4LGRB

Ricin a chain bound to camelid nanobody (vhh3)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
VQLVESGGGLVQPGGSLRLHCAASGSIASIYRTCWYRQGTGKQRELVAAITSGGNTYYADSVKGRFTISRDNAKNTIDLQMNSLKPEDTAVYYCNADEAGIGGFNDYWGQGTQVTVSSAHHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ricin
publication title Crystal Structures of Ricin Toxin's Enzymatic Subunit (RTA) in Complex with Neutralizing and Non-Neutralizing Single-Chain Antibodies.
pubmed doi rcsb
source organism Ricinus communis
molecule tags Hydrolase/immune system
total genus 34
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2013-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lgrB00
1H8NA 2X5PA 4Z7UA 4R26H 5E4EC 1ZOXA 3OKLA 4ZUSB 3V0AC 4MQ7B 1SBSL 1AFVL 4GAJL 4FQ1L 4JZJB 3H0TA 4D9RD 2I9LA 4CVUA 3TN0A 3E1F1 3D0LA 3QFDB 5L8KB 1Q0XH 1N6VA 4WUUD 1NUFA 2A6DA 4ZFZA 4BH8A 1EHXA 4M3KB 4ZDHA 3K74B 3CFBA 1WC7B 5EZOL 4R4BA 2Y6SD 1A7RH 5FYKU 5C07E 4OD1L 4P9HH 3HG1D 1BFOA 2W0KA 4LSUL 4LVNB 4MLIA 2DIBA 1M4KA 1P69B 4FQXA 4OLZL 4AL8L 2VH5L 5ACZA 1A7NH 4KQ4L 5IJVB 5ICYA 2IQAB 4NQXA 3O9WB 5DRZB 5MENE 4P2QA 1RMFH 3DI3B 2VUOA 3O3EA 1KIUA 1S7QB 1MCJA 3D9AL 2NY6C 5EU6D 1EHLL 4L3EA 3HE7A 3WHE0 1IL1B 4HD9A 5SWSD 1NGYB 2X05A 1QEWB 4MXQD 1NAKL 1WZ1L 4Q0XL 5I73B 4XI5C 4PRPB 5IMMA 4Z7QF 3WFBH 1YJDC 5EORL 2DQJH 3B2VH 1MUJA 5C0AA 4FTVA 1WCQA 3OBAA 2F74A 3GBML 5A2JH 3V6OA 1FYTE 2P43B 3BPCA 3MV7E 1L9MA 3W5NA 3BHBB 4JPVL 1HHGB 3C87A 1Q94A 2IMMA 1MIEL 1OAZL 3UZQA 1KYOJ 4G8IB 3GKWL 3STZA 1TJGH 1FO0A 1QHOA 1FVDA 2FATH 2P46B 4K3DH 1EZVX 1RUKH 1I7ZA 5HGBB 2IAMA 3WXVH 3RTQD 4PRNB 1HDMB 3WO4C 4FQJL 1YPZB 3WFZA 2Z8RA 1LO2H 2MNUA 3JTSB 5DQ9B 3NTCL 1AC6A 3X14B 4WY7L 4R3SA 1I9RH 1QFWH 3EDFA 4G43A 3RZCB 1ZK9A 3D2UB 1II4E 3BKYH 4HKZA 1RVFH 3QYCA 4TSBH 1KCRH 1N6QH 3ME0A 2HJFB 2HMID 1QO3B 2C3WA 5DHXB 2OBGA 2GSIA 4JFPB 4EXPX 1EH9A 3N1GC 1S9XB 5E94A 2R2HB 4HBCH 4OF3A 4PJFB 1F11B 2ZWLT 2BY3A 1NAML 3QPQD 3DBXA 1AKJB 4YUEL 3FJTA 1DSFL 1FZKA 1TVBB 3O45A 4EI6A 4HGMA 1TNMA 4X7TB 4NPYB 5ESVA 2VXSH 5ADPH 1R5WA 3DXAA 3HRZB 5D71L 5E5MA 1SJEA 5ITBL 1HHIB 2DWEB 5HY9A 1J9CT 1G7QB 3QHTC 1GSMA 4GBXB 1T2QH 5I76A 1JHTA 4MX7A 3LHPL 2I27N 1KIRA 5TPWL 1UACL 1TZGL 1LEIA 4MDJB 4ERSH 5A2KH 3TO4D 2R69H 1IGYA 1QTYT 5HYJA 2NX5D 4D9QD 5FO7B 4NT6A 4AEIL 5GS1B 4O02H 3D25A 1EVTC 1T0NA 2XACC 4PJAA 1EPFA 3DVGB 3DVNB 5EO0B 3DIFA 5GGSB 3DRTA 5CZKA 1LDPH 5GRYA 1NC4A 4D3CL 4R8WL 3V4VH 4P57A 3BGFC 3JSSA 4RGMB 3TBTA 2PYED 4C83A 2JJSC 5IF0B 1J7VR 4GMSH 5CIPA 5F1SA 2VRAA 4YEFA 4JVUA 4GKSA 2EDDA 3JV6A 1KN2L 1CXIA 2XNAB 4WU7A 4GAGH 1CFNA 3UBXI 2SEBB 3BQUD 5I8KL 3BZDA 4P5TA 2VXUL 4NC1C 1CDBA 1LE5A 1R3JB 1DQDL 1X44A 1ZANL 3DV4B 1RZ8A 2FECI 1V7NL 1T1WB 3GMRB 4XRCB 2IH3B 3I85A 3MFFA 4YR6B 1NCWL 2E9IA 4XNMA 5EUKB 3FT3A 2KDGA 3NFNB 5KVMC 1K6QH 3V5HB 5DQDH 1I1FA 3UYRL 3MLWL 1S5IL 4MMXC 1JGDB 1RD6A 2UZIL 5DZLA 12E8H 3WS6C 3MRPB 3SJVD 4M8QB 4ZPVB 1SM3H 1NPUA 2DM3A 2EYTA 3I6GA 1C5CH 1MJJB 2BVUA 1GCFA 1OTTD 4RA3A 2VZUA 1QKZH 1XEDA 4KTDH 1DL7H 3RGHA 1CDGA 2M2DA 5JXED 1JNJA 1CGXA 2HWZL 3HMWL 3RVVC 2APFA 5KVEH 4B41A 3VG0H 5IUSA 2DJSA 2WBJC 2Z4QB 2MTPA 1D5MA 4ESKA 3BPNC 4HWNA 3VFNB 1I9JL 4QHLB 4LPTA 4OLXH 3VFUB 4QHMB 3MACH 2ADGA 2XTJB 5ADOL 3PQYA 2BVOA 3L3HB 3H9HA 4KHXH 4JO3L 2VR9A 1YEKH 2LV4A 4URTB 4JFEE 3KG5A 1OPGL 5I18H 1XF5B 4PJ8A 2YKLL 4L9LA 3MR9A 4N1CA 3B9AA 2VQTA 1YYML 1VDGA 3F7YA 4UIKL 1JWMA 3V5DB 3SE8L 1S7SA 4OM0L 5M7QA 2AEPL 1SYSB 3QI9C 2CDGB 2CLRB 4X7FC 2ZUQB 1OT1A 1EAPA 3V0WL 5GHWH 2OP4L 2ED7A 3A6BH 4TTDD 3SCMB 1Q72L 1UWXK 4ZS6C 4MNGE 5E2WL 1L0QA 2DL2A 5HD8C 5DQJB 5K9QG 1R5VA 3HE6B 1WBXA 5E6IB 4AQ1B 4F7PB 4P46C 5H2BA 3ZE1F 4F8QA 2FX8H 4M62L 4RAVB 2DLEA 4NRXB 4YEEA 5IHZA 4LLMA 2ORBH 4LHUD 1R3HB 3MNZA 1FNAA 2YSSA 2BNRB 4B53A 2GAZB 3MNVB 4I9WD 2YRLA 3F65A 3STBA 3VXMB 4U0RC 3BWAA 3GSRB 4LLWB 1QBMH 4JFYB 4U1GB 4DTGL 1KFAL 1JFQL 3V7AE 1INEL 1MFDH 2EIBA 4LCWE 4ORZC 5EWIL 4GSDL 5ESAA 5BRZE 1T66D 4ZUUB 5DJZA 4JM2A 5FUCC 3REVA 3DYPA 5JORA 3FO9A 4LCCB 1XGUA 3NCYS 1CDHA 4NRZA 5IVZA 1DUZA 1UB5A 1RZKC 4I3GA 4X9HA 1UWEH 1MAJA 2IPUG 3ELAT 3C2SA 3HUJE 4K23L 1F6AA 5MEOA 1RPQA 5E7BA 2DWDA 3BN3B 3I3EA 4HCRA 3GSVB 1J1XL 3L9RA 4UQ2B 4YFEA 3GIZL 2W0FA 4NFCA 4WFHD 5GRUH 3IXTA 1UFUA 3GM8A 1QSZA 2WBKA 3GHBL 4FG6D 3WUWG 2YBRA 4IEFB 5IM7B 1MLCA 5MEQA 1BD2D 2MPAL 4D0CB 2DQFB 3U0WH 1VFBB 1D5ZA 4M1CD 1YC7A 4IIQA 5C0IA 4R90L 1RHHA 3RRQA 3TBYA 4JY5H 1WFOA 3C6LD 3S96B 5CP7A 4P2OB 2IANE 5I1GH 4MJID 4PV9A 3VA2C 1M7DB 4G6AC 4IJ3B 4ZO7A 3MV8E 5FYJD 3R0MA 3BGMA 3SKOB 3RL2A 2QQKL 3QXWA 5BQ7A 3G6JF 4QWWD 4F2MA 3U36A 1PY4A 3FT4B 1MH5A 2G2RB 1N5YL 5K59F 1C12A 5KSBE 1ZHBB 4OD1H 1YQ2A 3GGWB 4MNQD 3TVMA 1AGDA 3HR5B 4XZUB 1FFNA 4YBLB 4PRBA 2FIKB 3QIWD 2P47B 4PJBB 1NEZA 5I15L 2CGRL 2EC9U 4Q9QH 2J8UB 1MF2L 4AH2A 1NMAH 1EXUB 3L7EB 1ZHNA 4UNUA 2WUCL 3PHSA 2IADB 2WINA 2GEEA 4TRPH 3LZFL 4HFUL 4S0TD 3VWJC 3JV0A 4HIEA 4EBQH 1HINL 4OKDA 5I74C 3T4AA 5HHQB 2DM4A 3PG2A 5DJ6A 3TC9A 4HFWA 4K7PY 4KJPD 2AQ1A 1FFOA 5TE7H 3GSNL 3O8XA 3MNWB 5FECB 2VZSA 1NMBL 3CFEA 4XTRD 4QF1B 4GLRH 3QJFA 1C16A 1J0KA 4ZS7H 4PREA 1U95B 3RWEA 1PFCA 