5JXED

Human pd-1 ectodomain complexed with pembrolizumab fab
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
218
structure length
197
Chain Sequence
QVQLVQSGVEVKKPGASVKVSCKASGYTFTNYYMYWVRQAPGQGLEWMGGINPSNGGTNFNEKFKNRVTLTTDSSTTTAYMELKSLQFDDTAVYYCARRDYRFDMGFDYWGQGTTVTVSSASTKGPSVFPLAPLGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVTCNVDHKPSNTKVDKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for blocking PD-1-mediated immune suppression by therapeutic antibody pembrolizumab.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Programmed cell death protein 1
total genus 35
structure length 197
sequence length 218
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jxeD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jxeD01
1S5IH 1UQSB 4PRBB 3GSRB 4TTDD 5FA4A 1P7HL 3MJ9A 4KWUA 2YUZA 2PXYD 4NN5C 2DQIL 2J6EA 4OF8A 5BVPH 1A1NA 1UZ8A 2AABL 2DI8A 1Q9OB 3BP4B 1IVLA 3UJIH 1RIHH 5T1KD 1IAIH 3BEVA 1IC4H 2X4TA 3HE6A 2XV6B 3EGSB 1BIIB 2Q7YA 3MRPA 5DRNB 1JZ6A 1JNNL 5AUMA 1UC6A 4U6VL 3BDXA 4O51B 3K4DA 5BJTB 3QUXA 3OF6D 2H1PH 1XGQA 4C55A 3ROOB 5AD0B 2AXGB 3B9KA 3L7EB 1FSKB 2HJFA 4YBQD 3X11A 1PW3A 3RBGA 3FCTB 4IEFB 1N6QH 1ZLSL 4HT1H 4Z77A 4P9HL 1Y6NR 2K7PA 4G6JH 4ODUB 4OI7A 4XHJD 5GZND 3CSGA 3LN5B 2E27L 1UB5B 5I1LA 1N8ZB 4D3CL 1DBJH 1MFCH 3U83A 5JORA 4OKDA 4L8DB 3EZJB 5SX4I 5EU5B 2C1PA 5J1AB 5D6DC 1XIWA 2OLDA 4KTDH 3BZFB 2OL3B 1FV1B 3DX6B 3RUGB 5EU6D 2EEDA 1RHHA 2E6PA 3PGDA 5EZIL 2R29L 2JIXA 1RUKH 5HHOB 5CBAA 4EBQH 4H25B 5F21B 4E5XA 3V5DA 4F37K 2PYFB 4PLJD 2OJZH 4GG6F 2OXHA 1F3JA 5FF6B 4P59L 5GGVL 2ADFH 2KUTA 2FJFA 5LKNA 2I60H 2ILLA 5CJOL 3D39A 1JGEB 2X70A 1SJEA 1F6FB 1WAAF 3VWJA 4W6YB 1R5WB 5F7YC 4NHUA 4PV9B 3V6OC 4ZUUA 1YPZB 1BREA 1P6FA 3GJEA 3MX0A 4UV7L 4XP5H 4Z76B 1CL7I 2DICA 3U4EA 1CXLA 3SE8L 1EZVY 2CXKA 5EO1B 5JLZB 3MOBH 4HPOL 5KOVC 3QXUA 3O2DL 4L4TE 4AMKL 3Q6FB 2N7AA 5IEKB 1P5UA 3IU4H 2PO6C 2E5EA 1R3LA 3WUWG 3WV0A 1R3HB 5JW3H 2ARJA 2V9RA 5DYOA 3BGMB 1JBJA 4OZGA 4Y2DD 4FZEH 4XVJL 3B43A 1EHXA 5BRZE 2VXTH 4NBXB 1W72L 2VL5A 2R9HC 2XTJB 1MHEA 5IB5B 1MREL 4YXKH 4OBRA 4HIJB 4OCXH 5C6WH 4G8GA 2AVGA 5T3XH 4OKVB 3I2CH 5IVZB 2X4PA 3E0GA 3CSBA 2HJKB 4WI3A 4WWID 1FNSL 1SJHB 4FQQB 4NQDB 3U9UA 2OP4L 4GLRH 4LU5H 3EJYD 4N1EA 5EBGA 3HZKA 3RY6A 5CIPB 3Q6FA 3BIKB 4BZ2H 1CD8A 3NACH 3HLAB 2PF6A 1MCRA 5HHOE 3SKNA 1XGUB 1BQHA 5D72L 1F8TH 1OAQL 4WNQA 1G7MB 5DMKB 4QRQB 1YEIL 5D2NC 4EN3D 4OV6F 5K59E 4YHNA 2J5LB 2V2XB 5ALCL 3OAZH 4WFFD 1D5ZB 4YHOL 5TDNB 1N7ML 2KQNA 4CW1B 1WQVT 4N90E 4NWTH 4Q6IC 2BY3A 4GRMB 4LVNC 3SJVD 2VDLH 1IJ9A 1YNKL 32C2B 4K71B 5BZDB 4G9FD 1FC1A 1HWGB 3L6FA 1AR1C 4QF1A 3DJ9A 5A16B 1RV6X 3KPTA 3N9GL 5DUML 4MCYA 7FABL 1MFDH 3RKPA 3VXRD 5FM5M 2VB5A 2VL4A 3SDYL 4M7KL 5JHLH 4LLDA 1ORQB 3D85D 5DJCB 2A9MH 2F5AH 3UJTH 5DC9B 4JDTH 5DJ6B 4EN3B 3BH8B 2FH6A 3T3PF 4N8CL 3DXAB 4XWGL 4XNQB 2VZ1A 2V2XA 2X4UB 3I9GL 1VFUA 3O0RH 2FO1A 4CNIB 2OTPA 1A3LH 2Z92B 4UT9H 4U1LA 1MH5A 3VH8A 1S7WB 2VWEC 4ZNCD 4RWHA 4C83B 5GRJL 2IBZY 4KK9C 1LEIA 4X6FA 1QSEA 12E8H 4MD5B 5AYUH 3WS3B 2EEAA 3VI3E 3LKOB 4G8GD 5I18H 1KTDA 4WCYH 4NO3B 3OGCB 3QUKA 4V2CB 2ID5A 1U8QB 3WDHA 3VGHA 2YA0A 3B9DA 1T1XB 5FHAH 4PGBA 2E7LA 3B2VH 3UTSA 2V17L 1X5KA 5IB5A 3FL7A 4NZDA 2OM5A 4RFOL 2PW1A 3BGMA 5BV7C 3NIGE 4AZ8A 5DA4A 2X4QB 4NDMA 3VXUA 1FRGL 2LV4A 5IROA 4JKKA 1NDGA 5DYOB 3K8KA 3TBTA 1D6EB 2IALA 1FZMB 4KK6D 4PB0H 1QSEB 4KGLA 3BT2L 1YPZF 2HTKD 1CXIA 2Z8RA 5E2VL 5I16A 4PPTA 5L9DL 1TJIH 3D39E 1U8PB 4QXTA 2NYYD 4OLVL 1CGTA 1T4KB 4JFYA 1Z0MA 2J5LC 3V8OA 3LKPB 1WTGT 3MODL 4JZJC 4UIMA 5GRUL 1S5HB 5DSCA 4KY1L 4NN7B 2H8PB 4ZUTB 1JNLH 4XMPL 1FZKB 3DXAD 5DR5H 2WWMC 1HCFX 3HC0B 1KB5A 2XQBL 4OCYL 1I9JH 3KWWB 5B4MD 4M6ML 2E7HA 3DLQR 4JPIB 1EVTC 2NY3D 4M00A 2DM7A 2J4WH 2Y07H 3ZTJH 2QR0A 3WHXA 3MJ8A 5B4MC 2XWBB 4YK4B 3NPZB 4GXVH 4EDXA 3VFPB 3KPRA 1B88A 1CBVL 4LCUA 5I1DA 4ZFFB 1MJ8L 3LS5H 1FL6B 2DQJL 4ZUWA 2QQLH 3ES6A 3EYFB 3RWCB 3EYSH 3MV11 3U7WH 3VXMB 4GW4A 1TPXC 3LKRA 2EDDA 1T7XA 3L3KB 3H9SD 2H9GA 3I6GA 1C08A 3ARSA 4Y16D 1IAOB 4KPHL 3B9AA 4PLKC 1QRNB 2AGJL 5C0EB 3X11B 1QSEE 3CZJA 3IAGC 3BQUC 3V6OA 3BXNA 3ELAT 2GJ6D 3L3DB 2GJ6E 3EYVA 3O45B 2YKLH 3CPLB 1MEXH 3BPCA 3MXWH 4X5XA 3OHXA 3RPIB 3T0AA 3LQZA 4UAOC 1EEQA 2PXYB 1ULVA 1D9KB 1P9MA 3KYAA 1CLOL 5E8OA 1YMHB 3GJFH 4KAQL 3GB7A 4HHAB 4X7SH 1FDLH 2D31B 3WLBB 2NY4C 4JANB 5GGTL 5I1IL 1XR8B 5J9PA 5I2IA 4KMTL 3T8XA 1N0XL 2XRAH 3LHPH 4IIQB 3VJ6A 1CFTB 1RUMH 3SE3C 3MJGX 3H2WA 5BOPA 3KYNB 5BXFA 4QHMB 3ARFD 2Z8WC 5FEBA 5E4EC 2RCSL 1UH3A 3BO8B 2HVJB 3IDNA 5DRWB 1VFAB 3ARBB 3PGFL 4YDVB 5TF1H 4PRPA 4TRPL 3PUCA 1MCQA 3FN0H 3UTTD 1CFQB 3LKSB 1GH7A 1BQUA 3ILQC 4ZSOE 3TBVB 5D71H 4APQA 3QNYA 1XH3B 3UPRA 3P4MB 4NWUH 1DVFB 4MNQE 5CEXA 5EWIH 1JF1B 3KDMB 4JDVA 4JREC 1U3HA 1G1YA 3WBDA 1NCWH 3KXFD 5E00A 2W91A 5HHOA 2W07A 3DHJA 3ARDA 4Y19D 2HMID 2E27H 1INEH 1BVKA 1BQLL 4YZFF 4H8WC 3VFTA 5LBSH 1MCWW 2XZQL 5GIRB 3ARGD 4WEBH 3OGOE 3VFSB 4E41A 5E1AA 5F44A 4ZXBD 3QXTA 4FXGB 3D25A 4GRLC 4DUVA 3GSWB 5EOQL 4X6BA 1D5MB 3WJLC 1JGUL 1WWWX 1DE4B 4KUZH 1Q9LA 2DQFA 4TNWF 1VSCA 4M6AA 5AZ2L 5LCVH 4U33A 3CX2A 