5JXED

Human pd-1 ectodomain complexed with pembrolizumab fab
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
218
structure length
197
Chain Sequence
b'QVQLVQSGVEVKKPGASVKVSCKASGYTFTNYYMYWVRQAPGQGLEWMGGINPSNGGTNFNEKFKNRVTLTTDSSTTTAYMELKSLQFDDTAVYYCARRDYRFDMGFDYWGQGTTVTVSSASTKGPSVFPLAPLGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVTCNVDHKPSNTKVDKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 1
publication title Structural basis for blocking PD-1-mediated immune suppression by therapeutic antibody pembrolizumab.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 197
sequence length 218
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jxeD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jxeD01
3Q1SL 4TRPH 1U6AL 4QXTB 3PGFL 3VD9A 5IMMB 5C0FA 4QHMB 1IGIL 2QLVB 4CADB 1JUFA 3MJ8A 3CX5J 1QQDA 3HRZA 1E27A 1FV1A 4XI5D 3WUWA 3STZA 1NDMB 1CLZH 1M1SA 3JTSA 3NIGF 4LPWA 2HH0H 4KKBC 4QHNA 5D1ZB 4QY8A 5J6GA 2VDLH 2WBJA 4NJAH 4DN3H 4OLXL 1F3JB 3RWFA 3L3KA 2P8MB 3UO1H 3IGAA 1IZKA 5I8OL 3PHSA 3BQUA 2GYSA 5SWQB 5E9DA 1A6PA 3O9WD 5D9SB 3VGDA 3LEYL 1U8KB 3C08L 4NQCE 4WDIA 4OD2B 3KS0J 2R39A 1DR9A 3KNBB 2NY5L 4JFEE 5IJVA 1T83A 3G6DL 4OB5L 4ORGA 3EJZC 5C0CA 3EO9H 2ICWI 4X6EA 1A4JA 2V5MA 5IF0B 3IFNL 4XXDA 1H15A 3MLYL 1G0DA 5EFIB 5KZCB 4TOYH 5D2LA 1OGTA 4MDIA 1MCWM 5HY9A 4BQ8A 2R4RH 1C08B 5JO5B 2VIRB 1DQDL 5F8QC 3CFDA 3O2DH 4OKDA 3ROOB 2A77H 1J88A 1UH3A 4N0FB 2ZJSH 4NC2B 4FTVA 3MRKB 3MRGB 1P84J 4BH8A 1F2QA 1EHAA 1XGYL 4PJHF 1CE6A 2Q7YA 3L3IB 3GMPB 4Q6YA 1CIUA 3EYFA 5KAQF 2HFTA 3W82A 3OJDA 2F74B 3FONA 3U9UA 1Y18A 3KPRB 1SYSB 3WNKA 4PJCA 5DZNA 3SY0A 5C92A 5ALCL 2CR3A 4HT1L 4L9LA 1FC2D 1OPGH 5GJSH 5B38A 3K4DA 3RWHA 5D7IB 4MJIB 1XCTA 3C6LB 2NW3B 3DHJA 3WEXB 2IPUG 4ZPTB 3SPVA 1GZQA 3OPZH 1Y6NR 3HI6L 2X4PB 4X6BB 1AR2A 5CAYB 3W9EA 5FYLH 3FMGL 1QRNE 3GSWB 4JFQA 1DEDA 5I1KL 2XPGA 4G43B 5EBMA 4ZUTA 1ACZA 4D2NA 3F8UB 4P4KA 5I30L 2J8UE 5J1AB 4O51A 2I9LB 5ELIA 4LL9A 4YC2C 2AQ1A 4QHLA 3BGFC 3VXUD 3SCMC 1BVLA 4GUPA 3QNZA 3EO0A 1FVCB 2G60L 5GRJH 4U1KB 3PV7A 4H8WC 2Z91A 5JOPE 1T2JA 2R9HC 5TQ0L 3HMXH 1CFQA 1AJ7H 3FT2B 2DIJA 4O2FA 1BZQK 1Q9LA 3B3IB 4PV9B 3VXNA 1EJ6A 1R3HA 4LKCB 5JIHA 2C1OB 3LHPL 4OZHF 1A1OB 1KN2H 3H9YA 4WW2C 2HTLD 4KTYA 2H45A 1CFBA 2JJSC 3C5ZD 5F9WC 2L7UA 1WWAX 3BDYL 4KAQH 4PRBB 4YDJA 1VFAB 5JORA 4LLUB 4PYHA 1XIWC 3I6LD 3MJ9H 4ONFH 1J86A 4JRXA 5J8OA 4UILL 5FYKU 4XNQB 4Z76A 4QXUH 2X44D 1E6OH 4ZSOE 3FJTA 1TJHL 3VFMB 2DLEA 5IVXB 3B5TA 1HQ4B 4Z7UB 3VFUB 1T1YA 1OARH 1AKJD 1H3PL 2AEWA 2EZ0D 2HRLA 1GGBH 3VRIB 5KSVA 4IOFC 3HC0A 2PO6C 5BVJB 5KSBF 4YHOH 1MAJA 4XWGL 1MFDH 1ZHLB 1CL7H 1CDIA 2EE2A 5CMAB 5B8CC 5L0QB 1QR1A 3VW3L 3HFMH 3O3AB 5L9DH 3CPLB 2XWTA 3BIAX 6CGTA 1CR9H 2V2XB 2FX9L 2GJ6B 2ZCHH 1OF2A 4F57L 5DVLA 1IE5A 4PGBA 4V2CB 3ALXA 1CDHA 4PGJA 2ESVD 3TVMD 3RAJL 5KW9L 2OR9L 4OGAD 1EFQA 4UZGA 5HD8D 1UYWL 1JNNL 1B9ZA 3QUYA 4NWUL 1WLHA 4ZAKD 3MUGA 1T04A 4Z7VE 2JE8A 4KXZH 3V7MA 1UENA 4PLJC 4XPTH 3C8HA 3BP5A 4ODUB 4YK4B 1FO0L 2X9XA 3WJLA 4P3WA 2P24A 4EUPA 5C07D 5J6HB 5HDQH 2PYEB 2C3VB 4Y5XB 3JTTA 5FCUH 3VMNA 4PGDA 4NT6A 5C9JB 3FB7B 3WFDL 1RZ7H 1XGPA 4TVSa 3CFCL 2FR4A 2AEQH 5JHDE 2CMRL 3HE7B 5EU4A 5CEYA 4DUVA 4Y89A 4ZUUB 2FNBA 1V7NL 2OR8A 3MXVH 1MCOL 2VXVH 3I02B 4ZYKA 1U8HA 1L7TL 1WF5A 5J12C 3MQIA 2QADC 1JPST 1HXMB 3AROA 1QSED 4YHIB 1KB5B 4B0MM 2BNRA 1EV2E 4JM4H 4LSVH 3OF6D 4XPGH 2X4SA 2YUWA 1ZLUK 5HYIA 1BQHG 3BSZL 2JCCA 5INCA 4YLQT 1DANT 2H26A 3O41B 1W72L 2XI9A 3DRTB 3HKFA 1YN6B 2V5RA 1U8LB 3ZE2F 3IDJB 3P4MB 2AV1A 2YKLH 4MA7H 3PGDA 4XCEA 3UTPE 2CO7B 3T4YB 1BZ7B 1EZVX 3ZE1E 4AK1A 1JYNA 1MI5E 2O5ZH 2R29H 1D9KB 2FGWH 4MA1C 4F33B 4ZXBD 4XCYA 4M1GL 2OMBA 3SN6N 3CDGA 4MS8C 1EHNA 5MEQA 5BZDB 4K94C 2HJLA 4YDLC 4RGND 3K1KC 5DS8B 4L4VA 2HKFL 3QJHA 5KSAB 1A6VL 3U4BL 4JY5L 4LSQH 2X4TB 2CLRB 1TXKA 3TBVB 4ZNEA 5DXWA 4X7FC 2COQA 3O8XA 3R06A 4HJJH 4M03A 5C0IA 4OUUB 5HBBA 4F9LC 4PJ7B 1P2CA 4P23C 2FB4H 2YBRA 2R2BB 4QOKB 4Y4HC 4PRHE 4POZC 1S9YA 5FO9A 4O02H 3L95B 4OCRL 5TF1H 3SDYL 2NY2D 1IC1A 4PREA 4ZTPL 2OTUB 4M7LT 2GJJA 5I75C 3W39A 5D1XC 3Q0HA 3QXDB 1IC4L 1KJ3L 1EVUA 1VACA 5K9OA 2CDEB 4YGAB 3MJ7B 5TE4L 1NGZA 4NQDD 2R1XA 4TULH 2DI8A 4J3VA 3I2CH 4JFDD 3WXWL 5D7IF 3PWVA 3W9DA 1D5BB 1FYTB 3QUKA 5CJ8A 4LCCB 5MEPA 5GSVA 3EDFA 3QIWD 4WWKD 4EXPX 2PXYC 2WUBH 1BIIB 1WJ3A 3J7HA 1AQKL 3GHEH 4XC3H 1ZLSH 4FFWD 3DXAA 4LSSH 4XP4L 3BZEB 3C8DA 5IMOB 1G7PA 5KVEL 4Z7WB 3HCVA 4FN0A 2FWOB 1E4KA 2JJSA 3LRSB 2EXWD 5DRZB 4QNPE 1DFBH 2E7LC 3P4LA 3VRJA 3BO8B 3C09B 1ZS8A 3MRNB 1XIWA 1PG7L 1KCRL 4U4BA 5CKAA 2K1MA 2KH2B 1OGAB 2IADB 5IFAH 1FCCA 1P53A 4KI5F 2BNUB 3QQNA 4URTB 3GRWA 4FQJH 5ADOL 4HKBB 2VXSL 5JXEA 2D7QA 2Z31A 5FGCB 2MQ0A 4PD4K 1KPRA 1C1EH 3C2AL 1NBQA 2IG2H 4HGWA 4XZUB 5M94B 1LE5A 5GGQH 5HYSA 5HGDB 3CUPA 2F8XC 1S8DB 2O93L 5B8CA 5GRXG 4L4TD 2QSQA 2CJUL 1F11A 5EUKB 3I50L 3UMTA 3WXVL 4UQ3A 3KYOB 3AB0C 4YGVB 5F7LB 1FSKB 3ZT7A 1IEBB 4RIRB 3T8XB 3I9GL 4JZJC 5FUOH 4Y4FC 1BBJA 3RZCC 4FG6C 5IVXF 4JHAL 5IW1B 5CEZH 1N6VA 2BVYA 5C09B 2EIBA 3QDGD 4P2OB 2ICWA 3QZWB 3PWUB 1J0JA 4XCNA 3DMMC 5EU6A 4OFYD 5IW6B 