5JXED

Human pd-1 ectodomain complexed with pembrolizumab fab
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
218
structure length
197
Chain Sequence
QVQLVQSGVEVKKPGASVKVSCKASGYTFTNYYMYWVRQAPGQGLEWMGGINPSNGGTNFNEKFKNRVTLTTDSSTTTAYMELKSLQFDDTAVYYCARRDYRFDMGFDYWGQGTTVTVSSASTKGPSVFPLAPLGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVTCNVDHKPSNTKVDKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Programmed cell death protein 1
publication title Structural basis for blocking PD-1-mediated immune suppression by therapeutic antibody pembrolizumab.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 197
sequence length 218
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jxeD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jxeD01
4L4TD 1NKRA 3VXUB 1G9ML 3EOTH 3DHJA 1WEJH 3T77A 4R2GD 4YWGH 1T3FB 2FR4A 2Y36L 3HI1B 3OKMB 5EUOB 1DBKH 4HHAA 4U05A 4JFFE 5HYJD 3H42L 3LPFA 3EYUH 4L4TE 3HG1A 3V6OA 1JV5A 2IH1B 2OR7A 2FEEI 3L6FB 1RUPH 3R8QA 3MCKA 1P4LA 3MJ7B 4S2SB 1JL8A 3KAAA 5DRZA 5HYJE 4HKZA 1I8IA 1AGEA 4BSWB 1S7RA 1A0QL 3ARDC 5D7LD 1I7RA 3SQOL 4ENED 2Q3AA 5INCB 3KPSD 5EC2B 1SJVA 4L8BA 2MTPA 2YPLA 1J9CT 3TN0D 3K1KC 3LQAL 1Q94B 4P9MH 5E8NA 1H8OA 1KLGB 4Y4KB 3GNML 3VFSB 3MV01 3FT3B 1HE7A 3BH8B 5SX5H 3K7UA 3KPSE 4G7YH 4NBYB 4XCEA 5I1AA 4C83A 4K3JL 5D6DA 1KCUH 3DV6A 3P4OB 3LOWA 1ZA3B 1QSEA 3VD7A 4A6YL 2Q1EA 1UZ8A 4M8VA 4Y16C 2YD5A 3B9VA 4KMTH 1JZ6A 4PJIA 1NDMB 5IB5B 3HMXA 1D6VH 3HNVH 5IF0A 4PRID 5D9SA 3JWOH 2J88L 2YD3A 2YPVL 4R8WH 4M6ML 2EEBA 2ERJB 2VDRH 4PIRF 1HWHB 5DDHB 1PZ5B 2NXYD 4MNGA 4OZHA 2UUDK 4UIKL 5D7IF 3RU8L 1A5FL 4ZDHB 1J7VR 3RPIA 3NMEA 5TE6L 3IJYB 3L3OA 5FECA 2C4XA 1UH3A 4OCYL 4R4BB 3UTTB 1NCNA 1MFCH 4QOKA 2H32H 4NN7B 3QI9A 5C0RH 2NMSA 2E9WA 2EZ0D 3UBXB 5DHVB 2VN7A 4M93B 4P99A 2Y7QA 2O26U 4ELMF 3MNZA 1RZGB 4P2QD 4IJ3C 2NY7H 4ODSH 5EPMA 5GGQL 5EDXA 4U6VH 1BEYH 2FHBA 4E41A 4P2QE 1RY7B 2DDQH 4I0PD 4TSCL 4PJDF 4OFKA 3H7BA 1OSPH 4POZD 43C9B 2ZSVA 3I3EA 4FFVC 1MFDH 3TIDA 3IKCB 5C08D 2QR0B 3RGHA 1U8MB 2BXYA 5AYUH 3QDJB 4LSDA 4P49A 2IADB 1CD9B 4UOJA 4ZS6C 5MEPA 4V2BA 2CIKB 4G8GB 2FYYB 5MERA 4QRRD 2K9UA 5C08E 5DLML 1DANT 4WI5A 3QNYB 1EEZB 4GUPB 4XPHH 2Y6SD 4O00A 1TTGA 1YEJH 2GUOB 1ADQL 3T8XA 4QRRE 1T03L 4OM0H 2OJEA 4V1DB 5J89A 2R2HB 1WIPA 3G6DL 4ZXBD 1WTLA 3LSOB 4YBLB 3STLB 3D0VA 4O02L 2F8VA 5E4EB 1FNGA 1KPUB 3PWUA 3KLAB 3QWRA 2I26N 3UYRL 1EHXA 3L3JA 1G9EA 1R5WB 4M7ZC 1CE1H 3SGKC 3SGEH 2BSTB 1G7QB 3HPJA 3FRUA 2L7UA 1C8PA 1N6QL 3ZYIA 4N0RA 2O5ZL 1WIOA 2ZPKL 1D5MB 5DK2B 3RWIB 1H3PL 3T1FB 1FYHB 2GYSA 3SQBA 5TPWH 3FB8B 4NM8H 1AIFB 1K4DB 3KYOB 3U9PL 2AJ3A 2VLKD 1FLRH 1A6WL 4HWEH 5C8JB 5C0AB 2X09A 5JR1L 1CD8A 3SE4A 5BZWB 1ND0A 4Z7OE 5GS1A 2J6EH 1FC2D 2IQAB 4JO3H 3FHAA 4MD5B 2VLKE 1A6VL 4HK0A 4RMUA 1AD0A 4WUUB 2DMKA 1I7TA 1M6OA 3DMMA 1KG0A 1J0HA 3MUJA 1VGKB 1A4KA 1CDGA 1LO5A 32C2B 1EUUA 5JDSB 3RDTA 1KIQB 3F62A 4K9EL 1CD0A 2GITB 3HE7C 1T80A 3ZMRA 4YXLL 4Z8FH 2WIIB 4JLRB 4GG6B 2EDBA 3BO8A 3OF6D 1Q9KA 2HKHH 4O2CA 2X4UA 2ZJSL 4X99B 2R56H 4HJ0C 1KNOA 4YDLC 1VKXA 1QVOA 5IB3B 3SO3B 3ZE0F 3H3PL 2R29L 5HGBB 3MLVL 1S8DA 1NGXA 4JVPA 3OZ9L 2H45A 1QA9A 1KOAA 5I1IL 2GJZA 5ICZA 3V4VL 4QWWC 2LTQB 2VL5B 2VLMD 1BFOB 2YPKA 3IDGB 1NCCL 1G7HB 5DD3L 5D7IA 2CLZA 1JGVH 3HTLX 3D87B 4KXZH 3RZCC 3P30H 3WE6B 1IZJA 1T7VA 2BMKA 1JGLL 2YD4A 3U9UB 3MLXH 4LCUB 1G7PA 1RUML 2VQTA 4GJTB 2VLME 3RWDB 1RHFA 1RVFL 3PGFL 3QRGH 3CLFL 3H9SD 5HDBE 1GOHA 1JZ3A 2NY6B 3PWVA 3DPBA 2EH8H 3C8KA 2WINA 3TBVB 3PDDA 1MLCA 1H5BA 4DKFL 3QZWA 1V7NH 4Y5XC 3ARQA 3C60B 3H9SE 4G6AD 3DRTB 3FCTB 3O6MH 3AM8A 4XPBL 1S3KH 4CVWA 4JG1H 4OQTH 4TVSa 1MRCH 1ZA6A 1KYOK 4DFHA 4N8VB 3PJSB 1WSST 5EA0H 3CSBA 3KYKL 2H2SC 4WNQA 5I1DA 1O0VA 2XA8L 1CDYA 5K59F 3MGTA 4UQ3B 3L9RB 3MXVH 1ZK9A 3CDFA 3I02B 1DDHB 4Z78A 4MJ4A 3K1DA 1A6PA 3EFDL 4M4RA 6FABL 1EJOH 2YPLD 3FB7B 3RVUC 1B4JH 1WCBA 4NKIH 4FFZH 4F37F 1HCVA 1A1MA 5GRZA 3AGVA 3IETB 4OIIH 4X7SH 1LO0H 1G0DA 4I18B 4Z95L 2A0LD 2YPLE 4JZJB 5I1CH 1QSED 2H1PH 1KIRB 3VFVB 4CADA 3GM0A 1RHHB 4JQVC 2EDDA 5DRWA 2IH3B 4QTIH 5A43C 4U31A 4EZMA 3REVA 1SBSH 3ARGC 1QSEE 3FO1A 3HNSH 4K3EH 4O9HL 5JMRA 3T0DA 4LKCB 3RX7A 3L5IA 3WL9A 3B9EA 4PJGB 2JIXB 3EKCA 2BCKB 4PJIE 2ARJA 1F2QA 2WBWB 5GS3A 2A73A 5B4MC 3BISA 3O4LA 1QLEL 4KI5D 2ID5A 4ODWA 3ULVD 1FFOA 3Q2CA 4DKAA 2NW2A 4MNGE 3QI9D 2NTFA 3QUMA 3T3PF 4YDKH 3HLAB 4LGPB 4KI5E 4Y4FB 5C0EB 2DBLH 4K94C 2JJVA 2NY0D 3QDGB 3ROLB 3BD4A 4QRUB 1N59A 1LEKB 3TT3H 2FBJH 3BSZL 3C6SB 4C4KT 3ARXA 3BKYH 3O11B 1T1YA 4YO0B 3O3BB 4TUJA 1TPXC 2N4IA 4KK6C 5DO2D 4H25A 1CN4A 4MA3B 4E41D 1KPVB 4J4PC 5I76B 3W39B 2D3VA 4HIXH 3NH7H 5A2IH 1F8TL 2DLGA 4TTDD 3U36A 4S1QH 3VFWA 2JJTA 3EO1A 4ZUSA 2IPKA 4ODHL 3KDMA 3HMXL 4L3EA 3WFBL 5DI8B 4E41E 1J10A 5DJAA 1TQCB 1DFBL 3C2AH 1R3KA 4Y1AA 4IOFD 1VERA 1L9MA 3ALWA 1FNAA 5CGMA 5F3BA 4LQFH 5BV7H 3ZYZA 4P4KC 1MVFA 1H9VA 4UTBL 3G04A 3ZZ1A 1NGWB 5T33H 3DVGA 5B21A 4CVZA 3EGSA 1U2CA 3EYFB 2BVOB 4LPWA 1MREL 1YEHL 2OJZH 1JI1A 2HJKA 4XCFL 5I18L 2AEIT 3QWRD 3SOBH 12E8L 1HN1A 6CGTA 3JV4B 4JY4B 5AYQA 3QIBC 2Q8AL 3FB5A 1OT1A 3AMKA 1HCFX 1M7XA 2EEDA 3V4UL 