4ZS6C 1YY9D 2XZZA 4EJ1C 1S7RA 5H2BA 2ATKA 2OS7A 3DURB 4LP5A 2NY1B 3O6FA 3BUYA 5C0EA 2PR4H 5F96H 3ULUD 3L5WA 4GW4B 3RTQD 3TJHD 5JQHC 43C9A 3L3KA 1SHMA 4NKMA 3MZTA 4ODHH 5AUMB 1JYNA 2PYEE 2CDGB 1OPGL 2PYED 1J8HD 2P7TA 2C7UA 1NDMA 4X5WB 4Z9KB 1G7QB 3TNMB 4LLDB 4RRPG 1OTUD 1VEOA 2HWZH 1AH1A 3OAUH 4XXDB 3BRFA 3AXLB 3WNMA 5SWZE 3KPNB 2PXYA 3FQTB 1L9NA 1EZVX 3TH3T 2V6HA 2HT4C 2ZNWA 2PW2A 1KPRB 2BP3A 5FYKD 1K6QL 4APQC 4PP1C 3EYVB 1TIUA 1N64L 3LV3B 4JN1H 1CFSA 3ARTA 4GQPH 1A6VH 4XP6L 2Q7NA 2HT4D 5F7EL 3RWFB 4JRXB 1URLA 3C6LC 3NFNA 4G3YL 1KELH 4XBPA 3UJJH 4GAFB 1CE6B 2CLRA 4HWEH 5DXWA 1OD9A 2EC9U 4ZD3L 2P24B 2DQTL 3V5HB 6CGTA 1OM3L 4EVNB 1I7TB 3HCVA 4XVTL 2L7UA 4HC1L 3MLXL 3Q0HA 2AABH 1BX2A 4C59B 1S7SB 3SBWC 1QR1B 2PNDA 4YLQT 1M7XA 1WIOA 2AEQL 3H9ZA 4HX1A 4R2GC 5DZOA 3H9HA 4HLZH 3OJVC 1INDL 1BJMA 1X4XA 2BSSB 3SJVE 5F7DB 4YHZH 4JPIA 2IPTH 5F9WC 4X9BA 1HH6B 3VXOB 1EEZA 3IXAA 5EU7C 3H0TB 3SO3C 1M1SA 2ZUSA 3D1MC 3IJSA 4R2GD 4O00A 5TQ0H 4WFED 3V2AR 3PL6D 3IDGB 5DZLA 4K07A 4OFIA 5EZJB 3LKNA 5SX5K 5HYJE 1FZKA 3C60A 3BGAA 2WK2A 2XQBH 2EXWD 3TH2T 5FGSA 5SV4A 1MAMH 3HHRB 4N1HB 4YEFA 4OZHA 3LIZH 1UWEH 3BGFB 5I8OH 3N1MC 5HGHB 5KOMC 2J4WL 2W59A 2XT1B 5KS9B 4ACPA 2NY6B 3EHBC 4U1GB 3LQAH 4OD1L 3G6DL 4YGVB 4JFPB 3UTSD 4D0BA 4MCZB 3HB3D 1PKOA 5DVKA 5HDQH 1RFDL 4HIEA 1NFDB 5IW1B 1GZQA 5BRZA 1MJJA 2XFXA 3BYYA 4S1DC 3A67H 2APXA 1ZMYA 3SGEH 2VQUA 3CUPA 2BFVL 4N9OB 3H3KA 1TENA 3ZT5A 3RFZC 1EEYA 1U2HA 2GAZA 3OB0H 5T5FH 2G5BA 4ZTOH 1P5VA 3OZ9L 3MLPA 3AVEA 4RZCB 1YYML 1UG9A 1XCTA 1BOGA 4DGYL 4F7CA 4RGMB 2OQJA 3WNNA 3HC0A 1MCLA 4O58L 5CBEB 2VLMD 5A2JH 4OLWL 4W81A 4ZSOB 5K9JH 1JI1A 2QSCH 3SE8H 3LN4B 5AAMA 4P2RE 3RJQB 1DQLH 2IEPA 4TULH 3RU8L 1GJIA 3MRFB 3AAZB 4XVSH 3EDEA 3MV8E 2ADIA 2CUMA 5A2FA 1X4ZA 3MRIB 3ARVA 1LK2B 4WTZG 1ZLWK 5IEHB 4HAFA 2AI0H 3K3QA 5DURB 1AHWB 1E4XH 1EO7A 4P4RA 4RGOL 3MV9A 1OOAA 1UXSB 1DQQB 4OLUH 4R96A 1J88A 1B4JH 5GGQH 4BZYA 1DCLA 5DRXA 5DJ6A 2PN5A 1I7UA 4D0DA 1FE8L 2W9DH 4HFUL 1NCNA 1EHAA 4ISVB 4Z7WA 1FZOA 1E4KC 1OAZH 2UVFA 5JPNA 4YXHL 2Y36L 2WZPD 1MFBH 4LU5L 4ODBD 4XBGA 1ES0A 5BS0E 3K80A 3MLWH 1C16A 5C2BL 5IJKC 4JGJA 3MXWL 5F7DA 4HZLA 4AEHH 1CLZH 1HSBA 1ZS8A 3N85L 4PRBA 5DLML 4NO3A 3LEXB 5IWLA 2VLRA 1S7QB 3TP4A 3ULVF 3FMGL 3QRGL 1SEBB 2A1WH 3FTGA 3MV8D 1A21A 1MCNA 1T2XA 1INQB 2D7OA 3NIGF 1P69B 4R4NC 3G5ZA 4WFHD 3MRDB 2HKHL 4ZDHA 4HS6A 1VFMA 2NY7L 4NWTL 3HUJF 3EO9L 4JQIL 5TPWH 1DR9A 3QFJA 4W70A 4AEIL 1LO0H 4LVNB 1YNKH 1YMME 3SKMB 1A3QA 4NKQB 2EECA 2VQTA 5CZKA 4OZHB 3VFWB 3T0EA 4AH2A 1IC4L 4PJGE 3P11H 3QDJA 3TCXA 4MMXC 3AMLA 1YJDL 4ETQB 4HV8A 1V7ML 5HYSA 4Y5XA 4Q2ZA 1DE4A 3QI9C 4KHTL 4WW2C 5CJOH 3MV8A 4NUJA 5GGRY 4Z7OE 5L88L 3FT3A 4XWGH 4B53A 2CSPA 2VDNH 5JOPE 2JJUA 3AXLA 2G60L 4X8XA 3RVWC 4AENB 1QBLL 3PWLB 4WO4D 3IDXL 4Y16C 5IKCB 2R2EA 5I74B 4P46C 1A02N 1HHHA 4PLKD 4RNRA 3SE9L 3CZFB 1JFQH 5CEZH 1K3ZA 1EV2E 5DEGB 5C0CA 3RGVD 4D0CB 3BQUD 3O3DA 1X7QB 4X7SL 3M45A 2CDGA 3MV9B 1FYTA 4ODUA 4RA0C 3VE0B 3DSFH 5HTSA 4XH2A 3HG1E 3OX8A 1UADC 1FL3B 1NL0L 3GM8A 3C09C 1FG2B 3MUZ1 4NZUL 4E5XB 3UJJL 4P59H 3HE6B 4XC1L 5D71L 5FHBL 3PF2A 4I2XB 4CKVX 1G0DA 1KBGH 4GAYB 1Q9LB 2DQFB 2H2SD 3PQYB 3K0WA 3PGDB 4XWOD 1DQML 5J9PB 3KYMA 1KCRL 3GIZH 2GI7A 3VD9A 3BUTA 3MRRB 3FRPG 5JW4M 3KS0J 3NOIA 3F7PC 4JM2A 2VXQL 4J7RA 5IV2A 4KXZI 2P8LA 4HUUA 3C8DA 2DBLL 3P0YH 2D03L 3OR7B 2R4SH 2BX5A 3IKCB 3QFDA 4FXKA 1E6OH 4MD4B 3ESUF 4PRDB 43C9B 1LO2H 2CDFB 5FO9A 4OF5A 3DVFA 4EIZC 5IBLD 4KY1H 1VPOL 3BIBX 5EA0L 1GGCH 1X9QA 2WWKT 1WBYB 5CGYD 3QA3B 5I0ZA 5D7LE 1NBQA 4OCYH 3T0VA 3GK8H 4FFWD 4F3FB 3CVHA 3QO1A 3G6JA 4WIQA 1JGEA 2X70B 4RGND 2BNQD 5EOCJ 4NKDB 1U58B 3AREA 2O5XL 3MV9E 4I77L 4D9RE 1T04A 3FQRA 4CDHA 2NQCA 1N3NB 5J1SC 1DSFL 4M6NL 3D3VE 2PYFA 5EBMB 1PD6A 4S1SL 2QADB 3CZFA 1KN4L 2HFGL 2J8OA 1T2JA 1GZPB 4OBSA 4KKBC 2IGFH 2NW2B 4E41B 4KZDH 5E94B 2HLFC 3D25B 1J8HE 4Z7WE 3X17A 4YJZL 2FSEA 4BH8B 3K74B 1N0LA 3UEZA 3H9HB 1JGVH 2FSEB 3GSRA 3EOBB 5BOZG 5ICYB 5J13B 5L6YH 5C0RH 5C07A 5L7XH 1ZHLB 2Y5TA 4JFEA 1D5IL 4MJ5B 1KJMB 2YSSB 4PRIB 2EDTA 5DFVD 1QLEL 2W60B 1OW0C 2Y36H 3KPMA 1C5BL 2P45B 3FQRB 2NW3B 1ZWIA 3GSQB 4GKZA 4K3HA 5KVDL 1CICA 3LKPA 3R06A 2F8OA 2V9QA 1AXSA 3IYLW 4OGAD 4JHAL 4NKOB 4J4PC 2F8VA 3QDGA 2LU3A 4X98A 1B9ZA 1ZHBA 2DWDA 2IADA 3STLB 4TQEL 1T1ZB 4MXWH 1OCWH 3BAEL 4RFEA 4QHMA 3CFEB 2NXZD 3STZA 5KZCB 1CGYA 1CBVH 5EC1A 2ZOLB 3JV5A 3THMH 1KENH 5IB1B 4U1SA 3VFPA 3BHBA 4JQIH 3QBTB 5J4MA 3HE6C 5I1CL 1ETZB 4HS3B 2R23B 5EUKA 2LABA 4CU7A 4FG6D 1MI5A 1IGFL 3F65A 3DVGA 1RULH 3H6JA 4Z7WB 4QLRA 5GRUH 3OGCA 4K2UL 4RMWA 4JQVC 1T1ZA 3JVGC 1FGNL 3NAAL 1BGXH 4KRLB 3PGCB 5AG8A 1MEXL 4N5ED 5T1MA 1WCBB 5AYQA 4LBEB 4FQPA 5IR1A 1JWUB 1QO3B 3L3GA 1ZOXA 1XGRA 3GO1L 3DYMA 5IEHA 4PJBB 1NANH 4LCWA 1UACH 2YWYA 2E7BA 4PJ5A 5K9KB 3QUYC 3VCLB 5BS0A 4OZFA 4DN3H 5SX5H 4RMTA 3WFHA 1HK6A 3LMJL 1Z2KA 4IS6A 1FZMA 4M62L 2Q3ZA 3RNKA 4DQOH 4Q74A 3MGOA 4DKFL 5JQ6H 3MUGB 1PG7L 3V52L 3KLAB 3MREB 3QPXH 4U6TA 5F1NA 4DK3A 2R39A 1OP3K 4XBEH 3S36X 3VGEA 3SDAD 3EOAB 4Y16B 3A6OA 1F4YL 5E00B 3QIBC 4ZXBA 1RURL 2E7MA 5FA3A 1N2RB 2VQ1A 1KCVH 4J3SA 1TTGA 