4LGRB

Ricin a chain bound to camelid nanobody (vhh3)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
b'VQLVESGGGLVQPGGSLRLHCAASGSIASIYRTCWYRQGTGKQRELVAAITSGGNTYYADSVKGRFTISRDNAKNTIDLQMNSLKPEDTAVYYCNADEAGIGGFNDYWGQGTQVTVSSAHHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ricin
molecule tags Hydrolase/immune system
source organism Ricinus communis
publication title Crystal Structures of Ricin Toxin's Enzymatic Subunit (RTA) in Complex with Neutralizing and Non-Neutralizing Single-Chain Antibodies.
pubmed doi rcsb
total genus 34
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2013-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lgrB00
4M9PA 3AREC 3OJ2C 3CFKA 4KK5D 3UTQA 2YZ8A 4UILL 3UBXA 1UYWH 3GRWH 1S9YA 2ADGB 5HHQB 3TO4B 3LQMA 2KZ1B 3PQYE 3SEPA 1ZHKB 4PYGA 4DN4H 1NCDL 4QXTB 3GMOA 4L3AA 1S7UB 5I1EH 3R4DA 4HUNB 3SKOB 3MFGB 1E28B 5JPNA 2DDQH 1QD0A 3MLWH 4E0RA 1BMGA 4GAJL 4XHQA 3GSXB 3WD5L 2I9LB 3V5KB 3W39A 3QIUD 2FECL 1W2KT 4GXUN 4RRPA 3TJEL 5D96B 4HUVA 5J6HB 4L1HA 4MB4A 4YGVB 5KVFL 1KEGL 1HXYB 3OX8B 3NN8B 4OKVB 4NQCB 5ALBH 2D4FA 2D4DA 3CX5J 3VA6A 3H7LA 4DKFL 5ICYA 5TFSL 5DJ8B 3NFSH 15C8L 4JM2D 2ITCB 4Y19D 5EUKB 3VRIA 2LABA 3P9MA 3ARFD 1DZBA 4NYLA 4GMSH 5C2UB 2DKSA 4RMVA 1RK0B 2FIKA 1UACL 2DM4A 3V9FA 1Q94B 3BKJL 4JRXD 4MLSA 1JF6A 2XNAB 4G8FA 2ATKB 2NNAA 3AY4C 5DR5L 3MRKA 4PG2A 5HBBA 3TNNA 1WBZB 1ZXQA 3SGKC 4NQSA 5CJXC 2J8UA 4ODTL 4IRZL 2B0SH 2GSGB 2L7UA 3QQ9D 5E9DE 1PGRB 4HIIA 4YHYC 4YPJA 4HUWB 2YPLB 4R26H 4KQ4H 4K9EC 1UZ6E 3QDJD 2VQUA 2X10A 2PXYB 2BHYA 1DDHB 3TEUA 1MJ8H 4WHTA 5C9JA 5FHAH 1HWGB 1X5KA 2UZIL 4UINL 3RY6C 3O9WA 2G60H 3E2HC 1I9RL 4JLRA 1ZLUK 1J0YA 3JSSA 3OAYK 5I1GH 4UU9A 2F19H 3GBML 3P0VH 2DKMA 2HRPL 5GGRA 5IJKA 3CH1B 3D48R 4XNXL 2ED8A 4I18A 1T2JA 4PLJC 2EH8H 2X42A 4TPRL 2ZPKL 4M7LL 3NCEB 3SY0B 4YDVA 5AZEL 1H9VA 4YHPB 4EQ2A 1VPOL 3RI5F 1BZ9A 3OR6B 5CZKA 6CGTA 5HJ3A 4DKDC 1NLDL 3PIQB 5SWQB 3VXSE 4WU5A 1DBJL 5HI3C 4PREB 2V17L 1D6VH 4P23C 2CO6B 3ETBF 1GGCH 3V4PL 4OB5H 2V5MA 2EXYC 4TVSa 5F9OL 5I8CA 2OTUB 1M71A 3O11A 4LHUD 1R5IA 1HQRA 2FNBA 1IT9L 4XPFL 1U8HA 1B4JH 1FGVL 1FL6B 3MXWL 4XB8A 5HYFA 4BA8A 5LGHH 1HH6B 2H32B 1DE4A 4XMKL 2IPUG 3LPGA 5I1HL 4XTRD 3DHJA 1FNGA 3HE7C 2ZUYA 1MJUH 2NTFB 3X13A 4HJJL 4N5ED 3G08B 5I2IB 4DZ8B 1OSPH 1T21B 3E2HB 4Q2ZB 3BDBA 3LH2H 1ZLWK 2H1PL 1TTFA 1YMME 4Z7VA 2FGWL 3GHEH 4PGZA 4QHLA 5MEOA 3G9VA 1I7ZB 3MR9B 1ZLSH 3KAAA 1N7ML 3CK0L 1CXEA 5JMOC 3UTTA 4YJZL 4Q9CA 2FD6H 4RAUB 4M7KH 5SWSB 1I1YA 3VXOB 3OGCA 4Z7WF 2DBLH 3OSKA 1NEZG 3OG4B 4UT6L 3BZ4A 1P4LB 1GPOH 1GOHA 1HKLL 4NNXA 2C3WA 4I13B 4WTWA 2AKRB 4U1SA 3IJYB 3UC0L 5EBWB 4G43A 1FO0B 2VXSH 3PWNB 4PGCA 5KSBA 2VZ3A 1MAMH 2VR4A 1TZIA 4E5XB 2W0KA 3O2DA 5DEGB 5FA4B 5FK9A 1AKJA 2BSRA 3QULB 3QPXL 4OSUL 3O3BA 5HHNB 4X7SH 2F54A 1J88A 4F3FA 3MLXL 4IIQA 4NO0B 3A6CH 3O4LA 3CNKA 3OL2A 4EI6A 4N0YH 3QIBC 4WHYG 2IBGA 2BNRD 3T4AA 3CUPB 1KFAH 4GKNA 1MCPH 5ERWB 3NTCL 3IDJB 4QXTA 3O41A 2B1AH 4K2UL 5ANMA 2MCPH 4PJFF 1CLZH 1KN4H 2HFGH 4OV6F 4I0PA 3VGDA 2NXZC 1JWSB 5EIIB 1MCWW 1EA9C 1MCLA 1OQOA 3C08L 3WS3B 1OGAD 2GCYB 2IBZX 4LCCB 3MV8A 1QSED 2Z31A 1JPSH 4OZFG 4JFOA 1BQHA 1EIBA 4FFYH 4HZLB 3ARBD 2OX5A 5F3HB 5L2KE 2GHWB 2VXVH 3TVMB 3O6ML 1FFNB 3PGFL 4AL8L 1WFUA 4QYOB 3I3DA 3FO9B 3NCJH 4UMGA 1MI5E 3K46A 1KLFA 4KQ3H 2BC4B 3DRQB 2JIXD 3QEGL 4WEMB 2O61B 3REWB 4PJBE 1AO7B 5CIPA 3DXAE 3EDKA 4PBVC 1JHTB 3GMLA 3IDIA 3L9RB 3QZWB 4ZODA 4AT6B 4BKLB 2DQFA 2VNCA 4M1GL 3S3SA 3GIZH 2M26A 2AJSH 2HFTA 3LEYL 5DGQA 5SV3A 3OHXB 1WVZA 3LRHA 3X3FH 1O7SA 3KWWA 4V1DA 4ERSL 1R3JB 1UVQB 4IRSB 3D39E 4YE4L 4P5MB 3OQ3B 4XPAL 5DQJA 4PJ9C 1S78C 1I8KA 3QPQC 3N1GC 4MNHA 1SVCP 1D3CA 2X1WL 3T0ED 3DVGA 1BLNB 4P3DA 4K8RD 4JFXA 1EEZB 1HYSD 4Y4FB 4TOYH 5F89B 3LSOB 4FXKA 1CFVL 3BEWB 1HQ4A 3CMOL 1MHEB 1JTTA 4MAYA 3O9WB 4P23A 3RU8H 1NMCB 3I02A 4UU9B 3QRGL 5ANME 4X6CB 3KPRE 5SX4H 5ISZE 2ARJA 3BH9B 1NCCH 3U0PB 4AMKH 1DVFD 3MBED 1MSPA 1C5CH 1R5VB 1B88A 1OD7A 3D3VA 2FCBA 2XIDA 1BM3H 2E7LC 2E5EA 3G6DH 4YPGA 3QNXB 4OUUA 1A6AB 1B6DA 5FDYA 5E2JA 2GSIA 1HHJB 5K93A 2YMXH 3GSUB 1P7QD 5TF1H 4JG1L 3RTQA 5I0DA 3DMMA 1U3HA 2IH3A 1OARL 4J7RA 4YHKL 2PETA 5D1QC 3ZDYF 5IMOB 5ACZA 4LSSL 1IAKB 4HZAA 2D7PA 4X6EB 1JZ7A 3AAZB 3QJHB 4HCRL 1U3ZA 1E4XH 3UTSA 1EUTA 3O3UN 3SDAD 4Y4HC 3DXAD 2A1WL 4QOKB 1BIIB 2EDFA 2VN7A 3F62A 1CD9B 5KVDL 3BI9X 4I3GA 3SKNB 3GKWH 2C1PB 1CDGA 5AD0A 2CSPA 5GRVK 2MPAL 2YUWA 3TVMD 1S8DA 3VXMB 4S0SD 1KCRL 4FNLL 2Y36L 5DJCB 2DMBA 3KLAA 2A83A 3QEQE 2NY4C 4U6VH 3QUYB 2YA2A 5LCVL 4JG0H 4KY1H 5FGRA 5C6TL 1DTUA 3IDGB 1VACA 5ALCL 3MLZL 5CZVH 1ND0A 5AUMA 4OZFH 1UB5A 5T3XL 2R4SL 5F72S 5MENB 5TE4H 3FOMB 2HKFL 3RUGE 4HJJH 1JF1A 4QO1A 5EU3A 3WFEL 3AREA 3AS0A 1KJVB 4EQ3A 2BOBA 4ZTOH 3P40A 3MGTB 1D5XA 1MRDH 4LSTL 4OIIH 4NUJA 5DQ9B 3NFPB 2BSED 1Q38A 2GJ6B 1RUML 1DEEB 2APFA 4NJAH 4X9IA 4XBPA 1MCDA 2HAZA 1EGJL 3PP3H 2J8HA 4WWKD 5D2NB 5DF0A 4HWBA 2AEPL 3SDDD 1CFSB 1X5JA 4WO4C 1MFEL 2W38A 3U9PH 3U9UA 3LD8B 5F6IB 1TJHL 4IMLB 1GPOL 1QFPA 4C56A 5HHMD 5C07E 3QDMD 1BVZA 1IT9H 4XPFH 3T3PE 2RFXB 3X14A 3W2DH 3S9DB 43C9B 3C6LA 1NC2D 1CZ8L 