2AJSL 1FN4B 1H3XA 3FB7B 5CP7A 4F7TB 4FXGC 5D70H 3D2TA 4H5SA 1W0YT 3NESA 3TP4A 1U9KA 3CN3A 3IGFA 3E8UH 3HS0B 5CEZH 5DMYA 1YRKA 1GIGL 3QULB 4XPBH 1HOCB 5E6SB 2GSMB 1BD2D 4BUGA 4TSAL 3EFDH 1S46A 5CLZA 4EI6B 2SEBB 4R4ND 2BSED 3BXNA 1LWHA 2WZ5A 3UIZA 1I9RH 4QHKJ 1INDL 4BSVB 1CF1A 4EDWL 4F37F 4XP4H 1E90A 1CE6A 1CJYA 2AHIA 3MV8B 4MCYA 3KM1A 2OSWA 1JP5A 4WSKA 3C75A 1RZ7L 1XL6A 2H9GB 1JXJA 4KDTA 4KITB 1NAMH 2WTRA 4GIAA 1BZ9A 4C54A 5EZOL 4GLRH 4PJHF 2Z35B 2KLTA 4TRPH 3Q6GH 4Q7DA 3TJHC 1IGMH 4PJ8A 3O9WA 4LSUL 1QACA 1BEXA 2ICCA 2QFPA 4QHUB 2GJ6A 2VUOA 5DLML 2B5IC 2Q6WA 1JDDA 1V7NH 3GIVA 1ZT7A 3M17A 3SE6A 1YLBB 3SE9L 1C16B 1FFNB 4KDVA 2L0DA 1ODUA 3CFKB 4OLZH 4XN9A 1PY9A 4WJG3 5KYXB 1QTSA 4Y5YA 3JWNG 4BH8B 4KQ3L 1JSYA 4FYRA 3TNNB 1YC7A 1DP0A 2AJ3A 1MIEL 4J3WA 3OAZK 1G1OA 2W5PA 1PG7W 5AOZA 1XGUB 2ZWLT 3VWKC 3MLWL 1KFGA 5F3FA 4S1RL 4Y5VC 2J1ZA 3IKCA 4M5ZL 1U33A 4M8QA 1T2QL 3SKOA 3EFOB 4BA0A 3MBXL 5C0IA 1J5DA 3UTSE 1S7UB 2VOTA 1AQDB 2VDRB 1YJDC 5HYQA 3LDBB 1NM9A 2VXSL 1HXMA 2XPGB 3BKCL 5DJ6B 2RJMA 3Q3GB 4Z0XB 2CK0L 3Q2CA 1FGVH 1JZFA 1GJIA 1B4JH 3FQUB 1ZTXH 4CGUB 2H32A 3K2MC 3CH8A 5HHQA 3TFKD 3UGXA 4G83A 3P3TA 3UTOA 4ABWA 3IVKA 1PBYA 4UILL 2UZXB 5IFAL 4DGYH 4PG2C 4QRSA 2DWTA 3VDCA 1RULL 1JGVL 2K45A 1QUPA 1YAZA 4JHVA 1BMWA 1ROWA 5MEND 5KYWB 3MI6A 1WHOA 3C5ZA 3TBTA 1IM9B 4J8RB 1GHFL 2I9TB 5FWRA 3S35L 2F6AA 2PPCA 4LMQE 2QKIC 4KKBD 5DJDA 2VXUL 5IMOA 3CPUA 4OZHF 3INUH 1ACYH 1NCWL 5AKRA 3EYFA 2UZYA 2DN7A 4U31A 3LY6A 3UTSD 1G5GA 2EINB 1ETB1 1RZPA 2N0MA 1PNCA 3UAJC 4XCFL 4QTIH 2R2HB 3MRPA 2EDWA 4PUBH 3VTAA 3QUGA 1KUMA 1YEIL 3FB6A 4NSKB 2AGJL 4GUPA 1OP4A 5ENWA 3ZHNA 1T7WA 3AUWB 1MI5D 4JFXA 4I8DA 4G2AA 4DJMA 1BZOA 2VSCA 3SDXA 3VGBA 4OZFB 5EUKA 2WYIA 3FU9A 1HKLH 2YD2A 1WIPA 3DOIA 3JTSA 3IS1X 4X9HA 3OHXC 4MMXA 1UH3A 4IMKC 1NGWB 5I5JA 3RGVC 1NPNA 6PCYA 5ID0B 5L2JA 2AF2A 1S7VA 2KLRA 3CXHJ 5EBGA 3M86A 4XP1H 3EH1A 3IMSA 2PN5A 3OLDA 4WI5A 1QSFA 4PG9A 1I7ZB 4ANXA 5C0CB 2E56A 5E6IC 2GITB 2VDML 3OGCA 3LKRA 4R8WH 3B7SA 4OM0L 2Z1PA 4ZODA 1B6DA 2HMID 3SDXE 3OGOE 3WFBL 2HX9A 1Z9MA 5IEHA 2X4PA 4GMSL 2IOMA 1A4CA 1VRSA 5C9KA 5EO0A 3BVTA 3HE7D 2RD0A 4N2GA 1T22B 1B0GA 2ZYRA 4GFXA 3WV0A 3SDAD 1P1VA 3S3JA 3QRGH 2B15A 1DBBH 4EBQL 4UTAH 1NSNL 1TETL 4MKMA 3LXUX 2YAHA 1IAIL 3QI9A 3WO3B 1P1ZB 4K15A 4F5CA 1JV2B 1LEKB 12E8L 4Z95H 4R4FH 4Z7QE 2NTFA 4FN0A 4PVNA 3ILEA 4GRLA 3TGXA 1RZGA 1FYHB 2QV2A 5KSBA 3QJFA 1MCNA 3HZYA 1NDMB 2QPSA 3EO9H 5AW2B 1CGWA 1RZKH 4KAQH 5E94A 5T5FH 3ULUE 