5JXED

Human pd-1 ectodomain complexed with pembrolizumab fab
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
218
structure length
197
Chain Sequence
QVQLVQSGVEVKKPGASVKVSCKASGYTFTNYYMYWVRQAPGQGLEWMGGINPSNGGTNFNEKFKNRVTLTTDSSTTTAYMELKSLQFDDTAVYYCARRDYRFDMGFDYWGQGTTVTVSSASTKGPSVFPLAPLGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVTCNVDHKPSNTKVDKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for blocking PD-1-mediated immune suppression by therapeutic antibody pembrolizumab.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Programmed cell death protein 1
total genus 35
structure length 197
sequence length 218
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jxeD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jxeD01
1S7UA 5CEZE 2VQ1A 4G6FD 2OTUA 4U1GC 3C2AH 5J7CC 1CBVL 4ODTL 4OGYL 4IRZH 4PP1D 4U6TA 3BP7A 5IMKB 4NUJA 5BQ7A 4RZCB 2IBGA 3D69A 1GGBH 4XP4L 4JKLA 5I1DB 1Q1JH 3KS0H 1G7QB 3WFDH 1WGOA 1FC2D 1CFSB 2NY6C 1AC6A 3ZYIA 5IGXL 2Q3AA 3DX8B 4LSVH 2B0SL 2JELL 2ZUQC 1CCZA 3WLWC 3EZ8A 4G7VH 4NHCL 1NFKA 4NQXB 4UV7H 5BV7H 3WFBL 2OL3A 3HAEA 3OKNB 3OMZA 3UZVB 2A6DB 5HI5C 4LMQI 4FG6D 2NR6C 4QHLB 4TULH 4YHIB 4HCRA 1UWEL 4IRZL 4N0YH 1FQ9C 5C08E 4CNIB 2B7DT 2IALB 3D3VA 2ZSWA 3EDKA 3HNTL 2AERT 5FO9B 1E4KA 2OSLA 3V4UL 3JXAA 4NKQB 1D9KB 2FLRT 2WUCH 1TTFA 4ODWA 1RJCA 1EFXB 4HGMA 5EO9B 4KI5E 4X6DF 1JGLL 3W81A 1ZGLB 3K4ZA 1QLFA 1CIDA 3C5JB 3HZKB 5CP7A 3RPKA 2NY4B 3T0ED 1L0XA 3EOTH 3HUJE 2Z93A 4ZYKB 5F71A 2H32H 3B2UD 5DQDH 4HV8A 2WV3A 4BUHA 3QJHA 4ZFFA 2Q76A 1I8KB 3O3EB 4OD1L 5F8RC 1M7DB 2ED9A 1DBKH 2CDEB 3VJ6A 4MJIE 1N0XL 3HI5H 2IBZY 3L5IA 4S1SL 4KRPD 4AG4L 2R8SL 1J0IA 1NFDF 3DSFH 5DUBB 1PX3A 2V2XA 5EWIH 3NPSB 3AM8C 1NGZA 5JXED 3W9EA 3O8XA 2KZ1B 4BKLA 3QUMB 1AGFB 5TF1L 1HDMA 1BFVH 3KNBB 3DUSA 4LVOC 3FCTB 1AI1H 5EPMA 3ZT7A 1T1WA 1J1PH 5DUMH 1QQDB 1R3KA 5CCKL 3GMPB 5K9KA 2GCYA 4R2GC 5CINL 1KFAL 1I7TA 3EW3B 5H2BB 4YIQB 4LBEA 3S98A 2UZIL 2VAJA 5T3XL 2DBLH 1LE5B 4PJ8B 1T6VN 1OB1B 4U3CA 3KXFB 4HF5L 2CLZA 3DRQB 3RWIB 4HS8L 1MJ8H 1YY9D 2HG5A 5HYEA 2ZSVB 5KVGL 3TT1L 1FL3B 3F7YB 4PY7A 3MYZA 3NTCH 4YHNB 1A9BB 4RMSA 4MAYB 2A73A 4AMKH 1JHKH 5AG9A 5GSRB 4HUVB 1J12A 2BMKB 3PGFH 4NYLA 3ZE1E 1JCKA 3RY6A 4ZUTB 3PWVA 5JW4R 4PJ9A 4XP6H 5KVDL 3U9UB 2NY0D 5I1LA 1OTUC 3PHQB 4WHTB 2NY1C 1HHGA 3QUXD 4UIKL 5F1NA 5HHMB 5MP6L 3O3DB 3RPIA 5GRVL 1CS6A 1A7PH 1IQWL 1PG7H 4CADA 4GUPA 1YPZA 1BFOB 2CSPA 2HFEB 4JM2C 3RDTB 2R0ZL 1N3NA 4JDVB 1MF2L 3CLEH 3D2UA 2WANA 5JORA 5TQ2H 3TZVA 5AZ2L 3VD9A 4OLXL 1EHLH 4RDQG 1D9KC 4LKCB 3SCMA 2YRPA 3P0YH 4GRMA 4KUZL 5GRUH 1NFDE 2VABB 4G6AC 5HVHB 4OZIE 3C60D 1KIUA 4XNUH 3FAXA 5C0CD 1WISA 2BNRA 4Y8AA 4R9HA 1UXSB 1N5YL 3EJZD 3P0VL 2X5PA 3QXAB 1NEZB 1MCPH 4ZMAT 3CSYA 1YMMA 3EGSA 5F7EL 3FOLA 5IEHB 5FO8A 1AXIB 4N8VG 2NLJB 5BXFB 1J1OL 2DTMH 3MGTA 2MSPA 4JPIA 2C9AA 5J6GB 3DLQR 4NIKB 4PGBA 3SEPA 1ACYH 4U1SB 1EGJA 2J6EL 4NUGH 4OUUA 3EYUH 1FL5B 1KB9K 5D7LB 4ZOEA 4V1DB 1N7MH 1A6VH 1UXWA 2UZXB 3MZTA 4QRRE 4IRSD 5CEXA 1JYXA 5B38G 1TETH 3DRTA 1MCDA 2VXVH 3RVVD 3MACL 3MNVB 5C0EB 4ZQKA 5J6HB 4HGWB 4X98B 2YA1A 4G6MH 4NQVA 4KHXL 4EZMA 3HE6C 4NBXB 1HEZB 1R5WA 3BPNC 1QR4A 4JY6A 5IR1A 5EBWB 3LN5A 4YXLL 5E1AB 3B2VL 1EJOH 3VXRD 3VFTA 3NFNB 1MNUL 4LAQL 3QNYB 3O6FA 2NNAB 3GJFK 1OGTB 1FH5H 1YNTB 3C60A 4O2EA 3U30C 1U2CA 5TQ2L 1AXTH 2H32B 1IGFH 1B3JA 2D7TH 2XY1A 1XZ0A 3RHWK 2UWEB 3EYVA 2P5WA 3X14B 5C6PB 3O2DL 2FJHA 4FQXB 1UACH 4G5ZH 4YNYA 3KWWB 3KPQB 3LKRB 2O5XL 5JPMA 3CFEA 4Z7WE 1KB5H 1FIGH 4O4YL 3KLHD 2ADIA 2PF6A 2WM0A 3L3IB 5DO2C 4M9OA 1KIRB 1S7QA 5A3IC 3RUGB 5L9DH 5KJRH 5C0JA 3G5ZA 1RVFH 2VTFA 3IJHB 3SJVE 2ZNXA 4PLOB 1JL8A 4E0RB 2V5RA 5DZLA 1TQBC 4K55A 5EC1A 1E28A 4U6HA 3OKYA 5L2KB 4XI5C 1LDPL 3P2TA 1KT2B 2X2YA 3O9WB 3SE4A 4JFXB 2VQTA 4OF8A 4H0HB 2GYSA 1I1CA 1JBJA 1KTRL 5IB1A 3QUKA 2VLJD 3MTRA 4NSKA 3OZ9L 4CUCA 4I3RL 2PN5A 4WUKL 2R39A 1MI5B 3TCLB 1YY8B 2CK0L 4ZTPH 2FD6H 1HILB 3DHMA 4P3WA 4M5ZH 3H0TB 5I1KH 3ALPA 2XYCA 4PP1C 3QJFA 3VRLE 1XF5B 4J6RH 4G9DA 3HRZB 4WUKH 3BESR 1KJMA 3ARBB 4PG9B 3BISA 1QVOA 5D4QA 1U8QA 3ARGA 4NQED 1DEDA 2V7HB 4S1RL 2GJZB 2DQEH 2HKFL 1YN6B 4JFEA 5CD3B 2R9HC 2FYYB 3PP3H 3DGCR 4WUUD 2Y07L 5TH2A 4Y5XB 2EDLA 3GMRB 4AIXA 3BUYB 2BK8A 1VGKB 4UNUA 1I7ZB 3TBSB 4FZ8H 1JUFB 5BO1L 1G9MH 1Y0LA 4ZOBA 3BKYL 3DYOA 1GSMA 5GJSH 1I3GH 2YD1A 3LD8C 3HPJA 2V17H 3DVIA 2ED7A 4XBGB 4HH8A 4KTDL 5L2JB 2ID5A 4ZNEA 2YUZA 1MOEA 2OTPA 3VE0B 1CICC 1J7VR 1JPTL 4O2CB 1U91A 5D7JB 3QDGB 4HFWA 2C5DC 2AJYH 5E2UL 1M71B 1OAYL 3MLUL 3S5LA 1IZKA 5FV2A 5MI0C 4XP5L 3ZKSD 2PXYA 1GPOH 3ZTJG 1DBJH 5I1CL 1U58B 1HQ4B 1P6AB 1UT9A 3OHXB 3MLXH 4K2UL 3SDXE 2Z92A 3QFJA 1SBBA 5TQ0L 1M71A 4PJ8C 1DFBH 3PHOA 5IMOB 4JFED 1GGCH 4K8RH 2F8XC 2VE6B 1PSKH 5DJYA 3T0EC 4G7YL 4AK1A 3X17A 2DKSA 5GGRB 