1T7VA 1H3PL 2CKBB 1B0RB 5TGBB 1X5GA 4MD4B 4W70A 5I73B 4I48B 1A1OB 2CO7B 3CVHL 1JWSA 5EIIA 4H0GA 3VG9C 3EYFB 3VFVB 1OAXH 3WNPA 4GW5A 4JY4A 4L9LB 5KSBF 5D72H 5T5NF 4G6FB 5T1MB 4PY7B 4Y89A 1XR9A 2VO5A 3LS4H 4Y1AE 4YZFE 3G5YB 4GXVL 1JMXA 2J4WH 3BP5A 4W6WB 1Q1JH 3O6FA 5EO0A 1YMMD 1NMAH 4MD5B 3S35L 1FG2A 3ULVC 1CN4A 1PZ5B 4P2YA 2OQJA 4AJ0A 4XP4H 4MA7L 3SQOH 1EHLH 4KROC 5IBLC 1BFOB 5D70H 1U92B 4GKZA 4TRPH 3IFOA 4HKBA 2Y07L 2HJFB 4WU7B 4M6OL 1QFUH 3ZT6A 4ZO8A 1M05A 1OT2A 1QVOB 3MNVB 1LO0H 2WBJB 4WFGE 2R1YA 2BOCB 4QTIH 4YK4C 3EFFB 3ZTJG 3OV6A 1T3FA 2NY5L 2VLJB 3ECBB 5BV7H 5CINH 3QJFB 4JFED 4XH2A 3GBMH 3P0VL 5FYKD 1F5WA 1N8ZB 2OCFD 3LKOA 1CGSL 3JWOC 4FP8H 1IGMH 2B1HH 4NIKB 4R4FL 3QUML 2VXTH 4IDJH 1DN2A 1F4YL 3QFJA 3BN9D 5T1KB 3VGAC 2GY5A 4NDMA 5D2NE 3SO3C 1OAZL 1CDBA 1A14H 1SEQH 3ALPA 4GBXB 3CLFL 4LQFH 1K3IA 2DF3A 4C83A 4HWEH 3EYSH 1D9KC 1RUPL 3IDNB 4QT5B 4Z5RB 4IOSD 3JWOH 1RZFH 3CXDL 1G7IB 5DJDA 2FIKB 3BSZL 4HLJA 4MXQD 5IMKA 4JQIL 3I6GB 2MQCA 5D1QA 5F7WC 1JE6A 4PLOB 5D6CA 4UDUA 1X4YA 3MJ6A 3RUGB 5EOTA 3F7YB 4HKXA 4Z7OE 3C60A 2FX8H 4ZNEE 5MENE 1WC7B 2DMCA 4KKCC 4QHNB 1MLBB 2Q3AA 4WNQA 1VKXA 4RDQF 1EO8H 5DDHA 3EOAB 2CGRL 1RZJH 4GG6F 2MFNA 3VXME 3U6RA 1RULH 4LARH 3TBWB 5HYJB 5I8KL 3QRGH 4IOIA 1FJ1A 3LQZB 1QR1B 4ZFOL 3L5JA 4YQXL 4QOKE 1R3LA 4JZOA 4OV5A 3QDGE 1IGTA 5CJBA 2R56L 1MHHA 5IROA 4KPHL 3U36B 4HC1A 2FWOB 4AL8H 1ZEAH 4MNQE 5JDJA 2MKLC 5BO1H 4LFHG 2V5TA 4KQ3L 1D6EA 1F3DJ 1QZ1A 3DRTB 4GOSA 5IW1B 5CLTA 1FL5B 3NH7H 5BV7B 1KTDA 2Z91B 3D85B 1C5BL 4YC2C 2VAAA 1PQZA 3ILPB 4U49A 4M93C 2HVKA 2YHGA 3VXSA 2ZKHH 4FQXA 1SHMA 3I9GL 1S5HB 5E2TH 3KYOA 3WLBB 4NC1C 1CFVH 1X44A 5JR1H 3LY6A 4NKOA 1HHIA 3L3IA 4L29B 5IHUH 4D9LH 3WL9A 3MRMA 3VRJB 1KBGL 1R5IB 3QUYA 1GGIH 1ETZA 1T0PB 2NZ9C 1OGAE 4HH9B 3WNKA 3F7QA 2OL3A 4K3JL 3BZFB 5ISZB 3KPRB 1AI1L 3U82B 4GRMA 5FA3A 3FQTA 4EIGB 4JKKA 4XBGA 4QRPD 2G75B 4W81A 2E9JA 4ZUSA 2VLKA 1FAKT 2APVA 4NOBA 3HAEH 4MJ5B 5ESAA 1AXIB 5B8CC 1KB5B 3VXNA 3QIWC 3WFDH 2Z92A 3WIHL 3EYUH 3NA9L 3FT4A 5T3ZL 2MKWA 1GGYA 3A6OA 1MY5A 1EEQA 1CFQB 1E6JL 4WW1B 4LLUB 4WVRA 1VFBA 3KPOB 4JGJA 5F6HI 3QEUB 5I73C 1CL7H 2EYRB 4YUEL 1AO7D 1EO7A 2OR7A 4M6AA 4S2SB 4BUHA 3REVB 5E8OB 4I1NB 1MF2L 4Y16C 3BIKB 5A3IC 2FSEA 5EC1B 4NZTH 1KXTB 1AGDA 2HMID 2NMSA 1ZS8A 4H26A 4PJBB 4KMLB 5IQ7L 2ITDA 1KN2L 2Y7QB 3A0OA 1A3RL 4WHTB 3W11D 3WXVH 1R24A 4ENED 1FRGH 1MI5B 4HKZA 1LDPL 2BHUA 1OLZA 4LASH 1CLYL 1XMWA 2BMKA 4KY1L 3GI9H 5L2KB 1YEIH 4OLYL 1CZ8H 1N5YL 2RCSH 3NCCB 4G9FA 2NY7H 2VABA 3GSNL 4MDIA 2F5AH 4I0KA 4UI2A 1FV1B 2V5RA 4XMPL 5D7IB 4LKCA 5DQDL 5JNYA 3TWCH 5I75C 1VADA 1V7NH 3ARFB 4X5LA 4RA3A 5HHXL 2ARJQ 4MYWB 4NJAL 4X6DE 3HI5H 4M6ML 1A7QL 5C0IA 2R2CA 3CLEH 3KPMB 3VGAB 1I9JL 2JIXA 2ZCLL 3U9PL 4ZFFB 1JGVL 1QLRA 3LQAH 2D9CA 3C6LD 4LCUB 4OKDA 2HRPH 5I17B 5MEQB 3HAEG 4ZUVB 3U7YL 4H8WC 5GGVL 2PW1B 5GS2D 4IS6A 2EH8L 2E9WA 1JGUH 2FL5B 4XZUB 2WINB 2P7TA 1MOEA 2EIZB 1G7PA 3OKYA 2DYPD 5C0CD 5C0FB 2A77H 1PLGH 4LAJH 3U79A 2J7LA 2VYRE 1M7DA 5DHVH 1KJVA 2RBLA 3O4LE 1YNTB 3GI8L 5KJRH 3W9DA 4PJIB 4WUUE 5GGQL 2CD0A 3S5LG 3C60B 2NY6D 2JB5L 1BZ7B 5HSFA 4J8RA 4QRPB 2HN7B 2LU4A 5C0BA 4MB3A 5E1AB 4N9GB 5JLZA 4PLKD 2WW8A 2CIKA 2VDPH 5CHNA 2FJFA 2H32H 4ZO9A 4K7PX 3VWJB 3K3QA 3ULVE 3HNSH 3OGCB 2FATH 5IJVA 1U6AL 3BZ4B 1RZFL 3CXDH 3TH3T 1T5XA 4TN9A 2RFXA 2F54D 3TCLB 4JQIH 1EBPA 5IQ9B 3SPVA 4UV7H 3HKFA 1BVKB 4DK6A 3FONB 5DFVD 3TBYA 3HE6C 2GJZB 1RVFH 2R2HB 5IM7A 3DJ9A 2QBWA 4MB5A 4JO3L 2VIRA 2XRAH 4Y4HD 4CN4A 3DXAA 4ZFOB 2AW2A 4BFBD 4BH8A 3MZTA 4Y7MA 1F90H 3BE1H 1QYGL 4XP4L 5CKGA 3SKUD 1D5BA 4TNWK 4MQXD 1CFNA 4TYUA 5DRZA 4LARL 2VLRA 4F7CB 3LZFL 4KFZC 1BZ9B 4I77H 2EIEA 1JPTH 1JF5A 1LQSR 3Q6GH 3VXSB 2OQJB 4LKXA 4NRZA 4YQXH 2NX5A 5E8PB 4M48H 4UT9L 3KNBB 1I7RA 5IHLB 3MV8E 5HYSA 1GXEA 3JWOL 3DBXA 2F53E 1NGWB 1CK0H 3LN9A 1MWAL 4RWYL 4LVHB 4X7CC 1A1MA 5D7JC 4PJCF 1J05A 1JCKA 1SEBA 4UV4L 5DRXB 1DP0A 3D39D 3QA3A 3P9LB 3RPIB 1LP9A 4RGND 1RY7B 4Z7WE 4O02L 1Q0XL 4BSWA 2P47B 2AJVL 4CKVX 1ZHKA 4J3XA 1BFSA 4KTEL 3P3YA 4P4RB 1Q9WA 3HPLA 4JCMA 5I1DB 4TUKL 3JV5A 2DQUL 2V2WB 4HIJB 4G9DB 3CMGA 1NMBH 3IT8D 1HH9B 3MV7E 1N64L 5EO1A 3HMWL 1N2RA 1BQLH 1PFCA 1F11B 2IG2L 1CDHA 2XWJB 4U3HA 3NZHL 4HDIB 5E9DB 5TQ2H 3GJFH 4ZUWB 3SDXE 1CT8A 1UYWL 4AENB 5BRZE 2C1OA 1QHPA 3AS1A 3ULVD 4EN3B 2F5BH 3EZJB 5LWYH 4OFDA 3L5XH 2ZNXA 4LSPL 3HZKB 4TULH 4ELMA 2QSCH 1GGBH 4KJPC 4K2UH 4O9HL 3H3KA 4R4ND 1Y0LA 2ZOKA 4URTB 2B5IB 2PCPB 5E00A 3S37H 3AS2A 5C3LD 2LVEA 3G6JF 1IZKA 3C08H 3TIDB 3DV6B 4NQCE 2DTML 2VDOL 5HYJA 1XF2A 4D0CA 4WFEE 3S4SB 4CU7A 1NSNL 3ARBB 5L2KA 1F6FB 4FP8L 5DEFA 5J1AB 2OMNA 5TDPB 1R5VA 3D3VB 2E8YA 4Y1AD 3MUHL 2X4NB 3EOTH 1NMCC 2EYTA 1AD0B 4OD1H 5DK3A 4ONHB 5F3BA 3BPOC 3B2UC 3TBVB 3PQYB 3UYRL 4ODXB 3KJ4B 4YH6A 1NGXA 1B9ZA 1FCGA 1ZV5A 1E6JH 2Q86A 2WWMC 1HK6A 3CVIL 5IEKB 2APBA 4F58L 2BNRA 2UYLA 4F15C 4WENB 3DUSA 3KJ6L 3Q5OA 4M03A 1DL7H 4IMKA 4S1DD 2CRYA 1T22B 2C3GA 3FB6B 4RBPH 3W9EB 1G7JB 1QRNA 5E2WL 1M7DB 1U36A 4YDIH 1NFDB 5DD5H 2R29L 1J7VR 5DHYB 5FM5M 2OZ4A 2Y5TA 3VXQB 1OVZA 4JG1H 2XN9E 4MSWA 4RCAA 4XH2B 4X7DC 3NOIA 3PHOB 4PRIB 3WXVL 5JHDD 