4LBAA

Crystal structure of a conjugative transposon lipoprotein (bacegg_03088) from bacteroides eggerthii dsm 20697 at 1.70 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
106
structure length
106
Chain Sequence
SYPFTVEVMPVPNKVVKGQTVEIRCELKKEGDFSGTLYTIRYFQFEGEGSLKMDNGITFLPNDRYLLENEKFRLYYTAAGDEAHNFIVVVEDNFSNSYELEFDFNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords conjugative transposon lipoprotein
publication title Crystal structure of a conjugative transposon lipoprotein (BACEGG_03088) from Bacteroides eggerthii DSM 20697 at 1.70 A resolution
rcsb
source organism Bacteroides eggerthii
total genus 22
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2410 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4lbaA01
2L3BA 2L7QA 4LBAA
chains in the Genus database with same CATH superfamily
1XF2B 4WUUE 4UF7C 1HL5A 2A9NH 4GB9A 4MQ7A 2XA8H 1DVSA 2R1YA 3TWYA 2WZAA 4FFYH 2IPTL 3CXDL 4OJEH 5A43C 4N5ED 4L1DA 5KS9E 4K5PA 3VDBA 1KENL 4DZ8A 1WZAA 1NOFA 1T6BX 2GHZA 4Q6IC 4L9DA 3RWFA 4DAGL 2XN9E 4NNYA 1OE3A 3WEXB 3SGJC 4BZYA 4IU2B 4PJ7F 5C0BE 4UQEA 3FKUS 3SGKA 2WXHA 1XF3A 1X7SA 3NH7L 4I18C 5D93B 4YXHL 2HKAA 5I1DB 1F45A 2DWXA 3GMPA 4HJGA 1B88A 2IOOA 4CUCA 4Z5RB 3NRQA 3UPRA 1UCBL 2OCFD 3Q05A 1UGKA 4PW9A 2E7LA 3IDYC 3VXMA 4Z0XA 4EN3C 4B0MB 4YHMH 2E5EA 4QAMB 4G7VL 1QR4A 3PPEA 4PRHE 1FH2A 3LPWA 5LAXA 3HE6C 5FUZH 5FYKL 2XV6B 4A1RA 5EULV 1FZKA 2A73A 3E9TA 2JCCE 4M43L 4AL8H 4AQAA 1NFIA 4PJXF 1JTPA 3MQIA 3H55A 3IDIB 3QEUB 4A7GA 1OALA 2EE2A 2ZNXA 3MLWL 3EYOB 3ULVC 3EGXB 3AJ7A 4FQQB 3H9ZA 4MMYA 5JIIA 2NX5B 1JVKA 3Q9QA 3W9EB 2JKJA 1A1MA 4HEME 3KZ8A 1DBAL 1Q90A 1KJMB 3LKOA 2OM5A 3HI1A 3C2AH 1ZKAA 2CBTA 2OMWA 1CDIA 5IM7A 2IPUG 3CN0A 3MLVL 1ETA1 4NLAA 4I0PC 1DQDL 1ZOXA 3K5SA 1M1XA 4L4TB 3QORD 1FFNA 4J3UA 2JWYA 3MBXH 2XTJC 2YRZA 3D4ZA 2J5WA 1W72H 1ZSDA 3LXBA 1CFQB 3N44B 4XPHH 4DP4X 5EEWA 5GRJL 1F4YH 4N2FA 2AJZB 3S98A 4O02H 4AMKH 2BNUB 4QRPD 5E2TL 5E8OB 2CBMA 3O2VH 1Q1PA 4P4RB 4IMLA 2KERA 4JHWH 4DVBA 1B9ZA 4HD5A 2UZYB 3P9MB 3SQRA 4G6KH 2APVA 5D1ZA 3TBCA 2BNRD 3K6FA 5ITFA 4QI3A 4YHZL 2JIXD 4NSKB 4FMVA 2AXJA 3C6SB 5I73C 2VAJA 3WD5L 4G7YL 3KE0A 4XNYL 2DB8A 2Y36L 2P42B 5CUSL 3RA7H 4YDVB 5E99L 4N0FB 2CGYA 3B8YA 4XPTH 2DLGA 4GIPD 4HOMA 1D7CA 2NY3B 2F8OA 5AAPA 2WVSA 4YWGH 1MXDA 3E7JA 5A6LA 2W81C 1LO2H 4OD3H 1KYOK 1GAFL 3UTPE 2XFXB 1YECH 3GSNB 3H9YA 1KJ2H 2ZOUA 3WNKA 5HHQB 2OJEA 3LDBC 3MDJA 4HH8A 2FYVA 3OZLA 5BZWB 3RRQA 5T1DL 2VABB 2ESVA 3CWGA 5FK9B 1K4DB 5F93C 3X14B 4JNXA 4L3CA 4GO9A 1I1FB 1RK0A 3GEWB 1X3DA 2MCMA 2R59A 2VLLA 4EF3A 5C6WH 2P5WD 4CU7A 4PJ8A 4NQDB 5IESH 3NMEA 2PN5A 1X5ZA 3HFFA 1JZ5A 3QWQB 2NSQA 1I31A 2DQJH 2NSMA 5FYJE 2XZZA 4RFEA 2EABA 1HOCA 4Y4HA 1I8KA 2OQJB 5DRWB 2GJ6B 1BP3B 1PZSA 2EE3A 3SE9L 4ACTA 5HGBA 3IMSA 1A21A 3VWKB 2GIXA 5CHNA 2GEQA 2IC2A 3IDNB 1F58H 5T5FH 4WNQB 1JPSH 4NI3A 3EYVA 1HFUA 2IFFH 5AZ2L 5DD5L 5DK2B 5KVGH 1TLKA 1GSKA 1CK0L 4FQJL 4E2OA 2VW6A 3X1BA 4PRBB 1A7NL 1BCIA 1MVUB 3C8KA 1EEYA 2OULB 1QR1B 4PJEA 1I7TB 2XQYG 2B1AH 1DBBH 5IQ9A 2CA4A 1PL3A 1IAOA 1S7TA 4KKNA 4LSRH 3RPKA 4ZQKB 2YD9A 1E67A 1OAUL 1DQLH 2FQEA 3PL6A 5D1QD 4WHTA 5FLUA 4Q8BA 1IVTA 4TSAL 5I76A 2EIMB 2Y07L 4ATTA 1A0QH 2YPLB 3APFA 3EUUA 3QEHA 1J1XL 2ITDA 3PAZA 3S3CB 1NPNA 5C0CB 3GSVA 1J18A 4XB7A 4WV1C 3E8VA 3FCTA 3V9EA 3KDPB 4F27A 4GY4A 4ZZKA 1DE4B 4EJ1C 3QQNA 2A2QT 5AYUL 4NP4L 2IH3B 1T89A 1QWNA 5E70A 3QO1B 5AKSA 5AW2B 3M8OH 4IEFB 4PREB 1JF1A 4JCWA 2ZWZA 2BSRA 5TDPA 4I3RH 3WXWH 1RUQH 4TNVK 1XR8A 2NY0B 3GB7A 1XT5A 1V7NL 3PV7A 3H7BA 4O51B 3P11L 1PYWB 4FTVA 6FABH 2WLZA 3UTTA 4IOIA 3TWCL 1UT9A 4U1JA 4RESB 3RZWA 1O9VA 3FDWA 1H3GA 2GABA 4TL4A 2OTUA 4FFVD 4FLQA 1N0XL 3I75B 2NCEA 3MJ7B 1F6LL 3MOBL 4V2BA 3L95B 1IM3D 1MWAA 4K55A 1OQOA 1AY1L 1DJIA 3MTXA 5E94A 3OPZL 5CIPB 4BUGA 4ALAC 3IGAB 2PABA 3NIFB 4L3ED 4WW2B 1KT2A 5J6SA 2H6PA 3FNKA 5HPOA 3WNMA 4RBPK 4RAVB 5LGHH 1CDYA 4AT6A 2EH8L 1FI8C 1ZE3C 2CO4A 2YN5A 4FXKA 2KDYA 4X5PA 5C09A 4ZFFB 2GJPA 1DVTA 2BIPA 4CC0A 1HWGB 5KBDA 4AE1A 2FL5B 2J44A 5DU7A 1D6VL 4BK4A 1NC2D 3D48R 3G3LA 3P0GB 3CXHK 1GOGA 4D0CB 5CSZA 3MRQB 4C58B 3F7LA 2XWTB 4WKZA 2ZWLT 5FA4A 2ADIA 1S7UB 2X70B 4NOFA 4AVKA 5JZ7D 2EKJA 1UUSA 3FQNB 4CVXA 4BRJA 4DN4H 2AJUL 4LARH 5HJDA 3ZN6A 2G5BB 3NCJH 2G2NA 2VQ4A 3ZL1A 2ZAIA 1CE6A 4L37B 1I7UA 2OCJA 3ZU8A 3IKCA 2FECL 1BX2A 2DTMH 1FNGB 1BZ9A 3A5VA 3GSOB 3QQ9C 4ZXBC 4IJ3C 5JPMA 5FUOH 2MHAA 3GBEA 1OGTB 1XIWB 1CFMA 1RVFL 1IQWH 2VO5A 5C07D 3UO1H 2DJ4A 3NJKA 4U6YA 4POUB 1TCRA 4QRBA 1I9RL 1YY8A 4Y16C 5ACZA 1DSWA 3G6AA 1FL3A 3CH1A 4FKHA 3BT2H 1IB5A 4FP8L 4OGQC 2ZXWB 2X9ZA 2ZX8A 3QHTC 4HWZB 4QEGA 3G5VB 1XSIA 4XGZA 4HWEH 5CILH 3KPMB 3VFWB 3GSQB 4NZ8A 3WKYA 1KCVL 2B39A 4DZBB 5T1LA 4L9LB 1MRCL 2XLLA 5C0EB 3SOTA 3ARSA 2FQDA 4ZTOL 5JW4R 2WUBL 3H3PH 1AS8A 1M2VA 3NN8A 3FXIC 2JKXA 4LQ1A 3TIEA 1LO5A 1S7VB 2DV6A 2I07A 2Y6SC 3GIZH 3W0WD 3GSNL 4YZWA 3GK8H 2J25A 5TE7L 2NY6D 2ADGB 1WBYB 4LSSL 2RALA 2DI9A 4X5WA 5G4MA 4WGVB 3CNKA 4PJ5D 4FG6C 3P4NA 1DQQA 2F0CA 3WUWG 5C0NC 1MCWW 5IEKB 2X12A 3NEEA 5L8KB 3QULB 4UYQA 1U8NA 5IVXF 25C8L 1HJBC 2ZSVB 3CTTA 2F53B 1OAJA 4ILDA 2WWKT 1U8OA 