4QRRA 3Q2CA 3QAZB 5CLTA 4JE4B 5E7FA 3FQRA 3PL6D 3EYQC 5HGDA 1UCBH 1G0DA 4GRWF 3S3PA 3WS3B 3MLWH 5GS2D 1WEJL 4XAWH 1Q1JL 4XT1C 5FYJE 3MXVH 3T0EA 4IMLA 4PRNB 3KG5A 1QBML 3V6OA 4WU5A 3Q3GB 4RGMB 2XWJA 5DJZB 1YDPA 3O11B 4ODTH 5FV1L 5GIRB 4ALAL 5I1EH 2AI0H 1A7NL 1XCQB 1EMTH 3O4LD 2XZQL 3C6SB 5C0NC 4LHUA 3QHFH 3RDTC 1JGDB 5HHXH 2X42A 1T04B 4QRTA 1CFNA 1MCPL 4K7PL 1ZXQA 5BV7C 4PJFB 3HE7D 2HJLA 5D2NC 5ITBL 1NANH 2P42B 1KXVC 4EEEA 3EOBA 4Q2ZB 4QHKI 2B2XH 5F97E 4GLRH 1U8HA 1INEH 5F6IB 4Q6IB 2JLLA 3OXRB 2H6PB 4P2OD 3CZFB 4WHDA 4GG8B 4P9ML 1IRAY 3KPRE 5I8KL 2HT3D 5JNYB 3H9ZA 5KG9B 4EI5A 1RJZA 1KCLA 2YD2A 3CK0L 1FNGB 1KIPB 3RWJA 2NR6D 2YOCA 5J56B 1WZ1L 3O6LL 5CJBA 1SVZA 3IDGB 2AV1B 4NNYB 1X5YA 3MOBL 2VJXA 3T0BA 1X4YA 2ZOKB 4XNMB 1EEZA 1O0VA 1YPZF 4XGZB 4OB5L 2DQCL 3VXSD 3PGFL 4N1CA 4JN2A 4R4BB 4ODXA 3SOBH 2IMMA 1WC7B 2BVEA 4RSVA 1QBLL 4LVHC 3V0AC 4LSTL 2K7QA 3OKMA 3PL6B 1F3JA 4FMFA 3T77B 1GVIA 4KMQA 1NMAH 5DC9B 2AGJL 3WNKA 3HNVL 2F8VA 3P11L 3HC3H 4G8EA 3SDAA 4XVSH 4LRIA 5KVFH 1J5OL 4JM4H 4KRMB 2LAGB 2IQAB 2HRLA 3S6CA 2GFBB 3FFCA 4HZAA 3IB4A 1T21A 1UJTA 3K8KA 3P11H 3B9KC 4LPYA 2D0GA 3BH9A 2ITCB 3TPKA 3RVTC 3QEQB 4IRSB 2IMNA 2A77H 3K7UA 1D5MB 5FB8B 1QSFA 5C0IB 3U1SH 3SGKC 4D9RD 2APWA 4BH8B 2IAMB 2CMRH 5ESAA 2QQNL 2EDKA 3U48A 3KXFE 1P84K 1J11A 1BREA 1NGXB 3MROB 1T0MA 4HUMB 2CGRL 5DGRA 1KC5L 1N0XH 3HI5L 3ZYZA 2UZYB 3GBNH 3SE9H 3QDAA 2L4OA 3L9RA 3LZFL 5FGCB 3RP1A 2FX9L 4MQXC 4XBPB 4KUCD 4Z8FL 4U1SA 4ZNCD 4R7DB 1MI5E 4L1DA 3TGXA 4W6XB 4M1DH 5E99H 1CI5A 1CFVH 2X4QA 2IFGA 4JKMA 1T5WA 2W60A 1YN6A 5HBBA 2BVOA 4XRCA 5CS7A 1I8IB 1QNZH 3MUZ1 4UTAL 3JTTB 2V7HA 3CSYB 4OLWL 3ARGB 5L7XH 3QWRA 2Y6SC 5C0ND 3G6DH 2J8OA 4OCWH 2COQA 4UDTB 4PJEE 4KMTH 1BX2B 3RY4A 5ISZB 5EUKA 4FTVD 1F3RB 4DGVL 3HE6D 1S7TA 2AABL 3D0VA 2FEDD 4Y1AB 5HVFB 2BHYA 4LFHD 4ZXBC 2EDDA 1F11B 4LKCA 2B8OT 5C9JB 2C3GA 5JW3L 3V6FB 5BMFL 3VFNA 2DIJA 1GAFH 1I3RA 2E5EA 1QBMH 4Y2DB 2W9LA 1R0AH 3TA3B 4CVZA 1JI1A 1ZS8A 3HI1B 3HI1A 1N59A 1WEJH 3CSGA 3F12B 3MRRA 3BGAA 4OTXL 2BNQA 5DJXA 5I1HH 4MMZC 3W5MA 4MX7A 5IJVA 5ISZD 3PWVB 1MWAA 3P0GB 5DSCA 4J3VA 1T1ZA 2HVJB 4A6YL 2E7HA 2AJXL 3D9AL 5D71L 1A8JH 3MOAL 1NGWA 4N8PA 2DQGH 3G08A 3GMLB 4XP5H 2OQJA 4YHNA 2ED8A 2G5BB 1YECL 5IT2H 1RUAL 1BMGA 1DR9A 2J12B 2YXFA 2NX5D 2EO9A 4PRDB 2EKSA 3P73B 4JDZB 2ADIB 4YHPA 4RA3A 1J8KA 1W0YT 1EVUA 2X70A 1TCMA 3X11B 2BSRB 1SEQH 4P3CL 5GJTH 3JV0A 3PE9A 3QT2A 1VFBA 5FYJH 2NXYD 3IGAA 3LRGA 5EORL 1WZKA 5HYSA 4B50A 1I1YA 1P1ZB 5IK3A 3SBWC 2GCYB 3X12A 3HZYB 4I8DA 1RZJC 1SJEB 5JR1H 1ONQB 3CLFH 1NBYA 4ZUUB 7FABL 4G42B 4LLYA 2NY3C 4HC1L 5IBUG 1S7VA 5GGQL 4EVNA 4NQVB 1OCWL 1I1FA 1ES0A 4Z7WF 1BZ7A 3MFFB 2CR6A 1AXSB 2C3WA 4X8JA 2VZVA 5E8EA 1PD6A 2FBOJ 4F7TB 1H3PH 1WF5A 1I8KA 1CT8A 4OZGA 4ZFFB 5HYSG 3R06A 4JB9L 2KZWA 5LWYL 1XGTB 4MJ5B 2VMFA 4QT5A 4HIHB 3SGEI 1IVLA 3QXWA 5CZVL 4HXBL 4DAGL 1JF6A 4M4PA 4MQ7A 4QXWA 5D8JL 4ZTPL 5J6GA 1ZK9A 4YDIH 5GHWH 3ZMRA 1RK1A 4P5TB 4UT9L 4HIJA 4MZ3A 4PJ5B 1FYHB 3D1MC 5HYSB 2IQAA 1SMAA 1RUKL 5H35B 4RGNB 2Q86B 4BA8A 1DVFD 4P9HL 1KJ3L 4E41D 3T1WA 4S1DC 2O5YL 1ZT4B 1FVCA 4GAYB 3WLBB 3NIFF 5SX4H 1UG9A 4LSSL 4YHOH 5JW4Q 4JQIH 5L88H 4XB8A 1WFNA 4XCEA 5FECA 4MHHG 3I6GA 1T89A 5D7IB 4YBLB 3IFNL 1F90L 1FNHA 4KZEL 4YPGA 4OZFH 3SCMB 4NO2B 3PXJA 3IVKA 5I76B 1FZOA 3GM8A 4U6XB 2EO1A 2HVJA 2FBJL 5DSCB 1XGPA 1RJYA 1RJLB 1YEDB 2I5YH 3GSWA 4GOSA 5I75B 4KTYA 3LIZH 3P9LA 3P9LB 4MXWL 3LSOA 1BGXH 5I17A 1LO5A 1NLDH 4WHTA 1YN7A 4N0CD 3IDNB 1ERNA 2BNRD 4ZUTA 3ULSA 3V4VH 3EFDH 4EUPA 5EU6D 2CJUL 3VWJA 3N06B 4WJ5A 2ATPB 2XFXA 4MAYD 1HINH 3O4LB 5GS1A 1B4JH 5D7JC 1HXMB 4X7CC 1YECH 2X4SA 5IIEA 3RRQA 5IHBA 4PJBE 5MEND 4U6YB 4X0KB 1QUNA 3K2UH 5FDWA 4LAQH 2VQ1B 1TJIL 2HLAA 4EIGB 3VXSB 1DQQA 1ZA3B 3C5SA 3B2VH 3EO0A 3MXWH 4X7DC 1AY1H 5HYIA 4Y19D 1Z3GH 4PJAE 4H0IA 3QDGE 1HYSC 1WBXB 1WFOA 3IAGC 1AO7D 1MCHA 1YEJL 4OD2B 1F3DJ 2RQ8A 2O5ZH 1GAFL 1RSFA 4PJBB 4WWKB 5I75C 3AREA 4Y4KB 1YEGL 4GXUM 4LLVB 2PNDA 4IMKC 4PJXA 2VLKB 3ARFD 5FGCE 4DGVH 4WY7H 4L4JA 5HHQB 3B83A 3CDGA 3MUHL 4QWWD 3U46A 1IAIH 3DO3A 1FFNA 4KI5C 4BQBA 3RVXD 1GZQA 3E1F1 3TYGL 3P40A 3HAEH 1UKQA 2IFFH 2XTJB 3QUZC 3MRQA 1X5KA 3W2DH 4LQFL 5D2NB 3JV5A 4GSDL 1Y6KR 3EYFB 1TLKA 4MA8H 1EFXA 4Y19A 5D7JA 1GRWA 1OAQL 2R0WH 4KDWA 2VLRD 3RWDB 5D5MA 3K2MC 1TZGL 2YEZB 3E6HB 5C71A 3UBXG 5EOQH 3OKMB 4MXQC 1T20B 5SX5H 1ROWA 2DKMA 2B20A 1T4KB 3U6RA 1CFTB 2G60H 1S7RB 4M4RA 1WC7A 4N68A 1TZHA 2DQTL 2ZUTA 5DEZA 3RVUD 3B9AA 3MJ8A 4M00A 1MUJA 4R6UA 1FNSH 4X9IA 5DHVB 1NLDL 1MFAH 3EUUA 2VXUL 3RI5F 1GL4B 1T1ZB 4HZLB 1F90H 1CLOL 3OKOB 5IBLC 1KXQE 2A6DA 3BX7C 2DWEA 1BVZA 2NY3B 5IQ9A 2FEDC 3UC0H 4HF5H 1KCSH 2HJKA 4IIQC 5FA3A 4JFYB 1UM4H 4OZIF 2PR4L 3AVEA 3LQZB 4EDWL 4BZ1H 4U05A 1HXYB 1JZ4A 3K0WA 5FF6A 1IGYA 4WUUB 1U8HB 2ARJQ 3QUZB 