2A6IA 4FQPA 1ED3B 2WUCH 4PS8A 2XZCH 3QUMA 2NY5H 3MX0A 3TNMB 2NUPB 4M4RB 2YRLA 3N04A 4NM8L 1HILA 5AVQB 1JZGA 5H8DA 2FX9L 1HS6A 2W38A 3V6FB 1V55B 1HXYB 1KBKA 1T80A 2IFGA 5E4OA 3T6QC 2O5YH 2AI0H 5HGBB 2YSSB 3CBJB 3TL5A 4AQAB 5C09A 4RMUA 5KSBE 5HYEA 4I4WB 5AVWB 1QLRB 1FHNA 4L9LB 1SBBA 3OB0H 3QEUA 4FG4A 2XJKA 3V5DB 4OLWL 1VSCA 3DSNA 4AEIL 1MVUB 1I7UA 2ZYHA 3L5XH 1LGVA 2F15A 4K7FA 3THMH 4DNLA 1HYSC 4HMEA 1VZHA 2M1KA 3FQNA 3BP7B 3R1GL 1WWCA 4QRQB 5I73C 4DCQA 2Y5TB 4AH2B 5DHMC 1X44A 2A99A 1DQTA 1I31A 5C09E 2ZUXA 3M1OA 3A23A 1AIFA 3TV3L 3KPNA 4F3FA 2QQKL 2Z0UA 4KRPC 5GGTA 1O7DE 2YPVA 3MRFB 4EI5A 1NPUA 3SPHA 3VGAB 2QVIA 5ITBH 3KWXA 1DJHA 1A22B 1PX4A 1MEXH 4MAYA 5GPRA 1QLEB 5T1KD 1QNIA 1BGXH 1WEJH 2OX5B 1DDHA 4G43A 2XN9B 35C8H 1IEBB 1EAOA 1QFWH 3EO1B 4WEBL 3FU5A 1WWBX 2ZSWB 1A5FL 4B9JA 2IPTH 3K2KA 5DMGC 1C7SA 1T04B 4FI7A 2QHRL 1KNOB 4LKCA 3OR7A 1TJHL 5SWZD 1XAKA 2OXGA 1JYWA 1SXSA 4KZEH 3NSYA 3MO1B 4FMKA 4I1NB 3SKNB 3JWNE 4X98B 2CIIB 5F6HJ 2PETA 1PG7L 2IQAA 2JJSA 1JD9A 2D2CC 1NAKH 4PV1C 4U1GB 2YA0A 1GZQB 2E9WA 2IANA 2VXVL 3DYMA 2R0ZL 1IRAY 3RZWA 3HI6H 4I18C 4TULH 4A2FA 2CM6A 4IBSA 3FRUB 4K3DL 4X6DF 1AZNA 4GAYB 2RHEA 4JGJA 3QIWD 1XGYL 1XSJA 3BN3B 3D85D 3CFNA 3MA9L 4RSYA 4FULA 4HHAB 4ODXB 4YZFF 1E6JL 3PXJA 4WW2A 2WIIB 2XUWA 3BQVA 3EADA 3KL3A 2A1WL 4PM1A 1KTLB 3DIFA 3TCTA 3KBFA 1OAYL 1TNMA 4YXLH 2Y25A 2A9BA 2YKLH 1JNLH 1MQKH 5K93A 2IANE 2YAOA 4KC3B 2C7UA 5DZPA 3LKNB 4A55A 1U30A 2EIZA 3T4AB 4EN3C 3ALXA 3D69A 5GRJH 1LLAA 1NC2D 1U92A 3DVIA 3EKCA 3R06A 4XNZB 1HH9B 5D2LE 2VWEE 2H3NA 4YWGH 1AD0A 2ZUWA 2EE2A 1I8KB 4LSSL 3H6AA 5EOCJ 4J3SA 3VXMB 1QEXA 4JM2D 3LKQB 1FJ1A 4QI3A 3WLWC 3WU1A 4B5ZA 1XXDC 1T0MB 1Q9OA 4J2QA 4P23A 5HHNB 5MI0B 1WPCA 3P9MB 2FGWH 2GT9A 4MVBD 2XPZA 3KLHD 2IWKA 4GW5A 1S3KH 4QRUA 4LCYB 1YN7A 3I6KB 4WU7A 4Y4HC 2VR6A 3VM5A 3TBYA 4PGBA 1FG9C 2QTVA 5EV7A 1AZVA 3IRPX 4IRJB 4DTGH 3L7FB 1KJ2H 1JZDC 5HVGB 2XTJD 1IGTB 1S3RA 5F0PB 2DV6A 2H0EA 3QDHA 3D51A 1NCUA 4NQUA 4Z7WB 4G11A 3MV7D 4UQBA 4PW4A 4P04A 4P5SA 3ECUA 3PU7A 3IGUA 5EF3A 1BG1A 2NQCA 4K71B 2C9AA 1CDJA 4ZRGA 1KYOJ 4GQ9H 1KG0B 4Y5XB 4RGNB 4UI2A 1U3ZA 4TVPH 1U41A 3GRBA 1VZGA 3S97C 5CEZE 1J0HA 1PYWA 1A7OL 3I02A 3WNMA 1A7NH 1KZQA 3ZBMA 1WLHA 1IIIA 5DJ0A 3TN0B 3ARGD 4NKMA 3VMNA 1BF8A 4OGAC 4L29A 3N2JA 5LCVH 1CGSH 4JFUA 4C56A 2X9WA 4WEMB 1A7PL 1IGCH 3QIBC 3GTNA 1R5WA 43CAA 4GXVL 4WV1B 4MNQB 4B9CA 3RFRA 2A9CA 3RZCB 2OI9B 2IMMA 1LO2L 3P69A 4TL4A 3WJMA 5JR1L 1OLLA 4YDVA 5I6LA 1W72H 4B41A 4JDEB 