5C71A 4X98B 4H0IA 3PUCA 3STLB 4LF3B 2JK5A 3U7WH 1MEXL 3IDNA 1YY8A 1T21A 2AEQH 4Y8AA 5E9DD 2UWEE 3P9WB 3O2DH 3F7YA 5EPMB 2W9DL 3QUYD 1UT9A 3MRIA 1L6ZA 1J0IA 1B4JL 2QSQA 3MRDB 4JM2F 1FORH 2PTVA 3QULA 1A6WH 4Z76A 3VDCA 3B9VA 1I85A 4NOFA 4X4YB 3STBA 1IAMA 1WCBA 2IAMD 3BKCL 4QGYA 5IESL 4XI5C 1FO0A 5JXAH 1AXTH 3SDAB 3DARA 5CP7A 1GHFH 1DVFC 3UYOD 2AI0H 3VXRA 2VMFA 2AEIT 1WBXB 2LVCA 4NQVB 2IPTH 1FC2D 4X4ZA 1QR1A 2DQGL 4GKNB 2H2SC 5IVXB 3QDAA 5BZWA 4ORZC 4AIZB 5GHWL 5F96L 1BF8A 1HSBA 3ILQD 4LLQA 5JW4R 1ZA3B 3AROA 3TH4T 3ZE2E 3FB7B 3QQ3A 5GJSL 3ALXA 5D96C 4M00A 4S1SL 5DJZA 3QIBD 1A64A 4R0LB 3QSKB 5KG9B 3OWEA 1KGCE 5IT2H 2BRQA 5GGUB 4WDIB 3IKCB 2Q7NA 3MODH 2A77L 5ENWA 3Q6FA 3QXTA 1A7RL 3ARDC 2KKQA 3DYMA 2P5WB 1A7PL 5IW6B 3MLRL 3G5ZB 4QWWD 5I1LA 3WJLC 3HI6H 2VL5B 1OCWH 3TN0D 2BVOB 1S7TB 4N0YL 4O02H 5MP6L 5DR5H 5BXFB 3QEHB 4N5UA 2Z31D 5C0BD 3BD5A 4LEXL 2UWEA 3QQ9C 1VHPA 5DVOA 1FFPA 3MRGB 3CU7A 1NC4A 5LKNA 3FO0L 4XBGB 4F37F 1Z9SA 4LDLB 3TO2A 1CLZL 1KN4L 1OTSC 2GITA 3S36X 3N1MC 4XC1H 1UWEH 1DQQA 1QNZL 2VDNL 4GUPB 3DI2B 3RHWK 3R1GH 5SWZD 1N0XH 1A02N 3F5WB 4KDWA 1DSFH 2XG4A 4FOMA 3CPLB 2ITCA 2DI7A 1KIRB 3SJVA 2R2EB 1NGYA 3O4LD 3VXRE 1KCSL 4XTRC 1WFOA 3VWKD 2VWEC 1J5OL 4KXZH 1V8HA 1K8DB 3K2MC 3TBSA 4YDKL 1GVIA 4JO2H 5BV7L 4TNWF 5DEFB 1CG9B 5J1AA 1U8OA 2P48B 3L1OH 2YPKB 4MA7H 4TTGA 3LS5L 1WEJL 1CE1L 3SBWC 1HHHB 3U4BL 2QLVB 1OP5K 4JRYB 3MUGA 1SJXA 3AM8C 5B8CB 1HN1A 6FABH 5D9SB 2DQTL 4HSQA 1FSKB 3ZYJA 3QEQA 4HQQL 4CMMA 3I02B 1JHKL 3VGFA 3NPZB 3TBVA 1DDHA 1NL0H 1TVHB 3VI3F 4XCFL 3RWFB 4PGBB 2WQRA 3ARUA 4ZPVA 4JFEB 1KULA 4BSVA 3KPSE 3FQUA 1FGVH 1UCBH 2YN5A 1EAPA 2P4AB 4NQTA 3QWRA 4L8BA 3L5IA 4PYHA 3DMMC 4WI5A 4XCEB 2F5BL 3RPIA 2B4CL 3QG6A 2HTLC 1WTLA 4ZXBB 2JCCB 4LDOB 1OTTD 4OF7A 1NKOA 2W1NA 4KI1A 2G5RA 4NGHH 4P4KC 1AY1L 3G6JB 3LV3B 3CH1A 3U0WL 3PHOA 4FFWC 1IEBA 1ADQL 3GGWB 4FQJL 1PAMA 5BZDA 5F9JA 1M7IB 5EO9B 2MOVA 5CJ5A 1PBYA 3BAEH 3KR3H 4ZNCD 3UPRB 4LHUG 3WIFB 4XT1C 3OF6D 4YHOL 4KK5C 2OJEA 1NKRA 2F74B 1AIFB 1P84J 2R0LL 4G8GA 2PTTA 5CFHA 3TFKD 4OD1L 1G7IA 4OQTA 5DJDB 2DTMH 2VDOH 1NDGA 3RGHA 1BBJB 1WZ1L 4J8RB 1NSNH 4NUJB 2IH1A 3EYVA 3ARGD 4OUOA 5C09A 3KDMA 4M5ZH 4H8WH 5F7FA 3Q3GA 1FZMA 5JDSA 2AERT 5ALBL 3UTTB 2COQA 1AGFB 1LE5A 3CSGA 3U46A 2K1MA 4DFIA 2ADJA 1XT5A 1U2CA 4MNHB 1JV5A 2I25N 2JKXA 1KPUB 3MCKB 2QQQA 3DSFL 1JN6B 1IBGL 4N0FB 4QHLB 3QEQD 3EFDL 3ZTNL 4UBDC 1UJTA 5EN2B 3SGJA 4GAJH 3GSQA 3HMWH 1ZVHA 2FYYB 1JFQL 1IGJB 3J7HA 1S5IH 3D1MC 1WUNT 3K4AA 4FFVC 1T6WA 1NEZB 2X4PA 3L3JB 4NM4L 4U1SB 4BQ6A 3U30B 5KVFH 1S9XA 5C9KA 3K4ZA 3OKDB 3PGCA 3EOBB 4LNVA 1J8HB 1UACH 4NFDA 2DDQL 1X7QB 4HFUH 4LEOA 4N90D 3TIEB 4YBLC 1T1XB 2YC1A 2D03L 5DHVB 5M7QA 1F00I 3LEYH 3LEXA 1BFOA 1R3HB 1ZHNB 3CDYA 1SY6L 1U3HB 2IH3B 3RWCB 1RZGB 3NFNA 2DQIL 3D69B 1GH7A 4JFDE 3O6FB 2WANA 2M1KA 4GW1B 4U1MA 1TTGA 1II4E 4IBLT 1QSEE 1LILA 4PRIA 4U1GC 4U1IB 5D1QD 5FO8B 5IR1A 4CVZA 4KMTH 4QHMA 1RZ8B 2V5YA 4NO5A 1BWMA 1HI6A 4FN0A 3SKNA 2YD3A 3PL6B 3RTQC 1E28A 4TOYL 4KKAC 3RNKA 4WHYH 4QOKA 5ESAB 1T5WB 1G9NL 1ZWIA 1F4XH 2BOCA 1KB5L 3O45A 5H37G 4YAQA 1NGYB 1VCAA 1G1YA 4JJHA 1GC1H 5I1JL 4JZJC 1CFQA 3QDGD 2GI7A 3ARZA 4YHMH 2EDOA 4LCIL 3ZL4H 3BQUB 1ONQB 5CJQH 4ODTH 3P4NB 1U8OB 4FHBD 3VXTA 3HRZA 2GTZB 2WUBH 4OTXH 2AK4E 3EHBC 2VXQH 1YDPB 4DEPC 1FNAA 3HMXH 1O0VA 3IDGA 1CBVL 2E6PA 3ULUH 3D6GA 5JPMA 1S9KC 3MRRA 1FNEA 5JIKA 3QUMB 2F58H 3BP7B 5HI5C 1YEJH 5DD1L 5IEHB 3BGFC 4K8RC 3S3JA 5I1EL 4XPHH 3MGTA 3MLWL 2AXGA 3CSYB 3I6LD 4P3WA 4YFLI 1XF2B 2HT2D 2V2TA 3WHXA 1EV2E 3GI8H 2XZCL 4ZAKA 4NHCH 5KJRL 4S1QL 1DBML 1J87A 3MLSH 1JRHL 3LKRB 3HG1D 4ODVH 1I1FB 2HWZH 3PWPB 1NLBH 3C6LB 3U7YH 3U36A 3I50H 3RIFF 2I27N 3S98A 1KCKA 3U4EA 1MAML 5TJWK 5DLMH 4RA0C 4Y88A 4X6CF 5ENWB 1KELL 4M7KL 1MLCA 2N7BA 4MA8L 1ULVA 5F9OH 2NY3D 2FWOA 4Y4HB 2P8LA 3TPUB 5KS9E 1YMHB 4LLMA 1FORL 1OP5H 3SO3B 1I75A 5HHPB 5ALCH 4YPGB 5J12C 2FBJH 1QPPA 3V52L 1YEEL 4L8CA 4WWKA 3MJ9L 5H35A 4BZ1L 3L1OL 5D7LB 1A3LL 1X4ZA 5MEPA 4YHPA 2IPUK 3G04B 2B4CC 5KVEL 4UT6H 3IFNL 3DMMB 2EECA 3K81A 4N8CL 3TF7C 1JI1A 4QKXB 1W72L 4Q6YA 4OT1H 1L7TL 3PP4H 2XPGA 4LHQB 4HCRA 5CGMA 4LPXA 4Y2DC 1B2WL 4OD2A 5HI4C 1IGYA 4NQCD 4APQB 4E0RB 4KDTA 1J1PH 4CNIA 4BZYA 4JN1H 5C9JB 3RL1A 3MYZA 1FL6A 4PP2B 3T1FB 5J8OA 4YNYB 2D0GA 3FRUA 3FQTB 1HHKA 4Y4KD 5FV1L 4CVUA 4K3EH 4W4OA 2DRUA 5E8EA 1WTGT 1XZ0A 3P2TA 3PGDB 4NDMB 3QDJE 5DEZA 4AEHH 1G7QA 1JHKH 3O3EA 4NZRL 1Z3GH 4XGZB 1GGIL 1OTUC 5CJOL 2IALA 1AY1H 3SN6N 4DZBB 5INDA 1G0DA 1KB9K 1NQBA 1RUQL 3QNZB 4GRLA 4Y1AA 1XGRA 4EKXA 4DUXA 5HVHB 2ARWA 4ZFOA 1QPXA 1R3JA 3FN0L 5EBGA 5FUZH 5KSBE 1XIWD 3MO1B 2L0DA 4GMTL 4G3YH 1CL7I 1XGTB 1JGEA 4LIQL 2X4OB 2DQCH 3HS0B 4ZYKA 1RIHH 3O3DB 4PJHB 3H9YA 4RMUA 4UOJA 1H3TA 4LCWB 2BSSB 5F7DA 2DB8A 2G9HB 3QQNA 4O9HH 3BDYH 1DANU 2IC2A 3P4OA 1U95B 1A5FH 1RAMA 1XF1A 4WHCA 1AJ7H 5CEXB 1QKZH 4ODUA 4R4BA 5D1ZC 5IF0A 1SJHA 2CDFA 2BRRL 4YDKH 4P23D 3DYPA 3SGKA 1XF4A 4POZC 2CIIB 1GYAA 1O7VA 3IRPX 3HPLB 5MEQA 1KJ2B 3V5HA 3BXNB 2QR0B 4DOHE 3VXPA 3PHSA 3NPSB 4JREC 2WINA 1LWRA 1RURH 1YPZA 1WAAF 1OTTC 1FVEB 4AY0A 5FEBA 5JIHA 2NY0D 4GT7A 5EU4A 