3ESVF 1KEGL 4HLZG 1NCTA 4JY4B 3ARBC 3O4LA 4RMTA 2X4PA 3MRPB 3R4DA 1HILA 4XNXL 1LMKA 3MCKA 1XF4B 4M1CD 4PJIB 1G7HA 4LRNL 2KQNA 1Q9WB 2FGZA 4R4FH 5E08H 4CU8A 4Y4FD 1AI1L 3KHOA 4KHTL 4NJAL 3CUPB 5D2LB 1TJGL 2BVOB 3C6SA 1I1AC 1CN4A 3TBYB 3QIWD 1RIHH 4N9GB 2VZ3A 5ABDE 1KENH 2X4QB 1RZKL 1P69B 4J3TA 3BKCH 5IQ9B 5HXMA 2DWEB 3G6JF 2ICCA 1ZGLP 2C7UB 1XIWC 3QCVL 2FECI 2XXCB 4U1NA 5K9QI 2ZUVA 2FJFB 4JG1L 1S78D 2UYLB 2WBKA 5E2WL 3W0WB 4Y2DD 1K85A 1INEL 3TNNA 2V6HA 4NFDA 3VRLF 3I6KA 3MJ6A 1BPVA 3TM6A 1CD8A 4M62H 1I9JH 5DLMH 2W91A 2CDGB 3MLSH 2MQCA 3S35L 3VXNB 1AD0B 3GNML 4NQEB 3QA3A 2ARJB 3S35X 1A47A 1ZT4A 5IFAL 4KH2A 3RKPA 4NT6A 1S9YB 5D1ZC 4I77H 3WEXA 3Q1SH 1RUAH 3EYFA 4DKFL 5HHXL 5F9WC 4DOHB 1JNJA 3NCEB 3EYSH 5F9AC 3QQ9C 2W1NA 1OAZH 1YNTA 4RBPK 5DEFB 5J1AB 3MOAH 1CXEA 1T2QH 3NFNA 2OM5A 3HI6L 1NPUA 3OJDB 5BS0D 3RIAF 2DWDA 2KKQA 1PZ5B 3B3IB 1CU4L 1NCDH 3QH3A 4ENEC 5I6XB 2GITA 1LNUA 1OQOA 4EN3A 4L8CA 5T5FH 1RZFL 3WFBH 2DQGL 1FVEA 4WV1C 5I17B 2P4AB 4NCC2 1SQ2N 3TIEA 1CDUA 3E3QE 1UCBL 1IFHL 4UTBH 3V8OA 1GGUA 4HWNA 4RX4D 3ZYOA 3U4BH 4R8WH 3BGMB 4LARL 1DDHB 5EBGA 4IMKA 1MJ7H 5D93B 4EUPH 5I73C 1UXWB 7CGTA 3W0WA 5JA8B 1K5NB 4R97B 2BHZA 2JJTC 1SY6L 4DGYH 3VXPB 3NIGE 3N1PC 2OCFD 2QSCH 3ARZA 5J4MA 3QFJE 3GMRA 5HYJE 2AEQL 4XPHH 3RUGE 3KYNA 1AKJB 5FYKH 4H20H 3RWJB 5AG8A 5BMFH 1P1ZA 3OAUL 4IRJC 1LP9E 5DD6A 1NAML 3IDMA 4RA0C 4L3EB 2FWOA 4LCYA 4RISL 3MRDB 1BZQK 3S96B 5L7XL 4HIEA 3C5SB 3RZCD 4B5EA 1ZLWK 3IDYB 3UYOD 3D3VD 3FTGB 1LK3L 4MXQD 5HDBE 1YEFL 2X89D 4K3HA 1JZ2A 4JAMA 3MCKB 4PJ7F 4UDUB 5L8LB 2WZPD 2AKRB 4GW1A 4JRYE 1KN4H 1HHIA 2EDQA 4XNQB 3GMLA 2EEDA 1UKTA 4QT5B 4Z7VA 4XAKE 4MJ5A 5GRVK 3T04D 1KLUB 1T1YB 3G5YA 5EA0L 5KOMC 4CJ0A 1HWGB 5DWUH 1KB5B 4X8JB 3C08H 1ZLSL 3DVNA 2GT9A 3ARSA 1A02N 3IDJB 4OGXH 4F7CB 1RZKH 1JPFB 2VSCA 1JF1A 3PJSA 3OSKA 4QXGH 5L2KA 1YEIL 2F53A 2J88H 5I19H 1S7XA 3GSQA 1EUTA 4RWYH 1K3ZA 3A0OA 4F2MA 2XICA 5KZCB 5KAQF 3FL7A 1A0QL 2WWMD 5HHVL 5JA9A 5IBTH 3SO3B 4Z78A 1JPSL 5HHMD 1PYWA 5GSVB 2APFA 4DZBB 2GJ6D 4NN5C 4BSWB 2YEZA 1NCAH 5D5MB 5BW7A 3BIBX 3QPQC 4NZTL 5AWNH 3LKRA 2QSVA 3MMEB 5A16B 3RTQC 3FOMB 1N64L 5D72L 4IRSC 4PRIA 4OZHF 1FNFA 1FCGA 3C60B 1HQ4A 1VADA 4XX1G 3MO1B 4XCFH 1YQVL 2OQJB 3SE4C 1PEZA 1BHGA 4HKJB 3HNVH 3S5LB 3KPRA 1DBBH 4PLKD 3U4EA 1A1OB 2BRQA 1HHHA 2GY7B 4L9LB 3ROOA 1VFOA 2YRLA 5JZ7C 4ZAKD 3UJJL 3HC4L 3ZHKA 4CW1A 1UM4L 1V3JA 5C0BD 3G6JA 3TVMA 4F7TA 3BMVA 2VO5A 3U30B 5B22A 1WQVT 4GAGH 5JUEL 4XMPL 3S5LG 1G7IB 3HE7A 3ESUF 3R1GL 4YXKH 1FORL 4GT7A 4YHLL 1P4LB 3QDJE 4NKMA 4IBLT 3MLTB 3ZKMC 5DVNA 1DSFL 3FN0L 1WIPA 3ELAT 5C09E 3FB7A 2VXUH 3QEUB 1QSED 3FB5B 1VFMA 5DMGD 1E27B 1ONQA 1E6OL 2FX7L 3L6FA 1NUGA 5I8KH 1K6QH 2AEPL 5DTFA 3TPUB 3OB0K 8CGTA 4M61A 1Q8MA 1JZ6A 2NY3D 3AS2A 4Z6AT 3KJ4C 5FUOL 3T0EE 3OX8A 2XTJE 4LSPH 4DK6A 4I48A 1Q9WA 1NAKL 4KHXH 2XQBL 1Q9KA 3BHBB 2BVTA 3HLAA 4YFDB 3NZHL 1F3JB 3PL6A 3T77A 1A2YA 1LK3H 2V9RA 4NN5B 2EDTA 4KRLB 1MSPA 2P5ED 5ALBL 1KTLB 4F80A 4KKAD 3G08B 1MQKL 3O2WL 2P44B 3GSQB 3MLTA 1N3NB 1P9MA 3IDNA 2VZSA 5DJDB 1CD1B 4MB3A 1MELA 4HG4K 1ITBB 3DX9B 3ZKXC 2JJTA 3TLRA 4J23A 4BJLA 1HE7A 4X83A 4YHMH 1C5CH 1LO3H 5KVEH 4EI5B 5JHLL 4GBXB 1DFBL 2E7CA 4PJEB 4OUOA 3BE1L 1XGPB 1LO0H 5I30L 2DWDB 4ESKA 1CFSA 5KW9L 2YPKA 3ARFA 4HBQA 2A1WL 1JHLL 5I1DA 4P46D 1UM6L 1TZHB 2Q8AL 1HHIB 3ISWA 1BVKB 3QG7L 4HJ0C 3LKOA 3RTQB 1NQBA 2FEEI 3LS5H 1QPXA 4MNQE 4N8VB 5I8OL 1U8PA 2IG2L 4FXKB 1EUUA 3CVIH 3HG1B 4OQTL 1CZ8H 3KPQA 4HWEL 4MA1C 4YNYB 2D7PA 3H9SE 1VFUA 1FPTH 1I8IA 2GJJA 3TFKD 4XRCB 1ND0A 4CAGA 4XWOC 4R90L 1HOCA 1IT9L 2CD0A 2P43B 5BO1H 2OJZL 5B3JE 1EJ6A 3VDBA 4KTDH 3L3HB 2DRUA 1XH3B 5IFHH 4Q97A 1YC7A 2FJFA 3WIHH 3UTZB 1FFNB 1MRFH 1B90A 4PRHE 3BZEA 1HKLL 1OP3K 3D85D 2X10A 3WSQH 4APQB 1BOGB 3LKQB 3HB3D 3GB7B 1LP9B 1MJUH 4BFBD 1X5FA 2PO6C 5BRZD 5LG1A 4U1IB 3BZFB 5D7SH 4ZO8A 3GEWB 4MDIA 2Y4SA 3KPOA 3QH3B 1G7HB 1RIUL 1G1YA 1A1OA 4YDKL 3MRPA 4YZFE 4HLZH 3IS1X 1U42A 1KELL 4FFZL 1NH6A 4RQQA 2YWYA 4JKPH 2GSIA 3TJEL 3B2UC 5F88B 2NLJA 1ZGLA 1H3VA 1KN2H 2W65B 4YDIL 5HDQL 4WFEE 1WWWX 1ZVSB 1EERB 2ORBH 4JO1H 1EH9A 4PGCB 1XGUA 2EDRA 2VOTA 4R0LC 5CSBA 4E42A 4JM2D 5D7SL 5BW7C 4PRDA 4TTDC 1N6VA 3FJTA 5F96H 1YNKH 4TOYH 2WWMC 5GS1B 4Z7UE 4GMSL 4WU5B 1ZLWH 3RY5A 3VW3H 4ZO6A 3UTPE 5DVLA 2DBJA 4Z7WA 4IMLB 4PRNA 1LP9F 2MQ0A 4FHBD 1Z2KA 2DDQH 1XGYL 1I7ZA 4XNMA 2D4DA 5IJKC 4Y89A 2F58L 3BKJL 3VXQB 4HEPG 4OLZH 1PEWA 3IDGA 3O2VL 4LEOA 3C8DA 4LVNC 3WFCH 3O3BB 2FJGA 5E9DB 1K9TA 1FJ1A 3GM0A 4O2FA 5FM5M 4BZ2L 4L8CB 3IJYB 3U9UA 3UBXA 4PG9A 4U2ZA 2G60L 4XHQA 4YJZL 5GS0L 5TE6L 2BMKA 4NYLB 1A7QL 3B5TA 4J3XA 4S0SD 3IDXH 2EE9A 3QIBA 1M7IB 2BOBB 3VCLB 1SJXA 2BX5A 5L6YH 5KSUB 3WHE0 2ZPKH 3GBMH 1BM3H 2E7LC 5HVWA 4PJ7A 2D7TL 3G9VA 4UDTA 2E9IA 4ZFOL 2GK0B 3U46B 2NQCA 4OFIA 3RGHA 1FVCB 