4LGRB

Ricin a chain bound to camelid nanobody (vhh3)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
VQLVESGGGLVQPGGSLRLHCAASGSIASIYRTCWYRQGTGKQRELVAAITSGGNTYYADSVKGRFTISRDNAKNTIDLQMNSLKPEDTAVYYCNADEAGIGGFNDYWGQGTQVTVSSAHHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords Ricin
publication title Crystal Structures of Ricin Toxin's Enzymatic Subunit (RTA) in Complex with Neutralizing and Non-Neutralizing Single-Chain Antibodies.
pubmed doi rcsb
source organism Ricinus communis
total genus 34
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2013-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lgrB00
4XX1E 3MXVH 4MJ5B 1VADB 3REVA 4H0GA 2LVEA 3O8XA 4HC1A 5J89A 5I1CH 2E9JA 1RUAL 4U1LA 1G1YA 1P84K 5HTSA 1JI1A 1HH9A 1KC5L 1X6NA 3BEVB 4QHNB 3V5HA 1S5HB 3QWRA 4M61A 2Y9RT 4K23L 4NJ9L 2Q3AA 4NYLB 1TETH 1IBGH 2XNAA 4G6KH 4UOJA 4F57L 4HMDA 5FHAL 4MAYC 4LSPL 1MFEL 4JQXA 4O4YH 1I8KA 3H9HB 1T66D 5T1LA 3O2WL 3WDHA 1IGIL 1SEBA 3IS1X 4ORGA 4ZNCD 4QF1A 1X5XA 2P5EA 5CD3A 1J8HD 2DYPB 4OKVB 4J2XA 1CFSA 1AFVH 1LK3H 1YNLL 1T3FB 5F71A 2VZOA 4FQXC 4IHOB 1M1SA 1OD9A 3FAXA 5F7FA 1DUYA 4L3ED 4RMWA 1MFAL 1CLYH 4OGAD 4A6YH 1EVTC 2NY6D 4JHWL 1GHFL 2X6MA 2ATKA 1Q0XL 2YMXL 4ZO7A 4HW6A 5H35B 4ZUVB 3NIGF 4J7RA 4PRIA 5C6WH 1MAML 3CFKB 4GG6A 4PS4H 4QHMA 5D7JC 4DKDC 3O8XD 1Z0MA 3F8UB 2J88H 4RMTA 1BM3L 4I0PD 2XZCL 1ZV5A 3O6FD 4WW2B 4P59L 2PO6A 1NCDH 5KTEL 2CR6A 1KB9K 1LO5A 3DXAB 3QEQE 3ECBB 1FYTD 2XRAL 4NZTL 3CJJA 3DVFA 2VIRB 4JM2D 2E7LA 5I1KL 5DJAA 5T1LD 2DQJH 1N5YH 1TXKA 1A6UH 4APQD 4ZFFB 3UJIL 1A6AA 2MCG1 3UJTL 3WN5B 1T21A 3ZYOA 4OQ1A 5BW7A 5EBGA 5D1ZA 4ODBD 3UPRB 1TLKA 2KZWA 3S9DB 1RUQL 5ESQB 4G9FA 1KIPB 3B2UC 5CSZB 1A6ZA 1E6JH 4CBPA 3V6OA 3QHFL 1G84A 3MLSL 4K7FB 4M3JA 3S37L 3IFPA 4OFYA 3RL2B 4JO4H 4AEIL 4P2RA 3EUUA 4AEHL 4HC1H 3AMLA 4Y4KB 3W0WE 1FVEA 1MWAB 2DQEL 3B2VH 4FXLA 3SPVB 4BUGA 4TSBH 1MCFA 4KVNL 3I6LD 1S9XB 2IPTL 3OHXA 2X4PB 4L4VA 1YPZA 1D5BB 4MJ6B 3LHPL 4WTXA 4XXDA 3C5ZC 4UV7H 3QB7C 5HVHC 1NCBH 1UM6H 2Y6SD 2EC9U 4JPVL 4LP4A 4FQ1H 4ZSOE 4M1DH 3ZKND 4RGMB 2OTWA 5I8OH 3PDDA 2J6EH 5TQ2H 1C5BL 3MRLB 4H1LG 1KG0A 5EBMA 5SWQB 3QUXA 3FQNA 2VXUL 3CVHL 4I9WD 5BVPH 4ZUWA 3KLDA 3ZT7A 1CFQB 3AY4A 2ZCHH 1CXLA 1K6QH 5IFAL 1ZMYA 2ZCKL 5CEYA 3VXSE 2VDRL 4Z7QE 1GAFL 1T20B 1X5LA 4G9FD 2EDJA 1P7QB 5EUKB 3BP6B 4O00A 5I1IL 4LSVL 1UEYA 2EDEA 1L6XA 2UWEB 3WMSA 4XCEB 1ZT1B 2A9MH 5CJBA 3HZMA 1GGCH 3WFCH 2XTJC 3FQXB 2ZUXA 4YHZH 5JR1L 1X5JA 5I1HL 2CLRB 2FLBT 3PGFH 1A22B 1MCPL 5D7KD 3RPKA 4PV9A 2WWMD 1IM3B 5IQ7H 2GTWB 1LO0L 2AJUH 4X9BA 4HLZH 4EI5A 3WE6A 1A02N 1YNTA 2IJ0C 3V6FB 4QHUB 4ZAKB 2NXZC 2ZG2A 2KKQA 1G7MB 1DL7H 4F7CA 2UY7A 4TSCH 3C08H 3BHBB 4OCWH 5I76A 2YHGA 4TPRL 5FKPA 4G8GB 5F3BB 4LKXB 2GJ6E 3DV4A 4H25B 4HF5L 3MOBL 4G7VH 3LKPB 1VESA 2PO6C 4Z7WB 2G5BB 4X8JA 2XZAL 5KS9E 3MRMA 2E7LC 4RMSA 3IU4L 3IB4A 3FT2A 2IWGA 3NH7H 4KDTC 4NKDB 5IVZA 4HIXH 5BVJA 3EJZD 3BAEL 4ZS7L 5DD6A 3OKNA 1AY1L 1RV6X 1ZHLA 1YEKH 1KEML 1KLUB 1PZ5A 2V9RA 4YLQT 5LJYH 5D1ZC 4QHKJ 5BOPA 3FO1B 2DIBA 3QH3B 4WEBL 5GRZA 5GSRA 2CXGA 4JFFB 3K74B 4QRSA 1MNUL 3BEWB 3MV8D 1ZLSL 4PJ9C 4EI5D 4X99B 2B1AH 4LOUC 2ZCKH 5ALCL 3U4BH 4FQIL 3D6GA 3HCVA 1CFVH 2CD0A 1QLRA 3RAJH 2OLDA 4NRXA 3QDJE 2NW2A 1DUZA 3DVNB 1J1XH 1ONQB 2PTVA 1OP3K 1A6VH 4HH9B 2X1XR 4NZDA 1B88A 4OF3A 3HNTL 1DANU 4HZLA 5ESAB 3BDYL 3QXTA 1Q72L 1VEOA 3UBXA 1MFDL 12E8L 5E6YA 4HEPG 1QSVA 1AQKL 1U8IA 2BVEA 5C0JA 2J5LB 4KUZL 3VFNB 1DDHA 2W9DH 2CDEB 5BRZE 4Q97A 5DK0A 4WJ5B 3TBSB 2XN9E 4H20H 4ODVL 3SDAB 4XVUC 5CMAB 5K9OA 2LAAA 2R4RL 3D39E 4S1RL 3VXOA 4HWEH 2DLGA 1BF2A 4MNQB 4ZXBC 1FNSL 5KVEH 1E28B 1MY7A 3PP4L 4NN7C 1JHTA 4H8WL 1FL3A 2IALA 1MIEH 4PJEA 1YEGH 1ZHKB 1HILB 3R1GH 4JFQB 1J5OH 1WITA 1PDKA 1NCNA 1Q94A 2GITB 4D0CA 4KH2A 3VFVB 3KS0H 2EIBA 1CE1H 1G9NH 4UOW1 5DJZA 4JKWA 2H1PL 3CDFA 3NIGE 3WJJA 3OTTA 3WS6A 3BH9A 3GJEB 2P4AB 2HKFL 5AD0B 4G43B 4Z78B 1UT9A 5CSGA 3VFOA 4N0UE 2CK0H 1CXKA 1INEL 4NQED 4ZUTA 1T1XA 4M5ZH 3DX9B 4MNGA 1BPVA 1FO0A 4RFOH 4BZ2H 1HOCB 2FO4A 1R5VA 2EH7H 1CN4A 1K3IA 2R2EA 5EOQH 2VLKE 3ARBD 5GS0H 4B7IA 1NANH 4HSQA 4NKOB 8CGTA 2AJVH 2NX5D 1G9NC 2GCYA 3BKCH 1QYGH 2ZOKB 5SWSA 3AC0A 1TZIB 3BP5B 4JR9H 1E4WL 5HGHA 1U3JA 5GIRB 4XCFH 1Q0YH 4JKPL 1HCFX 5CZXD 4K8RL 3TH2T 3U2SA 3VGBA 1LDSA 1T1ZA 3D9AL 4JG0H 3EYQC 1HKLL 1KIQA 1P4LA 1I3RB 3L3GB 4C58B 3OF6A 5GGRY 5GS0C 1TJIH 5IR1B 3K1KC 2JKXA 3U36A 4JFXA 2D4FA 3K8MA 3VCLA 1XGYH 5C0EA 4PG9A 3JWOL 1DLHB 1SBSH 1FC1A 1JHLL 3WLBB 3K2UH 3IXTB 1OTUC 3DVGA 8FABB 3PF2A 3G5XB 4JY6B 2DQIL 4S1QL 1WZMA 3FRUA 1WLHA 2FRGP 2AABH 4NJAH 1NCAL 5HDQL 1CG9A 2XY2A 1ZANL 3C9NB 4JFEE 1HINH 3KJ6H 1QZ1A 5JW3H 3S36H 3QG7L 3P30H 2PXYA 2W0PA 1UYWH 4ZUSA 2PW1B 2A74A 3DLQR 4ELMB 4ZTOL 4DGYL 4IMLA 2HVKA 4W68A 4XAWH 3W0WA 1EFQA 5DD3L 3JWDH 2IAMB 4MX7B 4F2MB 2ESVE 3UTSB 4L5FH 1P7KA 1YDPA 1D3CA 1F2XK 1HSAB 1I1YA 1IC5L 2MTPA 1S7SB 1V3LA 3QUZA 4LDLB 5T33L 2VDKH 3LZFL 1PJ9A 4DZ8A 1YEIH 1G1CA 1WBXB 1J05B 3S4SB 2PUQT 3RTQB 5E2TL 4YHIA 2NZIA 3LQZA 2P24A 3STBA 3RBSA 3L6FB 2NY4D 4M02A 2F8XC 3SKMA 3QRGL 2DD8L 4IS6B 1NQBA 3HE6B 3B6SB 1JF1B 4TN9A 