4IRSA 1IGCL 1IT9H 1VFAB 2GUYA 1A7PH 3CFEA 5T1MA 4XO3A 2YXMA 3MRIB 4HPYH 4HUMB 1OP5K 2PWGA 4JE0A 3HR5A 4GAFB 1GGCH 3O3BA 4PGJA 4AENB 4ENED 4YGVA 4JHAL 1PSKL 4ONHB 2ZCZA 5C0FA 2VMFA 4X4XB 2CM6A 3QEGH 3P3TA 4RZCB 1WJ3A 1KBPA 3MYJB 1Z0NA 4XMXA 4YSTA 2VM4A 4F57L 1ZEAL 3GHEL 3RUGE 1F42A 2NZIA 4NQEA 4NQCA 4NC2B 3OKOA 4ZPVB 3CN1A 5AVYB 3QI9C 4G8EA 1NMBL 1YPZA 1JPFA 4N68A 1EO8H 4HAFA 1EVUA 3ULSA 2KH2B 3MV7A 2DWTA 4NN5C 4HETA 5DFWH 1MW0A 1T6VN 3EG9A 4WSJA 5J57B 3VFMA 2NZ9D 1XGYH 3L4CA 1MJJA 1UJTA 2A6KA 3IXAB 4H8QA 2WMPA 2OJZL 3IAGC 2YD8A 3LRSA 4LEOA 5AVRB 3OAWA 4BGLA 4NAJA 3ENEA 1HKFA 1U8QB 3AZUA 1SXZA 4K8RL 5BNXD 1LLAA 4U1IB 1URZA 1A6PA 1KGJA 1KIQB 2V0AA 2D7TL 2PWFA 2YPVL 3BUDA 4KAQL 4IHBA 4M6OH 3U1QA 1G7QA 3U9PL 5SWSD 4OLWH 2ZKWA 2XETA 3MKKA 5E4IA 3Q43A 3VRLF 3WELA 4OAWA 5I75B 3QCTL 2DQ6A 2AAAA 4OZ4B 5IBUG 3U4EB 1I1YA 3ZE2B 1U93A 4ZOBA 1JYWA 3BD4A 5IJBC 3VFGL 5I16B 1H19A 3U6RB 4A2LA 3VD2A 1Y6NR 4KXBA 4ZX6A 1R3HA 1JZ7A 4YOKA 1WZ1L 2VXVL 3VWJB 4QOKB 4XR8C 4AYFA 4UOQA 5AKTA 2WUCL 4MMZC 4DO4A 1FBIL 3KBFA 1ZLUH 1LO0H 4TTGA 1G7JB 3LKQA 4X6DF 2W60A 4EIZC 4ZUUA 3VFSA 4JN2B 1QKZL 4G1EA 3FQRB 5AALA 3CLEL 4LSQL 4OBRA 2V5RA 2MCPH 4V1DD 1HEJC 4MD5B 2NTFB 4QXVA 3MROA 3NCXA 1HN1A 3WYRA 3QG6A 4JEGB 4A68A 4IRJA 1PIFA 1U95A 1CLZL 4EVNA 1E5ZA 1FLTX 3EFOB 5LHDA 4QWWC 3MN8A 3P2DA 4UANA 3RI5K 4LVEA 2J2ZB 4JQXA 4Q9QH 1UWGL 2Z7UA 2VLMD 2F58H 4TN9A 4KV5F 4RIRB 4PJGF 5C3TA 4HKBA 4TQPA 5I2IA 1F86A 4O2CA 4H25A 4BFIB 2WIIB 2ZP0T 2XWBB 2AKRA 4LPVA 3FTZA 3SDDA 3DX6A 3Q6FA 3Q8EA 4LCUA 2X4RA 1BHGA 3HN3A 3ZTCC 5DJ0A 2AGJL 5KG9B 1VFOA 2IALA 3CVCA 3MA7A 4ZQTA 5D7LD 1CVSC 3D52A 3OKNB 5FX3A 4ZMVA 2C1OA 3EKCA 1XX9C 2JSFA 3CFUA 2X89A 1BF5A 3KM1A 1Q1JL 4DPCX 5HDBF 2EYRA 2ZIDA 3KGTA 1D2PA 4PWGA 1PBYA 4U1GB 1G1YA 4M1CC 2A6DA 3ECQA 2FWLB 3VD3A 1DN0A 1ID5I 3SKJH 1IC5L 1KYAA 4E42A 4IK7A 4JR9L 5ID0A 5GSVA 1TJHH 2CUAA 3AW5A 3S8GB 1BVOA 5DVMA 4PJBE 2XKSA 4NGHL 1SFHA 1CGSH 2TSBA 3HRPA 1FVCB 1N10A 2LV4A 4E41B 4NYLB 5DJ6A 4H8WC 1JPTL 1MH5B 1NGPL 3GSWA 4U3XA 5D7JB 4DEPC 2ZTBA 4AIOA 1NBVL 3TO4C 2XWXA 4IBSA 1R5VA 2WANA 2VQUA 2OFQA 2XBTA 2VWEE 4FYSA 5KJ7E 3BKCH 3QDME 2R4RH 4IDJL 4O5LH 1AMXA 1A1NA 4P46D 4UTBH 1YJDC 3FCGA 2FT7A 1XCTB 3G04A 4WO4B 3DUUB 5K9JH 3NCBB 3F05A 3NACH 5EBMB 2PXYA 4EOWL 2WB1A 2YFNA 2G3ZA 1B4RA 4BFRA 3F3HA 1XGRA 5CU9A 4OCSL 4XVUC 4J3TA 2PPDA 4MAZA 3CN3A 2BVOA 4M1GL 4N0UE 1SN2A 4ZFOB 4M8QB 3VJ6B 4P2QA 4F8LA 1MFDL 1DUYA 3DPBB 4PD4K 1GXEA 3HKFA 3L45A 1HAUA 2G9HA 5BXFB 3CCHB 3RG1C 5CZXD 4NXSA 1LEIB 1AQ8A 1IBGH 1S7RB 3RDTD 4Z7NE 2YKLH 3AREA 2CMRL 2VERN 3WKNA 1NOAA 4OD1L 3MXWH 3L81A 2VQTA 1WWBX 2YEZA 2Z31B 4LAQH 3VXRB 1DJYA 1S7XA 4N20A 4XP6H 3KEHA 4JDVB 1CF8H 4W9ZA 1G7HA 3K71A 1E5CA 3WUZA 3HNVL 1Y6MR 4TQEL 1KCSL 3HG1D 1JAEA 5IMMB 3WN5C 2QGCA 2XRAL 1T7XA 2IO5A 4ISVB 1D5IL 1QATA 1RIUH 5AVWB 1JNHA 1MSPA 4XNXH 3TBSA 4WU7A 4WWID 1RD6A 1ZTMA 2FEDD 3KPTA 1AR1D 2F8IA 3E9UA 3I3EA 1SN5A 4OVVA 2PWDA 1WZKA 3QIUB 4HEPG 3ZHFA 3T0DA 1Q94A 4I9WD 3KPSE 4EDXB 2GY5A 2MTPA 2E6JA 3ZO0A 2DIBA 4N2NA 4PGEA 4OCRL 3MJWA 1DFBH 3NUKA 4YJZL 3KS0H 2WXPA 1TNNA 3QEQE 1QHOA 2NUPA 1U2CA 5T3ZD 2E7HA 1LMIA 4DFIA 5JR1H 3IVKB 4K15A 4YUEL 3O6KH 5AFAA 5AW1B 2WP3O 4FA8A 2X9WA 2Y2WA 5FDYA 4HCRH 2HA1A 5JPNB 4JG5A 2DW5A 2B0SH 1N2RA 5DXWA 2WNWA 3W39A 3HZKA 4W9DC 5FAAA 3AU0A 4MCYB 1QFOA 5EF3A 1HH6A 3BIKA 1KY6A 4L1SA 4LDLB 2PPCA 5J1SC 2J8OA 3JT2A 1ZY9A 1PLCA 2J8UA 3VU2A 4IIQC 2EDHA 3EH1A 5H35B 4F8OA 2BP8B 4ZO9A 4W4OA 3FSZA 3UC0L 3I50H 4G3YL 1A6TB 4FFWC 2KZKA 2Y0SA 3CFQA 3V52H 3VFVA 2Q86A 5JW4N 1WS7A 4X8XA 4HS6B 1A9BB 3PXLA 4ELME 4WVRA 2R51A 3VSQA 4O2FB 2D4FA 3M86A 4XBEH 1NFDE 4NIYE 1MF2H 1XXFC 1AGEA 1X5LA 3GNMH 4QTHB 1C7TA 5ITBL 3S5LA 1N64H 5CZVH 4X98B 5IUCA 1TZHA 5KOMC 1SLVA 3JWNC 4AQOA 1BG1A 2OSLB 3WIFB 2PO6D 3WJMA 1QRKA 1U8LB 5EDXA 3UCQA 4DQAA 1U0QA 2A74C 3JTSA 4R2GD 4X6EA 4BH8A 3QHZH 1OHQA 1MHCA 4F24A 2BOCA 1NGQL 1GC1H 1EFXA 1JNNL 4GKNB 4D3CL 3BH8B 4ZOAA 3B9KB 1LILA 1SGKA 2APSA 2FO8A 4CILA 3EUDA 4IYKA 3FFCD 1Z9OA 4HPOL 1T3FB 3QQ3A 3RY5A 2DWDA 3RPBA 1QFUL 3QDGA 4KRNA 3GMNA 1FZMA 3X1FA 3T0AA 5KSBB 3NIGB 4BHUA 2ERJC 1I8IB 4U7MA 3O3DB 2X4UA 4NCDA 1V7MH 1GYWA 3K6SA 5DCCA 2B16A 1BD2B 3BGFC 4NN6C 1MCFA 3VD1A 5DI8A 3JWOC 1LVEA 1F41A 3WMQA 4Z7VE 2Z0UA 4HIEA 3V0VB 3IBEA 2WSDA 5EIIG 3VU1A 1D5ZA 1ZHLB 3QJRB 3IFLL 1ZTXH 4I0PA 2FJHA 1ULVA 4JFEB 1QLFA 5CSGA 4OSUL 3OZ9L 4G7QB 4Z7OB 3RL2B 3PIQA 4Q6IB 8CGTA 1IBHA 2J8HA 2LHAA 4PPTA 4QY8B 1DQTA 2Y7MA 5KS9F 3SCMD 5G4NA 4H8VA 2Z64C 5F3FA 2UUDH 32C2B 1XL6A 5JXED 3BJLA 2R0ZH 2D03L 3VNYA 5JW4M 1CD1B 3F7YB 1OGAB 1LM8V 1M42A 1ADQH 2PUQT 1AS7A 3IDYB 4JZNA 4EN3B 2BXYA 4R97C 2VLJE 1BVLA 1GZQB 1H15B 2FSDA 3OAZK 3QIBC 4KDTC 4GG6B 2FO1A 2QQNL 3B9AA 5D5MA 2FSEA 2CHDA 3HE6B 2BVYA 5F3BB 4JY6B 2JJTC 4J27A 3EAKA 4G9FD 1XO8A 4KQ3L 5ICYB 4W9LC 4L8CA 4LASH 3A47A 1HIML 3PGDB 4LOUC 3IXTB 1J05B 1DLHA 1O6SB 1DQKA 1TVHB 3G5XA 3GI8H 3ME0A 3MJ9H 4XMPH 4YHIA 5SX5H 5GZOC 1MFNA 2ZXGA 4M1DH 1C5CL 3G5WA 2JCCF 2L7UA 4TLTA 3GGWB 1FH5L 2A83A 4W6YB 2HPOA 1DDHA 4XN4A 5FYLL 3SQBA 1OPGH 2C1PA 4KH2A 4OM0H 2E46A 1HZKA 2QZQA 2E47A 2H3NA 4OZGA 4PG2C 5GS3A 1M71A 