1EVTC 3LQZA 3S4SG 4EOWH 2Y5EA 5DD6B 4JFYA 2YR3A 3S8WA 1PLGL 2HTLD 3MA7B 4PRID 2CKBB 2EECA 3VWKD 4LDOB 1YDPB 3PQYD 4PJEF 1BD2D 1KCVH 4G6ML 1UADC 2AJXH 4Y5VC 3S37L 4AH2A 1CYGA 1A6TB 2MOVA 3OKLB 4LVNB 5SWZB 1NL0H 2CIKB 3HCVB 3T0AA 4OZIA 4TPRH 4MA3B 4IJ3C 2YD9A 3MROA 4RAVB 2B4CC 4LCCC 4JFQB 4Q0XH 1UCTA 2A9NH 2QHRL 5DYOA 4XVJL 1BZ7B 1AGBA 4M8VA 1ES0B 3P0VH 3KPNA 1JRHH 2NY2C 2D3VA 5JW3H 3MV8B 5JPMB 1NAKH 2GITB 2FO4A 4IRJB 4N9OB 5IMOA 5FHBH 4AEFA 5FYLH 4KUZH 3U4EB 1FDLH 1FLRH 4NQCE 3SQOH 3GSNB 1OSPH 2GFBA 4HKZA 2O61B 5EU3B 1YJDH 4OCWL 1IGYB 1A6WH 1EXUA 4XNUL 2B4CL 1R5WB 1CQKA 2KUTA 3QA3B 2VLJB 2IGFH 5JO5B 1FAKT 3BN9C 2FGWH 1JGEA 1O7VA 1KT2A 5GGSY 4WI7A 4LLDA 5AZ2H 1Y18B 3DX9A 4OAWA 5ICXA 3VG0H 4ZQKB 3R1GH 1Q0XH 4UNTA 3SKJL 1E6OH 2CMRL 5DRNA 5SWZA 5IW1A 1A6TA 5E70A 3DXAA 1BIIB 2OR9L 4GQ9H 1OM3L 5E9DE 3VXME 5FYLD 4ZTOH 1MUJB 4DTGL 2IJ0C 4HH9B 4N1EA 5KVDH 3B9KA 3HAEB 1FGVH 5C07E 5EZJB 3MGTB 1U0QA 1KIRA 1S7QB 4XCFL 3L3IA 1CFQB 1Q9KB 3DX6B 3EYOA 2NY2B 4EBQL 3QQ4A 4HT1H 4MXVF 3SGJA 2ATKB 3QZWB 1LO4L 4TTDD 2ZZUT 3ARBA 2WUBL 4X6FB 3HZMB 4GBXD 2YZ1A 3CX5J 4OZHB 1IQDB 3OXRA 4UT7L 2VDQL 1CDCA 5FXCH 5DJ8A 3EO9H 3BH8A 4LSSH 1REIA 2C3XA 3C87A 3I9GL 3UDWA 4LFHG 4DUVA 4P4RB 1BFVL 1RUPL 5D5MF 2JB6A 1YQ2A 2IANE 3LN5B 2CRIA 3KYMA 4GS7C 5IHZB 5ADPL 5JQ6L 4JY6B 1DZBA 2E8YA 2VB5A 5CINH 1PG7W 1I1AD 5I1JH 5FOBA 2G9HA 1KLGB 3CFDA 3MFFA 1CTOA 2CO6B 2EYSA 1VEPA 3CK0H 3O3BA 3V5DA 4NRXB 4G6FB 3CU7A 1TQCC 1MFBH 1VPOL 4L9LA 3L9RB 2ZCLL 3QCUH 3HR6A 3RX8A 1JNLH 3KPRB 3O6LH 2JJSC 4Y1AD 3X3GL 4MAYA 5IP4A 2XRAL 1QLEH 5DK0A 1DCLA 4TSBH 4MDJB 5MEPA 1OSPL 3LV3A 2VLJA 4XX1E 4WW2C 1M05A 1M05B 2YHGA 4YHPB 3MLYL 4JDZA 4HUNB 4PJ7B 4MDJA 4OJFL 3PHOB 1CIUA 1F2XK 5EORH 1OF2B 4RISH 1OAUL 3FRPA 4JN1L 5H2BA 1AC0A 5D2NA 4P3CH 5GJTL 4G43B 4Z78B 4FABL 1U3YA 4WV1B 4X4ME 1YEFH 4N8CH 3N0PB 5EO0A 4JG0L 4H1LB 1WAAA 1K4DA 3KNBA 4QRPE 3AMKA 3VD4A 2XV6B 4I18B 1JF5A 1JE6A 1UYWL 1WITA 3EHBD 5TGBA 5CD5D 3TH4T 3ZT6A 1UM5H 4X7FC 2R15A 2BNQB 4TRPH 4PUBL 1EX0A 4LARH 2FJGB 1PBYA 2HT4D 2OZ4L 3NA9L 2MCG1 2JE8A 4ODUB 3AREB 4JKKA 1KLUA 4JFDE 3DHJA 1ZOXA 3CH1A 4YDVA 1DN0A 4NZUH 3FKUS 3I3DA 1FG9C 5DD1L 4JG0H 4K3JH 2JB6B 4HS6A 4U7SA 3SDYL 4TSCL 4K2UH 5DF0A 3QEGH 4N9GA 4PV8A 2GJ6A 3MA7A 1CGWA 4GAFB 5HD8C 2GJZA 2R69H 1RJZB 5FUCC 3M8OL 3ROLA 1UEMA 5A2LH 5A2IH 1IE5A 3NABH 5GGRY 4NRYB 3WS6C 3X11A 2MKWA 2FWOB 5I1IL 1DVFC 1LHZA 1D9KA 4Q6IA 1H3GA 5DFVC 2FNBA 4PJ5A 2VR4A 1DBJL 5I1CH 2D9CA 1TVHB 2LAAA 1EDQA 1R3KB 4JZOA 1DBAH 3BSZH 4GRMB 2A74B 5E8OB 5DQJA 5IFAH 5IESH 1BIIA 3DTXA 5FA4A 3GMNA 3VI4E 3WFCL 4KKNA 4NSKB 5DRNB 3E2HC 3IJYA 4DUXA 1LP9A 2EC9U 2NY5H 3OKNA 1LO5B 2YD4A 4IDJH 3PHSA 3H9SB 3MA9H 3G04A 3BDBA 3MFGB 3RAJH 5F1NB 3V5KA 3G6JB 5DR5H 2ENYA 2ZCLH 3QCUL 5DK2B 2JIXD 5C0CA 2YPLB 1TNMA 1KUMA 3V5HB 1M7XA 3QFDA 4XNZC 5D2LF 3L3HA 4OGAD 3SDDC 1C5BL 4KI1A 2NYYC 2ORBL 4JO1L 3U1SL 1U3HB 1HOCB 4M5ZL 5HGDB 2OLDA 5I1GL 2XA3A 4PJIF 3J8F7 4X80H 2QADD 3FRUB 1ZTXH 1BX2A 5ISZA 3O0RH 1PKOA 1EEUA 5C3LD 3N9GL 2VLKE 3L1OL 5FUZH 2Z4QB 2DQUH 2F5AH 3V7AG 2WUBH 5JPNB 4XXDA 1IBGL 1RUPH 4P23D 4F9LC 1KBGL 3B4NA 3RTQA 1AO7B 1U8MA 2GSIB 4O58L 3P30L 1I4FB 3ARGD 3LEXB 4OZIB 3LEVH 3DJ9A 3MRGA 4K94C 1DN2A 2QV2A 4YQXH 4BELD 4OF7A 2W07A 4JFFD 2XG5A 3RVVC 1P6FA 4ZTOL 2C7UA 4XZUA 4PRHA 5J11C 4M43L 4KKLC 3ZKXB 3LMJH 3RKDC 4P5TD 4MWFA 4F7CA 5SWSA 4JFZL 5B8CB 2X4RB 3CMOL 4JVUA 2HFGH 3QIUD 1M7DA 4RGMC 4Y4KA 1EPFA 2PW2A 4KK6D 1IT9H 2H6PA 4JEGB 1INQB 2QEJA 1NCBH 1ZLUK 4NC0B 3UTZA 3NCJH 2RR3A 5BJTA 3OB8A 4KUCF 4OF0A 4TVPD 5TJWK 3QXVA 4LQFH 2AEWA 2VDLH 3FFCB 5IK3B 2ICWJ 4KV5E 3VRJA 1AO7A 4WUUA 5D7LD 2OTUB 2W38A 3FTGA 4KWUA 3RGVD 4J1UB 1UM6H 2Q8AH 4CKVX 1H0DA 5L8KB 2AS5M 3FQUA 3CMGA 4MLSA 1OOAA 1N0LA 3MRDA 1FRGL 1QD0A 4L3EA 2ERJC 1NBZB 1TZIB 5JMRA 2DQJL 3ZHDA 2W60B 3O6FC 3QP3A 3SQOL 4Q6IC 4J4PC 5EZJA 3H0TA 5EU5A 4NKIH 1ZV5A 3LKOB 5GSVA 1T3FB 3KVQA 3TYGH 1JGUH 3EZJB 3VMNA 4YWGH 1DBMH 2UVEA 4NNXB 3UTSA 2NY1D 3EFFA 3VDAA 4QRSB 2YPLA 5F89A 4QHLA 4ODUA 2X4NB 2QJDA 2VDKL 4KXZH 4HUUB 3BJLA 4UQ2A 5SWSB 4CADB 1IAOB 1AR1D 3TIEB 4PJBF 5D1XC 1CD1A 3DVNB 2ZKHL 2W9EL 3MLWL 1DE4A 3OAZH 4NKIL 2QLVB 1DL7H 3TH3T 3KLSA 3RNKA 4E0RA 3BH9B 2EDFA 1UENA 4ISVB 4WV1A 4G9FE 2OX5A 1DBML 1I75A 1F11A 3B43A 4RMQA 2OJEB 2OR8A 4P57B 3UTQB 4UNVA 1BD2B 1BM3L 4KJQD 3MV7D 4KK8C 4M8QA 3NCMA 1F4XH 2HG5B 4P2CG 4P9HC 2AJVL 3PUCA 1NLBH 4NRZA 3MJ9A 4RWHA 4PY8I 4MDIB 3CFEB 2ZJSH 4WI9A 4D9LL 3K81A 2P5WB 3X14A 3GBML 5GS1C 5C2BH 3WFZA 1IQWH 4RAVA 2AK1L 2RGSA 4HIJB 4R4BA 3LKSA 3TPUA 5J11B 4LLVA 3WUWA 4L9LC 1FORH 5HJ3B 3V5HA 4FQHB 4U3XA 2PYED 4XP6L 4FQHA 1IM9A 2R0ZH 2W0FB 3WNMA 3BKYH 3G6JE 4C56E 2HMIC 2B1AL 4HGWA 4X98A 3KJ6H 3V8CA 1F3DH 3IDJA 4I5BA 4N0UB 2PXYD 1LVEA 3T0XA 4PGZA 4JREC 4QTIH 5E8NA 1ZLVK 5C86A 5D7IF 4B41A 5TGBB 