3VGAB 3JWDC 4RFEB 1ZLVH 4EN3C 1E4KA 4X6CB 2EDOA 1PY4A 5HHPA 4UTBL 1U8OB 3VRLF 1MPAH 1JYWA 4LLQB 5E9DD 5KSAC 2AXJA 5J1AA 5E0QA 1XGTB 4ODSL 2GY5A 2YD1A 4UOW0 4UU9A 4YDKL 1HWGB 5HYSB 5BXFB 4RZCA 1J8KA 5I30L 1YMMB 1QHOA 3GSQA 1N0LA 2BFVH 4E41D 5FV2A 3MXWL 3TNNA 1RHFA 3QO0B 4GJTB 1WCQA 5B38A 4J3SA 5DMGC 4I5BA 2C4FU 4AEFA 4Z18A 3O6ML 3STZB 1A7RH 1AGDB 4JHZA 5DR5L 1T22A 2BDNL 4BFIB 4ODUB 1DQQB 5MEQB 1HI6B 1LILA 2X4QA 3CFIC 1ORSA 4PGEA 1TQBC 1MOEA 3IYLW 3EHBC 5DA0B 4F80A 1J12A 1RI8A 3OAYK 3MBEC 5DRXA 2OX5A 3A67H 3G04B 3BZ4A 1M05B 3W39B 1G7JA 3L95A 4QRTB 4JZNB 1IAKA 4MYWB 1CXIA 3QZWB 2CRMA 5KS9A 2AEWA 3RVUD 2H2PD 3KXFA 1ZLUH 1CGSL 4QLRA 1NFDB 1KEGH 1HQRA 2HFFB 4EQ3A 1K2DA 2YRZA 4M6NH 4UDTB 5GRJH 5KSBF 2X4UA 1ZSDA 5SWZD 3BPNC 4NWTH 2RCSH 5DK2B 2JELL 5DD1H 3U82B 1BHGA 1NLDL 1YQVH 4YNYB 2PXYC 3BPCB 4U3CA 5HYEA 1RJZA 1VPOH 1S5IH 4R3SA 5J13B 2Z31B 3VI4F 4NC1E 4YC2B 5EU6D 1BZ9B 4Z76B 3TH4T 1UKQA 1LP9F 3O3BA 1FZOB 1DLFH 1TCRB 4S2SB 1A9EA 5E8DH 2ADJA 1N2RB 1CBVH 3F5WA 2MHAA 4RIRA 3V5DA 2Z91A 3IDXL 1WTGT 3QUZC 1UJ3A 4L8BA 2J3SA 5FKAB 4X9FA 2DLTA 4M7KH 3MJ7B 5IQ9A 3IDIB 5CEZL 1KB9J 5KANI 4FQCH 5FF6A 1EUUA 3CDYA 1AO7B 3U4AA 1FNEA 2C3XA 5HHMB 1BQLL 2DQTH 3QWOA 1N8ZB 2ZSVB 5C07B 3KXFD 3LKRA 1K8DB 2ADFH 4KY1L 1EZVY 1L0YA 4W4OA 3H9SE 1E4KC 3SKNA 2HAZA 5DRNB 4W6WB 4QXTA 4UINL 1T5WA 1T7VA 4DCQA 3F6LA 5J6HA 2MQCA 3EFDH 4N8CH 5IT2L 2R4SH 4PRPE 3C2AL 1IKFH 4H88L 3RUGF 4QXGL 4BSJA 3CNKA 2VUOA 1RPQA 1Z2KA 3SCMA 2BVQB 3CD4A 3BO8A 5DD5H 4GKSB 4WI7A 4CNIA 1CD1B 4QWWD 1KUMA 1X5FA 3S34H 2VLLA 1QEWA 2CUHA 3OJDB 2I9LA 4NKMA 4DK6A 5IBTL 3PDOA 3RVVD 2GSIA 4N0UA 2IEPA 2BRQA 5IGXL 1HQ4A 2FZ3A 5EPMA 2BSTA 2W59A 5ITFA 3G5VA 5MERB 4OT1H 1KTLA 5KANG 1CL7L 5I1DA 4F37K 3MREB 2VITB 1JL8A 3CPLA 4OLZL 3VXRB 3FONB 2KPNA 3GSVA 4S1SH 2BNRA 4Z7UA 1CLOH 2Z92B 2HTKC 5HHOD 4LIQL 4TNVK 1CYGA 5A16B 4LAQL 4NCC1 5TE7L 2NY1B 2W38A 5BV7L 4NKQB 4YHPA 4CL7A 3T3MF 5E5MB 3RWIB 1ZS8A 3LH2L 4D2NA 3ILPA 3RA7L 1RUKL 1YN7B 1II4E 4AT6A 1CQYA 3QO1A 4W4NA 3EO9H 3L7FB 3GRWA 3Q48A 4L8DB 5FYJE 2D0GA 3SGKA 4ONOA 2VYRE 1ZGLB 3D69A 6FABH 1C08A 1S7QA 3GJFB 3O41B 1P2CA 5CILL 2CRZA 3QR2A 3H7BA 2X05A 3BWAA 4PTUA 4BSWA 4E5XA 1K4DA 3QDGD 2AK4B 3B9EA 1I8MA 1V8HA 4PJDB 4LLYB 3WNMA 2DQFA 1Y6MR 4LQFH 5CUSH 1SMOA 4WWKB 2A77H 32C2B 2X9WA 4NFDA 1NJ9A 4KTDL 5CCKH 3GSNL 2Z35A 4FTVA 3QEQB 5INCA 2BNRD 2VDQH 5B39G 5FHBH 2JJSA 1WWBX 1JUFB 3CFJA 4YWGH 5ELIA 3UYRL 2HMID 1UJ3C 2VWEE 2Q8AL 1HEZB 2HT3D 2V7NA 4O2EA 1G0DA 5EO9B 4XCCH 3EZJB 1OHQA 1S7RA 5F9WC 3B8YA 3SJVE 5EORH 3I3BA 1H5BC 3AS3A 3P4MB 4OCLC 3TT3L 4JRYB 2APTA 1QRNE 2E7CA 4CADA 3VRLE 3G9VA 5D7IE 2VLJB 4Z7VB 2E27L 3SDDA 1F00I 4IRSA 3S5LG 1Z3GH 5E4EB 3GGWB 3MV7E 3KYOA 1KN4L 4JN2A 4JPKH 4W4OC 3EDKA 1KB5A 5C0CE 3SE3A 2CMRH 4HQQH 4PJ8A 3VXQA 2WSKA 4N0YL 1J8HE 4WI4A 4LEXL 4YDVA 3TBYA 4F9PA 4OZ4A 4OUUB 4XPTH 2EKSA 3KR3H 2Y06H 1VFBB 3IU3A 3SDYH 5JOFB 1HHKB 2VDOL 1N3NA 3QI9A 5E08H 4GRLB 5HYIA 3E6HA 3IVKA 3T2PA 2FX9H 5DJDB 3F7QA 1NEZA 1OCWH 3MV9B 2ORBH 3LN4B 4ZSOB 2VZ1A 3X3GH 3SCMC 1DBJH 1QLEH 5FYKD 1AGFB 5FAAA 3TJEL 2JF1A 3MA7B 3PGDB 4PJFB 1T2JA 1W0YT 3P11H 4JANA 3GMQB 5CJ5A 1MH5A 1CS6A 5E6ID 4NDMB 2WAHA 3QISA 2VDML 3MRCB 3HR6A 4HHAA 5F1NA 3ARDB 5JOPE 4UV4H 4P3DA 1FYTE 1MHPL 3M07A 3CK0H 1BF8A 1JGVL 1GPOL 2BVOB 3A6BH 3GRWH 4PRHE 5EIIB 3SDDD 1E0OB 4GKNB 5EUOF 1BQHB 2G9HA 5TQ0H 4WI9A 3WKNA 2Q6WA 1TCMA 4QRRB 4JDVB 3MUJA 2FEEL 4LGRB 4MQXD 3MLTB 3V6ZA 4U1MB 1E4JA 3QQ4A 2ATPA 3KPSA 3AU1B 2D0HA 1OM3L 3VI4E 1MFBH 4WO4A 1A6WH 4NWUH 5JNYB 1INQB 3MRRA 4PBWD 5FUOL 1LP9E 5AG8A 3FO0L 4ONFL 1AJ7L 2K3TA 5AZEH 1D5ZB 1SVCP 4YHNB 2BCKB 1EXUA 3ARFA 5C0BB 1KXVC 2P44B 4GAFB 3H8NA 1QRKA 5LAXB 2GJ6B 4MQTB 1UC6A 3KPMB 5CAYB 3GM8A 3TO2B 3C6SB 5H37H 4YX2H 1KB5H 4XCYB 5AAWA 5F1KC 4BM7A 3O3EA 2YWZA 4OLVH 1INDH 5INDA 3BGMB 4I9WE 4HPOL 5FB8A 4ELKA 4QRQA 3NCYP 1S78C 4GFTB 3VFRB 1MEXH 3WXVH 1RVFH 1I7ZA 4JDZB 3MRGA 1P69B 1LNUA 3QEGL 4MD4B 4C56D 1P53A 1WWAX 4R4ND 3I02A 3QFJA 5FDWB 2VZVA 1U36A 3CUPA 3UZQA 2YA2A 3B9KA 4HX1A 1BBJB 4NBYB 5I1LB 2FBJH 2O5XH 1T89A 3WCYA 5F7YC 4IRSC 4POZD 4P23A 1HIMH 4LLDA 3TJEH 4MCZB 3MOAH 4FFZL 4CVZB 5E7BA 3RUGE 3O4OB 4PJ8C 4K7PL 1NC4A 4EOWL 4LSRH 5E2VH 1FSKB 4YZFF 4F9PC 3CFEA 2ICWA 4Z7NF 4KJQC 3FQTA 4LSUL 4XPHH 4YR6A 1MI5B 1RUML 3U1SH 1XCTA 2BC4B 3QI9C 5AUMB 3HNVH 3AUVA 4OD3H 5JZ7C 1PKQB 4RRPG 4OZGA 1FVDA 3BVNB 4X80L 2QQQA 5C0IB 3QXDB 5I17A 1AR2A 1WC7B 1TVDA 1JPSL 1SEQL 3GSXA 2F5BL 1FG2A 1NDMA 4I3RH 1SYVA 4P5MB 5IHUH 4N5ED 4XPGH 1DZBA 5DUBA 2LAGB 3IDMB 1UKTA 4ODTH 1C5CH 2V2XA 3AMKA 1IC7H 4U49A 2FR4A 3PE9A 3GK8L 4M1CC 4XC1H 4MJIB 2WBJA 4Q0XH 4URTB 3T3ME 1XF2B 1OAZH 1VEMA 5F3HB 3VXPB 3QNZA 1BAFL 4OV5B 3JVGA 4QGTA 5DDHB 2GJZB 3GI8L 3QULA 4ETYA 4RX4D 4G5ZL 4XBGA 2HN7A 1JVKA 5IVXF 3GSWA 1UM5H 4CN4A 3WLWD 3OR7B 5J11C 4YHKL 5C0GA 1ACYL 4KKBD 4GBXA 3MV8E 3QUYA 5E8NA 1BFVL 2ZUVA 1I1FB 1JWUB 4HKBA 4LP5A 5K9JL 4GXVL 3TZVD 5DC4B 5ICZA 4LSDA 4DEPB 1OQXA 1OY3B 4V1DB 3ARFC 4P5TD 3RKDC 3NPSB 3DYOA 4PRAA 4NPYB 1WZLA 3O0RH 4PJHB 4O58H 4PRBA 4P2OA 5KBNC 4MD5B 4U1SB 4WFHD 1FAIH 1H3XA 4HLZG 5FYJL 4NNPH 5BV7B 3LD8B 2QQNH 