1I7UA 4IRSA 1DQTA 1AD9B 1KEGL 2OI9C 3U79A 3VU2A 1JZ5A 4JFYB 2VLRB 4ESKA 5EZLA 3T65A 5C3TA 5IR1A 1AXSB 1C7SA 3UAJD 1C12A 5JMOC 1IKFL 3DRQA 3NTCL 1U8LA 2ZUXA 3QFJB 2XOTA 3MRMB 2AEWA 4G6JH 4PGDB 4TRPH 2CDGB 4K3GA 3RVWD 3QHFH 2XI9A 1EMTL 3HC3H 2HVJA 3GMMB 1B0RA 4I0CC 4B50A 1A7OH 3JTTB 1U8KB 3PP4H 3L5HA 1LD9A 5GS2H 2DICA 2Q7NA 2H26A 4KHTL 1BIIA 3DMMD 5GRUH 1FZMB 5DS8B 1FAIH 5EU3B 1XCTA 1N5AA 3NIFF 1KCSL 4U0RC 4MA8L 3RDTD 1GAFL 3D69B 1NAKH 2HFEB 2NY5H 4NP4L 4OKVB 4WFHD 1ZEAL 5CZVL 4LSTH 2HTLD 3VRIB 3EYSH 4ZFGH 1H0DB 1JPGA 2A74B 1PY9A 2EDNA 1R5VA 2C3XA 5M95B 4OJFH 5JORB 3QIUC 1WBYB 1IZKA 5C6TH 5D7SL 5ACZB 3OAUL 1NAMA 5BO1L 2X2YA 2R9HC 3BUYA 5CP3H 5D5MF 1JNLH 2G5BA 3NFPA 3SKJH 3T2QA 4LLVB 4GXVH 2DQFB 2V5TA 4LVHC 4JFXA 1UVQB 3ARDB 1B2WL 3JWOC 4MJ2A 3NCFB 5KVGH 2JB6B 3B5GA 4JDZA 5FIEA 1GJIA 5ETUA 3WIHA 3QNXA 4WI2A 5A2KH 5C0BA 4G3YL 2V9QA 4DN4H 3CDGB 4IEFB 3ECBA 4HLJA 3IB4A 3OKKB 1MHCB 5IESL 3ZE1F 2MOVA 1KB9K 1FL6A 3T0XA 1DUZB 1JGUL 1FSKC 2KZWA 4OD1L 4Q6IA 5IJVB 2CLRB 5D7IE 3VW3H 3MJ9L 4HIIA 1XGTB 4TPRL 3L3DA 1Q9LB 3TNNA 1H3UA 3K2UL 1IGTA 1MJUH 3U7WH 2VXVL 3HRPA 4Y16B 1CLCA 3GSQA 1NCUA 4D3CH 2VXQL 1X4ZA 5EFIA 3IFOB 3OG6B 1X5AA 4RWYH 4MCZB 3S98A 1UXSA 3EJZC 1JPFB 1FP5A 5DD0H 2KZ1B 3LEXA 4L8DA 1KXQE 1YNTB 3PABA 2A6JB 1YUHB 4TUOA 1UM5L 1IC7H 4ELME 4I77H 1F4AA 5IW1B 4XX1G 3DGCR 1IAKB 4WHDA 3GMLA 1S9WA 2JF1A 4X7CC 5BS0B 2D31A 4PR5A 4UTAH 2ED9A 2UZIH 4YGVB 1HILB 2UWEF 4OT1L 3RWGB 3BQUA 1P84J 3VCLB 3VFMB 2IG2H 1KIPB 1Q1JL 4YX2H 4PJDE 4MS8C 3WFCL 4ZQKB 3BIAX 2AXGB 1PYWB 3QO0A 1ZLSH 1KTRL 4G8IA 3QHTC 4K8RD 3JZ7A 4PV8B 4IJ3B 2OTUB 4XP5L 3MOBH 2EYSB 2VE6B 1YPZA 5FHBH 1IGJA 1EGJA 3PQYA 4UIMB 1D6EB 1H8SA 1N64H 4OZGF 1J0IA 4LU5L 2FRGP 4MD0B 1I1AC 1ITCA 5DJXB 1FJ1B 2DD8L 5EC1B 4OZ4B 4WW1B 1DBMH 3RIFF 2VZ1A 2AV7B 1X5KA 1U58A 4YDIH 1VPOH 2YWZA 3H8NA 3N1PC 2EYTB 1MSPA 5DJ8B 3K8KA 4RFNC 2H3NB 1MRDL 2OQJA 4OCSL 2CJUL 1OAXL 3P40A 5DHYB 4PJ5A 3W0WA 4YHNB 3ARUA 2ZCKH 4GKSA 1NFKA 2NZ9C 4X83A 3R06B 3U0TB 5E5RB 3KXFA 1AR1D 4ONFH 2IPUK 2DF3A 1GGBH 1ZGLA 4AMKL 2P8LB 4M7ZB 1OLZA 2CK2A 1GGTA 3U4AA 3VE0A 5KBNC 4NZDA 5C0FA 1NGZB 1T6WA 2VXTL 5C09A 4C4KO 2XTLA 2AV1B 2QKIB 4K94L 5D2NA 5EO1A 1V8HA 4L3ED 5HHVL 3L5WB 5GGUB 4C59B 5F7KC 4M7JH 1KUMA 3TCLA 4LARH 5FGBA 3CFEB 2YC1B 4Y1AD 5SX5K 3I9GH 1U8OB 5GRXG 3I2CL 4L3EE 4S1RH 4EOWL 1BZ7B 4IMLA 4Y1AE 3IU3B 3ZE0E 3CVHH 1MHEA 3O3EA 3B8YA 5CKGA 3HE7B 4JFDA 3QUML 1J18A 4YFDB 1MHPL 4LLAA 1S9XA 2YN5A 3AS3A 2NX5D 4LPUA 3HFML 3SGDI 5LQBH 3OKDA 5FCUL 2D7QA 3GSNB 2ZCHH 4XNYL 1F4YH 3R1GL 1NEZB 4GBXA 3UDWC 1ZHBB 4LNRB 4YDLB 2G2RB 4O4YL 4IRSD 1TNNA 1ZOXA 2IPTH 3R0MA 2NX5E 3FAXA 2C7UA 3SCMC 2H2PD 3PL6A 3M17B 1T1XA 2P24A 1SEQL 4L3CB 4P3DA 1UADC 3S37L 5T5NF 3IS0X 1RUKH 3G6AA 1MCLA 3BP6B 5JDJA 3ROOA 2Y5TB 3ULVH 3RNQA 2ORBL 1MQ8A 4HS3B 2C3VA 2NZIA 4MQ7A 3U0PA 4KJYA 4K7FA 5E4IA 4GAJH 5AWNL 2FECL 2IFFL 3RZCB 4PRHA 3BKCL 2X41A 5FOBA 1VFUA 4QXWA 3CC5A 1MNUH 1S7XA 2UWEA 4HK3J 3EOTL 3AVEA 2XZAL 5C0DA 3L1OL 3V7AE 5IB2A 3TYGH 4R97C 2DLFH 1F3JB 3UEZA 1FE8H 3TJEH 5HVFB 2VNCA 1INDH 5CEZD 5GS0D 2DLTA 4WTWA 1A9EB 4GKZA 5EWIH 4HCRA 3FO9B 4JHWL 1BVLB 3HC4H 4Y5XB 2QQNL 5L8KB 4JAMA 2ZNWA 4J1UA 2EECA 5CEZE 3G5YB 5LCVL 5FO8A 1MJJB 3RHWK 3DX6A 4NHCL 1J05A 2OL3L 3E2HC 2FATH 3AMLA 3NACH 1G6VK 4OZGA 2BRRL 4NO0B 4NBXB 1KJ2B 2X4QB 3MOQA 3GUTB 1EAJA 5F7MC 1YEKH 3FN0H 4XXDA 4ERSH 1U8IA 4R6UA 4X4ZA 5K9KB 5FM4A 4OM1L 5C0BD 4OF3A 5JOEA 4HJJH 2AXFA 3KPOA 3GSXA 4YPGA 5KVEL 4OZIB 1A2YB 2VTFA 2R1WB 4TSAL 1IQWH 2XT1B 3LV3A 1TLKA 3MXWH 4JANA 5DD1L 2NY2C 3CU1A 3WS6C 5C0BE 1I1YA 5SWZB 2BVUA 4HQQL 5JXEA 5FGRA 1T22A 4UAOC 1UJ3C 4PY8J 3CAFA 4DUWA 5IBTH 1NEUA 5ITBH 5GISH 3EDDA 3BEWB 3ARGB 1RZKH 3T3PE 3MV7B 2AP2A 4R2GC 3FOLA 3CUPB 2CGRL 3LS5H 2P5EB 1BFTA 1E0OB 1I9EA 1UM4H 4FQXA 4XBGB 1I1RA 4BQ9A 2VR5A 3KPRA 4AT6B 4KK8D 2MMXA 3G5XA 4G7VH 1INQA 2K3TA 4R9HA 3FQTA 4NCC1 3SKMA 5DMKB 3D2UA 2J8UB 1KTLA 1VFAA 1X5ZA 2HJLB 4DUXA 4PGJA 3L5JA 1F3DH 4WW2F 3LN9A 3ARSA 3HPLA 5CD3B 3BP7B 5L7XL 1KPRB 3V8CA 5CD5D 3HUJF 3MRCA 4ENEC 3LS4H 4RIRA 2GT9A 2IQ9H 1W0WA 3WIHL 4BH8A 3P4NB 2GFBB 3S96B 3TN0C 4XNQB 1WWAX 2FJGB 5DJCA 5BV7C 5HYQA 1QBMH 1MLBB 4EDXA 1J8KA 1XGQB 3PHOB 3B2VL 5HY9A 2YA1A 5DRXB 1TPXB 3MRKA 2AI0L 1R0AH 2ZG3A 3CFBA 5FUOH 3HNTH 5I66B 3FONB 5GJTL 3AROA 2VXSH 4PJFF 2DYPB 3MA9L 4G8EB 3BH9B 1E4KC 5T1MA 5C0JA 4PRDA 4QRPB 1Q0XL 3AFLA 4IDJH 4MSWA 5CGTA 4XH2B 2I5YL 5D7JC 3FO2B 4LCIL 2F74B 3DIFB 3WJJC 5J0BA 4XPHL 5CFHA 4ODBD 4R90L 5E00A 1TVHA 4DQOH 8FABA 4UU9B 2Z91A 5I2IA 2NXYC 3MLYL 3OTTA 4P4KB 3QAZC 1JWSB 4APQA 1WQVT 4JRXA 4AM0A 1S9VA 3S5LB 1BVKA 2J4WL 4WI9A 2XKUA 1MIMH 3AXLB 2EZ0C 3W0WD 4F7PA 2DJ4A 2ICEB 3KXFD 3MRFA 2VH5H 3OKYA 1KBGL 1KB5B 2D7MA 4I5BB 3QIBB 1JZ8A 4ZFZB 4K3DH 2KL6A 3W0WE 3C5SB 3Q6FB 1L7IL 2NY5C 3KXFE 1XFPA 1AQDA 2B0SL 4HWEL 2OI9B 5DYOB 1OAKH 3QCVH 4DN3L 2ZUVA 1JGDB 1DQJA 4HF5H 1EGJL 3VMNA 1H3WM 1XF3A 3NIFE 5DEGA 4I0PC 2E7BA 2F19H 4POZC 1GZQB 3CH8A 4LRIC 4D0BB 3K8MA 1FORH 5FDWA 3OQ3B 3O45A 1E4XI 1Z9SA 1BZ9A 2E5EA 2MQCA 3MO1A 5D2NE 4DVRL 4FABL 2FJFB 3AU1B 3EOBB 1BOGB 3K4DA 3TBTB 4BELD 5KN5B 4QRSB 4WRLA 7FABH 2E27H 