2YC1A 2VLRB 5TH2B 4LPUA 4OCLC 3QWRD 1CXKA 4HAGA 4LLDA 5INDA 1GZPB 2WAHA 2EDLA 3PL6B 1D7FA 4F9LC 1YN6B 5KTEL 4W6YB 5CGYD 1OP5H 4FQJH 2XKNA 1GAFL 1A6VL 4ISVB 3MBEB 3B8SA 5F1OB 1EGJA 2C3GA 3TBVB 4ALAH 1P5UA 5I1IH 2OR7A 2AXGA 2EDOA 3LB6D 3ZHKA 1IGMH 1MWAB 2YZ8A 4MD5A 3L6FA 1URLA 3IKCA 1JWSB 3S37X 4DKFL 5JW3L 3GSXA 1FL3A 3E8UL 1DDHB 3CCHA 4XMPL 4WJ5B 3TIEB 1PG7H 1LD9A 5IKCB 1CD8A 3O6FB 4JGJA 4CUCA 1AHWC 4CVWA 4M9OA 4IRSB 4HWEH 4Z77B 3RUGF 4U6HB 5LXGL 1B4RA 4JO2L 1EFXA 4JZOA 3KPPA 1ND0A 5EUOF 1N59A 5C9JA 3LN5A 5DRNB 4PGEA 3LH2L 3QPXH 3CU1A 4DFIA 4PJDE 1BBJA 1CDIA 3UTTE 2XN9B 1YEHL 3UJIL 4WU5B 4FP8L 3I02A 4HJJL 2Y07H 3IDYC 3EIFA 3ZE0F 2M8XA 1FV1B 1HSAB 5IEKB 4XP4H 3QDGB 4LLVB 1UACH 3TYFB 1G6RA 1X5KA 4O5LH 3MFGB 1PQZB 4HIHA 2OZ4A 9CGTA 3UPCA 1I8IB 1INQA 4Y16A 4NHCH 3BPOB 4ZXBA 4JFHE 1F4WH 5I16B 5IMKB 3N50A 3HZKB 1KGCE 4U1LB 1WBYA 4YDVB 1QSED 5DF0A 2NLJB 4CBPA 2AJXL 5C0JB 2AS5M 1I1AB 4KRMB 1FGNH 4TQEH 5FGBA 5IFAL 5KZCD 2HAZA 5H37H 3S6CA 4GG6B 3D39D 1IM9D 2NPLX 5F7KC 3SE4C 5EFIB 5E6ZA 1C8PA 4YXLH 3MRQA 3MRLB 1I8KA 4PRIB 2E7CA 4JFDD 5B39A 1I3GL 1U8NB 4PJ7E 3WNMA 4F7TB 1RZJC 4L4TA 1KN2H 3VH8B 4F7EB 4H26A 2D4FA 4HS3B 1ADQA 4JRXE 1LHZA 3SOBH 4EDWL 5BVJB 3SO3B 1NCDL 2EXYD 4NCC1 3BDYH 43C9B 3UPRB 1YQVL 4NFDA 4G9FB 1P4BL 2D2OA 4NN5C 4NWUH 5I8EB 1NGQL 1SYVB 4PJIA 5DR5H 1KLGA 1U8PA 4S1QH 4WUUA 3JWOC 2FYYB 3BO8A 5DVKA 4LCUB 5AZEL 3V0VB 2UWEE 5JPNB 5KS9B 1RZIB 4G5ZH 4QO1A 1ZEAH 1H0DB 5F96L 2L7UA 3MRFB 1DN2A 1S5IH 3CSYA 3SDDC 5IGXH 4NDMA 5T1LD 3OAZH 5IW3A 3ILPA 4JFFA 1DEDA 4KGJA 2GT9A 4FN0A 2VMFA 3QT2A 1U8LA 1E4WL 4IOIB 5FYLH 2PO6B 5HVHB 1PKQA 4M61B 4LQFH 2GK0B 5TE6L 4AT6B 2XWJA 2YPKA 3W9DB 3VXOA 1RK1B 5EA0L 5CBAB 5GGQH 2CLVB 1G7HB 1CYGA 4TPRH 3EO1A 5EU6A 3GI8L 1ODAA 4K7FA 1RJLB 5KVDL 2O93L 4N9GB 1KOAA 2XIDA 3CJJA 4QHUB 4U7KA 1I9JH 2E6PA 2X42A 1J8HE 4MVBD 3BP5B 3VGHA 4KZDH 4ENED 2FHCA 3O4LD 4HUXB 5ADOH 4CN4A 1ZXQA 4GMTL 5GJTL 1BIIA 3CK0H 3QH3A 1T5XA 2VC2L 5CZXC 3SY0B 1BQSA 1NLDL 4Q9RH 3EJZD 5DHVH 5T1DH 3OJ2C 3W0WD 5I66A 5AYUH 4OZHA 4AENB 4UQ3A 3WSQL 5FUOL 8CGTA 4Z7OE 1NLBH 3VU2A 1FZMB 3P4MB 4M5ZH 2X4TA 3E6FA 2R1WB 4UIKH 2HKHH 2H9GB 3FO0L 3QEGL 1DQLL 3BESR 3O3BB 3L3JA 1FDLL 4F37K 5I6XB 3LV3A 1SEBA 1A7PH 4NIKB 2CIKA 1MHCB 3BIAX 1X3DA 4OM0H 1RSFA 3RTQA 4ZPTA 5LG1A 4D0DA 2JJTA 3V52L 4XBEL 1MCSA 5BV7L 3GNMH 2BY1A 2A1WL 1REIA 5HDQH 2R1YA 4MB5A 2ZSVB 5E56A 4P2RD 3BIKA 5LAXB 2HFEB 3LEYL 5E5RB 1AI1H 4NHUB 3C8KB 4ELME 4WDIA 5K9OB 5CSGA 1KCVH 2VXVH 5FYLE 4ODSH 4HK3N 5FYKL 2NZ9C 5INCA 4MS8C 1BVZA 4Q97A 2ITDA 5GS3A 4OZFH 5D8JL 3TT3L 2VDML 2DLTA 4M48L 1IC4L 3JTTB 1CFSB 4LF3B 3ROOB 4MAUL 1XGYL 1NDGA 1S9VA 2V5MA 3DV6A 4XCCL 5J13C 2VE6A 4FXGA 3QIUC 3TH3T 1BOYA 3QO0A 4APQB 1DBJH 3I50H 4LLQB 4YHKL 4RGNC 3GI9L 1J0HA 1RIUL 5AAMA 1JGEA 4C56B 2EH7L 2W59A 2IBZX 4OIIH 5FYKD 5A40E 3F7QA 4R7NA 5FOBA 4O58H 1MI5E 5EBMA 4LGRB 4PJGB 1O7VA 1CICD 1LVEA 2WV3A 5FA3B 2GFBB 3MV01 3VRIB 4CMMB 5I1AB 2GYSA 5I9QC 3FOLB 4R2GD 1CFVH 4FXKA 2NW3A 2R29L 3TO4A 1I1CA 2VDRL 1NAMA 3RGVB 4RFEB 5T3XL 2NX5A 2B1AL 2I60L 2ZUYA 1J1XH 3G9VA 5EULV 4R96B 4DJMA 4YNYA 1RU9L 1R3LA 3FQRB 4MAYD 1BX2A 2P4AB 3HKFA 5DJYA 2EDWA 3QNXA 4U1IB 4WHYH 3BP6A 1OCWH 2H32A 3HNTH 1VKXA 3PDGA 4N0UB 1A9BB 3QDMB 4NQVB 5E9DB 3RNQA 2VLLA 2A0LD 4KV5F 4KROD 1JNLL 3V5KA 3JWDL 4CDHA 4CVZB 4XC3H 1DVFB 3GJFK 5JZ7C 1LEGA 4Y4HC 1NGZA 4M7LT 2PYEA 3L5WB 3FCTB 4JANA 3ZHLA 3TM6A 4UT7H 32C2A 4D0BB 4OFPA 4E0RA 4QRTA 1MRCL 2AK4E 3O0RH 4MDIA 1P6AB 2A9MH 3F7VB 3RKDC 1GPOL 1TCMA 4P9MH 1EDQA 2E7MA 1NC2A 2YEZB 2J88H 4LPYA 5I1JH 3V6ZB 2Q8AH 3CFDB 4U05A 5JHDB 4XX1E 2JF1A 3L1OL 4NQEB 5D1ZD 5LWYL 5GGTL 2FHFA 1CQKA 3UTPE 4WWKB 1KLUA 4GW1A 5EBGA 5JO5B 4FZEH 4TOYL 4XXCC 2D9QB 4QRPA 4NYLA 3BP4A 3BZ4B 1WWWX 2YXMA 4F37F 1WUNT 2CGRH 4L4VD 4XVTL 4V2BA 5HI4D 1ES0B 1S9KC 1MF2H 5KSAC 3ULVH 2P8MA 1RUPH 4X7DC 1AD9B 2DQCH 5IQ7H 1MCOH 1F3RB 1X7QB 2QR0B 2WUCH 4OBSA 3LKRB 4OM1L 3FB7A 4BYHA 4YHNB 4U6VL 1QQDB 4YPGA 4BK4A 1MCWW 5E70A 5JXEA 3N1MC 1B0RA 4XP6L 3RVUD 5MI0C 2AJZB 1HINH 2C7UA 4E41D 3WFHA 4EUPA 5IB1A 4JPWL 1I3RB 3KYMB 5I1DA 2R0KL 3PP4H 1R3KA 2DRUA 4TVSa 3FL7A 1J8KA 4XGZB 4UBDC 1QFOA 4FQHA 3PABA 4Z7UE 4NZJA 5FK9A 4ODUB 3QWOB 3MLYH 5K9JH 1QBLL 2HLAB 3VFOB 4P4KD 4N9OB 1OM3L 3ZT5A 4FNLL 1SY6L 3HPLA 3HZVB 2VZVA 1QPXA 4HZLA 2X9WA 5F9WB 2M26A 3VXQA 5L6YH 1YEGH 5C09D 5KTEH 5CMAA 3GUTB 1UG9A 1KELH 1UVQB 1MQKL 1KJMB 3QUXC 4OGZA 3PF2A 2HLFD 1KB5L 1JWUA 3BUTA 25C8H 5IG7A 1BLNA 2VLJB 2V5SA 1BFVL 1CZ8H 3LN4A 4ODTH 5JW3H 1LEKB 3QQ4A 1HKLL 3MLTB 3E8UH 1NFDB 1LK3L 1EIBA 4XMPH 1UM6L 3GB7A 3U30B 3OAUH 3EYFA 3OMZA 3DUUB 3S9DB 1S9WA 5GQBA 3ULVE 4PGBB 1TCRB 3NMEA 2X4NB 3TN0C 4L3EE 3ARGD 3U9UB 4M7ZC 2ZUSA 1Z9SA 4AQOA 5EO1A 5DVOA 2DQHL 4OKVB 5DYOA 4DOHE 1MFNA 1T1ZB 4QHKJ 2DQGL 3WDHA 3CVHL 3A6CH 3LY6A 3TPUB 3X12A 3WKML 5C6PB 2UVEA 1J1OL 4FTVE 4NQDD 4HJJH 4WHCA 3WLWC 5B3JE 3V6OE 1UWGL 1A7QL 4FQXC 1EFQA 2GJJA 1JRHI 2R39A 1U3HB 2BNUA 1JZ6A 1XGPA 2Y1VA 3MBXH 4PJ5B 3VGEA 5LBSH 1J18A 5E8EB 1A3RH 3KHOA 4K8RL 4EI5B 3T65A 1KSRA 4NO0B 4UDTA 2EKSA 3V8CA 4ZUVB 3HE7C 2CDEB 4YGVA 3KLAA 3V6FA 4JY6A 3KGRA 4XNXL 4HBQA 2HRPH 