1IL1B 2BMKB 2VZVA 3V5KA 4C58B 4WWKD 3RDTB 2MJWA 1TQCB 1YYMH 5D1ZC 15C8L 4C56B 2VABA 4NQEE 4IOFD 1KV3A 2QKIB 1T4KA 4UQ2B 4Y1AD 3UTTE 1HHIB 1OAKL 1NC4B 2ESVE 4QRRE 4QCIA 1AGFA 4X6EA 1BQHB 4U0QB 4BQCA 1OT1A 2FJGA 1WV7T 1TCMA 1YEDA 4FA8A 1YECL 3SDCA 4Z0XA 4YHPB 3GGWA 3UTTA 3U7YH 4OCRL 4HS8L 3E3QC 3SE3A 1HXMA 1NGZB 5HPMA 2DM2A 4MS8D 3G04B 3KYMB 4HQQH 4OUOA 1PZ5A 2VDPL 3GHBH 3VI4E 1DBBH 1TZHB 1NEZB 5E1HB 2XWTB 1HYSD 4WDIA 4PRAA 1IEAB 5C0CD 3MNVA 4UNUA 1DBKL 1XT5A 2AK4D 2R2HB 1T83C 3C08H 1H3UA 3V0WH 4N0FB 1FFQA 2BDNH 1MHCB 3VI4F 3T04D 5F97E 1Q9WA 1T2QH 4IOIB 3U36A 4Z8FL 4BM7A 4FFVC 5C8JA 3X3GH 3O9WA 1F6LL 4RGNE 2EZ0C 5L7XL 1KACB 1X7QA 3U1SH 3G6AA 3HMWH 1IM9A 4XPGL 5CCKH 4P5MB 2V7HA 4CVZA 1YUHB 5EOCH 5GSVB 5HJ3B 1KPRA 2ATPB 1I1FA 2HT3C 4XAKD 4NP4H 4PJIE 2WBJD 3CSPA 1U8OA 3HUJE 4P2QA 5A16A 1NJ9A 4YDLC 5BMFH 1MQKH 2FIRT 3QXDA 1KYOJ 1FVCB 1P6AB 4OM1H 2AAVA 5HHNA 4UUJB 1F4XL 4PJHA 2E9JA 4JRXD 4YWGL 2XI9A 1IGTB 1SYSB 1MJJB 2QHRL 1QFPA 3I75B 4ZS7L 4G7VL 1TZGH 4RMRA 2F15A 3T0DA 2JTDA 4N8VA 2DQCH 1X44A 1PDKA 4WJ5A 4YX2L 2EDLA 4P99A 1FCGA 2FEDC 3DIFA 4H20L 3A67L 4H8WH 4YFLI 4OLYH 3FKUS 4XPTH 3PWNB 4X98B 4P4KC 1G7MA 3ZYZA 1Z9OA 2QADD 5KS9A 3TN0B 2CH8A 1H3PH 2X05A 1FNHA 4KZEL 3QUXB 5MI0B 5JA9A 1U3YA 4KXZH 4P4KD 3NAAH 1N64H 1UVQB 3K2UH 5CJXA 3G5YA 1HHKB 1UM4H 1A6WL 4HXBL 4JFEB 4L3AA 4MJ5A 2DQUH 2EDRA 4FTVB 5IP4A 4LQFL 4FTVA 4FXGA 3IDIA 5C3LD 2C4FT 5GIRA 1NGZA 4LSSL 3VXPA 1G0YR 1I1AC 1QA9A 5DUBB 1UACL 3QDJD 3GIVA 4OD1H 1OARH 1ONQA 2VDML 3VXNA 2B4CL 3MC0A 3QI9A 5GS0L 2B7DT 3HE7D 1IGJB 1MFEL 5BW7C 3PHOA 4XI5C 1KENL 3QEHB 2WMPA 4XTRC 4LSDA 3KDMA 2OJEB 5D7SL 5H37G 4CU6A 5F6HI 2GITB 1UB5A 1BF2A 3MFFA 1L7IH 4CNIA 3QDGB 4XTRD 5ESAB 5EN2B 2H2SC 3MRFA 3G5VA 3QQ4B 4MA7L 1JMZA 3BJLA 3O3BB 4U6YB 5T33H 5KSBF 1IKNC 3ULVH 1S9KC 1CN4A 4LASH 2HJLB 3T2OA 4L9LC 4DUWA 4XAWH 3C5SB 4XP4H 1JYXA 4YH6A 4XC3L 1ZHLA 4HCRA 1NPUA 5TF0A 1RHHB 1JCKA 4OF3A 1KCSL 2EIEA 5TE7H 1MWAB 2Y4SA 3FQWA 3B2UC 4CDGC 4S1RH 2GYSA 3BP7A 3D85A 3PXJA 4KJYB 1DDHA 4AIOA 3KPSB 4ZUVA 4PJ5E 1YUHA 2QQKH 2EDWA 3MRGA 1A5FL 4G8FB 3KJ4C 2CUIA 2N7BA 3T3MF 2ZOLA 5HYFA 3LRSA 1G7IB 3DROB 2NZ9D 1AGDB 2X4SA 1J5OH 5GJSL 5GJTL 5IMMA 4HWZB 2VLRD 5ISZA 3ZDZE 1HDMB 1X5XA 4G43A 5K9QI 4P4KA 4YAQB 4YDJB 1F00I 3TO4C 4Y5VC 1QLRB 2IBGA 3L3IA 4KK9D 4PJ7A 1S9YA 4K23L 3BP6A 2MCPL 1C08B 4R8WH 5E7FA 2F19H 3LEYL 1A1MB 1BJ1H 5L8JB 4OB5H 5IJVB 3U9UB 2EKJA 3HE7B 3ZDZF 1FFRA 4K7PH 1MIEL 2NX5B 5IHUH 3O3DB 3OMZA 4PD4K 4GUPA 5MEPA 3MMEB 4HFWA 3V6BR 3GSWA 5HHVH 2LQRA 1NBYA 1KIPA 3HZMB 3ZE2F 3IXAB 2CK2A 2DL9A 4OUUB 1CIUA 3GKWH 5ICYA 3LSOA 3BSZH 3HR5A 4BQ6A 3VFVA 3I02A 3Q3GB 4H1LG 3VFNA 4PJCB 4MSWB 3X3FL 3H9SB 3JZ7A 4HGWA 4HJJH 4WI9A 4RGOH 4AEIH 2F53D 1JMXA 4MAUH 5HYSB 2OL3H 3PE9A 4YQXH 5EIVA 1P4BH 5T3ZD 3FB6B 4HMEA 1GGYA 3O3BA 3ZT7A 1I3UA 1EXUA 2I07B 2SEBA 5GS1B 3MACH 4OCXL 1KGCD 1ZTXH 3O6LL 2XOTA 4NNPH 1JNNH 2XXCB 1J0ZA 4U1MA 1WSST 1T22A 1MCOH 1VDGA 4MNQA 3GMOB 5BQ7B 2Z93B 2I26N 1U8IB 3RUGF 4LPUA 1DUZB 3N0PB 5ESQA 4G7VH 1TZGL 5IB2A 2K9UA 1X5YA 3O4LE 5HDOA 3MLTB 5BRZD 2H2PC 4K94H 4U6HA 3D87B 2NY3C 4Y4FD 35C8L 3HZYA 4JY6A 4U3CA 2R4SL 1RIVH 4GXUM 4MWFA 1LO5A 1AFVL 3LOWA 3SDXA 4XPFL 1I1YB 2XZCL 4CUCA 4DVRH 4H1LH 4QT5B 1FFNB 3TNMA 3P2TA 4HGKC 2HRLA 1M71A 4YHOH 3JV6A 4Q6IA 5EC2A 1YA5A 4X7TB 1XIWC 1J0JA 1QNZH 2Y7QB 4Q58C 1LWRA 1VEPA 3TA3A 5EOCL 5EU4A 5DT1H 4RAUA 5D6CA 3G9VA 3W9DB 4A6YA 5EO9A 1N8ZA 1KCLA 5EZOH 2UUDH 1RUKL 3LEVL 1K85A 1OF2B 4QHLA 4U0RB 4TUOB 4XZUB 3BW9B 2EIBA 4PY7B 4X6FB 4QWWC 3MJ6A 4D9RD 3ULUE 3F58L 1X5JA 4Y19A 1UB6B 2BVUA 4Y89A 3UJTL 2ZG2A 5EUOB 1NCAL 1RZJC 2HVKB 4I4WB 4IDJH 4ODSL 3VRIB 5D2LA 5IGXL 3B8SA 3MBEC 1SJXA 4LVHC 2MCG1 1A3LL 4UT9L 3WFCH 4ZSOA 4PJAE 2APVA 3HRZA 3WHXB 3RX8A 3ARZA 4URTB 5KW9H 1FLTX 4G6AD 3HNTH 4KKCC 1CLYH 1NCCH 5TJWK 2VLJE 2F54B 3VWKA 5D7IA 3WO4B 3TV3L 1FNEB 4JHAH 1A7OL 4Q2ZB 3CFEA 4OFKA 5MP6H 2DJSA 3BZDA 3QCVH 2VXTL 1PKQA 3B2VL 3DGCR 3FQNA 1NC4D 1YEKL 4XP1L 4OZIA 2BOBB 2AV7A 3HC3L 5GISH 3FN3A 3DBXB 1ZT7A 3TYFA 4RDQG 3ZE0E 3MYZA 3R06B 4Y4FA 3VWJC 3BRGC 2FYYB 3B3IB 3HI1B 2OP4H 1GC1L 2BHZA 1HILA 3GIZL 2H32H 1FZJB 3T08A 4G9FB 3HLAA 4X4YA 3CFKB 4PV8B 3O6FC 1JPFA 1F90H 3BKCL 3C2AL 4Z0BL 3HPLB 4MNQD 1H8NA 3GZKA 3S36H 3HFML 1RY7B 4I3RL 5CUSL 4QTHA 3QI9B 5E8DH 5L9DH 1P2CB 1HN1A 5TE4L 4ZO8A 1HWHB 5DJDB 3HR5B 2K7QA 1NUFA 3HC4L 2CO6B 2XWJA 4QHUA 4DZ8A 1RVFL 1ZLUH 5AYUL 3IDIB 4FQHA 5F9JA 2CRIA 3PDDA 4GG8B 4X9FA 5DJ2B 3VXOA 5MEOB 3QEQA 3SGDH 2UY7A 3CH1A 1T0NB 1NGYA 4XP9H 1L0QA 2VDLL 4QYOB 1UCBL 5GQBA 3G5YB 3BPCB 2AEIT 1UM4L 4TQEH 3SO3B 2EZ0D 5F9WB 5ADOL 3FB8B 1CK0H 5J1TC 3LKQA 3HZVA 3NCYP 4P0DA 1Q1JL 4AMKH 1IGYA 3W11C 3GBNH 4IMLA 1I3GL 4PRPD 4LVOB 1U8KA 1I8KB 1ZHKB 2A38A 4JZJA 3VMOA 5J6GB 3MCLH 3QEGH 5CFHA 1FO0B 3MRIA 2YRLA 1KSRA 3E8UH 1P7QD 3DXAA 5F8QC 4F9PA 1QFUL 4NO0D 1VENA 4JFFB 5BZWB 3R0NA 1GAFH 4JO4H 4D9LL 1MF2H 4YO0B 1ED3B 3WN5B 3ZDYF 4HK0B 5KSAC 3JWOC 1WZKA 5T3XL 4ZO9A 4PJ8D 3WNKA 1BFVH 4NN5B 3ZDXF 1CFNA 4PJEF 4G9FE 4WFGE 2F19L 1QQDA 2XY2A 2Z9TA 2XKNB 3MJ7B 3MRJA 4ZYKB 5CGMA 3NPSC 2OR9L 2EIZB 2X4OA 2FEDD 5DR5L 2FIKB 1E27B 5FM4A 5I8CA 