2YKLH 5IMOA 2P24B 5FGBA 1DN0A 4OGXL 4ELKB 4LSQL 5FYJD 1LO3L 4Z0XB 1XGPB 4PV9A 5I71C 3LPFA 4JZJA 3BZFA 1Z0NA 2UY7A 4ODSL 2IQ9L 4YGAB 2A9MH 5ISZA 3V7AG 3VCLA 4HAFA 3SDDB 4P9MH 1PJ9A 3NIDE 3EJZD 4P4KB 3R06B 4YHKH 2C26A 1XGUB 3RZWA 2FR4A 4LHJB 1BJ1H 1FCCA 1G7LA 3ARGC 4X8XA 2AK1L 2ZUSA 2XFXB 2A9NL 4P46B 3GSXA 2EH7L 1G9NC 1U3HC 1KIRA 5F88B 3ABZA 2LTQC 1XF3B 4GH7B 2V2XB 3EYOA 3CSYA 4PPTA 4NUGH 5GGSB 4LCIH 3ZYZA 2R56H 4J3TA 1LP9E 3QIUA 4QGTA 5KTEL 4LPWA 4NKIH 1FIEA 1K3ZA 3KLAB 3OB0H 1JGDB 4Z8FL 1XCQA 3QUXA 3RWDA 3JTSA 1MVUA 4JDVA 1JPFA 5GS1B 4XPGL 4LGPB 5C0CE 4ODWB 4FQLH 2Y6SC 1I1AB 2EC8A 2AJUH 3V4VL 1C16A 2EDRA 4P5TD 4LVOB 1I3UA 2R69H 4JFDD 3D2UD 2OSLB 1LO5B 2FHCA 4X6BB 3MYJB 4ACPA 3OXSA 5C8JB 3H6JA 2FEEL 1MCKA 3MQIA 4M5YL 4QRSA 1L0XA 1A7NH 2AABL 3N9GH 2ICCA 4OF3A 4I8DA 2VZVA 1RHHB 1I7RB 3MLUH 3UAJD 3GMNA 4A6YA 1L6XA 3INUL 4NN5B 1FNFA 5GRUL 2YR3A 3W2DL 1RZKL 4LCWD 1H3PH 2VLRB 4F7CA 3CFJB 1S7VA 3QI9C 1YMMA 3KYKH 1FVCB 2E27L 1I3RA 4XP5L 2XWTA 1UWXK 2R1XB 4DGVH 5DD0L 4EEEA 1DUZB 1BLNA 5E6IB 5E99H 1A6VH 5C07A 3KYMA 1YPZF 1IL1A 2DM3A 2D31B 4OM1L 4X4XA 5FM5O 3ZTJH 1WWWX 2J4WL 2Q3ZA 5LXGL 4I0PB 2CRIA 2JIXB 4ZFFA 2YUXA 4CADB 5T5FL 3SGJC 3BT2H 2BVOA 1P53A 1A3LH 3STLA 3LB6D 3FQNA 5GGRY 2X4UB 3MGOA 4LSUH 5FCUH 3VD7A 1RIVL 3FQRB 4BQ9A 3GHBL 1EXUB 1JNLL 2UVEA 2ZSWA 1C7TA 4OCYH 5ACLA 3E8UH 4PJFB 3UDWA 1CF8L 4UIMB 1UWXH 4WO4D 3VXUA 4OT1L 5M95B 5IBLD 3GO1H 3BUYA 1FN4A 2J5LC 3KGRA 3H3BC 4P2RB 4F9LC 1G7MA 4NBYB 5HHME 5C07D 2A6DA 1BX2A 2I9TB 4XCYA 3CC5B 3GSUA 4H0HB 2CUIA 4ONGL 4XXDB 3T0EB 3QNYA 1IGIH 2EDKA 1YNTA 3CX5K 1LDPH 4QHUB 4HXBH 3FT4B 3H7BA 2OZ4L 4UT7L 4NO2A 4PG9A 4ALAH 3ULUF 3C8DA 1AFVH 1RUKL 3TBSB 3QIBB 4TSBL 1ZANL 3SGEH 5HGBA 2VLKB 4JM2B 4Y19B 1MCOH 3EGSA 5FYKU 4IRJB 2NLJA 1WGOA 1A2YB 3BMVA 5B3NA 3ARED 2DLEA 1DVFB 2X89A 3T8XA 3ARPA 4U4BA 4KZDH 4L4VE 1WZKA 3FO1B 5FYLE 2J5LB 2CRZA 3KS0J 3BDXA 4YHIB 1DFBH 1KCRH 5KVGL 3GSRB 2E9IA 2ED7A 1VFOA 4P2QE 1CICA 2E8ZA 4JN1L 2H3NA 3GRWA 3LN4A 1ZVSA 2RIKA 4QHNA 4AH2A 3C5ZD 2NX5D 5F8RC 4TUOA 3U2SA 1LNUB 2ESVB 5I1CL 1RULL 5E08H 4ZDHB 4E41E 1W72H 4ZFGL 3DUSB 2Z93A 5EU6D 1HOCA 4M62L 5D8JL 5MENA 1WISA 5DD1H 3NIFE 4KRLB 4P2OA 4MQ7B 2QQKL 2VR5A 3Q1SL 1YECH 1KCSH 4PJAB 2YD5A 3G6JA 3LV3A 3RA7L 2XKNB 3ARTA 4PV8A 4U6YA 2MQ0A 5F7MC 1CLOL 4ZO6A 5FGBC 1C7SA 1YJDL 3KXFE 4R4NC 4FFZH 5BZDB 5B39A 3MNWB 1ORQA 1AHWB 1XF5A 3SGDH 1E4XI 2XWBB 5EBLB 3NAAL 5DLML 5IW3A 3WIFA 3QCTL 4YAQB 2OJEB 1MUJA 3F7VA 2Y06H 1RZ7L 2EKSB 5C0IB 4OGXH 2H8PA 3UROR 4V1DE 3HE6B 3BX7C 3BZEA 4K23H 1U8NA 1I1AC 3MLYL 1IEAA 3IJSA 4KV5F 1G0XA 4Y2DD 1EHAA 4H25A 3BE1L 4PUBL 4AG4H 1YEGL 4O2EA 4EVNA 2BC4A 1XR9B 3DRQA 1TJIH 3Q3GB 3IDMB 2AK4A 1T7YA 1ZOXA 2ZUQC 1A4KA 1MHCB 4HK0B 5GS3A 1I8IB 5ACMA 5SV4A 1JF1B 5EU3B 1EH9A 3FFCA 4F8TA 2VXUL 3LKNA 3IVKB 3I2CL 3RWIB 1T1ZA 4NP4H 5DFTA 4Y5YB 5E03A 4XX1E 5CILH 5MEOB 3KLSA 4JPIA 4OCRH 2C5DC 3UTPD 4U1LB 1I9IH 3VJ6A 5E5MB 1UWGH 4IRJD 1H3VA 4HJ0C 4RAVA 2ORBL 3NCJL 1S7VB 4HK3N 4PJGF 2XV6B 3CAFA 4HH8A 3DURB 4M43H 1A14L 4Z7OF 2P43B 3JV4A 3VFGL 1ES0B 1QFWL 1MPAH 3QI9A 4HWEL 3DECA 1F3RB 2HLFD 5D4QA 4U1HA 2NX5B 2N56A 4HFWB 4PGEA 1IAII 1WWBX 1IEHA 3P0YH 1REIA 4PJDA 3RNQB 2Q86B 3RVWD 2YD1A 3VFVA 2BNRB 5C92A 5FYKH 1MCHA 2PN5A 2Q8AL 3NIDF 5IBTL 4J4PD 1SEBB 1F4HA 5GGUA 5FUZL 3B2VL 2P1YA 1A6TA 1KT2B 1QBML 4TUJB 4HBCH 3HZMB 4R6UA 1TQCC 3KNBA 2GSGA 5KOMC 4TQEL 3KLHC 3T3ME 4OLUH 3D0LA 1FRGL 1UM6H 3DBXB 1ACZA 5JORB 1V7NL 3AMKA 4FTVB 1SQ2N 5I1IL 4FFVD 1Q9WB 4WIQA 7CGTA 1HHIB 4NQDD 5BJTB 4PJXB 2V7NA 3CVHB 1HH9A 3TNMA 4F9LA 4P2QD 4L8SC 4GBXD 3MRGA 4JO1H 3FTGA 2X4QA 2JK5B 4ZQKA 5ESVB 5CBAA 4KJPD 2ICEB 2VC2H 4WI3A 1B0WA 4KI5E 1C12A 3L3OA 4J3OC 1SJEB 1FFNA 1QUNA 5A2KH 4TSCL 1JZ5A 4WUKH 1DQMH 4OGYH 5L2JA 4JQVC 4N0FA 1X5LA 3H42H 3MRFA 4MJ6A 5DS8A 1EDQA 1MJJB 5DO2D 3FCTA 2XOTA 4JRXB 3RUGF 1AXSB 5EPMA 3C5SA 2PCPA 5E00B 4G8IB 4C83B 2HVKB 5FM4A 2FJHB 1LEKA 4X6BA 1FNSL 1N6VA 2OTWB 4Z77A 1CGTA 3TN0B 2F8VA 3TV3L 1OGTA 1RZKH 4IM8A 3LN4B 3S88H 4PJEB 1TPXB 1H8OA 4XMKH 5C0BB 4R7DB 2K7PA 1C08B 2CIKB 2CLZA 5HHOD 4LSUL 3IU3A 4Z7QE 4J4PA 4WFED 3WFHB 2DQHH 3IDYB 2GEEA 4F7EB 3BHBB 4LPTA 2Y25A 2FGWH 3GHEL 5E8NA 2YEZB 1T5XB 3P4OB 5T3ZD 1EEZA 1JNJA 5JTWA 1E6OL 4LLQB 4NHUB 1V7ML 3CZFB 4HKJA 4OAWB 1BVKA 1UQSB 3LDBC 4OCWH 3D85D 1U9KA 1BFVH 4XNMB 5IHBA 2PYFB 5L0QC 3PWVA 3C60C 2WUBL 4MZ2A 3NPSC 4G9FB 4O58H 1D5ZB 4HXAH 3T0EC 5DJZB 5DD6A 5FKAB 2OI9B 3NCYS 5IV2B 1NLBL 3HR5B 5F9JB 1Y18B 5JW3L 4OUUB 1T6VN 3I50L 5EO9A 4LKCB 4X80L 4S1RH 1WT5A 2XRAL 1G7HA 3MOBL 3ARWA 3BPLC 2VE6B 2BERA 1IEBB 3OR7A 3HE6A 5EC1A 2J6EH 3WE6A 2XZCH 2XA8L 3MREA 4OCXH 3CC5A 4X6EA 4XCCH 3QUXD 4HMCA 3VDBA 2DLFH 1FAIH 1Q0YL 1MI5A 4HKZB 4HWZA 2PW1A 4YHZL 2VDLL 1YNKH 1UM4H 4UT9H 1N5AB 5C0AD 2IPKB 4WI6A 5D7KD 2A73A 2P7TB 2WIIB 4YNYA 5JIIA 1AD9B 1OHQA 5DHYA 3W11C 2PYEB 2CLVA 3GFUA 3DX6A 4R2GB 2WBJA 3WEXA 1K4CB 1WF5A 5ETUB 3PNWB 1TDQA 1RUAL 3IDJA 2HKHH 3EOYG 4Y16B 2EDWA 4KK6C 2G60L 5H37H 1S8DB 5IFHH 1BF2A 4N9GA 1ZT1B 3GMQB 1JK8A 2HFGL 1UKSA 4Z9KB 1BEYL 2ENSA 1S7WA 1F8TL 4FFZL 3U4EB 1SYSA 2UZXB 1A6ZB 1KIPA 1PD6A 5D5ME 1PY9A 3DIFA 4S2SA 