4F80A 1A14L 3P73B 3DBXA 5JW3L 1LDSA 4K8RH 4EI6A 4U0RB 5D5ME 3Q3GA 5I1GH 3KLHD 3RL2B 1HHHA 4HD9A 3GFUA 5DZOA 4JFDD 1XZ0A 2Y6SC 3F5WB 2W0FB 1IJ9A 1CT8A 1GZPB 4D0DA 5HBBA 1YYMH 4LSSL 1KTKE 4M1GH 4QY8A 2GAZB 3W9DA 1J1OH 1AJ7H 1NGYA 1YEFH 3LMJH 4ZXBC 1WK0A 3O3DB 1K2DA 5I30H 1LE9A 2EDHA 5JOFB 1NLDL 4JFDE 3K81A 5HGHB 2B4CH 3S34H 5F88B 2AS5M 3QIUB 4GBXD 1CLOH 4J3XA 1W0VA 1UA6H 1F6AA 4PJEF 3ZE1E 1N4XH 1JHLL 4LLMB 3P4MA 4TOYH 5KVMC 2JB5H 4HZAA 5F9OH 1EHLH 4PLJD 1XR8A 4U1MA 5K33A 4OLYH 2APBA 4LVHB 3P30L 4HIHA 3WKML 1JPTH 3PHQA 3MV8B 3DXAE 5DR5H 5IT2L 2ARWA 1JMZA 4QYOA 4Y2OA 3V6FA 3HZVB 4LK4A 1SM3H 3W5MA 2HMID 2BOBB 4PRHD 3TPUA 4U2ZA 4X6BB 2EH8L 3RWJB 4TTGA 4NNYB 1IAIH 4LF3A 4JREC 1ZLWH 4V2CB 1FSKB 1NUNB 2H32B 3RWFA 4XP1L 2X7LB 4PRHE 4BUHA 1RI8A 5F9JB 2DBJA 3HUJA 3O6ML 5IOPB 1DTUA 1IEAB 1SJEA 1T20A 1MJ8H 2UWEE 4XVJH 5DJYB 1QFWI 2P47B 1CGYA 3AUVA 1NCBH 3MLZH 3QDMB 5HHQB 1CFVH 3WFHB 5I71C 5FYKL 3D85A 4L9LA 5C07D 3SBWA 4C56A 2XKSA 2QEJA 2YWYA 5D96C 1K5NB 3O4OC 3TBSB 5E6YA 3SKNB 5DVMA 3IVKA 1M7IB 4WCYH 1WC7B 3VXSB 2CRYA 5ICXA 5C07E 1EJOL 4PJFA 1ETZB 4NKIL 4FFZL 3L3KA 4YNYA 4PV9B 4KAQL 1U92B 5KSUA 2VLLB 1EO8L 3UXFA 1XR9A 4WDIB 3VFUA 4OZGE 4NO2A 3MRDA 3QO1A 2H1PL 4L4VA 2DQTH 5D1XA 1E27B 1UM6L 1OP9A 2MNUA 1Q72L 4Z77B 4DOHB 5J12B 3PNWB 5FA3A 1LMKA 3GI9L 1RJZB 2CKBL 2X44D 4K3EL 3ZHDA 5LKNA 3UTSB 3HAEG 1X6LA 1GCFA 4U3HA 5J6HA 1M4KA 3UPAA 3NAAL 3AB0C 5HGAA 3HR5A 2EO1A 3L3IB 4BH7A 1VCAA 1I1AB 2UV3A 4Y8DC 3ZTNH 4ZYKB 3DUUA 4XZUB 4NRYA 5BVJA 2JJWA 3QXDA 1LILA 2VABB 4G6AC 2DJSA 1WGOA 5IM7B 3J7HA 4FQXD 1JYWA 1FLTX 3T0EA 2XPGA 1T2QH 3KPRD 2CDEA 3J8F7 1Z0MA 1T66D 5IB4B 4Z5RA 3VMOA 3HRZB 4JFPB 5A2FA 5IG7A 4ODXA 5JHLL 1FC1A 4RFNB 2PR4L 4PYGA 3KPRE 4B53A 3IKKA 5I1JH 1AO7B 4YHIB 1QLRB 4RAUA 4Y4HD 2XG5A 4CRPA 3D39A 2QTEA 3HA0A 1IM9A 4JM2C 4WWID 3LKQB 5CEZH 5GS0H 5F7WC 1EDQA 2BHUA 4RZCB 2FX9L 4EDWH 5JIIA 5J13C 1CGTA 4PJ9A 3V52L 4JHZA 3MUGA 4YHKH 1OAYL 4UV4L 2A0LC 2VZTA 5E2WH 5D6DC 4JJ5A 1S9YB 1UB6B 2E9IA 2B1HH 5CBAB 3D0LB 4LL9A 5CAYB 3GZKA 2EKSB 3EYOB 3I75A 4FZEH 4X4ME 2VDPL 4DGIL 1NAMH 5H2BB 4IOSD 4J6RL 1XGPA 1JF1B 3QP3A 4EJ1C 2AJYH 4HGWA 4WJ5A 3RIAF 4PJEA 1MIEH 5DC0A 2ICWB 2ITDA 4LSUH 4YXHL 1MJ7L 43CAB 1FRGL 5GGRA 4S0TD 1I9IL 2R15A 3MROB 4GFTB 3FHQA 2WP3T 4KI5C 1T7YA 4KK9D 4APQD 5IEHB 1F5WA 4OAWB 4MNHA 4Q9QL 2NTSP 1ZMYA 5TDOA 4PG9B 5FK9B 3QI9C 4KHXH 3BKML 1MCBA 1RK1B 5E8PB 4EQ3A 4QKXB 1LEIB 4OI7A 1NCAL 2NY0C 2BY1A 3BGAA 5DJDB 1P7QB 4PBVC 4EEEA 4OFPA 4OV5B 5ID1A 4RFEB 3SDXB 4PB0L 1K8IB 7CGTA 1WZ1L 2DM4A 4LIQE 5E5MB 2GCYA 3SCMB 4GRLC 5DO2C 1H3XA 1ZANL 4FXGA 1UKQA 3HC3L 1C5BL 5CBEB 1ZKAA 1B9ZA 1YC7A 4ZS7H 4TTDC 4JE4B 3UP1A 3C9NB 3V6ZA 1P4BL 3OXRA 2L7JA 4CW1A 4P9HH 4JPVL 1DQQA 3S97C 1FAIL 4CMMB 5T1LA 1DBAH 2AKRB 3KYMA 4IOFC 1MFEL 5E8OA 5B3NA 3FQUA 3QWQB 4PJAB 2X4SB 4R97B 3CX5J 4LLUA 1TMCB 1SY6L 1V3MA 1SMOA 4UILH 1J12A 1A4JA 4ZUVB 3QFDA 3WLWD 4OJFL 2IGFL 4U1GC 4LP4A 4MA1C 5FKAA 5C6TL 3DX8A 3CZFA 4MB5A 2V5RA 1J87A 3NPSC 1JNLL 2H8PA 1B0GB 2OR9H 2R4RH 4ONHA 1HKLL 5ILTH 5F6HJ 5KSBB 4GXVL 4NQVB 4DVBB 2E8ZA 5IMKB 2AJUH 3E2HB 3G6JB 4KVCH 4JO4L 1FZKA 1J88A 1QBLL 3DJ9A 4JVWA 1MVUA 1FYTB 4A2LA 4KPHL 1MRFL 4M43H 1G6RA 4RMSA 1JRHL 3CFDB 4G6FB 3BDYH 3NGBC 3QQ4A 3BZ4B 3UAJC 5CMAA 5E2UL 1TENA 3SY0A 4D0CA 2O61B 1W0YT 3BZFB 3RVWC 2W1NA 4BZ2L 3CX2A 4TUKL 4QTHB 3B8SA 1QRNB 3MGOA 2Z35A 4IOIB 2NY2B 1NMAH 4RWYL 4MZ3A 4RQQA 5D7KD 3DWTA 1IEBB 3DMMC 4F33A 4NC2B 4UAOB 1UJ3B 4YHOL 3NA9H 2ZSWB 3KWWA 4YHLH 3RDTC 1IC7L 4JFFB 4LPXA 1E4JA 4HBQA 4I77L 2VDKL 3KG5A 5EH1A 3K74B 1EAPA 1LWRA 4LBEB 4OGYH 5D7KE 1MUJA 2R1YB 3D85D 4R2GB 1T1WB 3QIWA 4C56D 4QEGA 3HUJE 4I4WB 3IDNB 4BA8A 5SV4A 1YQ2A 1KIUA 3OMZA 4J7RA 4LLDB 5HYJB 3O3AB 3ARZA 1QD0A 1JFQH 4KROD 4C56E 4NT6B 4UV7H 3FQWA 4HUVA 5I1KH 4KTEL 4XHJD 4XX1E 3VRLF 3O0RH 1NCTA 1F97A 4PJFE 2W0KA 3KPSB 1A7QL 1Q0YL 1FFPA 3BXNB 4GG8A 3QNZB 2Z8RA 3KPPB 4L4VD 3TN0B 3SDYL 4MDJA 5BV7B 3LKNA 2YXFA 4ZODA 4LLWB 4P5MA 1CXFA 3LHPH 5EBLA 3QSKB 5IK3B 3BP4B 4L4VE 1U8NB 1BJMA 2AJXL 3MLRL 3RAJL 4U2YA 1MCOL 1R24B 5I1HL 1DBML 4I1NB 4LMQE 2I27N 4FQJL 5E8EB 1QQDA 1H5BC 1UACH 1UKSA 5TDPB 3QCUH 1U8HA 1CD1A 4KKCD 2YUXA 4LASH 5D7JB 4HPYH 2XRAH 2WWMD 1T0NA 1OY3B 3AM8C 1U9KA 4FQCL 3T0ED 5HDQH 4GMSH 4M7LT 4W6YB 2A6DA 3A6BL 3IJHA 1HZHL 3NCMA 3QAZB 2DQHL 4AENA 1D5BA 3T0EE 4ZPTA 2VRAA 2DQGH 1XF1A 5ITFA 5EOTA 1RQ5A 1P6AB 4NQCA 5CEXA 1Z2KA 2AQ3A 3D39D 3DTXB 4ZPVB 4E42A 5IKCA 3OSKA 5T3XL 3F58H 4AY0A 4F7EA 5IW6A 1VACA 2X89A 4LP5A 3WXVH 1TZGH 4ODTH 4LSVL 3OB8A 2ZKHL 4K8RC 3LQMA 4P2QB 4XAWH 3D39E 3KPQB 3INUL 3VXMA 3U0WL 1EEQA 1S5IH 4NCDA 1RJYA 2EIEA 4QXUH 2OBGA 5DJ0A 1AE6L 1RJLA 2FWOA 3JVGC 4JRYA 3ULSB 5EU5B 4LCYB 3K4ZA 3UTQA 4I0PB 1CVSC 1TJIH 1F02I 5KSVA 2B4CC 3H9HA 5C08B 1XGYL 4NQSA 3CVHL 1AGDB 1CZ8L 1K6QH 4JQIL 5KJRH 1U3YA 4KGLA 2EE2A 1PSKL 2YD8A 4QRRB 2OYPA 3M8OH 4PJEE 4JFEA 4HV8B 3B9AA 4PJHF 2P48B 4GT7A 4KTYA 3REWA 4PREA 2WP3O 3RVVD 2DB8A 4GO6B 4H8WH 1H15B 4ZXBB 5SV3A 2C1OB 2PXYA 5E7BA 1FNFA 4LSPH 1AR1C 4B0MM 4JHAL 4PGEA 1HQRA 5L2JA 3WEXA 4GQ9H 5E2JA 4JPKH 4XMKL 5BXFA 4NZRL 1YY9D 1A7PH 1OM3H 3HC0B 2YD2A 1N2RB 