2VLME 5C0IA 4M4RA 2GSGA 4YR6B 1UKQA 3HRZB 1V3LA 3GI8H 4BFGA 5IHUL 1P9MC 5EU3A 1RZ7L 1LO4L 4BZ1H 3HNSL 3C6LD 5ENWA 1A7PL 4M6NH 4WV1A 4OFPA 3DNKA 1ZKAA 3S98A 1J0IA 4MB3A 4HIHB 1QSZA 3MOQA 4GSDL 3HI5L 1AY1L 3UTSE 5IVXE 1A2YB 1MCKA 2VE6B 2EO1A 3D3VA 1XF2B 2YEZB 3WUWB 1U6AL 3JVGA 3DXAE 1MHCA 4LQ1A 4HUNB 3PNWB 2BSED 2ZUQB 4LLVA 3MRQA 3O6FB 5ID0B 4K3EH 1KFAL 4HCRH 1AIFA 3DWTA 4KI5D 3MRHB 3EYOA 1QACA 2R1WB 4C4KT 1NKRA 2HLAA 4M7LT 1R24A 5DJ0A 3ABZA 3IJYB 3FB5A 3FFDB 3RJDA 1C5BH 1SY6A 2H1PL 4BYHA 1U93A 1J1PH 1K8IA 1D5MA 3NIFF 5HVHB 4P57A 3G04A 1GIGL 4WHDA 4OT1H 4NZTH 1HXMB 2OI9C 5HPMB 2DMBA 1NSNH 3VFTB 3L3OB 4BUHA 4PRNB 1KIRB 4L29B 4WGWB 4FHBD 3OKOA 2IFFL 1Q0XH 2P7TB 5DK0B 1JPSL 2P1YA 1L4IA 2KZWA 3HUJA 4P2QE 3F12A 4U4BA 2VR5A 1PQZA 4I5BB 3BGFC 2FX7H 4RFEB 2QQNH 2FGWL 1AGFB 5IBUG 2XZCH 4CN6A 2ICWB 4KMTH 2Z0BA 3QJFA 5D93C 1NEZG 5KANI 3T0XA 5E6ID 4PV9A 4KJPC 4PRHB 1OWRM 1PLGL 5EU6B 2Q6WB 2IMNA 3FB8A 4JRYB 1CICB 1F5WA 4OCWL 3VG9C 4JFHE 1Q72H 3QIUC 1AO7B 3U30C 5T1DH 5E6IC 1ORQA 1FYTD 3KHQA 1CFSB 3MROA 1FYTE 4GQ9L 4BJLA 1MVUB 1KJMA 3CX5J 2J8HA 1U36A 4M7ZB 5L2JA 3MV7E 2Z91A 2OZ4A 3WLWC 3IFNH 3ARED 5KBNC 2BCKB 4GO6B 3PQYD 3RKDC 5KAQG 3ZKXB 2XACC 3NMEA 5E56A 1AD9A 4OM0L 1KIUA 3QXAA 5E8PB 43CAA 2AKRA 4CVZB 4YXLL 3UCRA 4O2CA 5KSUA 4MNGA 5DMYA 3O2DH 4FQJH 3RKDD 3QQ3B 1OSZA 1UXSA 2YD7A 1S7VA 4PUBH 1J86A 5TE4H 1IKNA 4PJFF 2IPTL 3LHPL 1JWUA 3L3GB 3WD5L 4D8PB 1QYGL 1R5IB 2AJSH 4JREB 5DD1H 5HYSG 2GUOB 4FNLL 1E28B 4HUMB 5TQ0L 2YPLE 1R5VA 2YPLD 1A7RH 1KT2B 1IQWL 1CWVA 1YEEH 1F2QA 4PGEA 5ICZB 3C8KB 1HI6A 3DX7A 3T65A 1WC7A 1RMFL 3LZFL 2HN7B 1REIA 3QPQD 1HYRC 1NAML 3L5JA 4UT7L 4QRRA 3SCMB 3RWJB 4DGIH 1KCVL 4RBPH 1GGBL 2R8SL 4LSVL 4YHIB 4ZUSB 5JOPD 4YFLF 4OTXL 3D0VB 3RL1B 3I6LD 4JRYE 2X1XR 1WJ3A 2HG5A 4F7TA 4Y5YA 4EZMA 1P84J 5FYKE 1X5LA 1A6TA 3PWVA 1B0GA 5FGBC 1DBAL 4RQQB 1FGVL 4W4OA 3RVXD 4F57H 1UM6H 1WUNT 5BCAA 4DWHA 1QHOA 4JG1H 1MF2L 3ETBF 3RUGE 5LGJA 3CFKA 5KW9L 3AS2A 2NPLX 2P8PB 1BFVL 2HN7A 4LSPL 4I0PB 4YGVA 1CGUA 4YUEH 1QFWL 2Y1VA 3VGAB 5KSBA 4M61A 1T22B 3BPOB 2BERA 2H2PD 5F88B 2ARWA 1QOKA 4JFDD 4RCAA 3JTTB 5MP6L 2V17H 2R56H 1M7IB 4ZNEE 4L8SA 1ZAGA 2HFFA 4NRYA 1UCTA 1QBML 1NLBH 4FZ8H 3SJVA 1QRKA 4TULL 1FDLL 3DRQA 4N90D 1NGYB 5EFIA 4ZUWB 3HC3H 4FP8H 3JWDC 1HHHB 4RNRB 5CZVL 2HTLD 3TPUB 1S7TA 4M7ZC 4KDTC 4N5UA 1H0DB 3D2UB 4GW5A 3I9GH 4Z7OF 1OTTC 4GW5B 1BLNB 1G9EA 1OLZA 3LDBC 4JPVH 4AG4H 4U1JB 1BF8A 5DO2C 1T1WA 3CLFL 1CFVL 2X9XA 1CXHA 2OI9B 4OQTH 4S1QH 5IVXB 2LAAA 4OF7A 1RJZA 1DUZA 5ESQB 5IB2B 4ZFOL 2A6KA 5E2TL 5HHQA 3CXDL 4X5XB 2MQCA 4NT6A 4PJ9D 1CU4H 5I1LB 2J6EH 2XTJE 2C3XA 1BVLB 5ILTL 5FECA 4OD3L 1A7QH 2FHFA 1UB6A 3GJFB 5E8NA 5F1KC 1WBYA 2EDQA 5IOPB 3ME0A 4HXBH 1BPVA 4F3FA 4PJ8A 1KJ2L 1NEUA 1LE5A 5CWSB 1ZT1A 1A14L 4PLNC 1EFXD 1KULA 3VA6A 4JPKH 3L3JA 2IG2H 1F3RB 3Q48A 4RAUB 4HWZA 2F5AL 3GSUB 1P7QA 2CKBA 2F74A 2EH7L 4U7SA 4PJAA 1BM3H 2CMRH 4YNYB 4P5TD 1SYSA 1OGTA 3MA7A 2Q3AA 3VRJB 4M93B 3SGDI 3TIDA 1IMHC 1GRWA 1BFSA 1N59B 3BDYH 5JXEA 3E8UL 3CFBB 2D4FA 4OQ1A 5GGUB 2XY1A 4I0PD 3LQZB 2E6JA 5HJ3A 5EIIA 3P11L 2ZPKH 4PJDE 3S7GA 4GQ9H 4EDWL 4WUUB 2WWKO 4DK6A 5CGYC 5MEND 4IRZL 5F1IA 2VLRE 3QWRA 5ADPL 2R2CA 4GBXB 2X1PA 1O0VA 4AEHL 1MWAH 1YY9C 3MRNB 4KAQH 1T6VN 3RWCA 2BJMH 3SE9H 1QSFB 1UWEL 3SKNB 5DEGA 5D1XD 1AKJD 1VGKB 4WFGD 5I30H 3SGKC 2Y5TB 3PABB 1WWBX 3PHOB 1YN7A 4UAOB 5GHWH 4PB9H 3TJEL 4MX7A 1TMCB 1RU9L 2ZSVA 2HLFD 2XWBA 4N0RA 5CD3B 1ZVYA 2FX8H 3UYPA 1K6QH 1EGJA 5EULV 5EOTA 1NGXB 3WEXA 1RZGA 4HIJA 1B4JL 2YBRA 1HINL 4PR5B 4U6HB 4UDUA 4JHZA 4LHJB 1RJCA 5FUZH 5CMAB 1X6LA 1A47A 4I18B 3SKOA 3SJVB 1WIUA 5C07D 4Q7DA 2FECL 3OKMA 3GGWB 1XF4A 3UAJC 4HBCL 1AGBB 3TPKA 3IFNL 5KJRL 3DETD 1U8HA 3S96B 2G2RB 2B1AL 2ARJQ 5ICXB 5E99H 1BEYH 5JDSB 1NUDA 3CU1A 5KVEL 1YEGH 2R1XA 3WIFB 1EO8H 1ZGLM 3HNTL 3IKCA 3QFDB 3WIIL 3QNXB 4HWUA 3DX9B 2XRAL 3HI5H 1A22B 5EOQH 3DROA 4HUUB 2CKBH 3D39B 3KYKH 4TSCL 1JHLH 3HR6A 4HIXL 3STBA 1UENA 4MA1C 4NQDD 4LSPH 1U6AH 1ZVHA 4NSKA 3QUZA 4MAYA 3O4LD 2VR4A 1QUNA 1OQOA 1VPOH 4M1CC 2H3NB 2RCSH 5DEFB 3S5LG 1CGSL 1EEUA 4LCYA 1ZK9A 1IM3A 3ARDC 3FZUC 1CT8B 3PIQA 4HD9A 3LDBB 4G3YH 4J3XA 3MGOB 5L2KD 3MRBA 1I1FB 2Z31D 2VXVH 1RQ5A 3BD3A 4E41D 2WUCL 5KSVB 1MIML 3MRLB 2Z31B 1S8DA 4JY5L 4U1KB 4ZPTB 1S7SA 4OTXH 3ARDD 5I1KL 4R96B 2WQRA 5E2JA 3MXVL 1R0AH 2FDBP 2OTUA 3B6SA 4GFTB 2GTWB 1OP3H 1CDHA 2IH1B 1IARB 2E3VA 2JCCE 2IFFH 3AY4C 1TTUA 3SY0B 1ZT7B 2VXQH 3TYFB 3QH3B 1YPZA 1KJ3H 4DZBA 1FYHB 3WL9B 4H1LB 1S9XA 1CICC 1JV5B 3VD4A 4QXGH 1OGAE 4ZFFA 3MRGB 3JV4B 5FV1L 1TVHB 1BFOA 1S9VB 2EO9A 4OGZA 4H26B 2VLJD 3MRPB 2EH8L 3QWQB 2YD6A 3PP4H 4P5TA 3TZVA 4F7MB 2EYTA 5C0AA 1CK0L 1N5AA 4X4ME 4QOKB 4HJ0C 4LIQL 1NC2A 3E6HA 4D9QD 5B39A 1YZZA 4WI5A 4CW1A 4ZAKB 1EGJL 3AS0A 3HS0B 5HVHC 4JFFA 4J8RA 1NCAH 4Y4HC 5EC1B 4PG9B 4F58L 4HC1H 2IGFL 1LD9A 4H1LA 3ORJA 4AK1A 3ZKMC 3ARBC 3P77A 1OQXA 4J6RH 4IRJD 5C0DA 4XCEB 4UI2A 3QSKB 4PJ8B 3FO9A 1KJ2B 3O41A 3MCKB 4K7FA 3DMMD 2AEPL 3GRWA 1G0XA 1BD2B 5CSGA 1XMWA 2X44D 1S7RB 1P4IH 1RI8A 3RA7H 5DD0L 3RGVB 2MHAA 1N4XL 1T20B 1DN0A 4UIKH 1IQDB 4MQ7A 5JHDD 3QCVL 1F3JB 1MRFH 5F6HJ 