4CMMB 3M1BA 4XVSL 5I8EB 2AV1A 2VUOA 3GB7B 4M1CD 4D8PB 3TYFA 5B8CA 2JB6B 5CZXD 2APTA 4YE4H 5CGTA 4AQOA 5J4MA 3DVFA 3DTXB 4WWID 2YPVH 4YIQB 1CLOH 4PJHF 4ZOBA 3O0RH 2B1HL 1H5BB 4MVBD 1ZLVH 2DIBA 1ZHLB 1GIGH 3DSFH 5JHDB 1WLHA 2PO6A 5T1LA 4V1DD 4J3UA 5GZND 5FUOH 4HUMB 4PJ8C 3RBSA 4PBWD 4XCEA 3KYMB 4U0RB 5L8LB 1MELA 3F7PC 1JFQH 4MS8D 3S96B 4NKDA 1F6AA 3TC9A 5HYQB 4PGDB 3G5VB 4ONHA 5C09D 4Z7VE 1UH2A 5ILTL 1ZT4A 5GZOD 1L7IL 5C0EB 3H0TA 5TE6H 5J06A 3C8HA 4JJ5B 5F9WB 3DSNA 4Z6AT 1RMFL 4OKVA 3BZEB 3MRJB 3BH9A 5CUSH 4UIMA 3BQUA 5C0JA 3B8YA 2DJUA 2PR4L 4FQXB 3RRQA 5D1ZD 3G5ZA 3VXUE 4FXGB 4M8VA 2BNQB 3CFCH 2O93L 3QHZH 4OLEA 1KYOK 5C0FA 4JQVA 3VG0H 2YD8A 3HUJB 5IKCA 3H7BB 2KZWA 4MCYB 3MOQA 4G8FB 1YYLH 3SJVB 2MTPA 3MPCA 2YS4A 1BGXH 1FO0L 1X6LA 2EDHA 3C8KA 4P4KD 1J05B 2AV7B 3D25A 3BGFB 4KHTH 3L7EA 4Q6IC 4DVRH 2CDEB 4MDJB 5K59E 5FYJL 3LVEA 4P0DA 3K2UL 3MACL 4ZYKB 4XBEH 1K6QL 4M8QA 1OM3H 3JUZA 4MXQC 5EC2B 5GRWA 2FLBT 5DD5L 3V7MA 4L5FL 1XCTB 2X44D 1PYWB 4HIJA 2GW5A 2NY4B 3N0PB 1FPTL 4ODUB 2H3NB 5FFLA 4M61B 3RUGA 4GAGH 4AH2B 2E3VA 2YWZA 3NZ8A 3E6HB 4KRNA 1QBMH 3C09B 5MHSE 2XTJB 5DI8B 3WNLA 2CKNA 2CMRH 4R26L 4TQEH 2B2XH 4MQTB 2ATPA 1DQJB 4Z18A 4L3EE 4PS4L 1MIEL 3QXUA 5GSVB 2IF7A 1FVCA 4NBXB 1L9NA 5KAQF 3U4AA 4P46D 1BQSA 1DBBH 8FABB 4YWGH 5H94A 3BPNC 4LEOB 5GXBB 1I9RH 3WIHH 4LKXB 1J1OH 3NGBC 4JO1L 4WWKC 3FRPG 5CILL 3GMRB 5EOCH 2YRZA 4XNXH 1WZLA 5AG8A 3RDTC 4DW2H 1E4XL 1CU4H 3GK8H 3WIIL 3KXFA 4G6AC 4CVZB 1U8QA 3G5XB 3QA3B 2C4FT 4S0TD 3V95A 3WLWD 1OTUD 2AJUL 5EZIH 3O2VL 3BGMB 2FR4B 1A7RH 3QUKA 4KWUA 4ISVB 3BESR 1U2HA 1TZHB 4MMXC 5HGGS 4HX1B 1B0RA 1G9MH 2QHRL 5CZXC 3TA3A 3ISWA 3CFBA 5GHWH 1OB1A 3RU8L 3GEWB 4O2CA 2GK0B 3T2NL 1J1XL 1KXQE 4XXDA 2GQHA 4GFTB 5HVWA 1K2DA 2QTEA 1QO3B 2BJML 4X0KA 4ZUTA 3I3EA 1IAIH 1P5VA 5SWSA 5T1MA 2FL5A 2VDKH 5E8EB 7FABH 1H3UA 2GT9A 5ELIA 1S7RA 2NPLX 2EC9U 5JOPE 1OAYH 2FO4A 4G43B 4L3CA 4RMWA 5TF1L 12E8H 4PJIA 3ZKND 1JWUA 4KI5F 1G7JA 4FQQB 4QRSB 4W6XB 4B7LA 3O3BB 5HHNA 5DK2B 4DUWA 2VRAA 1DEDA 4WGVB 3WD5H 2Z92B 4OZFA 4X6FA 1MREH 5F1KC 5AWNL 3GJEA 5FCSH 4KJQD 1S9WA 5IB3A 4L4TA 1F8TH 4XCCL 1ZHLA 1NCWH 2G2RB 2JJTC 2HT3C 3QJFA 5IHZB 3HZYA 5ESQB 1CGYA 5FB8A 2YPKA 4A2LA 5C0CA 1JYNA 2R2BA 4U6XA 1PG7H 1MEXH 2D7QA 5TFSH 1IL1B 1CXKA 4K8RH 3OZ9H 2V7HB 4OI9A 5D6DA 2EDNA 2OP4H 4PRAA 4QRRE 4ZS6C 1ZS8B 2VLLA 4O2FA 4YHML 1A9EB 3LKPA 3SJVE 5E2UH 5EZOH 3UC0H 5HHOB 4XNQA 4HS3B 4LPCA 2DQCL 1GAFH 4IMKC 2EDBA 2R0ZL 3BKCH 5C0JB 4U7KA 5IESH 4I3SL 3BKML 4ZXBC 2BNQE 1YUHB 3VXUB 1U8HB 3C60D 3DX8B 2HT4D 4X8JB 5E08L 2NZIA 2XQBL 2DIJA 5AEAA 1H3XA 3BJ91 1P1ZB 5D7IA 4YHNA 5DYOB 3ZSSA 5E2VL 1JZ6A 4LRNL 5D1XD 2QQKH 3PNWA 4QXGH 1OAQL 4IOIB 3B83A 3K7UA 3L3KA 3VCLB 5DJXB 4FQHA 1KTLA 2BCKA 1FZOA 1VGEH 3ARGA 3PWLB 3TO2B 2DL9A 3RIAK 5KVMC 3UTSE 3DVGB 1YC7A 4EDXB 2AJ3A 2FLRT 1BOGA 4HK0A 3QB7C 1WK0A 3GSOB 3OG6B 4QY8A 5JHDE 4KUZL 1X3DA 4F57L 5HTSA 2NY6C 4ZUWA 2NW3A 2AV1B 3CFIC 3FZUC 1S5HA 3VXTB 1A6UH 4Q9RL 3LS4L 3MRHB 1X5YA 1CGUA 1MJ7L 4OF5A 4EBQL 5F9AC 2ZCHH 3WS6C 1P69B 1F4WH 4GLRH 3VH8A 5I74B 1XGTA 3O6LH 1IGFL 3EW3B 3IJHB 1KV3A 3PDOB 1RMFH 4XPTL 5BXFA 4YIQA 1IILE 3RX7A 3O6FD 3MXWH 4OBSA 3STZA 2X9YA 5ABDE 1IGCL 3CFKB 2ZOLB 5HYJD 3UZVB 1QOKA 4M6NL 2ADJB 2G9HA 4M9OA 3EYUL 2DI8A 4NHUA 2V9RA 1IARB 5E7FA 4R4BB 5DC4B 1Q9LA 4K55A 4X4ME 3UJIH 4DN3H 3G6AB 1SM3L 3HE6D 3NZHH 3SCMD 1J5OH 3QXDA 3JUYA 1ZA3A 2AP2A 2JJUA 3MJ9A 5DT1H 2VDQL 1NAMA 1HXYA 2NY1C 3LKSA 3OX8A 1BAFL 2QKIA 4EUPB 3OKEB 2Z8RA 5HDQH 2PYEE 3ZE1E 2YWYA 1U93A 2VJXA 3UBXB 1U58A 2AABH 3N9GL 1J8HA 1KN2H 1FHGA 2GFBB 4M43L 3QHTC 1S3KH 1UA6H 2DQJH 5LGJB 3L95A 4GW4B 4UNVA 1ITBB 3GGWA 4BKLA 1XGPA 4PV9B 2BNUB 2EDJA 3OKLB 5CSZA 3GSWB 5FYLH 5JO5B 2NXZD 3VFUB 1S7SA 4ZS7H 1H15B 5HDLA 4DKEH 2A6KA 5K9QI 3ULUD 3IFPA 4R96B 4OQTH 3IXTA 4KGJA 1PX4A 3PWPD 3VFGH 3FQXB 4Y5XC 4JKLA 5L0QB 3B9KD 2HP4A 3KPLB 5DJ2B 1DEEA 3V6OC 4G9FE 3UXFA 2UVFA 4OLVH 4QF1B 4LQ1A 1IAIL 1UG9A 1SY6H 5DMYA 5E7BA 4OTXL 2IFFL 1EHNA 1XCTA 4N90E 1K4DA 3AXLA 3HMXL 3O3AB 1HEZA 5HGBB 4TVPD 1HSAB 1CGWA 1UKQA 1T0MB 5ESQA 5MEND 5FB8B 2DQEL 4D0DB 4EUPG 3IU3B 4JO4L 1NCAL 3QFDA 3UBXG 5D7LD 4OZHF 2NY2D 3SE8H 3ZT7A 3MV9A 3O9WC 2YEZA 4AK1A 3DMMD 4O4YL 3GIZL 5GSVA 3EYFA 3QUZA 1W8NA 2WP3O 2YKLL 2RB8A 5JHLH 2KQMA 3WNOA 5DHXB 4BK5A 4JPKH 2CUMA 3X3FL 3RI5K 3RZCB 3MFFB 3IXAA 4ODSH 3O81A 2Q76B 1CWVA 4G5ZH 4BUGA 3QP3A 9CGTA 5AZ2L 2JJSC 5JOFA 3D9AL 2Q7YA 3R0MA 4BQBA 3V6FA 2BVYA 4LVHC 4Q6IA 2A9NH 3E1F1 4NKDB 4KK9D 4ZXBA 2DL2A 2HJFA 2VDPL 4WU7A 3LRSA 4D0BA 5HHXH 2CKBH 4JFZH 1HNFA 4XCNB 2XZZA 3CVHA 2WBWB 3QCUH 5C7XH 1I4FB 4KI5C 4HX1A 3SPVB 4JJ5A 3S4SG 4Z7WA 1JRHI 1RK1A 7FABL 4MJIE 3MV7A 5DJCA 2A2QT 4EDWL 5DGRA 3HAEB 3SQBA 4GO6B 1ZAGA 2R9HD 3ZZ1A 4PB0H 1OAYL 5JW5B 4C4KO 1IEAB 3IJSB 4NKMB 2DICA 3WKMH 25C8L 2P5WA 1T7WA 4M6OH 3S5LA 1QFUL 1XIWB 1TZGL 1MFBH 3QZWG 5EU5A 3ULUE 4PJFA 3FQWA 3VWKC 3BW9B 1F4AA 5FHBL 1EEUA 3H9SB 5GGQH 1YEEH 3QEHA 5C3TA 4R0LC 1YY9D 2MHAB 3VFPB 1CGSH 5INCB 1YN7B 2BNRE 5HPMA 3NABH 5EOCL 1FGNH 3SDDA 4H1LA 4MVBC 5IIEB 5DRNA 3RWEB 3QIUB 1UFUA 5MERB 4PJ7E 1F4YH 1YEIL 4NQSB 2NX5E 3K1KC 1KXVC 