4BQCA 4WDIA 1L7TL 1XF5B 1B0RA 1U8QB 2NZ9D 4CMHB 5GZNC 2F58H 4N0RA 3SEPA 2JIXB 4NC1C 3PWLA 3MC0A 3REWA 4Z95L 3QXAB 2F8VA 4MA7H 2BVPB 3FQRB 4J3XA 3QQ9C 3O6LL 3IDNB 2DOCA 5J06A 3KPNB 3B9KC 4JG1H 1YEJL 3EBAA 1T89C 4LLUA 4JFYA 1UVQA 5HY9A 2P47B 4F58L 1EFXD 3BRDA 4Z0BH 2DWEA 4P23C 2AXGB 4GBXD 4QRPD 3G08A 1OW0C 3SJVA 5D72H 2R0WL 1VACA 3LS4L 4EI6B 1I7RA 1OGAB 1FNAA 5I15L 3FB7B 5BS0B 3EJYC 1QRNA 1ZGLP 1J88A 4Q9BA 3RDTB 3PNWA 4AL8H 4DKFL 2X70B 5MI0C 4WCYH 5C0CA 4NQEE 3BP4B 1EAPB 1MFCH 1JMXA 3D0VB 4U1IB 5DJCA 2WIIB 2XKNA 1A7PL 1U2HA 4KRPB 3V7MA 3TA3B 1PG7H 4NT6A 3QRFM 5EUOE 2VRAA 2NX5E 1EEUA 2B5IC 1XF4B 5I8EB 4PGCA 3TFKC 5KSUB 5C08B 4HMEA 3WD5H 4DUXA 1JYNA 1MHCB 2Y7QA 1T0NA 1CXHA 3FRPG 1NCTA 5F96L 2KQNA 3WIHL 1F5WA 5KVGL 3O9WB 2WBJC 1ES0B 1NANI 1R5IB 1FZMB 3F58L 3LEYH 3W9DB 1FFNA 4NN5B 2JB5H 3EFFB 2R56L 4PREA 1HXYA 4ZQKB 1T1WB 4C55A 5FYKU 2A73B 3WIFA 2SEBA 3EGSA 3LRGA 3W2DH 1Z9OA 3CZFB 4MQSB 4NRZB 1U3HB 3QHZH 1EV2E 1ZT4B 4KROD 1E27B 1TTGA 4PRHA 5HGAB 3DX6A 5FYJH 1TITA 3J8F7 4G80A 3DO7B 4NGHH 5EO1A 3GBNH 3IAPA 3MLXH 4ZODA 5LCVH 3ARRA 4G6MH 1AE6H 1T04A 4NNXB 4UAOC 2C4XA 2W60A 1OAUL 5DQJB 1LEGB 1F3JA 1XR9A 3MCKA 3QUYC 5F9DC 5IB1A 1BVLB 5KSBA 3NAAL 1ED3B 4Y2DD 1EVUA 4LPTA 5DF0A 3T65B 3THMH 4EBQL 2YPLE 5IVNA 4LBEB 3L3JB 3UBXI 3ROLB 1HDMA 4KQ3H 4N9GA 3QBTB 5C0AB 1OAKL 3DUUA 5HI4D 1QFUL 2FIKA 1U8MB 4P2OC 2Z4QB 4HWBL 3PQYB 3G6AB 4HBCL 3NABL 4HFWA 3D18B 4GAJL 4WV1B 4L29A 3MBXL 15C8H 4ZFZA 1QBBA 4J3VA 4PGBB 2AKRB 3X13A 2HLAB 3W11D 5D5MF 5DT1H 4FQJL 1JHKH 1JPFA 1UCBL 1I7TB 4KK6D 4NOBA 4BH8B 4CW1B 1U8HA 2KUTA 4HK3N 1A3LL 4NKIL 2XWBB 4XPBH 4I77H 3WUWG 3LQAH 4PJ5D 3L5XH 2DBLH 3FQWB 1JNLL 3MLVH 1JYXA 5F9OL 4D9LL 4F37F 1F4WL 3MRHB 4OFKA 2IQAB 4PIRF 1O7SA 4LVOB 3GMMA 4JY5L 5F72S 3VG9C 4Z7NE 3UEZA 1QG3A 1MHHA 2VWEC 4ZD3H 3HPJB 5T3ZE 1UWXH 1G7QA 2OCFD 5LGKA 4TNVF 1UB5A 2Q87A 1MJUL 4FZ8L 3O6KL 3GO1L 1CICA 3FB5A 5E9DE 4PJBA 3WIHH 3V7AE 4LDOB 1YNKH 5ISZB 5I1AA 3LQAC 4N8PA 3HUJF 3IFLL 4UNVA 2A1WL 5MENB 4OZHB 4Z77B 4JGUA 3T2QA 1OVZA 3IDYC 1VA9A 1F8TH 1N5AA 4YDJA 4WGVB 3TGXA 2DTML 3BYTA 1VSCA 1K5NA 4ZDHB 1S7UB 5HPOA 3QQ3A 2H2SD 4XX1G 2AK1H 4QHLB 1O5DT 5D96C 1Z6JT 5DK3A 5EZOH 3CMOL 1GZPB 5DTFB 4JDTL 3T1FA 1BIIB 1ADQL 5D2NE 4LHUG 5ILTH 4LCUA 4YO0A 1H3TA 1FLRH 3CSYA 1KIRB 4QTIH 2HFEA 4NO2B 4I0PC 4D0DB 4QTHB 3GEWB 4WFFD 1ZHBA 4HJ0C 1TVHB 2GEEA 5J7CC 5EWIH 1U95B 3RZCC 2A0LC 1HHJA 5EA0L 1KTDA 1TVBB 3GHBL 5CJXA 3MNVA 4MCYA 2YR3A 4X9GA 5BZDA 5IW6A 4R90L 4BH7B 4GRMA 4O02H 3GKWL 3Q3GA 4P4KA 3DECA 5E8OA 1G9EA 5SWZE 1U92B 1RIHL 2IBGA 5TH2A 3W81A 2C1PA 1XEDA 3U9UB 5K59F 1QOKA 4TQEH 1NPUA 5E00A 1WBZA 5I1GL 1QPPA 2VUYA 3FFCA 2JK5A 2H3NA 3CU1A 3QEUB 5EU6E 5E8PB 3V0WH 1A64A 3ARVA 3SGJC 2E8YA 4YHMH 4FABH 5FK9A 2CLZA 4NNYA 1F6AA 2DQDL 4F3FA 3RVXD 3ARGA 1P4IL 3KLAA 4I4WB 2LVCA 3CX5J 4FQLH 4P3CH 3VWJD 3DNKA 4ODXB 1DSFL 3AREA 4ONGL 1DQJA 1MF2H 5GGQH 5I1JL 4P9HH 4XBEH 3LCYA 1XIWD 3O11B 4WHYH 2XQYG 1QSEE 4E42B 1ZT7A 3IS0X 5IEHA 1UACH 2R0ZL 3PHQB 3RWFA 3BIBX 3C5SB 3PL6C 4Y1AA 1YQ2A 2QADB 2QQKL 5DLMH 3KYKH 1UA6H 5LBSL 3BRGC 4YBLB 5E7FA 1S7VB 1A7QL 4G7YL 2UZIH 1FORL 1ZA3B 3OJ2C 2YC1A 1IGCL 3ZTNH 1NAMA 1W2KT 3Q1SH 1IGJB 4P4KD 4EVNA 4XP5H 4P9HC 5CIPH 4LLMA 4A2LA 3KYMB 2EDBA 2EXYC 4YDLC 1CICC 1N0XH 3FFCD 2F74A 2W9EH 1ZEAH 4YAQB 3UTTB 5FOJA 2CLVA 3FCTB 3MA9H 5E2UL 1BD2B 1I85C 2BVYA 3MRJB 1FE8H 3L3KA 4IMKC 3TIDA 1XCQB 1JPGA 2DKUA 5JHDE 3DUSB 2R1YB 2EYSB 3D1MC 3M45A 4OZIE 4XMLL 5D7LB 2R23A 1ORQA 2NY0C 2H26B 3VXUB 4A6YB 3V4PL 1RMFL 5C09D 1LE9B 2MMXA 3VW3L 3QCUL 3WFBH 5D8JH 3GMNA 4FNLL 5LGJB 4HDIB 4KRLB 5L2JB 5HHXL 4U6YA 4B41A 3JUZA 3O4LE 4IIQA 4P2YA 2I5YH 1VGKA 3E2HC 4P46A 5DS8B 3V4UH 1S9VB 5CJOH 4K3JH 3H9ZA 4N8VB 3JV4A 3TYGH 1AGBB 2GK2A 1QUNA 5HHOE 5E1AA 4NQCA 2C3VA 4OAWB 1AQDA 1CU4H 4GS7C 4RBPK 5ITBL 4KPHH 1JPTH 4QXUL 4QY8A 4JHAH 1XGQA 3E1F1 3X14A 1J8HB 4NUGL 4F7EB 1KPUA 2ITCA 4XNZC 2VDLH 5GGSA 3K4AA 1DN0A 5AZ2H 4NM4H 3QCVL 2EDYA 3OG6B 5HVHB 1OSPH 1YMHA 2GUOA 5C6PB 4WHTA 1WEJL 1XGRA 2W0FA 4L3EB 5FA4A 3QIWA 3S8WA 1F11B 4RISL 4AIOA 3MLZH 1Q38A 2NY6B 4X6DE 4HWUA 4LLAA 3RU8L 3REVB 2WWKT 1DBBL 3O8XB 4U1LB 5DHXB 4Z5RA 1LGVA 2BSSA 3HC4L 5I9QC 1FO0L 4LNRA 3O6FB 5GGSY 1UWGH 1NAMH 4M61B 1DCLA 2YPLA 3PUCA 5IJKC 4NIKB 3TO4A 3IJYA 3AREC 1AP2A 1C1EH 4OCNC 2NY2D 1RU9H 3BKYH 4JM2B 4NQCD 1A5FL 5JIKA 5T1LB 4MJ2A 4APQB 2BMKA 4FZEH 4EXPX 4QEGA 4ORGB 4PB0H 4QF1B 1UXSA 1NUDA 2APWA 5E1HB 5CD3B 2DQHH 1CFSB 4MQ7A 5IW3A 2AQ3A 4PJAB 3A6CL 4LLVA 4JO3H 4Q6IA 4TRPL 2Y1VA 3SDCA 1G0XA 1R3JB 2EKJA 3MRBA 2AJXL 3DXAD 4J4PC 3HUJE 1VGEL 4NC2B 2F9BT 1P7HL 5D70H 2ATKB 3ZYJA 3PV6A 4PRIB 4OIIH 4P4RA 4GG6B 2DI8A 4F7PA 4QHMB 4C4KT 5IG7A 3RGHA 3HN3A 2DIAA 2WNGA 3TN0A 5BMFL 3EOTL 2DI7A 1D6VH 2CJUH 5IKCA 5HHQA 2PO6B 3L7EA 2OYPA 4OCYH 1LO5B 3Q5YA 4JFOA 3TO4D 2IADB 3BZEA 5FYKE 3DROA 4OF8A 4XCNB 4MXVF 3V95A 4PRDA 5JW4Q 4KZEL 5H94A 1BVKA 3EDDA 1MVUA 3JSSA 4QOKA 4Y4KD 3VXNA 4WU7B 5HI3D 5IWLC 5SX4H 2NPLX 1JYVA 2YRLA 5DQDL 4NQDA 3GNML 2HH0H 3ARXA 3RIAK 4IIQC 3HLAA 2V5MA 3C60A 4P46C 2NY3B 4G9FB 3ARBC 3H42H 3T0EA 3BT2L 1EMTL 1S9KC 2WW8A 4HG4K 2H32A 3IFPB 3ZHDA 