1M05B 5A2AA 4FOMA 5EOTB 1OY3B 4A63A 4KHTL 1WBXB 2XVLA 1JI2A 3QUMB 1OB1B 3FB7B 1E8YA 1H6EA 1LTXA 3DJRA 1KC5H 1G5GA 5GGVL 4BKLA 2XTJB 4P8QA 3WE6B 3B5GA 2PYED 2F54E 1EFQA 2YQ3A 3BIBX 2A6IB 1EZSA 3D25B 1SDDA 1CPUA 5SWZA 3TASA 4DKTA 4MDIA 2DTSA 4DW2H 3INUL 4XCFL 3HN8A 1A5FL 5D1XA 4R4FL 4RMSA 4JLRA 4CNIA 1CO1A 4BCZA 2VDNB 2Q6WB 3A22A 1NGWA 4X7EC 1O7SA 1RZQA 1FUNA 1KTJA 4LKXA 1CL7H 2A9DA 3IAPA 4FI8A 4OBSA 1KLFA 4JCLA 1UT1A 1D7FA 5A7EA 4U1NB 2X4SB 3UTSD 5I0ZA 1RULL 1AOHA 4OIBA 3X1EA 5I73B 3Q2WA 3WFCL 4NKMA 2QFPA 3U4AA 8FABB 2L0DA 1NWPA 1TZGH 3BX7C 4FXGA 2XQBH 5HXMA 3D08A 3HNSL 3UYPB 1WO2A 4LHUA 4PJXA 3FOMB 5K59E 3LDBB 2J20A 3ULUD 5HI5D 3IU3B 2P49B 3FQ4A 2HTKC 1MUJB 1OARH 1KB9J 1AD0B 2IAAC 3RWGB 2K1MA 4E9LA 1RKRA 3VGBA 1CIUA 5GIRB 4TUKH 5TFSH 1ZAGA 4G43B 5DYOA 5C6TL 4WWKD 1BJMA 2WQWA 3VFOA 4N3TA 2HWZH 4OM1L 3OQ3B 4PP1D 5DJXB 4U1MB 1MEXL 1IGFH 1E5BA 4PCYA 3I02A 4ZPTB 4XZ4A 4K2UL 2MCG1 4AJWA 4POYA 4G8GA 4YSDA 1FZOA 3ZQXA 1GPOL 3MRKB 4MB3A 5ESVB 3A4AA 5H2BB 1PW3A 2K6WA 1AJ7H 4ZMTA 4PJ7B 1EGJA 2J21A 4BBWA 5AG9A 3CG8A 3V0HA 4AQEB 5MERB 3TVMD 1OTSC 4LE8A 4W9EC 3DECA 4M29A 4M93C 4P23A 3MV11 5EZIL 1FFPA 3ZT7A 4NNPL 2J73A 1VDGA 2CA3A 4R4BB 3IWUA 5E9DB 2A3TA 3RGVA 3X3GH 4HF5H 1BYOA 3GRWH 3QHFH 4UQIM 4PJ9C 5DEZA 1ROWA 5DMIH 1Z5LB 2NUTB 2C3XA 4XAWL 2QBWA 1SHMA 2YAHA 4JO4L 4EBQH 3MBWB 4NO5A 1IM9D 4U1LB 4EE2A 3RZCA 2WNGA 4ANKA 3BVVA 4AYMC 3D0AA 2R56L 1Y7VA 4M6ML 3QXAB 4P2RE 2NT0A 4PMFA 2B1OA 4ZDHB 3FUJA 5HYJD 4NFDA 3F7VA 3FO2B 4WV1B 4WF7A 2DH2A 4XCYB 2OSYA 1R3JA 1EUTA 3RFZA 4NJ9H 4UBDD 1JERA 5FM4A 5DLMH 3UJTH 3RURA 2B08A 3DETC 4B7LA 3A4FA 5CU5A 4N9GB 4IIZA 5DO8A 3FMGH 3SDCA 5L2KB 1E3XA 2C7FA 5L4MA 4GAGH 3B1TA 3X2QB 5KTEH 2HMIC 3RWEA 1FCCA 5AOIA 3O11B 4S0HA 3BXNB 5IEHA 1AP2B 2FCBA 2WWNA 5IGXH 3NPSC 1XCQB 3DURB 4Y4KA 1BXUA 2VDRB 3DPDA 1F1GA 3BQUC 1DJGA 3MACL 3X11A 2EDOA 5FCUH 3BFWA 2C9SA 3QUGA 4AYDC 2BZ7A 4UQAA 4YHPB 4UV7L 1S9YB 4XN9A 1BAWA 1CYXA 1WIPA 2APTA 2W0FB 5J6GB 2BY3A 4OFYD 1T5WA 2P5EB 4TSBH 3MLZH 1PCSA 7CGTA 1Z9NA 2A9MH 4QRRE 1MAMH 1Z3RA 2KC0A 4J3OD 1TFHA 4KXZI 5C08E 4EO5A 2YA2A 3RILA 3UGEA 1KCUL 1KJ3L 1TJMA 2CDGA 2OSXA 4MQTB 3VXTB 3IMUA 4UNTA 1A6ZA 4KTDL 3LS5H 35C8L 5HYQA 3I2CH 1O5PA 2AANA 3ULVL 4FJYA 1VGKA 4QT5A 1GOHA 1WHPA 3WIIL 1T2QH 5DEFA 4OLYL 1NBCA 4KHXL 3EJZC 4AV4A 1YYMH 1PZDA 3FW6A 2YMOA 4MA3A 3JWNG 1KGIA 4MJIA 4NPYA 4PG9A 4QXUL 3IMBA 2ZPKL 3L7EA 3QUHA 5EHFA 4BFOA 4KJYB 5FF6A 4PIRF 4WW1B 1CYGA 2F19H 3QUML 3UZVA 4ZXBB 4EUPA 4R84A 2YD2A 4IJ3B 2A99A 2AXFA 1Z32X 1XGTA 3H7LA 4KQ4H 2V5TA 1JXJA 3P3RA 5ERWA 3M1CA 2NY4D 4BYHA 4XH2A 1JHTA 5GGVY 5J6HA 3L5WB 1JZ2A 3M88A 3B6SB 1KJVB 4FQCH 5EU6A 5ANMB 2H32B 3GBML 1DZBA 1UCTA 3OF6D 4Y16B 3KJ6H 2VDNL 1BWMA 5FR3A 2QPSA 4BZ2A 1QEWB 2X44D 3CDZA 1KOAA 1IGJA 3NFPA 2UXVA 4RGNE 4DOHB 1XGPA 3DVGB 3PCYA 4RH4A 3O8XC 3L2LA 5DJ2B 2D3LA 3IGUA 1NCUA 4JG1L 3UZEC 4QHPA 1BFVL 1T22A 4G8IB 1USQA 2MMXA 5FV2A 2JTYA 3HS0C 4G7RB 4WEEA 2FRGP 3N06B 3EYUL 5CP7A 4TNFA 4Z3FA 1FYTE 2NYYC 5E2VH 5DRXA 5DA4A 2NDGA 1FE8L 3GMMA 3PWPB 1UZ8B 4HJEA 2R7EA 3QS2A 1MI5D 3QUXD 4JRXB 4Z7UA 1A1OA 4OKVA 4RMUA 3O4LD 4D2NA 3QJVB 4WU5B 2AABH 3DXAA 3OLGA 1FG9C 1PAMA 1HS6A 1RK1A 4CDHA 1FHNA 2X4QB 4F80A 2E4TA 4W1TA 3CN2A 2IIJA 2R2HB 5ICZA 4KX7A 3W2DH 2E6QA 2FO4A 3LPOA 3Q8AA 5IB2A 1EIBA 1FV1A 1BM7A 4P4KD 2PP8A 3KYMB 3QCVL 3AXLA 2C3VA 3N41F 4YDJB 2JVUA 3ZMNA 1UH3A 2AEPH 2IJ0C 3CV5A 3K1KC 3O0RH 1DSYA 3I3DA 3FU9A 4N0CD 1U3HA 1CFTB 2WK2A 2JB6B 4F2MB 3OB0H 3O9WA 2OBGA 1QSEB 1SBSH 2XWCA 2JMRA 5JHDA 5F1NA 1C08B 2IG2H 3QT2A 4BSWA 4QHUB 4UQBA 1N59A 4ZUWB 4EQ3A 3QI9B 4TOYL 2J71A 1A6WH 2VR8A 1RFDH 3VXSA 4FXTA 3UAAA 2X0UA 1I3UA 4JFDA 1LEKA 1KZQA 4NZUL 4NJAH 4NN5B 2A9AA 3RUGF 1MPAL 5EIIB 5T1KA 3RBGA 4S1QH 3KBEA 3VI4E 4NFCA 4WTXA 4HXBL 3WDHA 4EI6B 1GIGH 3EDKA 4L4VB 1PKQB 2DWEB 2UYLA 4XBPB 3D7PA 5IQNA 3W11C 2Z8RA 1YEHL 2OR8A 3IFOB 4S1DD 4P2OA 3WXVH 4HUVB 2BS71 2ROXA 1FG2B 2VDMH 1OAYL 4Q9BA 3T5WA 1WFNA 1UB5B 1Y6KR 2P24A 5DZOA 1TPXB 3BESR 1LNUB 1YN7A 2OA9A 3NVQA 3IDXL 3ILPA 3LKRA 1WD9A 2OL3A 1MLBB 2QHRH 1KPRA 1V10A 5AOLA 3SKUD 5IVXA 3BI9X 1M4KA 2HJLA 1KNOA 4M7LH 2H8PB 3DX8A 2NXZC 4JO5A 4C56E 2DMGA 3L3HA 4MAYD 2BSEA 3P4OB 3U46A 3E38A 5CMAB 4G1MB 2FJFB 2X2YA 2DQCL 2VIRA 2VC2B 1UG9A 3HLAA 1EGJL 4MMZB 1X4ZA 2BRQA 1YNKL 3QC5X 1F4WL 2ZUQC 3J27A 2VDRL 1IC0A 2BPBA 2X87A 4XBGB 4MZRA 2FYYB 2Z35B 4G42A 4JL2A 2UZXA 1IGIL 2MCAA 4BZ1H 3QFJD 5E6ZA 4JFSA 4UILH 4Y5VC 2H2SC 5F7HA 1VJSA 1YMHA 3O6LL 1EJOH 4N5UA 1NCBL 3T0ED 4MMXC 1M53A 1QSFE 4ZMLA 1K5NB 3APCA 3KLAB 1QRNA 1XGQB 4ALAL 5KYUB 1ASPA 4C83A 2XT1B 1ZGLB 4HWBH 1MREL 1PNDA 2X4TB 1ECZA 1ZJBA 5HPMB 4LVNC 7FABH 4CW1A 1SMDA 2X6AA 3DMMA 5HD8C 3VD7A 1E6OL 1PX4A 4HZLB 4C8XA 1NA8A 4Z78A 5IW1A 2EDRA 4FYRA 4S1RH 5DUPH 1I3GL 1BREA 3ROOB 2HKFH 4NHCL 2UY6B 4K3DH 3CD4A 2P8LB 3O45B 2E86A 1E4XL 3SDYH 3B34A 3RVUC 3VQLA 5FYKD 4GBXC 1CLOH 3N55A 4Q56A 2HFFA 3HC0B 4OCYL 2Z91A 3LQAH 5I1AB 4LNRB 3V4PA 5B3SB 3L48A 3JV4B 1CN4A 2EIJB 4Y19B 4OCLC 3IRZA 2P7TA 1JZFA 5AW8B 3FN3A 1M3JA 4LSUL 1E90A 5EZOL 1UWEL 1IAKA 3K80A 4XNQA 2P8MB 2X4OA 1RZ8A 3ZTDC 1ODUA 1EZLA 1TTCA 3CFJB 4QHNA 5HDWA 4XHQA 