2CK0H 3EOAA 3BYYA 5B3JF 3P9LA 1JPFB 4ODHL 5I66B 3F5WA 1M6OB 4JPWL 3FFCB 1DCLA 4Y4KC 1J1PL 5KSVA 4OFYD 3RWHA 4KKLC 4OLXL 3PGDA 4PRHD 4OD3H 1YYMH 1WAAA 4A6YH 5J9PA 1E0OB 1GGTA 1OAXL 2XN9A 3C9NB 5I15L 4EI5A 3IETB 1QR4A 4JM2C 4HS6A 2G5BA 3PHQB 4K3EL 3FN0H 2JE8A 1TNMA 1AQKL 3FL7A 4M3JA 4JVPA 3UZEA 3GMNB 3TZVA 2J88H 1KPRA 3GHBH 3EDJA 1NBZB 4GG6E 1U91A 5J3HC 4EN3C 2OSLA 4BM7A 1T83C 1MQ8A 4U33A 4ZOAA 3PGCB 4I0PC 3GO1L 2JF1A 4OF8A 3T2PA 1L7TH 4K7FB 5C09E 2PW2B 1M7XA 3UJIL 1UWGL 1NUDA 1R3KB 4KVNL 3VA2C 4ZTPH 3L5XL 4UIKL 1OF2B 5CJOH 4HXBL 1E4KC 4HKBB 4UNTA 4U6YB 1FC1A 5IF0B 4H1LG 2D2OA 1S7SB 5IVOA 4V1DB 3CDGB 1U8MB 4JRWA 4P9HL 2P5EB 1IM9A 3V6BR 5EU6A 3MRBB 4ZOEA 3BISA 3HA0A 4HUUA 4YGVA 1ZLWH 2K3TA 3IKCA 4Y5VA 3MXVH 4YXHH 5E1HB 4P5TB 2ADFL 5JA9A 5I74C 5GIRA 2HLAB 4JQXA 1NL0L 5KW9H 1G6RA 4QF1A 2BVPB 3BOVA 3I75A 4KGLA 1AXSA 2NY0C 4X6DA 5EU4B 1XGQA 4PJAE 4LSRH 1S7RB 2XNAA 4GQ9L 1NC4D 1HINL 4ZD3L 8CGTA 3GMMB 4FQCH 1G7QB 2BNQD 2KL6A 4K7PH 4QRTA 4FMFA 4WW2B 4D9LL 1MCRA 2A6DB 3QCVL 3FFDB 4ZS6D 1T1ZB 3GNML 3DROB 2ESVE 4Q9QL 4IRZH 4LK4A 4JFXB 4M7ZC 3RP1A 2X7LA 3SOBH 2IFFH 5TE7H 3D18A 3VFTA 2BK8A 4J4PC 4OZHB 4CGTA 1R5WA 2X09A 4P2QB 1A7BA 5C0ND 4B0MM 5BMFL 3SGDI 5DVLA 1GZQA 1Q0XH 3T77B 2NXYC 4JRYD 2C4FU 4BFIA 2IQ9H 3LKRA 4C55A 4PLNC 3T4AB 2AXFB 1HHGA 1IM9D 4LSVH 3OB0K 4GQPH 5FKPB 1Z9OA 4H5SB 2E6QA 4LHUB 5FOBB 1FV1A 4TUKH 1SEQL 3QCTH 2KDGA 2Z93B 4Y19E 2VLKE 3UTZA 3MRCA 3BSZH 5HI5D 4KZEH 2VZSA 1I1CA 4XNYL 1QSEA 4WY7H 5IB4B 4OZIA 1AR1C 4Y4HA 4XC3L 1VFAA 3KXFD 3ZDYE 1GHFL 1TJIL 2FX7H 2P45B 4KQ4L 1HIML 3BKYH 1EO8L 5HHMB 2OTUA 1U8KA 4O5LL 1RV6X 4PJ5A 1F13A 4DKAA 3BGMA 4FTVA 3HPJA 4TUJA 1F2XK 1BWWA 3IFPB 1NC2B 5DYOA 4U3CA 3MA9H 1PX3A 3U1SL 1KC5H 1FVDB 3AY4A 4OIBA 5TH2A 1BD2D 2UV3A 2ZCLH 3TJHD 4MJ5A 2E9BA 3RY6A 2DWDA 1UCTA 1KTLB 4FQHB 5FM8A 4JPKL 1S7QB 5EA0L 1IGYB 1EMTH 4L3ED 2AQ1A 5F1IB 5ESVA 1VB9A 2H32A 3SGEI 5E4EB 5D1XC 3WIIH 1PLGL 2V9QA 1KCVL 4NO0D 5C08B 4I2XA 3O6KH 5TQ0L 1LO2L 2GUOA 4NQEB 3L7FB 4P2OC 5JOPD 1WZMA 4D0DA 2Z8WC 1J1OL 3TJEH 4MAYB 4G6JH 1HKLH 2OZ4H 1JHLL 3P4NA 2PF6A 4LASL 5E4IA 3UTTD 4NYLB 5ICZA 1MVUB 3IDXH 5T3ZE 1AGDB 3N1FC 1CF8H 3GI9L 3TH2T 5FYLL 1MFCH 3GZKA 1NH6A 4RSVA 3O2VH 1AQDA 1RJYB 1JNLH 2IEPA 2Q87A 4A6YL 4XMPH 4W4OC 3M1BB 5I8EA 4YK4B 2ZUTA 5J1TC 4U7MA 4PD4K 5DTFB 3RKPA 4G8GE 4OGAC 4PTTB 2DLIA 2X4SA 1A0QL 4UT7H 4OM1H 4C56D 4QRRA 1G9ML 2QHRH 3V8OA 5CLWA 3VWJC 1QP1A 1X9QA 5LXGH 1ES0A 4U1LA 4JDTH 1P4BH 4TSBH 4HUKB 3KHOA 5T5FH 3SKJH 4RIRB 4ONGH 3O6FC 3S96A 4FXLA 1I1FA 1G6RH 4XCNA 1FYTE 2Z8VC 5KANI 5FCUL 2OR8A 5DJ6A 1BBDH 1LP9B 1MQKL 2H26B 2CDGB 3RL2A 4MLIA 3T0VA 1QHOA 1AFVL 2Z0BA 3TBTB 4LF3A 1T2QH 3FO2A 1KEML 3QFJB 3RIFK 4KVNH 2EYSB 2CIIA 5CEZL 4ZSOB 2FEDC 5J57B 4NSKB 5D71L 3OR6A 5D72L 2DBLL 1AO7A 1FNSH 4M5YH 5BVJA 5ID1A 3ARSA 1M05B 4MWFB 5AYUL 4P9HH 1KJ2L 4X9GA 1IMHC 5EOTB 2XKNA 3W39B 5A1AA 4U1MB 1MCOL 2J88L 5E5UB 5SWZB 1JZ8A 1S9VB 4RWHA 3BWUC 4DOHB 4XCFH 5B39B 1D5MA 5CHNB 5CBEA 1F97A 3KLHD 1NMBL 2EKJA 4LLWB 2P42B 3VE0B 4FABL 4APQA 1BQLL 4N8PA 2XXCB 4OM0H 5E4EC 5KSVB 1XGYL 4X7FC 5I76B 2R23A 3EZ8A 3ZT5A 3C6LC 1CFSA 4ETQA 3L5WA 2CK2A 1INDL 1QSFD 3VFSA 2FBJL 4P57B 1I7TB 3D87B 4LLVB 5IB5A 1GGBL 4WGWB 5TDPA 4PJBF 1AE6H 1CE1H 3LN5B 1HHGB 4R7DA 2C4XA 3FQNB 1MLBA 5JXED 1I1YB 3P11L 3O3EB 5ISZD 1YQVH 4PJHE 1MFNA 4FQXD 4AMKL 3I2CH 5EC2A 3ROOB 3ESVF 3W0WA 3DYOA 2IANE 3BHBA 1UXSB 4UZGA 1PYWA 1IC5L 4XPBH 4PUBH 3BPLB 4AG4L 5KSBB 1RJLA 5F9WC 3ZKQD 3HG1B 3WIHA 2H9GB 3CFDB 5IVZB 4HLZG 3MO1A 1R3IH 1IQWL 5ITFB 4NJ9H 1FAIL 2HJKB 1JWMA 2OI9C 2ESVA 4K71B 4I3RL 5C6WH 1BPVA 4X7EC 2VISB 2OYPA 2YXFA 5L9DL 3QO0A 4P2CG 4XP9L 1UWEL 3HNSL 1CR9H 5EBMB 4ZUUB 4OAWA 1N4XL 2WBKA 4FZEH 4DUVA 1NFDA 2IAND 3DUHA 5IFJB 2R1XA 3HZVB 3HCVA 2UUDH 3CDFA 1NCCL 3MRLB 3OKMB 4TTDC 4XC3H 4KVCH 5BO1L 4FFYL 5BCAA 3OR7B 3CFBB 1QBLL 3IDYC 3U30C 1N6UA 5I9QC 1HINH 1GRWA 3T0AA 4X5WA 1F90L 2ZP0T 4M7ZB 3NGBB 4WWKB 5H35B 1FIGH 2C3XA 5DZOA 3PJSA 1XIWA 5MEPB 3MV8D 1BVLB 3RJQB 1DUYA 4EN3A 4I18B 3ARQA 1HCFX 1IKFL 3MCLH 4U1JB 3H9SA 3IXTB 2H45A 1JYVA 2FSEB 1FNGB 2C7UA 5TE7L 4UTBH 5K59F 2RJMA 3BUYB 1JVKA 2VN4A 3VFWA 2WQ8A 5E5RB 5CKAA 4P2OB 3MLXH 3W0WE 5DFWH 4UDTB 5HI3D 5I1KL 5EUOF 5BVPH 2J12B 1T4KB 3MV01 1SJEA 3ZKXB 2AEQL 2YK1L 4NRYB 4GG8B 5D93C 4IMLA 4WEBH 5ID0A 1V3KA 1IZJA 4UQ2B 2C3HA 3EDFA 5JA8B 2G2RA 3RFZC 1MCNA 2V2XA 3EYOB 5FECB 3ZTNH 3T2NH 5IVXA 2MJWA 3LIZL 4LLDA 3VFRA 4YDLB 4OZFB 1U8LB 2EO1A 3NCBB 2VDMH 3GB7A 3QDGA 4MD0A 2WLZA 5E5MA 2NTFA 3X13B 1LEKB 2EE9A 1UKTA 4HJGB 4RAVB 4KKLD 3V2AR 3QXDB 4HGKC 4UB0H 2EO9A 3MLVL 4GAYB 1FYHB 2MQ3A 4HMEA 3PWUB 1QBBA 3I84A 3DURA 2D0HA 1C5DB 2K9UA 3BVNB 1MF2H 1Q8MA 4XXCC 4CVXB 4OZIB 3ULSA 1UZ8A 4N68A 4S1DC 4EI6B 5A40E 4D8PA 1RUMH 1LNUA 3Q6FB 4F7MA 3WFCH 1U8PA 3QUYC 4M02A 2R29H 4JDTL 2DQDH 1U8IB 2WWMD 4P5KA 4FZ8L 4DCQB 1A3RH 3L6FB 4PRDB 4CMHB 1JBJA 1NC2A 5EIVA 1U95A 5TE4L 3G5VA 1DLFH 3IAQA 3UAJC 3VFOB 1MNUH 4AIOA 1CVSC 4N0UE 5CEZD 5BRZA 4OLYH 5JZ7C 4F33A 4YX2L 2R1YB 2HTLD 1H3GA 5J0BA 2ICWI 2DIAA 5SWZA 1T04A 1CI5A 4ZAKD 4ZPTB 3TO4A 2AXJA 3GIVA 3QHFH 5FYJH 3I6KA 1OARH 4NM8L 3EOTL 4GUPA 