5IMKB 4P2RB 1MRCL 1YY9C 5E2WL 5GRVK 1GGYA 5I0ZA 1CDGA 4M7JL 4ENED 5D2NA 1KACB 3SHSA 3D48R 3TN0D 1T5XA 2Y07H 5IVXA 3OHXB 1KCUL 1YPZB 4GQ9H 5K59E 4XXDB 5IB4B 4PLJD 1X7QA 1YYMH 3QXUA 2J7LA 3T8XA 3ZE0F 5FO9A 4K3GA 3QIWC 3IXAA 2IG2L 3RVWC 1NAKH 1BREA 2A2QT 4PB9L 3DX8B 1KG0B 2CDFB 5EBMB 4G8EA 3QUXB 4PFEA 3FZUD 4XHQA 3FQNB 4TUJA 1BOYA 2HWZH 1IAIL 4OM1H 3OKLA 3DGGA 1U8LA 4NQDD 3G6JE 5GGVL 2XOTA 2R2HA 4U2YA 3AXLB 1RZKL 4QNPE 2CKBL 5C2BH 3MCLL 1XMWA 3O2DA 4ZAKD 4C56E 3HZMB 5T3ZH 4WNQA 3HC3H 4O51A 2EDFA 2BY1A 2HG5A 5A3ID 3UMTA 1C5DA 4NBXB 2WUBL 3QPQC 4MGXA 2E9BA 3NA4A 3DIFB 1QSEA 2C7UA 1IEBA 3SDCC 4DOHB 2CQVA 3P2TA 1A7OL 4J8RA 4OD1L 4I3SH 4NHCL 2NY4C 4EI5B 1F90H 3WE6B 1MFNA 4U1HB 3AS2A 3VRJA 3WEXA 4I48A 5F7NC 4NC0B 5I76B 5FKPB 4U31A 2HLFC 3DYPA 3VE0A 3DV4B 3KPQA 2J8UE 4WUKH 4HWNA 4OLYH 2H32H 1AIFB 1A0QL 2BOBA 2FX8L 3HNSH 4X8JB 3S36X 2E7BA 5I1EH 3C87A 3WKML 4DWHA 3MRMB 2VXSL 2AEPL 3FT2B 4K3DL 5DMJB 2DTSA 1QA9B 4M48L 5BVJB 3E8UH 2MPAH 2UV3A 4XVSH 1QTYT 1JNNL 5JHDA 3ULUF 1ZHLB 4U1NA 5H37G 1KELH 3CFBA 4KK5C 1SY6A 2GSGB 1W72L 4UT9H 5BCAA 3C60C 4ZO8A 3AM8C 5CGYC 3ULSA 3T0EC 4QO1A 4CUCA 5GSRB 1V5JA 4YBQD 5IESH 3BKJL 4LRNH 5EC2B 5D1XD 1H0DA 2CIKA 5J57B 5ETUA 5HDBE 2BNQA 3FO9A 1JFQL 3D3VA 4OBRA 5A43C 5D2NC 3WIIH 4YXLH 3AROA 3HCVB 3N9GH 4M6AA 2VKXA 3U7YH 2UYLA 1G6RH 1QLRB 3SKJL 1I1CA 4Q9RL 4NRXB 4W6YB 1I9JL 4JCLA 4L4JA 1AHWA 2IANA 4B5EA 1CTOA 4O9HL 4MNQD 1RZFH 3TPUA 4D0BA 3FJTA 4PP1D 4GMSL 4OLWH 4DJMA 3MJ8A 4HZLB 2W91A 2WK2A 5I71C 1K3ZA 3LN5B 3UBXB 1E4XH 5ANMA 1JIBA 3SE8H 3O2DH 5C0JB 3WXWL 3RJDA 4KJYA 2D7QA 4WU5A 5DK0B 5I73C 4JB9H 2OL3A 1C16B 3BGFB 4HIJA 4WENB 4WFHE 2Z0BA 4GOSA 1UM4L 5K9OB 4X4ME 1L7IH 2QLVB 3LKNA 2ADIA 3VFPB 3ZYZA 4HLJA 4NQUA 3OAYH 1OTTD 1JHTB 2QBWA 1IARB 1FL3B 2IALB 5D5MA 3ABZA 1N64H 4PJEB 2XTLA 5F7LB 1GIGH 3VGHA 4D94A 4D0CB 2KDGA 3D3VD 2A6KA 3BKMH 1JF6A 2VSCA 1EERB 4WI5A 5DJZB 2Y5EA 3ESUF 3UZEA 2ICWI 2F5AH 4HXBL 2UZXB 4KI5F 4MS8C 3VFOB 4ZUTB 4AEEA 1T1XB 4ZTPL 5JXEA 1BLNB 1Q1JL 4BKLA 5JHLH 4LCWA 2K9UA 4MNGB 5TGBA 1FO0B 5HD8C 5FCSH 3BSZL 1R5VB 1FC2D 2R2EB 5GGTL 2UVFA 1FGVL 1JWMA 5T1DH 3SOBH 1LO4L 4PJIB 3VXTA 1JZ2A 1SY6H 1CE6A 1S7XB 2GCYB 4P2CG 3MV11 5SWSB 1UB6A 2BY0A 5AEAA 5BQ7A 4M6OH 5HGHB 4F15B 5EU5A 4ZS6D 3TM6A 1H8NA 1JZ4A 3RVTD 3EOBA 3W9EA 5SX5H 2R8SH 3SDXA 4CMMA 3HAEB 4YDIL 4WRLA 1EHAA 4LVNB 4LSQL 1MJ7H 5E24E 1KIQB 1P4LB 3JTTA 1MCOH 3S88H 2BRRH 1AR1D 1NCWL 1HZHL 1RAMA 4MAUH 3U36B 4JFXB 3WS3B 5FYKL 5GISH 2VQTA 2FYYB 3VCLB 4I18B 1KLGB 5DO2D 3MFFB 3TBWA 4PG9B 5C0EB 1U8PA 1CVSC 3LEVL 4PUBL 2VQUA 5JXED 3TBTA 4G6AD 2IAMD 3DVGB 4XWOD 1T2XA 4DKEH 3GI9L 3FRUB 3GFUA 5DJ2A 3MGOA 1MIML 1XGPA 4JO1H 1EJ6A 1NKOA 3BPNB 5JO5B 3ZE0E 5MP6L 2ITDA 1IJ9A 2OL3H 1KYOK 4L9LB 1CG9B 1FL6A 2DS4A 3ZLQC 1Z0NA 3EKCA 4MA3A 1BOGA 4Y19E 5E9DB 4HIEA 1TPXB 1AHWC 1NMAH 3DSFH 4ZUSB 4K94H 1IGFL 4FQ2L 2APXA 2XZQH 2YD7A 4IMLB 2HVKB 2KH2B 4KXZH 4E41B 5DC0A 3HE6D 1P7KB 1YDPB 3QCTH 2MSPA 1I1YB 4X6EA 4BZ1H 1JI2A 4DVBA 4DZ8B 5BO1L 1OLLA 5LVEA 3MRPA 4YHIB 1X5ZA 2P24B 2X4SA 3F7RA 3VGDA 3GHEH 3LS5H 3SE9H 2X1WL 4TOYH 1HHHA 4KTEH 5D1QA 4J3OC 2XFXA 4K94C 3SKMB 5HYJA 1NBZA 3PWPE 35C8L 4X7TA 3VFGH 4YUEL 3TWCH 2X7LA 1GOGA 2B2XL 4PJ5E 2NNAA 3P77B 3H3PL 5HHPB 4NQSA 2NXYC 3HPLB 2OP4L 5DFTA 3EYOA 4S10A 1OTSC 1DR9A 2F53A 5J1AB 1U42A 1ZOXA 2HMIC 2AW2A 4UU9B 4GAGL 2IGFL 1OP5K 1CGXA 2P46B 4RZCB 1EZVX 3GSQB 3UDWC 3QPXL 1I8IA 1HKFA 3DSNA 2FATH 4MB3A 5SWZB 5EU3A 4OFDA 4NP4L 4WW2F 2BK8A 3DV6A 5DVNA 5EG6C 5B38B 4XVJL 4R0LB 2XA8L 3KYAA 2R0KH 3VFSA 2CKBB 2QSVA 4XNXH 3KPRE 3EYFA 3M17A 1QFHA 1CR9L 4PJCA 4LCIL 4ZPVA 5T1KA 3CIQA 1SJVA 2I27N 3ARZA 3ULUE 1ORSB 3IFOA 3HZKA 4U1KB 5HYJD 1MCBA 5JPNA 4FFYH 4ORZC 4IJ3B 2BJMH 4R7DA 1IGYB 5I2IA 3KPLA 3MGAA 5DRXB 2BHZA 5L7XH 1I9IL 4E0RA 3BZ4B 4HUUA 2BSRA 3OGOE 3QJFA 3MJGX 3ZSSA 4HUWA 1H8OA 3IDUA 1G7JB 1KFAH 3L95B 5FYLD 1IAKB 2I26N 5IHLB 1OAQL 2F53D 5F70A 1Z5LA 2ERJC 4M8QA 4KJWD 3UTQA 5E8EA 4PLOB 1T6WA 3KXFB 4NN6C 4LSTH 2DLFL 3OPZH 1L6ZA 4MA8H 2L4OA 1K2DB 4MZ2A 4L4TA 1MJ8H 4XWGL 1ZSDB 3GBMH 2O5ZH 2OSLB 3F6IA 1KV3A 1FQ9C 4X4XA 3TESA 4WW1A 3CMGA 3QIUD 2H8PA 1TENA 3RWJB 4PLNC 1JWSA 5B8CA 1RJZB 4HXAH 5T3XE 2QR0A 3OKOA 1ODAA 4H1LA 2R69H 4HAFA 1YJDH 1J9CT 1A9EB 2YPVH 2ADJB 2V17H 5KOVC 2MHAB 1CF8L 1SJXA 1NGQH 4RIRB 5GJSL 3V5DB 5A1AA 4D9QD 2VLRE 5EOTA 3RGVA 3CH8A 4R26H 4K3HA 2NMSA 2QSCL 4OCSL 5ECJE 4L8BB 2EDTA 1J1OL 1MLCA 3QIBA 1HNGA 4TSAH 4FFWD 1YEFH 1YY8A 3QDME 1FNEB 4UNTA 5EZIL 1QKZH 1YEDB 4UIKL 2EIDA 5CLWA 2I24N 4M7LH 2GK0B 4BK5A 3LKRB 3BXNA 5D1QC 1EEYB 1WBYA 3U48A 5C0DA 3RWHA 1I3UA 1YJDC 2FHFA 5EN2A 4RAHA 3LDBB 2PETA 3MUGB 4GMTH 4X4MA 4JFDE 4QCIA 1DVFA 1KN2H 5KW9L 1KJVA 4O2CB 4MNHA 1T5WB 2AJSL 4L9DA 4DCQB 5J6HB 3B4NA 4HG4J 3RIAF 4I8DA 3NACH 4R2GB 1R3IH 5JPMA 2FGWH 1FH5L 2EDLA 1NDGA 4KGJA 3C09C 1ERNA 3U30C 1BX2A 3VXRD 4OV6F 4XP9L 3SCMB 4AY0A 4Y4HA 3BO8B 1JZ6A 2A6IB 3MMEA 4X6DB 1A14H 4HKXA 4YHOL 5TE6H 4Z7WF 2I9LB 4MDJA 4NKMB 4X4YB 1RZIA 3GB7A 5DHVH 1OARL 3QIBD 3NGBB 3PDOB 4GW4A 1CTNA 1RUPL 1AKJA 2P43B 2MWCA 2VXTL 2XKUA 1YEHL 2X1OA 1HQ4B 1KJMA 2FZ3B 4OQTH 2BSTB 5EPMB 4M03A 5L88H 