3FT4B 1LD9B 4NRZB 4IRSA 3GMQA 4P9HH 4KKBD 3VW3L 4S1RH 2UZIH 5T3XH 3S37X 4Y88A 4LEXL 2D03H 2HFTA 4UAOC 3I84A 2AKRA 1CLYL 2JTDA 4UDUA 4MQXD 3A67L 1UC6A 3AY4A 1SJHA 3ARVA 3ZE0F 1ZVHA 2CLVA 4HFWB 2MTPA 4XPAL 5A16A 2VERN 3ULSB 2DQFA 3QHZL 1NEZA 2EDEA 3QQ4B 4KJWD 1F2QA 3TJEH 1X5IA 3DSFL 4HS6B 5DR5L 2X1XR 5DMJB 3W11D 2X4NA 1F8TH 1LDSA 4HZLA 1NC2B 2Y23A 4OF6A 3WJLA 3WNNA 3O4LE 4OCYH 1ZGLM 3TBSA 3FO0L 4Z7WB 3BYYA 5JR1L 3MRCB 3QCTL 3SKUD 1TQCB 1W72H 3WMSA 3PJSB 1XR8A 4FFYH 4JO4L 2N7AA 3OF6A 4HUKB 3V7MA 1ADQA 1H0DB 1I3RB 4J1UA 3O6MH 1PZ5A 3B3IA 4Y19B 5L9DL 1K4DB 4H1LA 5IFHL 2CLVB 5E4EB 3V6FA 3THML 1BIHA 1OQXA 1XZ0B 2MNUA 4HGKC 5C6TH 5IHZA 3UBXI 4O4YH 3JWDC 5INCA 5DD5L 1I3VA 4RQQB 4PY7B 5C2BL 2AK4A 1FPTL 3WNPA 1OGAD 3O2DH 3HNTH 4APQD 1W0WB 1U36A 4IRJA 1MI5A 3TCLA 3TWCL 2DL2A 3HE6A 5FYKL 3TV3L 4M6AA 3MV8A 4TUJA 3GHEH 4DN4H 4QRTB 1N5AB 4V1DE 5D6CA 3BPLB 1AGBB 1U41A 5B8CA 3QO0A 2F74B 3EDJA 1C5CL 1LO3L 3HE7B 1T5WB 4PJGE 3E0GA 3TVMB 4ODBD 4V1DA 2HTLC 2VXQH 2UYLA 3UJTL 4TULL 1NSNL 3MV8E 4M6NL 5E2TL 1RUML 3ZE1F 1VACB 4YX2L 5HI3C 5C0RL 2BRRH 3SQBA 2E6QA 2CKBA 5I16B 4YEEA 5EIVA 3JVGC 1CFTA 3KLAA 3EYUL 2DI8A 1X5GA 5JPNA 3ZDXF 2X41A 4DW2L 2Z4QA 4H26B 3W82A 4LSDA 3HRZA 3QWOA 5F1IB 1ZMYA 4FQXA 2FJHB 1OWRM 1OARH 1D6VL 2N4IA 2W0LA 5JQHC 2C26A 4LCUB 2AK4B 5GRJH 5I0ZA 4WI8A 4X7EC 1J0HA 3QWQB 1OT1A 4P23C 1NGWB 1CFVL 5IW3A 5BVPL 1IQDA 2PO6D 3QFDB 5IWLC 1PAMA 3FN3A 1WUNT 4FFVC 2HLFC 3UBXB 1S7XB 4LSRH 2F53B 1OP3H 1JNNL 3OJVC 3VU2A 2NY4C 4M1DL 3PP4L 3QFJD 1MF2H 1FGNL 4XH2B 3MRLA 4K3EH 4OLYL 4GAGL 1Y0LB 2BSSA 5KSBE 3K3QA 3GO1H 4YAQA 1PG7L 4CNIA 3DTXB 1NEZG 3QDJB 4AH2B 4NO2A 1JNLL 4UIKH 3IVKB 1GYAA 3ARGC 2EH7L 3X3FL 4OD2A 2Q1EA 5E08L 1W0VA 4OAWB 5ICXB 1Q72H 4G8GE 1JGEB 1Z5LB 2XT1B 4JAMB 1QFWM 4NQXA 4XTRC 5C6WH 4K23L 3RWIA 3WJLC 2IQ9L 2E6PA 3CUPA 1OY3B 4JRYD 2C3HA 5CBAA 3LS4H 2OK0H 4HPYL 3FO9A 3OX8B 2Y9RT 1ZVSA 3DX8A 3LQAH 3WL9A 4MJ6B 2W65A 4M61B 1CGTA 2ZG2A 3LHPH 4EKXA 4V1DD 5DC4B 2GTZB 3NCBB 4K9EH 5HHOA 5KN5B 4PLNC 5JHDE 4JHZA 4R4NC 3WXWH 2VLRA 1AIFB 1BLNA 2XFXB 1IEBB 4KPHH 3SOBL 4Z7OF 4Q58C 3VXPA 3CH1B 4I18C 4XVSL 3R06B 2P24B 5HPOA 3FB7B 4HPOL 1CK0L 1J87A 1F5WA 1QHPA 4UT7H 1R6VA 3W9EB 5ISZE 3MV8D 4KVNL 4KK9D 1YPZB 4N0UA 4HPYH 5J6HA 1QBLH 3MCLH 4P0DA 4APQA 1G7IA 2FL5B 2IQ9H 3O3DA 3FN9A 3O9WA 3RPIB 2E6JA 2IAMA 5D7KD 2VLLB 4OLYH 4M7LL 3BZEB 3QUML 4U6HB 3Q3GA 1ZLSH 3AM8A 1AR1C 5EZIH 2NY1B 4O02L 3EO1A 1IGIL 1T03L 4PY8J 5C0CE 4XCNB 1HQRA 5E95B 4F37K 5JIIA 3HKFA 1TTUA 1F6FB 3C5JA 3MJ8B 4YUEL 3X12B 4OIAA 2B4CH 4AM0B 1VADB 3OPZH 2LU4A 2HA1A 5FO8B 5D7IA 5F7NC 1YYLH 4X7SL 1MCOL 1F02I 2YBRA 1DQML 5C0DA 1BJ8A 1U3JA 2QTEA 3KPSA 3KPSB 5GS2H 1XGUB 2C4FT 1EGJH 1U8PB 5L2KD 4M7ZC 1T66D 4PJFF 5FO7B 4M6OH 5CGMA 1KN4L 1XCTB 5FM5O 1II4E 5DK0B 5J0BA 1T7WA 2Z92B 3VH8G 1QO3A 1MRDL 3VFUB 5CJQL 5I1IH 3BRGC 5E1AA 3TZVB 5JORB 1GZQB 3OAYK 4U1NB 5C8JB 5IR1B 4M3JA 1DE4B 1BFOA 3C8KA 4MAUH 4MSWB 3FO2B 4Q9RH 4UBDC 2EYSB 1HH9A 4Q6YA 1FNGA 5E9DA 3C5ZA 1A7RL 2ZCHH 3CU1A 1P9MC 1VENA 3KPPA 4M02A 1L9NA 4M7KH 4A6YB 3JUZA 5CIPA 4GRWB 5AUMB 3OBAA 3QJHB 3WXVH 4ZUUA 2Z91A 4XNQA 1U8KB 4AEIL 4HK3N 1AIFA 4HW6A 4J4PA 3NZ8A 5T1LA 5EU5B 5KN5A 2NTSP 4I0CC 1ZLUH 1G7JA 3DXAD 4I13B 3WL9B 3REWB 1PLGH 1U6AH 3ALWA 4WO4A 5GRWA 4G9FB 4W4OA 2UVFA 1QVOB 2VH5H 4LCWD 1JPTH 2ATKA 5TQ0H 4EQ2A 2LV4A 4FABH 5I1AB 4PV8B 1CE1L 1P7QA 3ZKMD 3GMPA 5K9KB 1HXMA 2X1PA 1MCWW 3MLSL 1F4YL 1ZT1B 4ELKA 5FOJA 5A2JH 2EIDA 5EPMB 2ATPA 4FQCL 3I2CH 2EE2A 1E27A 3BDYL 5I74C 1A5FL 3UZEA 2WWKT 1AJ7H 2EDYA 3QEUA 1L6ZA 1CXIA 5T33L 3LY6A 4JG1H 3D2UB 5CEZH 3VXUB 4C59B 4YBLC 2CPCA 4FQXD 5I2IB 4PJEA 1P7QD 2R29L 2NY7L 3ZSTA 3MCG1 3KPPB 1XGYH 1BOGA 4JO4H 4OCNC 5LBSH 1IC4L 1ZS8B 4DKAA 2H8PA 3RWDA 4PRHB 5TE7H 2Q76B 4JO2L 3EJYC 4LSUL 3PQYB 4QOKA 4YGAB 1S7WB 4U6XA 1X5LA 3QCVH 4ZYKA 1VKXA 2VIRB 3OJDA 3V7AE 3MRGB 5TPWH 1G7QA 3BKCL 1FBIL 1KTLA 2YK1L 3MO1A 3O9WC 1MFCH 5K9OB 2DICA 4LL9A 1I1RA 2YD5A 4LPTA 4PRIB 5FO7A 5EUKB 1VFBB 1TJHL 3BHBA 3HLAB 3U7YL 3CVHH 3CIQA 3QZWG 2DM3A 2DS4A 4FA8A 4NZDA 1QKZH 3ARDD 3LRHA 4NQDD 4HXAH 1UH4A 3O4OC 4YIQA 4PRPB 3U0WL 4Y4FC 2DN7A 2Y5TB 2BY0A 2YMXH 2Z35B 3DUSB 4MHHI 1L0QA 4XVUC 3DETD 4WIQA 2WMPA 1OCWH 3V9FA 1GOGA 3FMGL 5E8EB 4G6JH 3RZCA 3TBYA 1FGVL 2Y36H 4NO0A 1EAJA 3SE3C 4OLVH 3FQWA 4HBCH 3G5XB 2YN5A 3EDDA 4JFOB 3EJJX 1CLOH 3VJ6B 1KJMB 1TZGH 2AK1H 4WFED 1AHWC 4NP4L 3DXAE 3HE6B 1BF8A 3QQ9D 3RUGF 3ROOB 4L8SC 4X4XA 1F4YH 2Z93B 5GGTA 1Q0XL 3SKJH 2VLRB 1VEMA 1H3UA 3G5VB 5F93C 4RRPG 4I2XB 5ACLA 5KSUA 4JFHD 2B1HH 5T3ZE 5F7WC 3INUH 3QUZA 1RZ8B 1OAKH 5DJ0B 2UWEF 1KPUB 2Y06H 2OZ4A 2A83B 2H2SD 3QI9D 4PYHA 3RX7A 4NRYA 5GZOD 2QR0A 5D2NE 4HIEB 4GSDH 4AT6B 2AK4D 2EDBA 1QRND 1FFOB 4A6YH 1NLBL 4DZBA 1BJ1J 4GRLB 4LEOB 4NOBA 1QG3A 5FYLL 2DMKA 5JW4N 4R7DA 4FQ1H 1RJLA 