3ARFB 3LKOA 5IFAH 5GZNC 1B3JA 4HXBH 3ZKQD 3NCBB 2FJGB 3B9EA 3P9LA 4OZGE 1BOGB 2VB5A 1AGCB 2PTTB 4GAYA 5IHBA 3IFPA 4N5ED 3CDFA 4K8RD 4AEEA 3EJJX 1TJHL 2YPVL 3C8HA 4KK9C 1OGAE 3BEWB 1WQVT 4I0PC 5F7DA 5ALBL 3DHJA 4R4NC 4EDWH 43CAB 4XBGA 2OX5A 2DBLL 5DI8B 3C6LA 2Y5TA 4ZAKB 5F6HJ 2QQLL 3U6RA 1ZLVK 2D03H 2IAMC 1P4BH 4OFYA 4MJIA 1KTLA 2PXYC 4HH9A 1GOGA 3VXRB 5HHPB 5DEFA 1ORQA 4RISH 4PG2A 5FA4B 3TZVB 4YC2C 1HI6B 3DXAE 5F96H 3VD4A 4LGSB 1OVZA 1UH2A 4X6DB 4PP1D 5HHXL 4KJYB 3BRGC 4MNQA 5I8OH 4JPKL 1AGBB 3T3PF 4F80A 5F7FA 5TDOB 3HZYB 4G7YH 5EPMB 5HYJE 4EOWL 4K55A 3TT1L 4G3YL 2D7PA 5FF6B 1T0MB 4PJAE 1A6AA 1VADA 3IFLL 5DFWH 3DSNA 1QD0A 4X7SL 3SKMA 4V1DE 3WXWH 4QRQB 5GGVY 4A6YB 5E8OB 5BVPL 4C4KT 3T0BA 4RX4A 4LKCB 1KCSL 3N0PB 2K7QA 1MNUL 4IOSD 2PW1B 5FCUL 4OT1H 2JCCF 2CJUH 5GSVA 2BHUA 4BA8A 4PIRF 4G42A 2ESVE 4UILL 4YIQA 5DA4A 3HAEB 3T3MF 4ODXB 1J1PH 1RZFL 5HGHA 2X40A 3KJ6L 2MOVA 3FOMB 1M7IA 3FQUB 1OAXH 3OAYH 2D31A 4MXWH 1YNLH 4PLJD 3MV11 2DMKA 4N0FA 3SDAB 5I1HL 4OI7A 1WSST 1IAOB 5F88B 2Q8BH 3BKJL 5F9AC 3G5XB 4X9FA 1TIUA 3BDBA 3RDTD 2R2CA 2DM2A 4FFYL 3QWRA 4M6OL 2I9TB 1AGFA 3FQWA 2DKSA 2YOCA 5E4IA 3B5GA 1ACYH 4G6KL 1Y18B 5HPMA 5E4EB 5K93A 3SKUD 3GSNA 5CWSB 2YK1L 2MQ0A 4JCLA 3LQZB 3D3VB 3WD5L 2X4PB 1IC5L 3P4OB 1CGVA 4ZFOB 4LLAA 4MJ6A 1A1NA 2P8LB 4IMLA 4YHIA 1AO7B 3JVGA 5IV2B 4QXUL 5ESQB 3T0EA 4NWTH 3TO2B 4HXAH 4HKXB 2A6IB 3MV9A 4HGWA 2GITA 1JUFB 4ODBD 3PV6A 4OUOA 3CD4A 4P5TC 1A0QL 2GY7B 3H42H 3NCJL 5IB2A 3HI6H 3OKKB 4Y1AE 4Q74A 3DX7B 5TF0A 1KJ2A 4PFEA 4OZIA 3NZ8A 2FBOJ 4MAUH 3F62A 3LKNA 2HT3C 1XR9B 1NGXA 3QEQB 4WTXA 3D2UD 4RAHA 1IEHA 2Q6WA 1YMMD 2NY6D 1ZSDA 3BX7C 3U4AA 2FL5A 1HOCB 2YPLE 3DRQB 3ILQC 3B2UD 1YC8A 3MJ7A 5MP6H 1K4DB 1A6ZA 1CR9H 2VXQH 4AMKL 5ITFA 3CDGB 2XPGA 4LARL 1CBVH 2OL3B 4LSTH 4MJ5A 5IOPA 4ONFH 1QLFB 3HI1B 2IJ0C 2DQIL 3S97C 3IDJA 4M5YL 1QA9A 2HVKA 5DT1L 4Z5RB 1LNUB 1JYWA 1MHHB 3STLB 3KWWA 3OKEA 3PWJA 2CLZB 4QYOA 3FHQA 5T3XH 1VACB 1YY9C 5FV2A 2I60H 5K9QI 1AR1D 2YR3A 3ZSSA 3WIIH 1HQ4B 4QRRB 4ZOAA 4ZUWA 1HHJB 4QRUA 5ACMA 5MENB 4NO5B 4JO1H 5L9DL 1F45A 4Y2DA 3TJEL 1IQDB 3V6BR 2CIIB 3IU3A 2RCSL 4MWFA 4Z7NF 3D39A 1IM9A 2X4SA 1G0XA 3WO4B 4YE4H 1W72A 3RIFK 4XPGL 3O2WH 4LFHG 4JFDA 2LQRA 3LQAL 4ODVH 1T1XB 1VGEH 2YZ1A 2Z91A 4L1DA 2V2TA 1ZGLP 1BFSA 4HUWB 5D2LE 4PJ8C 3AU1B 4L9LC 1IEAB 2AXHA 3QEUB 1MRCH 5FUZL 3TBSB 4H25B 3RPKA 4DVBB 5F6IC 5FO8A 1R0AL 4UT9H 1FYTB 1DTUA 2W9LA 1QHPA 3B5TA 3HC4H 1XCTA 4WVRA 3PNWA 1N26A 3O6LH 1KN4H 4RWYL 2H3NA 1D9KD 3RWIA 3KPNB 2R4RH 5BXFB 1QR1B 4BFGA 1WISA 1FNSL 3RIAK 4J12A 3L3KA 4UTAL 2VDKL 1N4XL 2Q7YB 1MCQA 2H8PA 5EOTA 2Q86B 5GGRA 2PTUA 2WW8A 3SGEH 5ETUA 1W0YT 4PJHF 2A83B 4OCSH 2X4UB 5ABDE 1EK3A 1EJ6A 4RRPG 2ICWJ 4HUKB 4O2EB 4JN2A 3WHE1 3P73B 1OGTB 5F1NA 4L3CB 4WTZG 2VQ1A 3T0VA 5CHNB 2AKRA 3PIQB 3C6SB 2NXZB 5T3XE 3GO1L 2C1PB 3BPLC 4NO3B 3ARDD 1CLOL 2UUDK 5F9OH 2ZKHH 1TENA 4OAWB 1RQ5A 2PUQT 2OR9L 4FZ8H 1ETZA 4GXUM 1KJVA 3ZHDA 3VFTA 5GIRA 1JK8A 4CAGA 4AIZB 2GJZA 1WVZA 1K5NB 5EOCH 1FNEA 3AC0A 3DHMA 4RZCA 1ORSB 4GW4A 3VE0B 1KF9B 3IJYB 1D5BA 1JZ2A 3O4LA 5L88H 3CLFL 4LEXL 4HC1H 3BGFB 5FHBH 4X80L 1KXTB 4QHNA 4F8TA 4TVPL 3Q5YA 4ZYKB 4OD2B 3QEHA 4POUB 1QR4A 4NNXA 2FGWL 3W0WA 4GRMB 3PWPA 1JGLL 2BZDA 2QSVA 2HT2C 2AK1L 4R97B 4GKNB 1EGJH 2PR4L 3HB3C 4HJ0C 3VXPB 4MZ2A 5KSBF 1GYAA 1PEWA 4WHTA 4BFIB 4RMQA 3L7FA 4Z76B 1MHPL 3VRLF 3KPMB 2JE8A 4IIQC 3ESVF 3QULB 5J9PB 1NDMA 3MRBA 4P2RA 2NR6D 4TVPD 4JLRA 4QGYA 3BW9B 2ADFH 4KKLC 1Q0YH 3OKDB 3G5ZA 2NYYC 2FRGP 1LWRA 1ZV5A 3MREB 4YDJB 4XCFL 4X98A 3MLZH 1I4FB 3SCMD 3PP3K 4R0LA 3TF7C 4QXTA 5D7LB 4XNYH 3SGDH 1K4CB 2H2PD 1FH5L 3MJ9L 2DQGH 3K1KC 1ZA6A 2XZCH 3AMKA 5E6ID 4XCYA 3WKMH 5CD3B 3Q48A 2FWOA 2A38A 2R2EB 1T1YB 4KXZH 1A7QH 2VISB 5DFVD 2WBJB 2ICWB 3EYSH 4Y5VA 3SKNA 3QDJD 5DMJB 3ABZA 5GS2H 3BPNB 1O0VA 3TH4T 1OTUD 4N90D 4XNUH 4PRAB 3H7BB 3GSOA 3HRPA 1CICA 3U0PA 2IG2H 5B8CA 4K9EH 3MXWH 4I3SH 2MHAA 1QSFB 3SDYH 5J11C 1IGTA 1XGTA 3AXLA 4HIJA 4K7PL 3QHFL 3I2CH 2R15A 5ID0A 1H9VA 1UKSA 2NXYD 5DJDA 3TYGL 4HWUA 5H8DA 4KTYA 2NY5L 4QTHB 4HZAA 4XXDB 5HSFA 1UENA 3DUSB 3HC0B 4MAYA 3L95A 1NUDA 8FABB 4LSSL 1TQBB 4PJ7F 2ZG3A 2EECA 3BD5A 4IRZL 3WDJA 2VSDA 3EYVB 2OK0L 5TDNA 3SPVB 1ZVSB 3VFWA 5KJRL 1KEML 3HR6A 1ADQH 2J6EH 3GMOA 4NKDB 5CEZL 3QI9B 1P7QA 4CW1B 1GH7A 2B4CC 1XR8B 3VWKD 4JHBA 3MX0A 2FO4A 2OJEB 1T20B 2X1WL 1B6DA 5SWZD 3RY6A 4OJFL 3V7AG 4L3AA 5ALCH 5C0DB 1ZT4B 5L8JB 4KK6C 4JO4L 5HI5C 5A3ID 1FGVL 3CFJA 5DJ8A 3QQ9D 3FT2B 3I6LE 4HDIB 4WFGD 3O41A 2P8PB 2UWEF 3LEVL 5C7XL 1IBGH 4OUUA 2ZCHL 4X6CA 4P46B 1RZGA 4MGXA 4JFEB 3T2NL 3EGSB 2JIXD 2G5BA 1UZ6E 2HP4A 5HYFA 2YUXA 1F8TH 3GRWH 5D1ZA 4YX2L 3ULSB 2BSTB 4JPKH 1MHEB 5D1QD 3S4SB 3D0VB 4U0RB 3DURA 5IW6A 1FORL 5EU4A 4OCMC 4X5WA 5FOJA 4EOWH 4F15C 4RFNC 4HUVA 1NCAH 2BFVH 4RNRA 5EU7C 1RK0A 4XC1H 2EE3A 3OPZL 4L4VA 4E9LA 4XWGL 2EYRB 4WV1A 1F3JA 1HSBA 3BISA 1WT5A 4H20H 5E6YA 4X7SH 5IVNA 4MNGB 2DTML 5F3HB 3C5ZD 3MPCA 1CLZH 1E6OL 5DRWA 1Q9LA 5BVPH 3IU4L 2DD8L 1WZKA 1KCSH 1G6VK 2OQJB 5GGTA 1I7TA 3RWDA 3T09A 4ZFFB 2HJKB 2Z35A 3KLHD 4OQ1A 4E41A 1L7TH 4ZFGL 1IGJA 4JQXA 4GUPA 5EBLB 2APBA 