1TVBB 2D03H 2JJTC 2P42B 4EXKA 1AC6A 2VLJA 4MJ5B 3QQ3A 5F7UA 2VLKB 4CGTA 2PUQT 1FFNB 2DTML 3TJEL 4JG0H 1H3GA 2XY1A 3SKOA 5DEFA 2R0ZH 3LRSB 5T1LD 15C8L 5FUZH 3NA4A 3V5HA 3VXOA 1CGSH 4JREB 1UYWL 4NNXB 2DM2A 3OR7B 1BGXL 1BX2B 2ADGA 4AQ1B 4RX4A 5B39G 4Q97A 5B3JF 3FT4B 4JB9L 3QXWA 2COQA 2PCPB 4K2UL 1QACA 3CSYB 5I71B 2FATL 3F7VB 2EDFA 1R5IA 5D96B 4NM4H 3O4OB 3ALXA 1RIUL 1XIWA 1YEKL 2VKXA 1IBGH 2ZCLH 1NBYA 2RIKA 4QGTA 1MI5A 1JNHB 4LCWA 1S7SA 3BIKB 1FVCB 1C16A 2YZ8A 3NZ8A 4GW4A 4IRSC 3NABH 5DRNB 3Q1SL 2BDNL 4JN1H 2H2PC 4HKJA 4UT6H 1E28A 2DQUH 5D1ZA 4HXAH 1IQWL 1BQLL 3L95B 2QHRH 4L4JA 3BVNA 4L29A 5J9PB 3LN4A 3OKLA 3EAKA 3GSOB 1VGEL 4HUWB 2D0GA 4MQXD 5EG6C 3O2DA 1CXIA 3ARPA 5GISL 4BFGA 3HCVA 4LIQH 5IV2B 2OSLB 3HAEA 2JK5A 1OHQA 5TF0A 3LS5L 1J1XH 1JHTB 3H9SB 1AHWA 2ZOKA 1DR9A 3AB0B 4LHUG 5EULV 1M71A 5GS0C 5LXGL 4NQDA 2AGJL 2WMPA 3P77A 3T2NL 4NUGL 4KDWA 3T77B 3IGAA 1PG7L 3QIWD 2NY1D 3G5VA 4FQIH 4UDUA 1HNFA 1OARL 4ETQA 1ES0A 4HHAB 3M07A 1WT5A 4AJ0A 1JV5B 2I07A 4ORZC 1R3JB 3LS4L 1R3LA 4OLWH 3PGDA 4NUJA 1W8OA 1P4LB 2PYED 3MCKB 5CSBA 1MCWM 2Q7YA 5DRZB 3CMOL 1CYGA 1QBML 5JPNA 4HKZB 1I8MA 1AGEB 3TC9A 1S7RB 2W9LA 4D9LH 1CL7H 1L0QA 1I7RB 1X6NA 1NPUA 1DJSA 4JM2B 2PYEE 2VDNH 4X80H 4F57L 2YPLB 4UQ2A 5E8NB 3MUZ1 1RJCA 4PUBL 3AY4C 5J13B 2ESVA 1P84K 3JSSA 3X3FH 3PWLA 5CJOH 5I1AB 1RU9L 1PAMA 4C83B 3CVHB 3X12A 3DV6B 1H8NA 1PJ9A 3HHRB 3JV6A 4Q6IC 1QSEB 3BP5A 1HHKA 4NNPL 1UZ8B 5DURD 4ZAKA 2APTA 2DMBA 3LIZL 1T5XA 1S7UA 4PJIB 4JO1H 3GIVB 1A1OB 2I9TA 1I4FA 1J1PH 5E2VH 2X05A 5IF0B 2E7HA 5D9SB 2BNRA 1P2CA 4DZBB 5E8DL 1ZLWK 5J3HD 4KK8C 4R26H 3BUTA 3RPIB 1FGVL 3LQZA 5KW9H 3L3OB 5FECB 3I6GB 4QNPF 4B5EA 2E6JA 1GIGH 4JN2A 4U1NA 3F8UB 5EIIA 4NQCD 1NCWL 4EVNA 3QI9B 1FVEA 4FZ8H 4KY1H 3GJFH 1BJ1J 5CD5C 3RTQA 5F7DA 3BKJH 2X89D 3M1BA 3MLTA 3V8OA 1PKOA 2O5YL 2UVFA 3GSWA 2NY0B 1OAKL 2Y7QB 2MPAH 5K9QG 3PDGA 3DX9B 3QG7L 3B9KD 3F12A 3VXMD 3VWKC 1QKZL 4P4RB 4M03A 2R69H 4GRLB 1FORL 4NWUL 5KZCD 3ZDXF 1ZGLM 4JRYD 4E41B 4RISL 3F6IA 4ORGA 3VXME 3TWCH 3T4YB 3H7BB 4B7LA 2ZSVB 5JOPD 3FN9A 3TIDB 4KTDL 4U6TA 1S7WB 4JRYE 3FB6B 1IILE 1Y6NR 3OWEA 1MWAA 4QHNA 1BAFH 1QSFA 5MEPB 5JOPE 5J06A 4U6YA 2DOCA 1MY7A 3EZ8A 4KQ4H 1PQZB 4HWZA 1AJ7L 2YUVA 4PYHA 4S1SL 5I30L 5F9DC 2B4CL 3T08A 4ZFOB 4U1GB 1CLOL 4MA1B 4WHCA 1N4XL 1TFHA 4HUKB 3NPSB 3UYPA 5I8KH 5F9OL 4HW6A 2OZ4A 2PXYD 2GSGB 3D0VB 4WHYG 3SHSA 1T6VN 3FOMA 4DZ8A 1T0MB 4DW2L 3WSQL 3L3JB 3CU7A 4M02A 1YEGH 3FRUB 4ALAH 4XCNB 5GRJH 3SGEI 1CR9L 5F7EL 3RY6A 3L3GB 3NGBB 1IAIL 3F7YA 4P48A 5D2NC 3WFZA 2AJ3B 1KENL 4ZOCA 1CXEA 3A67H 3BGMA 3UBXG 5CZKA 5FGBC 1BQUA 3ORJA 1ND0B 3ZKND 2WANA 1NCDH 4X4XA 3MLZL 4XVTL 2R0KL 1BOYA 5CINH 4I0KA 1CFVL 4HK0B 3CK0L 2X6MA 4RX4D 1I7TB 1M6OB 2DQCH 3LH2H 3DMMB 1KG0B 1JF5A 1A4KB 1LO5B 2IAMA 3N06B 3KVQA 4KVNH 3BESR 3RDTB 3KLHC 2XWJA 3VRLE 2ZUYA 3O2WH 2OXGA 1QLFB 1M05A 5HD8D 4PRPD 4WO4A 3FFCD 3CXDH 1GC1H 5KTEL 4IRZL 1UG9A 1GGUA 4O5LH 3SGDH 2NR6D 4H0GA 1J8HB 2AEQL 2N7BA 1MI5D 2VIRB 3EDEA 4LCWD 1KNOB 4PRPE 4GBXC 3FFCE 1VKXB 1QVOB 4ZMAT 5CJ8A 5DMJB 4KRNA 1ZT4B 2DQTL 3MRHB 4PLJC 2V2XA 5D1ZD 1MI5E 1S8DB 1NGXB 3FL7A 4LCWE 1UB5A 3O6KL 1HI6A 3K0WA 1GSMA 5TGBA 3X17A 3NFSH 4XAKD 4HWBA 2BHZA 3ZE2F 2GJZB 2BJMH 5ICZB 5DHXB 5DSCB 2DN7A 4NGHH 2RFXA 1TIUA 5IVXA 2ADIB 2YPKB 4X6DA 3MODH 2HMIC 1X4XA 2AAVA 5GGSA 5D7IB 2PN5A 1W8NA 2CLZB 8CGTA 2BMKB 5EOCJ 4OGAD 5I1LB 4XAKE 3G9AB 3EYVA 1Y18A 1IC5H 1Y6MR 2AQ2A 2IFGA 4N1HB 1WAAF 3PWVB 3OL2A 4NQDD 2WINB 5DJZA 4XCYA 3K8LA 4X7TA 1H5BB 4ELMB 2D7OA 4OF6A 3QZWB 4F2MA 3MREA 2NY3D 3QUZA 3LEYL 4GSDH 2C26A 3MLUH 4I2XE 3TVMD 4NQDE 4Y5VA 5DT1L 5E94A 1CCZA 3X14B 5I1JL 1ZA6B 3UYOD 1HH9A 5J57B 1OF2A 3S36H 3MUY1 5EZIH 5BVPH 5DQJA 3NZHL 4PJDB 4WNQB 5I1DB 5DA0B 1R3IH 4HFUH 4OBRA 1U93B 4XP4L 2YA2A 3GMRB 4M9PA 3W9EA 5DJ6B 4Z78B 2LU3A 3EO0A 3CH1A 3QXTA 4YHKL 1NJ9A 5E2WL 1WCBB 4FFYH 2X4NA 4M6OL 5GSRB 1ORSA 4ETYA 1A1MB 3GSUA 5DK0A 1VEOA 3SE8H 2ESVD 1IGIL 2XXMB 3VI3F 5ECJE 3X3GH 2XWBA 1ZLVH 5A3ID 3CXHK 1T2JA 1MFAL 2ESVE 1RK0A 2WLYA 4WHTA 1KN2H 4PJHE 2IANA 1XF5A 3VFOA 4H8WC 4ZUUA 1LVEA 5JUEL 2YUWA 4XT1C 3REVB 1RUAL 3OGCB 1URLA 1UWGH 5I8CB 3IAGC 1IGMH 1G6RH 2MSPA 1U91A 3WL9B 2LV4A 2P5WD 4G8FA 2BNRD 4D9QD 5T1DH 2ARJB 4FQXC 4PP2B 1ACYH 5CZXD 5K9OB 5J6GA 5IEKA 1T66C 4UDTA 3TV3H 4ODWB 2W60B 5IWLA 3KR3H 2P5WE 4GS7C 5C2BL 2BNRE 1AI1H 4D9QE 1FFOB 2XTJD 3N9GL 3N1FC 5D70L 3KPLB 4PB9H 5HYSG 2NTFB 1W72H 1DLHA 1SEBA 3RTQD 4Y4HC 4NQXA 5F1NB 3VD3A 2XTJE 3JTSB 1N59B 2FIKA 2XICA 4H0IA 3OAYH 4JGJA 4TUJB 2V5MA 4RNRA 3UO1H 1F11B 2BX5A 5EO0A 1EZVX 4CMHC 2WQ8A 3ARVA 1HWGB 4AL8L 1TXKA 3U36B 3V6BR 3F7QA 4J8RA 5DD6A 4ZUSB 2IPKB 1A8JH 4AIOA 4KRMB 2R39A 4R7NA 3KDMB 5IMMA 4KKLD 4L3EB 5ABDE 1SYSB 3UC0H 4G42A 1UEYA 2WBKA 4LPVA 4P46A 5B8CC 2BVYA 1R3KB 4Y1AB 1QSFD 1AY1H 3SKUD 1U8QA 4M3KB 1NC2A 5B39A 3ULUF 3DV4A 3G04B 2AEPL 3CFKA 4NKOB 4KK9C 4APQC 1Y0LA 1QSFE 3WNOA 3DVGB 4XPGL 4KDVA 4CVZB 1T04A 5CJQH 5CJXA 2AJUL 2G60H 2Z4QB 1CE6B 3N0PB 4CKVX 2APXA 3FQNA 3GK8H 2PYFA 5IROC 5BZDA 2GHWB 2Y07H 2X9WA 1J0KA 2NX5B 1MPAH 4Q0XH 3B3IA 3ZDZF 4UB0L 3FB5B 1BBDL 3LB6D 3ZT7A 2FGZA 4IRSB 4JO2L 4MA7H 4XWGH 