5DEGA 3QDGB 4HWZA 3ARUA 5I1DB 1WF5A 4HS6A 2ZKHL 1I3GL 4G8IA 43C9A 1GXEA 1I1AC 3CPLB 4RMQA 3OX8A 3HZVA 3GSVB 4WFED 4XPAL 5C09E 5GHWH 2BNRB 5DRWA 4Z7UB 1ZA6A 5L2KE 1W0VA 2H45A 3EYSL 4RCAA 2VSDA 4HJJH 3QT2A 2NYYD 2WM0A 1R24B 3ZL4H 2R1XA 1ZS8B 4H1LH 1YECL 3VWKC 3ILPB 2AV7A 3JV6A 4R4BB 4NM8H 3WJLA 3ZT5A 7CGTA 1U8JA 4KU1A 1RIVH 2D7NA 3TJHD 1JBJA 1I9RH 4WWKD 4AT6B 3QO1B 4WUUA 1UZ8A 3I3EA 1OP9A 3EAKA 5ABDE 4OF7A 4Y4HD 1WAAF 1JGUH 1LDPH 3BIAX 2AP2A 3ZDYE 1C08B 1S7QB 5C0FB 3ZDZF 4U6TA 4AMKL 1P2CB 4YHYB 3AAZA 2NTSP 1MJJB 5I0DA 3H7BB 3BE1L 2VB5A 2BVTA 3BWAB 4BSWB 4E5XB 3H9YA 2B39A 1X9QA 1I8MB 5F7MC 2DQFB 2HT2C 2QQLH 9CGTA 1FFRA 4M6MH 1FNFA 1RFDH 2YKLH 2Z35B 3RGVC 4Y19A 3DHMA 3CFJB 2NW3A 4UQ2A 1E6OH 2IPUG 1CXEA 4O2EB 4LASL 1ETZA 3K2MC 5E6IB 1S7RB 4GSDL 3OXRA 4MVBC 2VNCA 2W1NA 1NSNH 4CADB 2RIKA 4PD4K 2IFFH 4XVTH 3MRIA 3SDDB 4FP8L 2J8HA 1XFPA 4M62L 1T03L 3MV9D 3KYOB 4JN2B 4MXWH 1EHLL 1IAOA 1V7NH 4RQQA 1I8LA 3SQOL 3T4YA 4GLRH 4XMPH 5CJQH 3HI6H 4JRXA 5FM5O 1DQLL 1DVFC 1DQDH 4KAQL 1A1MA 3TBYB 4OZ4B 1WIPA 2EKSB 5J12B 2X4NA 3GIZL 4C83A 5F88A 3IU3B 4RA3A 3ARDD 4YPGA 1RURL 3DXAE 1N3NB 1NLBL 2D7TH 5K9QI 5IFHH 4YXHL 3IVKB 1NEZB 2AXHA 1WVZA 3P40A 3ZDXF 4S0TD 2GT9A 2D2OA 2PYEA 1EJOH 4QRRD 3UP1A 4DFHA 3EDEA 3FL7A 4JANB 2GKIA 5GPRA 1F6FB 1IFHH 1MH5B 1HSBA 4J6RL 5GS2H 4R96A 1OWWA 4HHAB 4Q6YA 4GW1A 1B4JL 4OB5L 4ZPTB 1QNZL 1F3DH 5K33A 4OIBA 4Y4FA 4ZFGL 3L5IA 3OZ9L 5L8JB 2MCPL 3VI3F 4QYOB 5IF0A 1LWRA 2VH5L 4ZNEE 2WINA 2O5YH 3PP3H 4KKLD 4AH2A 2Q6WB 1HYSC 5BJTA 4G6JL 4HKJA 3KPRA 5JA8B 4NZUH 4DGVL 2F54A 1A3QA 1S7WA 2C5DC 4OGZA 3L3HB 5FGCB 2VDPH 3ELAT 4IDJH 1IQWL 5B4MD 3QQ4B 5DD0H 5EFIB 5SX4I 2FJHB 3CZJA 3DMMA 2CH8A 1RIUH 4OCXH 3HMXA 1EBPA 3P73A 4NHUA 4WO4B 4KRMB 5K9QG 3HI1B 3MRRB 2YD3A 3WO4C 3HE7C 4ZMAT 3STLA 4X9IA 1EO8H 5A2FA 2B1HL 4ELMF 3KG5A 2IC2A 3CU7A 4BELD 1EIBA 4F8TA 4UB0H 1EXUB 3ARFB 5KN5A 3RI5F 1KBGH 5H2BA 5IMLA 1F58L 2HRPL 3FN3A 3B83A 5HHVH 1KCLA 4KROC 4X7CC 1LK2A 3HKFA 2OR7A 1AXTH 5EO0A 1UCTA 2UWEE 4OLXL 4R97C 3O3EB 4XNYL 3V52H 4G8FA 5INDB 5FB8B 4QRQB 4I0KA 3WSQL 2F54D 4M43H 3MRGB 1NH6A 5IP4A 1A2YA 2OXHA 1PG7X 2VN7A 3I02B 3CLEH 3CUPB 2E3VA 4X6CF 3B9KB 2VLRA 1K8IA 2YA1A 3MODH 4P23B 3OJVC 4LLDB 3B9DA 4YFLF 3LN9A 3U4EA 3NFPA 4JJ5B 4Y5VC 3GUTA 4F33A 1I8LC 4OLUL 3TIEA 3JTSA 4ALAH 1B0GA 2EEAA 1N7ML 3BQUA 4G8GE 2ICWB 4HUXA 3FQTB 1ZKAA 1QBLH 1G9ML 3WFEL 3FQUA 4Z7WE 4YR6B 5DFVC 1MRDL 4M1GH 1XCTB 1CD9B 4MJID 1R0AH 4B53A 4ERSL 1KYOJ 4UTAL 4OZGB 4PJXF 1T0PB 1CFNB 1LO3H 3T0AA 1WZ1H 1FG2B 5F8QC 3ULUH 1SYVB 1EUTA 2B5IB 2W07A 3EZ8A 3H0TB 2AI0H 1FFOA 2V2XB 3NFSL 5IIEA 1HHIA 5DWUL 2NR6C 4GW5A 2Z8SA 4JFFE 2WBJB 4Y4FC 1R5WB 1BBDL 2D3VA 1LEKA 3P9LA 1XGUA 2H6PB 1NL0H 3FO2A 3W5NA 3NZ8A 1WCBA 1FN4A 3PV7A 3ZE1F 3FT3A 2FX7H 4Z7OF 3QULB 2X41A 4TVPD 1NFDF 4UILH 2HN7B 4JRWA 3ULUC 1G7PA 3VGFA 5IBUG 1F4XL 3CSGA 1MY5A 5AYUH 2AV1A 3GSWB 5EU4B 3CH1B 3RL1A 3R0NA 4ZFOA 3LKSB 2HJLA 5L2KA 3DMMC 3UYPA 5C0GB 1X44A 1Y18A 4GBXB 3AB0C 4QRPB 3EYVA 4Q9CA 4HPYH 3QUYB 4PJ7A 3UTZA 1NMCC 4XBPA 5T3XH 3IFNH 5AYQA 4HKBB 4O2FA 5CKGA 4J1UB 3D25B 5DUPH 3KAAA 4LK4A 5ICZB 3VWKD 4XZUA 3ZKMC 1V05A 5TF1H 3RX8A 4M5YH 3IJHA 2V2TA 1W8NA 5CKAA 2FSEA 2R9HC 1GRWA 3V7AG 1MRFL 2DMKA 4MNQE 4PRAB 5TDPB 4PRBB 4P2OB 4JGJA 4C54A 4FQHA 4OM0L 4PLKD 4LHQB 5GJTL 5IM7A 3BX7C 4PP2A 5JDSA 2Q8BH 1B0RB 5IK3A 1S3KL 4GG8B 4QHNA 5JLZA 2FHCA 4WVRA 3B43A 4LRIC 3PWLB 4IEFB 1OGAD 1E4XI 2X4OA 5C0ND 4Y16A 3RDTD 1J11A 2DM4A 1MCIA 2AEQH 2HFGH 3MJ9A 3NCEB 1IKNA 3LSOA 4LLUB 4RGNB 4JFYB 1UVQB 5HY9B 1LMKA 1N6QH 2DWEB 1F45A 4HCRH 1T3FA 4LNVA 1X4XA 5JORA 3TT1L 5JQ6L 1X4YA 1OPGL 1I7RB 1FBIL 3V5KA 3EO1A 4AENB 3BQUC 5LXGL 5ID0B 1G9MC 2RBLA 2Y5TA 3VH8B 2JLLA 4S0SD 4ZOBA 1NBVL 1IC4H 4ZUVA 1RZJL 4KVCL 4P57A 4KI5C 2ZUUA 1A7NL 5I8CA 4XP6H 3S35L 3O9WD 3ZT6A 2B4CH 1AXSA 2FEDD 4Z6AT 5ESVB 5DJCB 4NO0A 2XKNB 2HYMA 1X3DA 3MNZB 3LIZL 4NT6B 5GRUH 5TDNA 4NCDA 3I9GH 4CVUA 1J10A 1RZGA 3ECBA 3RNQA 2VIRA 1WWCA 1FDLH 4IRJA 4OFIA 2Y7QB 3U7WH 4JHBA 3O3DA 1FPTL 1ITCA 1Q8MA 1WFNA 2VE6A 4DGIL 3ARTA 1D5MA 3VG0H 1FFNB 3UC0L 4M7ZC 1HXMA 2JJVA 2R0LH 2B4CC 3C6LA 2DM2A 4JO2H 1HXYB 1TJGH 4KKAD 5F7DB 4X6FB 3WIFB 2SEBB 3EGSB 3HG1A 3BUTA 4XMKH 5TPWL 3X12B 4K7FA 3DX6B 4JZOA 3EYUL 1G6VK 5GQBA 4DTGH 4G80B 2NY7H 5EO1B 2QHRH 1V3KA 4ELME 4TULL 4JY4B 3PQYD 4M9PA 4R8WL 1T04B 2YD9A 4P5KA 3UTSE 3VFTA 1F3JB 2CR3A 5FUZL 3MCKB 5IB1B 1D5BA 2XI9A 4NO0D 5KSBB 2IQ9H 2XQBL 3ULVD 1RK1B 4UT7H 4FMFA 5JOEA 1MCCA 1XH3B 1NGPL 2AJ3A 4N9GB 1Z9MA 4XXCA 3ZMRA 3MJ9H 5GS3A 2RAMA 2FIKB 1KJ2A 1GZQA 2MQ0A 1QHPA 3QEHB 5B39A 3PXHA 4HFWB 4RWYH 4L29B 4ZFZB 2Q86B 5LGHH 3MLYH 1DBKL 3CLFL 4X7SL 1JPFB 3GSRA 4X6CE 4AQOA 1T20A 4D9RE 1F02I 2G60H 1U8HB 4KXZI 4FG6D 4Z7VF 5FGBC 1P7QA 3S5LA 1MCKA 1JRHI 4V2CB 5CGTA 2C26A 2EDXA 4GAYA 1IT9L 4XCEA 1IKNC 1GC1L 5MEND 4FXKA 3L9RB 4PJGA 3UAJD 2V5TA 1YMME 2D03H 3RZWA 2WP3T 5L6YH 3FQXA 1MHHB 3P0VH 3OXSA 4EXKA 5C7XL 3QUMA 1G7QB 5KVFH 3OKYA 1UB5B 3J7HA 3E6FB 2CLRA 3EO0B 5EOCH 2R39A 2PNDA 1CICB 3FB5B 4PJBB 4DAGL 3NTCL 5CZVL 4EIGB 4OTXL 1BFOB 5I1AB 2DL2A 2DQCH 2N7AA 5CP3H 4IOSD 4PJFF 2FB4H 1N5AB 1UWEL 