5ANMA 4Y4FC 1RZFH 4N1EA 1VEPA 1MCRA 4L4TE 3MROB 1G0DA 5DK2B 2LTQC 1QLRB 2ICCA 5CCKH 4XP1L 2YD7A 3FQTB 4EXKA 1I7UB 4LASH 1DBBL 4LCWB 5L2JB 3LRHA 3LS5H 5BRZB 4D9RE 1BZ7B 3FRUA 5HTSA 5JDSB 4EIGB 3K1DA 4PJIE 5H35A 5C09A 4G6AD 5FGBC 3NFPA 4XPHL 3MA9L 1HZHH 3NPZB 5CUSL 3TJHD 4DVRL 3BUYB 4HJGB 1YMHA 1MFCH 4JFFE 4P59L 4YO0A 4M4PA 3KJ4C 3V95A 5MEPA 4M6NL 4Q6IA 3MRDA 3THMH 4JDZB 4JDTL 1EV2E 3U82B 4E5XA 3QA3B 1OAYL 3IJSB 4XHQA 1MJUH 1MREL 5J06A 1H3WM 3MBED 4KKCC 1X6NA 4HPYL 1H5BA 3LS4L 2DLHA 3DVIA 4PB9H 4N8VA 4LLUB 4PJEB 1DQJB 3VMOA 4KRPD 3I6KA 4X6FA 3RWJB 3ARGA 1R24A 3KPOB 2MFNA 1KB5A 3HPJB 4PRPE 2NY3B 1HEZA 1B2WH 3C8DA 2IANB 3EDKA 4O9HL 4H8WL 3O6FD 1QLEH 2Y6SC 3WNLA 4JFQA 4AMKH 5HHMB 3NACH 3VWJB 1JHKL 3OB8A 4NQDA 3RWGB 3DWTA 3DSFL 3CFIC 3QNYB 1BF8A 2FH6A 4X99B 2W9EH 3ECBA 4Z0XA 5DT1H 3IETB 1QBAA 3GSWA 4OZHE 3EYOA 3NIDF 5DUMH 1RULH 4MHHG 2XN9D 1S3KL 4HQQH 2V17L 5E8PB 1OAUL 3I84A 3FFCB 3O6MH 5I17A 2F53D 5AWNH 5BCAA 4HV8B 1HXMB 3CVHA 3QG6B 3QUMA 3IT8D 1CIUA 4AZ8A 1YECH 4I0KA 2AJSH 5TQ0H 2CKBL 3MCG1 2EH8H 3HLAA 4PP2A 4MXQC 4NJ9H 4W6XB 1QRNB 4JHAL 1GZQB 2UY7A 3MGTA 4PTUB 3X13A 4Y89A 2XZAH 1LILA 4R7DB 2EEDA 1OP3K 1FVCB 3DJ9A 5C0CD 1G7LB 2ZP0T 3VXSD 4PJCF 2DLGA 2ITCA 1D6VL 1V8HA 4PJ9A 1EBAA 1CXHA 3W2DL 3G08B 1CT8B 1ZTXH 4WI5A 3QG7H 2IALA 3FMGL 1JP5A 3QCVH 4PRID 3MRGA 3RTQC 2BXYA 1J86A 2JJTC 5ACLA 4RWYH 3T77A 4N0YL 1P84K 1U93A 1KG0B 2CD0A 3KDMB 3QDHA 2JB5H 2VR5A 4XAKD 3QXDA 4LKXB 4I4WB 3VFMB 4N8CL 1F6FB 4X8JB 5DEGB 3J8F7 4P3CL 1T22A 1PGRB 2O5YH 5D72L 5TFSL 1KNOB 1DBKH 3IVKA 4R6UA 4Z7WF 2D0GA 2HMIC 3UJTL 1CF8L 5E8DH 5C71A 5ISZD 1SEQH 3B3IB 5LGJA 4KHTL 2NX5E 3T4YB 4KK8D 1A1MB 4U1SA 3WHXA 4B7IA 1YEFL 1X6LA 4G6ML 4KVNH 2R2BB 1LP9B 2DI9A 4NQCB 5C9KA 1I85C 2ZSWB 5KANG 1UEYA 3QFJB 3WNNA 5GGUB 1G9NH 4NUGL 3QPQC 3Q6GL 4WCYL 5HJ3A 1G7IB 3TNMB 4NQUA 5FB8A 4HKJB 4KMLB 5E1AA 1KT2A 5E2JA 2XFXB 3FB6B 1WK0A 3ULUH 1AQDA 4TSAL 3RI5K 4L8BA 1LO5B 5DRZA 1KPVB 1T21A 4NN7C 1MJ8H 2FLBT 5DJXB 1YEJH 2PYEE 2P7TB 5HVWA 5SX4H 2QHRL 3DROB 4XPFL 1F58H 3GHEH 4OCYH 2APTA 1MCBA 3CLFH 2Z92A 1WLHA 3UTTB 3IDIA 2EDEA 4CVXA 3TO4C 2I26N 5J89A 2Z93A 4WI4A 1IAIL 4S1SH 3WE6B 3NFSL 3WEXA 3BSZH 4FQ2H 4HPOH 2CRMA 5T3ZH 2DLFL 1U8JB 2PR4H 3RDTA 1JTTA 5DVNA 5IROA 1MIML 3NCMA 3NA9H 4HWZB 4I2XE 5ERWB 2DICA 4EN3D 1SQ2N 2RBLA 2BRRH 5DD5H 1HHHA 1HHGA 1NJ9A 4NN5B 4QRPE 1I8MA 3S5LB 3EW3B 1X5HA 3ULVF 3QUYD 4I8DA 4WW1B 3VW3H 3G6DH 1N5AB 3SDDB 1T4KB 3BFOA 3O3AB 3BQUC 1RJCA 3H2WA 5H37G 4I48A 4X4YA 1E4JA 5IESL 5L2KB 3EOBB 2AV1B 4KUZL 4IHOA 4J3OC 2B0SH 3NZHH 3K0WA 5GJSL 1UC6A 4FFZH 1FAIH 4PB0L 4KJQD 3LSOA 3O11A 2BC4A 1H3PH 1YUHB 4PRHA 1INDH 1YMMA 5DURD 3HA0A 2H6PA 5E8NB 3Q1SL 4UV4L 3ULUE 2XTJE 1JPGB 1IGFL 2DLIA 3IJHB 4LCIL 3L5IA 4OIAA 4OB5H 1HXYA 2Z0BA 1CDJA 5I0ZA 1YEIL 4K94H 5HYSA 5GSRB 3DLQR 3IDXL 2WIMA 1BJ1H 1IKFL 1PW3A 2ATPB 4WNQB 1OWWA 3UTOA 1WEJL 1A22B 4LOUD 1V3KA 5D7IB 1JYNA 5M95B 2OYPA 5HYQB 3KPTA 4OGAD 4C56D 3HS0A 1NBVH 2FD6L 4HT1L 3UTQB 3G04A 3HC3L 4K7PH 4NPYA 5DMKA 4JM4H 5T3ZE 3JUYA 1MCKA 3V4PH 1F3DH 1C5BH 1A2YB 2NZIA 3ZYZA 5SV3A 2VDOH 4LSSH 5JPMB 5CGTA 1NGPH 2XRAL 1FIGH 5D5MA 4KWUA 2XA8H 3RGVD 1JMZA 4WW2F 3BI9X 5IFJB 2EO1A 4FABL 3QR2A 4Z7VA 5CEZH 4P49A 4PTTA 1TJIL 4G9DB 5F89A 4XBPB 4YHZL 1KLFA 3P11L 5DDHB 5E2TL 5GGSA 3ARUA 3KVQA 1WITA 3QIBD 2BNRE 3JV5A 5FYJH 3DX6A 3O2DH 3RI5F 3VD9A 4MCZB 3VXME 1IE5A 1DVFD 1SJVA 4NKOB 5ICZA 5IF0A 3I9GH 4YXKL 5I1CH 4MA3B 3MYZA 1I8LA 4H0HB 4M03A 3QIUD 3LKQA 1D9KA 4YX2H 1BWMA 4X6EA 3UTZB 2GJ6B 1B88A 3CPLA 4JHWH 1CTOA 3GMQB 3L3GB 4QHKI 4YDLC 5DJ2A 4TTDC 5J13B 5IEHB 1XGQA 1JPTH 5ILTH 2ZJSH 4QXGL 4NJAL 1ZGLB 1ULVA 4EVNA 4RGNB 3LDBC 2OS7A 2R1XA 5JHDD 2O61A 5J6HB 1VFAB 3GMRA 2GSGA 2IH3A 4NQED 4OCXL 4KPHH 3KPSB 1NANI 3AS0A 1FLRL 4OTXL 5GRXG 1OARH 2NY4D 3IU4H 1GRWA 2DD8H 4Y5YA 4NKMB 5IK3B 1JZ4A 5I9QB 3KYKH 4HIXH 4YH6A 2HJLB 3ARDA 3C08H 5KAQF 1MFEL 4LBEB 3KXFB 2X1XR 1KPRB 4OZFG 4UT6H 4HS6A 1NL0L 3FB8B 1T66C 4RDQG 5EOQL 2A6JA 1RY7B 4Y0GA 5CEYA 4LSRH 1ZLSH 2X70B 5CEZE 4J4PD 3PGDB 3WIHL 3IFOA 5T5FL 1BVLB 3FONB 4JAMA 4UAOC 1U8KB 1MVUA 4KY1L 4XX1G 1S7UB 5CINL 2VAAB 3MRIA 3TPKA 2FBJH 1AJ7H 5FYJE 1S7XA 2DQUL 1MCHA 2X2YA 3AB0C 1MI5B 2PCPB 5F21B 4Y4HB 3MRNA 4Y5XC 3MRRB 4QHLA 4RMTA 5CUSH 2N4IA 3BMWA 1P7KB 2C1OA 3WLBA 3SDXB 3D18A 3M1BA 3NOIA 5HHOB 1MWAH 4FG6C 3SDCB 5GXBB 1FZOB 4G7VL 4HK3J 1YDPA 4PJBE 2XZQH 4N0CD 4M1CC 2FZ3B 1BM3L 5F9DC 1PG7W 1XH3B 3RVXD 4K3EL 2BDNH 5F9JB 2EDRA 1MREH 3MMEB 3QZWG 4K71B 1KJ2H 4HPYH 3C6LC 4ZSOB 2DN7A 5D1XD 3T1FA 2FJHB 5DD3L 1VB9A 4O4YH 2VLJD 4JQIL 5KSAD 2ICES 3F12B 3LPWA 1N3NA 3G6AB 4PGCB 3RNKA 1KV3A 4PG2C 4OGXH 1CFTB 4L8CA 4QWWC 2Q20A 3AROA 4WWID 1FN4A 2CMRH 2V2WA 5E6IA 3BP7B 3GSQB 2LVCA 1W2KT 4F7CA 1YNKL 5JIIA 1G7JB 2Y23A 4WUKL 4KQ3L 2E6QA 1EZVY 1A47A 4XCEB 2VLRE 5KN5B 1HWHB 1R3HA 3QIWC 3QDJA 1FZJA 2BXZA 5BJTB 4UBDD 2JB6A 1T83C 5I1LB 2V17H 1XCQB 3BT2L 4LLWA 4OQTA 5DHYA 5J4MA 3IGAB 3MJ9A 1FRGL 4ZNEE 1U3HD 4TNWK 4J6RH 1EEYB 2F58L 3KYNB 2DAVA 5IVOA 2HYMA 2DKUA 4YAQA 1H15A 1IGCL 1OB1A 2OI9C 3T0EE 3WBDA 5DSCA 4EI5D 3LMJH 1GC1H 2BVEA 2J4WH 3MV9E 1JNNH 4XTRC 4JRYB 2I25N 4PGZA 