3EUUA 1OSZB 2I07A 4FRWA 3F12A 4HWBH 1CXLA 4GKSB 4CU8A 1FBIL 1Q9OA 5GS0C 1GGCL 4OF6A 1FSKC 1CYGA 3L7FA 3BQUD 3DGCR 3LDBB 4MA3A 3CSBA 1RHFA 1GAFL 3MLUL 3V52H 2EKSA 1UEMA 3SKJL 4WI9A 4GAGL 3UYRH 5LCVH 1R0AH 1NAKH 4JFDB 1H5BC 4U1HB 1ERNA 1EFXD 4JDZA 5KVEH 4OBRA 2RAMA 3VI4F 5TPWH 4CRPA 3TYGH 5D6CB 1NLDH 3ZDXE 3A6BL 3MRHA 5K9OA 3RWJA 4HKXB 4CAGA 1YEKH 1FG9C 1QFOA 2Y23A 1MWAA 1BQHB 4EVNB 1S9XB 1N0XL 3MRFB 5DC0A 1J8HE 2R0KH 1R6VA 2P49B 3DROA 5DD0H 3RBGA 2J1KA 5E2VH 4QY8B 3V4PH 3WKML 5DDHB 5C86A 1URLA 4PJ9B 5JQHC 3MA9L 1CS6A 1N7MH 4JG0L 4H26B 4PJBA 4PRBA 4RGNE 5IG7A 1JWUB 2O61A 2A6JB 3MLZH 5CZVL 4LRIC 5DMKA 3C8KB 1MVFA 2FX9H 1KSRA 4ONOA 3BD3A 1EFXA 5FGCB 1EMTL 3VD5A 4FQ2H 3LS5H 4E41A 3VFMB 5C08D 2QJDA 5C6PB 3RVTC 5BOPA 4IRSA 5B3JE 1MFBL 1N0LA 4ODHH 3X14B 3CCHB 1NBYB 3VW3H 2R2BB 3Q2CA 2IAMC 4F7PB 3MRCB 3QWQB 4EUPA 2XXMB 2YPVL 1ZWIB 4ZFZB 4I48A 5I1JH 5FK9B 1CFTA 1MJJA 4MNQD 2DM2A 1JZ4A 3SCMC 1QG3A 5DURB 4LEXH 3S37X 3OKNB 5CJQL 3U2SB 2J8OA 4ORGA 3V4UL 4LCUA 4AZ8A 4ELMF 2VXQL 1JGLH 3PJSB 1NGZA 1JPTL 3S35X 2GTWB 3SE4A 3CFJA 5TDOB 2D9QB 5F7NC 4F7TB 5FGSA 1PVHA 2OJZH 3WN5A 1N3NB 3MRBA 2DI9A 5IK3A 1PZ5A 1G7PB 5IMLB 1B4RA 5DVKA 3TT3L 2PTTB 5FA3B 1X5FA 1ACYL 1KENH 4KRPC 5IFHL 5DJ0A 4EZMA 2QADB 1HXMA 4OCWL 1SMOA 3B9EA 1VSCA 3PGFH 3HR6A 4U2YA 4CADA 3BD4A 3NH7L 2NY4D 1YNLL 3DVNB 4S1SH 3AC0A 3QUMH 4X9BA 4Y5XA 2DLGA 1XGQB 3G6JE 2ICWJ 4KTEH 1K8DA 2W92A 4UQ2A 3VFSB 1AJ7L 2ZSWB 3FAWA 4WTZA 1J0JA 1KACB 1Y6KR 3NN8A 4G7VH 4XP9H 1HDMB 4MAUL 5D7JD 3RX8A 3WMSA 5FOJA 4MZ3A 2NY5H 1HHHA 3C5ZB 1BFTA 1OPGH 2JJVA 2Y5EA 4P2RA 3Q1SH 5B4MC 2R0WL 5FYJE 3QFDB 5HJ3B 3KPSB 3GJFK 2J6EL 5D9SA 2F53A 3QWOB 3HUJA 5IKCB 5CMAB 3GMQA 5JMRA 2ZZUT 4MCYA 3BO8B 1ZK9A 1PEWA 4L8SA 1VFBB 4PJDF 1CE6A 1QLFA 1WJ3A 3FOLA 4R7NB 2WBJD 1ED3A 2R0LH 4PJ9D 1NGPH 4Z7UB 1UM4L 2EZ0D 2AJZB 1GZQB 2RHEA 5E94A 4XMLL 1RIUH 3MROA 1AH1A 1MFAL 2AJSL 4JRYE 5L6YL 4N8CH 4NT6B 5KS9A 3MJGX 3VD4A 3JVGC 2X4NA 4FQCL 2XZQL 4M5ZL 2NY1B 2HJLB 2IFGA 3RX5A 3Q5TA 4JM4H 1RPQA 5I2IA 3QWRD 4D0BB 4ETYA 2JJSA 2GJJA 4P23B 5DRXA 5DVNA 1H5BA 3IU4H 4M61A 2WZPD 3OAYH 2FBOJ 5DQDH 3O8XA 2DAVA 5JOFB 5F44A 4RGNC 4NNPL 1FPTH 4PJIF 3VGEA 1GOFA 5JW5A 3PABA 4U1KA 2WLYA 2ZG3A 3SDYL 1OAUH 4PRHE 1U58B 2VAAB 5AZEH 3B5HA 5HGAB 2EIZA 4U1JA 1WBYA 1OW0C 4X83A 4Z7NF 3CVIH 2XWJA 2IALB 5ACZB 5DUML 3SDXA 4L3EA 3F8UB 4R2GD 1OD9A 3HRZB 2A6IB 4NZTL 1GC1C 4NM8H 1YDPA 4Y16D 3EBAA 5GS1C 2P5WE 5L7XH 3WSQL 2EZ0C 4I4WB 3REWA 4H20H 3QXAA 3FQXA 4LNRB 1YC8A 1FBIH 1KFAL 5GRUH 2EDQA 3FB8B 1WIUA 1GSMA 4JY5L 3TCLA 2CUHA 5KBNC 5E1AA 1MRFL 3X3GH 3BJLA 2OMBA 5CEXA 5FYKL 2A83B 1TCRA 2FH8A 3MBEC 1DQLH 1D5IL 2YD2A 1K2DB 1T0MA 1SJHB 2CDFB 3LH2L 1ZHBB 2R4SH 3FB5B 3H0TB 4MJID 3BRGC 1AGCB 1TZGH 3WFEH 2V5SA 3EYQD 5IVXE 4NQED 4N8VB 3CK0H 2EXWD 2WV3A 3AVEA 3HNVL 3SE4C 1NUGA 3OGOE 1AQDB 1RJYA 3ZDXF 4EN3D 1WCBB 3NCFB 2J6EA 1HZHL 5IQ9A 4F7PA 2NW3B 5F3BB 1J0HA 5IWLC 3NACL 1NEUA 1ORSB 4MX7B 3TN0A 5ITBH 4OJFL 4GBXA 1X5ZA 1P7QA 2VIRB 2QADC 1ZT7B 3MV9E 4ODVL 2CK0L 1NAMH 1T83A 1LVEA 3V6ZB 3VWKB 5DI8A 1ZHNA 3NBNA 2HRLA 4P9ML 4XPAH 3MFFA 4NCC2 2I60L 2UWEB 2VZUA 3UMTA 2IANA 1A9BB 2YSSA 5TDOA 5TQ0H 4U3XA 3OTTA 1HHJA 4HEME 4P4KA 4UV7L 4DGYL 5DMIL 3FFCD 1P7HL 3HE7B 4UQ3A 5TDNB 5J11C 1SBBA 1YN6B 3EGSB 3HTLX 4PRPD 3QIWD 2NLJB 3C6SB 1OF2A 2Y5TB 1A4JA 1RZIB 2AJVH 1AHWC 2PYFA 5T3ZH 5GJSH 1TMCB 2E7CA 4YHLH 3T0WA 3IJYA 3RHWF 2D7TH 5FDWA 4PRIE 1U8MA 2HH0H 1PG7L 1XR8A 3PWNA 1SYVA 4LGSB 4HS3A 3RAJL 5D93B 1IGTB 2DYPA 1UB6B 1N6QL 3MODL 4RZCA 4GRWF 4K8RL 2GJ6D 1NFDE 2X4RB 4F80A 1PKQA 1A6TB 5F70A 4M48L 3O2WL 5FHAL 2JJWA 3QISA 1FH5L 2F53D 2F54E 3SE8L 3WV0A 3GBNH 1W0VA 4KMQA 3ZE0E 4XZUA 3IYLW 4UNUA 1T1YB 2QHLA 5C70A 2BXYA 4H1LB 2ICWB 4MXWL 5IIEA 5H94B 3MRNA 1TVHA 5F8QC 3C2AL 2X4QB 1ED3B 1UB5B 5HDBE 2BY0A 1BP3B 4TSAH 3MRMB 4L1DA 4LPUA 4UTAL 3ARBA 4ERSH 3B6SB 3D0VA 1GOGA 3MOAL 5DUPH 5FECA 1FFOA 3T77A 2APXA 2CDEA 4MDJA 1NFIA 2XWTB 3O4OB 2IQAB 4WRLA 4GRMB 3D3VE 3BIKA 4DWHA 3FCTB 4HPOH 2VZOA 1VEPA 4F2MB 4W4NA 3KYNB 3L3HA 4FXKB 3HB3C 4GSDL 5DJ6B 5IVZA 4ELME 4NN6B 5EFIB 1FDLH 2FATL 1CFTB 4RMSA 3LQAL 3O8XB 2NNAB 4OZGB 2QQNH 1R24B 5EUOA 5HHVL 5EIQA 2BFVH 3VI3E 3HLAA 4X6DF 5KG9A 3EJJX 4KUCF 2Y06L 4JFEA 1CXIA 2HA1A 5IB4A 4MA1C 1ZSDB 3FQUB 4YDJB 2F15A 4YC2B 4HUXA 4P49A 4YR6A 5CJ8A 1ZLSL 3V5HB 3V8CA 4U1KB 5BV7C 1GZPA 2Q7YB 3KWWB 1RUQH 5DC9B 4LDEB 5ADPL 1U8KB 3QEUA 5IOPA 1N3NA 3D39A 1MCWM 5HVGB 2Z35B 4QRQB 3VFOA 1Z0MA 1A22B 5BRZB 1NDMB 2VLMD 3SDXB 4FQQA 1IGCH 3OKMA 1MFEH 2VXSL 4Q7DA 1OW0A 3PP3K 1P6FA 1EHXA 3MV7B 5IB3B 3LKQA 1LGVA 1A7OL 2Z9TA 4X5WB 3NVQA 1IM9B 2VITA 4BSWB 2Y72A 3OMZA 3CDCA 5C0DA 1WAAE 4PR5A 1HNGA 1ZVYA 5TH2B 4PJCE 1PQZB 3ILPA 4W68A 4CL7A 1KELH 2MMXA 1LK3L 4Z7WB 3QI9B 2A74A 2FEDD 4RGOH 4F58H 1RZJC 2EIDA 2VSCA 1BJMA 3SDCA 1F4WL 3MRJA 4PRAB 4U1NA 4O2CB 4C56E 5CP3A 3RGVD 5L7XL 5INDB 2F53B 3QWOA 2CXKA 3MV8B 3MJ9H 4LSPH 3KPMA 3C87A 2XZQH 3GKZA 1QLRB 3FJTA 4V2BA 3OAZK 1U42A 4R96A 3QAZC 2EDLA 3JWDL 4GG8A 4RX4A 1OLLA 4N0UA 4OFKA 3DWTA 2PYEA 2MHAA 3HZMA 3VFPA 1ORSA 4MX7A 5IMKB 4GG6A 1P9MC 5DWUH 4AEIH 1JN6A 3ZKSD 4XWGL 3IKKA 3U7AA 