1CK0L 4CKVX 5LQBH 4JPWL 2M2DA 1K5NB 4G8GA 5HSFA 4U0RB 4LKXA 4MAYA 5H8DA 1C12A 1NGZA 3M8OL 4WW2C 3QQ3B 5GRVL 3R4DA 5ENWA 3FT4A 2I07A 3LEXB 5HPMB 3ZE1E 1ZE3C 1DJSA 4IRJC 4Q2ZA 4MD0A 3AFLA 1MWAH 5K93A 3T1FB 4U7SA 4I3GA 1NFDE 1NGYB 4FQXA 5C70A 4XH2B 3OR6A 4LCUB 3WN5C 1KJ3L 3CSYB 3C6LC 4YXKH 1XIWB 3RIFK 1D5IH 3FO1A 2WUCL 4EDWH 3K4ZA 4KHTL 4PD4J 3VD7A 3GMLA 4YE4H 4GT7A 5D7JA 1KJ2H 1NC2A 2ED8A 1HHJB 2HKHH 3BEWA 2X4RA 3MNVB 4DFIA 3CXDH 4MCYB 4N1EA 1U3YA 4XC3L 3T0XA 5BZDB 1SMAA 1BGXL 4GRMB 3T2NH 2VLMD 5ADPL 3Q3GB 1GGTA 2VMFA 4P4KB 5E8OB 5TH2B 4ZUUA 1J1PH 1WAAA 2VZSA 2C1PB 4MAYD 5HYFA 4HUMB 2PKDA 4HH9A 1CFTA 1WBZB 4RGMC 2YK1H 3RY6C 3FFCB 2JK5B 2H3NB 1A4JA 2E6PA 3FB8A 4HS8L 1AO7E 4YQXL 3TV3L 1IVLA 1DBMH 2WLZA 5HHME 2E9WA 5C07E 5FK9B 4LMQE 1F6AB 3VFNA 3UPCA 3X11A 3ARGB 5C9JA 1G7LA 4FQXD 1MQKH 2DIJA 2OMBA 3F7VA 4HIIB 4D9QE 1VHPA 1UH2A 3QUMH 3AREB 5DUML 1X4ZA 1WK0A 1H3GA 4J12A 2Y36L 5CMAA 3I6GA 5J3HC 4DN3L 1NFKA 1DFBH 2A6JB 5CLTA 1F4YL 3NN8A 3VXMA 1E28A 1ZT7B 5IEHB 3RWFB 3KJ4B 4Y1AB 4N68A 1A3RL 5D2LB 2XPGB 5D7JD 1A1OB 2ARWA 5FUCC 4JFHD 3G6DL 3UTTD 2R2BA 2W92A 1GGBH 1BD2D 2VO5A 3VFVA 2YC1B 5DMIL 3GIVB 2AJZA 3QAZB 1NAMB 1H8SA 2DKSA 5DVOA 1KCKA 4EVNB 1EGJH 3WO3B 4U6VH 5HI5D 1C7TA 3EW3B 4XTRC 3VXUD 3HC0B 4LLMB 1B9ZA 4Z78A 3P0YH 3A0OA 5FCUH 3UXFA 4O5LL 1BWWA 1G7HA 3KPOB 2R1WB 3TYFA 5D6CA 2F74B 1P4BL 2BOCB 4RRPA 3DX9A 5IB3B 1KCSL 3DETC 1SHMA 4ZAKC 4FXGA 3TIDB 3ZE2E 3L3KB 5T5FL 5EC1B 3VXRE 1JPGB 3LB6C 2ZPKH 3B2UD 6CGTA 3Q6GH 5D4QA 4KKCC 2B0SL 1BJ8A 3SO3C 1ORQB 4NQVB 5KG9A 4P2QA 1T4KB 3VXMD 3BP5A 2J6EA 25C8H 4TNWK 5GIRA 2OS7A 1RJYA 5EH1A 2OJZL 3W82A 1DQTA 4XNUL 2FECL 2GAZA 3GMNB 1AD9A 1F42A 5JXAL 5C3LD 4RFNB 3I50L 4U6YB 3HFML 5HGDA 3C5ZD 1VGKB 1IZJA 3L3GA 4RAVA 2AEIT 1DE4A 1RK0A 3JV4B 4XP1L 1M71A 4LEOA 2OR8A 1PLGL 2NY2B 4M00A 5E1AB 4NQCB 2C3VB 1CDHA 4PGJA 3DJ9A 4QY8B 4HZAA 1DLHA 3X14B 2UY6A 2ITCB 3IXTA 1CD0A 2X10A 3QDAA 1LQSR 3NCFB 2AK4E 4JY6A 4PJDE 5ADOH 4OGYL 5ICYA 4KHXL 4GUPB 3QWRD 4WHTB 3BPLB 5HXMA 4Q9QL 1JRHL 1XGRB 5FA4B 1EBAA 3MLWL 2UZYB 4PJHF 3DARA 4NUJB 2BNUA 4KDTA 2PW1A 3PWUA 2MJWA 4ELMA 3SKOB 1B4RA 5D9SA 4YBQC 1QFWL 2PW2A 4MX7A 1A6PA 1V7ML 1A6TB 2P5ED 3UTSA 4Z5RB 4JRYE 2BSSB 5AWNH 1KIUA 3IJSB 2J5LC 4LNRB 5KJRH 2VLJE 4Z7VE 2EO9A 4HIHA 2OK0L 2OTUA 5EBLB 5I75C 4UBDC 3TO4B 3IJYB 1CDJA 1JGLL 1AP2B 3SDAC 1J05A 3S4SA 3RTQA 1MCWM 2CO7B 1JZ7A 3KPTA 1RUAH 2B7DT 4PJ9A 2BMKB 4NZRL 4PRID 1GVIA 1KC5H 2NXZD 3B6SA 2CDGA 1A4KA 3QUKB 3M1BB 4K23H 4K9EL 4NJ9H 5EDXA 5I18L 3WFDL 4RFEA 2DAVA 2P5WA 4N90D 4LLVB 4Q6IB 1P6AB 3MV9E 4LSPH 3CGTA 5FHAH 1MFEH 4F57H 2PO6D 3SDCB 4DQOL 3ZTJG 1D5XA 3O2WH 4OGXL 1IGIH 4KQ4L 2DI9A 4AIZA 5TF0A 4PJFE 1OTTC 3CVHA 4P4RB 1YNLH 5IOPA 3HB3C 4F7PB 2I60L 1R3KA 3TN0B 1KSRA 4GLRI 2FL5A 3QO0A 1MFAH 4JFZL 5D1ZD 3UZVB 4ZXBA 5IKCB 5HHQB 2CIIA 4JHWH 3PWNB 2NY3D 1GHFH 2QKIA 3UO1L 1Q0XH 5AG9A 1EHNA 2YMXH 4OFPA 3RWCA 3BZEB 1KF9B 4PJXA 3WDJA 1MAMH 4QRRE 1J18A 4OFYD 1WGOA 4P2RD 1DQQA 5E95B 1GGIL 4XGZA 3FRPA 4JREC 4AYFA 5MEQA 2UUDH 1BVKB 1MVUB 1BM3H 4IRZL 3TVMA 2VL5A 4LOUD 4QOKB 2N7BA 5DURB 3VXNB 1CLZL 4BFBD 2XZCH 1CLCA 5T5NG 4NQDB 4P59H 5KTEH 4L4VD 2E5EA 3FOMA 2XRAH 4NZTH 2BXYA 3T77A 5HBBA 3T0EB 5I1KH 3OGCB 1T80A 3W39A 4JZNA 2H32B 1OAYL 2YZ1A 3S3SA 4HBQA 3UJIH 3JBG7 3QNXA 3UJTH 4AK1A 1D6EA 1F4AA 2DM7A 1QSFA 3QUXD 2COQA 1NFDA 5C0BE 2HFFA 1DQML 1RUQH 1T5XB 4I2XA 5IVXB 4XVUD 3QHFH 3MLSH 3S37H 1X7QB 4N0CC 2JCCB 5F7WC 4AEIH 1FIGL 3T8XB 5FO9B 2VAAB 3O45A 3IXAB 4AEHH 4KZDL 5FYLL 4LSSL 2Z31A 4HS3A 2DQEH 5DO2C 4KVNH 1MCEA 1TCRA 2IPTH 4G8EB 3HTLX 4TUJB 3LHPH 3OKLB 1UH4A 4G6AC 2VXVL 3DGGB 4OSUL 5EOCJ 5GGUA 1U8LB 4JPVH 1IQDB 2FD6L 2R2HB 5FKAA 1H3PL 3MJ7A 2D31B 1C5BH 3RTQC 3WUWA 5IUSA 2VXUH 3CVHH 4TUOA 1N8ZA 4L8SA 1K8DA 5IFAH 2X89A 4WNQB 4AIXA 3RRQA 4O51B 2VDRH 1GAFH 2HT4C 3VGAC 2HG5B 3ZZ1A 2R2CA 1MI5E 1EHXA 3SQBA 4RNRA 1VERA 5DRNA 4JM4L 5CEZE 5I1IH 1PKQE 2C7UB 2IH3B 4LSVH 1IEBB 3U0WL 1U93B 2ZUWA 2AQ1A 4DN4L 4J8RB 5D1XB 1DTUA 3L5HA 2NY5L 4OZHF 3IKCA 3EYQD 4RGOL 4TTDC 5JR1H 3WEXB 4I48B 5D71L 5I1HH 3CCHA 2BVQA 4DW2L 2DDQL 1MCPH 4GKSA 4MJIE 3ISWA 1D7FA 3MX0A 3VE0B 1ZLWH 5GS0D 3KPQB 4JE4B 4WFGD 4PBVC 1LO0H 5CBEA 2BOBB 1RULL 1YUHB 3D2UA 2I9TA 3FTGA 5DYOA 3MRQB 3MNWA 1OTUD 4JEGB 2ARJA 4EN3A 5IB2A 2VITA 3FB6A 4TPRH 3TVMC 5LWYL 5GXBB 3LV3A 4LHUA 2ZUQB 4HF5H 3MOBH 1P1ZB 3TBVA 1CZ8L 4U1NB 2GIYA 3CFBB 2ZJSL 5KSAA 2PF6A 2XZAH 1OAXL 3O2VL 4UMGA 3ULSB 4HGWA 3LY6A 3IU4H 1ZLVK 4UT6L 5GZOC 3LRHA 4JFPB 1SBBA 5B21A 3OB8A 3BAEH 4ZS7H 1H0DB 5ETUB 2YZ8A 1AY1H 2BNQB 4V1DE 5GGRA 3FO9B 1KEMH 1Z9SA 3D3VB 2GQHA 1GL4B 3MRDB 4PJHE 4XPFL 5AAMA 1N26A 4LIQE 2UYLB 1TJHL 5DZOA 1OP5H 2YUWA 4WEBH 5DJ0A 3ILQC 3VFMA 1AHWB 2IANB 3GJFA 3TPUB 1MNUH 4D0BB 1U58A 4FQPA 3DBXB 3V8OA 1ZLSH 4OZFB 4OF5A 3D2UD 1AGEA 2EXWC 2P7TB 2YD8A 5J13C 2Z31C 5ANMB 5ALCH 4YC2C 4FQIH 3WL9B 5ALBL 4EN3D 3MBEA 4KJYB 5KOMC 4WU5B 4LHUD 4HIJB 3WUZA 3QEQA 1RZ7L 5DMKB 3NZHL 3HNTH 1N6VA 2ADIB 3BDYH 1Q72H 4NSKA 3WNKA 3RQ3A 3KHQA 1HEZA 12E8H 1MFDH 3ARSA 4Q58C 5EO9A 1AQKH 3ZYIA 1PZUB 3T3PF 5FIEA 4KUZH 2YUVA 5J1TC 1OGAE 5BS0E 1FG9C 1FZKA 1FNGA 4ODVH 