5I8EB 3VJ6A 1I8LC 2DL9A 3BZEA 5DJ2B 2ICES 5EZLB 1EZVY 4MXWL 5DD5H 1ZVYA 3T65B 5IR1B 4TVPL 4AK1A 1XH3A 3TT1L 3DRQB 3CNKA 1BHGA 1MQKH 1U8LB 1NBVH 2EDYA 2D2OA 4P57A 1B0RB 5H94A 1RZJH 2YSSA 2N7AA 4AH2A 5JNYB 1E4XH 4HC1L 3QEUA 2HT3D 1CFQA 4JKPH 4NBZB 4LHUA 1BIIB 2ARJQ 2P8MA 1KTDB 1WICA 1XCTB 2IAMD 4F7MB 5C0ND 4H0HB 3VWJD 5AEAA 1ACZA 2DLIA 1ZVSA 3CGTA 3WLWC 5GJSH 5CS7A 5C7XL 1JFQL 4X9GA 3BAEL 4WO4D 2VOTA 4DCQA 4HPOH 5GZNC 1XGUA 1NANH 4LDLB 5FB8A 4RRPG 1N7ML 2OZ4L 1RIHH 1P69B 1R5VB 2YMXL 3JV5A 3O0RL 4HSQA 2OCFD 2F5AH 1A7RL 5L2KA 3RIFK 3D9AH 5HVHC 4RGOH 1PFCA 1A64A 1CU4H 1NAMB 4PJ7F 1FO0A 3BUYB 3VGEA 5JIHA 2G5BB 4N0CD 1WIUA 3MRBA 3NFPB 5ALCL 2CRIA 2CLVA 5AZ2H 4ODVH 4JFXB 5B22A 1QUNA 2JTDA 1MEXL 4JDZB 3NBNA 4HDIA 2VZ3A 5ETUB 1N3NA 4FP8H 4EKXA 4YBHA 5C0BB 2A9NL 2EH7L 5DF0A 1XGRA 1AXTH 2W0LA 3GSRB 2C1PA 1A1NA 4KRLB 4GMTL 4R0LA 5TDNB 1CIDA 1QOKA 1RZIA 3IDYC 5DQ9B 1UACL 1DBJL 3C6LA 1KELH 4HMEA 4Q6IB 4WW2C 2XFXA 4JY5H 4LASL 1KJ3H 4HIIB 3P9LA 3L3DB 3TNNB 1NFIA 1IGTB 2XWTA 1X5YA 3NCYS 2GQHA 1HSBA 3GSQB 5EU4A 3S3JA 4QNPE 5EFIB 3DECA 3QT2A 4N8CH 3X11A 1QFWH 1UXSB 3QUZD 4L9LC 4WFGD 3FMGH 3LEXB 4F9LA 4L8DB 1IAOA 3PABB 4TUOB 3C5ZD 3DOSA 4NPYA 2PO6B 1OWWA 1IGCH 5HI5C 5C0CD 5KSAA 4GLRH 4KDTA 4WFGE 3GMLB 4KROC 3X13B 1YEEL 2EKJA 3MNWA 2D31B 4PR5B 4MAYA 5TE7H 4HH9B 5IFAH 4XHJC 4RMRA 3JV0A 3ZDXE 4BKLB 1I85A 3GBNH 4LGRB 4HULB 5C0CE 5I8OH 1U6AL 3VXUA 4HG4K 4ZNEA 3E8UH 3QO0B 5L9DL 5F44A 3OKMA 4OLZH 1KB9J 5TQ2L 2E7CA 4KV5F 4FQHA 3B2UD 5GGTL 4DFIA 1TJGL 3VWKB 2XZQH 1T7XA 1JF6A 1WZLA 1TJIL 3WFEL 3MV11 2IAND 4S2SA 1HDMB 5F6IC 1AGFA 5CCKH 4M1CD 4BSWA 2OLDA 2Q86A 5CJBA 5LAXA 2IANE 4KKCC 3ZYJA 1ZS8A 5ESVA 2WWMC 1T21B 1QR4A 4CJ0A 3T0EC 3VFSA 4N68A 1DZBA 3WHE1 1UH2A 1U58B 1YDPA 3LKRA 1PLGL 4H8WL 1N0XH 5KVFL 3O2DH 2QSCL 4M4PA 3MJGX 4TQEH 1ZA3A 1S7QA 4PRNA 5L88H 2OQJB 3WIIH 4FNLH 1OAZH 3CFCH 2CSPA 2AJVL 1NDMA 5IB5A 2VZOA 3W0WB 4HK3N 1NUGA 3KXFB 2DI9A 1UWEH 2YK1L 5I19H 1ZGLB 1JVKA 3PUCA 4U7KA 2FO1A 3IDXL 1QNZL 2VDML 5E08L 5EN2B 5M94B 1PZ5A 1YMMD 4U1KA 4TULH 1GC1C 4R4BA 5EOCH 5FUZL 3MBXL 5D1QA 5D2NB 4WVRA 3GBML 1LE5B 4YXKL 4X5XB 1R3HA 2F54B 4NHUA 3GRWL 4JFOA 3UBXA 1YMME 4XNUL 1DL7H 1K9TA 4P46D 4RFOH 5GHWL 5D5MB 4GAGL 1II4E 1RZGA 2UYLA 4WTZG 4CBPA 3HI6H 2WUBL 4L8CA 2A9MH 1NC2D 3FAWA 4OCRL 5F7FA 5TF1L 1NC4A 3BD3A 3SE9L 1CGUA 3WLBB 1OAUH 2ZCLL 2EYRA 4JFDB 3EJYD 5HVGB 5BQ7A 4OQ1A 2AJZA 2XKNB 2ILLA 3MLWH 43C9A 3VMPA 3RVVC 2ENYA 1RZFL 3ZE2E 3Q6GL 3L5XH 4U49A 2DQUL 2R0LH 4HXAL 3QDJA 4Y88A 3U82B 4GKOA 4GBXB 4XMPH 2VDOL 1LGVA 3DXAB 2CIKA 4Y8AA 2C7UB 3U1SL 1YY9C 1CS6A 3QNYA 1EEZA 1WAAE 4P3DB 3BMVA 4BFIB 2BERA 3GJFK 3G6AB 1VA9A 3ROOB 1JPSH 2GUOA 2AXHA 4GRWF 2R2HA 5E0QA 1AQKL 1U0QA 3U0PB 3U83A 2JCCF 4K7FB 4PRAB 4PRHB 3STLA 5FOBB 5JW4M 5EBWA 3BYTA 1LDPL 1KPUA 4JGUA 3BDXA 2UWEB 2HFGL 5IB2B 4Y2DA 1E4WH 4LHUD 5DWUH 4NJ9L 1FZJA 1KEMH 4YHZH 1W2KT 3IDMA 3UROR 2RB8A 3WXWH 3DUSA 2YZ1A 4GKZB 3V0WL 2R0WL 3T1FA 3IDIA 4PD4K 2FEDD 2ATKA 1AIFA 1XF2B 4P23A 5C07B 2VR9A 3TO4A 4P3WA 3DX6B 5L2KD 1J05B 4D9LL 3CIQA 5E2TL 5BZWA 3VI3E 5LGHH 2B7DT 2IQAA 4MD5A 2CXKA 4OZGB 4YPJA 1MWAH 1ERNA 1OAQH 5BMFL 5L2KE 4M8QA 1U8IB 1IKNA 2GSIB 4UINH 5TFSH 3S88L 4X9HA 5F3HB 2GITA 1K8DB 4QXTA 2AXFB 3KPOB 4LAQH 4JLRA 4YPGB 5F70A 3C08L 3VFGL 1CVRA 4ISVB 4PTUB 5C2UB 3LV3B 4JANB 4MQXC 3THMH 1NH6A 4C54A 4PRBB 2B39A 4JO1L 3C6LD 2QJDA 1U36A 1J1PL 3IDJA 1HOCA 1S7VB 1RULH 4U1HA 5IB3A 5AD0B 1T22B 1LK3H 3OX8A 4N0YH 3ZKSD 2YS4A 4FFWD 3MRJB 3NCJH 4L5FL 3WYRA 5E99H 1QBBA 4R7DB 5FCSH 4G6MH 3ABZA 4A6YA 4R26L 4XPFL 1OD7A 2BNUB 3FOLB 3QIWC 2NY1C 4KQ3L 5ADOH 3WIFB 5KW9L 1QFUH 1DSFH 4OD3H 4YIQB 1BFOA 2DQDH 3RX8A 1RFDH 2DQJL 4FQXB 1PKQA 3KPRB 5KSAD 1JGEA 3U9UA 2LU7A 4LKXB 3FQTB 4EI5A 3SKMB 3S7GA 1YNKH 4XVSL 4GS7B 3RWDA 3N85L 5HYSA 1KTLB 4HWNA 1S7TA 5T3ZL 1NL0H 1YNLH 3HPLB 4KUZL 4Y4HB 5HHOD 3MRCB 3ZTJG 3I84A 4Y5YA 4RIRB 2GT9B 2A77L 4YR6A 2VUYA 5DJCB 4OB5H 5HYQB 1MH5A 3ULUD 3WS3A 5C0IA 3DRTA 4X4YA 5HY9B 3TWCL 1KF9B 5HHOE 2NY4D 3MRKB 4ZNEE 2DAVA 1D3CA 1NKOA 1DANU 3CFBB 3GI8H 4CMHB 3ULUE 1RZ8A 4ZTPH 2BVQA 3D3VA 3OXSA 2EDWA 1RIVL 5TH2A 3I02A 3GIZH 1DDHA 5T1MB 4NJAH 4PRDB 1X5JA 5LGJA 1X5IA 3VFTA 4MSWB 3DI2B 2Q87A 1Y6KR 3PWNB 5B8CB 2AJSH 4U1JA 4XVUD 3GHBL 1KN4L 5E00B 1TVHB 5D71L 5T5FH 2Z91B 1XAUA 5I2IB 4I18A 2W65A 2HH0L 5J3HC 3ZDZE 2HJFB 1F4WL 5C0GB 1AGBB 3IDUA 4APQB 3LZFH 4AM0B 4EBQH 1S9VB 1BVKB 2A1WH 1OQXA 2HFFB 2IH3A 2J5LC 3MNVA 1RZJC 1P9MA 2WQRA 4X6EA 3WHXA 2R8SH 1ADQA 5GRJL 3VD9A 3LKPA 3MRFB 4LKCA 5E9DA 5IHUH 4PJGA 3B9KC 2BCKA 4WEBL 1CDJA 2AK4A 2B1AL 4XPTL 4E0RA 4OGXL 1P7HL 1AQDB 3A67L 1U3JA 4NZUH 4KZDL 5K9JH 5I73C 1CBVH 1I9JH 5D1QD 5T1KA 5JA8B 3OV6A 5JO5A 1CLYH 4BYHA 4Y4FA 5FYLL 3P3YA 4JGMA 1GHFH 3O45B 1YMHA 2DWDA 3QDGA 1BZ9B 3ROLA 1MCPH 1ZLUH 3MO1B 4OCXH 1F90L 3DO3A 1LEKA 3WUWG 2V6HA 1QPPA 3C6SA 1ZLVK 2WBJA 4CVUA 1NC4D 3PGCA 3DBXB 1X5HA 5IQ7H 4PJ7E 2XZCL 3Q3GB 1MCJA 3OPZH 4M7KL 1KPVA 5I76A 3GHEL 2DQEH 3ARYA 1CT8B 4D0DB 2ADFL 3ARBA 4RRPA 5DMIL 1A7NL 1K2DB 5IFJA 3GKZA 5GGVH 1PGRB 2JLLA 3MR9A 4LLQA 3MJ6A 3QDJD 3V5DA 4TSBH 4OI9A 5HVHB 1V05A 1F6AB 3S35H 4KJQD 2WUCH 4WU5A 