4LCWA 4YO0B 4BELD 3PF2A 1AC0A 3BP6B 4MXVF 1EPFA 3MNVA 3S36L 4TSCH 1PG7X 3ZE2F 2IWGA 5KSUB 1IGJA 1KCVH 4BQ8A 3BMWA 1HEZB 4N1CA 1CTOA 3DX9B 3SE9H 5FO7A 2UZIH 5E8DH 4HT1L 5C0GA 3NA9H 3UP1A 3RDTB 3VH8G 2LTQB 1OP3H 2FJFB 4LLYB 4GMSL 1NGQL 4XAWL 4DVBB 4ZFZA 4UTBL 2ED9A 1TTUA 1OPGL 4G7YH 4Z7NE 1I3VA 4RBPK 4LCYB 1A47A 2DJSA 3ALWA 1C1EL 4QRPE 3EJYC 3U0TB 1SY6A 5HGAA 3MLYH 1XR8B 2VZTA 1NBZA 4JO4H 1JI2A 5I1KH 1KGCD 3I6GA 3EO0B 3MR9A 5ID1B 5L88H 2HFEB 4WUUB 4LVEA 1DQJA 4PJIE 1M7IA 4R9HA 2AS5M 3O4LB 4HS8H 2Q76A 2YK1H 3WDHA 3P77A 2DQGH 4HF5H 3WJJC 8FABA 5IR1B 3I3BA 1MJ8L 2OS7A 3D5OF 1HCVA 4HIIB 1IQDB 4KDTC 3UZQA 4F7EA 4C56B 2GAZB 3QUZC 2VL5A 2DQIH 1F6AB 5HYQA 5KTEH 4NBZB 5JNYB 1DBAL 3OKLA 5CSZB 3G6DL 3DVNA 4MA3B 2GKIA 3MLVH 3CPLA 4OZ4A 4PG9B 4ZAKB 4PJCB 1RSFA 4X6DB 2OL3B 4QLRA 1IKNA 2VLJA 2ORBH 5D1ZB 3V4VH 1NCDH 4IIQB 1KJMA 3D2UA 4QRUA 2C1OB 5HI4D 2YD4A 5D7IE 1UH3A 4P5TA 4R2GC 5IUSA 3D9AH 3ZKMC 4KAQL 5FHBH 4XB7A 4RQQA 5IB2B 4E9LA 4O4YH 3FO1A 1Y0LB 2ZOKB 2L7JA 5MP6H 3T2OA 2D7NA 2IJ0C 4KUCD 4KZEL 2DWEB 5SX4I 4RFOH 5CIPH 4JFFA 5HPMB 4R7NA 2EE6A 2D7TL 3K74B 5IMMB 5I30L 4LLMB 2QEJA 4ZS7L 5JPNB 3MLTB 1ETZB 4XNUL 3RAJH 3F58L 2WMPA 1JUFB 3VMOA 4X4YA 4JRYA 4LFHD 3PL6C 1ZGLA 4JVUA 3O2DL 2WNGA 5T1DL 4IOFD 3OJDA 4OZGE 1NCUA 5DTFA 4ELMB 1I3RB 1YNKL 3RWFA 4MA1B 4G9FD 1JYXA 4OCNC 4JFFD 2V7NB 4O00A 4PJ8B 4HV8A 1RI8A 1N6QH 2DM7A 3N06B 1EAPB 3LOWA 4XBPB 5F7EL 3ZO0A 3A6BH 1DQDL 1E4WH 2ESVD 3IB4A 4WTXA 1D5BB 5EZLB 2HT2C 4L8CB 3F7RA 1OSZA 2I07B 1DFBL 1T7ZA 5KVGH 4HW6A 1TETL 3CVHH 2XICA 4J3SA 2Z91A 3MOBH 5IMLA 5E8OA 5K9JL 4JFQA 1P9MA 5ITBL 1WWAX 2VLJD 3HC0B 3UYPA 3L95B 4WJ5B 4HG4K 1OGAB 3VFNB 3VWJD 2O26U 4JDZB 2DD8H 4RMTA 2KBGA 5GS0D 4EJ1C 3B9KB 2QV2A 1S7TA 4G80B 2ICWA 1CLYH 4O2EB 2F54B 1MCPL 4LLAA 4HH9A 4LP4A 3HPJB 2EE2A 2H41A 3CD4A 2NY7L 4LLWA 3QDHA 4HUUB 4JAMB 4KZDL 1AKJD 1LE5B 4PTUA 1Z9MA 3U46B 3UJTH 3WNMA 1E6OH 3VFWB 5ID0B 5JZ7D 4G9DA 1JPSL 3ZKMD 5INCA 3TWCL 3UCRA 4UBDD 5DMKB 3EYVB 3QQ4B 4MNQB 4UIKH 2F19L 4S11A 3VJ6B 4G6AD 4Q0XL 3MMEA 3QDGB 2OL3H 4JCLA 4Z76B 4NQEA 5L8KB 1MJUL 5EFIA 3DPBA 5HYJE 3ECBA 3U4BH 4J1UA 1T2XA 4WV1A 1GGUA 1MAKA 3M8OH 4L8DA 4K94C 3CZJA 4PRNA 3HR5A 1X5IA 1TQCB 3T04D 1AGEA 4Y4FD 5CP7B 1KJ2A 3DGGB 1JJUA 2VOTA 4CDGC 1VGKA 3HI6L 3MV9B 2GJZA 2R2HA 1M4KA 2X7LB 3PL6D 4OB5L 3V0VB 4HJ0D 3HG1A 4J3WA 1FGNL 3W9DB 1S7UA 1YNLH 2IMNA 2P8PB 5KSAC 2QL1A 2VISA 1CFNB 5DRZB 5ITFA 4IJ3C 4JZJB 4LOUC 3WUWB 4YBQD 1NBVL 3FT2A 1JMZA 5DUPL 43CAB 3PV6A 5IB1A 1MCBA 3RVVD 1LEIA 5I66A 4FG6C 4G6KH 2GY7B 1ORQB 4JFHE 2WWKO 3EIFA 3OAUL 1L4IA 2QR0A 4XVTL 5F1SA 4M7JL 5EOQL 4NC2B 5C1MB 4NNXB 2E7HA 1P7KA 3O8XD 2FO1A 3OJMB 3REVA 4JM4L 2VLJE 3RVXD 2AJXL 3O45B 3TBTA 4I9WE 1HIMH 3BKYL 3QUZD 1FFRA 2MPAH 3UDWC 4NWTL 1P2CA 5FUCC 4F8QA 5BMFH 5A43C 5DEGA 5FA4A 3ME0A 5KANG 1CGVA 4OQ1A 5HGHA 1TPXC 1FLTX 1XH3B 1FG2B 4GKSA 5L2JB 1LDSA 2YD9A 1S9VA 4QOKD 3U1SH 3UPRA 1U8JA 1F42A 1BVLA 4GRLD 1ZEAL 4HQQH 4G8IA 4L9LC 2Q8AH 3DNKA 3KPPB 1P4IH 1EEYB 2CQVA 5IGXH 2EIBA 4MJIA 4WI7A 3VMPA 2Q8BH 4PJ9A 2OLDA 3VFUA 4Y1AB 2XACC 4PG2C 4X9FA 1R3IL 2YZ1A 4Y8DC 1R3KA 4JKPL 3ZMRA 4I0PD 4PJEA 4UV4H 4PRHB 4N0CD 4OLWL 4ETQB 1C08A 4I3RH 5I18L 1OQXA 4NCDA 3AAZA 3QJHA 2LAAA 1NGQH 2YN3A 3PWPA 5IEHA 4MAYC 4TVPE 1ZE3C 3LD8C 1TFHA 1KBGH 4RFNB 3MUGB 4QT5A 2G75A 2ZNWA 1RZ7H 5HY9A 1U6AH 5C07B 1UJ3B 3OKKB 4GJTB 1RZKC 1ZT4B 2YUVA 3VRLE 3TZVC 4Z0BL 2BVPA 4IRSC 1TNNA 4DKFH 5SWQA 4MHHG 3TPUA 3S6CA 4HDIA 3VH8B 2GJ6E 3MNZB 3LKOB 1KPRB 4RAHA 4HIEA 5B22A 4OQTL 3MGAA 3RKDD 3KLDA 1J1XH 3ARDD 5I8CB 1ND0B 4Z7UE 1S7XA 1I9EA 3KJ4C 1BZ7A 2EXYD 2HN7A 3VXPB 3V5DB 1NMAL 5HHQA 3LHPH 1G84A 3GUTA 3TBWA 1BFVL 3ZHDA 4AM0B 2P8LB 3PWJA 3LQZA 3SQOL 3WO3B 1MY7A 2X40A 3X3GL 1ITCA 2DQHL 4P3DB 3UBXI 2BY2A 4O58L 4X4XB 3QEQB 4Z0XA 2UZYB 5D70L 2AI0L 2ZCKH 3D69A 5CSGA 1MRDL 4OIIL 4LAQH 3EAKA 2APWA 5CD5C 4F33B 1LO0L 3HNVH 1WSST 3HB3D 1MCCA 2DYPB 2J3SA 4LL9A 2AEPH 2X4RA 4OLZH 5IHZA 4FQIH 3RWGA 4OFPA 4WI2A 4XAWH 4NZUL 4LHUA 1K5NB 1F45A 4GLRI 5FOBA 1HDMA 4JPVH 5GGSA 2HFFA 3RNKB 1X6NA 4HXAL 1KJ2H 4JE4B 1QEWA 3GSNH 2UY6A 4FMKA 1S5IL 4AEEA 1T7XA 2O5XL 4Y5XB 3QUXB 5HYEA 5TF0A 2NY2B 5K9OB 1W0WB 4IRSD 1RD6A 1KCUL 4YXLH 4XP6H 4XI5D 1EHLL 1MQKH 4GRLB 5D2LA 3M17B 1QFWI 3KJ6H 4MA8H 3P73A 2X41A 5M94B 3MRKB 1DLHA 5AYUH 3RZCD 1FP5A 5I17A 3TYFB 1IGIL 2K7QA 5IJKC 2YA0A 3FFDA 1T1WA 5C6TH 1EGJH 1UXWB 1G6RL 1RU9H 1IM3B 2QADD 5LGHL 1VA9A 3EO1A 3E3QE 4X6CE 5MI0C 1JRHH 1X5HA 5ANMB 1A21A 4YXKH 4OZHA 4PB9L 3R8BB 4OZGA 4KI5D 2NY0B 3LAFA 1B2WH 3UTSD 2W60B 5GSRA 4BFIB 5IB1B 2A1WH 5A3ID 1NBYA 5CEYA 1FZMB 5T33H 3N85L 4HGWB 5I1AA 2EXWC 4J6RL 4ZDHA 5T3XD 1PW3A 5FKAA 2FIRT 4P5TC 4KC3B 5FGCE 1A6UL 4Q9RH 2J8UF 2YPLD 5GISL 5IFAH 2FD6L 5AD0B 3OPZL 4FNLH 1RJLB 2W9LA 1GL4B 3D39B 3QQ3B 4I0CC 4G8EA 1BJ1J 2ITDB 3LEXB 1YJDC 2Y9RT 4RGNB 5CIPB 3GM0A 3HC0A 3TV3H 4PJ7F 3MGOB 3RY5A 4IEFB 5MI0B 3DO7B 3I9GH 5ICZB 3MRDA 3EJZC 1VEOA 4WDIA 4PV8B 4F57H 1WC7A 4OCSH 2QQNL 5HHVH 3J8F7 3LRGA 2HKFH 5IHUL 2D7OA 3ZDZF 3DXAB 1AO7E 3KPNB 1N5AA 3THML 3U9UB 4LVOC 1EZVX 3A67L 4LRNH 1AI1H 1YEFH 3X11B 5DQ9A 1FQ9C 1OAQH 1X7QA 5CJXA 3CU1A 4BZ1H