5D2LF 3RX7A 1OSZB 2ZOLB 3QUXB 5E99H 4AM0A 3H9SA 3EO9H 5E24E 1DANT 2DQTH 3GSVA 1GL4B 3H9YA 4M7LL 3VWKA 4ONHA 3X11B 1Q9OB 3H8NA 5SWZA 3MZGB 3RL1A 2X4RB 5JXAH 4IM8A 4Z7UB 4RMSA 3OKLB 5CGYC 2XOTA 5DS8A 3ARBD 4GQ9L 1VENA 2HTKD 3H0TB 3TN0B 3D0LB 3ZYOA 2FEEI 2JIXA 1PZUB 2A6DB 3JVGC 4ZFZB 1TFHA 2G60L 4BQ9A 4GKZA 3QDGE 1VFUA 1OQXA 3LB6C 2HRLA 4ZDHB 3CFBB 4D9LH 4LSPL 5DK0A 4R4BB 2AXFA 2QJDA 3VXRD 2HFTA 1EEQA 5C08A 1A9EA 3MODL 5D1QA 2QEJA 3JZ7A 1CI5A 1N64H 3SQOL 3TCLA 3TZVD 1BFOB 5FM5O 2HKFH 4PPTA 3EYQD 4FQXB 3TV3L 4A6YL 4OFKA 4OBRA 5ACZB 1P53A 2LAAA 5ICYB 4G6MH 4FQLL 4JFXA 5I8CA 3ZE2E 1JNHA 4Q2ZA 2RHEA 4NQXB 4ODHL 3PWNA 4P2QB 4BZ1L 4X6CF 3O3EB 3C5ZA 4MYWB 4M7JL 4DUVA 4P5KA 2O5XH 2E7BA 5F71A 5E5UB 4L3EB 3M17A 3D39E 3HE7B 3MLXL 5D96B 3TESA 1ACZA 1FSKC 3UDWA 2BVTA 4K2UL 3AGVA 1UYWL 2Y9RT 3U4EA 5DZOA 5IMMB 4XPTL 3W11D 2H45A 4FFWD 2EYSA 1MUJB 5C0AB 3RBSA 2X89D 2Y7QA 4FTVB 1AD0A 4G9FE 1QPPA 3WUWA 4YWGH 2F74B 1IAIH 4KK9D 4MQXD 3EOAA 3VRJA 3BPCB 4I0PD 4DZBA 5JA8B 3SEPA 1KENL 3PGFH 1TVDA 1Q1JH 1NCBH 4ZFOL 3STZB 1FO0B 3MGOA 1FVDB 3ZT6A 1XZ0A 1I7ZB 1I9IL 2IAMB 1GGCL 1QFWI 2BNQD 3T8XA 3CH1A 3VI4F 5DMGD 2CQVA 3PHQA 4KI5E 4R3SB 3TLRA 4U6TA 4TNWF 5D6CA 1T6WA 4G43B 4OV6F 2AGJL 4HKZB 4IS6A 5HDBE 1RUML 2EXYC 2UZYB 3DUHA 1S8DA 1KCUL 1AO7D 2ICWI 5IHUL 1CL7H 4JJ5A 2GSIB 3M8OL 1YY8A 5E94B 5F7EL 1ONQA 3LD8B 5FIEA 2DYPD 1DFBL 1ZLUH 2EDJA 3B9DA 3O6FA 3DBXB 4RGOH 4X5XA 4BKLA 4M6AA 4D8PA 2R9HD 3O4LE 2VLKD 1FZKB 3O45B 1IKFH 3UJJH 4EI6B 1P5VA 5ESVB 1R5WB 3DXAB 4KDTA 5ID1A 5E5MB 1SJEB 2FB4H 4KJWD 1CFQA 3TIDA 5HY9B 1BQHA 4PJXF 4IDJH 5I76B 4RMVA 1JHTB 3PWPE 2BJMH 4MX7B 1MCCA 1EJOH 3CDYA 4P4RA 4ZD3H 1KIRB 5J56B 2XN9A 1LEIB 2OLDA 1WFUA 4XMKL 2F53A 1IGYB 5HYJB 5E2UH 4NT6B 5IIEA 3WNOA 2F5AL 3C2AL 3D25B 4S2SA 4U2ZA 4G8FA 4MA7L 5C07D 1T6VN 1T0NB 4NZTL 1MFBL 4PJAB 2EDXA 4F9LA 2VTFA 2W1NA 5B38G 3DMMD 3DRTB 4ENEC 1NC4B 4OCRH 4P57B 3B9KD 2BX5A 4HG4J 2PYFA 4YZFE 1U3ZA 3GK8H 3TBTB 5JW4R 5C0CA 4C83B 3EJZC 3X3FH 3P40A 4PD4K 5CIPB 3VXSA 3HI5H 2PW2A 4GKSB 4JQVC 1OL0A 3JV6B 4WU7B 1NEUA 1FVEA 1CFNB 1UZ6F 2CKBA 3W5MA 4P5TB 1AHWA 1LE5B 1ZHKA 2VLME 2FEDD 4GRWB 4OD3H 3IDNA 4EJ1C 1Q0XL 2EDBA 3GMPA 4BFEA 5CAYB 1RZ8B 5F7WC 3MFFB 4XNMB 3FT3B 4NJAH 1CDYA 1IGIH 3ILQD 3MV7D 3WN5B 1A7RL 4K7PX 1I1FB 3GIVA 4PGJA 3WFEH 2FEEL 3P9WB 4P9HL 4YK4C 5FKAA 3ROLA 4OCXH 4HF5L 1T2JA 1GIGH 5ISZA 1A7NL 4R0LC 2Q76A 5BV7C 2EYTB 3I6GB 2BSRA 1GOHA 1RMFL 2RR3A 5FGSA 1YY9D 1U91A 3R06A 4JR9H 5E9DE 1FNFA 1MFEH 5T1KD 1FNHA 3OKNA 5AUMA 5B38B 2PNDA 5C0FA 5CD5D 1PKOA 4UOJA 4BQBA 2NXZD 1D5MB 3VD7A 2BOCA 3TBWA 4CMHB 4FQCH 4KZEH 3P77A 1CICC 1AXIB 3SE4A 3WFBL 5B8CC 2DQJL 3B2VL 4JHZA 3P0VL 4C57C 3S3JA 4R2GC 2ADGB 4J3VA 2DQUH 3PQYB 2BVOB 3E6HA 3H9HB 3VI3F 2YN3A 3MRHA 3MRMA 4LFHD 4UZGA 3BP5A 3QUKB 1Q8MA 15C8H 1TJGL 4L9LB 4MAYC 3BJLA 1SJHA 3MR9B 4K3DL 2FATL 5E08H 1B0GA 4KAQH 1RUKL 2DI7A 3C60D 3WJLA 5F6IB 3F7YB 1F00I 3WXVL 4EN3A 2R8SH 1JWMB 2A0LC 4U6YA 4KROC 1S7SB 4GRLD 5CJOH 3IDUA 4XNZC 1N8ZA 5DC4B 1LO2L 3GSUA 3U83A 3BYYA 4NUJA 4QRSA 5T1MA 5HVFB 1EAPB 2H9GA 3BDXA 3QUYA 3IDGA 3OXSA 3RY6C 4XH2A 1I9EA 4I13B 1KB9K 4GXVH 5C8JA 2GTWA 3BKYL 1CU4H 1RVFL 1R5VB 1F2QA 3RJQB 1E6JH 4TSBL 1KCRL 5JQHC 5FGCE 1N6QL 1WBXB 4PS4H 4C54A 4NGHH 4FFVD 1G9MH 3ET9F 5H2BB 4PY8I 5LAXA 5MERA 5DVMA 3JWDC 2EICA 5IHZB 3RAJH 1O5DT 3LEXA 4HBCL 5D1ZC 4LLMB 2XWTA 5ANME 3MNZB 2YSSB 1YNKH 4J7RA 4Y4KC 3GMMA 4AY0A 5IVXA 1DEEA 3BPLB 4AEHL 2A77H 1DBAH 3IAGC 2WANA 4FQQA 2VXSL 4HS8H 4KDWA 5JOPE 3S36L 5ESAB 3VXNA 5HI4C 4DGVH 3QXVA 5DJZB 1FP5A 1YPZF 5GGVH 4JKWA 1T2QL 4JM2B 3REVB 5JORB 3FO9B 1XGUB 5FHAL 4NRZB 5IVZB 5C6TL 3QUMH 5GS0H 1DUZB 1FBIH 1FRGH 1UB5B 1SHMA 3KLDA 5BO1H 3LKPA 4ERSL 3P30L 3SE3A 4FA8A 3RVUC 1P1ZA 5GRJH 2F58H 4UDUA 1NFKA 1F6AB 5EOCJ 5MEOB 1TITA 2DWDB 2X7LA 4O02L 3ZDXF 4PJGA 5DGRA 3MLVH 4DEPC 3EOTH 3L9RB 2W0FB 1NFDE 3IXTB 5D7SH 3G6JA 2DMBA 3FZUD 1UXSA 3ZKND 3R1GH 3V4VL 2UYLB 2YBRB 4PJFF 3BD3A 1ZWIA 1MLCB 5MEQB 3ARRA 1D5ZB 3MOAH 1J5OL 2DJ4A 4P4KC 2QQQA 5DJCA 3K80A 4GMSL 1ZLWH 4IIQB 5C0IB 4NP4H 1RHHB 1N2RA 1WFTA 3SN6N 3TBYB 3QIBA 5CP7B 3MLRH 2XG4A 1XF2A 2JTDA 4PV9B 5HPOA 4MHHI 2NY0C 2PTVA 2R0LL 1ZKAA 1AXSA 5JLZA 3BGMB 2HLFC 3RL2B 1UJ3C 1Y0LA 5BQ7B 2P5WD 3QIUA 4F2MB 3U36B 1MH5B 1W8OA 2VWEC 1L6ZA 5DJAA 4PJ5E 1K6QL 5DQDL 1C12B 4XAWH 3E2HB 1H5BC 3TVMB 3JV4A 2P45B 5ENWA 3ARED 4I77L 3FO1A 12E8L 3TV3H 1FFNB 2IPKA 4NQEA 1BBDL 4PRBB 3D48R 1NEZB 1SM3L 2X1PA 4QOKD 1C5CL 1U8IA 4ETQA 3VG9C 5LGKA 5CEXA 5B21A 2AJ3A 4AH2B 2NW2A 2Q3ZA 4M7JH 1QKZL 3C09C 4CU8A 1B6UA 1ZHNB 4KTDL 1DL7L 1CVRA 2AEIT 5TE4H 2WINB 3HAEH 3T2PA 1A6UL 2NY7H 5KVEL 4K2UH 3VG0L 5AZ2H 1SMAA 4GLRI 3CSBA 2QR0A 3T4AB 5HGAA 5DJ6B 1FFOB 4XPTH 4FQPA 3O8XB 2ZCKH 1H8OA 3OB0K 3G5YA 3CFEB 4OLXL 4J4PA 4RFOH 3U2SA 3MACL 2OR8A 5HGGS 3QJFB 1C16B 3NH7L 3VXUE 1I3RA 1I3UA 2I07A 4KHXL 4PREB 3REWA 1R6VA 1YEKL 4MA1C 1MLBA 3RWEB 5BW7C 2YC1B 3TEUA 5I18L 4U1JA 4NSKA 5HI5D 4MXVF 4L8SC 4X6DE 4LLDB 3UC0H 5INDB 5DFTA 1XF1A 2ERJC 4LCWD 4W4OC 1GGCH 2GTZA 5BRZD 5EUOA 2XKNB 5KANI 1DANU 3D5OF 4F57H 3CSPA 1VHPA 2YMXH 4DKDC 3BKML 4N5EC 2ZUTA 4X4MA 4K8RC 4NNYA 