5JQHC 1FIGH 1XR8B 4MLIA 5C1MB 4U1MB 3QCTH 3QDJE 4QHLA 2BSRA 3C8DA 4HIHB 3PHQB 5HYEA 4QYOB 1OWRM 4OSUH 4P2OA 4OZHF 5DUPL 1WWCA 5FF6A 3TPUB 4O2EA 3ULVF 1OPGH 3ZKNC 4LF3B 3IDYB 5C9JA 3CSGA 3E6FA 4Y2DD 4WV1A 3JV4A 4WW2B 5LG1A 4CJ1A 1RD6A 3GJFB 1OP3H 3HUJB 1AD9A 5EIVA 2NW3A 1L7TL 1SJEB 1T20B 2FO4A 4N90D 5IVOA 2PKDA 2Z8VC 3S36L 3UJJH 1RMFH 3BZDA 3Q0HA 4L9LB 4P23D 2FGWL 1U8PA 3O6LL 4C56B 3TO4D 3RIAK 3QFJA 4PGDA 4QXGH 3IVKB 3GMMA 4WU7A 2NR6C 4J3SA 4KV5E 2J2ZA 3QUYA 4PLNC 5ICXB 4Q9RH 4KROB 4PJFB 1U8KA 3TFKD 4OTXH 1KCVH 3L3KB 3UPRA 4YNYB 1FZMA 4LCCC 5DS8A 5KSUB 5EU3A 4NZTH 1K85A 5D1ZC 2A38A 4XNXL 4Z0BL 3VFUB 1MOEA 3BE1H 2Z93B 4OKVA 4YDVA 2CDFA 3MRDB 3OKEB 3QO1B 1LO2H 4L4VB 3WJLC 5AG8A 1H0DA 2A74A 4LQ1A 1S78D 5CLTA 1HIMH 1SJHB 3IU4L 3MACL 4OGAC 4P5KA 5FA3B 5JORA 3NIGF 3O9WA 1GGYA 2AABH 5LBSH 5TJWK 4YH6A 3HE6A 1AHWC 1V7MH 5HGAB 3HR5B 2BNQD 4W4OC 4ZD3H 4XCCH 5F6IB 2HT2D 4BH7B 5D8JL 4HS8L 1UVQA 5IVZB 4F15C 4Z76B 3DUUB 4NRYB 2NY3C 3QXDB 4X6FA 2J8HA 4LVOC 4FQ1L 4XB8A 2BNQE 2QADD 3CDYA 3TVMC 1P7KB 3T0EB 2XPGB 1WT5C 1MHCA 1W72L 2YD7A 2BSSA 5IJKC 5I9QC 2EIZA 4EI5D 2ENSA 4ODXB 4S0SD 5IJVA 4XC3H 1PKQE 1G7MA 1T7ZA 2NY6D 4MHHG 4N0FA 2DKSA 4RAUB 3OG4B 2YEZA 4B7IA 3G5ZB 4JM4H 4BM7A 4MZ2A 1JPFA 5LWYH 4PS4H 2EDQA 3OJMB 3PXJA 1T83A 4XBEH 2A6JA 1BFVH 5CILL 3DVNA 2F58H 1YUHA 3MUGB 2OK0L 3TH4T 5DUBB 2EE9A 4JJ5B 3T0WA 1MCEA 35C8H 5A3IC 2V7NA 5D7LE 4HMDA 5BS0A 4YGVA 3I75B 1HILA 3C09C 2RCSH 3D3VD 3QEQD 3P11L 3TNMA 1TJHH 2MCPH 3VFMA 4BFBD 1KIPA 1IT9L 1INEH 4XGZA 1A3LH 1BD2A 4IS6B 4PJEB 3CPLA 3QEQE 5I0DA 3D3VE 4WTZA 1F4HA 3UJIL 2DI7A 4UOW1 2ITDB 3RWHB 4K7PL 5CJQL 4CUCA 5CZXC 4NKMA 5C92A 2R4SH 1ZVHA 5TE4H 2VE6A 2A6KB 2DIAA 4OLVH 2FSEB 4LEXL 5F8QC 3LEVH 4YHYC 3ZSTA 3QQNA 2E3VA 1EFQA 5ENWA 1TETH 2XTJC 1WBZB 4PRIE 4J3VA 3GMPA 4MWFA 4MD0A 3RTQC 4MA7L 1UENA 3VDAA 2E9BA 4XBPA 3RA7H 4N8PA 1RUQL 1FJ1A 2PTVA 4GRWE 4HGMA 5E9DD 1AFVH 5EC1A 2JCCE 1FPTL 2RR3A 5ID1B 4XPAL 2AK4D 3MRGA 3ZKQD 1BM3H 4JY6B 1F00I 4U0QB 4H1LG 5E9DE 4FN0A 4FXGB 1EO7A 3GMNA 3B5HA 3RBSA 3FKUS 5DJ8A 4PJBF 5T1KD 5DUMH 1YEIL 2H3NA 2AK4E 5BRZA 4LRNL 4JKKA 1DQLL 5DQDL 4NQUA 3V6ZB 4X5LA 4X6CF 4E5XA 3OXRB 4Y4FD 5HYIA 1IEHA 4KKLC 4PJXF 1DQQB 4YHNA 2KQNA 5JXAH 2DQIL 3R06A 2WK2A 2ATPA 1LEGB 1YECL 5T1LB 2Q6WA 2EDJA 3KYMB 2WBJD 5GJSL 5JIPA 3EO9H 5E8OB 3FQUB 4F9PC 4BZ1H 4LLUB 3ULUH 1S9KC 4OLXL 4FQLL 4DAGH 1UWXH 2VDLH 3QFDB 1ZV5A 1BECA 1BP3B 5GQBA 1NLBH 4ZUTB 5FKAB 3ARBD 5E5UB 3CZFB 2HKFH 3DYOA 3CFIC 2H8PB 4WUKH 4KUCD 1B90A 2QQKL 2IMMA 2VWEE 2WWKT 2YC1A 3VXNB 4N5UA 1U8OA 4CU7A 1TITA 1FZKB 3Q5OA 3LB6C 3MRPA 4N5ED 5I15H 1MVUB 4JZNA 1G6RB 2HVKB 4WY7H 5EU7E 3HMWL 4P2OD 1L4IA 1FNSH 4P3CL 4MCYA 3RGVA 5CMAB 4D0CB 1JNNH 3NCCB 5F7LB 4PGBA 2HWZH 1QSVA 3K46A 5JQ6L 2Z35B 5MI0C 2D7TH 4WHYH 1KV3A 4C55A 1FH5H 1QFWL 1W72B 4RQQB 4LNRA 2R2BA 2G2RA 5IGXH 1FDLL 1UQSB 4M48H 3FMGL 4JPWL 5IMOB 4E9LA 2IAMC 3HZMA 3KWWB 5C0NC 1L6ZA 4W6WB 3VWJC 3BN9D 3MJ9A 2FH6A 3I50L 1MUJB 1PG7W 4WO4C 3QIWB 4PGCB 2NY1B 3H0TA 4RAVA 3QFJD 2Y5TA 3U7YH 1YQVH 1Q9OB 4M61A 3QXVA 1F45A 2C5DC 2B2XL 3QDHA 3RZCA 1FQ9C 3JWDH 3QUYD 3V0VA 1LO3L 4IBLT 4JFZL 1NFDF 1DBBL 1RZ7L 2EDOA 3OAZH 2PYEB 3PV6B 4KMQA 4K23H 4OFVA 4HUMB 4PPTA 5CEYA 4R96A 1A9EA 3N1MC 1CK0H 2X4RA 2JELH 4PP1D 4Z7NF 2GIYA 2NXZD 3MRNA 5HHXL 3O8XA 4FQ2H 4GG8B 1N5YH 4GW1B 3TCXA 2BVTA 3KYAA 4Y5XA 2PW1A 4JDTH 4MDJB 5D4QA 3LKNB 4DGVH 3DUHA 1JN6A 1KXVC 4YBQD 1OCWH 1MJJA 5CP7A 4LDEB 5H35B 3O9WD 5BOZG 2G5RA 1MFBH 2I9LB 3ZHLA 2R1XA 4Q7DA 1JHKL 3HE6D 4LHQB 2EDEA 2AVGA 2X4QA 4AG4L 5KS9F 1KFAL 4X98A 2D9QB 4Q9BA 5DURB 1ZTXL 3FQRB 3TH2T 3U6RA 1QQDB 2YKLH 2GTZA 3MTRA 1CD1B 3QQ9D 1KGCD 2VDQH 1M7DA 3MRIB 2XN9A 3QUZC 4WI6A 1C5CL 2DS4A 3RJQB 1JWMA 1G7IB 4TQEL 4Y5VC 1UT9A 5CUSL 2J8OA 3C5ZC 4DKEH 4F3FA 3IJHB 1JCKA 1KGCE 4PJBA 1I9RH 3HG1D 4OCNC 3IT8D 4AENB 1D5BB 4ZPTB 4QGYA 3RVTD 1HKFA 3I6KB 4UT9H 4X6CA 5ITFB 3MV9A 5EOTB 3SE3A 1Q8MA 2VERN 3WD5H 4PJXA 3RQ3A 3SDCA 2V9TA 4ZTOH 4XMLH 5CEXB 1GXEA 2J5LB 1MY5A 3F65A 4E42B 3V6OE 3HG1E 5CSGA 1E6OL 4F7EB 5IW6B 1VACB 3MV7A 4IMKA 1IFHL 4TNWK 5FM5O 1KJMB 5K93A 5JW4Q 5EU6A 3WCYA 3B9KB 2ZZUT 4TNVF 5EOCL 2DM3A 3B2UC 3VXMB 5FDYA 3LN5A 3OJDA 2R23B 4AT6A 1G9MH 1DUYA 5KZCB 2FWOB 3H9ZA 5I73B 4JRYB 1DE4A 4OV6F 1FG2A 3H42H 3UTQB 1BFSA 2FL5A 2FHCA 2CKNA 4M1CC 3BP7A 5KSVB 4NRZB 1BD2D 4L9DA 1T0PB 3PIQA 2A83B 3S96A 1V5JA 3WUWA 4NQSB 3I3BA 4CL7A 1K4CB 1A0QH 1A6UL 3PHOA 3SQOH 1BD2E 2BK8A 4K71C 3LQAH 1NQBA 4DJMA 3L5XL 4ZSOA 4CU6A 2ITCB 4PREB 1UZ6F 2DJUA 5MEQA 4FFVD 3BH9A 4K3JH 4QOKD 4QRPA 3LVEA 4LAJH 4OZHE 2PW2A 5EB9A 3FO2A 1NBZA 1ZHNA 1CLZH 3RNKA 5EZOL 3RKDD 4PGEB 4A6YH 1HQRB 1F6LL 3MFGB 3WEXB 3ULVE 3TYFB 3MJ8A 4QOKE 5FYJL 2BP3A 3NN8B 3ESVF 4UU9A 5GZOD 2OP4L 5BXFB 2YRLA 5MEOA 4ZFFA 2J88H 2YPVH 4OZFG 3PWJB 5BRZD 4M6MH 4NQEA 4DEPC 3QQ3B 4UIKH 1A5FH 5IHZA 5KAQG 4YEEA 2I25N 1EK3A 2ZUTA 3SKOB 4L8SA 4OCYH 5BRZE 4P46C 1NFDA 4OBSA 4U1SA 3V5HB 3VXOB 2BVEA 4M9OA 2W9EL 1ROWA 1P4IH 4I5BA 4ZFZA 3O6FA 3TEUA 5I6XC 1KT2A 2Q8BL 1JGDA 4YHML 2Y25A 5CJXC 3EJYC 5I74C 5E1HB 4PJCF 4PRPB 1QYGH 1YPZF 3FFCB 1VFMA 3O81A 3QR2A 3IFPA 4D0BA 1G1CA 5FA4A 3KJ4C 