5FM5O 4RAVA 5JLZB 1N12A 1U93B 3MRBB 4JG5A 3B7UX 4HSQA 2H2PC 3ARDA 3E9TA 2NY4C 1NBYA 5F7EH 4XMWA 2DLFL 4JFFB 4C56E 2VJ0A 2R59A 1X5KA 3MYJB 3QQXA 1TQVA 5DHVB 2YGPA 4PJAA 4KKCC 3GSOA 3K6DA 3S5LG 3FQTA 2MQ3A 4WCYH 2WLJA 1B0RB 1WBZB 3C2AL 4YGVA 3O3DA 1GJWA 2J6EH 3IFNL 3GSQA 2OR8A 1T7ZA 2HWZL 1ID5I 3GI9H 1S9WA 4IOIB 3MHZA 4Z7UE 3LN5A 3UZQA 2QFRA 1FI8C 2BS71 1J8KA 2A38A 4WO0A 1FVEB 5F0JB 5J13C 1EEZA 2H0JA 5IVNA 3QQ3A 2VABB 1FDLH 4Z7VF 4FMVA 3HC3L 5TQ2L 4HIHB 3EH2A 3WIIL 1T83A 5D5ME 4TNGA 2FR4A 2P5ED 2OL3L 3EJRA 5J1TC 4RDBA 1PCSA 1ZTXE 2B20A 2VDQH 2PWFA 3NPSB 1I7TA 5JHMA 4ORGB 2IDUA 2QQNH 2WIMA 4WGWB 3WG7B 3SCMB 3TO2A 4LLQA 4KZ0A 2VDLH 2YMOA 4DPCX 3JQOB 1LE5A 1H0DB 5FDYA 3DV6A 1SMOA 4NX0A 1IUZA 1QW8A 3DDGA 4PMEA 3HMWH 5E2WL 4ZAKA 5I71C 2AVGA 3RDJA 2ED6A 3T1FB 1Q90A 3EYUL 1MY5A 2N3JA 2UX7A 5KSAC 4PS4L 1J1XL 2VMDA 5F1NA 3BD3A 4YBLB 2FYYB 3QO0B 4J6IA 4NPKA 4QXTB 4FG0A 1DQQA 2QVFB 4AMKL 2DYPA 5H94A 4XPFH 4YVUA 2UZIL 1LD9A 5BO1H 5C0BA 1JHTB 1L9MA 2D9QB 4IW4C 5JPMA 4JO8A 3L95B 1SVZA 2PR4L 2EIJB 4G5ZL 3MUZ1 1MUJA 1KY7A 4HIXL 3BQUD 4FTVD 4K8RL 3C2SA 4JZJC 4AGMA 2EUXA 3O3BA 2H6UA 4LU5H 2IWGA 3HNTL 4B3EA 3RTQD 2CK2A 2Y22A 2X2HA 4U0RB 32C2A 4HXBL 3RIAK 5HDQH 2WTOA 1ZSHA 15C8L 1L7IH 4C4KO 1E5UI 5B4MC 1UD2A 1F8TH 1Z3RA 3EJUA 1NUNB 4LLYA 3TZVB 5C0EA 1IU1A 3GS7A 3FRPB 2ADJB 4YHKH 1GW0A 2PYEA 3VACA 3QAZB 1NCBL 2OZNA 4A6YH 3VD3A 4FG6D 3C6SA 3O41A 3O6FB 4LL9A 4ZTOL 2QVMA 5KBKA 4GB9A 2J4WH 3GHBL 5EN2A 2YQ3A 3UX9B 2EDLA 3PGDB 1AHKA 4X2UA 2WYTA 3O4OB 3ATEA 1KJVA 2EEFA 4WI6A 1AGEB 5ANHA 3HIZA 5LBGA 3S3BB 1S7QA 3T2QA 3CZFB 4MCZB 4OBRA 3OXRA 5CU5A 2X9YA 3R7RA 1U8MB 1TZHB 1Z6JT 2DQDL 2G0KA 1MCQA 2NX5D 2WB1A 2H4EA 5CWSA 2PYEE 3JWDL 3WN5A 2FX7H 2H8PB 1XGQB 1KYDA 3KDPB 3QEQB 4P2OD 3FQRB 5DWUH 5KVFE 3B1TA 4FFWC 2COVD 1W2KT 1KCVH 3QBTB 3CVHA 1CICD 2FSEB 4L8CA 2J5LB 2ZXAA 4PJHE 3POHA 4NQXA 4MA1C 5EIIA 3W9DB 1E8ZA 2X70B 2YD0A 5LDSA 3TXAA 4FKEA 4XN1A 3U1SL 4GO8A 4MMZC 3CZUB 2FWSA 4UQAA 3VI4F 5ALBH 5DUMH 1C5BL 3FKUS 3C9NA 3V4VH 1URZA 1LE9A 1ZPLA 1Z32X 3GKWL 3FOLA 3DK0A 4X7TA 1DQDH 2Z64C 1IBBA 4I2XA 3V0WH 3SDCD 3CNKA 3AWFA 4HH8A 4TQIA 2MCPH 4JDZA 2BERA 2CR3A 4N1HB 4GKZA 1NIFA 4HX1B 4XI5C 3RI5K 1FNSL 2X0VA 4DGWC 1SY6L 2WXJA 4JO1L 1DJYA 1TJIL 4NI3A 1I9IL 1S8DA 2NNFA 4PJDB 3ZO9A 4HZLA 4Y2DB 3LD8C 5EA0H 4DOHE 5T3XL 4PJFB 1RVFL 2W07A 3OMNB 4NQSB 4P3CL 2BH0A 2VM9A 4HOMA 1UGNA 3F83A 5BV7C 4KHXL 4YSTA 3TCXA 1R34A 1WGOA 2CH8A 2Q76B 3NACH 1OGAB 2XWZA 3HVDA 1AO7D 1UEMA 4PWIA 