3FO0L 4AYBA 2BRRL 2J1XA 3TIDA 4ZAKA 4O4YH 4XMLH 4DGYL 3WS3B 1MJ7L 4ZUSA 5FGCB 5CGYC 1R6VA 4Q58C 3TO4B 2XZCH 4PJBF 5FOBA 3RIAF 3UDWA 2KMWA 2YS4A 5ICUA 2B15A 3Q1SL 2R29A 3F5WA 3CQPA 1Q72H 5JHAA 2MH4A 3GXUB 1M9SA 3QAQA 4X5RA 4Y1TA 1IZKA 2PR9A 3EOAB 5AW7B 1CGYA 2ZYSA 4NM4L 3UCRA 5IMLB 4FFYA 2EYTA 4PJGA 2BVQA 4XE5B 3U0PA 1YYCA 1A3RL 1OCWL 1E9PB 3VXOB 2FWOA 5AW6B 2NY7H 5LLIC 3BEVA 2EKSA 1FN4B 5D9SB 2ZICA 3NA9L 2GSGB 2H0JA 4J3VA 1RUAH 3BVWA 5FEBA 1SPDA 2DQIH 4NS0A 4WCYL 3QJZA 3MGOB 2VDKH 1EBAA 1SOQA 4OIAA 2SEBA 4PSRA 1QFWL 2I69A 1DDTA 2AQNA 3TBTB 2NY1D 3V0WL 4XHJC 4QRTA 4DUWA 2FD6H 1Z9SA 5JDSA 1P84J 3DRTA 2TAAA 4M48H 4WI8A 3GUFA 4X4ZA 2YOAA 3ULUH 4N6QA 4PJCE 5HHVL 1DBJH 2YJLA 4Z7NF 4J6IA 1U91A 1Y07A 4FFZH 1QNZL 4JFFE 3Q8CA 2IGLA 5GGTL 3L3IB 4WEBL 4X6DB 5C71A 5C70A 2DI7A 3HE7D 1EHXA 3D2TA 2WQ8A 2D7MA 2I9LB 1USZA 1YA5A 1NC4A 4FMFA 4LSVH 3WN5B 1KULA 3DX7A 2H6UA 3N3EA 5GRVL 3SY0A 3TL5A 4XVJL 4XO5A 1KV3A 4JMNA 3VH8A 4RA0C 5FO2A 3BGMB 2X40A 2QR0A 3HC2A 3ELQA 4ANVA 4GKZB 3DLQR 5EN3A 4J2QA 3QJTB 3KXFD 4HUWB 5LAPA 3SBRA 1BMWA 1ZWIA 2HX9A 2K4AA 3LRGA 5EEVA 1AO7D 3OKDA 4RMWA 1GKOA 1UXSB 1JGLL 3IM1A 3RWDB 5JHLL 1ZLDA 3SBQA 2JI2A 5CN2A 1K6QH 3K6DA 3WGVB 3D30A 1W72A 1MKFA 2ZUXA 3NP4A 1TQWA 3A6CL 3FRUB 4O02A 1A8JH 1NBZB 3SDXE 2QVFB 1U3YA 4WY7H 5TPWH 1L0PA 4PGBB 3K72A 5BVPH 1SJEA 1PVHA 3EJSA 5CSBA 3TO2B 4AQ8C 5DSCB 5E5UB 1AE6L 1VESA 1F90H 1AGCA 1AIFA 5FM5O 1FCGA 3QYCA 1BOGB 3BKJL 3QNFA 3OXRB 4LKCA 3BH9A 2B2XL 2IANB 5C0DA 4KROC 1CG9A 3KCPB 1KDJA 1OOAA 1QI5A 4N9OB 1Q9LA 5DJZA 3VG9C 3F6IA 4IIQB 3W81A 4AVJA 3LN5A 2OMTA 3BN3B 2VC2L 4QF1A 4ZNCD 1RZGB 1TZIB 3PU7A 4EDWH 1E2ZA 2QPUA 4OW6A 3H9SD 3JWDC 1AH1A 2F7QA 1KCLA 4R90L 3DV4A 1KJ2A 3AAZA 1TMCB 3GLDA 1OM3L 1IFHH 2OMXB 2VXQL 2IH1A 2VXSL 1TR7A 1UD2A 1GS6X 1TQUA 2HFGH 3GMRB 4DIXA 4ZO8A 5I1LA 4F8PA 1T7WA 1Q0EA 4TM9A 1MHPH 1P5UA 4KOCA 4XRCB 4ELMF 3UGUA 1A4JA 2IGFH 1RZIA 1XHHA 1TJGH 3NDYE 1PD0A 3NJVA 4Z0BH 1NFDF 2VWEC 1NAMB 1AR2A 1L7TH 5HJGA 1EZVY 2IQ9H 4NX0A 4ODTH 4DVBB 2EE0A 5ILTL 1YCSA 1B2WH 1T04B 5TE6L 1G9HA 2A74B 3DO3A 5DJYB 3SE3A 3A0OA 4DPRA 5JW4Q 2BNQD 3HBQA 2AEOA 5FKAA 5J11C 3ATAA 5E23A 4JZOB 1UB6A 3QJOA 4HJIA 5IB5B 3ZUNC 4Y1AB 2ICCA 1OCOB 2IQAA 3U36B 1NDMB 4XZUA 2C4XA 1NLDH 4I0KA 4BSVA 2C9RA 3NAAL 2XN2A 2I7SA 5JW5B 2EACA 4Z8FH 2ERJB 5DVPA 2HVKB 5I26A 5DD1H 3U7YL 5BV7C 5T5FA 1BLIA 4OQ1A 1HCVA 4J3OH 3WHE1 2L7QA 2V5MA 1F1DA 2OZ4H 2QL1A 3SDAD 3BGFB 4NN6B 3ARBA 3LVTA 3ZKND 2O5YL 3CIAA 3OR7B 3DO7B 3RVWC 3D39B 3HB3C 3B2UD 3CFCH 2EE6A 3FCUB 4B9PA 3ARGD 4FE9A 2NX5D 3DX9B 1JZHA 1NCTA 4JREC 4BDVB 3ARRA 5M95B 3NABL 1TMQA 3MV8E 5DJAB 2VLRE 5F9WC 5DLLA 5FO8A 4OIIL 5H4YA 5IFJB 4Z7VF 5IQ7H 4JGUA 5D71L 4APQC 4OGYH 3CZLA 1P69B 1RZJL 4H8WL 4WTZA 2G30A 4YQXL 5EU7E 4CMHC 5CEZL 1SYVB 4FHBD 3R06A 3FQTB 3RDJA 2P4AB 4YPGA 4P5RA 1K2DB 1G1CA 3LNGA 4TLUA 1NCDH 4XMVA 5AAWC 3QCUL 1N18A 1YJDL 4YHLH 1RIHL 1UD8A 5D72L 4R97B 4PVMA 1BBJB 2Q76A 3AS0A 3O2WL 3QIBB 4XXWC 1OK0A 5DQ9A 5F7FA 1F3JB 2BSSB 3RTQC 1JOIA 4G71B 3VXMD 5LVEA 1CF1A 4JFOA 3BD5A 3OJ2C 4L8DB 2WVVB 4GUPB 3WEOA 5FFOA 5I1IH 3HFML 3QNZB 2LU5A 1J8HA 1RMFL 2VZ3A 4M7JL 4NQUA 3UP6A 3V9FA 2P80D 1DO5A 4D0DA 4IRZH 1DL7L 5D4HA 2NY3D 3LZFH 4MKMA 3V4PL 4L3FA 5IOPA 4QKTA 5T5NG 4DP8X 1XGUB 2WXFA 4GP5B 4PRPA 5C0IB 1KTRL 4XPGH 3EJYD 2Q7YB 3QWRD 2AMGA 1KLGB 3MPCA 5ISZE 4MNGB 3OHXC 3KLHD 3ES6A 5D7SH 1BEYH 2CUMA 5T8IA 3DUHA 4I0CC 3WAKA 1XZ0B 4OLZL 3OSVA 2EYSA 3H0TA 3L4YA 2VLKE 1MNUH 4GOSA 2VDLB 1PCXA 3V4VB 1SVCP 1WZLA 3ZDXE 1N6VA 1WT5A 2FK9A 2Q1EA 5ECJE 5IJDC 1R3KA 1UJ3B 1HI6B 5JOFB 3DWTA 4HSQA 1P4IH 4KJPC 3RVVD 3DOSB 4NQDD 5BW7C 5KS9A 4RAUA 1NGXB 4AYGA 1ZLWK 2R29L 4L8SC 3GKWH 3KPNB 5F9DC 1CTNA 4ZMOA 4Q6KA 2C9PA 2O6DA 5IHUL 1V3KA 4Q9RH 4FQXC 3PWUB 2VE6A 1QW8A 2GJ6D 4TNEA 4AEIL 3EJRA 4L0ZA 4F7PA 1N70A 1X5JA 4AIZB 4JKPL 1HXKA 1L6PA 2DYPB 5D1ZD 3IGLA 3BZEB 1Q9WB 3ZDYE 1FJ1B 1NCCH 2EDDA 3U6XS 1XQ4A 2OAAA 4GKSA 4MD0A 1GGIL 3K74B 1VAHA 3U83A 5IT2L 4OCWL 4ADGA 1TSHA 1UM4H 5F9JB 2J6WA 5F8QC 4NZFA 4FXKB 1GCFA 5B39A 2BHYA 1A4CA 4QXTA 5L2KE 3GBNL 3TZVA 4WIQA 3EHBC 4MJHA 3C8HA 4OLEA 2XVBA 3RP1A 2XTSA 4ZMWA 4PN6A 2HUHA 4MA8L 5CJXA 5K59F 4K8RD 2P5WE 3HMWH 4YHML 2YPLD 1CDUA 3G08B 5DHDA 2JF1A 2Z4TA 1K8IA 4S2SA 3BVNA 3OKEB 3P3YA 1G87A 2ESVD 4NN7B 1KXVC 1NBYA 4X9IA 4MAUL 2C9UA 4PRNB 4UNUA 1TOXA 4YLQT 3S5LG 3SQOH 5JHBA 3US1A 4AL8L 1V54B 1WICA 4WUUB 3CHSA 4MNQA 1S8DB 1OE2A 1IZJA 3BWZA 5FGBC 4FQHA 4CL7A 1A9EA 3EO0B 4M61B 3LB6D 4RWYL 2WN2A 4PJ8D 3VRIA 5D7HA 3L3JA 3LZOA 3QUKA 4K3JL 3EDJA 2O6PA 2XN9B 3BQUA 1OSPH 4M93B 3BAWA 3DTXA 4Y4HD 4OFVA 3FQWA 3DROB 5C0BB 4HGKC 3FT3A 3BAJA 1NAML 1T66C 2AI0H 1RHHA 4XOCA 1ZRUA 1YY9D 4JG9A 4PJ9B 1CGUA 3WEMA 2ZCKH 4XP1L 3N85L 4U1KB 1X6LA 1T0MB 4GG8A 1AHWA 3MBXL 3QXWA 3T71A 4TUOA 1NPJA 1KN2L 5HDQL 1W72L 3IFPA 1GYCA 1TG8A 2IPTH 3CXDH 1L9TA 1F4YL 4IMKC 4JKWA 4MS8C 1S9VB 3WFEH 1AGBB 3L3KB 4AMKL 1KENH 4L4JA 3D3VB 2IADA 2B5IC 4PRHB 1F13A 5IY5B 3CVDA 3TA3A 5IB1B 1BECA 3S88L 3MLTB 2ICWB 4R3SA 2NW3A 1T5XB 2ZOLB 4OD2A 2AEWA 4YVUA 2E7DA 2JCCB 4G6KL 3DJZA 3NH7H 4YXHH 4UOW1 3M1BB 1JV2A 3Q2LA 1OP5H 1QW9A 2BP5M 2OXHB 2ZXCA 3KHOA 