5JXAL 3TT1H 2V2WA 4JKPH 1W8NA 5K33A 1UB6B 3B5HA 4NN6B 2LV4A 4XPFH 3GGWB 3K3QA 4YXLL 4GQ9H 3K80A 1OQOA 4KKCD 4QF1B 1JRHL 3I6GA 2ZP0T 4UOW1 3NPSC 3KPPB 4LQFL 5FYLE 4GAYB 3NPZB 2EO9A 1MHCA 4K23L 1NCAL 5H94B 1AGDB 4MJ5B 5F7YC 4NQEA 4OIIL 2KPNA 3HE6A 1RJZB 2BJML 5CHNA 5I2IA 3QPQC 1MPAL 1KBGL 4F7EB 3MRLA 4GW1A 4U3HA 3OZ9H 1A7PL 2MCPL 4QRQB 1NC4B 5I1JH 4YHZL 1F58L 1OLLA 5E8NA 4P2QA 2IGFL 4EI6B 1ZA3B 4KK6D 1T89A 3OKLA 3VRLF 1FZJA 4RMRA 4ZPVA 3O45A 5C7XH 5INDA 3FQUA 4PRPB 5JZ7C 5ICYB 3ARED 4P46A 1A7QL 2OJEB 3RVTD 4QYOB 4MVBD 5GRWA 4DFHA 4BQ6A 4M7JL 4WEMB 4OCMC 3DO7B 4MJ4A 5EBLA 4YIQA 2NY3C 4BUGA 3ARSA 3D39B 4H25B 1NC2A 3MCLL 1QFHA 5TGBB 3V5KB 4R7NB 1MRFH 3JWDH 2XN9B 3PWPE 4KHTH 1FAKT 4FNLH 4OFKA 1J1XH 2SEBB 1XT5A 2DTML 1QFWI 1J0ZA 2KZ1B 5FHBL 1KB9K 5HVHB 1BLNB 5T1LA 3H2WA 1MWAB 5F89A 3BESR 4BFGA 4LNVA 9CGTA 3D0LB 4PYGA 2VXUH 2QQKL 1Q9WA 4N8CL 3S34L 3MA7A 4HC1L 2EKJA 3RNQB 2DTSA 5T3XD 1U58B 4NZTH 5IQ9A 1VCAA 3U79A 2FZ3A 1JNLH 4TRPL 5A16A 3P9MA 2XQBH 3T0XA 4R97C 3WCYA 5DQJA 3LQZA 5EOTB 3UBXG 2ZOKB 3MX0A 4HWZB 2KQNA 1AR1C 5T1KA 1CLZL 1NH6A 3QG6A 3PJSB 1UVQA 1OTSD 2VDLL 3NH7L 4J3OC 4X9GA 5D2NC 3WFHA 4NJAL 2OQJB 4DN3L 3RGHA 5BV7H 4JREC 5FA4B 3UO1L 4K3HA 4PLKC 5HDLA 1FNFA 1JP5A 1UZ8A 2WBJD 1D6VH 3U1SH 3DETD 5CWSB 4NC0B 3P4OB 5EIVA 4NCC2 1EX0A 4OIBA 4ELMF 4WHYH 3GB7B 1NL0H 3BQUD 3GJEA 4Z7OF 5L2KE 5E9DD 3EO9L 4HUWB 3FN0H 3WIIH 4H8WH 2APVA 4OBSA 3JV4A 1MJ8H 4TOYL 2YRPA 3IU3A 5KOMC 5TH2B 5L2JB 1IQWH 1CICA 2R4RL 3U0TA 2AV7A 2J7LA 4F2MB 5C0CD 4HS8L 3O2DL 3L3OA 2E7LA 5LWYL 2A77L 4PJBE 3ECBA 1YMMA 2ZJSL 1GH7A 1URLA 4UV4H 1XR8A 4G7VH 4G9DB 2J88H 5D8JH 5SX4H 1CGUA 3REWB 3C5SB 1KTLA 5CZVH 4N0UE 1MJUH 1N0XH 4FTVD 1C7SA 4U2ZA 3G9VA 4Z9KB 1Z2KA 1YUHA 2QL1A 3G04A 1S5HB 3WLBA 4Z7WF 2W1NA 4OFDA 3MROA 1ETZB 1OPGL 4U6HB 5GJSL 1VPOH 3VH8B 4O2EA 4BSWA 4E0RB 4CW1B 3EYVB 4XAKE 1NCWH 1JWSB 2PW2A 5F7WC 5LJYH 3O6FB 3OPZL 4P5KA 2YPLE 5C6WH 4PJ9A 3ULUC 5KANG 5FYLL 3ZKMD 4G8EA 3OHXA 4UIMA 4F9PA 3FCTB 4R7DA 4L3EB 3N9GH 1CFSB 3ZKXB 3CSBA 4HG4K 2GFBA 2OCFD 5ICXA 3PUCA 1IM3A 3QUXC 2Z8VC 4OZGA 4UNVA 3DV4A 1GVIA 3HI1B 2YD7A 2QHRH 1RIUH 4WFED 4QTIL 4P4KD 1LVEA 2APTA 5EUOA 1T7XA 2A73A 1RHHA 3SGEH 3LQAC 1AJ7L 3LN5A 3OB0H 1PVHA 4HUXB 4IDJH 4LHQB 3TC9A 5HYJE 4K7PY 5I73C 4OAWA 2VLKB 2OR7A 2X6MA 3C2SA 3TJHD 4I2XB 3GSNA 1KN2L 4QHKJ 4PFEA 3P0GB 4M4PA 3UPRB 1MLCB 1NBYA 4JN1H 4WHYG 2LU3A 1J12A 2MOVA 2XG4A 4WFFE 5ITFB 1TZHB 4KAQL 3KPQA 1GGYA 2O26U 5FKPB 3WNNA 2R0ZH 3MV9E 4Y1AE 3SDDC 3MJ9L 1AGEB 4ONFL 4ZS6D 3KYNA 3D0VA 3GMLB 4QXUL 4MCZA 1E6OL 4LDOB 2DM2A 3ZKNC 3RDTB 1OARL 1GGBL 1T1WB 4X9IA 4JRXD 3GSXA 3TN0B 2EDDA 2E6JA 4YHOL 3U6RB 1MFDL 1CL7L 4JM2B 1ZHNA 3ZT6A 4PJEF 3D6GA 3B9DA 5GGSY 3HFML 1FL3A 5L9DL 1I9IH 1CR9L 3O6MH 2ZCHL 3FRUA 4U31A 5BS0E 4QEGA 1Q9KB 4YNYA 4LU5H 1BVKA 2ZKHH 2J4WH 2JJUA 4H0HB 4FZEH 4PJHA 3TO2A 3KG5A 3ZYZA 1AD0A 4HBCH 4OCWH 4KMTH 4BKLB 5E2VL 4JFPB 1Z6JT 5LAXB 1WEJH 4MQSB 1J11A 5SWSA 4XPTL 5HHNB 2MMXA 1ULVA 3S4SB 4GKZA 1JPFB 4Q9CA 1NUGA 5HHOE 3CMGA 5HDQL 3QUYD 4N1CA 1IGFH 3TNMB 5IJKC 2X9YA 1AXSB 2P5EA 3LV3B 4LVOC 3RPIA 2AEQL 2CIIB 4PB0H 3V6ZA 4OCSH 1DVFA 4TVPH 4GXUM 1P69B 4Z7QF 5D2NA 4HKJA 3ILPA 4Q97A 2YD1A 3MXVL 3ZE0F 2VXVL 5CEZE 2K3TA 3CC5A 4J3TA 4GLRI 1ZVSA 4KJWC 5CILH 2LVCA 3QQ4B 3DRQA 4IOIB 4Y19A 5C0ND 4XNXH 3QH3A 2HG5A 3TPUA 5IHUH 4E41B 3T0EB 1WBZB 3KPTA 4PP1D 4R4BB 4LSVL 4KGLA 2ICES 4XPGL 4DK3A 2XZQH 4J6RH 2DQGH 2P8PA 4FQLH 5E0QA 2WIIB 5FO7A 3MRIB 3C6LC 4UAOB 1MF2H 2EDQA 5K9KB 1QNZL 4K3DH 4UV7L 4GO6B 3BE1H 2BNRD 4QT5A 1FVEA 4C83B 3QCUH 3N1MC 2YKLL 1G7QA 4MA7L 3LKQA 3V5HB 1PD6A 3LKPA 4OZHA 5DJ6B 1R3JB 2OL3B 1AHWB 3QDJA 4XNZB 4LLYA 4IRSB 2BSSA 1FRGH 2O5ZL 4ODBD 3MV01 3Q6FA 2FGWL 2M26A 3EOBB 4M62H 5C0BB 5DMGC 1G6RA 5F7UA 1J5OH 3B2VL 1JTTA 2VWEC 5F44A 4MMXC 1YECH 3F62A 3H6JA 3MLXH 5MENB 5F7HA 3OXRB 4ELKA 3V6BR 4HBQA 4L4VD 4X4ZA 1CD1A 4EVNA 5KSBA 4HH9A 2FB4L 1A9BA 2E7CA 5GXBB 1C7TA 1T1XB 4L29B 4HIJB 3TIDB 1U93B 4O02L 2ED7A 3O8XD 5TF1L 4X5XA 3WS3B 4XMLH 3RNKA 1F00I 5BMFH 3W0WE 3R8BB 5C86A 2BSRA 3WS6C 1IVLA 1KNOA 1QLFA 2KKQA 4TULL 1BFSA 3EDEA 3FFCE 3I2CL 2DN7A 3CFKB 3D3VE 3TJEH 4TSAH 1QBMH 5L0QC 3K81A 4JVPA 2WUBL 1LP9E 1U8IA 1VHPA 4MXQC 1BZ9B 3GHEL 4XC3L 1ZLSL 3KLSA 4X6FA 4QKXB 4LSSL 3OR7B 3QNXB 4X4XA 1YA5A 4YBQC 1NFKA 4M9PA 1DFBL 4CL7A 4LCYB 4GG6E 5FK9B 3DXAD 5A2LH 4M1DH 3HTLX 1S7VA 4D9RD 3TA3A 5I1LA 1O7VA 5IFAL 5J3HC 1P7QB 2Y5TA 1ZHBA 4GXUN 1M4KA 4YK4C 5DMKA 2JELH 4OFPA 5DTFB 3EJJX 5IMMA 4FQJL 2XXMB 1I7TB 5DJZB 3TBYB 1EJOH 2YRZA 1HYRC 4CADA 1XIWD 1YZZA 4LMQE 1CVSC 2WLYA 1RJCA 1EGJA 1ZT7B 1NDMA 1C1EL 3F7YB 2KDGA 2IG2L 5D1ZA 5GGQL 5B39G 2BVUA 2HJKB 4JVWA 2UUDK 5JXED 1IZJA 2Z31D 4P99A 3ARWA 2PO6D 1JFQH 5D9SA 1U8KA 5FUOL 4YXKH 4BZYA 4NO2B 4TTDC 4JCMA 1EBPA 2IFFH 3NZHH 4MA3A 3UTSE 1GXEA 4PG2C 1OVZA 2MQ3A 1XCQA 5FYJH 1C16A 5HSFA 43C9B 1QLRB 3SEPA 1X5LA 2HT3C 4PP2B 1EEYB 4JKPL 2VDPH 1E4JA 5JO5A 2VIRA 3QCTH 3LS4H 3S37H 4GQ9L 3ROOA 5EU6D 3G5VB 4N0FA 4PLJD 1NFDB 4PJGE 3REVA 2WUCH 1I1AC 3NAAH 1WFOA 1OAXH 1T20B 1U8QB 3MRKA 1IBGH 4KJPD 3MRGA 4LGSB 3MGOB 1D9KC 5ID0A 1NBZA 3NCJH 1ZLVH 7CGTA 1VB9A 4U1SA 