2ZUSA 1NCCL 4L8SC 2R4RH 1X5GA 4S1RH 2A6KB 2NXYB 1FNSH 1ZLUK 5DMGD 2P49B 5JIPA 3ARWA 3PP4H 1ACZA 4R7NA 4H8WH 1CDUA 5SWSD 1QBML 3CFCL 4CVXA 3NFNA 1AI1L 3F62A 2YD2A 5MHSE 4BKLB 4LCWB 3T04D 5TGBB 4EUPB 2BY2A 4YK4B 2H1PH 4GRLA 4BFEA 3BD4A 5C08E 1JWMB 5DJDA 3LN4A 2HKFH 4ZSOA 3VXTB 1AXIB 3OF6D 1YEEL 1CE6B 3TNMB 1NBQA 2PTTA 4OUOA 1INEH 2FJGB 1C8PA 2J2ZA 1AGFA 4R4FL 1UB6B 4Y5YB 4H8WC 5F6HI 5BQ7B 3B9AA 2APVA 4HT1L 4Z8FL 3EOBB 4MXQD 3U9PL 3W9EB 3SDXB 4CMMB 1AH1A 3VXSA 3F7PC 3JTTB 4GKNA 2DBJA 5D7IF 1E4WH 4L3CA 1QBAA 2PXYD 3GJFH 4HFUL 5F6IB 3DI3B 5ACLA 4G3YL 4JKPH 4IOFD 5J4MA 3T09A 4AG4L 2VJXA 4K8RH 4NN6B 3TBWB 2VKWA 1U8PB 2NY1C 3D9AH 2YWYA 2EE6A 1NFIB 3W0WD 3TBTB 1HKLH 4YPJA 1DBAL 3WFHB 5C71A 2QEJA 4BQ6A 4U1MA 3OKMB 3MGOB 1PFCA 1SM3L 3NA9L 5FOBA 1XGPB 2ITDB 4OJFL 5C0AE 1LHZA 1SQ2N 2Z8VC 4PRNB 4FA8A 1FL6B 3QUZD 3AU1A 4MA3B 2Q7YA 1BOGB 2EYRA 2ZCLL 3PQYE 4U1GC 4HIEB 3JWOH 3LMJL 1MUJB 1FRGL 3N85L 5DGQA 1U6AL 1JHLH 3ESVF 3OAUL 3TCXA 3R8QA 1W0WA 2DQIH 4S1QH 4XB7A 4F7TA 4K8RC 3OAZH 2X4TA 5J0BA 3ULVE 1NCAH 5FO8A 5HDQH 4OIAA 1ZANH 1F13A 4P0DA 3QG7H 2GJ6A 3RPIB 3D87B 4XCYA 4FHBD 4JM2F 4ZTOH 4DGYH 3MRPB 1CCZA 5DD3H 3JWOC 3VFRA 1N4XL 4JDZA 1HHHB 1JN6B 4KDWA 4P9ML 5F7EL 2XFXB 5HYJB 1NBZB 4X7TB 1IC5H 3QQNA 5FDWA 5T33H 2X7LB 4PJAF 3LZFH 3T4AA 5I1LA 1BBJA 4TNWF 5E2TH 1BEYL 2NNAB 5ISZE 5E4EC 5B3JF 4J23A 3EYOB 5MENE 2F53B 4P99A 3D85A 4OZHE 2F19L 3QRGH 2DD8H 3V4VL 1NKRA 2X5PA 1WV7T 2AVGA 3U30B 4OBSA 3U0PB 4HK3J 5E99L 1TZGL 1I8IB 4DVRL 2EEBA 4WEMB 1FGNL 2G75A 1MI5A 4UTBH 5EU3B 2HTKD 4GRLC 3QDJA 5DJ6A 4X5WA 1KCVL 3DV6B 4EQ2A 3QIUB 2CPCA 3BVNA 4ODSH 5C0IA 2W9LA 1S9WB 4PGDA 4TUKL 3HMXL 3K46A 4YDKH 3VFSB 2XXMB 4IDLA 5CEXB 3EYFB 3U79A 1H5BA 4CJ0A 4PJCB 5I30H 3IDGA 2J4WL 4ZPVB 3IDMA 3MXWH 1QP1A 3UJJL 2IPKA 5JPNB 5BRZA 3BISA 3GMRA 5I6XB 2XN9A 3ARDC 5FDYA 1JK8B 5I2IB 3KPLB 4XAKD 3D39A 3O6MH 2R29L 2EYTA 4E0RB 5DR5H 3LQMA 4HUUB 2BDNH 3QJFB 5F3HA 3VXPA 4JQIL 1ZWIA 3L1OL 1U3ZA 2VC2L 3CVIL 5FXCH 4EIZC 1Z5LB 2DLEA 4M8QB 4YHLL 5E70A 3I3DA 3OKDA 5E8EB 5CGMA 2HTLD 1ND0B 4L4TB 5A2JH 5I74B 3GZKA 2D9CA 4M93B 3QDJD 2IH1A 4X4XB 4FRWA 4WW1B 3L3IB 1CGSH 1JWSB 2RHEA 2ZOLA 5I8KL 5B8CB 43CAA 1DN2A 3OKOB 5E6ZA 2VLME 4H1LB 1IGML 3RNKB 2PYFA 4V1DA 5FA3A 2ZP0T 3KPPB 4TVPL 2VLKA 4NPYA 5CINL 4PJHA 1KTRL 2JELH 2XN9D 3RGVB 5EOTB 1BJ1H 4MD5A 2YSSA 1NLDH 1LE5B 3T3PE 1L0QA 1MLCB 3QIBB 1ZVSA 1MELA 1XF5A 4IOIA 1YYLL 1YY8B 3BW9A 3MLRL 2JIXA 4R2GD 1MSPA 2PR4L 3BXNB 3QXAA 1A9BA 2WIMA 5C0DB 3RWHB 5EN2B 5DXWA 5KVDL 3IDXH 3IDNA 2FH6A 3SCMD 3CSBA 1KCRL 3V0AC 5CEZH 1DVFB 3VA2C 1KJVB 3I2CL 2AXGA 4JFHE 3UTTE 1BQLH 2EE9A 1BD2E 3PJSA 4KY1H 1NUFA 2CGRL 3KS0J 4EI6A 2LABA 3CAFA 3FB7A 5DHYB 5JPMB 3TEUA 1FSKC 4KMTL 5L0QB 2KQMA 3FN0L 4OCRL 1NDGB 1QLFB 3GSNA 5D7LE 3VXUE 1BX2B 4K3EL 2VLKD 5F93C 3X3FL 4UINH 4JFEA 4Y4HB 4K2UL 3BP4A 3MMEB 4HKXB 2AGJL 5IT2H 2EDRA 3ZHLA 3BN9C 2ENYA 4JQVA 4MDJB 1RZIB 3GB7B 3C2AH 3S7GA 1EAPA 4H88H 4GW4B 5C8JA 1AKJB 3EJJX 1KJMB 4QXGH 5DEGB 2ESVA 3P4NA 4HWZB 3VGEA 4G8IB 43C9B 1XF4A 3KNBA 5KSUA 5C08A 3MO1A 2DJSA 2MNUA 1IM9A 3HZVB 3CX2A 2EE2A 1TNMA 3OV6A 5IBTH 2PTUA 1ZA6B 5J6GA 1W0VB 3L3OB 1JV5A 5IGXH 4HGMA 2BERA 2ED9A 1R5IA 1FZMA 3H3BC 4NO5B 4CDGC 7FABL 4LCYB 2AAVA 3IT8D 1KPRA 1CL7H 4LARL 2R1XB 4RSVA 4ZQKA 1T1WA 4OLZH 2RGSA 1ZVHA 4HMCA 2AV7B 3MYJA 3JV6B 5IV2A 3QYCA 3DHJA 4L3EE 1OQOA 4NRZA 2VDNL 1U3HA 3NCJL 3MRFB 1ZHNB 5JDJA 2OZ4L 5HGAA 4WUUB 3OWEA 4LIQH 2H9GA 2O61A 4KJPD 4LAQH 5TE7H 4JFED 1SYSA 2LTQC 4FTVD 2NLJB 2N4IA 5BV7H 2BHYA 3CX5K 1MREL 1S78D 3LH2H 3RWGA 5DQJA 4WY7L 1Y0LA 4PPTA 4XNMA 3AAZB 1H3UA 2PR4H 5F1SA 3RA7H 1RUKH 3HMWL 4X7EC 5D7SL 4IRSD 4OKDA 1IM9D 3ALPA 4K71B 2V9TA 5CILH 3D18A 4XP4L 4PJ8D 2P5EE 2NW3B 5CD5C 5KAQG 5BV7C 3L5WB 2AKRA 3LD8C 3GM0A 1ETZB 1HYRC 4PJAE 2GY7B 3CXHJ 1T7XA 4PJEF 3OXRB 4KJQD 4CMHC 3V79C 4BH8A 1XF3A 4CW1A 4KTDH 3ULVL 3TP4A 1A47A 3GSNH 3Q6FB 2YBRA 5B3JE 3QI9D 3MRIB 5IBLC 3MUHL 3BPOB 3INUL 3UYRH 4OFVA 1VEPA 4PRIE 2Q8AH 1IAOB 2FIRT 3T4YB 5IB5B 5J56B 4GG6E 3OG4B 3PXJA 2IQAA 3MACL 1I3VA 3I6LE 4RAUA 1A1MB 3TT3H 1GSMA 3IAQA 3HI5L 4N90E 3MQIA 3H3KA 3FHQA 2E27H 5F88B 3KLHC 3PHOA 2VXQL 4YPGB 3W5MA 3LKQA 4DZBB 1KN4H 3RDTC 4PJIF 4N0YH 5ISZA 1I4FA 4LEXH 1KENL 4GRWB 2GT9B 4IM8A 4GKOA 4Y5XA 1B2WL 5TE4L 2DWDB 2PYEB 4Z77A 3F7YA 3V0VB 4PBXA 4JQVC 2P8MA 1HSBB 2VDOH 1SJHB 2B8OT 4KRPC 1S7UA 3TA3C 4R96B 1CT8A 1T0MB 2GFBA 4G9FE 2VISB 2XG5A 4GW1B 4RMVA 4X5XA 4LU5L 3V6OE 4DKAA 4Y4FB 3FMGL 1QR1A 4P2RE 3MLUL 2WINB 3KPSD 5DTFA 3P4LA 2AJYL 4AH2B 4WO4D 4DUVA 1T2QL 1Q9OB 1OW0A 1ZTXL 5BJTB 4HKJB 2VQ1B 2F54B 3HRZA 2VDMH 1S7WB 2EH8L 4L4VE 1YPZE 4HUVA 3OL2A 1MHPH 2WZPD 1LO2L 5JUEL 3ARFD 3RKDD 1JGVH 1GPOH 5D7KE 3H9SA 4JGMA 1U3HC 1IEHA 5HGGS 1NMBL 5DFWH 1LEIA 3HA0A 5I19L 4OF0A 3DTXA 5C6TL 3P73B 4NHUB 2R15A 1S9YA 4CDHA 5GZND 4PRPA 3FHAA 4BH7A 4K7PY 2OI9B 2ZG3A 1FFPA 5KN5B 1JZ8A 1B3JA 5H2BB 3QQ9D 1Q9LA 5IMLB 3MFGB 3QFJD 5KVMC 4JN1L 5SV3A 1OM3H 1D9KA 3B9KD 2DQGL 1LK2B 4OZFG 3FFDA 5FUOH 5L9DL 3FO0H 5ICXA 4ONFH 1AJ7H 4P23D 5TFSL 5IROA 4ODHL 4G8FB 1PSKL 1NC4D 2DQUL 4WV1C 4BSVA 4ZO9A 4W70A 4ODXA 3EJYD 4KTYA 1A2YB 3O11A 