3CUPA 3IDGB 4G8IA 1A65A 4CC4C 3WOVA 3BDYL 1TQCC 3L3DB 1MRDL 3VDBA 3BVWA 1B4RA 2X44D 2IALB 3GSNH 2ZQKA 4MBRA 5LJYH 4PRID 3ZDYB 5F9OL 1WQVT 2CHZA 2NUTB 3MLYH 5EU3A 2P48B 3TO4D 1TQUA 4CDHA 1CC3A 3MODL 1S7SA 3S5LA 1QHOA 4XXWA 3C5XA 3PG2A 2WBJB 4AKOA 4B95C 5TPWL 2YGOA 2W80C 3DBSA 2CMRH 5SX4H 5ESQA 1IAOA 4Y4FD 4D8OA 3DX0A 4NBYB 4ONFH 3MJ9A 2FLRT 5FKPB 5TK4A 4F58L 4AGNA 5TQ0L 2O5XH 2IH1A 1HNYA 4UINH 2CG9X 3IBEA 3REVB 4N87A 2BVPA 4MA7L 2X42A 4OZHE 4ZSOA 3CFBA 3NJMA 5F71A 4TKWA 1F4YL 3NA4A 3SYAA 1AG0A 1T5WB 5IB2B 4DK5A 4M9OA 3V5HB 4FHJA 2I07A 4FA7B 4PD4J 1E67A 4NNPL 3FULA 2W95A 3OD3A 3RWHB 1KIUA 3KYNB 3X1GA 1BFTA 2YQGA 2JH2A 4Q14A 3IGAA 2FB4H 5LAPA 5HI3D 2XN0A 4EZLA 5AD0A 1FYTE 4GRMA 1XH3A 1MDTA 4X5XB 3KBPA 3HRZC 5EEZA 3EBGA 3DKHA 5AOLA 2WXHA 5EU7C 3SJVE 2C1PA 3S4SB 1DFBL 4MGXA 4HLEA 3EW3B 4HCRL 5LBSH 5CHNB 4HS8H 2PYFA 3ILQD 1NMCC 3VXUD 3O6KH 4GSQA 3UZVB 4HJ1A 5GJTH 1MAMH 1D9KA 4N8CL 2HTKD 4AL8H 1JBJA 5I1AA 2HG5A 4WFGE 3E80A 4D0DA 1CFBA 3MBEA 1J86A 4RRPA 4QO1B 3T77B 2NW3B 1MCOL 2W9EH 4MHHG 2ZSVA 1SXZA 5DMIH 3CSFA 4S1DC 1WFNA 2DMGA 3IU3A 1OV8A 3QUKA 4JO3L 2X4OB 3CX5J 4CNIB 3Q44A 1U42A 2AEQH 3S34H 5D1XB 1DJZA 2BWIA 1QX1A 3K71B 1B0WA 4ZOCA 1FYTD 4FADA 3MUUA 3QUXA 5C0RL 1QTYT 2P24B 3DUHA 5JW4Q 4Y8AA 2BP8A 1W15A 1DL7L 3D39B 1ZWIB 3IJEB 2CKBL 3H55A 1JV5A 4OZGF 4G9FB 4AJ0A 5A2JH 1QRKA 3HPJB 5HVWA 3IFLL 5ANMA 3ME0B 1JTTA 4POUB 1R3JB 3Q01A 5AALA 3T4YB 4HWBL 5DT1L 3U9UB 1OAUH 1WT5C 4KTDL 2YMXL 1UA6L 4RGOH 3VNZA 3ZIMA 2DQTL 4EKXA 4Q4EA 4XZUA 1EO8L 5DJ8B 3QR0A 5TTRA 2V2XA 3MRGB 1AGBB 2CPUA 1YDPB 2J8OA 3QUZC 4QTHA 3QQDA 1SF5A 5CMAB 4QAWA 4XVTH 4E9WA 4MQXC 4ONGH 4TVPE 1J05B 3H85A 2VUKA 3DROA 3ZGHA 2ZCHL 3P0YH 4LCUB 1F6FB 5ANME 4GT0A 4DGIH 4X4MA 4FJ6A 4L0ZA 4DGVL 3AW5A 1A6ZA 1TO4A 2JKTM 3QDGD 2FWOA 4HAKA 5EC2A 1MFMA 3QG6B 5B1CA 4PJEB 4Z77A 5IJVA 2NY0B 3KXFA 3KWUA 5I1HH 2HFEB 2FHFA 2G75B 3K4AA 1NGPH 3DDFA 1GA2A 3F64A 2JB5L 4MX7A 3U36A 5FYLL 1N70A 3RKPA 2PUQT 4G8FA 2XQYK 1SXBA 4J8QA 4HOXA 5FUOH 1SLUA 1U8KA 3K3QA 4KJYA 4YDIL 4ZZKA 2ZKYA 4JPWL 2WKLA 3KYAA 1JHLL 1MIMH 2C4XA 1CFTB 1E27A 1NBQA 2QGDA 2JVUA 2H26A 5ICZB 3COOA 2EYTB 1X5MA 3V4PH 2MNWA 3KXFE 3LEXB 3BAXA 3N41F 3NMEA 5EH1A 3TWCL 3D1MC 1LK3H 2NW2B 1CF8H 3MLVH 1O6SA 4PRHA 3ZL4L 5LKNA 3TJHD 2WVVA 3IEAA 3L9YA 5FECB 4TVPD 3IPBA 2UX6A 3LHAA 4ZFOA 3ZE0B 3MFFA 2C34A 5DO2C 1NLBH 2BC4A 4XMLH 3ZRSA 4MB1A 1JWSA 4O51A 4UM9A 1HAWA 3WYRA 3FONB 1F86A 2HVJB 3UTZA 2WZAA 2NY6D 5I9QC 3EJTA 4ZTPH 1JZIA 5J4MA 1LDSA 