2AJUH 3O4LB 2VSCA 1TJIH 5ISZE 4ODTL 2N4IA 4KVCH 4TUOB 2AP2A 1EFXB 4WNQA 5DD3H 4G80B 1HSBB 2AXFB 1I3RA 5CCKH 5KSAC 3KPRA 1EO7A 1SYSA 3CVIH 1PKQE 1BEYH 1CFVH 4NQED 3HE6D 3LH2H 3IRPX 3O6KL 3ZDXF 2BXYA 3UJJH 3NA4A 3CH1B 5C0AE 5IG7B 3IKCA 2P7TB 4DK6A 4DZBB 5D7IA 4MJIA 4RFNB 5C7XL 4R26H 2NW3A 1HWGB 3WEXA 5LGJB 3FL7A 4J7RA 1HH6B 4P2QD 4X6BA 2PR4H 1HI6B 3GSWA 2NTSP 4G8GB 4U1IB 1WFTA 4NNYB 3QWOB 2NNAB 4CN4A 4BZ1H 5SWZB 4P46D 4V1DB 5SX5K 1MRFL 2I9LA 3JWDL 3T2PA 4KHTL 4M1CC 3RJDA 4FNLL 3SKJH 1NAMA 1N4XH 1DJSA 3SDXB 4JFYA 3TYFA 5CBEB 1FVCA 1J1XL 1NDGB 3QUMH 3SGKC 1IGYB 1NC2D 3RHWF 1OM3H 1RMFH 3WD5H 3FT2A 3ZYIA 5DEZA 3MR9B 1RJLB 4AIZA 3B3IA 1JMXA 1T0MB 2DQUH 2VXUL 3QRGH 4PV9A 3F65A 3DROB 3ELAT 2ORBH 2OTWB 4XMKH 2F58H 4KPHL 3W11D 5DHYB 5T1LD 1A1OA 1JNLL 3T0WA 3H9SA 1IJ9A 5DJAB 5IQ7H 1DE4B 2XQBL 4OLZH 1T5WA 2I27N 4PRBA 3SGJC 1VFAA 3C09C 3BJLA 5C08E 4LLUA 5ERWB 3FQWA 4AENB 4RSVA 5BV7L 4Q9RH 5IVNA 5FUZL 3VFMA 1D7FA 1UXWA 1HYSC 4KKAD 5AAMA 5T1KD 1AFVH 5IVXA 1HQ4A 3VFUA 3JUZA 1SY6A 1ZTXH 2WP3T 1J8HB 3VRIA 1ZGLM 1TQCB 2VR9A 3RWJB 1D6VL 3U1SL 3HUJB 1ZHLA 3GMQB 5IEHB 2VJXA 3Q5OA 3HZYB 5FF6B 2EC9T 1NL0L 4W4OA 2EYSA 3CPLA 2V2XA 2GJ6A 2I60H 3WIIL 4H8WL 2APXA 1V5JA 3GJFB 2D7TH 1MJ8L 4TVPE 1HE7A 1CI5A 2XY1A 1RURL 3T77A 5MEOA 5DHVH 1F4HA 2W07A 2FJGB 5B21A 5GHWH 3MYJB 4HWEH 5AWNH 4LPXA 5IWLC 4OCXH 2E9BA 3RL1B 3BGMB 4QRUB 5D93B 4P2OC 5AEAA 3VXME 4UV4L 1OTUC 1CICD 4G7VL 4XH2B 2J88L 1E6JH 4LCWE 5D8JL 5J1TC 5KS9B 4M6NH 4ODUA 4HCRA 3MOAH 3X13A 5CZVL 4NDMB 3LEVH 5J4MA 1QG3A 1U3YA 4NN6C 1HDMA 1YMMD 3RWIB 1KCUH 2C3VA 1MJUL 4Y5XA 5J6HA 1N0XL 2P45B 2DBLH 4G6MH 4EDXB 2F5AH 5C9JA 4Y16C 3FB7A 5DDHB 4ENED 1XGTB 2MJWA 4CNIA 5D96B 2NY4B 3AAZB 4LARH 2VR5A 4R4ND 2XZCH 3PG2A 3HE7A 1FFQA 1A7BA 4ZUUA 1DN0B 4P57B 1VPOL 2JTDA 1NCWL 1GPOH 3OGOE 4XTRD 1CLYH 4RAUB 1SBSH 3L5HA 4FZ8H 5E99H 2EDOA 4GBXA 2V5TA 4P9HH 2FBJH 3QIUB 1I1FB 1U36A 1FO0B 3N9GL 4H0GA 4JFEB 3V8OA 4PJ9D 1VFBB 3FO0H 2F19L 2VB5A 4PG2A 5CIPB 1XMWA 1PSKH 4JDTH 1BX2A 1NKOA 1LE9B 5ALBH 2QHRL 3O41A 1J05B 1RIUL 1M05B 1JZ6A 1GAFH 3IDJA 3P4MA 2R56L 5CEXB 3EOTH 2XIDA 4X4ME 4W4NA 4UTAL 4OBRA 3VXUE 3T4YA 1A9EA 4IDJL 5FKAB 3AS2A 5FV2A 1OAZH 3U0PB 5IFHL 4GRLB 2DOCA 4JQXA 1SBBA 2WQRA 5L7XH 1D9KA 1Q9OB 1BD2E 4FQ1H 2DLGA 4IOSD 4JN1L 5BZDA 3RUGF 4YR6B 5HVHC 3F7VA 2V2TB 5DS8A 1RZKC 4HJGB 5KSAA 5T1MB 1N3NA 3GBLA 1CXFA 4X83A 1HHHA 2X4TA 3DVNA 4Z7NF 1W72B 2R0ZL 2CLRA 5ACMA 4L1DA 3TBVA 4M7ZB 3RGVB 3DBXB 1Y6KR 4HEPG 1DTUA 3ME0A 3PXJA 3T04D 4X9FA 8FABA 1NFDF 4OUUA 3SGDH 1UJ3B 4ELMA 4U05A 2R2BA 1C5BH 4Q6IA 5J57B 4K7PH 3QXAA 3L95A 1QRNB 1II4E 2CIKB 4JB9L 4PD4J 3LB6C 2OTUA 3T2NH 1I3VA 3O3UN 2J8UB 1ZE3C 1I9IL 1X5AA 1GYAA 2P8LA 4KRNA 4I9WD 5IVZB 3MJ7A 1A6ZB 4IRJB 5M7QA 2NY3D 1B4JL 4QRTA 4Y5YB 4LU5L 3B9KB 4MHHG 3H0TA 2J4WL 3ARYA 3DVIA 1FYTA 4G6JH 4NN5B 4LCCA 3MUZ1 2YD3A 1HH9B 5CD3B 4FXGB 5BVPH 1ORSB 4MAUH 3RIFK 1PBYA 2YUVA 3RP1A 4AJ0A 4OCWL 1BIIA 4HUKB 4KMTL 4FABH 1WEJL 4XC1H 5GGUB 3MRMB 4Z7WA 1A7NH 1IGFL 5DRZA 1KF9B 4UT9L 4XBPA 4J23A 4R3SA 2C9AA 1MFEH 1KCKA 3SGJA 4X6CE 5SWSD 2ATPB 4PB9L 5DGRA 5HYFA 4OCSL 4Y7MA 3QHFL 4FFZH 4NUJB 1X44A 5I8EB 2IADA 5IVOA 3THMH 1L0XA 3NFPA 2BNUA 3MZGB 5BOPA 2P5ED 1B0GB 1M71B 2DQDH 4LLVA 1H3VA 5FYJE 4ZSOB 1AR1D 4HKBA 4MQXC 5E6IC 1DVFD 5DSCB 3LN9A 2OYPA 5IHUL 4OF5A 1EPFA 4XZUA 5IMLB 5HGDA 3VG0L 3O3EA 2D3VA 5EC2A 1S8DA 2XZQL 4J6RL 4WI8A 1MELA 2B5IB 2NYYC 4RRPG 1R3IH 4MCYA 1I9EA 5EUKA 2BVOB 4ODSH 4F58H 2Y07H 3O6FC 3KYOA 2ICWJ 4YGVA 2YRLA 3BE1L 3RWGA 3RY5A 3EOAB 1I8LC 2C5DC 5E5RB 2RHEA 4RIRA 5C1MB 3QCUL 4JGUA 3IJSB 4HS3B 2Q8AH 3DIFB 3TEUA 3MXWL 4I13B 3RWEB 4BQBA 2FIKB 5HYQA 5C09A 4I3RH 4PGCA 1FRGL 3QZWA 2HFGH 1K4CA 3PWUA 2ZG3A 3MLSH 4M61A 4WHCA 5DJDB 4Z7VB 4Z0BH 4M62L 5IW6A 3G5XA 3TCXA 2AAVA 1ZT1A 1UB6A 1YEFH 1MCWW 3ARZA 3QDJD 2BC4B 1FPTL 1A6AB 1KB9J 4J12A 4ZOCA 2HLAB 4QF1A 3BPCB 3F5WB 2DJ4A 3WN5A 1YECL 5KVMC 3KPPA 3MLXL 4GAYA 4M00A 5CJOH 2AW2A 4XCFH 1HHIA 5C0GB 5JHDB 1ITCA 5E8OB 3LQMA 4H1LB 4RGNE 2ZUVA 1AGDA 1KYOK 4MJ5A 4NGHH 3WO3B 1RJZA 1OSPL 4KQ3H 1ZWIB 5DUBB 4LHUG 4PJEA 1B2WL 5KS9F 5FB8B 3QIBC 4QRQA 1NC4A 4WUUE 5EB9A 4RMWA 4XMLL 4EI6A 4MSWB 3VXOB 1X5ZA 1RZGB 4G7YL 5EA0H 2ICCA 2DQHH 2V6HA 2OZ4A 3S96A 5BMFL 4LLQB 4U0QB 4GOSA 3EBAA 5DD6A 3ULUD 4GAJH 2J5LC 5E8PB 5ICYA 1CU4L 5IB2A 4GW4A 2OJEA 3RDTC 2YSSB 4QYOA 4XVUC 2NX5A 1A1MB 3AMLA 3N1FC 2VRAA 3DO7A 3TN0C 3VJ6B 4KROD 3MRQB 4F15C 1QRKA 3N85L 4TSAL 3TJEL 1QBML 3D39A 4JM2C 4H25A 3NZ8B 1G7LB 5IKCA 2FJFB 1MHEB 5TGBA 5IBTH 4R7NA 2XN9A 4HUMB 5T5NF 4X7CC 3QEQB 3BAEH 3WFEL 4OLEA 1MI5B 1QVOB 2SEBA 1S9XB 2MHAA 1UH2A 3BP6B 1BLNA 4H5SB 1MWAA 3CFJB 1KJ2H 1ED3B 4RA0C 2DYPB 3CH8A 3WHE1 4B7IA 4M1DL 5DC0A 3RNQA 1GL4B 5FFLA 1U58A 4C54A 1NGXB 3MFGB 1FFNB 4L1HA 2JELL 3G6JE 3SE4A 5I19H 4HV8B 4WHTB 2OK0H 3GBNH 3HC4H 1GC1C 2A74B 3IDUA 1I7UB 5EOTA 3DUUA 1ZXQA 2A83B 3TA3D 4LLWA 1QKZH 4PRHB 2DI9A 1N8ZB 1JBJA 4LDEB 1UG9A 2OQJA 1YEEH 5FA4A 3T65B 2H9GA 1I85A 1DQJA 1AGBB 2AXHA 2G75B 1JFQL 3L5IA 4EI5B 4MX7B 4JRWA 5D1ZD 3BZFB 1HQRA 1WTGT 3SJVE 3RA7H 4JFFE 4M8QB 1ZLUH 4YXKL 2HAZA 5CWSA 3U82B 3P4OA 2FD6L 2IFFL 1VA9A 3DURB 