2X40A 1RJLA 3DO3A 2X09A 4POYA 4U7KA 2VZTA 3H7LA 4WI2A 4DOHE 2DB8A 4U1JA 2OR9L 2WMPA 4HPOH 5JIIA 1MCWW 3MXVL 3NFPB 4Q7DA 1O7VA 3WHE1 4F33B 4H26A 1OD7A 4YFLI 3QEGH 5I1CL 5DSCB 2OQJA 4NOFA 3JTSB 4QXWA 3TIEB 2NQCA 3GDBA 4D8PA 1B0GB 1KNOA 1KT2A 4W6XB 3RWDB 1QFWM 4HUXB 3TFKD 5GS1A 4G6FD 1TETL 2RFXA 3LKOA 1OGTA 1IBGL 1RZ8A 2WP3O 4G6KL 3FQUB 1KGCD 4FFZH 2WBJD 4O4YL 4EOWH 4K7PH 4F7MA 5L8KB 2G2RB 4JAMB 4Y5XC 4F8QA 1AFVL 1LK3L 2V7HA 3DUSA 4ONHA 4LSUH 3S4SG 1JGEA 1RUMH 3MRKB 1FFOB 1M6OB 1UKSA 1J0JA 2EDWA 4WFGE 1HHIB 1UEMA 5FEBA 4GW5B 4A6YL 1CLYL 4X80H 3RWEA 5DJXA 4HAGA 1LEKB 3P9LB 1XGUB 3FO2B 3G5YA 1WCBB 2L7JA 1JPSH 4LHJB 1SEQH 1HN1A 1FN4B 2F5BH 4PS4L 3QUYD 3LOWA 3FT3B 5DS8A 2J88L 4MA1B 5EULV 2ZG1A 1AGBA 3GK8H 3IDJB 5D7IA 1NCDL 2AV1B 4N1HB 1NGWA 4Y7MA 1KXTB 4BQ9A 3MV7A 3K0WA 1BAFH 2F8OA 4P2OD 3RL1B 4ZOEA 1UWXK 4ZFOB 4BA8A 5HYSG 2HJLB 3P9MA 4KI1A 1J8HA 4F7EA 5DQ9B 1Y18B 4M7LT 2DQJL 2C1OB 1N5YL 3EYVB 3GKZA 3GI8H 4PJ7B 3UTZB 1A6UL 4G5ZH 2YXMA 3C8HA 1IRAY 4O2FB 4H0HB 5MEPA 4XZUB 5DGRA 3QWQB 3IJHB 2V2TB 3IAGC 3U0TA 4YHKH 3WIHA 1E6JL 4OZIF 1ACYH 4FQHB 1D9KC 3B9VA 2FO1A 4JO4L 5IM7B 1BFVH 4PP2B 4RGND 4PJEE 5K9JH 4GXVH 5JDSB 4HC1L 5IROC 5IK3B 4I0PA 1FZJA 2JJTA 3B2VL 5FM5M 5JLZB 1EH9A 3SJVD 3O6FA 4TSBL 4PR5B 1WUNT 3N1PC 3G5ZA 1FYTA 1QRND 3N1QC 5D93C 4UV7L 2X4OB 1NCBL 1UM6L 3RZCA 4LMQI 4JM2A 4Y16B 3QZWG 4FQ1L 2E6JA 4M1DL 5DJYA 1QVOB 3MV7D 2HVJA 1GYAA 5I8OL 4APQA 3LSOB 1L7TH 5C0CD 2QADC 4QT5A 3QA3B 2J6EL 5TQ2L 2ICEA 4MNGE 4YBLC 4PJAA 4Z95H 1FCGA 1HHGB 5BVPL 5JORB 2MQ3A 3VDCA 3O6LH 2ZCHL 3I75B 1K6QL 4PJIE 4YFDB 3V5KB 3BP7B 3EO1B 3WHE0 1R3JA 1FV1B 1YEJH 5GS1C 2Y5TB 2ED7A 4HWBA 5SWSE 4X0KB 3RP1A 4F58H 3BD5A 3SGJA 4X6BA 4X6DF 4P57B 2EDKA 5I8CB 1LP9A 2AXFB 4OF6A 2Q76B 2KBGA 2R0WH 1AXSB 2XIDA 3LS4H 4UI2A 5I15H 4BQBA 2A9ML 4NO0B 4ZYKB 3PABB 1GGCL 3WFCL 3LRSA 1V3JA 5TDNB 4HJ0D 2OBGA 4DKFH 1UXWB 5JOPD 3PL6A 4YHZL 2IADA 1RZGB 4U0QB 3RNQB 5HI5C 4JZJB 5GRYA 4XCNA 3RZCD 4PRHD 4IRJB 2A0LD 2D4DA 3PGFL 4Z7UF 5JQHC 1QO3B 3O3DB 2ZNWA 5IQ7L 1A7PH 2VE6B 4WU7A 2JB6B 2AJUL 1D5MB 3D0LA 1Z9LA 3VD4A 1HXMB 3C6LB 1TTFA 1IL1A 1DL7L 3DRQA 4TSCL 3C08L 3HG1B 4OCWL 3BDXA 2X44D 5MEOA 5F96H 1FJ1B 3HS0A 4JZOB 5KVGH 4G7VL 5IMKA 5HHNA 1T66C 3F58H 2YS4A 3KGRA 1CXFA 4U3HA 1VFAA 4R9HA 1QSZA 1I85A 1FAKT 3RUGA 4IMKA 2R56H 4E41E 3NH7L 4P5KB 3VFTB 4HIXL 4U2ZA 5IB4A 3BMVA 1YEKL 2AJ3B 5CIPA 3KVQA 3PL6D 4OGAC 2IPUK 2NY6C 2YA0A 1KJ2B 1GZQB 1OAUH 4GH7B 3DX8A 2CDFA 1ADQA 2VABA 5B39B 2ILLA 4S1DD 4UIMA 3ORJA 3NAAH 4JVWA 3O8XC 4EBQH 4C59B 2B1AL 3MZGB 3BIKA 2JJTC 2VZUA 3GSRB 4MSWB 5IMOA 1MAJA 2F15A 3U4BL 3O6FC 1OAKH 1CFVL 3TLRA 5CHNA 1QFUH 3AXLA 3RAJL 2EXYD 1CICD 4HWBH 4HBCH 3NABH 3S5LB 1J1XL 4JM2C 4JQXC 1A6VL 4GAJH 3MBXH 4GAYB 4WHCA 3IF1A 4APQC 4FXKB 4PJGB 1U8NA 4FQJH 1UCBH 1ZGLM 2NTFA 3R06B 2EIEA 3OXSB 1A3LH 4NKIH 2W9DL 3BESR 3QUMB 2Q20A 1YN6A 2NY0D 4WTZG 3DIFA 4H20L 2JE8A 1JNLH 3BUYB 4P3WA 4HWEL 5F9OH 4D9LH 2YN3A 1F4WH 5A2IH 3RJQB 5KVEL 3QP3A 4JY5H 3MV8A 2M26A 4U1HA 3GSUA 1MIEL 1Q9WA 1YEGL 1OSZA 5IJKA 3R1GL 1J5OL 1MJUH 3SO3B 4FZ8H 3O6KH 3GO1H 4MAYB 2E8ZA 2YPKA 1C12B 3CDCA 1NGZB 2Y6SC 1CE1L 1G9NL 1MCSA 3G6JF 3ZKNC 1AIFA 3NCCB 5HYQA 3IFLH 3FT4B 5ENWB 2I07B 2A1WH 1BMGA 4PTTA 4QNPF 2G5RA 1I7UA 4Q2ZB 4MD0B 2CK0L 3KXFE 4BJLA 5A2KH 4M5ZL 1QA9A 2DTMH 2RR3A 3MRNA 3QJHB 4FQXB 5HJ3A 1R3HB 3OR6B 4RFOL 4BZ2L 2EH7L 4J4PA 4XAKE 5EOQL 5BW7C 3T1WA 2GSGA 5GS0L 2DMCA 2NY3C 3CMOH 2AJVL 3V6OC 3GMLB 4JDTH 3BKCL 1QYGL 5D7JB 3QSKB 1NC2B 1ADQH 5EC2A 4AQ1B 4JR9L 2X4RB 3I85A 4XCFL 1Q0YL 4HK0A 2GTZA 3ARGD 5GSVA 4GKZA 3ARED 4JG0L 4PY8I 2Z93B 1TNNA 2BSED 4ZUUB 4WGWB 4HKZA 3LPFA 4FMKA 1PGRB 3Q5OA 4OD2A 5EA0H 1CFTB 3GHBH 4NQEA 1CGYA 1TJIL 4Y1AD 2J8UF 2WWMC 3DX7A 1A4JB 5IWLA 3FB8B 4AM0A 1XGYL 3PGCA 4R90H 3SE4A 3LN5A 1TQCC 1SBSL 3BI9X 3GKWH 5FYJU 3K2UL 3QUXC 2XXCB 3X11B 4V2BA 1RIHH 5C9JB 1G7LB 5FM4A 5I75B 2XWTA 3ARBA 3C5JA 3F7VB 5E2JA 1BQHG 3VJ6A 4GO6B 1C16A 1M7DA 5EUOA 3RX5A 3AY4C 2NX5A 2AABL 4NJAL 4J4PD 3I6GB 5I1GH 1HE7A 1OF2A 3VXMB 3NN8B 1HINL 3KJ6L 3VFPA 5JW3L 3S36L 3P30L 1UYWL 2FJFA 2DQDH 1P4IH 1IGTB 1JTOA 1PQZA 2ICWJ 1U41A 2R2BB 3DRTB 5F1IA 4XAWL 1DSFH 4ONGH 2GI7A 5I1JH 3P4OB 3C5ZB 3JWDL 3EJZC 4L5FL 2AJZB 3P3YA 4KK9D 5HDBF 4RA0C 4UDUA 2R0ZH 2P8PA 5K9KB 2X42A 2QQKH 2VDKL 4HV8B 5LBSH 1YEIL 2YRPA 1I9EA 4QKXB 4XRCA 1G7HB 1A7QH 3OMZA 4G7YH 4ODWA 5D6CB 3TYFB 5BZWA 1BLNA 1FORH 4OZGF 3QDGE 3F65A 5HDOA 1HH9B 1IGCH 3MR9A 3OJMB 4EI5C 3U46A 3RKPA 3TC9A 4FXGB 3V5HB 4B0MM 5M94B 4P46D 3MGTA 2XNAB 4PJIA 3OB0K 2BNRE 4K55A 2KL6A 4Z7UE 5T5NF 1S7XA 1OLZA 5KG9B 1FIEA 2X1PA 1I8KB 3S37X 1YY9D 1MPAL 4P2QB 4JREB 1FL5A 5E5RB 1JGDA 1SEBB 1NCUA 1RJYB 5E2UH 1N6UA 5TDOA 2P5EB 3UYOD 2XTJB 2GAZB 1AD9B 3OQ3B 4PG2A 3HAEA 5IEKA 5HGDB 1YC8A 2VL4A 1RY7B 4XMLH 2BFVL 4RAVB 1DE4B 1RK0B 3V4PH 4NFBA 2X2YA 1M71B 1RMFH 4LEOB 3SY0A 1DUYB 3QIWD 3VW3H 3QCUH 2DM3A 2V2WA 3RVWD 3WS3A 3N1MC 2FYYA 4I18A 1KLGA 3MFFA 4FNLH 1A7RL 2NXZB 3ZHKA 5HHXH 1OP3H 1U91A 5JO5A 2XY1A 5ICYB 1CQKA 1CL7I 2YPLD 4L9LA 4X98A 5ITBH 4FTVE 5HDLA 1KLFA 4QXUH 5E9DA 3A67L 1EK3A 5E94A 4JKKA 3MUZ1 4NUGH 3N06B 4ISVA 2BNUB