5CKAA 4B7IA 5JOPD 4Y4HD 1N7ML 2P5EA 3QNZB 1FZOB 1MWAB 5IJVB 4OGZA 3NN8A 1T83A 5DJXB 3ARDB 5KS9E 4JQVA 1I9IH 3RX5A 1T20A 3QI9C 2DTML 4XC1L 3WFHB 4OCLC 3PHQA 5C0GB 3KWWA 4FZEH 3KYAA 4Y5VB 1JMZA 1TJIH 4I1NB 1T1YA 5K33A 4H88L 4UUJA 1MFDH 4HKZB 3TYFA 3MX0A 43CAA 5J12C 1T21B 4YBQD 4P5TA 4P2RD 2NCMA 4HWZA 3GIZH 1QSFD 2DI7A 3GMQB 5FHAH 3MRMA 4CGTA 2XI9A 1BP3B 2Z8WC 3DGGA 4HIXH 1S78C 4LLWB 4TUKH 2UY6A 1T04A 5EC2B 4LCYB 2P47B 1AXSA 4WEBH 4LBEB 3LKQA 1XCQA 3MUY1 4WFFD 1I1FB 4JRXE 3LIZL 2ITDA 2HFGL 2ZUQB 3MODL 3SDXA 5DUPL 4D8PB 3GBLA 2DM7A 3KYOA 4RRPA 3OGCA 2J5LC 2DQIL 1I1AB 2PCPB 2EXYC 3P9MA 4A2LA 3NCJL 4K7PX 3FMGH 5FAAA 3ARDC 4AMKL 3Q5YA 4QOKD 5AYUL 4M1CC 3BGMA 3QIUC 3C09B 3QO0B 3FQTA 1M4KA 4YXKL 1KB5A 15C8L 2F58H 3RY6C 4OFPA 2X70B 4U6YA 4X0KA 1ZLVH 2X1WL 1I8LC 5AZEH 2ARWA 1ZE3C 2X4SB 2V7NB 4KC3B 1HIMH 5C09B 1EO5A 4LLAA 3SCMD 2VABA 4AEHH 3STZB 5DEFA 5J1AA 3RWHA 3VWJB 5GHWL 1NC4B 3LQAL 5GGTH 3WE6B 2YPKB 1KSRA 1HNFA 1FHGA 2L7UA 3WEXB 1HXYA 4OQTA 1LWRA 3VWKC 5F9WB 2YD7A 3GSNL 1CDGA 4I0KA 1YZZA 3NCCB 3LQMA 5JOEA 2DBLL 4N5EC 5HY9A 3IFLL 1MIEL 5DC0A 5DI8B 4XBGA 5HHVH 4PLJD 1WAAF 2R2BB 2ZG1A 3D48R 5J1SC 2XN9A 2NY2D 3X3FH 4U0RB 2CKBH 3LPWA 3HR5B 9CGTA 1AKJD 4HH9A 4ODXB 5TE7L 3I85A 3NN8B 1RJYB 1YEDA 1DBKL 3C2SA 5D96C 1KYOJ 1IC4H 3EFFB 1UFUA 4XP1L 4NNXA 3BQUC 1NFDB 3CFKB 4OGXL 1EHAA 2NTFB 3RGVC 1GXEA 1H5BB 4LGRB 5F9OL 2NY7H 2LTQC 2CQVA 4Y5XA 3IU4L 4NFBA 1JI2A 4OSUL 1SM3H 3QAZC 3VXSE 2PYEB 4KMLB 4JFEB 3Q5OA 2IH1A 3OKDA 4P2RE 3SY0A 3UTSD 5KSBA 3WJJA 3BSZL 5JNYA 4JZJC 2DLHA 1C1EL 2BVPA 4HMEA 3V0WL 4X6DB 5CEZL 1KTDB 3N1FC 3EJYD 5EU3A 3JWOC 4NKOB 3VXOB 1I7TB 4D9RE 2AEIT 2NNAA 3RVUC 3MRQB 4NQUA 3V4UH 1WV7T 1B2WL 4NUJB 5BQ7B 3T0WA 5KSAC 3VFTB 3C09C 4GW4A 1U6AL 2DF3A 2UWEE 1EMTL 1IKNA 4KKCC 3QEGL 5HDBF 4P23A 2R23B 5ADOL 4N0YL 1CFNB 5L2JA 3SKMA 4LU5H 3KPNB 4U1IA 4NNPL 1D7FA 4AEIH 3HPJB 3G5XA 4DZ8B 3NABL 1CDIA 1NGXA 2VLKA 4KRNA 4JFQA 4OTXH 1BWMA 2BRRL 1XEDA 4MA3A 2A0LC 2ZCKL 1U8OB 2J7LA 3O3EA 2VNCA 1E6JL 3T3PE 3LDBC 4XHJC 4C58B 5DMKB 4PUBH 1XH3A 5IGXH 1SY6H 3WUWB 5C2UB 5I1HL 5DHVA 4Q9QH 1INDH 3WS3A 3G5ZB 3V95A 5CD3A 1XF1A 3JBG7 4NC2B 1EV2E 3ULVD 1CXKA 4JQVC 1I1YB 3D85A 2VZUA 4X6DE 4LOUD 3UTOA 1MLCB 3E6FB 3GSUA 2ZCHL 3BGFB 4LSVL 3HB3C 1V7MH 4YEFA 3O81A 5T5FL 5KZCD 1XAUA 4NC1C 1CU4H 2DYPD 2QSTA 1JZ8A 4NGHH 2WLZA 1IC5H 1MCRA 4RAHA 2V9QA 4ZUWA 5DJ6A 4P57A 2VR5A 3O6FB 4UAOB 1T2QL 1YY8A 4XGZA 3F8UB 4WI4A 1KGCE 4NO5A 5DDHA 5I15L 4OCMC 4YE4H 1VKXB 4NQDE 3DIFB 4BYHA 5LAXB 4MNGE 3PQYA 3B9VA 1JFQH 2XZCL 3D18B 1G9ML 3DYMA 3GBNL 4TYUA 5K93A 3LSOB 3NVQA 5ESQA 3HS0B 4Y1AE 2G75B 5D93C 1ZHBA 2GJ6E 3QUMH 4HUUA 1PY4A 5CGYC 2Y07H 4LGSB 4GG8A 3O6KL 3OPZL 5INDA 1NC4D 2VC2H 1L9MA 2LABA 1FIEA 3EHBC 5EO1A 1VGKA 4IOFD 4RMVA 3RWFB 4WWKC 4F7EA 5IROA 4PV9A 5IMMB 5TH2B 5MI0B 3BP7B 5IMKA 4J6RL 2DIAA 4FFVD 4WGWB 2VXSH 3S7GA 1TITA 2IAMC 2XZZA 4ZSOE 4WFHD 2EEAA 3ARYA 1J8HD 3QHZH 3M1BA 3FQUB 2O26U 3VXSA 3QPXH 5EIQA 1J5OH 5F44A 2YD6A 4FP8L 4OLUH 4M93C 1T89C 4QRQB 2UWEA 3AY4C 1UJ3C 3K4DA 1JGDA 3LD8B 4TSAH 4LHUB 4HPOH 1OGTA 4O2EB 2DLIA 1FAIH 3O11A 5JXAL 3SE8H 1CICB 4XC3H 2N56A 3GSNH 1WSST 3QDJD 5I6XC 4YDVB 2NY4D 2ADGA 3H7BA 5C3TA 3KPOB 2HJFA 2FO1A 2PW2B 4BKLB 3D39A 4JRXB 4GBXC 1CGYA 1YN7B 2UY7A 4X7TA 1F13A 3MNVA 4HT1L 4NHUA 1FVEB 1HHGB 2EXWD 3BPOC 3BWAA 3IAPA 1QSFB 4Y0GA 4CW1B 3LRSA 5CFHA 3VG0L 3NGBB 1SVCP 4P9MH 3D25A 1RURL 3MRHB 4K3GA 5MENE 2IGFL 5L2KE 1MFAL 1S7SB 3RHWF 5FFLA 4IDLA 1MCQA 1S5IL 4M6ML 4JFDB 3IETA 5LXGL 2O93L 1CGSH 4XCEB 5FECB 1DQQB 1QFWI 1X4XA 1AXTL 1ZA3A 4BH7B 3MMEA 3VI3F 3DRQA 3VD5A 2IFFL 3WS6A 3TA3D 5C0DB 2J4WL 2BNRB 1JTOA 1OAQH 4Z7UF 5I0DA 1F45A 1TFHA 1BVKA 3B9DA 3QNYA 3VXRB 4FQIH 2EXYD 4PBWD 3AMLA 4L4TA 3NIDE 5EFIA 5C7XL 4J3WA 3IDUA 3KPLA 4FTVA 5DK2A 5E5UB 5MHSD 3BUYA 3OJ2C 4Z18A 4TPRL 3L7EB 3O8XB 4KV5F 3RTQD 4RDQF 2OL3B 1MCFA 2FYYA 2DOCA 2PETA 1FNEA 1JF1B 2JCCF 1JPFA 4XPHL 4S2SA 4WY7L 1MFNA 4J3UA 4XMKH 3C5ZC 5DJDA 3QI9B 2G9HB 3DRTB 3W5NA 3LB6C 5KSVA 2R1WA 4EN3C 1JGVH 4G42A 4LLYB 1T80A 5C9JA 5I76A 1RZGB 1OTTC 4YXHL 5ICZB 1XF4A 5DQJB 1TVBB 1BJMA 3H9SD 1LE9B 3GHEL 3HZKA 1MHPL 1NMCB 4JZOB 3HZYA 5CP7B 4DN4L 2DQJH 3T2NH 3PIQB 2YPVH 4Y19E 5DEGB 4KI5F 1FCCA 3MJ9H 1YMMB 1OB1A 2VDPH 2R1YA 3QXAA 5CILH 3TO2A 3ZE0E 1R5VB 3PL6C 4BFEA 2HJKB 5FA3B 5ADOH 2GJ6B 5HTSA 2XNAA 1RK1B 3NH7L 2GEEA 2EEBA 4PJAB 1I3GL 4JPVL 4KJPD 4NM8H 3FHQA 3OKOA 1DN0B 1OLZA 2JJSA 3AFLA 3SCMC 1K5NA 1L7TH 1AO7E 1EO7A 2Y6SD 1LEGB 2YKLL 3U2SB 1UB6B 5HHOD 2HFEA 3MRLB 4XH2A 1N2RA 4JFPB 1EO8L 4I4WA 5FYKD 2EYRB 1ULVA 4L8DA 5CJOH 5ESAB 2EZ0D 2HKFH 1CF8H 5JO5A 5SWQA 1UZ6E 3BVNB 4DFHA 3SDCB 2VITB 4W6YB 4HV8B 1A7BA 1J0YA 3EYVB 4YFLI 3HE7C 2XA8H 5GSRA 4HUVA 5KSBF 3ULUH 3OHXA 5D1QD 2VKWA 4HK0A 2R56H 3NCYS 4K07A 1JWMA 1G6RB 5F3BA 3MBED 4QGTA 4GMSH 