3MCKA 2APWA 2DYSB 2PABA 5E8OA 4BRVA 4QAMB 2NXZB 1VGEL 2G3XA 4YHNB 5F6IC 4OFYD 3G7TA 3Q6FA 4PJBA 3VWKD 5D1QE 1CGXA 4XCNB 1SN2A 3LRGA 4X6DE 1RERA 5GGRA 1K6QL 4WKZA 3JUZA 3T0EA 2WQUA 4H0HB 1JL8A 1U3HA 1KJMA 2AXFA 2Q3ZA 4HDIA 2DWDB 4UU9A 4YZFE 2ADGA 1V3JA 2H6OA 3BW9B 1XCTA 1KPVB 5C9JA 5IJKC 1X7QA 2MQGA 4GKOA 1WUNT 1IM3A 3MRDB 5K33A 1XIWB 2NR6D 4AG4H 3LZQA 4ZMPA 2BWQA 5J0BA 3S3PA 2HPOA 4PTTA 5CJXC 1F2QA 5IMKA 1FVDA 3QEGH 4OTXL 3GM0A 4BZ2H 1OAKH 3X3GL 1LL1A 3UZEA 5DD1H 1M2VB 2R2EA 4GJTB 3L1OH 2E7MA 2WCGA 4FFZL 3P2DA 1PZSA 1JPEA 4KK9C 3RWCB 3F6JA 2DPKA 1JWUA 4BFBD 4DQOH 1AR1C 4WI0A 2WXOA 5D7LA 1J1OH 1G7QB 5B7EA 2OZ4H 3UFIA 1DVFA 3GQFA 4WQOA 4A6YA 2F8IA 4PJ5D 4P5TB 5I75C 4LBEB 1WAAF 4IBYA 1AMXA 1R3LA 1P6AB 5I66B 5D1QD 5LN8A 1FSKC 1Z9LA 1P4BL 4AYDC 4ERSH 2B8OT 1YNKH 1P9MA 3GD1C 1E5ZA 5D8JL 3BH9A 3QPXL 5J8OA 1HHHA 3QZWB 5HHVH 3UAJD 2NYYC 3WTXA 4ZS6C 4ZW3A 1J8HD 5DO8A 5D7LE 4HKJA 3X11B 1UD5A 4LCCB 4M5TA 4QHLB 4R84A 5F1IB 6TAAA 3TBBA 3HBZA 5C2BH 3FTGA 4DQAA 2Y07H 3BT2H 1MXGA 5B38B 5DJ2B 4IBUA 5J7CC 2DH3A 1F45A 3FCTA 4P49A 1MG2C 5KEZA 4I77L 1F56A 4HH9B 3CXDL 3W11C 2DQEL 5IMMA 3QFDB 3UJTL 2HLFD 4LP8A 2E7LA 5IBLC 1SRDA 4QF1A 3RBGA 3OKEA 2H41A 1SDDA 2DMBA 3FHAA 2CNYA 4G1MB 1BMGA 1FCGA 2Y36L 4HKBA 5FA4A 4F7PA 3V95A 4I0PB 3FS9A 4NO0D 1E3ZA 3ZKNC 5E6ID 2Q2EB 1K8DB 4GKSA 3PQYD 4S2SB 4UOJA 4R5XA 2KZBA 2VXTH 4MLIA 3TCLB 2ZIDA 3W2DH 1OEZW 5K39B 5I8KL 3RVXC 4UQDA 4GS7B 1DVZA 1G94A 4D9RE 5BV7H 4ICXA 3REWA 4TTGA 3PABB 3BVUA 3MREA 5E24E 4Y2OA 2EDXA 2RCSH 5DVPA 5KS9F 3ULVC 1CDCA 1FE8L 5E0QA 1WP6A 4UV7H 1B2YA 2E3VA 3BGMB 3KH4A 1L3NA 2XWRA 2X4QB 3CHSA 1TYJA 3OR6A 4KK8C 4YSSA 4HIIB 3HZMB 4NO3A 2R0KL 1NCHA 4PJGB 2RGSA 3I9IA 5DVKA 1RXLA 4M43L 4PTUB 2KKQA 3GSNA 4BEIA 2R0WL 1CD1B 2YEQA 3NIDF 3QQ4A 4JFSA 1MZYA 3NCBB 3HI5L 1FO0L 1CDYA 2R69H 2A4ZA 3WO4B 2JKWA 1EIBA 1OAXL 4I1RA 1CT8A 3HC0B 3NJFA 3HJ0A 4NAJA 4P5RA 1JNNL 4OU3A 1BREA 2Z31B 1QA9A 1GH7A 4Z7VE 3BE1L 3F12B 4HKXA 2XQBH 4E41E 1SJEA 2PW1A 3B6SA 4G1EA 2J7LA 4CU7A 3W5NA 4C4UA 2P46B 4PGDB 3TVMA 2GFBA 2AK1L 4P9ML 5DK0A 1E43A 4Z5RA 5JA8B 3UYPA 3W5MA 4M6NL 4X6EA 3BPNC 5ELIA 5LXVA 2XQ0A 2LV4A 1A2YA 2FIKB 3F7YB 2Z91B 1D7FA 2B39A 2XT1B 4KX9A 3GK8L 3BAKA 3GMMA 3MRMB 4UNVA 1FZOA 3GJFA 2MHAA 4FXLA 3NIFF 3DETC 5FYKH 2HUHA 1BWWA 2WYHA 2BY3A 3L3GB 4RFOL 3VXTA 3BFQG 4O02H 3B2UC 4WWKC 1Y7VA 2H1LM 1P4LB 3SOBL 4D0BB 1Q9LA 3O45B 3P2TA 4PJIB 3SBWA 2J8UA 4HFWA 5EF2A 3OZ9L 2WOYA 4F8PA 4PY7B 4NRZB 2AC0A 4M1CC 4E9LA 4OJYA 4W9ZA 3P54A 