5MEOA 3JV0A 2DLTA 4XAKE 4OLWH 4KTEL 4X6CB 4E42B 5DHXB 3EFDH 1NFKA 1Q9KB 2YPVL 4S0TD 4MJ6A 3O6ML 2WAHA 3SOBH 2VLKB 3CJJA 4XHJC 4G5ZL 4JY6B 5ABDE 5E08H 5CD5C 1S7TB 3EYOB 4OLZH 2D2OA 5C0BB 2FCBA 3EO9H 5GHWL 2Q8AL 3O8XB 1MLCA 1X5FA 2WIIA 4FQIH 1SJVA 1JZ3A 3NFSH 4U0RC 4JN2A 3ROLB 5JDSA 1VFOA 4DKDC 1LMKA 3SY0A 3QPQC 3VD5A 1FGVH 4OQTL 1JNHB 4GBXA 4PJXA 1XGRB 3QUMH 1WICA 4PG2A 2P24A 2XXMB 3V5HA 2HTKC 3DSNA 4U3XA 3V9FA 3RNQA 4PGJA 5CEZE 3C6SA 2AJ3A 2JJWA 1BBDL 3FO2B 5ENWB 4CMHB 3AROA 4JFOA 4PLJC 1WFTA 3DI2B 3EYQC 3WSQH 4GAJH 4OFYA 1F3DH 3IVKB 4WW2F 2ICEB 5F1NB 3WXVL 4Z6AT 1ZLVK 4MQXD 4M48L 2OK0H 5EB9A 3HNSH 4UV7H 2MKLC 3LIZL 4G6KH 1B0GB 3H42L 3RU8H 4QHKI 3O4OB 1T5XA 2WWMD 3RNKB 3QDMB 3VXUD 1RUAH 5FO8B 1I3GH 1U42A 5HDLA 5HHME 2EYRA 4YBLC 1MRDL 4X80L 4MDJB 4YNYA 1JPTH 1EIBA 2H6PA 3FOLA 5ANMB 1G7HB 2OTWB 3V6FB 1MHPL 2HVKA 1RZIA 4J3UA 5ESVB 1NBZA 1JGVL 1C5CH 3DX8B 1NAMA 5JUEL 1KCUL 4JO4L 4D9LH 1ADQA 3BP5B 3C5ZB 5HI3C 4HQQL 2EC8A 2EE9A 4UQ2A 5I1EL 3CFJB 5C6TL 4EBQL 4HMDA 2VDKL 3LY6A 5A40E 2Y23A 2X1OA 5T5FL 1IAIM 4N0FA 2Q86A 1ACZA 4D8PA 4WUUA 5LJYH 1SY6H 5FYLH 1A6AB 2UWEB 3C9NA 2DLFL 3H3PH 2IQ9H 3FO1A 1OP9A 5JW5B 3BZ4B 4N8CH 2X4TB 1OSZB 4F15B 5ADPH 1KXVC 1DANU 3O3EA 3W81A 4H5SB 1A14H 1A7PH 1JPGB 3RAJH 2DQHH 3UYRH 4HDIA 4HEME 5DVOA 4GSDH 3MOBL 3CDFA 4BQBA 3LQAL 1EBPA 1P53A 1MFAL 1GL4B 4PJCF 4M02A 4N1CA 4ORGA 3C5JA 3ZHLA 4ODXA 5HHPA 1ORSA 1AJ7H 1LO0L 3MLTA 2PTTB 5C08E 1UWXK 2JCCB 1MVUA 4HS8H 2FRGP 1ZVSB 2CLVB 4AY0A 4XWOC 4AM0B 4NRYB 4G9FA 4RA3A 1QLFA 3W0WD 3GMLB 4F33B 3MRNA 3DVNA 1ZHBB 3TO2B 4JB9H 3ULSA 3C6SB 3GSNH 2D7MA 3CSYA 5SWQB 2D7QA 7FABH 4NKOA 4TPRL 1I7RB 1KLFA 2DYPB 4PRIE 1PEZA 1MOEA 4ZTOL 3SO5A 1J8KA 3DHMA 25C8H 1CL7H 4XNXH 3VG9B 1CG9A 1KCKA 2WLZA 4PREA 4DTGL 5FF6A 1SYVB 2R1YB 4MYWB 2ICES 4XCNA 4FFYH 4ZFOA 1EO5A 4FXKB 4MD4A 4PG2C 1FBIH 2VKXA 3CK0L 1FFPB 3VWKB 4XB7A 2A1WL 5EUKB 1ZS8B 5B8CA 4WW1A 1GGUA 4NJ9H 5E2WH 3D2UD 5T3XD 2CR6A 1KIPB 3BPLB 2QQQA 1BJ8A 3A6BL 4XMLH 4Y5YB 4YUEL 5E8OB 1NFIA 4HUWA 3JSSA 4XPGH 1GSMA 3PQYA 5LXGL 3VXSA 3FFDA 1WZMA 1YEEL 1NMBH 1MUJA 2EE6A 5I1JH 1DUYB 1TDQA 4M43H 3MBXH 4HH9A 2O5ZH 3HE7A 1FH5H 1OT2A 2X89D 3MRHA 1U3ZA 4LF3B 3BXNB 3PWPA 1WFUA 3C8KA 4LKXA 4MD0B 4UT7H 4A2MA 3U2SB 4KRPB 4PY7A 1CR9L 2V7NA 4LKCA 4R0LB 4OFVA 2J2ZA 3WUWA 3NCJL 2CDFA 3DIFB 5ERWA 4HBCH 3MFGB 4M6OH 1YNTA 4M5ZH 2VUOA 2XYCA 1WGOA 3LS5L 5ANMA 2B1HL 4PRID 2A6JB 5AWNL 5HXMA 4Z7UE 3GSNB 1FORL 4X6DE 4M8QA 3VFGL 1J0HA 1HZHL 4LCIH 2FD6H 4UV4L 5EU3B 5IMKB 1G7JB 2FX7L 3QHZL 3B9VA 3SDXB 3TC9A 2P5EE 5ALCH 5IQ7H 4TSBH 12E8L 3VG0L 4QXGL 2EDKA 2MNUA 5KVDH 1SVZA 4MA3A 2C1OA 3DSFL 3IDYB 1ITCA 3CLEL 3BN9C 3ZYJA 2RBLA 3KWWA 3WSQL 4Q0XL 2FB4L 5DC0A 2F53B 5ALBL 1I9JL 3SN6N 2VDQL 2XFXB 3SDDD 2DQGL 2FEEL 1DBJL 4GS7B 4HIEB 5ESAA 3AU1B 4RDQF 4KKNA 4ODTL 4MXQC 5C0BD 3E1F1 2AJXH 5C92A 5DDHB 4PJXB 3FFCE 3RY6C 5GZOD 4FQXA 3THML 3KPMB 1A5FH 1A4KB 1J0KA 3ILPA 2Y25A 2D9QB 1JPTL 2GITA 2M2DA 3GMLA 4OZHF 4F33A 1C5DA 1LO3L 4ZOEA 3T77A 1BZ9A 3IF1A 3QIWB 4CJ1A 5C0DB 1DZBA 1I9RH 3HZVB 3AGVA 2DTML 4L3EB 4JVPA 2IBZX 4LCWD 1IGJA 4PRNA 1TJHH 3OKOB 1A4JB 4XPBH 4QRTA 5FAAA 3FN0L 4PYHA 4JM4H 4E0RA 2YN3A 4B41A 1RIUH 3NFPB 4OZHE 4ZFZA 5F7WC 2Z91B 2DF3A 4K23H 3QDJE 1C16B 4RMSA 3VU2A 4WEUD 3J8F7 3OXSB 2N56A 2ICWJ 3RWJA 2GSIB 5D7LA 1TNMA 3EDFA 5C3TA 2ARJB 4C57C 5IG7B 5FHAL 4M6MH 4CU8A 1G6RA 3Q1SL 2GJJA 3IJHA 4XHQA 4U49A 4HF5L 4X8JA 3TT3L 1CLOH 5DRXB 4LSVH 2B0SL 2GUOA 3SDAC 5I1IH 3IU4L 1WISA 5JIIA 1YDPB 1TVBA 3CDCA 4ESKA 2CIIA 3S96A 4ELMF 1JGUH 2V5TA 4JFQA 4NO0B 5I1CH 3MBED 4ZQKB 3U9PH 4JGMA 1YQ2A 3OR7A 4QTIL 2V5YA 4LPCA 2DB8A 1PYWA 3OKMB 4IOFC 2R2EB 2W0LA 4GMSH 3QG7L 1MREH 2VLJB 4HLJA 5H8DA 4PJXE 1S8DB 4R9HA 5J12B 4AIZB 3AM8C 5K9QG 4EI5A 1IGCH 1N5AB 1T6WA 3HG1B 5IIEB 1U2CA 3QDGD 2UV3A 3ZHKA 1CF8L 3Q5TA 2DMKA 2C1OB 5EA0H 1U8OB 4KZEH 1YN6A 3QQ9D 3G9AB 4HJGB 1LVEA 5AEAA 2A73A 2I9LB 2OSLB 4ISVA 4LAJH 5EOTB 4HV8B 1VB9A 4DTGH 1E6JH 4G6JL 3MLZL 4X4XA 1G7JA 4LLUB 3BN3B 3M8OH 4G6MH 3D69B 4OF6A 2BNRA 4MXWL 4W6XB 2WINA 5HHMD 1JIBA 3GHEH 5JXED 1CCZA 4HKJB 5EUOA 3TH4T 1U8KB 2VDRH 3C2SA 3DO7B 1AD0B 5D7JA 2IPUG 5A43C 4HKZB 2YPKB 3Q6GH 4KUZL 4Y5VA 2E8ZA 2YUWA 4GRLD 3EYSL 3GMQA 3QIWC 2AXGA 3B9KB 4XZUA 5JNYB 2ZNXA 4FQQA 4NQDA 3W82A 1D5IH 3NA9H 3ULUL 4K9EH 4Q9CA 1FPTL 4OKVA 5IVZA 5D6CB 3GIVB 2RR3A 4AENA 1U8LB 3OXSA 1T5WB 2FR4A 5CMAA 3JV6B 4QGTA 1SY6L 5FYLL 5GGUA 1NLDH 1FFNA 4LASL 4XVTH 1ADQH 1ZLWH 3MNZB 5IW6B 2AXFA 4UU9B 3QUMB 2IAMD 3KGRA 3ZDYE 1JE6A 4ODSH 2DQCL 1YY8A 2GTZB 1CVRA 5DQJB 4ZODA 1X6NA 2BVTA 4FQCH 4D3CH 3PWPE 3E6FA 2BVEA 3OTTA 1P7QB 4KMLB 3PWPD 1EJOL 2IPUK 4S10A 2R1YA 1B90A 4S1RL 4ETYA 1VEMA 5INCB 2C3WA 5C0AE 4LFHG 2PTVA 2XZQH 4PREB 1TQCC 1JHLL 5D1ZB 1F58L 5FKPB 3K4ZA 4LLQB 4EXKA 1U95B 5CWSA 1OTUC 1F4WH 5INDB 2XKSA 4JE4B 3RQ3A 4OLXL 1IL1A 1UKSA 3TGXA 1XZ0A 1IGTA 2GCYB 1J0YA 1QSED 5KSAD 4GG6E 4NFCA 5I1EH 4QXWA 5EZJA 2JB6A 3QNZA 1E27A 5CJ8A 4K55A 4LRIA 5F9JB 1ORSB 5JXAH 1QBAA 5GS0H 2EDHA 2F53E 4P5TB 4F7MA 4P23B 1R0AL 1IAMA 2XIDA 2YKLL 3JBG7 5E8EB 3O8XC 3CFBA 1S9WA 2ZUYA 1J1OH 4FABL 5IGXH 5I71C 5TGBA 1NBYB 3QZWB 1F97A 1MFCL 