5DHVB 5GRVK 2Y22A 4L5FL 2QQLL 3RA7L 3C5ZA 3JWOL 1F5WA 1UOVA 5I5MA 4XPTL 5JA8B 1CXFA 1UWFA 3FFOA 5FYKH 2E8YA 2ORBH 7PCYA 4AZ8B 4N2HA 3F7KA 5AAMA 4OD3L 3VFTA 4ZMXA 2XTLA 3MV9E 5F7LB 1AD9B 1KJ2L 2XNAA 1H0DB 1P1VA 4M43H 4M6AA 5TH2A 3UTOA 4QHMA 1MZZA 2W94A 5IJKA 2PP7A 2GT9A 4U6XA 3MLWH 4ZMYA 2EC9U 5L4FA 4FTVD 43C9B 1SEBB 2WZ6A 3PRZA 3UTTD 3V0GA 1E3FA 1BFOB 2ED9A 1XIWD 4ODXA 5EH1A 4JVWA 5FHAL 4HV8A 4DT2A 5F7BA 3UAEA 2G5RA 2NR6D 3DYMA 3SKOA 1XR9B 2YEVB 5IESL 2LU7A 3MLVH 3BWUF 1DQDH 4YO0A 5JYMA 4DKDC 2QGEA 3DSNA 4NOBA 5K9KB 2HVJB 5GGRA 4OZIA 3P40A 2HLAB 2V2TB 2MKLC 1B0WA 5E2TH 3ULSB 1T1XA 3O2DL 1G7LB 1NJ9A 5DJDB 3PDOB 2QPDB 5INDB 4NT6A 3WJLA 4XNMB 1O7VA 1HXMA 1VGEL 4K3HA 2EDYA 4JJ5B 4KKBD 4RGOH 4RRPA 4S11A 5HVWA 1WAAE 4H40A 5FOJA 1OLLA 1QD0A 4AGNA 2YJQA 5ENWA 1MQ8A 2CIIB 1X5MA 4YHZH 4E9XA 1L9OA 2UWEE 3WD5H 5FM8A 4G7YH 4XNYH 5IFAL 2Y36H 5CUSH 5E99H 4BFBD 4UM9B 2X38A 5IR1A 4I2XB 4PFEA 1JRHL 1Q4NX 2W65B 3EJQA 2I60L 5DGRA 5ECGA 4B97A 2AXGA 4JE4B 3V4VL 2OX5B 3ILQD 4FG0A 3NCYS 1GAFH 3STLB 5DD6B 4Z76A 4XP9L 5CGTA 3EGDA 1SJXA 2QSCL 1NEZG 1I4FB 3CX5K 4FL4C 2GK2A 4F33B 5T1DH 5D7IE 4OV5B 3VFRB 3H85A 2ODIA 1BZ7A 1QSVA 5ETUB 4OIFA 4AV5A 4KMQA 1PZBA 1RURL 3BO8A 2D7OA 4GFXA 3M8OL 4LHUG 4NKOA 5GRXG 4LBEA 4YR6A 3KPLA 3SPGA 3O8XB 3DARA 5C97A 3L5XL 2KLRA 3CFIC 5IK3A 1JYNA 1YLBB 5GSRA 6FABL 5T33H 1G7PB 2WD0A 4KXDA 4JRYE 4X50A 5IG7B 5C0CE 2X4PB 3U4KA 3R7RA 4KO9A 3V0EA 3HS0B 4UNVA 1OCRB 4KFMA 5T1LD 3AFLA 3LN4B 4HIXL 4UM8A 4JANA 3L3OC 3CUPB 1YNTA 1QPPA 2W5PA 3QP3A 2ZUVA 3SE9H 3RKPA 4WI9A 1UKTA 3E1F1 1A3QA 3AG3B 5K9OB 1ZS8A 3OV6A 5AZ2H 5AENA 1NKGA 1V3JA 4RMBA 3Q2CA 5DD5H 2BSTA 4YXKL 1CK0H 4FQJH 1ZVYA 4QRPA 4UTBA 4JDTL 5DTFB 1A7NH 1QZ1A 2M26A 3V8OA 3RY6A 4CMMA 3D50A 3PJNA 2YD0A 1D6EB 3Q2NA 2VL5A 2JV6A 1E8WA 1OAUH 2BNRA 2D73A 1VKXA 1PPIA 3MNWB 4IRSD 4U6HA 1IAII 2WQVA 2Y07H 5ADPL 1Y0LB 1ZIAA 3NIFE 4AYEC 1J1XH 4FNLL 4BH7A 1K5WA 1MCKA 4HMDA 3VWJD 2QADC 3I6KA 5EIVA 5HDOA 3SJVE 4Q97A 1P53A 2R0LL 4N22A 1G1OA 1YVLA 1B0GB 1SHXA 2D2CC 3BWUC 5AYUH 4HPHA 4FADA 4NP4H 2HVBA 2FJSA 2DTML 3CFKB 1IL1A 3BLPX 5C0AE 3IDJB 4NM8L 4PQXA 8PAZA 3UROR 2CRZA 3MMEB 4P5KB 5E2UL 1V7NH 3V6OE 3P11H 2HT4D 1A7RL 3TWCH 5IBLC 5IMKA 3GXIA 2HJKB 3PG2A 3MOAL 4W9KC 2Y7QA 3VI4F 1ES0B 1N0XH 3BT2L 1JXFA 3NRPA 1HYRC 1AY1H 1VCAA 1H3XA 1E27A 2GJZA 4HWEL 4CSPA 2QV2A 3OPZH 4LK4A 5AD0A 4O9HL 1M57B 1JF6A 2QELA 4DCQA 5L6YH 1T1WB 3DHMA 3VDAA 1F3DH 2EH8H 3JV0A 3BVXA 5A16B 2NXZB 2F74B 4GRMA 5E00A 4ACPA 3H3PL 3HBPA 4EI0A 4R5TA 1FIGL 4GW4A 4Y2NA 1D6VH 5TGBA 4PLKC 3O41B 5LBSL 5JQHC 4N3UA 4E9YA 1KXTB 3GQFA 1ZA6B 2AQ3A 2ZUQB 3ARPA 4HCRA 4WTQA 4BQ9A 5I71C 3IMTA 2K45A 1DLFH 3QPXL 4HX1A 3KG5A 5FLVA 1JNLL 4JDZA 3DC0A 3TBVA 3FO9A 1VZHA 4FZEH 2PTTB 4Y5VB 3HCVB 4A6YB 4CADA 4MX7B 4C4BA 4DHLA 5DJCA 5H37H 4LCWB 4MMXB 4WI0A 4E68A 2ENQA 1O7DC 5D1QA 3PXHA 1ZHNA 1WFIA 3ZYIA 1IT9L 3DVNB 2WAQA 1BXAA 3QNYA 1U3ZA 4LVNB 2AQSA 4Q6YA 3RUGA 3MTRA 5FFGA 1RJYA 3QYMA 1PZ2A 1NCGA 3OWRA 4MCZA 1GGCL 4PP2B 2H1PL 1J1PH 1PZ5A 1YMMB 2FTAA 4XXDA 3U0WL 4RZKA 4J5VA 3PQYB 4YNYB 4KJWD 1RVFH 2ZONA 3QEGL 4KXZH 5D7LE 3BISA 1IKNC 1NANI 1DQML 1HXYA 2BSDA 3CSYB 3LV3B 2RBLA 2BC4A 5HGGS 1I9RH 2F53E 2O1AA 3G6DL 4JY5L 3VRJA 3NGBC 1YG9A 2C5DC 4HLZG 4LLYA 3D6GA 2ZP8A 2EDLA 4GBXB 4EUPG 4ADJA 3V5KA 2J1ZA 5DURB 2MQ0A 4N8VA 5IOKA 2LE9A 4X4ME 5EFIA 2Y2TA 1OTUD 4ZUVA 5GRUL 1F6AB 1KCVH 3C5JB 3NCYP 5EUKB 1QBAA 1KPVB 4LFHD 4OFPA 5IB4B 3N41B 1MRCH 2LW3A 5F1IB 4ZTOH 4GAAA 1ANUA 4K5MA 3REVB 3VE0A 3ATDA 2EEFA 2WUBH 1N8ZA 2AXWA 2X89D 4PJAE 5FYLD 3V5HB 1CDBA 1JZ3A 3ABMB 4L3EA 2Z31D 3GSNH 3VXRD 4FHJA 4M6OL 2AV7A 5FYJL 5TE7H 1CBVL 1QHPA 1G6VK 1A6UL 1PQZA 4JGJA 3VGEA 3KYAA 4LSSH 5KSAA 3GS7A 1QFWI 3C60C 1WIUA 3IEAA 2LTQC 4YHOL 1ADWA 1F97A 2QEJA 5IHLB 1NC2A 3D18B 3DHUA 1J0JA 4F20A 2VMDA 2FBJL 3SE4A 25C8H 2WXNA 2IOMA 3L2NA 1D7BA 3QAZC 2H2PC 1IGCH 1NKRA 1GKEA 5DR5H 2VSMB 5HHPB 3QIUD 4GKLA 3IJYA 1UURA 5HJ3A 3BOVA 2LU3A 4DPBX 5TDNB 2CO6B 2FQGA 4JFWA 3PP4L 2CJUH 1HTYA 1PSKH 4GO6B 4PTUB 2E27L 3AACA 4P3DB 4XVTH 2PWEA 2FUQA 3EYQD 3I6GB 2WWOA 3OGCB 4F57H 1ZEAH 3GHEH 3T65A 4EKJA 1DUZB 1MDTA 4QOKE 4DK6A 1NMBH 3NG5A 4L29A 4G6AC 1GGTA 1ADQA 5C07A 3VX1A 3HG4A 5IJCC 4MJ6A 3V0IA 1HL8A 2G3MA 3S3PA 4FGMA 4IS6B 5KOVC 1PZAA 3NJGA 1DBML 3T2NL 2GCYB 1E4JA 2OJZH 1GTNA 3QRBA 5HHOE 5TD4A 4K8RH 1JZEA 4IW4C 4PJCF 1VLXA 3MJ9A 2D7TH 2YPVH 4KAQH 5D70L 3VB8A 3U9PH 3CVHB 4FI6A 4HK0A 1T20A 2E9IA 4HVBA 3OAZH 4F8QA 4PGDB 2O5XL 3MBEB 1KTLB 3QR2A 3H42L 1UH2A 3C87A 2BDNL 1F02I 3NZ8B 2EVFA 2HFEA 1EERB 1HSBA 3MRNA 4A2HA 3VFGH 3W0WA 3CC5B 4LGRB 2WTOA 4PEEA 1E4KC 4QRSA 4UT9L 2QQKL 2WBJC 2C9AA 3A4DA 1G0XA 2VDPB 3ZSSA 1WZ1H 1WA1X 2Y25A 3P77A 3NJNA 4IJTA 1HSAA 4PJ5A 3VCLA 2WUCH 4X99B 3UAJC 1TIUA 2C26A 4ONGL 4WJ5B 1RUML 3TX4A 4C55A 4LNVA 5A6IA 1QKZH 2A9CA 5C0JB 3KYNA 4JFHE 4G80B 1QQDA 4LSQH 4AOFA 1GS7A 5CXPA 1HH9B 1N19A 1F3RB 4KJQD 2R4RL 1RUPL 3QPKA 3ZGIA 5CIPH 2CCLA 2MOVA 2QPFA 3B9KD 4O5LL 3SDXF 3T77B 1CLZH 4LRNL 5I17B 2Q8AH 4NHUA 1RJLA 1DCLA 5A6MA 4FJ6A 5E5MB 1XH1A 2CR3A 3UP1A 4KROB 5AVQB 2GYSA 4PWIA 2PYFA 2FGWL 1TYJA 4AEHL 1LP9E 3ZK0A 3VG9B 3QIWC 1S46A 5PAZA 