2X4UB 3MYJA 2WINA 4N90E 1MREL 1P7HL 2FO4B 4UT9H 3QEQE 3BD3A 5HHQA 2D03L 4Y4FA 5FYJD 3MLZL 3LV3B 5LGJB 4NQSA 4HMCA 5C08D 4JB9H 4BZYA 3TVMD 4XPAH 5C0EA 2DMBA 2A6IA 4KFZC 3D3VB 2XA8L 5CEXB 4I3RH 3QR2A 5ICYA 2YA0A 1QLRB 1FL5A 2YC1B 3UTTB 4YBQC 5BVJB 2AJZA 4QWWC 1SJVA 1PY9A 5K59F 4NNYA 4C54A 5H94A 3IU3A 5DJ2B 3PABA 4L4VE 3VFGL 3CLFL 3RGVB 5E94B 3RJQB 3LH2H 1MJUL 4XPBL 4Y2DA 3EO0B 5FOBB 5T33H 1I3UA 3P9WB 1U93B 1ZVYA 1LK2B 1F00I 5FDWB 3P4NB 1IGCL 3TIDB 1UXSA 3Q6FB 5GGQH 4Z7VB 5DJAB 4QY8A 1B9ZA 3P3YA 3X13B 2IH3A 4GW1B 3QG6B 4AZ8A 5F7HA 5J13C 3ZKNC 4BSVA 2HJLB 4P5KB 4XVUD 1M7IA 1L7TL 5I8OH 1MNUH 3ETBF 3IXAA 2OJZH 4Z7UA 1FIGL 5D1ZB 1BEYL 1WCQA 2NXZB 3HZMA 5DHVH 1T7YA 4X6FA 4PB9L 4ODHL 4JDVA 3MJ9L 1CDHA 5LQBH 1BQSA 4GUPB 3SDXF 4DGIH 4HULB 3ARFC 4PJDB 4OZFB 1CFQA 3DVFA 2J8UE 4GKZA 1Q38A 1TCRA 5FO9A 4FQ2H 1YJDC 2GTWA 3GIZL 3MRCA 5I1LB 3MUGB 4RFNC 5EC1B 5HDOA 5C07D 5KVEL 1TETL 1RAMA 1A14L 5CP3H 2HTKD 4DEPC 5D1XA 3V52L 3VGAC 4AYFA 4GMTL 2VISB 2NMSA 4LSQH 1A3QA 2MCPL 4P2RA 3OTTA 4JZNB 4X6CF 4GRWE 4Y4HC 3NFPB 2BOCB 1I8MB 2I25N 4LLDB 3OGOE 2BNUA 3VXMB 1KIPA 3HG1D 1U95A 3E6HA 4O51B 4XCYA 2C3VA 5D2LE 5E7BA 5F7EH 1GGTA 4PP2B 3RVWD 1KPVB 5F1KC 3ZL4L 2D31B 3MJGX 4JJ5B 1N5YH 1YYMH 1MHHB 4GRLD 4JFFB 2WWKO 1FRGH 5F7LB 1VGEL 5B38B 3O3AA 3ULVL 4MQ7B 1T0PB 2M2DA 5ID0B 2BFVH 4PJFA 4HWBH 5ECJE 4H25A 5C0FB 3L5XH 4QXUH 1XGTA 5GRYA 3GSOA 4LGPB 2IPUK 4MYWB 1MWAH 1EFXD 4FQIL 1P2CA 2R4RH 4G8EB 3SDAB 3CDGB 5IB3A 4NQEA 1MCEA 4GKSA 4W6WB 2PXYC 1FYTE 4OGAC 1UZ8B 3GB7A 4WENB 3T4AA 5HGBB 4QF1A 2GKIA 3WV0A 4MNQA 3TBWA 5DJZA 2EH8L 1JUFA 1FZMA 2VDOH 3OKLA 1F42A 4O9HL 1IGIH 4YHLH 2ZOKA 4BQ9A 2NX5E 2R1XB 1HYSD 1C12A 5JW5B 4M6MH 2AV1A 5JLZA 4MCYA 1S5IH 1SBSH 2AJUH 3F58L 1AHWA 3DWTA 3RBSA 1YNLL 2FRGP 5GISL 5BXFA 5HHNA 1DSFH 3FN0H 1A4JA 3DVGB 4K94H 5LGKA 3FOLB 4DVRL 3PGCA 4LVOB 4AJ0A 2ADJA 4DEPB 1H15B 5JQ6H 2XKNB 1MRCL 1XF5A 2DLEA 3GI9L 1WTGT 2EKSB 1IBGH 4KROB 1C5DA 5EBMA 2A77L 5J9PB 1A6UH 4OV5A 3TA3C 4NZTH 5AWNL 5T1DH 2NY0C 2ZSWB 3BWUC 3OKKB 2BOBA 3QIBB 3VCLA 1SMOA 4EUPB 4M5YL 3BZDA 5T3XE 4ZDHA 4FS0A 4PJ5D 5ETUB 1V3LA 2WLYA 1SYVA 3VWKA 2CDFB 3LN9A 3ZO0A 1JPGB 3N9GH 1PW3A 1FJ1B 4HKBA 5ILTL 1P53A 4CVZB 5EU7C 2H2PC 2N7BA 3TA3A 3ULUE 4Z5RA 4OLUL 3VXRE 4ZOAA 5EH1A 4HXBH 2HKHH 5GISH 4H0GA 2JCCA 5LWYH 4NWUH 2HT4C 5JHDA 3S88L 3M17B 4L4VA 3UTSE 3BIKA 2BC4A 1G7PB 1R3LB 2A73B 4K3EL 1TPXC 4G3YL 4R2GD 4Z9KB 5JDSA 4D0CA 2Z31A 1FL3A 3F7YA 4PJCB 3VG9B 1T4KA 2YSSA 5KS9A 4NDMA 2CRMA 3MSPA 4S1DD 4MJ4A 4MNHB 4K3DL 3ZZ1A 1L4IA 2P5EE 3D87B 2IADB 3T08A 2D0FA 1C8PA 1M1SA 5F7UA 5J06A 3U36B 1FLRL 4ZXBD 2IWGA 4P46B 5DRXA 4FQCH 5FHBL 4C83B 2E9BA 1D6EB 3C6LD 3L6FB 1X6LA 5BJTB 5EU6B 1HDMB 1VGEH 2HVKB 3KPTA 1ZHKA 4J8RA 1INQA 4DOHE 3FQNB 1AGFA 3OL2A 1ZA6A 2EC9T 3CSBA 2RCSL 1RUQL 1GZPB 1KV3A 4YC2B 4HJGB 3DV6A 4JM2F 4XWGL 1M6OB 2X9YA 4YLQT 1MJ7L 4X6CA 5DXWA 2HT2C 4PRPD 1S7VB 3W39B 2DLFL 5T1KB 1X5AA 4PBXA 2B0SH 4PJBA 1E6JH 1TQBB 4AQ1B 3QPQD 4G8IB 3PWPD 2ZCKH 4XMLL 3ULVC 2D7NA 4LNVA 4P3DA 4XWGH 2NXYC 1I4FA 3LEXA 5F1OB 1QA9B 5L0QB 4Z7NE 4Y5YB 4EDXA 1HZHL 6FABL 4ZO9A 3GK8H 1GGIL 3U7AA 3IGAB 5T5NF 5DFWH 4K7PY 2VN4A 3L3GB 5FKPB 3RVTD 1UWXH 2YPLD 3T2PA 5IIEB 3K1KC 3QNXA 3HC0B 3JSSA 1IC7H 3FRUA 3N85L 4PB9H 4J12A 3CAFA 2DJUA 4R2GB 4PRHD 1U3HA 4N90D 3MREA 5CJQH 4WJ5B 1A7QH 2HLFD 5IKCA 1X5JA 1EEZB 4F2MB 5EOTB 4JM2A 2BSED 4NPYA 4OIIL 2J8UB 3MV9E 5C0AE 5I18H 2ENSA 5F3HB 1QNZL 2NY6B 5IB2B 2H2PD 3MLYH 1AE6L 1N59B 3MRRB 4OSUH 1HHJA 1DQDL 1QFWH 4MD0B 3OF6D 4U1KB 5ESVB 4ZXBB 3LQAC 4IM8A 5T1LD 2ICWB 2ILLA 3VGBA 2CLRB 3KDMA 3QDHA 3S88H 1QEWA 3LN4A 3QULA 1NDMA 5AD0B 3RL2A 4Y4KC 4OCSL 4OUUB 5E6ID 3IJHA 5IVZB 4PTTA 1BECA 3NIGF 3TCXA 3VH8B 1V8HA 1A2YB 2MKLC 4LHUG 1G9NL 4NWUL 2XG4A 4YDLB 3HFMH 4OI7A 5F72S 4GAYA 4Y16B 3WLBA 5ANME 4E5XA 2FD6L 4GO6B 4MNQD 1IGML 5J1TC 5E24E 5HDQH 5I1JL 5H35A 3IDMB 3FZUC 5E8DL 4NC1E 1MREH 5EOCH 1JNHA 4CMHC 5ADPH 3KYNB 1MVUB 4N5ED 1QQDA 4R96B 5M7QA 1HIML 1KJ2B 4GRLC 4HHAA 1VESA 1S9WA 1MAJA 5F9JA 1MRCH 1MAMH 3ARBD 4XBPA 4PJFE 3T0EB 5BRZE 1JYWA 3TO4C 1MLBA 2DYPB 3EO9L 4U0QB 2MWCA 1HEZA 2EE6A 2YUXA 5GPRA 4WWID 4Q74A 2FZ3B 2UUDH 4NZRL 5MEQB 1IM3A 3GUTB 2PR4H 1FV1A 5AYUH 3QB7C 1YEEH 4KQ4L 43C9A 3RU8L 2HN7A 4ONHB 5I9QB 4QRRB 1EO8H 4EN3B 1LNUB 3DPBA 1IL1B 5D7LE 5CSZA 2VE6A 3O8XD 5DUPH 2EIZB 4U7MA 1NCWL 5B39G 1JTTA 2V5YA 3QFJB 1YNLH 1BVLB 4OFKA 3P4MB 1OTSD 3EDFA 2DJSA 3GRWL 1RVFL 4OZ4A 2F8OA 4ZD3L 1KXTB 2DQDL 3JTSA 1QSEA 5EO9A 3UEZA 1KB9J 1B6DA 5KJRL 1NUNB 5IB4A 1CD9B 4Z76A 4EIZC 3BKMH 3L95A 2CR3A 3L5XL 2X44D 1AGEB 4Y2OA 4BSWA 4WHYG 3I50H 4C56A 3RIAK 1ZEAL 2E27H 1ZAGA 1UJ3B 1MHCB 4HCRL 5C0AB 1MFDL 4JN2B 4ZG1A 1ODAA 3IFOA 3U4AA 3MLVL 4HHAB 3SDAD 4D2NA 1K4CA 3E2HB 3T8XA 1J1XL 3OWEA 2ZUYA 1UZ6F 1NJ9A 1YEGH 4NRXA 3QUMA 4XC1H 4ETQB 2GSGB 