4LOFA 2R2CA 1QPXA 1MCPH 2WZPA 1CO1A 4G6JL 2EDQA 1U95B 1N4XH 3EUUA 1M6OA 1UT9A 1H8SA 1B88A 3HG5A 4L1TA 5CS7A 1OGTB 3GGWA 4E41D 2VL5A 4N86A 4NZTL 1EJ6A 2CE6A 1OF2B 2XX1A 3VRIB 3QNYA 5L88L 3NCJL 1UOVA 4LFHD 5GGSB 1GOFA 3GNML 3LSOB 4NBZB 1U8NB 1XH1A 1AE6H 1KYFA 3D3VB 3NZHL 3F7VA 3QPQC 4PV9A 5D7KE 1G7IB 5DS1A 4URTB 3MLSH 4NIKB 4H7VA 1FVCA 4W9EC 3QNXA 1IE5A 2CGZA 3D34A 1K9TA 5ADPL 1I8MA 3U0PB 1PX8A 5TD4A 5B1JC 2CHXA 3P30H 3C8KB 4OLVH 1BJ8A 1RIVH 2DMCA 5D6DA 5IB1A 2YC1B 3DURB 3R8QA 4WO4A 5F96H 1H9DA 2AMGA 5HDLA 3T2NH 1TT6A 1Z5HA 1OIOA 3EZJB 4KUCD 3VI4A 4I85A 3IJHB 3DO3A 2QSCH 3N6YA 4HCIA 4H25B 4U6YB 4MZ2A 3NSXA 4NXSA 4J3OF 3HZVA 4XVSL 4OM1L 4YAQA 4GG6B 4AJVA 3SGJC 4E42B 1U58B 4KHTH 4IS6A 2X3AA 2ZG1A 4RFEB 4NQDA 1MAKA 1URLA 3HHSB 2G9HB 1OCWL 3NZUA 3O4LB 5I74C 1LVEA 3SKJH 3VI4E 4PJCB 3VQMA 2R56H 4L3EB 4U3HA 2DMKA 5IG7A 3WLWD 2ADFH 1YMMB 4X99A 3CSBA 3DJTA 5HYJB 2H3XC 4W9FC 4DESA 1I82A 2ZNXA 1UOWA 2H1PL 1F4WH 3SIKA 3DVGA 3SO5A 4WU5B 3B43A 1URIA 1AXIB 2BFVH 3CTTA 1PKQE 4Y4HD 2MOGA 4MZRA 3WLBA 4X0KB 3H3KA 4B50A 1EMTH 3M88A 3BP5A 1CI5A 2NQDA 2OQJB 1RHHA 4KH9A 5D55A 1U6AL 2YN3A 4J23A 2F5AH 4N20A 4OZ4A 1NC4D 1D5BB 3QJVB 1CPUA 3WSQH 2CUAA 5DK2B 1NFAA 5FM8A 1UT2A 2E9GA 5KYNA 1JMXA 2IAMB 3IXAA 4KU1A 1OWRM 3QNZA 2CLVA 4DN4H 3CFJA 3B7RL 2A73A 4Q56A 2QMKA 4OIBA 2BVTA 1DUZB 3ZHLA 5ID1B 3KVPA 1ZJBA 1ET7A 1RIHH 1U21A 1XT5A 1ZSDB 1A4KB 2CNZA 4TQEH 1CLOH 1O6VA 1E9PB 1OE3A 3B8SA 4KNSA 1MCIA 3E7JA 3H53A 4I5BA 3QIBD 3PWPA 3LPPA 5C3TA 1UGKA 2XLLA 3RPKA 2CBPA 1Q1JL 2VSMB 1TZGL 1NKRA 3MLUH 1MRFL 3ML9A 4NUJB 3LEVL 3TTSA 3ERXA 4A67A 5I1KL 5IJCC 4P5KB 4B6ZA 4NZUL 3WD5H 2VLJB 4XCYB 1JPFA 4BXVA 4XMKL 1EUTA 3UYOD 2PO6B 5GIRB 5EOCL 2FEJA 1S7TA 2DDQL 4FRWA 1BD2A 1QUNA 2DWSA 5TE4H 3ZYIA 5AAMA 2GTWB 2HJKA 3CBRA 5HHMB 2X9ZA 2BHUA 4YSDA 1WIOA 3B9KC 1BJ1J 2EDOA 3FF7A 1ZA3B 3L7EB 2ORBL 5JO5A 2VJXA 1HKFA 4JQVA 4KKCD 4LSTL 1QRNB 4Y4KB 5JDSA 3TPKA 4Z3TA 3OX8B 4OF3A 3STZA 3MBWA 4OCRH 4ACPA 3HS8A 4WRLA 2GAZB 3RB5A 1GW6A 4BZ2A 1AC0A 1ZLSL 3UROR 4PRBB 1KGJA 5E08L 3DSFL 4U1KA 2R51A 2XFGB 3QJHB 4GSUA 1IBHA 5BZWB 2HUEA 2F08A 5DYOA 2Q5BA 2OSYA 1F3DH 4XMUA 3PS6A 1KIRB 2IO5A 4L4VD 4I3RL 4ENEC 1QR1A 4M1DL 1S5IH 5E6ZA 1H8NA 3FOMA 4YPGA 1YY8A 4OZGA 2VDKL 4MJ6A 4L8BB 4L23A 5CN3A 3ULVL 4H1LB 3FT4A 3EFFA 4NNXA 4WI7A 2OK0H 3IN2A 4YJZL 4FERA 5GISH 1L0QA 1TZ8A 3X3FH 1MNNA 3WKMH 1IL1A 2Q7YB 2DM4A 2WZ6A 3UGUA 4J3OH 4HIPA 3U7WH 5GZNC 3FFOA 1JGLL 1MREL 5CFAA 1IC5H 3VXNB 2ZJSL 4LSVL 5FHAL 4OZGE 