4F7MB 4ZS7H 4CSSA 2OMUA 2BIOA 4R96A 1BD2D 1ZVHA 5AOKA 4X4YA 3VMNA 2J6EL 3RWJA 2VJXA 1B90A 2Y5QA 2X1QA 2FUTA 3HZMB 4PJBB 2OYKA 4AGMA 2AGJH 3GRBA 5C7XH 3JZYA 4A6YL 5HGHA 2YKLL 2A0LC 5AW3B 2IWKA 4M5SA 5J0BA 2OTWB 4LF3A 5D2NB 4NPKA 2JKLA 1FA4A 1KG0B 1U8PA 3PJSA 5E6IA 1T1YB 3QDMB 4FMKA 3KPSA 1N0LA 5LGYA 1A2YB 1UD5A 1TVBA 1IC5H 3MNVB 2GBAA 2JJVA 4JR9H 5JOPD 3WAJA 4M9OA 2XSKA 3HG5A 1OGAD 5J9PB 1K4CB 1FYHB 3BJ91 3MNDA 3ZZSA 4M8UA 1H6TA 1NEZB 1XSOA 4EN3D 2NW2B 1EFXD 1JPTH 1NGPH 4RQQA 1IRAY 2KLTA 4PRIB 1NBVH 1L3WA 4N0UB 5HYEA 2P52A 4Q2ZA 3HE6D 4H44C 4IDJH 4ZTEA 5ICXB 4AH2A 5BV7B 5BRZE 5IROA 3N40P 5KVEE 1A6VH 1INDL 3TN0C 3NJHA 3GRWA 3GTTA 3LXUX 3PNWA 4NC1E 2JQAA 2WZ0A 2C34A 3K7UA 3FULA 4Z7NB 4W9IC 1OSEA 3EADA 4V1DA 4XMWA 4KU1A 4EOWH 3HB3B 3ULVD 3O6KL 5HHMB 2FQFA 3GSRB 3JQOB 4MJ5A 3BAXA 4OCSH 4JREB 1L5GB 4R26L 2F2HA 4G72B 3VXNB 2AJ3B 2B0SL 4M1GH 5F9WB 4XN5A 1ZHKA 3QUYC 1NEUA 1VACA 4H1LB 4APQB 3JT0A 3LNFA 4I0PD 5JQ6L 2MNJB 4KKPA 2WP3T 1AYOA 5D7KD 1LEGB 4CMHB 5A2BA 3ARUA 4XNBA 1OD7A 4PGZA 4WRLA 5I66A 1G7MB 2CMRH 3L3GB 4OD1H 4L8SA 3REWA 5E8NB 5CJOH 3MRPB 4HDIA 1HNYA 2FB4L 4FQXA 3ARDA 2VZSA 5EZLB 2GSIB 3HNVH 3ARQA 4TQEH 5EO1A 2A6JA 3Q48A 3QEQB 3FQYA 5DFVC 2XRAH 1JWMB 4QRFA 3RTQB 1R46A 1D5IH 1FL5A 1WBZB 3B2VH 1TCMA 1I1AC 3WNNA 2K3HA 2VRQA 5E8PA 2ATKB 1YUHB 3BP7B 3VYNA 4ELKB 1EHAA 3TV8A 3SD5A 1F18A 1G9NC 3V6FA 5DHEA 1NDGB 3AG1B 5JW3H 4GQRA 4OCRH 2L4OA 3E6FA 3NSYA 1U8IA 1Z0MA 3D8MA 4HGMA 4MXQC 1KTCA 4XI5D 3U2SA 3JYBA 2FNBA 3QHZL 3M7OA 3OHXB 1A6AA 4GI8A 3CFMA 3VH8G 2N01B 3ARFC 4QRAA 3ORJA 2YLHA 4FYTA 1WYJA 2X28A 1TQBC 3ZKMD 4Y5XC 5IB3B 2FEEL 3S37X 5L2JB 4Y88A 3ZY7A 3LRHA 5E7FA 3CFBA 3ZYOA 1QHQA 1KTDB 4Z7VA 2XVKA 1LK2B 2W07A 5DRNA 1CWVA 4JHZA 3WU1A 4BFGA 4GQ9L 2PCFA 3ZYJA 1MDAA 1RV6X 3TFBA 4ELMB 1Y18A 4QHLA 3IPEA 4GINA 5CZKA 3ZDXF 1T1ZB 4PYHA 1XMEB 2WWMC 4NRXA 2W88A 3M7FB 3HPJB 5MEQA 1HHKB 3L4WA 4GRLC 2I24N 4PTTA 4NAMA 1I9IL 5D1XD 3S96A 3LXCA 3RGBA 3CN4A 1A3ZA 4Z77A 4XMZA 2VDPL 2VN6A 3DGGB 1Z5HA 5HYIA 4LL4A 4WK4B 1KN4L 3UC0H 4G3YH 3IS0X 1PDKB 5EU3B 4DH2A 3RDTA 1VERA 4X6CB 1P1ZB 1CQKA 1CFSB 4X4KA 4HIJB 4BCYA 4PLOB 3FQUA 3B3BA 4PV9A 4W9GC 3NFNA 1FAIH 4JVPA 4LPWA 3ZDYF 3FZUC 1Z7JA 1QYGL 1B3JA 1BJ1J 2F68X 3NCWA 4XP4L 3H2QA 4YGAB 5ITBH 5EC1A 4UUJA 4QGTA 4X6FA 2AQ1A 3HG1A 4OF6A 4OT1L 1ADQL 3ZTEA 2EUXA 3SKMA 3N50A 4MYPA 4MNHB 4JFEE 5MEPB 5TF0A 1MFBH 2NNXA 3GIVA 5F7NC 4AM0A 1UATA 1IIIA 3FUMA 4G6MH 4Z7OE 5IREA 3TPUA 1LQSR 4LAJH 4CKQA 2DQFB 3OAYK 1NGQH 1JNNH 4D3CH 5DUBA 5EOCJ 4DKFL 3GBDA 4KPHL 4PR5B 3GI8L 4J8RA 2GTQA 4HIHA 5HY9B 2KL6A 3F84A 1KPUB 3MUJA 3CU7A 3LD8C 1KIPA 3RNQA 3T3MB 1ZLUK 1QFUH 2B3RA 3ESMA 4M1DL 5JIHA 2XWZA 2WAHA 1LD9B 1OAQL 4I5BA 4ZO7A 4N6RB 1CGVA 2ZKHL 1XV8A 3MRDB 5DUML 5C8JA 1JZDC 1R3LB 5IVZA 4H8UA 2X88A 5EUOA 2LLGA 3MX0B 3GBLA 2V2WB 3I6SA 5DHMC 4XXCA 2ZX7A 4AJYV 1N3NA 4EZLA 2XICA 2VISA 4DGWC 4XVOA 1J9TA 4E5XA 5KN5B 2VLJB 3OZ9H 4R7DB 1TTFA 1QVOA 2B5IB 1THCA 2XKNB 3RWCB 2E59A 4M02A 4QCIB 2P5ED 3GMQA 2WO2B 5FDWA 3RZCD 5L9DL 2Y9RT 3Q5TA 4ZSOE 1CICB 3OJMB 4OJAA 5IZ7A 3HVDA 3NK4A 3PHQB 1CL7L 2R1XA 2D03H 5JIKA 3RNKB 5IV2A 2XTJE 5KBPA 3BWAA 3RAJL 3W38A 5MI0C 3OKLB 1U4FA 3QORC 4WTZG 2QQNH 1EHLL 5I1KL 4R5XA 1HILB 1QBLL 4M3KB 3SIKA 3CVIH 4JPKL 2WLLA 3QSKB 1HIMH 4TNWF 2XI9A 3DIFA 3WDJA 5FO9B 3FTSA 5KSVA 2PO6A 2F54B 4J39A 5AB9A 4MVBC 4UIKL 1V5JA 3FT0A 4QXWA 4ZXBD 4ZZFA 5E7BA 3QQ9D 2ZG1A 2FR4B 1C5CH 1QUPA 2RH0A 2ZCHL 1FL6A 3F01A 5FYLH 1A25A 4KFZC 1BW8A 2AJYL 5CBEB 3WNLA 3BN9C 1H9VA 2CBOA 2YN3A 4HBCL 4PB0L 1M6OB 4KHTH 3T1FB 4XE0A 3GDCA 2VR4A 3WKPA 4WNJA 5AVSB 5IQOA 1HJCA 5GGVH 1TITA 2JXMA 3BDYL 1OQXA 2ITCB 2CLRB 2EZ0D 3K6NA 4RMQA 4TVPE 5B1JA 3AROA 1G4RA 4JFQB 3ET9F 2KKQA 4DEUA 3FT9A 3INUH 4XCFH 4AKOA 4H5SB 4NEHB 3AMLA 4P99A 1TETL 4R4FH 3ERXA 3DIDA 2IDTA 2AK4A 2F5BH 3G5ZA 3LKNA 2HN7A 3LZPA 3QDJB 4HF5L 4P2RA 1ET5A 5E1AA 2HTLC 5HPMA 2Y6SD 1NMCC 3TF7C 1XVSA 2XWJB 3FYEB 4HWBA 4LLUB 1RULH 5EZJB 4KNQA 1UFUA 5G5DA 5A2JH 2RMNA 1ZHBB 5GS0H 1MCEA 1T83C 4NO2B 3SCMA 3MNZA 4FG6D 3M17B 4NRZB 4Q89A 4MJID 5C0ND 3FC8A 4JVUA 4P9HC 4ZW5A 2QPEB 2UWEF 2HH0H 3LH2L 1MLCA 1DVFA 3AWFA 1TTRA 2CHNA 3HNSH 5IW3A 4YDKL 3AM8A 5E9DE 3BAIA 3RL1B 1C12A 1R9FA 1NAKL 3BP5A 1S9XA 2PCPB 3AS3A 5C3IA 3QUZC 5ESQA 1HEZA 1CU4L 2DKUA 4FL4B 4RDQG 1WC7B 2H26A 3MRRA 4ESKA 2VDQB 3LQZB 4G9FA 2GTZB 4OZHB 3W5NA 4U6VH 5I28A 3TT3L 3N1PC 3N0PB 4L23A 5D7IF 1QSED 1NGYA 2IWGA 4JQIL 5B39G 5CCHE 3BZFB 2XG5B 5JORB 5KVMC 1MJ8L 3UEQA 2MPAL 1SBBA 4WI4A 3KPQA 1MI5E 4XTRC 3T4AA 1DQJA 3QI9D 1B6UA 1IC1A 3O3EB 1S7SA 5AWNL 3BMVA 2BINA 4FA7B 4XNUL 3D5OF 4U05A 1N6UA 4FZ8H 3DUSB 2HT2C 3L3OB 5GS1C 1IQDB 5ALBL 3D2UB 4OI9A 5EZIH 5HSFA 5BS0A 2V17L 5D6DC 3EYFB 4NNPH 3D0VB 4L4VD 5B1KA 2A1WL 5A2LH 1E9OA 2PYEA 4JBSA 4NENA 3UJIL 2ATPA 3DXAD 4X7FC 1IVLA 2CLZA 3MLZL 4RA3A 4XAWH 5JDJA 3AT9A 4JO4H 4URTB 2PW2B 1FQ9C 4OFQA 4JG0L 1BGXL 2DLIA 2ICWI 2XPGA 3QA3B 2R56H 2WZPD 3ZTNL 4B5EA 4M6MH 5HYSA 3STZB 3MRBA 1IEAA 4I4WB 4FFVC 3MRHA 3ARZA 2VW7A 1HQRA 4JM4L 3QH3B 5TTRA 2CUHA 4NUJA 4UWQB 1T2QL 2QADB 5A2CA 1JPST 3EZJB 4QMEA 3S34L 3NIFF 1UOKA 1G43A 3VXUB 1M7XA 4X8CA 1KF9B 1OV8A 