4MA8H 4CJ0A 1Z9MA 5D2LB 4J4PA 5GGTH 5T1LA 4DVBB 3TJEH 3QH3A 4MCZA 3B3IA 4JO3L 3M17A 3W0WA 4KKAD 1F11A 1XF5A 5K59F 2W9EH 3RGVC 2EH8H 2FO4B 3FQNB 2AV1B 3PWPB 1HH9A 2FO4A 2YR3A 3U4BL 5CINL 1HHGB 5CP3H 4KH2A 2ZCKH 4QHNA 1D5XB 4JG0L 5TDOA 1CYGA 1XGQB 5DRNA 5FGBA 2YD9A 4BSWB 3DVGB 4M3KB 3SEPA 4R7NB 3X13A 1MCEA 4S0SD 4X7TA 2AJZB 4JY4B 4I9WD 4YGAB 25C8L 3C08L 3UROR 3VXSB 3U0PA 4GG8A 5DJ2A 2QHRH 3QULB 4BK5A 1LE9B 1PSKL 2EYSB 2P47B 1J05A 2DQJH 3IFPA 1JF6A 1S7UB 2CGRL 1GOHA 5HGGS 3QDHA 1MFNA 1JRHH 3U7WL 1W0VA 3QJHA 1OPGH 4C4KO 1G9NH 4NO5A 4HUXB 1OAUH 3D2UA 1K2DB 1FFOA 4LGRB 4P9ML 4JZOB 1AGCB 4RRPA 1DQJA 4HPYL 3HPLA 3SGEI 5E2WL 1INDH 4P2CG 3WFZA 3GMOA 2WW8A 3CNKA 4PJCE 4WY7H 3U7YL 2BVQB 1CF8H 3ECBA 3CH8A 1N4XH 3OZ9H 2DWDB 2IADB 1SM3L 2CIKB 1E28A 1RHFA 2DD8H 5SWSA 2Q76B 3N9GH 3TF7C 3WXVH 5C2BH 2ZOKA 3NFNB 4TOYH 4IJ3C 3QFJD 4LSQH 4OGYH 1LDPL 3ZL4L 4MJIA 1LO4H 1ZWIB 5ITFA 3ARBA 2CLVA 4MVBC 3VFMB 5HHQB 2KPNA 1CD1B 5C0ND 3NN8A 3NABL 5JMOC 5IJKA 4P3CH 3BKYH 3I6LE 2ESVB 3S37X 3ALXA 1KTRL 1EEZB 3G6DH 5TQ2H 4JFDA 4Q9RH 1L6ZA 1S9WB 3IETA 4UU9A 4R97C 1V05A 1FV1A 2P5WB 2RIKA 3TBSB 5HDQL 4LPTA 2WBKA 4HHAA 2NY6D 2CDEA 5I1AA 3TZVC 3LH2L 4IS6B 2G75A 1CDBA 3OG6B 4IIQC 2OZ4L 4PGBB 1HHKA 1A6PA 3ULVE 5I76B 1IFHH 1VFBA 1X5IA 4OGXL 1ZA3A 3VCLA 4XCCH 2YPLB 4NWUL 2NX5A 1JUFA 4YHZL 1GGIH 3KPLA 4POZD 1QD0A 3B5HA 1T89C 5CLWA 2XNAB 4JEGB 4DOHB 1J1PL 4N9GB 3RHWF 2O61B 4L3CA 1HHGA 1CFQA 3LKSA 5T5NF 5F88A 4LSRL 4JRXA 4M61B 3SKJL 5BV7H 3F7YA 1GC1C 2BZDA 2ZSWB 1RZKC 4KC3B 4NBYB 1INQA 1P1ZA 3F12B 3BE1H 2EDOA 4R97B 3W2DL 1C7TA 5DMIL 3EYFA 2Z4QB 4RGNB 3KPQB 5EUOE 2GK2A 1ZSDA 2WLYA 4X4XB 4WFFE 4R4ND 5SWSD 4Z7QF 5HY9B 5E8PA 4JZNB 3DYOA 3NIDF 4JPWH 1G9ML 3DMMA 2FATL 2YWZA 3MMEA 4HFWB 1K8IB 4OCWH 1NCTA 5D1QA 4EQ3A 4L5FH 3N06B 2FJHB 3STZB 5JDJA 5I9QC 4MA7H 4TUJB 2R0WL 4QO1A 1JF1A 1J1XL 2Q87A 3QQ4A 1A3RH 1BFTA 2MFNA 1EBAA 4XH2B 3GMQB 2HP4A 4UBDD 1GXEA 1ODAA 1PG7X 4GKNA 4PGEB 1KJVB 4LNRA 1FVDB 3WFBL 5JA8B 2RAMA 3KJ6H 3UPAA 2YD2A 2O93L 4PRHA 1AD0A 4P4KB 2I07A 3VXMA 1NMAL 4RFOH 4PJBF 3TO2A 4HKJA 5DFTA 3CAFA 4EQ2A 4X4MA 2IPKA 3DYPA 1JWSA 5DWUH 3BSZL 3RVWD 4PJIA 3LRGA 4GXVL 2KDGA 1QEWB 4O2EA 5CHNA 3ZE1E 1ND0A 3K1KC 3MLUL 3RWEB 5A3ID 2CDEB 2GK0A 5I1AB 2X6MA 2CPCA 5DQJA 4FQIL 3W39A 2X4QA 3CXHJ 3LS4L 4HWNA 3F62A 3EBAA 4X6DA 1F6AA 5CINH 4LVHB 1QQDB 4PJAF 1NL0H 2PCPB 4HMCA 5HI5D 5LQBL 3ARRA 2ZKHH 4HBQA 2HJLA 1T5WA 4ZD3H 4NSKB 3DUHA 5FYKL 3NZHL 4R0LC 5JIKA 2ZG1A 2Z8VC 3LRHA 3PWJB 3E2HC 4KKCD 4KFZC 4JFYB 3UTZB 1AIFB 1UA6L 4DFHA 3CFDB 5SWSB 1F90L 4WWKA 1NCDH 2ZJSL 2VDOH 2OX5A 3TIEA 5IB3A 3GMPB 1QG3A 2ESVD 4B7IA 4CMMB 1I8LA 3FO0L 4FABH 3RZCA 5J6GA 2RFXA 3HFMH 5DLMH 1LNUA 4ODWA 3U7AA 3IDXH 4OCNC 1MH5B 3RIAF 3G5XB 4QGYA 4M9PA 3VXSE 4BFIA 1U3JA 1LP9F 3J7HA 2IC2A 5D4QA 1S7QA 2H6PB 4PY8J 1SEBA 2RJMA 4TNVF 2QQLL 3CLEH 3QUMA 2A74B 2PXYC 3PV7A 4F7EA 4UUJA 3LKNB 5I8CB 4LGPB 2IH3B 1KNOA 2JKXA 3UO1L 1YNLL 3IFPB 4OLXH 4XNZB 5F3BA 1NCBH 4CADA 3O6FD 3GEWB 1JF5A 5FKAB 2VYRE 1V7NH 3QUZC 4MAYC 4ZO6A 3IDYC 4R8WL 4ODTH 4AYFA 1S7XB 1BFOB 1S9VA 2F5BL 1OSPL 4ZUTA 2VLJA 4BFEA 1O7SA 1KBGL 1I7ZA 4LLYA 1QEWA 5F7UA 4B5EA 4J1UB 4PJ5B 1JWSB 3C5ZC 1JK8A 4KKBD 2RB8A 2FL5B 3P73A 1NBVH 1V3KA 4QRQA 1CDYA 3M17B 3W0WB 1HOCA 2BOCB 1E4WH 4WUKH 4MA8L 1WT5C 2CO7B 1KJVA 5F7MC 5ECJE 3KXFA 5C70A 4XMLL 3NCEB 2BNRB 2R2HA 5CIPA 1HKLL 3BJ91 4LLUA 3WJLA 3OKNB 1FN4B 3NGBB 2DQEL 1A7QL 5EIQA 2VLKA 1IRAY 1I3RB 3VXTA 4HIIA 4JAMA 2YXMA 2WBJB 3BEVB 1N6QL 1RZ7H 2H32A 3LB6C 3AC0A 4RZCA 1UWGL 4LCYB 5GXBB 4JFXB 3LD8B 3RTQC 2G5BB 4F9LC 4PTTB 2KKQA 4WEMB 1GPOH 1ZEAH 4DZ8B 4FZ8L 3ARGA 3ZDXE 1CL7L 4XNXL 4KVNL 1PX4A 1IM9B 1XGYL 5JPMB 3SDAB 5L8LB 4BFBD 4J3TA 3QXVA 1E4XL 3ZYOA 4J12A 4U1NB 3GSUA 4JRYA 5IW1A 1RJLB 2EICA 1SYVA 4WFHE 2EDXA 4WI2A 4Q6YA 2VIRB 3VFOA 1EX0A 4IRSC 4C83A 4BFIB 3KYOB 1PZUB 4PJDA 2VJXA 1RZFH 3QWOB 4PYGA 4Y4HB 3TM6A 1GVIA 3EIFA 5DGQA 5E2TH 3DBXA 1IAKA 4APQD 4IRSD 5D7KE 5SWQA 3PHQB 3IDMA 3K2MC 4K7PY 1RJYA 4BUGA 2BVOA 2NCMA 3C60B 2DN7A 4NDMB 3VXUB 4XP9L 5DVLA 2JCCA 2VN4A 1U9KA 4K71C 4UDUB 3VXRB 4HT1L 1KTKE 3EOAA 4HKXA 4Y16A 5I74C 4WU7A 4IDLA 4NO2B 1JGDB 3DV6B 2M26A 2W0FB 1MCJA 3TT3H 4LOUD 4KI5C 2AK1L 3OBAA 5DD6A 3VFSA 5DJDA 4KQ3H 2FR4B 3SHSA 2VERN 1UWXH 4P49A 1H8OA 4ERSH 4UTBH 4D0DB 4Y5XC 1F4HA 2F58L 1MHHB 5DMJB 4P2OC 5D7LD 1RFDH 4M8QB 4Q9RL 4P3DA 4P23D 5DJYB 1S9XB 1RAMA 4M1DL 2EDFA 4MJIB 3GKZA 4HC1A 3T0EC 3VH8B 1OGAB 5LWYL 5D1XB 4EN3C 5C0RL 4IOIA 2OZ4H 4MNGE 5F1IB 1ZXQA 2V7NB 2APFA 1H3WM 4RWYL 5K9OB 2VNCA 5C7XL 2A2QT 3WE6B 3OAYK 3MA9H 1NAMB 3T0WA 3GMNB 5MENB 1SM3H 2MQ3A 1SBSL 5HVWA 3INUL 4QOKE 5CBAB 4G8GB 4TUJA 1AXTL 1V3MA 4BZ2L 1UH4A 1NCDL 2ZJSH 4DKAA 5F89A 2IANB 3MGTA 3QEUB 1OLLA 2X10A 4HJ0D 3L6FB 3BHBB 3T0BA 2BJML 4JLRB 3EO0A 5IMKA 4LCCC 5HDBE 4KVCH 1G9MC 4RGMC 4MWFB 4YO0A 5SWSE 2YZ1A 4KJWC 2W65A 4Y4HD 5I30L 2HKFH 3HZYB 1E0OB 2C7UB 5F8RC 3OPZH 2BNUB 3DX9A 2DI7A 3H7LA 4J3WA 4MJID 1OAXH 3L3JB 5DC4B 3ARFA 2JB5L 4UMGA 1GGTA 4I3RH 4NKMB 5C0NC 1YQVL 2R0ZL 1I85C 1SQ2N 1FPTH 2C9AA 2QLVB 3FCTA 3TIEB 2NZ9C 4G8EB 4HLZG 3S9DB 1DEEB 5E4EB 3MJ9H 5IOPA 3BUYB 1T3FB 3BW9A 4EDWH 