3G5VA 5GHWL 2BY2A 3HNVH 2AXGB 3DYOA 3A6BL 2J2ZA 1PX3A 4MD5B 3L6FB 3IKCB 2H26A 5IBTH 3GSXB 2E7HA 4N0RA 5D1XA 3CCHB 3FHAA 5IHUH 1LD9B 1LO0H 5KSAA 4FS0A 2FX8L 4MCYA 1T3FA 3RWFA 1PLGH 4MA8H 2OL3H 3HCVA 4JZOB 1EFXB 1OF2A 2ORBL 3KPPB 4LIQH 1YA5A 4N5UA 2DS4A 1N59B 5C9JB 4PP1C 1DQML 3QXAA 3LN5B 4JZJC 4PGEB 4LSQH 2ZUWA 2AXJA 1QBML 4KMTL 1YJDH 1P2CA 1MFDL 3OR6A 5TQ2H 3DECA 2QSTA 2IPUK 1WBZA 4OF5A 3I02B 1HH6A 2NY3D 4AJ0A 1OP9A 3S34H 2IAND 1HYSD 4OKVA 1OLLA 1OOAA 1C7SA 2IFGA 1Q9WA 2ARJA 2HG5A 4G80A 3NA4A 3MV8D 3HZMA 4XMKH 1G6RB 2RQ8A 5C3TA 4J3SA 1UWEL 1WGOA 3D3VE 1CE6A 5KVGH 5EG6C 1INQB 3DTXA 4Y16B 3MRJA 1TLKA 4ZXBB 5HXMA 1JBJA 3A6OA 4WI9A 5JQ6L 3OL2A 2RFXA 1WBYB 4RIRA 5GRUL 2V5TA 2VDNH 2BK8A 3Q3GA 2EIZB 4X4XA 4EI5A 4BH7A 5D2NA 1N6UA 3B4NA 1ZT1A 2QADD 2FSEA 2C5DC 2NY2B 4EEEA 3MRQB 1F13A 1MCLA 1KCKA 4GQPH 1I8KB 2A74A 3KJ4B 1IEBA 3QEQE 4PLJC 5B39B 3C9NA 1V3MA 3MQIA 1MAMH 4L4TB 1MJ7H 4JY5L 3RDTC 4H26B 2IBZY 5IROC 3ZDZE 2R0WL 4WGVB 5I1GL 4PRHE 4LHQB 4WFEE 3BZFA 3P0YL 3UMTA 2OTUA 3ARBA 2BHYA 5MHSE 4LIQE 3QNZA 4PJIB 4S1DC 3PXJA 1KLGB 1U8PB 1UH4A 4WUUB 3BO8B 2X9XA 1UZ8B 3Q0HA 4NM8L 3FN9A 3IFNH 3CSYB 2OTWA 1E4XL 4HF5H 4UMGA 3Q6FA 3ILPB 3D6GA 4JFFB 1MSPA 2GT9B 1LO3H 2C3VA 3JXAA 3KPLA 1U8LB 4QRRE 5TJWK 1DN0A 2WLZA 5IR1B 4HWBA 5EU5A 4U3HA 2YA0A 1RJZA 3RX5A 1GGUA 2ZOKA 4Q9QL 1PKQB 3RZCC 2XQBH 2YRPA 1NMAL 1Z0MA 4R9HA 3RVTD 3CVIH 2XWJB 4X83A 3CIQA 2YPKB 3VXOB 5AD0A 4TRPL 5D5ME 1ROWA 1JYXA 5K9KA 3B2UC 3EO1B 5EU6B 4EBQL 4K7FB 4Z7VE 3H6JA 5AAWA 4NOFA 4GW5A 4E42A 5TE7L 4QNPE 3IAQA 1DZBA 2AI0L 3P0VH 4A6YA 1HNGA 3PUCA 1A8JH 1EHAA 1BIIB 4ZS7L 3L5XH 1PZ5A 3QH3B 1T5XB 2H2SD 1AR1C 4PBVC 2B7DT 4I0PA 5E2VH 1TVHA 5I66B 4X9GA 4OZHB 3TNNA 4ODXA 4UQ3B 3AFLA 3TWCH 4PG9A 4PJBF 2X4TB 3E6FB 5IWLA 1GXEA 2J8UF 3C5SB 3FQUA 2PXYA 3L3JB 4I3RH 1RV6X 3LV3B 1SEBB 3RTQB 4D2NA 1NBYB 4ZPTB 5LQBL 4D0DB 2BNQA 5H94A 3UO1L 2R1YB 4ALAL 4Y88A 2WUBL 1AGEA 5I1IL 3BIKB 4P2CG 3FRPG 1IGML 4M43L 3BZEA 1EBPA 3D85A 3NN8A 1JV5A 3BE1H 4WDIB 1U92A 4JFHD 5C0BA 3ZDYE 1PG7L 4RGMC 3KYOA 1KGCD 5INCB 2ITDB 3DPBA 7FABH 1I8LC 1ED3A 3A0OA 4HWEL 2QL1A 1D9KC 3CDCA 3QHZH 5SX5H 1NDGB 1S9VB 3DV6B 2VE6B 2AABH 4FXGB 4M1DH 2P42B 3LQAC 3QO0B 4AEHH 2DYPA 3ES6A 4OLYH 1LQSR 1R3IH 3QPXL 4LMQE 1D6EA 5F8QC 4F3FA 5KW9H 2YD8A 1JGEB 4YHMH 2VLKA 3RU8H 3S36H 1X5FA 3LKSA 4OQTH 4JRXD 1QRKA 2Y07L 3OWEA 3R8QA 4NN7B 3B9VA 4R7NB 5FOBB 5EBMB 1VPOH 1K8DA 2GIYA 1XT5A 4XP4L 5FHAH 5C6TH 4Y5YC 3JWNC 1CD0A 4MB3A 3WJJC 3P30H 1JPSH 4O5LL 4POYA 4LEOA 4NC1E 2IPTH 2EXWD 3VFGL 3ARDC 1MPAH 2NW3B 1B9ZA 4L29A 4NHCL 2NX5B 5F3BA 1FYHB 1F4WL 5JUEH 3Q2CA 5C07A 1F4AA 4LK4A 1R3LB 4YDKL 3STLA 1FGNL 4TQEL 5LCVL 4WEBH 3NVQA 5DJYB 3DMMA 3OTTA 3QNXB 3BP6B 2H32B 1VKXB 3AY4A 4YHYC 3RNQB 2VLLB 4YXLL 5F7HA 3V5KB 5JIPA 3B9KA 1J5OH 1F4YH 2IH1A 2VXTH 3EFDH 2AVGA 4TYUA 3ALWA 2F15A 1LEGB 5D7LE 1NGZB 2PYEB 4LRNH 32C2B 4ZODA 3SOBL 3PHOA 3X3GH 4QRTB 3BDYL 2R0LH 1TZIA 4MDIB 4NWUL 1RUQH 4Z78A 4FXLA 4KTEH 5FM5M 1NC2B 1J8HD 5DR5L 4S1QL 5FCSH 4NM4H 5KOVC 3NIFE 4G5ZL 1ZEAL 2NR6C 4I2XB 4BELD 4BK5A 4DCQA 3NCYP 3BRFA 35C8H 3MV7A 1KLUB 1QSFE 3N1FC 4I77H 5IGXL 4GW1B 3EJYD 1L6XA 4QRPB 4NYLB 3BP4B 2DF3A 4GG6F 4JGUA 1BBDH 2ZUQC 1RZKH 4Y19A 1T5WA 5FYLL 1E0OB 4JB9H 5CGMA 4M4RA 4LNVA 3PDDA 3HMXL 3SCMC 3S8WA 2P8MB 3X17A 2GQHA 5DZNA 4LQFL 2EDNA 2H2PC 2ARJQ 3FB7B 3HE6C 3S35H 2X4OA 5E6IC 4YPGB 1A6UH 5GGQL 1BJ1J 1F4XH 2H1PH 3H3PH 5T1KA 2W91A 4TPRL 1LK2A 4LP4A 4PY7A 1B0RB 2C7UB 2EKJA 3U7YH 4L3CA 3WFHB 5DFVC 3H9SE 5CJQH 3FAXA 5IB1B 1DLFH 1V7MH 5FYLD 1OTUC 2CK0L 5I1DB 3L3DA 1R3KB 3MZTA 4NO3A 5F7UA 4KZDL 4U1GC 1F3DJ 5SWZE 2CRIA 5KS9F 3NH7H 1N0XH 1AC0A 2VDQL 4FQHB 3PABB 1VGKA 5DO2C 4B7LA 3CK0L 5HI3C 5FK9B 4M8VA 5I75C 2XA3A 3ZTJH 4XP9H 4Q9RL 5T1DL 4X6BA 3HPLB 2NXYC 5AYUL 4LCCC 4HZLB 5CJ8A 5IMOB 3VXQB 5I1KH 1NLBL 5L7XH 1DLHA 2MKWA 4M5ZL 3IS1X 2HKHL 3BH9A 3VJ6A 5CMAB 4KI5F 2V5YA 5CJ5A 4JG1H 3C60A 1A7PL 3GJFA 1IFHH 5C08E 3AS2A 4XNQA 1MI5D 3BKMH 4JCMA 3GNML 4JDVA 4GRLA 5HDQL 1QOKA 5HDBF 3MLPA 1JWUB 4OF8A 1BLNB 3P4NA 3VWKC 2E27H 3LN4B 5FUCE 2DL9A 1SBBA 1E27A 3QQ4B 1AI1L 1AH1A 4YDLB 3T1WA 2NY5C 2UVFA 4ZUTA 3GB7B 1JZ3A 3GZKA 4L1HA 1KCVL 2VXVL 5A3IC 4ODSL 3EYFB 3QQ9C 1S9WB 3RWCA 4G6FB 2K3TA 1WAAF 4RRPA 4ORGA 4P2OC 1QFWM 1DQMH 4ONGH 5D7JD 5EO1B 1LE9A 5DYOB 1DBJL 1VFOA 3I50L 4KMTH 2IGFH 1IZKA 4JN1H 5D1QC 5LGHH 3X12B 2V7HB 3KPRA 2IBBA 1S7WA 5GRZA 3L5JA 4OIIL 2OMBA 4EDXA 4LVHB 1OAKH 1MY5A 2W0LA 3FTGA 4O58L 2VKXA 2BNUB 2AK4D 3DO7A 1XGPB 5EO9A 3BXNA 1FJ1A 4YQXH 1DQQA 3C5ZC 1QUNA 1CFVL 1CLYH 4UAOB 4YBLC 3T65B 4UDTB 2EKSB 3KLHC 2APWA 4YGVB 3UTPD 5JQ6H 3KLAB 3UDWC 3V6FB 4H5SA 4JY6B 4LVOC 3RVWD 5IVXF 1NGWA 2ZCLH 3LKOB 4NZRH 4YZFF 2X4QA 5IB4A 1OCWL 3HNTL 5F72S 5J7CC 3P9LB 4PJEE 5EU3A 4GAYB 3IFPB 2G75A 3MOBH 2F54A 4XC3L 2QKIA 1T0PB 2IQ9H 2JELH 3BWUC 4LDLB 2AJUH 4UT7L 5F7DB 2R0WH 4FHBD 4RMRA 4XBGB 4Z95L 4K3JH 3C6LB 2Y5TB 2EO9A 5HGDA 3QCTH 2VN4A 5JIKA 4PJGF 3U6RB 5HHME 3P0YH 3TJHC 3O0RL 1RUAH 4MJIB 2A9ML 1K3ZA 1KTLB 4HH9B 5HHVH 4P9ML 1PEZA 5DEFB 2J88L 3M07A 3CC5A 4U1HA 1ORQB 3T0AA 5I1JL 2Q8AL 5J6GA 5C0ND 2JK5A 4UB0H 3PL6C 4PYHA 4DQOH 2ICEA 