3NZUA 3PPSA 1KIUB 3U0TA 3FOLA 3FTYA 2F19L 2X7LB 2VERA 3RB5A 3I9IA 1ZT1B 1DEEB 1HCZA 1NTDA 4HS3A 2VRKA 4FFZA 3L9RA 4KNTA 4FA6A 5EA0L 5EN2A 1T21B 2OMYA 1VFBA 4B9ZA 1ZDSA 3SBWC 4U4BA 1C8PA 3W9DA 2NNAA 6TAAA 4QWWD 4I3SL 4QRRB 1A22B 1X7QA 4JHUA 3QJQB 5C08B 1JPEA 5DZLA 1W2KT 3O6FC 1I8AA 1PNCA 5JLZB 1KYUA 2VR5A 3T8XB 5FIEA 1AGFB 1FYTA 5D6CA 1OSZA 3F12B 4D9QE 4K71C 4C47A 1MRDL 1UVQA 3LY6A 2IDFA 4P2YA 1LE5B 3VM7A 4OUOA 2ZE0A 5SWQB 2YUVA 4TF4A 1DCEA 2HG0A 3D85B 1ERNA 1EXUA 5HI4D 4RVBA 4WFFD 5E2VL 2D7QA 4NQSA 3DOIA 2YC1A 2D2OA 3NTCL 5IP4A 1KCUH 1KJ3H 2VKWA 3QWNA 4F7TA 3ATEA 1L0XA 1IBDA 4M1CD 1OB0A 4KTDH 3T0EE 35C8H 3OKKB 2ZYHA 3CZFB 4PJHA 3ULVH 2V9TA 1K8DB 4GLRI 1QA9A 3C5SA 3MOQA 3WIIH 2K78A 4OLYH 2IV9A 3K8KA 2FT8A 4JMXA 4H26B 4KHXH 3C60A 5DD0H 3RPIB 4QXUH 1BQHA 1PEWA 2BVEA 2ZPKH 2F08A 1SJHA 3O3UN 3FONA 5CEXB 1I3RB 3PWPE 3US9A 3ZL4H 1KB5B 3RU8L 5CEZD 3QUMH 5KJRL 2AEPL 4JRXE 5F89A 3UPAA 3DBXB 3KYOB 1J1OL 1XAKA 3TBYA 4F3FB 1T2XA 5MENB 3G6JE 1FVEA 4WWPA 3BEWB 1ZWIB 3KM2A 1F11A 3NYKA 1P7HL 2NY6C 4I8DA 3N5AA 3MRCA 3MRMB 4F9LA 3KHQA 1S3KL 4HK3J 3U1PA 3FT1A 5J06A 4UU9B 3N2JA 3NGBB 1BJ1H 1C1EL 1JWUA 2VDNH 5A1AA 4PJDA 1P9MC 4LEEA 1O75A 1I3VA 4CC1A 2NXYC 1VA9A 3N91A 3S48A 4OLUH 4HULB 4O02B 1OF2B 4XP5H 2GITA 4NNXB 2GUOA 1MW3A 3EGSB 1SVZA 3RIAK 4AI7A 1NCAL 4JG1H 2RA1A 2COQA 2WC7A 3OHMB 1AKPA 5C0GA 4WFGD 5JOEA 2K7PA 5IW6B 2HCZX 3HTLX 3EYUH 4LPTA 4EIUA 3IETB 4OF7A 2CWRA 3KPRE 1FE8H 3RTLA 1MELA 4QR7A 2WQUA 2EO9A 4ORGA 5AZEH 5TJWK 1DHKA 2W9DL 3PWLB 4P2CG 4DP1X 1RAMA 5E6SB 1L9MA 3BKML 4QO1A 3B5HA 4PJAF 2YD5A 4LDOB 3CK0H 1T4KB 1BIIA 4ZFGL 2Y4SA 5J1AB 1XBRA 4NCC1 2LTQB 3QWOB 4YIQB 2ICEC 2VDQL 1U8CA 5FECB 3ISWA 1OW0C 4JO8A 2OZ4A 1RHFA 4OFDA 3P2TA 1CLVA 3FFDB 3GXMA 3ZVVA 4N85A 1TTGA 3Q01A 2OS7A 3QAZB 1XF5A 4HZ1A 2PNDA 4TTDC 2E0PA 3QCVH 2AMUA 5CD3B 4YAQB 2VAAB 3V9CA 3TJEL 3CSBA 5CWSA 3VI4B 3V6OC 3KWXA 4GH7B 1BLNB 1BFTA 2CRMA 5BCAA 1KXQA 2XJLA 3P69A 3GUTA 1BM3L 4XWGL 4CVZB 1BPLB 3LRLA 4PBDA 4MZ3A 4PRDA 5F3HB 3RJDA 5IIEB 4FS0A 2I32A 3E6HA 4TOYH 4ZMQA 4N2LA 3FTGA 4MDJA 1NINA 3SO5A 2E9WA 4HKZB 1J8RA 2I85A 4J12A 2ARJA 4NZUH 4P5MB 4DTGL 2Q20A 3AU1B 5EO0A 4FTDA 4P57A 1FO0B 4HXBH 1SXBA 1IEHA 4C56B 3OF6A 3ZZQA 4LPXA 3QJFB 3FBQA 5AW5B 1GZHA 2DF3A 5I8CB 2IAND 1YEHH 1U58A 1KLUA 3EO9H 1IMHC 4IBTA 1IKFL 1UXWA 1IAIH 3OKMB 4YSAA 3OR6A 2WINB 1LWHA 1OAYH 4IRZA 4Y8AA 5D4JA 2DY2A 1IEBB 1NC4D 3VYOA 4A66A 5ANHA 4FFWD 4P5TC 4HC1L 4JM2F 5IMOB 1HCYA 1XAUA 2B59B 4PGCA 5F7KC 3I9GL 3MGTA 1RSYA 2KQMA 5CBAB 1A47A 1ND0B 4NQTA 2DL2A 3VFNA 1QSFB 3MNMA 4XCNB 3QUXA 3DGCR 1RZFL 2D31B 2WBJB 2NNFA 3O4LA 1LO4L 3GLEA 4IHOB 4ZK8A 2DQCH 4ZI8A 1K3ZA 4Z95L 3IE9A 3B2MA 2XJKA 4Y2DA 1JTOA 1PY0A 1XCWA 1YNKH 1XFPA 4NBXB 1BF8A 2VDRH 5DUJA 4DESA 4YSCA 2FJUB 4JY4B 4QRQB 5E9NA 4LCCC 3F2LA 1IGIH 2CAKA 3SEPA 2R1WA 2EC9T 4Y19E 1HL9A 3FSOA 2L3BA 3O6LH 4P4KA 4C57C 1NCBH 5B38A 3LRMA 1AZCA 2HLEB 4ALAH 3EYSH 2LOEA 3L3DA 1MREH 2VITB 2B8OT 3H9HB 4Y1AD 4YK4C 4B96A 3FUNA 1IBYA 1ZE3H 1BXVA 3HVNA 1JBJA 4DKEL 1E6OH 3KVPA 3M45A 5C9JA 2VXUL 1UZGA 2D9QB 2ZSWB 3QIWB 3QNXA 3F7QA 3MRJA 4JFPB 1Y1DA 1ZLWH 1I3GH 1TENA 3N04A 4PLJD 5FGCE 5H94A 1NGZB 1XF1A 2Z7ZA 4NHCH 3HHSA 4K3EH 3MA9H 4PJCA 4XC3L 5C0RL 1LP9F 4U1SA 3D39D 2ADYA 3QZWB 5I30L 4KXAA 1ACCA 1CB4A 1VZGA 1BQLL 5LDSA 2CNZA 4OCYH 3WNOA 4H7VA 3C6LC 2EVJA 4BQCA 4UMGA 3FB5A 3P73A 1D3CA 4OI8A 4P46C 4MXWL 3T6ZA 3TEWA 1B0RA 1INQB 1YRKA 4EIGB 1OP4A 1DBJL 5GGSB 1SF3A 2EE9A 3MUGA 2E9GA 3CIQA 3ESUF 2XVGA 2B3IA 5EZOH 4KKAC 4MBOA 1FDLL 3BSHA 2Z1PA 4XVSL 3FO0H 1N5AA 2BRRH 2N7AA 3PUUA 1DSFL 5DRZB 4DGYH 1KBBA 1NIAA 5J89A 1MJ7H 2H32H 5CLXA 3QFDB 3KNBB 3I6LE 1FZJB 2MRYA 2W59A 4NZDA 1OGPA 2GQHA 3QG7L 4PHZA 4HU8A 5LGJA 3SO3C 2GK0A 3Q1SH 4LL1A 4B50A 4HH9A 4JGNA 4LOUD 3TN0B 3TBWB 2QKSA 4JO3L 4Y9GA 2VN3A 4L18A 4NM4H 4OUUB 2P5PA 1K6QL 3G7TA 1OGSA 2R2BB 2HJFA 1A4AA 1D5BB 3ARBD 4KK9C 1AZUA 3U79A 1NFAA 1W80A 2EDFA 3NA9H 4JFFB 3LOWA 4Z7WA 4EIBA 2IBZX 2V6HA 1JZGA 3QUYB 4EQ2A 1AR1C 43CAA 3NBNA 2YPKA 5CD5D 3UBXB 4JM2C 4GAYB 5BQ7B 4BA0A 4WCYH 1E9QA 1QFWH 2BFVL 2L7EA 2WLIA 3S6CA 3V0WH 3SKNA 4UIMB 4DP6X 3HRZC 3PXJA 3U9UA 3FRPA 3HHRB 4X5LA 3Q3GB 4HUXA 4DWHA 4KI5E 5K39A 1YEDB 3DI3B 2N7BA 3RHWF 4WFED 5SX4I 2HG5B 4GW5B 2FEEI 3NSCA 1QNZH 5FYKU 5GGTH 2OMVB 4WEBH 3GPSA 4YLCA 4Z3TA 1MRFL 5EIQA 1SEQL 1UD3A 4LLVB 4OKDA 3LKSA 3M46A 2BXZA 3S0PA 2Z92A 4XVJH 2DYPD 1I1AB 5I8EB 3LTVA 1L6ZA 1XB6A 4KUZL 1MHPL 2WCPA 3SDXB 2JJUA 1OTTC 3PP3K 1OT2A 5E8DL 4XCEB 1BQSA 3A67L 4ODTL 6PAZA 4ZFZB 2Y5TB 3Q8BA 2XG4B 1QLRB 3I85A 2RFXA 5CEYB 4WDIA 3GJEB 3BW9B 3KWWA 4YE4H 5HGDB 1FO0L 3CBJB 3ARFB 5JHLH 4NZRL 2HTKD 5KJ4A 1M7IB 2WTRA 3KPPB 3WJJA 4A7UA 4YBQD 4Y5XB 1JPGB 2X3AA 1CT8A 3A6CH 4PJFB 5F9OH 3VFPB 5CR1A 4D8PA 2YUXA 3FQXA 3P3UA 3JWNE 4HJ0C 1URIA 4D9RE 1IFGA 1WLHA 3E8UH 3MV8A 3PGFH 5FKPA 4X8JA 3OG4B 4P5SA 1KFGA 4WUUD 2OZ4L 1G94A 4RISL 3LPPA 4RRPM 3RWIA 1MW2A 1ASOA 2B2XH 4N24A 3BPNB 3DSFH 3BYTA 4GRLB 1SMOA 2ZYRA 5E56A 3BSZL 1UUNA 3RJQB 1OTSD 5KYXA 2XN9D 4L1HA 2DQHL 4HUNB 1GGUA 4FNRA 4PY7B 4UI2A 1WIOA 2VC2H 4LP5A 3BP6A 5C0BD 3U6XA 4HJJL 4B5ZA 5BVJA 4U4IA 4F92B 4FQLH 4CC4A 2LQRA 