2W1NA 4GW1B 5L88H 1DBKH 5H35B 2JK5B 4YWGH 1HYSC 1A8JH 1N6UA 3TBYA 5FA3B 5D5MA 4OM0H 3T3PE 1MI5B 5EU4B 5KVFL 5IVXA 4G6ML 4Q6IB 5EC2B 4MNGB 4ORZC 2CRYA 2Y7QA 4F57L 3GO1H 2LU4A 2P46B 1M7DB 1T5XB 5J6HB 1VGEL 3Q5OA 5DQ9B 4LLMB 4HXAH 1UGNA 5IT2H 5HBBA 2IBBA 1A4JA 4YE4H 4WW2A 3MRCA 1H15B 8FABA 2BY0A 2VAAB 5L2JB 2YZ8A 4ZFOB 3BOVA 4HUVA 2W9EL 1T0MA 4KTDL 3VRLE 1H3XA 3F7QA 3W0WE 1L6XA 1WWAX 5BS0B 2OYPA 1CD1A 4XNYH 1ZGLA 4OAWB 5EBWA 4EUPG 1QTYT 4I77H 2W9LA 3KJ4B 5J8OA 1IBGL 1D3CA 1T66D 3L7FA 5KVGH 4XPHL 2FX9L 3MFFB 1CXEA 1UEYA 2WUCH 4QXTB 3GJFK 3PGCA 4WI6A 3QJFB 1PKQB 2VDNL 1J8HB 4ZDHB 3QP3A 3S5LA 2YHGA 4F58H 3U82B 1DQJB 1NAKH 1ZLSH 5B8CC 4X9IA 2Q20A 2VAAA 3CLFH 1H9VA 5FDYA 3VGFA 5LGHH 2FHCA 1AXIB 4X0KA 3RL2B 1D9KC 4LRNL 2J88L 4GJTB 2W65B 1RZFL 3QUYB 5C9JB 1BOYA 4JANA 5IHZB 2HYMA 3LSOB 1IC5L 1JPST 1MWAA 4RAHA 2HG5B 4X5WA 1Q0YL 2HFTA 3QEUA 3MLUH 3D0VA 2DJUA 1DBML 3RL1A 4FNLH 4R7NA 4DKEL 2AJZA 4JY4A 2Y5EA 4QRPD 1T20A 3BPLC 1I1AA 3CFCH 3S4SB 2CLZA 4ONGL 2ZCKL 4G7YH 5CS7A 5D2NA 5HPOA 4GRWH 2PKDA 3WS3A 4L8SC 1DEEA 4U6YA 1RD6A 4DGIL 4JHBA 2YPKA 4P2RD 5DF0A 1U91B 3LKRB 2WUBL 5DJ8A 3L3IB 3DO7A 4N9GA 1XF3A 4DGVL 4UOW0 1WAAA 3DURA 3P73B 1ADQL 3UC0H 5J56B 5I1KH 2AJVH 1UT9A 2D7TL 1MFEH 3MO1B 2BDNL 2X4UA 5IV2B 2A6KB 1W8OA 2A6DA 3GMRA 3G08A 1RJZB 3LN4A 4XPAL 5FYLD 4O9HH 2VITA 3TESA 2DBLH 3QXAB 1MCIA 4H20H 4V2BA 1H15A 3MJ8B 3MRCB 3QDMA 2FGWH 4NCC2 1PKQE 4GT7A 5DQ9A 1U92A 4P23A 2UUDK 2X40A 2CRZA 2CKNA 4X9HA 2AQ3A 3V4UH 2BCKA 4XCFH 3FRPA 3S97C 1CDJA 1F3DJ 3TPUA 4YK4C 1XGTA 1CFNB 4G80A 4DCQB 1EAPA 3GK8L 1H8SA 2AS5M 1CD0A 1DQTA 2P8MB 1NC2D 5SWZA 4G6AC 3OKLA 5D5MB 1XZ0B 2V7HB 4Y8AA 3O9WC 5GGSB 3OAZK 3G6AB 2J3SA 5D8JH 5DQDL 2ZOKB 4Y88A 2YPVH 4I0PC 3EFFA 2DS4A 1JNHA 4S1SH 1W0WA 2R69H 2NNAB 3QZWG 4X7FC 4PJGA 4Y4HA 3OKEA 4WI4A 3BQUB 4OFYD 4YBHA 4QXUL 4YDIL 3QIUB 3LVEA 3R8QA 2MMXA 3DRTA 3VWJD 3PWJA 1QPPA 1AHWC 1SJHA 1CFTA 4N0CD 5DK0A 4HZLB 2BC4A 3SDDB 4RQQA 3T3ME 5AG9A 5E5UB 5KTEL 1X4YA 4KV5E 5DUPL 5EU6E 3V95A 5D2NE 5J6HA 1R3IL 5EORL 5I15L 4JO3H 5GGSY 3DV6A 2J6EL 3O6KL 3KVQA 2E7CA 1T83A 4XBGB 3G6JE 3AMKA 5FYJD 3X13B 4I1NB 4ZS6D 1EERB 5JW5A 1Z9LA 5DJAA 4GBXC 4LMQI 4E41E 1G7PA 3GBLA 2E9WA 3FO1B 1BEYL 3T4AA 1L0YA 3L1OH 1D5XA 4XVUD 3DV4A 1VGKA 1VKXA 3QIUA 3WIHL 3D0LB 5TE7L 1QR4A 4U31A 1BQLH 1JV5A 4MXVF 1HCVA 3VFUA 5EO1A 1WBZA 4KVNH 3O4LA 5F72S 3PNWA 1CDGA 4NGHH 4QCIB 3V7AG 3HCVB 2HFEA 4LHUG 5DDHA 3F7VB 2F58H 4U1LB 1S3KL 5I8KH 5C0GB 3BT2H 5DJYA 2X1WL 4D0CA 3ES6B 3HKFA 4YEEA 1IAIL 5I1DB 4X6DF 1NGWA 3IS1X 1O7VA 1I8LC 2WBWB 3IU3A 4OLEA 2ICCA 1SEQL 4QOKA 4FS0A 4JFXA 3UTOA 1EAPB 5ITBL 2DOCA 1FGNH 5IMOA 4PY8I 1MLBB 5EO0A 1PZ5B 4NQCB 4PP1D 5ID1B 4NQSB 4BELD 2R56L 3CUPB 32C2A 1DL7H 3RTQA 5GSVA 4F9LA 3P9MB 1OAKH 5FFLA 4JDZA 4M1CD 4N0YH 5EU5A 3NA4A 1FBIL 3CK0H 5B3NA 1GZQB 1EA9C 3AS1A 1R3KA 4Y0GA 4PGZA 1Z5LB 3QXWA 1YEDB 5DMIH 5KVMC 5F70A 5CEZD 1VACB 3S35L 2NTSP 4NQXB 2Z31C 5E08L 3O9WB 3UDWC 4IMLB 4F2MB 4JFPA 2M1KA 4HKBA 1TVBB 3EJJX 3GMPA 2NXYD 4I2XE 4U7KA 1WCBA 3LH2H 2OR8A 5J7CC 2W0KA 3VA2C 4F80A 3MNWB 1RK0A 5CBEA 4HH9B 4EKXA 4NT6B 3ZYIA 4M7KH 5GGVY 4NPYA 4P48A 4KPHH 3QWRD 4OZFH 5EH1A 2PW1B 2OCFD 4R7DB 1B2WH 3VD3A 4YC2C 1OB1B 3KAAA 2XWJB 4QHUB 3PL6C 2BSSA 2XQYK 3MXVH 2FHBA 1YEJH 1AE6H 4M6OL 4F7EB 2G5RA 1OL0A 3QUZB 4MAYB 1OAQH 1FCCA 2EXWC 1WITA 3L9RA 1NAKL 3MUY1 3HAEG 4OIIL 1KTDB 2J7LA 5CD3A 3RZCC 2FJGB 2Y9RT 1ZLVH 5I66A 4XCNB 1IT9L 5IEKA 4NKIH 4ZMAT 4YPGA 3EYUL 1J8HA 4F9PC 3RVVD 1MJUL 5GS0C 5I18L 5ELIA 3ZMRA 2B4CC 3TT1H 1P4IL 2HKFL 3D3VB 2UZYB 2VIRA 3VFOB 2ZUVA 1D5BB 4U7MA 2XPGA 1RZKL 4K3JH 3ZKMD 4S1DD 2DQUL 1KCUH 5GS0D 4PGDB 1DBBL 1EFXA 3TO4B 3L5HA 1FHGA 1RULL 2YUXA 3QISA 3LD8C 3RTQB 3CVIL 5DD5H 3VXSD 4WWKC 2F53A 4TPRH 4I0KA 2PW2B 4XP1H 1XGYH 4R2GB 4ZAKC 5B38A 1MLBA 5M7QA 2Q8AH 3VDAA 4BQ9A 1MIEH 4XP5L 4FFYL 2K1MA 1J05B 2XTJC 3HZMA 4EI5C 5IQ9A 5HHVL 3GSXA 1G7QA 1XIWB 2HRPH 5I6XB 3KLHC 4ZFGL 1G7LB 5JXEC 5AAWA 3MO1A 2CD0A 1G1CA 4P2RA 4PTUB 1RIUL 3OQ3B 2R0KL 3F8UB 2HFEB 4YIQA 1DEDA 1R6VA 4Y19B 4OZGE 2WANA 3JTTA 5DD0H 1NKOA 3UTQB 4N0UE 4GAJL 5E5MA 5T1MB 1EHNA 4DKEH 5DJXA 4YPJA 2CUHA 1MCFA 5LCVL 1OF2A 4EUPH 5LAXB 5I1JL 4NP4L 5D2NB 1UWGH 4I0PA 5IW3A 5FECB 5E4IA 1HDMA 3BWAA 3H42H 2NLJA 1L9MA 1V3JA 4TVSa 3LPWA 2MQ0A 3MOAL 4A6YB 4CN4A 1OD7A 3KPSE 3NZHH 1EHLL 1WIPA 3MRBB 4HW6A 1JZ7A 4G8FA 4P5KB 5D9SB 1CI5A 3P40A 4WENB 1AP2A 3IFLL 2AQ2A 2OMBA 4U1SB 5LVEA 1OGTB 3O2VH 5KVEH 4YDIH 2XN9B 4QY8A 1C8PA 4OLYL 1BQSA 1R3LB 4K9EC 4O9HL 4AJ0A 3ZHDA 2DDQH 5J0BA 1QR1A 1Y18B 2R15A 3HRPA 4L4VD 5LG1A 2NY4B 3C5SA 1M4KA 4PJIB 1SEQH 2VXSH 3JUYA 3W5MA 1I8MA 5C09D 4R90H 3RZCB 2FYYA 4CMMA 3CMOL 3T1WA 1U58A 1FNAA 3AREB 3ZKSD 5CEXB 4GOSA 4R3SA 1D5BA 2EDJA 3RWGB 2AV7B 2VABB 3JWDH 1BZ7B 2IAMB 3GHBL 3DUSA 3MLZH 2HVJA 3IDNB 5I75C 2P4AB 2QSCL 2VQ1B 5I19H 1VFBB 3SDXF 5FO9B 2X89A 3V6ZA 1G6RL 5FM8A 2P8PA 1BMGA 1T0MB 4NQVB 5LGKA 4N0UB 4JY5H 1JHTB 5SWZD 5FUOL 4LCCA 1CGWA 2X41A 1Q94B 1ACYH 2F54A 8CGTA 5F9DC 3TBTB 3RIAK 1AJ7L 3AB0C 5TDPB 3EOBA 3UC0L 1IZJA 1B6UA 3VMNA 4YQXL 3MBEB 2B1HH 3KPRD 3ARDB 3EKCA 4Y2DC 3FT3B 3FT4B 4OSUH 4GXUN 3X3GL 3S88H 