2P5WA 2QSCH 4NM8H 2JCCA 1E4XH 3WL9A 3N9GH 5BOZG 5BZWA 3MBEC 1JHLH 3FFCE 4FZEL 1OT2A 4WFFE 4MNQB 1KTRL 3AREA 4G8GA 3VD5A 1A4KA 3FQXA 2F53E 2CRZA 4KRPC 3ULVL 1RUPL 3LN9A 2DQCL 5IQ7L 1MCOL 4QOKA 1QRNE 2D0FA 4NKIH 1A6AB 1VADB 1U8QA 3QCUH 3SE9L 2BVPA 3SKMB 3O6FC 2K9UA 3CNKA 3K4DA 5SWQA 4MD0A 4IRSC 4M9PA 2VR4A 1KTDA 1KC5H 2KH2B 5EN2A 3OKOA 3CFCH 3QO1A 4HX1A 2NY1B 4KDTC 2Y36H 5GSVB 1FIEA 2AI0H 3PP4L 3VXSE 3ULVD 1ZAGA 2B2XH 4G42B 4YIQB 5JMOC 1RZJH 1AIFA 4L3ED 5HGHB 3AM8C 4BZ2H 3MTRA 3NABH 4JG0L 3MLYL 5K9JL 1A7OH 1PX4A 1M7IB 4H8WC 1Q38A 2D31B 4UOW0 4UUJA 3O4OC 4N0FB 5J8OA 2KUTA 1ZVHA 5L6YL 1YEGL 4FTVD 1AGFB 3FQWB 4XAKE 3FQTA 4JVPA 3JWOH 1XIWD 4O51B 1KELL 2YD3A 5HPMB 5DVLA 2YUWA 5LQBH 4G6JH 4GFTB 3GSNB 3UO1H 3BPOC 3E3QC 3K81A 2B5IC 1YN7A 2WUBH 2FIRT 1HIMH 4NKQB 4MJ6B 25C8L 4U1NA 1A1NB 1KPUA 5FDWA 4IMLB 4M43H 1CZ8L 3JBG7 4YHIB 4ODTL 1J05A 1CG9A 4Z8FL 4NQCE 2KZ1B 1LP9E 3T0EB 3QFJE 3HUJA 3T0WA 2NNAA 3MV9B 4HGWB 4KK5D 3OAUL 2GITB 3R0NA 3PV6B 3KR3H 3VH8G 5IB2B 1EEZA 1UJTA 5TGBA 3EDDA 1KJ2B 2BSSA 4OZIB 3NZ8B 3LKNB 4YLQT 4HK0A 1NGXB 5DTFA 1JF1A 3SO3C 2Q6WB 1WCBB 1ZSDB 4HEME 1U58A 3A6CL 4M6MH 3OG4B 1OGAD 4H0GA 2FL5B 3S88H 3MJ7B 1A6ZB 5ITFB 1OSPH 4BQCA 2XPGB 3UYOD 4Y4FA 2P5EA 4MJ5B 5IOPB 4XPAH 2FO1A 4KK8C 1BP3B 2CH8A 3IDJB 3ZE1E 1QA9B 2HVKB 3MBXL 4MQTB 3MV8A 4FOMA 5LBSL 3U9PH 2VNCA 3VFGH 4M3JA 4LGPB 1A3RL 3KWWB 1A3LL 3OKEB 3PWJB 4QYOB 4OSUL 2V9QA 3DXAD 4RAUA 3T04D 1H3VA 1RFDL 3CLEH 4HH8A 5DD6A 4ZUWB 1N7MH 4YDIH 4YDKH 2HRPL 4QRUB 5LCVH 2I5YH 4HXBL 3U0TA 3NCFB 4Y2DB 4YFLI 4WO4D 4BSWA 5KZCB 2BVQA 2IC2A 5HYJD 5I30H 2V2XA 3IU3B 4MWFB 3MA7A 5L2KE 3D39B 2X4SB 4UINH 4YHOH 1W72B 2F19H 4AIOA 1AQKH 5IB5B 5BS0D 4PJHA 4JFDB 4V1DD 2V2TB 2J8HA 2Z91B 1KBGH 3HFMH 3GJEA 1WTGT 2D03L 3WJLC 3NBNA 1UWXH 1WTLA 5FO8B 4EN3C 5LVEA 3S36X 1MOEA 1XCTB 4LSVH 3PNWB 2ESVD 4RISL 4NNPH 1IC7H 2H3NB 3RWIB 3SGEI 1OLZA 3QUYC 1BGXH 5D7IE 1H3UA 5IQ9A 1HK6A 3L3KB 1HN1A 3NGBB 4TNVK 2F5BH 4DK3A 3HG1A 2H8PB 5EOTB 1DBMH 5I8OL 5GGRB 1JPFA 4OF6A 1JI1A 5ETUB 1W8NA 3KHQA 5IB3A 3KS0H 3HMXH 2Z31B 4G7YL 1S7TA 1H3XA 1TTUA 4JN2B 3CX2A 5F1NB 1FCGA 2VQ1B 4Q6YA 1S5HA 2AKRB 1HYRC 4KJQC 3W39A 4J1UA 1VEMA 1KNOA 3WXWL 2XY1A 2H41A 2O26U 1A21A 5JR1H 1K8IA 5K59E 1CIDA 1TXKA 1CVSC 3GM0A 5SWSA 3MYJA 1ETZB 1KJVB 3BEVA 3VFTB 4OT1L 5JNYA 5KSBA 5GIRB 1JK8B 2CJUL 2CK0H 3RZWA 2GJZB 1K3IA 1GGIL 4QCIA 1T04A 1CTNA 1FNEB 3P2TA 4Y1AD 4LOUC 5DWUH 1J1PL 2VDQH 4RZCB 4OLVH 4GW4B 4JVWA 4UNVA 3ZMRA 4OGAC 1D5BB 3O4LB 4X6DF 3SE3C 1JGVL 1OAXL 5EBWA 4MXWL 1CLCA 1YNLL 3FB5A 4QHNB 3QEHB 2Q8BL 1U42A 2VABA 4NNXB 3IF1A 4POZD 4X4ZA 2GJ6E 3PWPB 1X9QA 2YPLD 2MMXA 4PJDA 3D69A 2OCFD 2N7BA 4XP5H 1ACYL 4RGNE 2VITB 3RGVC 3PWVA 1RI8A 4WHTB 3KPSE 3L7FB 1FG9C 3K3QA 4JY4A 5FYJU 4GOSA 1NDMB 1U8HA 4NWTL 4HXAL 4P2RB 2HA1A 4P23D 2MQ3A 3QIBC 1IRAY 1Q9KA 2P49B 5GGRY 3QAZB 4JLRB 4RBPK 1BJMA 4ZO6A 4OI8A 3B6SA 1NCNA 3G5ZB 3H42L 1DVFC 3HI6L 1Z5LA 3KXFE 5D9SA 1BZ9A 4JKPH 3MRCA 4MD4A 3GBLA 4ZQKA 3KNBA 4R0LB 3RKPA 5BMFH 4QXTB 4KXZI 4S1RH 5FKPA 5BV7B 4B50A 1I85A 3I75A 1U3YA 4PBXA 1ZA6B 1HHKA 4XCYB 3O3DA 1HCVA 2BMKA 2FWOB 5ECJE 4PJ7A 5MP6L 2VXQL 1CR9L 2Y06H 4XWOD 1JIBA 1CQYA 1CBVL 5IBLC 4LSTL 4JRXA 4ONFL 1BZQK 4Y5VB 3SKNB 5B4MD 3EYUH 4WWKC 1E28A 3GSOB 2NY4C 1CICB 3SDXE 3H7LA 3U0PB 5B8CB 5HHOE 5C2BH 4JREB 1IAKA 3RUGE 5FM8A 2MHAB 2BCKA 3BH8A 1IGTB 1PSKH 1M71A 4JPIB 1XGTB 2C4XA 3AXLB 4HIJB 1KIPB 4TNVF 1P6FA 2UWEA 3MUGA 3VFSA 3WIIL 5ID0B 1M6OA 4ZTOL 5DJDB 3ALXA 2W38A 4JO1L 1KEGH 2VL5A 2B1HH 3L95B 1JGUH 4MAYB 2HVJA 4ZSOE 4RMWA 3ZE0E 4CKVX 5IT2H 5CBEB 1FE8L 4J4PC 4ELKA 5FFLA 1QZ1A 5TDNB 3VFWB 2O5ZH 4YE4L 2KQMA 3ZDZF 4KROB 3BVNA 3GMOB 2HH0H 4XNZB 1OTSD 5T3XD 4XPBH 1QVOA 3O2WL 1P7QB 3OKYA 1G9EA 4ODVL 1VGEL 2X44D 5BZDA 2FO4B 4Z95H 4LCYB 4PGDA 4U3XA 3BQUA 2Y5EA 1WZLA 3CFJB 4UT9L 5DJ8B 3O41B 3HC4L 1FG2B 2YD2A 4NRYA 4OUUB 1D5XA 5F9WC 1RZGB 3O6LL 3O2VH 1KN4L 3O6KH 3RY5A 1J8HA 3MLUH 4N0CC 2G5BB 3RVXC 2R4RL 3IXAA 2R23A 4Y4KD 5D1ZB 1FL6A 4DW2H 3U7WH 3MO1A 4HWBH 1ZHLA 5D1XC 3QSKB 4KH2A 3H3BC 2HTLD 5IW6B 3DURB 3FO2A 4U4BA 4ZG1A 5EU4B 4X5WB 4OCSL 2CXKA 3OHXA 3SJVA 3CX5J 4DN4H 5F1IA 1ZGLM 4RNRB 1RK0B 5KG9A 4WV1B 1F3JB 1HSBB 3U30C 4C58B 1HILA 1KCLA 3SE9H 3TVMD 1ZGLA 3DGGA 1C08A 3LRSA 5DRWB 1QFUH 1Q9LB 1RJYA 4JRYE 5EC2A 4U1MA 5FGCB 1JL8A 5F9OL 1I7TB 2ZKHL 3RWDB 2JJUA 2Z35B 2XWBA 3OJDA 4FZ8L 5E1HB 5SX5K 4E41B 1XGRA 1IGJB 3TA3D 4GUPB 4ELMA 2CDFA 1A5FL 1H3TA 5ANMB 4AK1A 2VL4A 2W9DH 5EOCL 3WNKA 3WUZA 2VERN 1ERNA 3FN0H 4JG0H 5IHLB 5HVGB 4ACPA 5LKNA 5L88L 1FO0H 2ZG1A 4LQ1A 5M94B 4HC1L 4RMUA 3UTSD 1MCPL 5FHBL 3KLSA 5A2IH 1NFIA 4NO2A 1U3HC 1NCCL 3EO0A 3SKJL 3O8XD 3MGAA 3QRGH 1FLTX 1DE4A 4LPCA 4ZOCA 3VCLA 5H35B 5C09B 3OV6A 1EGJL 4EI5C 2NY0D 1C7TA 4CJ1A 5D2NC 4U1KA 4EQ2A 1MQ8A 5ISZB 3FQNA 1YMHB 1UXWA 2HFFA 2Y25A 4YO0B 3ARFC 2WP3T 3L3IA 3ZDYF 3MRRA 4F33A 1B4JH 4Z8FH 5I0DA 4P5MA 4PRDA 4Q6IB 5MEPB 5DUPH 4MNHA 3MRDB 4P2QE 2CXGA 5DHVA 1IT9L 4E5XB 1CXEA 2ADFL 1Q0YL 2CR6A 1H5BB 5D7KE 2ZZUT 5EZJA 1EMTL 3NPSC 2N7AA 1TPXB 3ARBC 2HTKC 3MLZL 4X5LA 4X0KA 3CZJA 3I6KB 1GHFH 3ARGB 1R24B 4LHUA 4XNYL 3VG9B 1KB5B 5D7JA 3UYPA 