5GGQH 1X7QB 5E1AA 1GOGA 2X1PA 1MI5B 4TSCH 4DTGL 3AU1A 1BOGA 4LCWB 1S7SB 1N6UA 5KS9A 3W5NA 5EOQL 2P1YA 4GW4B 4POYA 3NIGE 1IGYA 1F3DJ 3P73A 5C9KA 2OL3A 2WWKO 4LCCB 3VXTA 4XP9H 1LK2B 5D1ZB 2QQLL 3TIEA 3RL2A 1YC8A 3DSFL 3BVNB 2W0FA 1GZPA 3OB0H 1ZWIA 3RGVD 5E6IA 3OKLB 4GRWH 1SQ2N 3QJFB 1BF2A 5H37H 3STZB 5F21B 4X7FC 4I3RL 1D5IL 1WFNA 5F88A 5E99L 2JK5B 1ADQH 4O51B 1T03H 1CGVA 1DQMH 2ZOKB 3G6DH 1AHWB 2Z31A 4I2XB 1WVZA 5GGSY 5HHPA 4HEME 5JHDA 1M71B 1DQDL 4NQDB 1TVDA 2HRPL 4LEOB 3P77B 3UYRH 3E6HA 3IGAB 4F15B 2X4TA 3SEPA 3N1GC 3G5VB 4Q2ZA 3HZVA 2NY3B 2FEDC 4ETQB 4LVOB 3TVMB 1JRHI 1N6QH 1ZLUK 1CF8L 5I16A 2O5ZH 4Z7WF 2IWGA 3UTOA 1H3PH 3ELAT 2I07B 1I3GL 1Q38A 5I9QB 1TTUA 4OLUL 1IVLA 4PTTB 3S35X 1R3LB 5HDLA 1F3RB 3PGDB 4NUJB 1U3HA 3U9PH 3BT2H 4WFHE 2Q7YB 5JPNB 1I8MB 5JR1H 1IEAA 4MAUL 1VB9A 1KC5L 2LQRA 1P5UA 4HBCL 3O8XD 5HHQA 1CL7I 1A6VH 4UQ2B 2QLVB 2ESVB 1K5NA 3TBSA 2P45B 1EEYB 4PJHB 4R0LC 5GPRA 3GMQB 4NKDA 3GSNL 4K9EH 3X12B 5DMGD 2GW5A 3C6LC 2FX8L 4HAGA 3T2OA 4YXLH 3BP5B 2QBWA 3C09B 2V7HA 4RSVA 4PV9A 4XI5D 2VLLA 2G75B 1T5XB 1S7UB 5F96L 4Z6AT 2P44B 2LABA 3VFPA 2I9TB 2XN9D 1I4FB 3RVUD 4O58L 3ZDYF 4JCMA 1QFOA 1PX3A 1HHIB 3WNKA 4F9LC 3WN5C 2ZP0T 1E27A 3H3PH 3W11D 2P5WB 2BNRB 3LZFL 4G80B 1FL5B 2R29H 5F1OB 3MLVH 5GGVY 4HS6A 4CN6A 1CFNB 1HINL 3OZ9H 5KSAC 2XN9E 4KZEL 3V4VH 2Y06L 5AUMB 1RJZA 4YHYB 1OP3K 4XNMA 2MKWA 3UTSA 4YQXL 3MV9D 5DD3H 2XTJB 4JN2B 3WBDA 5AZEL 3SDCD 5IHUL 5EIIB 4LSRL 1CXLA 4EVNB 1FVEB 1JGLH 4PJBE 1KCRL 4G6KL 4UT7L 3RTQB 2LAAA 3M1BB 3MLTB 1RUMH 3VRJA 3GSWB 4X6CE 1RVFH 4XZUA 4L3AA 3MV9E 3RUGF 3BFOA 4JFQA 3V4PL 3JBG7 3IAPA 2VABA 4PJXE 5EU6D 3ZL4L 4WEUD 3ULUC 2F5BL 4MNQA 1YN6A 4AEIL 4AIZB 3BIBX 3ZLQC 1UH4A 2WNGA 3KNBA 2NY4C 4H1LA 5IB4A 3P4LA 3MZGB 1U8JA 4KK5C 5JIKA 5EU6E 3DNKA 4ORGB 4PJCA 1MCPL 1M1SA 1KJ2L 4XPBH 3NIDF 4HUXA 3BWAA 4XWOD 4RWHA 1IGFL 1QLRA 4LHJB 2OTWA 4DGYH 3KYKH 4RZCA 1MWAB 4QHNB 1PX4A 2DQEL 1DVFA 1QSFB 4XVUC 1FL3A 5EORL 4AIXA 1H3TA 1VFBA 4KGJA 1JYVA 5MP6L 6FABH 2NNAB 4P59L 3OKNA 5CIPA 4M6AA 4F8TA 1WTGT 1AKJA 4CNIA 3O4LD 4TSBL 3MLPA 5F71A 4Z95H 3T0AA 4LMQI 5H2BA 4ONGL 1YA5A 2D7PA 5IVNA 1FNLA 2Z9TA 4G43A 4NWTL 4ZSOE 1HH6A 3FOMB 3O4LE 4DZ8B 4FTVA 2ICWA 2BRQA 5BW7A 2FX7H 1GYAA 4WFED 2VC2L 1C1EL 4HWUA 3OKOB 3ES6A 2CMRL 4KRPD 1HHJA 3U2SB 4GXUN 4OAWA 4HH8A 1MCSA 4NQED 4WFEE 3F7YB 5D1QC 2B8OT 2F8OA 4MD4A 3CFJB 4OF7A 4Z7WA 3JWDC 4R4FL 1RK1A 1OL0A 1QLEH 4FRWA 1LEIA 1QZ1A 2IALA 1CICA 3QWOB 1NGQL 4NQEE 3C5JB 5MI0B 5DJDA 4X4XB 3L7EA 2X4PA 1XCQB 3UDWA 1K8IA 3O6FD 3OHXA 3PV7A 5HGDB 1MF2H 5SWQA 1NFDE 2IAMB 3MYJB 2GEEA 3VWJB 5CBEA 1TZHA 3BSZH 5LGKA 1M05B 1ZSDB 2WW8A 4Q9RL 4Z7NE 4GW5B 5I75C 4OTXL 1NGPL 1KCVL 3QEGL 5ID0B 1F8TH 1HSAA 1I3VA 5F97E 4ODHH 3QH3A 3KPNA 1LO2L 4KJQC 1Z5LA 3HMXH 4F8QA 5I1EL 3WFBH 2AK1L 4K07A 1J5OL 4JR9H 2WSKA 1HIML 3S3PA 1DFBH 1UB5B 2RQ8A 4Y19A 5KS9E 5TGBB 3TO2A 5E6ID 5M7QA 4FOMA 4U4BA 2RFXB 4LFHD 1NSNL 4U1LB 1T89C 5GGSB 3LKOA 1V7ML 3QPXL 1LO4L 1XF4B 5A16A 4XP6L 3CLEL 4FS0A 4X5WA 4DVBA 3EYVB 1KB5L 1Y18B 5FAAA 4Y2DC 3G6JA 3QDAA 1GGIL 1MREH 1TNMA 2Z31D 5L6YL 4NN5C 4W68A 5JHDD 4JEGB 4XCFH 2CKBA 1WEJL 5DJZB 4XCYB 3TBYA 4YWGL 5I18H 4H26A 5SX4H 5SWSA 12E8H 4X7TB 3RUGA 4YDJA 3HR6A 1BQHG 1DBKL 3MREB 4K55A 3QUZB 3DYMA 3FRPG 3V4UH 3BZ4A 3EYUL 4P23C 5JHDE 3TO4C 1BQSA 1G9MC 4Y5VB 4X9BA 1KEGH 3BZFA 5E94B 2F15A 3C5ZB 1HH9B 1OF2B 2UVEA 1RUPL 5EIQA 4JZOA 3LD8C 2H6PA 5C0CB 5DQJB 4JM4L 1U3HD 1IKFH 3NTCH 3TFKC 3RI5F 4PS4L 3RVXC 2Z8WC 1IEBA 1VFOA 1UWXK 1EMTH 1IKNC 1WZKA 4P9ML 4JFFA 3BW9B 3UPCA 1NJ9B 2Z8SA 3EJZD 4LBEA 2X4NB 1ORSB 1NDGA 3KJ6H 4KHTH 3GSUB 5DK0B 3NFNA 3IDNA 4G7YL 4I4WA 2RCSL 1KCSH 4MA8H 1GAFH 3LQAC 1KCUL 4LLDA 1A21A 5HYJA 3O3AA 2XWBB 3QEHB 2P8PB 3E0GA 1ZEAH 1AXIB 5DZNA 5CZVH 2XY2A 4HX1B 4KMTL 2IANB 1XF5B 3VFOB 1D5XB 4ZUUB 1FVDB 3VXPB 2HT2C 1D6VL 3HNVL 3JWOL 1UZ6E 5D7SH 5TE4L 4R8WL 3PDOB 3OAUH 4JDVB 3KPSA 5BO1H 1ZT1B 2ADJB 1U91B 2Y5EA 3IXTA 3QNZA 2H9GA 2VDRL 2C3GA 4P2RB 2QADC 1EXUA 3MRQA 2J3SA 5F89A 5J6GB 1B2WH 5IEKB 5IBLD 1FNEA 4K71B 5IK3A 3S8WA 4UDTB 4EI5C 1MFCL 3D48R 3UTSD 1U8NA 4G3YH 3UZVB 5C0RL 1AFVL 3EIFA 1U2HA 4S1DD 2CO6B 2D0FA 2YA0A 5IESH 1DLHB 1SEBB 2NQCA 4D94A 3BQUD 4Y5YC 5E8EA 1JGUH 2DLEA 4W81A 5HHMD 3UTSE 5HVWA 4FG6D 4OD1H 1OVZA 5D7JA 2NY7L 4TPRH 2FIKB 4MNQD 4ODSL 3K2UH 3CXHJ 4O2FA 2VXVH 2VJXA 3KHQA 5HHME 1YZZA 4U6VL 1BEYL 2CRMA 2OM5A 3OAZK 5EO0B 4BQCA 3F6LA 5F7NC 2DDQL 1MCIA 3TP4A 3EFFB 3Q5YA 4MNQE 4OZFA 1YMMB 1OSPL 2ZUSA 1HHGA 4NYLA 3BPCA 2MJWA 4J8RB 5DA4A 5DD6B 1MFDL 1YN7A 1UM5H 4DEPB 3CD4A 3EW3B 4R7NB 3PQYD 5IMMB 4ZPVA 3DTXA 4KU1A 5AYUL 3RWCA 3JWNC 2BY0A 4G42B 4PJCE 4TYUA 3ZTJH 1YPZE 4P46B 4OT1H 1DVFD 4GRMB 4PY7A 1U8QB 3PQYE 2UY6A 3KYNA 1NC2B 5B39B 2J12B 1Q1JH 5I6XB 3WFCH 1WISA 3DV4B 1X4YA 4EN3A 4WWKA 2XYCA 1YEJL 5ESAA 1X3DA 1AKJD 1Y0LB 1SYVA 4OM0L 5BJTA 1WFUA 5CHNA 1T04B 3ULSA 5EU5A 1FV1A 3SN6N 1SY6A 4LCYA 4XP5H 5I74B 3G9VA 5E70A 2PYFB 2EDXA 3WO4C 3KJ4B 4FTVD 1IL1A 2X4OB 1CE1L 4PJ5D 1JTPA 3B3IB 4LU5H 3DO7B 1X9QA 3UMTA 4XXCA 3LY6A 4PG2C 2QSQA 1FGNH 4OLEA 3BZEB 5TPWL 2DD8H 4HV8A 4FTVE 4NM8L 3QPQD 1T1ZA 1YY8A 4PJ5E 4KC3B 3NOIA 1WWWX 