4KI5F 5IIEB 1DN0A 3HAEH 3VI3B 3JWOL 5J9PB 2Y1AA 4FQ1H 2P8LA 4ODTL 1IE4A 4XAWL 1NH6A 3IYLW 1EO7A 2XXCB 1G5AA 3DO7A 1N5YL 3QHZH 2R4SH 4Z3EA 4R97C 1PJWA 3BCDA 1MJJA 2V9RA 5GGSY 1YA5A 2UY7B 2WWMD 5FHBH 2BRQA 5IWLA 4Z8FL 2ADIA 1QTPA 2VQTA 1HINH 3F8UB 3MJ8A 4NLHA 5MENA 2FSDA 3TBSA 4HUCA 1EBAA 3M1BB 1FV1A 1YAIA 1LM8V 2NY1C 4MJ5A 5B4MD 5KN5A 1O7SA 1MW3A 5CZVH 4YIQB 4LLMB 1A6AB 4AYFB 2Y7MA 3MGOA 1I3RA 4XTRD 2F53D 1NCDL 4N0CC 5GZOD 3KL0A 1F1GA 4MJ4A 4P2CG 4PJ9A 1T4KB 5J1AA 1E5BA 3QYCA 2EDYA 1MWAB 5ES4B 3V5KB 3VWJC 4X6BA 3GSVB 4XNZC 3RVVC 4QHNB 2IV9A 2EVHA 3JV5A 1E2VA 3CDZA 2D0GA 2F5BL 1A1NA 1IBGH 2OMVB 2PP9A 2VR3A 3RIFF 1W0WB 2CJTA 4BFFA 4J3BA 5AW0B 3ECVA 1GIGH 2EEAA 3MUGB 2DIBA 4HZAA 4C83A 3LZLA 4NKOB 4WHTB 2FL5A 4TSAH 1AS7A 1OAZL 2CRIA 3MOBL 2F7IA 5MI0C 2R27A 1TEGA 2BSSA 5F89A 2Z4TA 4HOWA 2DYRB 2FD6L 4FFWD 3WGUB 1XH2A 1WGVA 5C08E 1BX2A 1INDH 3H42L 4EDWH 2FWUA 4LPVA 3LN9A 3V7MA 2GHZA 5D93B 3MA7A 2BIIA 1N8ZA 4UDUB 3V0AC 2ZNWA 1QSVA 4FL4B 3MV9B 5L2KE 3A21A 1XV8A 2NY3B 3GBML 2D2OA 4OKDA 3AC0A 4HT1L 1LO5B 5EZOH 1SJMA 2A74B 2QGCA 2VERA 1DBJL 4LSUH 2DTML 6FABL 3HUJB 1HAUA 2N7BA 4Y5XC 3EGSA 3LOWA 5HHOE 5DLMH 1OPOA 2X2UA 1ZE3H 3D4CA 3DWTA 2ICES 3C60C 2EDBA 4LLUB 2OKMA 3SPVA 3FU7A 1CDGA 3A6CH 5IGXL 1A1MB 1P2CB 4KK5C 2NZ1A 4O02A 3FO0L 3LB6C 1IKNA 1J9SA 3VGGA 3BZDA 3X12A 1JPTL 3V7AG 5TDOA 3MC0A 1U8LA 1LNUA 4IBVA 5D6CA 2OMWB 3STBA 2K6YA 5EO9B 4KKZA 3E2HB 1OO2A 1WFOA 2JELL 1WSST 5J1SC 4G8EA 2R4RL 4M5ZH 1QLFA 2LU4A 2F7RA 2P52A 5DJYA 1T2QH 5C08D 2ZUTA 3WEBA 4Q9CA 2QR0A 5FM5M 5IREA 5FYKE 1CWVA 4NCC1 1RKRA 4J3OG 9CGTA 5I24A 4L05A 2VDRH 3L9BA 4IJ3B 4OT1L 2VXSH 5D1ZD 4GMTH 3SD2A 5L2KD 1T89A 3V0HA 2CSPA 3U2SB 5HJ3A 2CK0H 2WQAA 1FLTX 1OLZA 2XICA 2FX8H 3HAEG 4ZPTA 4OJFL 1ZHBA 5A2KH 1UWFA 3UTTD 2ESVB 3BH8B 2F54B 2E6QA 2UYLA 4TNFA 1CTMA 4B9KC 4ZW6A 4ZW5A 5J11C 1J5CA 5C7XL 1EHNA 1BVOA 3F7PC 5INCB 1WAAE 4LHUB 2GUOA 4JFTA 1O9ZA 1C5DB 4AC4A 4MDIB 4NO5B 4TN9A 4XNAA 3EXJA 5BRZA 2A4EA 3AT8A 1RJZA 1XR9A 2V7NB 5EUOB 1GTNA 1GHFH 1OTSC 4Z3GA 1PNDA 3E3QC 3FQXA 4Y19D 1IJNA 3WEOA 1G7LB 2C1OB 2FE0A 2BVEA 4O5LL 4P48A 4W9CC 5BQDA 4BXSV 3FFDB 5C0AE 1T0PB 4HVBA 5D2NB 1CYWA 1QAWA 2J73A 3QIUB 5AW9B 2XWTA 5KVEE 2GKIA 4U7SA 1I1AB 3C09C 4DETA 3NCYS 4XCFH 2YPLA 2GQHA 3S8FB 5IUSA 5CBEA 3E6HB 4BUHA 1RIUL 5BRZE 1YEIH 3VQ1C 4NRXB 5BS0B 5KYYB 2COQA 2CO2A 3LNIA 3OSKA 1KB3A 3BSZH 4YX2H 4GBXD 3D0LA 3VAEA 3VA6A 3IN0A 5KS9A 1AY1H 4OZFH 5K9JH 2E59A 3QYNA 4XNMB 4ESKA 2IQ9L 1UOKA 3C6LB 1NZRA 