2XZCL 4X9BA 1HEZB 2FX9H 5F1KC 5C0AE 4I18A 4NC0B 2W65A 1UQSA 4JFQB 3BYTA 1T03H 3OJVC 3D1MC 3TZVC 4NQDB 1G1CA 1G6RL 1EFXD 3EYSL 3EYQC 1UM4H 4OZFA 1G7PA 2NTFA 3ECBB 4NQSA 3I6LD 4XNUL 4Z0XB 1NSNH 3PDOA 3GSWB 2AK4A 4PJCA 4MQSB 2IG2L 5F70A 4DAGH 3EYOB 1A3LH 4PR5A 4K9EL 3MXWL 4I3SL 4L5FH 2K1MA 4OSUH 3SDYL 1XF3A 1RFDH 5I17B 2D7MA 3I2CL 3CVHB 3C5JA 4Y5XA 4HLJA 1O7SA 3QUMB 2FJFA 1J0YA 3PWLA 3EZJB 4NBXB 1PG7X 3HLAB 3EOYG 4PP2B 5GS2D 5CIPH 3S98A 2ERJB 4EQ3A 1A1OA 4Y16D 3W11C 4P99A 3MGTB 4FFWC 3X13B 1BD2A 4ZXBD 1X4ZA 5C0BE 1ZA3B 1ADQL 2J6EL 3HAEG 4MQXC 4XVSL 2WIIA 1FL5A 4Z7WA 4PD4J 3WS3B 4GRWH 2ITCB 2KPNA 2C26A 5EIIA 1RIVH 5F7NC 5ALCL 3QZWA 1L0XA 2NY2D 4LDEB 1F90H 4PJ9B 5IWLC 1RURH 4QTIL 3B83A 1BQLH 2IALB 3NIFF 3VXUB 3MRGB 5A16A 1IBGL 4XVJH 4OLEA 2ADIA 3T77B 3BN9D 3QUZD 5DMGC 1F8TL 4AEFA 3QXDB 3GRWL 1CXFA 5FO9A 3CUPA 4WHDA 5SV4A 1QSVA 1T22B 4BSVA 4IRJB 2G9HA 3IVKB 1NCAL 5C0GA 2BFVL 3QIWA 4XC1L 1A14H 1NBQA 2C9AA 5LGJB 4H20L 1T83A 4U1SB 3UBXA 3WHXB 4W81A 4JFFD 4YHPA 4J8RA 1CLZL 5TF1H 3BKCH 5HJ3B 3ZT7A 5L0QC 5SX4I 5FB8B 3O9WD 5E1AB 1KT2B 2R9HC 1L7TL 1S7RA 1A4JA 1AQDB 4HIIA 4L8BB 4Z0BH 1GGIH 1T21B 2R0ZH 4KJWC 1U41A 4OCWL 3S37H 5D93B 2DQEH 5KSVA 1IAMA 4ODWA 3U79A 3VGDA 4RSVA 1JGVH 3UP1A 5CCKL 5HYSG 1F42A 2Z92B 3OKMA 3IDIB 4LASL 5F7MC 1BECA 4GRWE 1OAQH 4I5BA 4CVXB 3LS5L 1A6TA 2YRZA 4PRPD 2Z93B 2WQ8A 5GISH 1GJIA 1EHNA 3F7RA 3WEXB 3GJFH 4P3DA 4HHAA 4WEUD 3DI2B 1FC1A 4PV8A 2YA1A 2VUYA 3W9EA 5E03A 1S78D 3RDTB 5J1AA 1AE6H 4MB4A 3F7PC 3SGKC 2XI9A 3DMMC 1HZHL 2EZ0D 5DRXA 1XIWA 1K2DA 4DGYH 3AY4C 1MFCL 4QLRA 1HHHB 3LIZH 4KKNA 1NJ9B 3B9KC 3HNSH 4S1DD 3VXTA 4Y19E 1YEDA 2GUOA 1I8MB 1DUYA 4O00A 2WK2A 3THML 1KB9J 3GMLA 1MJUL 2MCPH 1BREA 1UKTA 4J3WA 4PB9L 4I48B 4X4YB 3ZL4H 1G7MA 2W60A 3RZCD 2FEDC 4IHOB 2EE6A 5D6DC 1M05A 1P9MC 4ZOEA 1F02I 2C3HA 1FPTH 4OZGA 5GZOD 1YEEL 3LSOB 5EC1A 1B2WL 3O11B 4JZNA 2BC4B 4XMLH 4PRHB 4P48A 1YMMB 2NY6B 1QLEL 2H6PB 2GCYA 3NACL 4OI9A 1OGAA 3PQYE 1Y6KR 2QQNL 1HXYB 4WW2A 1QYGH 3HUJF 5HYSB 1EX0A 2ADJA 4CADA 2W9EL 1AKJD 1MELA 3W81A 1A64A 4HCRH 1DQTA 3CXHK 3DX8A 5DUML 1BVKA 1RULL 1JPST 5K33A 4Q58C 4HQQL 2L0DA 3BGAA 1IMHC 3HS0B 4CNIA 1CK0H 3O6ML 3G04B 2B39A 4GBXD 5AWNL 5DMKB 2EE9A 4GH7B 4ZTOH 1X5YA 2CK2A 4P9HC 1HE7A 5CD5C 4PJEF 1QSEA 4H1LA 5A2LH 1YECL 2NXZC 2AJSL 5TQ0L 2JJVA 2EH8L 3DX9A 1CDCA 4NJ9L 3CXDH 3RFZC 3P4LA 1FE8H 1KIQB 5D5MB 4WO4A 3OXRA 3SGJC 4ZTPH 3MLSH 1TETL 2WNGA 4Z7VB 2OJZH 4GG8A 2XZAL 3CZFA 1NUNB 4PTTB 5F89B 1P4IH 3QJHA 1I1YA 1U8OA 1FFPA 5BS0A 5CJXA 4Y2OA 2DDQH 4OCNC 4V1DA 4KRNA 2WLYA 3ESUF 3CMOH 3DX6B 4UV7H 2RB8A 1ZTXL 3FFDA 3PWUA 1CGSH 3QG7L 3C60C 3QCVL 1ZT7A 2HT4C 5ICZB 2AJYH 3BAEL 4LNRA 4UU9A 1F4HA 4GRLC 3KPRE 2ESVA 2XKUA 1OP5K 3RWHA 2JB5L 3LKQB 4R97C 1D9KB 4TUJA 4X6EB 2FR4A 4PUBH 3CPLB 5DJ2B 2AJVH 3ZTNH 5T1LA 3AUVA 4LPVA 1XGQB 2W0PA 2O5YL 1NC2D 2HFGH 4OLUH 4EVNB 1DBKL 3U4BH 2R1XB 2O61B 3OF6D 4FFVC 2GSGB 5E8DL 4EIZC 2D7QA 1SEQL 5EZLA 4WRLA 4WI7A 3DO3A 4F58H 3ZLQC 4WI6A 3WN5A 3WFCH 3MXVH 4KVNL 4Y5YB 3MSPA 4QRPD 1MCNA 5TDPA 1G9NL 2K7PA 1Z3GL 2FX7H 3ARDB 4HUUA 1A5FH 3ULUL 1S7VA 2F54E 1MJ8L 2MSPA 4HS6B 1BIHA 3T3PE 2A6JB 1YEJL 5CEYB 2B4CH 2PN5A 4XVUC 1F58L 3GHEL 4Y1AA 4OCYL 5B38A 2Z8VC 2DQDH 1UT9A 1DR9A 3IFOB 1MCPH 4JAMB 1F2XK 4YHYB 1MVUB 1NCCH 3SKJH 4TULH 5GGSY 4CRPA 4S1SL 3MRIB 2KZWA 2AQ3A 3BSZL 1S7XB 3K2UH 4FQ2L 4JQVA 4HPOL 1I75A 5T3ZL 3ULUD 2XTJD 2BOBA 3MRNB 3LAFA 2YPLA 2P5WE 3NA9L 3FZUC 3F58H 2C1OB 4PYGA 2JCCE 3WLBB 2VYRE 3KPQA 3RX8A 3ZKNC 3D18B 3M1BB 2BRRL 2R56L 1MRDH 5DD5L 1LP9F 1ZLVH 3T3ME 4H88L 5DJ0A 4G8GE 4HKBA 3QUKA 1YDPB 4L8DA 1FNGA 2OM5A 4OFDA 1TQBC 1IT9H 1OW0C 1TZHA 4P23A 1AY1H 3VW3L 4QOKE 5T3ZD 3U7AA 3G6DL 4S11A 1JCKA 3VFRA 1EMTH 3T1FB 5FGRA 1XF4A 3CFKA 1IQWH 4TUOA 3F5WA 4PJDF 4LAQL 2B0SL 3NZHL 1N3NB 1UM5H 3RNKB 4FFZL 3HE6D 1FAIL 4L8CB 3I3BA 4XCNA 1E4KC 1QNZL 6FABH 1H3PL 1FN4B 1INDL 1YNTA 1L0YA 2NTSP 4FRWA 3TCXA 2V2WB 4G6FD 2VDPH 1EUTA 2E8ZA 4F7CB 4QY8A 4OB5L 3VFPA 3AREC 1G6RH 5FAAA 4K94L 2BNRD 5D2LA 5JMRA 2OZ4H 3OAZK 1OY3B 3S4SG 4AG4L 4FMFA 5DD1H 3VXMD 1UCBH 1FZJB 3QDJB 3MJ8A 3EFFA 2GK2A 2Z9TA 3V8OA 2JB6B 5DO2D 2EDHA 5HI3D 3NAAH 1A6WH 5KVFH 4KVCH 5DHYB 1NBVL 1T7WA 4JM4L 2B8OT 5I1EH 3QISA 3V4PL 5C0RH 4NBYB 5I75B 5C86A 1C5BL 4LP5A 2VDOL 1C5DA 2NXYB 3OG6B 4TSCH 1G1YA 4YAQB 1H15B 3IDMA 5CKGA 1NGPL 1S9YA 1OB1B 1RIHH 3OGCA 1FIGL 2A73A 5DUBA 5DSCB 2XA8L 3GMNA 5DMYA 5T33H 4O2FA 4F7MA 2V7NA 3GBNH 4XVSH 4AM0B 3H9SB 5DLML 1BAFH 5C1MB 5EU7E 4OF7A 2VIRA 4WTWA 4J2XA 3VWKB 4ONHB 5FYJL 4QTIH 4W68A 3O2DL 2LE9A 5SWZB 2UYLA 4G8EA 4F9PA 3RL1B 4LLYA 5E0QA 4J3XA 5D7IF 5ICXA 2YWZA 5DS8B 3I9GL 2F8VA 5I1CL 3U46A 1ZS8B 1EO8H 4P2OD 2ED8A 5CEZD 4Z7NE 4TTGA 2LFGA 3ZTJG 2JIXB 4B0MM 2P5EE 3VGGA 4OV5A 2DTSA 1R5IA 4GKZB 5T5NF 4JHWL 4Y4KA 1SBSH 1UB6A 1AFVH 1ITCA 4FQ1H 4GAJH 4OFYD 5CLTA 3T0XA 1X5ZA 1J0JA 1JPTL 5ILTL 2ZJSL 5DK0B 2AXFB 4UIMA 5C08B 1A9EB 1V3JA 5D1QB 4RQQA 4LPXA 3TCLB 3AAZA 4KPHL 5EZOH 2ZUXA 2YS4A 4JFXB 3ZKXC 5I8CB 1OARL 1JNHB 4Q2ZB 3PWNB 2FECL 1LMKA 4LSUH 3C5ZB 5JOFB 3KYKL 4OLZH 3FN3A 4HIXL 4AL8H 1JN6A 4P5KB 2OSLA 1AP2A 2VH5H 3C08L 3P9MA 2N1KA 4KQ4H