4D8PA 3BDBA 1FLRL 4U1IA 3U4EB 5MHSD 1XH3B 5C09D 1NUDA 3DARA 1CICD 2J6EL 1H15A 2C1OA 4JO3L 5H94B 2YSSB 1EHAA 5DTFB 4AH2B 5MHSE 3WNMA 1MRDH 5C09E 4Z7WE 3QEUB 1CFQB 1DLFH 4OCSH 1MHHB 2WBJC 4M1DH 3TGXA 3TPKA 2CJUH 4LHUB 1OAXH 2O5XH 3L3HB 2P8MB 1FBIH 1K3ZA 5DXWA 2Z0BA 5C71A 1GL4B 1ZVSB 4Z8FL 4LNVA 3TZVA 2VWEC 4AMKH 2HKHL 4DCQB 3ARBC 4MJ5A 3MMEA 2VL4A 4Q74A 5FB8B 4K9EC 2R56L 2VLKA 5FYKD 1NANI 2VXTH 3HZKA 5L2KB 2FLRT 2M1KA 3GDBA 3LRSA 4K94H 2R2EA 3P9WB 5EU7C 5GSVA 5KOMC 4NNXA 5HHVH 4XNZC 3MRBB 1D9KA 5FYKE 3F7PC 4N5EC 1BX2A 1TZIA 3B9DA 1ULVA 2CLVB 4Y19D 1BLNA 4WEMB 5MENA 3WKNA 4HDIB 2FDBP 3PL6D 4P2OC 3I2CH 1T5WA 1N3NB 3CSYA 1JGVL 4J3WA 4X0KB 4HMCA 4EOWH 3MLXL 3ZDYE 4Y19E 1A1NB 2X1XR 4R0LB 2DRUA 1G9NH 4MDIB 4ZUWA 3V5KA 3QRGL 3QUMH 1EEUA 4WV1C 3C6LB 1JNHA 1MHPH 3TLRA 3BIKA 1T4KA 3P9LB 1D5ZA 4MLSA 3HFMH 5FCUH 2XWTB 5DRNA 1IM3A 1QO3A 1HSBB 4XNYH 5SWSD 1V7NL 1C08A 3JUYA 4KKNA 3BN9C 3EOYG 4O4YH 1S3KL 4JG1L 4BSJA 4OQTL 3WN5B 1MRCL 4A2MA 5SWSE 5IMLA 3QULA 3RUGE 4GXUM 5EA0L 4Q9CA 1SEQH 4XMLL 3S37H 5KSAB 3QUYC 3HS0A 3ZT6A 3MXVL 4QT5A 3MNWB 2AERT 4GLRI 2ORBH 5KVDH 5INDA 4G5ZH 4RMVA 4RGMC 1ONQA 1JHTA 3H9SA 5D6CA 3CVIH 1P5VA 3BKCH 1B4JL 4NN6C 1YYLH 1DN0A 3NIDE 4PP1C 3UX9B 5HHOB 2NXZC 2XZAH 3L1OH 3EUUA 4OIIL 2N1KA 4X7SL 5F7YC 1LO0L 1J0ZA 4U33A 2X9XA 2C4FT 4FQHB 2V2TA 4YBQC 5I1CL 4YFEA 3C2SA 2NY4B 4JHWH 4JPIA 3O9WC 1U41A 1AP2A 1R3JA 3O41A 2QQNH 2V9RA 4QTIL 3HE6C 2VXUH 4NFCA 4YAQB 4OUUA 3K4AA 5LCVH 3DROA 1AGFB 1SBSL 2X42A 3HNSL 4NHCH 5JXED 3OB0K 4UBDD 2OL3H 4F58H 2Q86B 4NOFA 2YBRA 3D18B 4JM2A 3QQ9C 5LAXB 1ZS8B 2BRRH 2DTSA 3MFFA 4UZGA 2Q3ZA 5ESVB 4LSQH 4FA8A 3S4SG 4H88H 1WV7T 4LPCA 1G7JB 5FYKU 1YDPB 3LKRB 2LVEA 3CVHA 4OM1H 3V6OC 4JJHA 3VG9C 4YDKL 4YLQT 4KKAD 1S7QB 2D4FA 2H41A 3RX5A 4PRNB 3VFRA 1LP9F 3RVTC 3QXAA 5KVEH 4HG4J 1CLZL 4HKXA 4KKBD 2DBLL 4TSAH 4NIKB 3D2UD 5DD1H 5IQ9A 4NCC2 3TT3L 2FBJL 3GIVA 4LVNC 5FO7A 1A1OA 5D7JD 3D25B 4HQQH 3BKYL 1CDIA 4KFZC 1T83C 5ICYA 2BHYA 2MHAB 4JCLA 5ACMA 1ZHLB 4DZBA 4HIJA 4HIXL 3NH7L 4X8XA 4S1QL 3MA7A 2A6IA 2CGRH 3MRLA 4U1KB 5J7CC 5B38B 3I6GA 3AS2A 5D1QB 5GIRB 1KCKA 1P4IL 1R3HB 4NHUB 4JFOB 5GRWA 3C2AL 4PJ7B 5GS2D 4Y0GA 4LQFL 5BV7L 3A6OA 2UYLB 3DX9A 1ZHKA 3KHOA 4L8CB 3BRDA 5I17A 5L7XH 1CDHA 1CTNA 1NC4B 3FQXB 4MB3A 4P4RA 4EN3D 4WWKD 5T33L 1QYGL 4LOUD 3WIHH 4MXVE 25C8H 4GRLA 2X1WL 3U30C 4XRCB 2EYRB 4MJIA 2V2WB 3B2VH 5BQ7B 2OJZL 3T4YA 1EFXA 1HQ4A 4OCLC 2AJZB 4HXBH 1RURH 5I75B 3ULVC 1O7VA 2AI0H 4JRXD 1KACB 3MBEA 3OBAA 3SOBL 2V17H 1QSZA 4PY8I 3V7MA 1S7WA 3FB6A 4XP9L 1A9BB 2GK2A 5GJTH 2QHLA 2FCBA 3RKDC 3SGJA 3MA9H 4JRXE 5EO9B 4OD2B 3VDCA 5GZOC 1CFTA 1Q0XH 1Z9LA 5AAWA 1PQZA 2I5YH 2VN4A 2CIIA 2VZSA 4LCIH 3SPVB 2BFVH 2NCMA 2HN7B 4R90H 4G6JL 2Q20A 4TRPL 4ZFOA 1BIHA 3QHFL 5JW4R 3MLYH 4N9GA 1WUNT 1UCBH 1DQML 5CWSA 1A7OL 3EJJX 2GSGA 3PP4L 5EBWB 1Q9WA 4ODUA 1T0MA 5DC9B 5GRUL 2J4WH 4Y2DB 1FZJB 4NN5B 3P0YH 2KQMA 3IDMB 1NAKL 2NY5L 4XCNA 3DUSB 4Z7VF 4DWHA 2EXYD 4H1LH 1BQHA 1H3VA 1KBGH 1PW3A 3IDIB 3EYSL 3L3GA 4LSTL 3TZVD 4ZFGL 4HLZG 3FRPA 2F9BT 2ATKB 4P23B 3BT2L 1CIUA 3ZKMD 3TO4B 1L7IH 2B0SH 4DN3H 3FTGA 1EGJH 3LD8B 4M7LH 3SKJL 1OB1A 3VXQA 3RWEA 1D9KD 1BWMA 5FUCE 2EC9T 1OTUD 5KVGL 3HZYB 4M8QB 4DUVA 4X7EC 4YFLI 4YZFF 3ME0A 1I75A 5MEND 1DN2A 4DVRH 4FABH 4DN4L 1RZKC 5CIPH 1QLFA 2KH2B 1A14H 3BEVA 3RGVC 4QXTB 5JW3H 3DHMA 3IAQA 3D1MC 3DURA 5MENE 3G08A 1J8HA 3VW3L 3MSPA 2VIRA 1K3IA 4LSSH 1LP9A 1QEWA 5HHNB 3SE4C 2KPNA 1HOCB 3IDJB 3U7WL 1MJUL 4CAGA 2KKQA 2A2QT 4U1HB 5GS1C 4D3CL 2K1MA 1ZT4A 3OX8B 4PD4J 3MRHA 1GGCH 2BNQB 1NLDH 5DD0L 5IFHH 4A6YB 1JHLH 5DSCA 3MRRA 2ADIA 4L4TB 1JZ2A 2QADB 1TCMA 3A0OA 1PKQB 3CCHB 3WKMH 1RPQA 5I1LA 3V9FA 1JGEB 2HTLC 1L9NA 4UTAL 5IT2H 2UZIL 4EI5B 2IG2L 3CZJA 5HYSB 4YX2L 1S7TB 5F9AC 4ZO7A 1ZLSL 1MCQA 3QUXA 2OS7A 5J4MA 4Y5YB 3O8XC 4ELMA 4YR6B 5DVLA 2XZZA 4XP1H 4WFFD 1MH5B 3MOBL 3WS3B 5C0IB 4FQQB 5T3XD 5D7LB 4X4YB 2GTWA 2WIMA 2DM7A 4OF8A 5JW5A 5FHBL 2APFA 2CUMA 5D1XD 3X14A 2PTTA 3C8HA 5IW3A 5DMGC 5FYKH 4DGYL 4WFFE 1N64L 1DEEB 4PJDA 5T3XE 1RZ8B 2FH8A 1U93A 2BVQB 3QEQB 3D3VB 3OXSB 3GMRA 5TH2B 3SJVA 4XI5C 4Z9KB 5DJ6A 3N50A 5LGJB 3VFTB 4JM2D 2IBZX 4EUPG 5GSRA 1UXWA 4U1JB 2DI8A 3O2VH 4YDIL 3W11C 4KAQH 1IC4H 1FAKT 1VPOL 4G9FA 1EO8H 3GBLA 2W65B 4PRIB 5F1IB 1N8ZA 4RGND 1UM6H 2XNAA 1Q72H 2NXYB 4GRWB 3JVGA 2HG5A 3SE3C 2JCCB 3SDCC 5FV1L 2FX7L 3MNVB 2ZCKL 5IHBA 3GO1H 3GI9H 3OGCA 4RGNE 2XQYG 2CKBH 4J23A 3WO4B 4ONFL 4IMKC 4X6EB 5I8CA 3WHXB 3LKPB 1GGBL 5E9DB 1IM9D 1J0JA 3NAAH 3VH8B 3KLSA 2AK4B 2ZNXA 4PP2A 5K9OA 1ZT7A 4Z7VA 4E0RB 4HCRH 3KPMA 4PJ9D 3WHE0 5FXCH 4I3SH 3DSNA 2W60A 3ARFA 4N0UA 1BPVA 5T1KB 3UTZB 3KPLA 2CXGA 4XWOC 1BBJB 4M7JL 1JWUA 5JO5B 1A6AB 4LARL 4JKMA 1MF2L 3I9GL 4L1HA 5F1NA 1YMHB 2DWDB 5JHLH 1BF8A 3FFDB 2IBZY 2PR4H 3JTSA 1CG9A 4S1RL 2WBJB 4HIEB 1JP5A 2YHGA 3PGCB 5A2JH 4K3HA 3AC0A 2J1KA 4GRLD 1F11A 3IJSB 2FX9H 3QISA 3N1QC 4BUGA 4MJID 5IB1A 2JE8A 5E95B 3V52H 1EFXD 5LQBL 2EDKA 3ARBB 1OAYH 4UV4H 3STBA 1G9NC 2QSVA 2ZCHL 3IFNH 3MBED 1F4YL 3CSPA 4UUJA 1AGCA 5IFJB 1SYSA 4F7TA 1OW0A 3MR9B 4LLQB 4MJIE 3V5DB 4JR9L 1WBXB 2IPTL 2VDPH 3VI4E 4DGIH 4J6RH 2Y23A 4J3UA