4AE1A 2CRMA 5T33H 2EDHA 4JFVA 3RDTD 3O0RH 4D8PA 4ZX3A 3TYFA 5B3SB 3NZ8A 3WTVA 2EYRA 3T2OA 4FQHB 2XRAH 4LARL 3EOYG 5EU6D 2GB2A 1RLBA 4L37A 2VDMH 1BOGA 3T0BA 3II2A 3GRWA 5IOPA 2EDNA 4HWUA 4XN2A 5E03A 4TUJB 2MEJB 5IW1B 1AYOA 3LNGA 3KW7A 5KS9E 3C8DA 1KCRH 5C0AD 2FYVA 1CLYL 3O3AB 4BK4A 2R2BB 2EILB 4UB0L 1HJCA 1E9QB 3KD4A 1Q9WB 2WC7A 5AZ2L 4B0MB 2BIPA 2R29L 4E9VA 4EBQH 3TM6A 2P47B 1NSNH 2I27N 4IRSB 3A6BH 3SB3A 1PLCA 3QAZC 3FT2B 3NIDE 1MF2H 2EUZA 3VXSB 3ECBB 3QJTB 4WWPA 1WITA 1J48A 3O6FC 2BIHA 4BINA 4B96A 2LT9A 3LRSB 3WHXA 4NN5C 2W94A 3CZKA 4XHQA 1CXFA 5DHYB 1MJ8L 4F8LA 1IMHC 3AMLA 4DEUA 3QHFL 4FAAB 3O4OC 5CP7B 2XHNA 3QUZD 3W38A 1NKGA 1G6VK 1CTNA 2ZUSA 4Q9QL 1XTMA 4H5SB 1B4LA 4MQXD 2V6HA 4N2IA 4R7XA 2MKWA 3O8XC 3FN0L 4NM8H 4ODBD 3JV4A 4Z7WF 1IB5A 3LXBA 4HC1L 3KHOA 3EYVA 3TFBA 3MUHL 3BXNB 3CSTA 1AG6A 4AEHH 9PCYA 2KDYA 2IF7A 5E00A 1KEGL 3EYOA 4BZ1L 1THCA 2W0LA 2GBUA 3S3SA 1IEAA 3NIFE 1CE6B 5KWYC 1NL0H 4MCYB 2XBDA 3NFSH 4LASH 4OLWH 7FABL 2FT7A 3KLSA 3H3PL 3GPSA 1ZS8A 4BRJA 4N9OB 4ODUA 4P9HL 4F7MA 3RVWC 1JN6A 2WTRB 1BZ9B 4P4KC 1NTDA 4PLKC 2OP4L 1SDYA 4PJ8B 3VFTA 3O9WB 4XNQA 3QWQB 1TQTA 4NZRL 2Z4QA 2GJ6B 2Q6WB 2EQDA 5D96C 3GIVB 4X7DC 5KBMA 1ZT7B 3M17B 4JQIH 3BWUF 4G42A 5D7JD 3TV3H 2ZWZA 4JLRA 5KTEL 4DEPB 4B9GA 25C8L 2WW8A 4Y5YB 4OGZA 2Z1KA 1S4IA 4FZ8L 3SPCA 2CAKA 3BIKA 1E65A 1N9PA 3NN8A 2AJ3B 1B90A 4Y2DC 3X1BA 5DO2D 5AW3B 4M5YL 1QLEH 4WEBH 1IGFL 3IKCB 1VFUA 4J12A 2DRUA 4M8QB 1UWYA 3SKOB 1JRHH 5C0IB 2QHRH 4LSRH 1TJHH 3OM3B 5HYQB 2YEVB 3S37L 1OB1A 1HXMB 4OZFG 3V6BR 1PZUB 4M03A 3V7AE 5EN3A 5FCSH 2YQ2A 4YDMA 4HBQA 4AQZA 5I1JL 3MAWA 4M6OL 1SMDA 1QPPA 2H32B 3ZR6A 2WBJC 5HHQB 1X5IA 1YNTF 4K3DH 3QORA 1AZZC 3IVKB 1A3QA 1FZJA 1XGYH 2BNRA 2BW4A 1UJTA 3BAEL 1LILA 3HG1A 3MA9H 3NCMA 1X5ZA 4UM8A 3HB3B 4QRSB 4W9JC 1E6JH 1UKSA 2D3LA 1T3FA 1IV8A 3ARFA 1ZDQA 3C5ZB 3DRTA 3TBTB 1OAYH 3DOSA 5DRNA 1BQ5A 4WW1A 1BFVL 5CCKH 2Z7ZA 4PY8J 2P5EA 5M7QA 1AR1D 3B5GA 5DJDB 2H2SC 5IMOB 4IMLA 2HKFL 4M02A 4M7LT 3KWWA 4PV8A 3DUSA 5I2IA 3OKMA 3EYFB 1KB5L 2UZYB 4IYKA 4JRYE 1ZIAA 2EECA 4K94H 5EFIB 1RU9L 3S48A 3ROLA 3HG1E 5I17A 4H8WC 3WNIA 2YSTA 1MCRA 3MRPB 1ZLVK 4YVNA 5IFJA 3GMNB 3FB6B 5DD5H 2AERT 3EHBB 4GUPB 3AABA 5ENWB 2DD8L 2PR9A 1FL3A 4ZFFA 4F9LC 5IT2L 1X5XA 4R26L 3WN6A 4JFXB 5E1QA 3DPDA 3MACH 3TH2T 4DKEH 2NYYD 4ZS6D 5AB1A 3SDXB 5IB3A 1U8PA 5EUKB 4K5OA 2IDTA 2XG5A 2Y7OA 4ODHL 3ZU8A 4EEEA 1YYCA 3JTSB 4G5AA 4MMXB 1T20A 4FQXA 4GUOA 5L2JB 2EE3A 1S7VB 5A6MA 2K6WA 4J3OD 4M3JA 2N01