1QFWI 2DKUA 3PGFH 4LGSB 4QRPA 4C56E 4MX7B 3PJSB 4NRZA 3ZKND 3QIBB 1T1XA 3DRQB 3IAPA 4NQEB 3QG6A 2WP3T 4DEPC 1R3IH 2BSTB 3OAUL 3BZ4A 2XKUA 3RWIA 3GSVA 3WCYA 5DVMA 2HAZA 3T0EB 4KUCF 2MOVA 1MFBL 3ZKNC 1YEFL 3P4MA 2NX5D 5DJ8B 2I5YL 2NY0C 4MMZC 4XP4L 1TCRB 2OR9H 4X4ZA 5KSBB 1TCRA 4HKZA 2FB4H 2YMXL 1TQBC 3OV6A 1FLRH 4S2SA 4FQ2H 1QBLH 5MERA 3BP5A 4LPWA 1UJ3A 4PTUA 1YEKH 5F1OB 3ARFB 1PVHA 2B0SH 5I1GH 3E3QE 2VLLB 4HUXA 6FABL 4XXCA 2IWGA 4O2CB 4EI6B 4Y4KC 1QYGH 1XFPA 3PWLA 2ADJB 1YMHA 3ET9F 5I8KL 4PTTA 2EIZA 1LO5B 5IESH 1T7WA 4GAGL 3MBXL 1QFUH 4AQOA 1EUUA 1K9TA 4HCRL 1KFAH 3NH7L 2XKNA 3MJ7A 5CJXC 4L4TA 2OMNA 1ZA6A 3IVKA 1A6UL 2X5PA 1HNFA 5JPNB 2ICEA 3MJ9L 5JOEA 4NC2B 1IEBA 5IB4A 4L8CB 3FFCA 5IBLC 1KPVB 1MPAH 4P5MA 5BQ7A 1I7UB 5FHBH 3DUSB 5HGAB 3FO2A 4AH2B 5E5MB 5FIEA 2O61A 1S78D 5IBTL 4N0CC 3B2UD 4KDWA 1J1OL 3NCYS 3CSYB 5K9OA 4ELKB 4RMUA 2LVEA 1DLFL 2GTWA 3EJZC 1AKJB 3V8CA 1LEGA 5KG9A 5CP7A 5TH2A 5IT2L 4UTAL 1K4DB 1RUPH 1MLCB 4TSBL 2F54D 3HUJB 1N26A 1XGPB 4WTXA 3S35H 1LO2L 3D3VD 1B0WA 1CQYA 4LHUB 5ACZB 5KSVA 1IILE 3QJHB 1W0VB 3BEWB 2FIKA 4JM2F 3P30H 1OB1A 1JGDA 4KU1A 4UQ3A 2XZAH 1ROWA 3S8WA 4R7DA 1LK3H 4P57B 3FT2A 2X7LB 4DOHE 4ETQA 2Z35A 4U6XB 3VXRA 4RWYH 4LVEA 4Y5XB 3CDYA 4IRSB 3F58H 5I6XC 1AO7A 4POZC 3L5XH 1UVQA 5GRXG 1KEML 3PL6A 5C09A 5EWIL 5TDOB 3VFWA 1R24B 3PHQA 3G6JF 2DLGA 3QO1B 3KS0H 1AE6L 3CDGB 3H9SE 4KK8C 4WI7A 2A83B 4LLVB 4M48H 3PV6B 2DTMH 3CC5B 4K94L 2ICWA 1PJ9A 2VXUL 4WJ5B 1MCBA 5DK2A 2V2TB 1W0WB 1U8NB 4YE4L 2OTWA 3A6BH 1R3JB 3V6FA 3BH8A 1NCUA 4ZAKA 2JJSC 3GSXB 2J1KA 5GJTH 5GJSH 2OL3L 1OAXL 1UZ6E 5E6IA 2EDYA 4TSAL 5HSFA 2VR9A 2BRRH 1X5HA 4XP6H 2YD1A 5T3ZH 1F6AB 4GRWB 1HXYA 3U0PB 2DQGH 3NIDE 3T1FB 5B38B 4HIIB 4JAMB 3S34H 2R0LH 3PP3K 3UTPD 2AGJH 2WBJA 1VERA 4NN6C 2IAND 3REWB 1GOGA 1U92B 3TVMD 5D6DA 2R69L 1FN4A 3IXTA 4K8RH 4I3SH 3QEQD 3UXFA 2A0LC 3OKNA 1X5ZA 5TE6H 1VA9A 1GIGH 1NCWL 4Y1AE 5KVFH 1BJ1J 4YHNB 4LSUH 1R3JA 5JW4Q 1LEGB 2XA3A 1RUQH 3GUTB 3IDJA 4LLWA 1A9BB 4LEOA 1A9BA 2J88H 3BYTA 4EVNA 4Y7MA 4XPBL 3SBWA 5IR1B 4BKLB 4FQJL 1KG0B 2WIIB 2PYEA 3X3FH 3AAZA 5T5NG 5HGAA 4KJQD 4U1KA 2VC2L 1A64A 2DWEA 3DGGB 4FQXC 1G6RB 5BO1H 3T2NL 3LV3A 1RK1B 3U6RA 3WN5C 3IXTB 1AD9B 4M43L 4NZJA 4RISH 5IW6A 5J06A 1BOGB 4F7CB 1IBGH 1W72A 4FQXD 1CQKA 4L9LB 3EO1A 1LDPH 2ED7A 2H3NA 5DRZB 1KOAA 1MWAL 2X1QA 3IRPX 5I73B 5BZWA 2DYPD 2R8SH 4PJDF 2BVOB 4NOFA 2BC4B 3RRQA 3SDDA 3IGAB 4NYLA 4IDJL 3MNWA 4ZQKA 1IKFL 3C60D 2BSRA 2G60H 4K94C 3MRKA 3OKEB 2NTFA 5DMKA 3GI9L 4XRCB 2ZSWA 1U95A 3PP3H 1BHGA 4DKFH 2G2RA 5GGRA 1EMTH 4KHXH 3JTSA 5ICXA 1PX3A 1IC5H 1X5AA 4X8JB 3VWJB 3ILQD 2A83A 1YMMD 5IQ7L 4JKMA 2OJZL 5HGBB 1UYWL 4WHTB 2V2WB 5EBLB 4Z95H 3V4PL 4JRYD 4PJXF 4JO1L 1QVOA 1QZ1A 1I4FA 4EI5D 1ZA3B 2FWOB 4FQLH 4PRIA 4YDKH 4I18A 3SKOB 3PDOA 3KLHD 3DMMC 2Q8BL 1HIMH 2VL5B 4RSVA 1T1WB 4FQ2L 5JHDB 3M1BB 1Q1JH 3NCFB 1I8IA 3MBEA 2JELL 3OAYH 2Y6SD 3SE4A 5J57B 1DSFH 1F02I 1HEZB 2YOCA 5DWUL 1P2CA 5GZNC 1BD2D 3WHE1 1NGWB 2R1WA 3B5GA 2ED8A 4YHKL 4J2XA 1TXKA 1JNJA 2B39A 1KCRH 4PRHE 2ZUUA 1XF1A 4KQ4L 4HUKB 2Y6SC 3MV01 4U3HA 3ILPB 2BNQB 4QTIH 4PD4J 2Z93A 4MNHA 4XNMB 2NNAA 2BNRE 2IQAA 3QG7H 4NJAL 4O4YH 3FB7B 4TUKL 3D9AL 2Q86B 1CD9B 3C09B 2YN5A 5D2LE 5I15H 1OAZL 4R4BA 2XG5A 3TBVA 2ZKHL 4LNRB 2A9NH 4ZPVA 1AO7D 2VH5H 1CE6A 2CLRB 3ECBB 4YDJA 1MPAL 1W2KT 3S37L 2I60L 4NZTL 5BJTA 4QOKD 3TYGH 3ARXA 3IS0X 2CK0L 2ENYA 3HMXH 2YA2A 1ZV5A 2KL6A 4YHLH 3LRSB 3WFBH 1NEZA 2WBJC 3QIBA 4HSQA 1HXYB 4NQEA 2XN9A 3I84A 1EJOH 2VMFA 1OCWL 3BAEH 4I8DA 4XVSL 5CJ5A 1ETZA 2XG4A 1VCAA 3GB7B 5FDWA 4H88H 5GS2D 2ADJA 3CGTA 4FP8L 4HK0A 4TVPD 3TIDB 2VLLA 2NY7H 2P44B 4GAYA 4UB0L 4YHIA 2AJSL 2DIJA 2O5YL 3SDXE 2AK4E 4NNXA 1I1RA 2UY6A 5MERB 2PO6D 4M5YL 3ZKQD 3SQBA 1H5BB 1KTLB 3O8XD 3O2DA 3CC5A 3CCHA 1S9YB 1IGFH 3BH9B 3OB8A 1IFHL 4G9DA 3CFDA 4LF3A 4RIRB 1WZLA 4PJHE 3LQMA 3FZUD 3GJFA 2BNQE 3TWCH 3VD7A 2R4RH 5C09B 3B4NA 5MEQB 1VFAA 3BKMH 2FLBT 3MLSH 1G6VK 1UA6H 5IBUB 3I3DA 4O2FA 4U2YA 2G75B 1WZ1H 3MLRH 3OR6B 2VZTA 5SV3A 4YX2H 4P9MH 2NZIA 4QRPB 4PJHF 5ISZD 5C0FB 1HEZA 1E6OL 2P5WA 3Q3GA 4XPTL 3TBSA 1U3HC 5HYJD 3TCLA 3BEWA 5JMRA 3QQNA 4X0KB 3NTCH 1DVFD 1FFPA 1GZPA 2DM3A 1ZT4B 1JN6B 3EAKA 3I50L 1KEGL 3FAXA 4W68A 3GSOB 5EBMA 4L8DA 3VGDA 1CVSC 1QSFA 5HI4C 3V6ZB 3T0ED 4WTWA 3QDJB 3WXWH 3K8MA 3QCTL 1DVFC 4M4PA 4KMQA 2XZAL 2C3VA 1A6ZA 4PRPE 3W9EA 5K33A 1IAKB 3VXMD 4DEPB 1Z6JT 4AT6B 4NCC1 4GKNB 5J89A 2HJFB 2R0WH 5HI4D 1MIMH 1XAUA 2AK4B 3EHBD 5I16B 1F4AA 4JO2H 3G5ZB 2XICA 1NGQL 3BZEA 3S4SA 1AGCA 2VRAA 3HB3C 4QNPE 4GLRI 1KB5H 3K46A 4P9HH 1DBAH 4J6RL 4KGJA 1WEJL 4QEGA 5JW4N 4PJHB 3KHOA 5IQ9B 1DQDL 2AXFB 1XR8A 3U46A 5D5MF 3NBNA 2DL2A 4L9LA 4KJWD 4LRIC 4KRPD 3TT1L 1S7UA 4KI5F 4RX4A 1S78C 3LQAC 5J13C 3QULA 1QSFD 4HK3N 1NGPL 4DQOL 4HZAA 3JUZA 4UDTA 3KPPA 3MV7B 2K3TA 4QRPE 3EJZD 3TBWA 1PG7H 3V52H 3TO4D 4AL8L 3EW3B 3MOAH 1V7MH 1BZQK 4R4BB 1LEIB 1U8MA 4MLIA 3AREC 4L4VB 1P7KB 5DS8A 1MQKL 1QRNA 1LEKA 5HYQB 3EOTH 2F8XC 3MLYL 2V5MA 3BIAX 5HVGB 3QT2A 4L1DA 4F2MA 5C8JB 2GJZA 3P4OB 5L2KB 2C3GA 5TQ2L 1I9EA 2DKMA 4ZS7H 1FO0L 3HAEA 1CS6A 4X6CF 3NACL 3REVA 5I76A 3TA3B 4YHYC 1YPZE