3NZHL 1FH5H 3GB7A 4NPYB 4UTBH 1VGEH 3B6SA 4BELD 2R0LH 4HUWA 5FYJL 4F7CB 5GZNC 3QYCA 4UAOC 1N59B 5F96H 5JPMB 5GZOD 5E8EA 4EUPH 5EO0B 5TH2A 3MLPA 2J8UF 2VDPL 5GRYA 4DN4L 5HVGB 4HF5H 5I8CA 5JPNB 3QCTL 3S37L 4F2MA 5IBLD 4MNGA 3QDGE 1FG2B 4LP5A 4X6DF 4P48A 1AHWC 3D85A 4XNZC 5KZCD 4IRSC 3NAAL 2B1AH 1F4WH 4RFEB 1IBGL 2X7LB 4G9DA 3DYPA 3P11H 3NCJL 1B4RA 4LGPB 3HPLB 2YZ1A 1CTNA 4HFWB 3QDMA 4HIHA 2AJUL 2FX7H 1TJIL 4PJXE 3C5SA 1UC6A 4KVCL 4JLRB 3BT2H 3R4DA 5KN5B 5DD3L 5FCSH 1BVZA 3L9RA 1BQSA 3CVIL 1S5HA 1BEYL 1ROWA 4IRZH 1CFVL 4FFYH 3E2HB 4BJLA 3LH2L 2ZG1A 3FB5B 3QDAA 5CSGA 3Q6GH 2EDYA 2A6IB 1UWEH 3UJJL 1HHJB 1S7XB 2DLFH 5GRZA 4IM8A 5AAWA 4E0RA 3EYVA 3N1GC 1UZ6E 4K3EH 1JWSA 3KPRD 4R26L 4K8RD 4M3JA 1I8LA 3RVVC 3ARDB 1ZKAA 3FTGB 3AS0A 4JFZH 1PG7W 4ZFOL 5GGRY 4MJID 3HC3H 4L3EA 3ABZA 4YDVB 3VI3E 4BZ1L 1RPQA 5EU7C 4YAQA 4GAFB 5LXGH 3V6OA 3SKJL 3HI1A 1N4XL 3L3GB 3QUML 3L3DB 5JQHC 2Q86B 4W6WB 1XF5A 1KCLA 1MCFA 1OM3L 3V4UH 4WW1B 1RMFL 3WD5L 5FECB 3MLWH 1AC0A 4YXHL 4OF6A 4HUXA 3H42L 3QRGL 2DQUL 3Q2CA 1KG0A 5C2BH 4JQVA 1A7RH 4P5MB 2VLKA 5DMGD 5ESAB 5FO8B 2ORBL 1FIGH 4XMKL 2F58L 1BHGA 4DKDC 4I2XA 1QSZA 4J8RB 2DIBA 1HN1A 2P1YA 4ODWA 2FDBP 2CRYA 4LVNB 5IQ7L 5ITFA 3MRBB 1S78C 1TZHA 5KBNC 4ZQKB 2DIAA 5ACZB 4YWGH 3EAKA 3OAYH 4NHCH 1R3KB 5E7FA 5C6PB 5FKPA 1CDGA 4EUPG 5TFSH 1LHZA 2P44B 4J2XA 4G9FE 3OKDB 2YK1H 3FN9A 5E8DL 4JY6A 4ODXB 1UA6H 3CZFB 3MUHL 4RISH 1AFVL 1T0NB 1G1YA 4YFDB 1T1WA 2J6EH 5HHME 1B6UA 1LO4H 4AM0B 3U6RA 1OP3H 1KLUB 4L3CA 3BEWB 2VWEE 1BQHB 3Q5TA 2NY6C 5KVFH 2YOCA 3UTOA 2P42B 4NYLB 3PWPB 4CU6A 2GT9B 2D7TL 1QFUH 2F9BT 1CGWA 2EXYD 4NKOA 4N9OB 5JIIA 2CR6A 5GGTA 3RBSA 4YDKH 1LO5A 2HN7B 4XNUH 4GKSA 4MXQD 5GHWL 4HWEL 2GJ6D 5AWNL 2H2SC 1YEKH 4UDTA 1XF2B 5IBUG 1J7VR 4OCXL 3WNPA 1Z0NA 1W2KT 4JFPA 1MQKH 4S1QH 1E6JL 2IBBA 5HHNA 5C0CE 1S7TA 2HT4D 2DICA 3LEVL 1MFCH 4I18B 4OD1H 2V5YA 1KCUL 3HNVH 3ZE1F 3TNMA 4G6ML 4Z7UE 4AG4L 3FB6B 1EEZB 2F5AL 1AXSA 4MAYB 1VEMA 3LV3A 3ULVF 1NAKH 25C8H 4N1EA 3TCLA 5GS0D 2XZCL 2Y06H 4XWOD 5D6CB 3SHSA 2VQ1A 4FTVE 5DFVD 4PJ5E 4EN3B 1GPOL 2NY5C 5D7KD 1CLYL 4Q9QH 3U4EB 1SBSL 1VFMA 5E99L 4AYFA 3QQ4A 4IOIA 3HE7D 3LDBB 3TNNB 4DOHE 2ITCB 1EO8H 4L5FH 3T0EA 4P9HL 1WBZA 4R4BA 1CXKA 4JKMA 2VDOH 4YUEH 5TE7H 3ILQC 2GAZA 1PSKL 5L2KB 1MFAH 4JDTL 1TQBB 4HWBH 4GBXD 4EZMA 5ALBL 3V8CA 1WZLA 3MA9H 5DJYB 3UXFA 1GAFL 2IALB 3EOTL 4C83A 4AT6A 4ZFFA 3BD3A 3V5HA 5IHZB 4MNHB 3INUL 5DJ6A 1R3JA 2OL3A 2OSLA 4IRSA 4N8VA 5ESVB 4PJBB 3PQYA 4CVZB 5IMKB 5L7XL 4OF0A 1H0DB 1V7MH 3EOBA 4TUKH 5C0BA 4WRLA 2Q8BH 1P7KB 5JOFB 2C3WA 4FQ1L 3AMKA 1VKXB 2G9HA 4QCIB 3EZ8A 1D9KD 5H35B 1JGVH 1NMAH 5MENA 3VWJC 3OXRA 3TYGH 4QNPF 1XF1A 1EXUB 3RHWK 1G0YR 4F37F 5KSAD 2GK0A 3P9LB 4U0RB 2BK8A 1T1XA 4DAGH 4L29A 1C5BL 3TIDA 1YY9D 1U93A 2YPLB 4K7PL 4X8JB 5FYKD 4AIOA 4RNRA 2Z35B 4ONGL 1LNUA 5L8KB 1EIBA 1RU9H 3T2NL 4X7SH 4U1JB 4HMCA 1X5HA 1TFHA 2QBWA 5T3XL 3TZVA 5IUSA 3JVGC 1UWXK 3GI8L 4APQA 5MHSD 4WCYH 1D5ZB 2RB8A 2HWZH 3X3FH 1TQCC 4KZDH 3CFKA 5LVEA 5E2UH 1YC7A 4KKLC 1S9VB 2JB6B 5BVPL 2BY3A 1KGCE 3RU8H 4N90E 1KEMH 3CZJA 2PTTB 4MZ3A 3LKOB 1BZ9A 4O58H 3VGFA 5HYJB 3FOLB 4XC1L 5J9PB 3VDCA 1FYTD 3U2SB 1DQTA 3MNZA 2EH7H 1A7NL 1OLZA 4Y88A 4XVTH 4Z18A 4G42B 1MFEL 4LCYA 4QOKE 2OLDA 3PP3K 5FK9A 2Q6WA 2E7MA 5GS1C 2NR6C 4K3GA 3K7UA 2XZAH 1T5XB 4FFZL 1OQXA 2NW2B 4RAVB 3MV9B 4Y1AB 5F3BB 2BSTB 1P7QA 2BOBB 4MNQE 3MO1B 3U7YH 2DQDL 3OKOB 5DJZA 3S98A 1O0VA 3AXLB 3LMJH 3RTQB 4OF8A 1ZT7A 2QJDA 5D96C 2NY4C 2EIZB 1C5DA 5GS2D 2OMNA 3C9NA 2MWCA 4YHPA 4BK4A 1PW3A 2HJKA 1HYSD 5JA9A 4KRMB 1MY5A 3HPJB 1TVDA 1R3IL 4PG9B 2WNGA 4ODSL 4F58L 5K9QI 2Y07L 3CDFA 3VFSB 3TT3L 4UBDD 1H3TA 3BMVA 2VXTH 5DF0A 1KCVH 2UWEF 2XY2A 4NO2A 4DZ8B 4Z95H 2X4RA 1LD9B 3KPSE 1ZLWK 5I74B 1JWMB 2BNRE 1CD8A 4I3RL 5GISH 5JA8B 5E1HB 5IM7B 2HFGL 3RUGA 4GG8B 3MLSL 5CP3A 2ED9A 43C9A 4L8CB 3RIAF 5DJ2B 3MMEB 4PV8A 1WK0A 4PP2A 1EEYA 1NLBH 3H7LA 1YEFL 2DM3A 4LAQH 3BZ4B 4XT1C 3VH8G 2ARWA 3O3DB 5C09D 5HHOB 2H2PD 1OTUD 2MSPA 2IQAB 3G5VA 3VXSA 1NFDA 3HHRB 4WENB 3IJHB 1B90A 1U8QA 5AD0B 4XCFL 1EAPB 1UKSA 3V6FB 5HGAB 3O4LA 4PJAE 1WGOA 5EBWA 4HZLB 4ISVB 4OZIE 1D5XB 1VFUA 1GC1H 4KQ3L 1EFXA 2H3NB 4M43H 3NABH 4G80A 2O61B 2AXFA 1I8MB 4LOUD 4EQ3A 2AJYH 3M17B 1TCRB 2Q87A 1V3LA 4L4VE 3MCKA 3DYOA 4GRWH 5EA0L 1MCRA 3RGVC 3U7WH 2DQHL 2MTPA 4P2RB 4DZBA 3MACH 5IG7A 3BZDA 1B0WA 4ZNEE 3ARRA 2RAMA 1NC4D 1UJ3C 4R90H 1JRHI 1QFOA 5LGJA 5I1EH 2LAAA 3EDDA 2EDXA 1CWVA 4U1IA 4KK9C 1JPTH 3K4AA 2AEIT 3OX8A 2DJSA 3QWOA 2XNAB 2NY1B 2D7MA 2NNAA 3E6FA 2EDFA 5SWZA 4CU8A 5IBTL 3ZSTA 2BNQE 2NX5D 1D5MA 3KLHC 1BWMA 4IRJC 1NDGA 3RKPA 1PEZA 3D39D 1IGYA 3IS1X 3GBMH 3B9KC 2K9UA 1JGLH 1GGCL 4NN5C 2ZCKH 3GIVA 2XN9D 1I8IB 1KJ2L 1CCZA 3B43A 4NFDA 5D7JB 3MR9A 1RJLA 1T0MA 1GIGL 3ARGC 2HJFB 3QBTB 1DEEA 3A6BH 4MD0B 5FAAA 4MLIA 5DHYA 1JHLH 4CMHC 3PHQB 3HNSL 4NWTH 4QRRA 5F70A 2AK4A 5DJAA 4C55A 3DXAE 5I19L 4PRPE 4I8DA 4PJBF 4PS4H 1DE4A 2IQ9H 2OK0L 4HIXH 3HC4L 1VSCA 5KSUA 2ZSVA 3GSVA 3CVHH 1QKZL 1YEGH 5ERWA 4U1LB 4AENA 2BRQA 1S7SA 3GSQB 3MJ6A 2CKNA 1RZJL 4PRAB 3GIZH 2V7HA 3W0WB 1TNMA 4LAJH 1UJTA 4LRIC 1NMBH 4JDZA 3RA7L 3S4SG 