1S78C 3JTTB 4R90H 3HHMA 1OM3H 1ILUA 2VXQH 2VXSH 4X6BA 1QBML 1UH4A 3HZYB 1OZTG 2KPNA 3BPLC 1GMEA 2JI1A 3ZPDA 4PRHD 5KZCB 2XDHA 3HE7A 4ODBD 3BUBA 1J8SA 1ICTA 2GKIA 2F7OA 1NH6A 3B3IA 4HIIB 1W0WB 12E8L 3CDYA 5KAQG 1UWYA 5ILTH 3LIZL 4RMRA 1K3IA 1U30A 5I1HL 4NC1C 2XY1A 3T2OA 2K6YA 4XX5A 3KL5A 2BH0A 5ISZA 1OLZA 3T6VA 4ERSL 4Z7OF 4FNPA 1ZGLP 4N2GA 4NQVB 4YSQA 5KVFE 3DETD 4NUGL 4L3AA 1DQVA 1J0IA 3MXVL 2FHFA 2MWCA 1ET7A 3LD8B 9CGTA 1AO7A 4ETQA 1V55B 2YGOA 4G9DB 3RX8A 1JV5B 2QKIC 1AFVH 2VLRB 1KFAL 3NAAH 1MCWM 5LG6A 3WO4C 2DM4A 1CFBA 1KSRA 1DR9A 5JXEC 1AIZA 3FHQA 4GT7A 1ZVSA 3U7YH 2HMID 4IBYA 4PVBA 4DP2X 4LRIA 1E65A 2I9TB 4F7EB 1F56A 3BPCB 4AQ1C 3KH4A 5D4IA 1E30A 1BEYL 3BQUD 4WNSA 2O5YH 5F88B 3WLWC 1GCYA 3TYFB 4WI6A 3G5YB 3UAFA 3V6ZB 1ONQB 1JUFA 5AOJA 4CN6A 4FAAB 1WFTA 2VXTL 2V7NA 4M8RA 3MKGA 3NABH 3IJ7A 3ZHKA 2E9JA 2OCCB 2Q5BA 2M8XA 3ASWA 5FM5M 3ZRFC 1HHJA 4OIIH 3LEVL 3P9LA 1P4IL 3LZNA 2EDNA 2AC0A 2DLFH 4H8WH 3D69B 4R0LC 2UX7A 4YQXH 1IGTA 4CVWA 3H6AA 3FCSB 3GXDA 5CEZH 1H3VA 2F1BA 4TUJA 4U6TA 5IHHA 1SYSB 3OJDB 3DO4A 2ENJA 4N2DA 2Y7SA 3H9SA 3QCUH 5L2KA 1YJDH 1NCIA 1RIHH 1J0YA 3UTQB 5MI0B 5D72H 3UTPD 3IDUA 5F7DB 1HHGB 3WLBB 5CS7A 1XF2A 5B1AB 2HYMA 3O2WH 1KB9K 3QORB 2JLLA 3FL7A 4XAKE 4PBXA 5HTSA 3RX7A 1GRWA 3EJZD 1W15A 4GI9A 4FTVE 3FO1B 3WEXA 1RMFH 4M7JH 5EDSA 2VLKB 3ECVA 4IU2A 1O9WA 4UM9D 1UACL 3ZDXB 1DL7H 3N1MC 3APMA 3V4PH 1QABA 4D0BB 1U2YA 1DBKL 4Z5RA 4HKJB 5L88L 1MCCA 4WO0A 2JIXB 4PMEA 3QJHB 1CDJA 5EG6C 3D1MC 4LPYA 1ODAA 4EXPX 4O58L 2Y1AA 3DYPA 4PJIB 5C09E 5ID1B 5B8CC 4JRLA 4MJ4A 2AS5M 2VM3A 3O8XD 4APXB 3IDIA 3QEUA 5E08L 1HQ4B 1ZA3B 2O5NA 3EYOA 2YAFA 2KLSA 3EGXA 3L16A 4OQTL 3WHXB 4FQQA 2NX5A 3EH2A 1G9NL 3QQDA 3W9EA 3FK3A 1L9PA 4WAFA 1KJMA 3W3BA 5IHUH 4IGBC 4GP8B 1B4LA 1NMCB 4WWKC 4MASA 4KTEL 4AEIH 1TTBA 2W95A 3CFTA 3OAUL 2PW1B 1UFGA 3MODL 1X5FA 2QVKA 4JKPH 5LG1A 4YFEA 2ATAA 4PWJA 4L4TA 2GSMB 2P5WB 3WFEL 3US0A 4X5XB 3L8QA 5E1IA 5EORL 1CFQA 1GGIH 3B9EA 5IT2H 4M5YH 2MSPA 4OCWH 2AJZA 3NSJA 5BUPA 2BNUA 1SDYA 2PR4H 2OJ1A 3GEFA 4P4RA 2RQ8A 5DHYB 3TVMC 3GD1C 2QMKA 2DYSB 2ALWA 2UZYA 3GBNH 3P9MA 3QUZB 1BA9A 2H45A 2NY5C 3KPOB 3A3YB 2OLDA 4MA8H 3S9DB 4NSKA 1KACB 4ZNEA 3C6SA 1T03L 3D3VE 2WJ5A 5CCGE 5E03A 1KIRB 2P80A 1AI1L 3Q7JA 2ORBL 4B95C 5IUSA 2WWKO 4YDVA 1EX0A 2IEPA 3SYQA 2CZNA 4LLQB 1YDPB 4MAUH 4N0FA 1A9VA 1E8ZA 3OVUB 1DEDA 1GTFA 2E6PA 3EJUA 3MRLB 3FTWA 3LN9A 2G5UA 5D1QB 5DQJB 4F9PA 2XFXA 3GSNA 3OBAA 4RWYH 4BKSC 5HHQA 2C3WA 3QWRA 4K3JH 2IH8A 3LJ3A 5GS1B 4JPSA 5BZWA 4ECNA 1A8ZA 2VABA 2BIHA 2Z93B 1A66A 3A4EA 2ZOKB 4XXDB 3K2KA 2C9QA 5FK9A 4JAMB 3AY2A 2W0PA 3JWNH 3V0FA 1JGUL 3W11D 1K4DA 5AYTA 3X14A 1NAMH 4ABVA 4J4PC 2GC7C 4B3EA 1I1FA 4RAHA 1ZPUA 2Y06L 4JS7A 2ZUWA 1S7QB 3N85H 4XP1H 2R8SL 4HFUL 1WAAA 3BZ4B 1KN2H 4NQDA 5HDQH 4B53A 2YQBA 5LN4A 2WLKA 1YYLH 3MCKB 4GXVL 4LHQB 4UQCA 3O3AB 1NLBL 1TU2B 2XIIA 1QBBA 5BZDB 3S88H 2OQJA 5KYYB 5DRWA 2GJ6A 4HOXA 1JJUA 4Y5YC 3MV9B 3H2WA 3IJHB 4RGOL 3K3QA 3VWKA 1FRGL 1IM3B 2ADJB 4DGVL 2ODHA 3IDNA 3ELAT 4E5XG 3ZHLA 4WNQA 3ZKSD 3DDFA 15C8H 4GSDL 4ODSL 3A6OA 4R7NB 1UTDA 4NQEE 3DJ9A 4HMCA 4L5FH 4NQCE 5DK2A 2QQLH 3JWOH 2ADFL 2CIKB 1YPZE 4P05A 4PRBA 5MEOB 1MVUA 4PS7A 5EOQL 1QR1A 3MV7E 1I7TA 2XUWA 2H2SD 3K2MC 1T0NB 4Y2LA 5TQ0L 2WVTA 1IAMA 1J0ZA 3BMWA 4FJZA 4ZQKA 3MC0A 1D9KC 1E3ZA 4PBVC 5IJVB 5KYWB 4K9EC 2YPLA 1DANU 3FT4B 2YPVA 2R9HC 1BWWA 1LK3L 4LCYB 4HG4J 5C0CA 1TO5A 1U92B 5I6MA 3O6FB 5LWYL 3NRFA 4K7PX 3KGRA 6CGTA 5KVFH 1CI5A 4YSUA 3CH8A 5FHAH 1L4IA 2G0KA 4I2XE 1DE4A 4ZS6D 4OGAD 1CLYL 4RX4D 1E2VA 4K71B 3PWJB 1KWGA 3HPLB 3F64A 2IH3A 1VADB 3QO1A 5IKCB 2GVYA 4CBZA 4IEFA 4PREA 5T33L 3GSXB 5GGUB 1W0VB 3RVUD 4Z3JA 4GBXD 2UWEB 2H41A 2IXQB 2FHBA 5F70A 5DURD 1QPKA 4O51A 3QXDB 1PYWA 4JFYB 5IHZB 4K5OA 5LN8A 4PYGA 1YC7A 2NY4C 4U33A 3O2DH 1JWSB 4MQXC 1RZKH 1S5IL 4YVNA 1WFJA 3I75A 3MJ7A 1FVDB 1JXDA 1SOKA 2L7JA 2ZNWA 3L95A 1R1CA 1VGEH 3FH7A 5DVKA 1OF0A 3DYOA 3NT0A 5AZUA 3UJJL 5CIPA 2J43A 3IGAA 2EADA 3SHSA 3B2XA 4WW2A 4UTCA 4BKTC 5D7IB 4RAVA 5I1GH 1PU0A 1X5XA 5DMGC 5IFAH 5I15L 3MR9B 1J12A 3CC1A 2XQ0A 4LESA 1H8NA 4ZFFA 1U8JB 3C9NB 5CGYD 3WS6A 4JKNA 3GZOA 1JRHH 2I60H 2VDLH 4OF0A 3V95A 1Q0XL 3TTYA 1HHHB 3V4VH 2VJ8A 2CDEB 2HXAA 1PY9A 1SRDA 1E6JL 4XP9H 4JZJC 4D0CA 4EXKA 4XCCL 1H5BC 1I1CA 2QSCH 3MRQA 4JRYB 3UOAB 4BWUA 4D9LL 3EFDH 2CNYA 2WO3B 1CR9L 1WSST 2NY6B 2XWTA 5EV7A 1V27A 1YSOA 1S7UA 1G7IB 2X70A 2KYIA 4GIOA 3G6JF 1QWHA 2NCMA 3FQNA 2OK0L 3PJLA 2EO7A 4M7KL 3L6FB 4TUUA 1YQVL 4M62H 2G5BA 2GIMA 1AKJB 4OZFB 2NXYB 1RURH 1E50A 1KGUA 4L37A 1SF5A 4UQ9A 5B1CA 2FIKB 4TVUA 3VQ1C 2B77A 3L5XH 1FNGA 3GSOA 3QRFM 4PI2A 3R4RA 2EXTA 3WTWA 1OGTA 1XIWA 4OU3A 4N0CC 1GYUA 2XWEA 1D5MB 4WFHE 4HIXH 1CFNB 4PRAB 2NR6A 1RJCA 4U3SB 2OMZB 3WI9A 5I8KL 1N4XL 2CKBB 4AG4L 1DO6A 5L6YL 2WXRA 4HWZA 1JDCA 4TNGA 1ML0A 2XA3A 3G5VA 5H8DA 3BPOC 2ICEB 5BMFL 3KPMA 3VFWA 3GSQA 4YXKH 3HG2A 5KSAD 3SJVB 4JDTH 4DZBA 1CMOA 3P30L 4OCMC 4HFWB 3S37L 2GEEA 1Z9PA 4L9LA 5C0EA 4Q74A 2O30A 5F1SA 5DJ8B 5IHBA 3WNPA 5C0AB 1S3RA 2W91A 1S7VA 2HT3C 4FQ2L 4NAQA 3UTZB 2YD1A 4A2GA 4B60A 1DLFL 5ADPH 3FAWA 3P9WB 4FNLH 2ADGA 4FZEL 4JPIB 1C5DB