3FFCB 1U42A 3FFDA 3M1BB 1CGYA 3GMQA 3D3VB 1FH5L 2IBZX 3WFBH 5JDJA 3HZYA 3C8KA 3S35X 3UTQB 3V0WH 1RHFA 1VGEL 3ZHDA 1MAMH 2B5IC 5E5MB 5I0ZA 2R0LL 2I9TB 1VEOA 4WFGE 3VE0B 4I4WA 1KEGL 1LP9B 5F96L 3WSQH 5ECJE 3LN4A 4D0DB 5FEBA 3B83A 1FGVH 1QHOA 3OR6B 1MCNA 4D3CH 1A3LH 1FNEA 2IPKB 4HF5L 1V05A 4E42B 2R15A 2VLJA 3AC0A 5BV7B 2FJGA 1TTFA 3MYJA 4C56A 2VITB 5ENWB 3IDNA 4I3SH 2B1AL 4GG6B 1F4WL 3BVNB 2CLZB 1U8PA 4XH2A 4NQSB 3B2UC 5D71H 5KS9A 1U3JA 1S9WA 3FAXA 4LF3B 4G5ZL 2VDMH 1L9MA 3D85D 3BT2L 3RWIA 1XR9A 2X5PA 4E5XB 4OZFA 3WDIA 5B3JE 3SCMB 3ZO0A 4EDXA 3IF1A 5DDHA 1MVFA 1WFNA 2N56A 3FRPA 4IRZL 4FFYL 3NN8B 3QDMD 3DUSB 4CU7A 4HZAA 2IANA 3FAWA 3TBTB 1QSFE 3Q6GL 1IAOB 1UWEL 2DLFL 4ALAH 5HGBA 4P57A 4RA3A 2ENYA 4NHUB 1WICA 4EEEA 35C8H 12E8H 2EDBA 4RAUA 2XTLA 3F7PC 3BGAA 4NSKB 2E9JA 3BYTA 3RVXC 4HW6A 3D5OF 5AZ2L 4Q2ZB 4JFZL 4WW2B 2NYYD 3HC3L 4NQCA 2AKRB 3QIUA 1I1FA 1PX3A 5F9WB 2APBA 4I0PB 3U36B 2DWDA 4L9DA 2XICA 1VFBA 5CIPA 5LXGL 1UQSB 4Z0XA 5HTSA 2A0LC 4N5EC 2MCG1 4MQTB 4L3ED 4HGMA 2H41A 1CBVH 1XGQA 4ORZC 3V4UL 4U1HB 1QA9B 4WU5B 3MLWL 1IKFH 1JVKA 5FKAA 4D94A 3BKYH 3U0PA 4GRLA 2X1OA 1A7RL 1NCUA 4PJGB 1FL6B 1FIGL 4LSUH 1KJMB 1FAIL 4X80H 1LO2H 1Q9OA 1IKNA 2R8SH 1DL7H 1IGML 4GT7A 5ISZB 3KHOA 2V2TA 4YWGL 4HJGA 2VLKD 1BFOB 5T1MA 4NHCL 3E0GA 1UM6L 3VDBA 1W72A 1PKQB 2HLFD 3RGVA 3DBXA 4BA8A 3LKNA 3VA6A 5LBSH 4IMKA 2APWA 4QRPE 5F1NB 3K2UL 1UA6L 5C0AB 1UJ3A 4LSTH 2R2EA 5HI5C 1BJ1H 5E94B 4RISL 2FHFA 5I1GH 4JFOB 5ESQB 2UUDH 3VCLA 4ZO6A 1F2XK 1LO4L 4Z78B 1QRNA 3PL6C 2QQNH 2WINB 4U6YA 1J87A 2J8UA 1JHTA 5KVFL 4Q74A 5IVZA 1QFWH 3QUZB 1A6ZA 4X6DA 1OD9A 4EI5C 3CFIC 1QFUL 4Y5YA 5D1QC 5JR1H 3KLDA 1W0WB 5EOQL 2IMNA 2F15A 3DX6B 4XNUL 2DAVA 1HH9A 3RX5A 3TWCH 5J12B 1IEAB 1K5NB 1MREH 3ARBB 1YEKL 2VZOA 4WUKH 1F3RB 3ZHLA 4A2MA 3GK8H 4S1QL 2EYTA 1KFAH 1K8IB 5GGUA 4MYWB 4RGOH 3MRMA 1CL7I 1MFCL 4OD1L 4KK5C 3HNVL 2YS4A 1WQVT 1E4XI 3ARFB 5IFJB 1DUZB 5BRZE 25C8L 2ATPA 4ZO8A 5IV2A 3G5YA 2X1XR 2Y06L 3FMGH 5C08B 3ARTA 4GQPH 1JGDA 4UT7L 4NUJA 5I8EA 1D5IH 1I1CA 2VABB 2HT2C 3EFFB 5I30H 2AXGB 3RI5F 4LDLB 2EO1A 3X12A 4Q9QL 1M71A 4ZSOA 3NCYS 4LRIA 3CU7A 4PBXA 4KXZI 4MA1B 5DSCA 1EO8L 3LRGA 2IWGA 5DK0A 3VXQB 4YEEA 2VDOL 3UDWC 5IMLA 4TNVF 4YUEL 4YDLB 5TE7L 5BQ7B 4I48A 1MFAL 2BVOA 1G7MB 4HQQH 4HWBL 3IXAA 3ZTJG 4TNWF 3T0ED 1EO5A 5D6DC 4ZUSA 3EOAA 3MA9L 3IJSA 4PJFE 3AM8A 1WSST 4G6KH 4PGEB 1WIOA 3RWEA 4K07A 4P23B 2R2HB 5CP7B 4Y4HB 1ODAA 3ZTNH 1FZKB 3GJFH 5GIRA 1V7ML 2VL5B 4TUKL 1Z9OA 3VXMB 3DX9B 3X3GH 4GRWE 4LCWB 2X42A 3PIQB 4UILH 2BC4A 1LP9F 4IRSD 4OLWL 1A6UH 3GSOB 1A6AA 2BVQA 5F7DB 3TBSB 3RBGA 3PQYD 2HLAA 2HTKD 3F5WA 1JGVL 1UWGH 5C0BD 1NMAL 3BEVA 2NXZD 4P5TC 1HSAB 1KV3A 5D5ME 1CGXA 3QFDB 4QWWC 4HPOH 4H1LA 4RFOH 4FRWA 3RPKA 2GTZB 5C3LD 2PF6A 1INEH 1BM3L 4WU7B 1ZWIA 5DJCB 5MEND 2C3HA 2QQLH 4NO0B 5FB8A 32C2B 3QT2A 4KK8C 1J0YA 3ARVA 4MSWA 3VXOA 5KW9H 5B39B 1RU9L 4X7SL 4XPHL 4NRXB 4LLQA 1UYWH 4JO4H 2CLVB 2RIKA 3MODL 4NWUH 2D2OA 3BHBA 3QI9A 2YSSA 3FB8B 4WCYL 4RMVA 5AG9A 2HWZL 3X3FL 1S7WB 4JAMB 3MRQA 2D7OA 1FO0H 4WFHD 5E2UL 3ZYOA 1FJ1B 3OAUH 3NZ8A 3TZVD 3KLAB 3RU8L 3MV7E 2JJTC 3VXUB 3OG6B 2LU4A 4APQD 3ZYJA 3L5WA 4O58L 4WW2F 1BOGB 3MV8E 1P6FA 2CMRH 5FM4A 1QVOA 5BCAA 3BP4B 1N2RA 3QQ3B 5T3ZH 1S9XA 2QTEA 2EH7L 1BD2B 1MCOH 3BP6A 4XVTL 2VQUA 3CFJA 3HB3D 2NZIA 4JFXA 5CZKA 4ZUVB 4L3AA 4PTTA 5GSRA 3AB0B 1I8KA 4OQTH 3VGBA 5DK2A 3CXDL 2HFFA 4LPUA 5IGXH 1IAIM 5DO2C 4M9OA 5HHVL 2GQHA 3F58H 3VXPA 1H5BA 1NGXA 3RZCB 1OTTC 3UYPA 2ZCLH 3P73B 2W9EH 5DD1H 2AS5M 1FFNA 2R0WH 3LZFH 1AQDB 2NCMA 4K7FB 4MA8L 2FATH 5GPRA 3U7YL 5E2JA 3X11A 5SWSE 5IB4A 1FFPB 3BSZH 4K71C 4WHTA 3T0VA 2A74A 1I7UA 4RZCA 4MAYC 2A83A 4G6AC 4HUVA 5DRWB 3FQNB 4PRHA 5L6YH 1P7QD 1N8ZA 2R1YB 4ZTOH 4ZXBA 5EWIL 1IMHC 1NJ9B 3T65A 2GTWB 4RMSA 3KPLA 4MXVF 1AKJB 2EEBA 2G75A 3O81A 1JZ4A 4MX7A 3GUTB 3OJ2C 3BZFA 4HC1A 2VXTL 2E27L 3LDBC 4M8QA 1KCVL 1TNNA 4PIRF 4Y19E 3DURA 3BKJH 3AUVA 3K2MC 3BPOC 4KH2A 5BXFB 4PBWD 4Z95L 4NPYA 2CGRH 2QEJA 5T33H 5IT2H 2YEZB 5GISL 4NKMB 4BYHA 5GS0H 1MCQA 1N59A 3DVGA 1AC6A 5JPMA 1WISA 1Q0XH 3X17A 3HLAA 4F7MA 4U7SA 5EO0A 3L3HB 1NLBL 4LAQL 3BP7B 4FP8H 2H2SD 5F6HI 3VFRB 3VFVB 2V17H 3HZVB 1FG2A 5KVDH 1MCJA 1RUKH 4JKLA 4ZAKB 4U1MA 2EE6A 3B9EA 2DF3A 4PLOB 1TDQA 4BUHA 1UADC 4X6CB 4Y5VB 4RFEA 4BH7B 2GW5A 4KDWA 1PZ5B 4XCCH 4X9BA 3TV3H 1EUTA 3HPLA 3GSRB 1WWBX 5CD5C 5GQBA 3VXSD 1GC1L 5KN5A 4M43L 3NABL 4WTZA 3PABA 3MPCA 3UBXI 2AJYL 2VAJA 3VFPB 3T3ME 1H3GA 4MQ7B 2QQQA 5CZXD 3O4LD 1YEHH 2PYFB 3EYQC 5J13B 5ITBH 2A6IA 1HHJA 1EFXD 5A2KH 4OI9A 3MACL 2FO4B 1A2YB 1R3LA 3O2DA 1JI2A 1FDLH 2RQ8A 4R90L 3G08B 1T6WA 4U0RC 1AQKH 3W81A 5I1EL 2BVPA 3ARDA 3FTGA 5E95B 1JPTL 1U95A 2ZNWA 5J06A 4TPRH 2VDKH 4PJ8C 4OQ1A 4OTXH 2J1KA 2I5YH 4F37K 4PBVC 2A6DB 1YMHA 4TSCH 3L3GA 3L3DA 1NPUA 3GBML 5ICZB 5H37H 5HHQA 4M8VA 4PR5B 5SWZD 4JREB 2CDGB 1VGKB 4WW1A 1JGLL 1BFTA 2ZCKL 1WTLA 1FL5A 4KDVA 5I1CH 5K9JH 1KUMA 4L4TA 4MJ6B 5FO8A 5ESAA 4PRIE 3GFUA 3DARA 4J8RA 4NWTL 1IM9B 4ZFOB 3NFNB 2W38A 1QPXA 4RGNB 1DANU 2IJ0C 1S7UB 4FQXA 2IQ9L 4HIXL 4ZQKA 5ACZA 4PJIF 3IDIB 2X70B 2F53E 1M7DA 1AH1A 1OSZB 3CVHL 2HRPH 1YEGL 4QRRD 4WUUB 2J12B 3QUMB 4CMMB 3I9GH 2JKXA 3V79C 3VFWB 4QGYA 4V1DE 3VGGA 1HNFA 3GIZL 1U8NB 5D7SH 2YMXL 3HMXA 4LRNH 2UWEA 2XACC 4C57C 3BRDA 1CIDA 3S36L 1JV5A 2LTQB 1NMBL 3RTQC 2WANA 3RY6A 1NBVH 5JXAH 4AM0A 1WBXB 2X05A 4UIKH 1A6WH 3WFBL 1KLUA 5TPWH 3BEWA 2L0DA 3IJYA 5BJTB 2AABH 5DEGB 2JJTA 4S0TD 3V0WL 1BQHA 1MAML 4F80A 4LLDB 4NYLA 2XKNA 1WBYB 3WSQL 3PWPA 5DUMH 4JFDB 1FGVL 3RX7A 1F6AB 3VD7A 3UAJD 3MJ9A 4C59B 4D3CL 1A3LL 2HN7A 1MFNA 2BJMH 3QIWB 4WWKB 3QPXH 3D25B 3LSOB 1MPAH 2VZ1A 1IT9H 2VAAB 5I74C 4ZDHA 4I3SL 1XF2A 1JWUA 1CE1H 3LRHA 4HXAL 4HMDA 4HUNB 4KRLB 1T7WA 2IGFH 5D71L 3BN3B 2VLJD 2D4FA 4C56D 2VDML 1SJEB 4I18A 1NCTA 3G6JB 4MD4B 3QUXB 3FB6A 3Q5YA 1EEZA 2GJZB 4MZ2A 4U1NB 4YH6A 2BCKA 4LVHB 1K9TA 3HUJE 3RIAK 1OCWL 3F12B 5H37G 4ALAL 3LCYA 1ZK9A 4GSDH 5DHVB 4EN3A 4QRSB 3MCLH 35C8L 2W65A 2VOTA 3RWDA 1N7MH 2H8PB 3WO4C 4UU9B 1P4IH 3TNNA 4HH8A 4ZO7A 5DMIH 5SX4I 3SJVB 3MRJA 5F7FA 3DTXA 5T1DH 1MFBH 1Q1JH 3CGTA 3K74B 1P1ZB 4HK3J 5L2KA 3VI4E 2YD9A 3MBXH 5TDOA 1WAAF 1N0LA 5DJYA 1YNKH 4NQCD 3QIUD 1CBVL 2IALA 5DEFB 1H8NA 5IHZA 1IKFL 1Z0MA 2NY1C 3MRDB 4MNHA 3WJJC 5EBGA 3QDGB 3BKYL 3ARUA 4XPBH 4N8PA 5ESVA 4S1DC 4PJBA 5IMKA 4YHMH 3VXTB 4LSUL 4X80L 5HGGS 4J4PC 1A3RH 4GFTB 1LO2L 3NH7H 1P7KA 5A3ID 4P0DA 2R8SL 4FFVC 1DL7L 4PJXB 5I66B 4GRLD 3IKKA 4JFHE 2V5SA 1VKXA 5D7JC 4N0UA 3LEXA 2GITB 3ESVF 2RFXB 1AD9B 4YE4H 1CFNA 2C1PB 4KI5E 2OP4L 2VH5H 5LBSL 5I1DA 2Z92B 3B9VA 2NXYB 1AE6H 4NKIH 4X6CF 4X5WB 4ZD3H 4LSTL 3GMNA 3S5LB 1NFIA 5I1GL 4C4KT 3JWDC 2W0LA 3H9SE 1JYVA 5JIKA 3RGVD 4I1NB 2ZSWB 1KIQB 2IBZY 1T2QH 3HZKB 4K55A 5T3ZE 4YDIH 2MQCA 1QEWB 1ACYH 2Z35A 2QQNL 5M95B 2FL5B 1U9KA 1K4DB 4KDTC 4HS8H 4I5BB 2E7HA 5LWYH 3OKMB 3VG9B 4LVOB 3VFNB 4IIQA 1QFWL 4KK9D 1RJYB 5JR1L 1QRND 1D5ZA 5FA3A 5I6XB 1BFVH 3V4VH 3FQRA 1S9VA 5DJ8B 2JB6A 3TWCL 1MREL 2OM5A 1G9MC 4WUKL 4MB5A 1GHFH 3GK8L 2PTTA 3LKOA 2Q76B 3WDJA 5HYJA 4KGJA 1KFAL 3FOLA 1TZIA 1B88A 5JOPD 5DVMA 3SKMB 3OL2A 3AU1A 3U2SA 4RGOL 4OI7A 2UY6A 1UM4H 1OW0C 5BV7C 1G1CA 4G42A 1MOEA 2XWBB 2FEDC 5I0DA 3FZUD 3F6IA 1T5XA 1K8DB 1ES0B 4WO4B 1D5IL 1U91B 4Y8DC 1WCBB 4RAVA 1XF3B 3MV9A 4LSDA 5F3BA 1QHPA 4G9FB 2DKUA 5DA0B 2H6PA 3QO1B 43CAA 1CT8B 3OKOA 4HKXB 3HRPA 4LHUB 1U2HA 3AXLA 3RTQA 4EIZC 4QTIH 5ADPH 2EIZA 5C0FB 5HHMB 3V95A 2FRGP 3STZB 4PG9A 3JTSB 4HS6B 3TP4A 5GGSB 4HQQL 1PX4A 4QY8B 4XB7A 1FVDB 3VFSA 2WBJB 5BS0A 3RWFB 3T1WA 2IMMA 2VQTA 2R0KL 3VD3A 3PWLB 3WKMH 4G6KL 1OOAA 4I0PC 1LD9A 3MOBH 5F7EL 1JWMA 4R0LC 3ZTNL 5IM7A 3DV6B 4GG8A 4WDIB 3S88H 1J1PH 4L8CA 5DJ2A 3LAFA 3MMEA 5IJVB 3TO4A 2WMPA 4GXVH 3X3GL 5C0CB 1GOGA 3BZ4A 3MBEA 3O3DA 1A6UL 1KELH 5D4QA 2IQAA 5D2LB 3C6SA 4MDIB 1UWGL 2IH3B 1SMOA 1MJJB 4KRPD 5AD0A 3ZZ1A 4CN6A 4Z8FL 3K0WA 3CFDB 1EAPA 3I3BA 5HGAA 4HPOL 3ARQA 4RFOL 2Y9RT 2LFGA 3ULUF 2NY0B 4FTVB 4ISVA 1INEL 1D5XA 4PJ5B 2H3NA 4BH8B 2O61A 1JL8A 2QQLL 2Q7YB 3VDAA 5JW3H 2NQCA 1I8MA 3UBXA 5JHDD 4KMQA 4JGJA 3ZKQD 3OJDB 3F6LA 1ND0B 2F5BH 4DOHB 3G6JF 3FONB 1VADB 3PWNB 1NAML 3OWEA 5DUPH 2O5XL 4LSRH 3IDYB 4PJCB 4JO4L 3SY0B 3RVXD 5JHLH 2A1WH 5IR1A 1OAYH 5E2VH 3UTZB 2XKUA 3KGRA 4L8DB 5D72H 1KSRA 3GMOB 5KOVC 4XXCC 3GMRB 4DUWA 3GSUB 2GK2A 4NBZB 5EZIH 4ELME 4Z7OE 1HXYB 2XNAA 3SPVB 3OAUL 1ONQB 3P77B 5JTWA 3W5NA 4V2BA 3QI9D 3JV6B 2A0LD 3QQ9C 4JFQB 3BIKA 4XB8A 2H32A 4ZUTB 5EH1A 3QUZC 3KYAA 4OM0H 4J4PA 5E08H 5T3ZL 3AS1A 2D0HA 4Q0XL 1HZHH 5CINH 3UTPD 4JO1L 4CAGA 1NQBA 4QHLB 1JYWA 1BVLB 1I8IA 5D7JA 3QFJA 3PWJB 3ARBC 4OQTL 1MH5B 5IGXL 1W0YT 1Y6MR 2HJFA 4RDQG 3ULVD 4RAHA 3F58L 5EU5A 3B8SA 4MD0A 1CDYA 1Q9LB 2ZCLL 5DD1L 2W9EL 1T7VA 3PHQA 2R0WL 3LZFL 1ZHKB 3QO0A 3VXNB 2FATL 1UB5B 2VISB 3ARFC 5F72S 3IYLW 1QNZH 4WI2A 4NCDA 4UV7H 2BSED 5ETUB 5L6YL 1IILE 3KXFE 3AY4C 4PJXF 4U1LA 3ULSA 3GSQA 4M6MH 1Z9MA 4LLAA 4ZTOL 4PRAA 1KJ2B 5JORB 3W0WA 3QEQE 1I1AB 5IB3B 3QAZB 4PRHD 4XI5C 1GGIH 4ODHH 3O2WH 1I3GH 3FFCA 3M1BA 3BKJL 2VKXA 3D3VA 4J1UB 2CGRL 3SDCB 5IT2L 5T33L 5KSVB 1Q72H 3RI5K 3B2VH 2I9TA 1AO7A 5GS0L 5IK3B 3VE0A 2FLRT 1LP9A 1Q0XL 4OLUL 3WV0A 1BJMA 3VD4A 4D0DA 2RCSH 1A0QH 3VI3F 1CD9B 4FP8L 5FGSA 2IPKA 4U49A 2R2CA 4HPYH 5KJRL 2V17L 5KVDL 4TNVK 1RUKL 4KTDH 3OJVC 1IQDB 3VMPA 4HGKC 4B50A 1SHMA 2XTJD 1XAUA 4TYUA 4TNWK 4XCCL 4NQSA 3TH3T 3TV3L 1XF4A 3PHOA 2MFNA 4LF3A 1AIFB 3ET9F 4M48H 4OSUL 4MNQB 1KT2B 4E5XA 1JF1B 3SKNB 3SCMA 3WIFA 4UDUB 2Q3ZA 2BMKB 3NN8A 4EUPB 3DUSA 1YEHL 2HFEB 3TBTA 5E2WH 5ITBL 1IAOA 4PGDB 4NT6B 3QISA 1S3KL 1FDLL 5EU4B 2VKWA 4LFHG 5DRNB 3DI2B 1XGRB 4NSKA 4R2GD 4NO3B 4ZYKB 4TPRL 2X09A 4WW2A 2VDKL 5JW5B 4CN1A 4WI7A 3I6KB 2FO1A 4I0PA 4OTXL 4JZNB 4FQPA 2I24N 2I5YL 5I9QB 1LEGA 3KPSB 3UTSA 1DDHB 2BNRB 3ARDD 1UQSA 1YY8A 5FOBB 4TSCL 3QRFM 2Y4SA 4N5UA 5C3TA 2JCCB 3KAAA 2KL6A 1QA9A 4WU5A 5INCB 2NX5E 5I1CL 5K9JL 1U2CA 5IBUB 1DQMH 1CVRA 2PO6A 4XCEB 1FL6A 2WW8A 5GGVY 3WBDA 5KG9B 2XXCB 3TFKD 3PP3H 5F9JB 4OGYL 4PJAB 5HHXH 1FZMA 4OZIB 3KS0H 1NGYB 5FYLD 1LEKB 4XCYB 3N06B 4QWWD 2HRPL 4JCLA 1BP3B 1F97A 2VLME 1CG9B 3AFLA 1UKQA 4L4VB 2HTLC 4FQXD 4HAGA 2UZXB 4Z7UF 5D7SL 4LRNL 5C0AA 3SBWC 1DBJH 5E94A 4PRDB 3R06B 3RL2A 4JFOA 4XXCA 1NBVL 3P0YH 1S7QB 5F9DC 1A3QA 4Z78A 1F3DJ 3EIFA 4NM8H 4R9HA 1A6WL 4UIKL 5TPWL 4LIQL 2DKSA 2AABL 4HXBH 3TESA 2ARJQ 4Y16B 1ADQH 4JQIH 3IDXH 1T3FB 2BNQB 4JZOA 2QR0A 1J0IA 4UNUA 5DUML 1GGTA 3I85A 3N1QC 4KHXH 4M5ZL 1YDPB 3PXHA 3T1FA 3W39B 1W0WA 1ZGLA 1F4AA 3DX6A 4NFCA 4ODTH 4OLYH 1NGZB 1MSPA 3QPXL 3QULA 1DQLH 5J89A 1IEAA 1IT9L 1K5NA 3C5JB 3PWPD 1FNHA 4YO0B 2DLTA 1CE1L 4BSVB 4POUB 5C0EB 1DLFL 3WUZA 5GSVB 3TVMC 1K8IA 2K7PA 3KPOA 1QSVA 3O6KH 4OGAC 4N8VG 1MCLA 1T22B 3OB0K 1IFHL 1RZFH 4N0RA 5A43C 3DXAB 3ARFA 5IFJA 4ZAKC 1DUZA 2Z4QB 1G7PB 3HAEA 5J7CC 4MNGE 5GRUH 1H3WM 1E28B 3QHTC 7FABL 4Y5VC 3K8LA 4NZUH 1NANH 4HMEA 1FCGA 3VRJB 2VABA 4AIXA 5TDNB 3EFFA 4K3JL 4GSDL 4XNYL 3I75A 3PNWA 3QDME 1N7ML 1PGRB 4CBPA 2RJMA 3U0WH 1P4IL 3FT4A 1L0YA 1INQB 4RWYH 5DMIL 3VXQA 3C60B 3IAQA 4EN3D 5J13C 5DJXB 3W5MA 5T1DL 1MFBL 1Q1JL 4WJ5A 4PPTA 5A2FA 4FMFA 1KPRB 4J3SA 3ZSSA 5MI0B 3MBXL 2XV6B 1CXEA 3CUPB 1X7QB 1PDKA 1YNKL 5EN2B 4MHHI 4KPHH 4YEFA 3ALPA 1F11B 4F9LA 4PGEA 3QDHA 1G9MH 4P23A 5L2KD 4HIIA 4XPBL 2R2HA 4Y4HA 1AY1H 1HK6A 5D7LE 1FZKA 1YC8A 5HDBF 4YHML 5TF0A 2VL5A 4LHJB 2IEPA 2YN3A 4L8SC 3DX9A 1A3RL 4PJIA 5HI4D 4LCWA 3V6OE 4XP1H 5D1XA 5IROC 2D03H 5DD0H 4AL8H 4PRNB 3IFLH 4XCNB 2VLLA 2Z93A 5FUZH 3TBSA 5IB1B 1TPXB 4YHNB 3CLEH 4C4KO 4OCYL 1HSAA 4YE4L 3QFDA 4PJ7F 2VH5L 1Q8MA 1QSFB 2EEAA 1NEUA 1AE6L 4NKIL 2PXYA 4RGNC 4ZD3L 1KJVB 4WU7A 4WV1B 1YEJH 3KWWA 4NO0A 4O4YH 1MIMH 3MRFA 1T2QL 1RURH 4JDVA 4YDIL 2DL2A 1ACYL 5CHNB 5I2IB 2X1QA 1MCKA 4F8TA 2OXGA 5B39A 1OB1A 4X99A 3SE3C 3UP1A 4NRXA 4XAKD 4NM4H 5C0JA 1I9RH 1LDPH 5E8NB 4P2QB 2KUTA 3EYSH 1K6QH 5AG8A 4U6TA 2Q1EA 2LTQC 3ZDZE 3FO1B 4CVXB 1BFVL 2NY2C 2BXZA 1S7WA 3V4VL 2AGJH 3O45B 4JAMA 4X4MA 5JDSB 3TBWA 3MOQA 3SGDI 3EGSB 5I15H 5E6IB 4A6YA 1SEBB 3BW9B 1GHFL 3UPAA 1SJVA 1BOGA 2Y6SD 1FNLA 2DDQH 3EDJA 3L6FA 3BP4A 5FGBC 1MQ8A 2XFXB 1UM4L 3S35H 3OMZA 1BD2A 3VWKB 3CNKA 3QIWC 4WWKC 2DRUA 5HYJD 1LGVA 3BN9D 3HZMA 1SMAA 3S97C 2XRAL 4FFWC 1KIUA 4OF7A 3WKNA 4OI8A 4JZJA 4Y4FA 4OV5B 3RZCA 4JPIA 4R6UA 4OLVL 1OP5K 3RWCB 2EXWC 1Q9WB 1YPZE 1AQDA 3MA7B 4K7FA 4WFFD 5DURB 2YA2A 1FFPA 5KVGH 1A02N 3SBWA 1MVUA 4QRPB 2F19H 2VC2L 3V52H 5IQ9B 3DX7B 3DMMA 2PUQT 2N7AA 2YR3A 3MV9D 3D1MC 2B39A 5DRWA 1U92A 5ADPL 3FQNA 4LVHC 1NEZA 5FUCE 3HR5B 2R56H 4PJAF 4PY8I 3ZDXE 5DFWH 4UTAH 1WAAA 4OZIF 5DQJB 3LQZB 5L88L 1NJ9A 3EYOA 2GTWA 2DKMA 3L7EB 1I1YA 5B22A 5T1KB 3RTQD 4XP9H 5IFHH 1A5FH 1UVQB 4MMZC 4ZS7H 2CKBH 2D31A 4KZEH 1W8OA 1ZOXA 4WI6A 1WC7A 1VERA 5HI3D 3WKML 1SJHA 1MCCA 3MOBL 4AEFA 5C2UB 2YEZA 3QIBB 5BS0D 3S88L 1J1PL 2R1WB 2YD2A 1LO3H 4GXVL 1T21B 3GJEB 3L3HA 1D6EB 2ZWLT 4QHUB 4LKXA 2VZ3A 5I18H 1EDQA 2W59A 3VFRA 5B4MD 3VFVA 3G6AB 2J5LB 3HZVA 1KELL 3IU3B 3IS0X 4NRYB 3TO4D 3STLA 3VU2A 4X6CA 2AV7B 5F1IB 4NFBA 4BH7A 2EIEA 5BRZB 4F15B 5DR5H 3MBED 2QSVA 3SKUD 4OZ4A 4JB9H 4O2CA 3GSRA 4P9HC 3DHMA 3ECBB 4HX1B 3PQYE 5FXCH 4DWHA 1R5IA 1XR8B 2FEEL 5JW3L 3QEGH 1B4JH 4D9LH 3QP3A 2X4OA 1KTLB 4MQ7A 1PZUB 2F54E 2F5BL 2PYFA 1SYVA 5JMRA 3Q3GB 3VXRE 5CEZD 3G04B 1ZEAL 4LSRL 4XNMA 5DUPL 1M7IA 2NXYC 5EU3A 5JHLL 2A1WL 1MCBA 3G08A 1OAYL 5D72L 5IB5A 2WWMC 4S2SB 3WMSA 2AJZA 1CDCA 1QO3B 5EZIL 2PW2B 4GMSL 1TTUA 4NJ9H 2CD0A 4P5KB 2ERJB 4ZMAT 4PJFB 2NLJA 4PJ9B 4UT9H 1HEZB 5EZOH 1YNTA 3AREC 3VG9C 3OHXB 3RVTC 4JY4B 2A6DA 4MVBC 4PB9H 5F1KC 4PJDE 3S36X 4R7DB 4OM0L 3D18B 2BY0A 3BXNA 3N0PB 3QHFH 5E08L 5I6XC 5ICZA 2NY1D 1WFUA 1HZHL 4PR5A 4GRWB 5CINL 5IROA 2CDGA 1VGKA 3G5ZB 1CK0H 4WI9A 1C12B 4KKBD 4J4PD 1JF6A 3S6CA 3U30B 2A73B 1RHHB 1V3JA 4MJ6A 1OAKH 4FFVD 2ADFH 2EICA 5D5MB 2Y1VA 3MJGX 4P2RE 1IM9A 3VG0H 5D7JD 3QFJD 4AH2B 3L3JB 1S7UA 3KDMB 1CXIA 4RQQB 3UJIH 2ARJB 1X3DA 3S8WA 3IDIA 2X70A 3GDBA 4ZFGH 3HS0B 4LQ1A 1CTOA 1H8SA 1E0OB 1OSZA 1NBYB 4WUUA 3WE6A 4CMMA 3QUMA 4WO4C 3EJZD 3VFWA 4M6ML 1OL0A 2GKIA 2EECA 4G8FA 3MXWH 3VGAC 3QHZH 1U8NA 5B3JF 3D9AH 1SM3H 1VFOA 1X9QA 2V7NA 1JF5A 3EDKA 2IAMB 3LKSB 1GGIL 4ODHL 3KYNB 3O2WL 1I3GL 4YQXH 1OTSC 4NC1C 1WBXA 1BBDH 4EDWH 3W0WD 2LAGB 1FPTH 1ZA6B 3GKWH 5BJTA 3GSXB 1Q72L 3WLWC 3MV7B 1DLHA 5T5NG 2CRIA 1TVHB 1WBYA 2D0FA 3FFCD 1ZHNB 5IESL 3LPWA 2WBJC 3CVHB 3MV8B 3D3VD 2RCSL 3DETC 1A0QL 1F6AA 5CLTA 5E00B 3MRRB 1RK0B 4GRMB 1CZ8L 4HPYL 3BQUC 1AO7D 1OSPH 4KTDL 3LSOA 3L7FB 2VAAA 1B2WH 1BVKB 2VERN 4BFIA 4M93C 4JRYE 1T83C 1OHQA 4G7YH 3RUGE 1AD0B 1KC5H 3BH9A 4KVNL 1SJEA 3T4AB 2IFGA 3HG1E 5E5UB 4M48L 3KVQA 3G6JA 4MD4A 2FEDD 3QUXA 5SWSB 1CU4H 4GKZB 4U1NA 5JNYB 2XQYG 3QWQB 5E2WL 3N85H 2VSDA 4JANB 3VXSE 5FV1L 5DHVA 3FO9A 3SCMD 2NY0C 1LILA 1DVFB 2FH6A 1F4XL 2ENSA 2H8PA 3WFEH 2R9HD 4UU9A 2I07B 3OKNB 4NNPH 3SJVA 4JFFA 4DVRH 3V0AC 1WIUA 1GZPB 1X6NA 2BRRH 3DRQB 4Y19B 1SEQH 3U9PH 1Z5LA 5EPMA 3QH3B 1P1ZA 1HHKB 3IDYC 4CRPA 4PLNC 4CKVX 2GCYB 3WYRA 5K59E 3ZKMC 3SDDA 4H0IA 1F6FB 2P8PB 4I0CC 4I0PD 5FO7B 3BX7C 3UJTH 4QXTA 3UTSD 5HDOA 2AI0H 2ZUYA 3IDGB 4QHMA 4YZFF 1SVZA 4WEBH 1FVEB 5DI8B 1DBBH 1DQML 2CRMA 3MGAA 1RI8A 3VXTA 3LKPB 4P4KC 4D9QE 3QDJB 5CGTA 3T2QA 2ZUTA 5E6ZA 1F3JA 2X10A 2ZUSA 2P8MA 2NY6B 4X98B 4PJXA 5I66A 3SOBL 5HHXL 2YC1B 1QBLL 3Q6FB 4IOFD 1G7IB 5SWQA 1JZ3A 4ZUWB 3KPMB 5K93A 3JWOH 4KY1H 3WNLA 5A2JH 1KCSH 4IEFB 1BQLL 4NP4H 2C1PA 4OD2A 3WFCH 2FD6H 3KNBA 2Z92A 2BERA 1N64L 4X5WA 5HPMB 1DBJL 1FLRH 2Q3AA 5IF0A 1MCDA 4JM2F 2AK4E 1HKLL 2P49B 5EFIA 3P0YL 3RRQA 2R4SH 1AGCB 3HZKA 4HH9B 2ATKB 4NM8L 4RBPK 3CK0H 5GGVH 4F3FB 1C08A 3EW3B 4DN4H 5C0AD 2FL5A 5IJKA 5GGRB 4HXBL 3OKMA 2W9DL 4RRPA 1ADQL 4JQIL 3IDXL 4P4RB 5HXMA 3UPCA 3ULVH 3SDAB 1RJYA 2VE6B 3QAZC 2W60B 4KHXL 2P5WE 2UVEA 3L3IA 3MLRH 1G9NL 2FECI 3GMPA 2BSRB 2KQMA 5AUMB 4DEPB 3H9ZA 4OLYL 5DJ8A 3BRFA 2F74A 1DQLL 3SDCC 3H9HB 4OGXH 3SKMA 4PJFF 4PRIB 1I7ZB 4HHAB 2PCPB 1U8IB 1RZFL 2QADD 1RZJC 4LCUB 3C6LA 4ZPTA 3RVUC 1NUDA 2XWBA 2Q7NA 2X4PA 5GRUL 5AYUH 1QACA 2F53B 4NZUL 1K8DA 1KTRL 1ES0A 4WO4A 3TM6A 4XVSH 4G43A 3B5GA 1WCBA 1XF3A 4JHWH 4G9FA 3ARFD 4YJZL 5J1AA 5EIIB 1HIMH 3J8F7 1PFCA 5MERB 2L4OA 2N1KA 3UTTE 3NCMA 4LHUA 5D5MF 3U0WL 5A1AA 5DMKB 3WJLC 4U1KA 1A14H 4RWYL 2DQCH 4Y0GA 1A8JH 1BWWA 4YXHH 4L8BB 2VUYA 3H42H 2IANE 4HS6A 5GGSA 1JZ2A 5C0NC 3FHAA 3VWJB 1FVDA 4LKCA 2VLRE 5C0DB 4MS8D 2C1OA 4PP1C 3PWLA 1G9ML 3E1F1 5F6HJ 2YD6A 1AY1L 5I9QC 3NIDE 3DV6A 4TVPD 4MA3B 3PF2A 2Z0BA 5GRVK 3BD5A 4KMLB 4P23D 3RJQB 4XP1L 2D03L 5DD0L 1XCQB 4UOW0 1C16B 4XNQA 1JNHB 5E8DH 4AL8L 4D0BB 3IFLL 2XKSA 4Y4HD 5CUSL 1AXTH 2DJUA 4POZD 3WS6A 5ABDE 2QV2A 1HNGA 4Z7UA 1B6DA 2YD8A 2IH3A 3E6HB 3R0MA 3CLEL 3VXMD 3TF7C 1MJJA 4LCWD 5BVJA 3QXTA 5D1XD 3ETBF 4W6YB 3REVB 2OI9C 5CMAA 3O3AA 2FHCA 4PJ5A 1YEJL 5ID0B 1NBZB 1U8OB 4AEHH 4U3CA 1MLBB 2H1PH 4U1SB 4O4YL 3BKCL 5EZLB 5CJ5A 1MIML 4HSQA 4G6FD 1T1ZB 4FQQB 1ND0A 2ZPKH 3QB7C 1VADA 4WNQB 2PXYD 1I3RB 3PWNA 4NM4L 4BFBD 5J56B 1I9RL 1YYLH 1LDPL 4NO0D 5JMOC 2WQ8A 3T09A 5GS1B 3EYSL 4RGMB 1K6QL 3UTZA 4L8DA 3GMOA 3O8XC 5GS3A 3IKCB 3GMRA 2AGJL 3GSUA 1RV6X 1HXYA 1ONQA 3P77A 3O3BB 2PYEA 5E70A 5I15L 3JV6A 4AG4H 1I1RA 3O11B 2DDQL 2MKWA 1WZMA 3PV6B 1JPSH 1AI1H 3S35L 4UINL 4X6DE 4UB0L 3I02A 1GRWA 3RKDC 1NAMB 3TYFB 4JFYB 5HGHB 3MRHB 3PWJA 1JZ8A 1MH5A 1HXMA 4Z6AT 2VL4A 4YHIA 4YPGB 4JO2H 1KB5A 3P30H 3F7QA 1BD2D 4AIZB 1JGEB 1ZHKA 1UB5A 2VISA 5KVGL 1U3HB 3MNWB 2EE3A 3OXSB 2CK2A 1SQ2N 3QR2A 1PLGH 3V52L 3T2OA 1FGNH 4HIEB 4Y4FD 3DRTA 1YN6A 3H9SB 5ACLA 3RZCD 5ETUA 1U8LA 1L7IL 1ZAGA 3M8OL 4FG6D 1E4KC 1D3CA 1DP0A 1T5WB 4WTZG 1BZ7A 3INUH 2B4CL 3DMMD 1KJ2A 4XP9L 1I1AA 1V3KA 5IB3A 1A5FL 3FN3A 3FQWB 3T3MF 4ZS7L 2CKBL 1REIA 1UCBH 4KZEL 5IP4A 4F33A 3T3PE 1WZ1H 3C60C 1UXWB 4J1UA 5EOCJ 2CDFB 5JXEC 1OWRM 1CN4A 1P4LB 3SDCA 3SQOH 1BF8A 1QOKA 2Z31C 4DKEL 2X4UB 2VDNL 4KJQC 5IK3A 5MI0C 1CDJA 1LO3L 4FOMA 1O7SA 3QPQD 3AS3A 4NZJA 2K7QA 1E4XH 2EYSB 3DVFA 5I18L 1O5DT 1IL1B 4PJ7A 4M7LH 3T77B 1XEDA 1IQDA 3I6LE 4QOKA 5MEOB 1YNLH 2V9QA 3QEUB 2V9TA 2CRZA 5DR5L 4ONGH 1LMKA 5JZ7D 1AIFA 3QXDA 2IPTH 2W92A 4MNQA 1KT2A 1JF1A 3SKNA 2CDEA 5T3XH 4UDUA 3GI8H 3QEGL 2O5YH 1PQZB 1TPXC 4KJPC 4D9LL 3SGKA 3X13B 2BMKA 3CMOH 4X7TB 1HDMB 2HFEA 4NKDB 1D5BA 2OXHA 2W91A 2LABA 2YXFA 4CNIB 5FYJD 3ARGB 4WTWA 2GIYA 2ESVE 5DRNA 2C26A 4WV1C 1T03H 3ZKSD 1XGRA 4YBLC 3EFDH 4HJ0C 4NO3A 4WY7H 3BZEA 4CMHB 1TCMA 3HE6C 5IMOA 1JK8B 5JW5A 15C8H 4NJ9L 5CFHA 1F5WA 2FWOA 3I6KA 3LRSA 4JZNA 3DPBA 3SDXF 5EZOL 3BO8A 2PTUA 3KPSA 4GBXB 1DDHA 5DQ9B 1IEHA 1NGQL 1WCQA 2CUIA 3MRNA 5FOBA 4EQ2A 5CSZB 3PE9A 5C07E 3X14B 1T89C 1P6AB 1OGAA 2Z8SA 1F4YH 2QHLA 1BX2B 4P46C 6FABH 5I1HH 4X8XA 1CK0L 3S5LG 3NCYP 2EDTA 3HNTH 1OAKL 2ADFL 3MNVB 3OV6A 5KG9A 1A9EB 2FIRT 4PLKD 3S3SA 2BVEA 3NGBB 5I16B 1P4BL 5F9JA 4PJAA 3VWKC 1QSEE 3QXUA 3BYYA 3QNYB 3ULVE 3UJIL 4OZIA 1NGYA 2VXQH 4IHOB 4ZFGL 1LEKA 1IAII 4KC3B 3WNMA 1IEBA 2HA1A 3TT3H 1IM9D 3T8XA 1CG9A 3W11C 1IC5L 3F7VB 1MJ7H 1A1NB 3QHZL 1N3NB 3IFOB 3D9AL 1FNSH 1SM3L 5IW1A 1HHHB 3DVNB 2RR3A 5IWLA 3KHQA 4ODVL 2YPVL 4P2OA 1J18A 4JG1H 4PRDA 4WUUD 3HUJF 3CJJA 8FABB 1MIEL 4YQXL 1S7QA 2GUOB 1BBDL 1S7RB 1J0KA 4ELMB 4EDWL 4YPJA 3OKEB 3GGWA 2AJVL 4Q6IB 3GKWL 4OT1H 4MLSA 2CXGA 3QXAB 4KKAC 4Y16A 3EHBC 3EJYC 1T3FA 4J3XA 4DQOH 2BNQA 1X4XA 4BFEA 3ZDYF 1YDPA 5BZWB 5H94A 1TJGH 2P8LB 2A6KB 3D2UB 3OSKA 4S1SH 4QRTB 5JW4Q 3VI4F 3C5JA 2VZTA 4YO0A 4F7EA 2IH1B 3H0TB 4BSVA 5IHLB 5DRXB 5C0EA 5DC9B 5EULV 1YJDH 2J6EA 1ZA3A 1KC5L 2EC8A 5ANME 1T22A 3WUWG 3NIFE 4X0KB 2XTJE 4PRPA 3KYKL 3BWAB 2Z4QA 1NGWB 3ARXA 3DUHA 1CICC 1E28A 4KV5E 4X4YB 1EERB 4JPVH 4XBPB 4R3SB 3KXFB 5TDNA 3LPGA 3QUXD 1RD6A 4NQDE 3V5KA 2LQRA 2VR4A 3OAYK 4ENEC 4JFDE 2VMFA 4QXGL 4R4NC 3NFPB 4U7KA 4NNPL 4N0CC 1INQA 3C60A 4LLVB 4DVRL 2BRRL 1GGCH 5DJXA 1SEQL 1G7JB 4XTRC 3VFTB 3U9PL 1MRDH 4HDIB 3D0LA 3OQ3B 1GIGH 2BZDA 5EO9B 1UACH 2B1HL 3O3EB 1FC1A 3BPLC 5E1AB 1X7QA 5EC2B 3SJVD 4JFFD 5MP6H 5EN2A 1OP3K 3HNSH 4MCYB 3UJTL 1T2XA 3BPNB 2AI0L 2ERJC 3RWGB 4NUGH 4PJ9C 4WEBL 4GS7C 2DQJH 2EYRB 1DBBL 3MSPA 4XP6H 3SDDD 3CSGA 2ZOKA 4HWZA 1N6UA 2XA8H 3UC0H 4F9PC 5EZJB 3GNMH 3PJSA 2KBGA 3PL6B 1X5JA 4FQCH 5HYQB 3ZKND 4YX2H 4PGCB 2X1WL 1RZJH 4R4FH 5FIEA 1K4CB 2QKIB 1DUYB 3MTRA 4M61B 4PRNA 5IB1A 3G5XB 3W2DH 1CYGA 5D1QB 4YHNA 2ILLA 4HWBA 3BH8B 3JWOL 1ZT1B 4KY1L 5B38G 3U30C 1KCSL 5BOZG 4NP4L 1JTOA 2JLLA 3WFCL 4L4TE 5BO1L 5JIPA 1QSFA 3KYMB 4NOBA 3WN5B 2M1KA 1KJVA 1QP1A 1RULH 1FLRL 4LLMB 4JGMA 1HHIB 3MRCB 4WV1A 1KEGH 1WT5C 4UMGA 3NCFB 3WNOA 2EKSB 2YPKB 2R4SL 2NMSA 2WIMA 2C3XA 4MDJB 5L2JA 5GGVL 1CQKA 3CK0L 2NXYD 2E9IA 4PJEB