3MLRL 4M1GH 4MA1B 4U1HB 2V2XB 1J0JA 5DUBA 3ZL4H 2J6EH 5I8CB 2MCPH 1ZWIB 4LCCA 3DSNA 4OCRH 4XPTL 4CVXB 3UPRA 2MMXA 2W9EH 2FIKB 3LKNA 1A3LL 2FIRT 3RWEA 4G9DB 1A14H 2IC2A 3VH8A 4LLUA 1NL0L 2Z9TA 4BK5A 1V3MA 1R3HB 4XBEL 3MLVH 3O41B 3E3QC 4JZJB 4P4RA 2O5ZL 2FLBT 2CXKA 1ZHNB 4G8FB 1L0YA 1UB5B 4TVSa 4YWGL 5FF6B 3QRGH 5BRZB 3WBDA 3CFBB 2X9WA 4G7YH 5GRUL 2JJVA 4ZXBA 1KCUL 2XIDA 3CNKA 2LU7A 1C16A 1LE5A 1S5HB 4AQOA 1OAKL 3S96A 3MV7A 4WW1A 4OLXH 3DX6A 3EYOB 4PJGF 2YUWA 3VXMD 4R0LB 4Z7OE 5TE4H 1MPAH 1DUZA 3TWCH 5DRWA 5HHOE 3B9KB 3PWLB 1XT5A 2DQDH 1H9VA 3NACH 4MXVE 4PJ5E 1OP5H 2JJUA 1PX4A 1FO0H 1LQSR 5KSAA 3VRIB 3VFWB 4F57L 3EOAB 5IVXE 4QRUA 1HN1A 4X9FA 4Y5YC 2FB4H 3B6SB 3CLEL 4Y4KD 5EN2A 3MRBB 5HGAB 1NGYB 2WBJA 3KS0J 3FQRB 3UP1A 3L3GA 1KNOA 2PUQT 2ZOLB 4KVCL 3MNZB 5C0IA 5GGRA 3KGRA 4H1LG 2H26A 4LIQE 3DMMB 1YNKL 3QEQA 4JFZH 1NMBH 4H5SA 5L88L 3WN5A 1RHHB 2B5IB 2J3SA 4M7JL 1FE8L 1QYGH 1DEEA 5DHYB 3TBTA 4I0PC 2OMNA 3RNQA 1AQKL 4MA7H 1J18A 3QDGA 5EBWA 1S9YA 2FX8H 1A6ZB 5F6HI 1V3KA 5DS8A 1HH6A 2YXMA 1FFPB 2W9DL 3VE0A 4IHOB 2D7MA 2GIYA 5JOPE 1LEIA 2IPUG 5BS0E 4YO0B 1FFRA 1VERA 1HCVA 3PWPB 4KK5C 1MEXL 2MPAH 3LOWA 1KJ3H 1I7RA 3ZE2F 1IGJA 3PGDB 2VXSL 1A0QH 4KK8D 3TNNB 1G6VK 2HYMA 4PGDA 2X6MA 3KXFD 4POZC 1D5XA 5FKAA 4WWKA 2AJSL 4QGYA 3EBAA 3QIUA 3WSQL 4PGBB 2Z8SA 3NBNA 4U1JB 4HG4J 3IDIB 4I3SH 3RA7L 4WEMB 4JPIB 3ULUL 2QQLH 1A7OH 3VFOA 3T4YB 2BVQA 2JK5A 3AU1B 1NMBL 4YR6B 4CU7A 1AR2A 1X9QA 2B5IC 2R8SH 4R26L 3ULUF 3PWPE 1QFOA 3OKEA 4HJ0D 4P59L 2FATL 1A5FH 3OB0H 1GOFA 4ZFZB 1D5IL 4OD1H 3SO3C 1X7QB 2Q87A 4ORGA 5SV3A 1DBAL 4Y4HB 2X4PB 4KKLD 4XNZB 5IVNA 1L6XA 1X44A 4WEUD 3QYCA 1N4XL 3M17A 3ARXA 2K3TA 4IIQB 1QFWL 5J3HC 4FTVE 4RFOL 1DP0A 5CP3A 4R90H 3CVHB 3BW9A 4G5ZL 12E8H 3QG7H 4MNGA 1N26A 4UT6L 1SEBA 2JF1A 1E4XL 2IANB 4O2FB 5TDOA 3R0NA 2VUOA 3TBVA 2BVUA 1BFSA 1ZHLA 3UO1L 2NW2B 5IV2A 2VH5L 1HYRC 1KEML 2IEPA 1IILE 1BBDL 4YXLH 4HUWA 2OS7A 4GH7B 1JGVL 1S9XB 3MRNB 5A1AA 2HRPH 2NW3A 4WWKD 2V2WA 1R0AL 4MMXC 2XTJD 4L3CA 4WI2A 1WT5A 4TSCH 4W4NA 4N0RA 1I9EA 2YA2A 5IW6A 3IYLW 3QXUA 4HUXA 5IM7B 1VSCA 2Q7NA 5C07A 4MAUL 3WKNA 2V9TA 3C6LC 1NCDL 1OAXL 4LCIL 3JWOL 4OCRL 4XPTH 1RUQH 5B8CC 4KDTA 4XMKL 4D0DB 1QPPA 3GJFA 3DX7B 3NZHH 5C0BA 4KMTL 2CO7B 2H32A 1Z9SA 4XHJD 3C2AL 1J9CT 4Q9RL 5F88A 3WFDL 2LVEA 1WBYB 3SKOB 1RZIB 2PXYB 4I77L 1D9KD 3BEVB 4LVHB 4HIHA 4N8CL 4B0MM 2A6KA 1KPRB 2P5WD 1CT8B 4OZGB 5C09D 3AC0A 3LCYA 1CBVH 4PG2A 2CUHA 3WIFA 4URTB 3WHXA 3G6DL 5LXGH 3FFCD 4X7SH 5LGHH 4Z8FH 4K9EC 1CFBA 4OJFH 4PJXB 3V0VB 1OTUD 3STLA 2CDEA 4PJHE 4LPXA 4TUOB 5CLWA 4Y5XC 2QQKH 4X4MA 4DJMA 2C4FU 5D7LA 2W59A 3MLPA 3FB6B 3O4OB 1AQDB 1RULL 4ORZC 4ZD3H 4JFDD 3GJFB 4N1HB 4KU1A 3FRPG 3MRIB 8FABB 3SE3A 1YMHB 1JZ7A 4G3YH 4ODWB 1U95B 2HLAB 3TO4A 4LAJH 4JLRA 3BD4A 3KR3L 3D39D 1H8SA 1I9RL 4N8VA 5E2JA 1N64H 1U92B 5HDLA 3UCRA 2OTWB 4XC3L 4D0BB 1QTYT 2X7LA 1FAIL 4EI5D 1KEGH 2M8XA 3HC3L 4KJYA 1P7KA 3S34H 3VRIA 1G6RH 1K8DB 4HS8H 2AGJH 4E41B 1NUDA 3I75B 5TFSH 5B4MC 3K80A 3DV4A 5F1SA 3ZKQD 4UQ3A 1JPSH 3SE8L 1IARB 4PJDA 1AD9B 1WBZA 4U2YA 3FB8A 15C8H 3H9HB 3CCHB 4G6KL 4K7FB 1QRKA 3ZE2E 1PFCA 4IJ3B 4RCAA 2X1OA 2EH7H 2F19L 5IHUH 1UVQB 1E28B 4IOIB 4WGVB 1N8ZA 4DTGH 3TZVD 2BDNH 3S4SA 3DUUA 3OR7A 1MCWM 4IIQA 5FEBA 4LHUD 1MFEH 3GIVB 4Q9CA 4IEFB 4JPKL 1MCBA 1NEUA 3OG6B 3BUTA 3IKCB 4RZCA 4DVRH 2EE3A 1SYSB 4WTXA 1J05B 5F21B 4OCSH 1FG2A 4FNLH 1SY6A 2OR9H 3P4NA 4GQ9L 1OM3H 4MJIA 4PRBB 5JMOC 3KXFA 1C7TA 2C1OA 5I8CA 4I48B 4YK4B 3CPLA 1GH7A 1R3JA 3PP4H 1NFIB 4U1HA 3IJSB 2MQ3A 4P49A 1EEYA 4M03A 5DVOA 3AXLA 4S10A 5H37G 5FHAL 4ONGL 1XGRB 2G2RA 5TDPA 3GKWH 1D6VH 5SWZE 2AVGA 5I8EA 3QDMB 3GSVB 3U9PL 1OSZB 2VDRH 1OW0C 3OAUH 5I15H 4L5FL 1QOKA 2NX5B 3QDGD 4Z0XA 4HEME 4C4KT 4X5XB 4H88H 2WUCL 1HSAB 3KJ4B 4MD5A 3RL1A 3PNWB 3W9DB 5MENA 2VZOA 4NKMB 4A2MA 2GI7A 3PG2A 2YD8A 4V2CB 4XAWL 1S9VB 4MD4A 3HUJB 5EU7E 4QHUB 4BH8A 2AI0L 5CSGA 4EVNB 1A6ZA 4X99A 2CXGA 4H8WC 1VFAA 2AEQH 2PYFA 3GGWB 1D5MA 4OZ4B 4XVTL 2VXQL 1YEJH 5JIPA 5DD1H 4RMWA 4HK0B 4LCWE 1SJEA 4KK5D 4DGYL 4R3SB 1WICA 3MXVL 4CL7A 1FN4B 4U1LB 3V52H 1RZFH 5MEOA 3GRWA 1I7UA 2IF7A 2P8MB 3MRFA 5I66B 1BBDH 4HIIA 3C8HA 5J57B 2VWEE 2PTUA 5E2TH 3BGFC 3FOMA 3FQXA 3UO1H 4G80A 4L8BB 3CFJA 3DO7A 5T3ZL 5EOCJ 2VLME 5BS0A 3EYSL 3V6BR 4QLRA 5EN2B 3DUHA 2HRPL 4ZPTA 3I6LE 1W2KT 12E8L 4YHYC 5GRXG 1UB6A 1X5ZA 5FCSH 2Y06L 3IFPA 1HSAA 2G5BA 5DHXB 3VFWA 1CLCA 3R8QA 1A1MB 3VFPB 3F6LA 4Y16D 5B21A 3QXTA 3P4OB 1CLZL 1GIGH 1Y6NR 1HHKB 4HX1A 1FNAA 3OQ3B 4H8WH 1UQSB 4NO0D 5GS0D 3IU4H 3V0WH 3MRKA 2DQHH 1RK0B 4TSBL 1XF3B 3BMWA 1CR9H 4MJIB 5KANI 4BZ2H 3CJJA 5D1ZD 1OD9A 3VFNB 2NPLX 4QKXB 3BAEH 1J05A 4HSQA 1H3XA 2P8PB 2P7TB 2AQ3A 2C1PA 5IVXA 3E8UL 4Y16C 5F96L 3JV4A 5FM4A 3DBXA 1OTTD 1UH3A 4WTZA 1BQHA 4ZUSA 2ZSVA 2VWEC 4X6BB 1QEWB 2CLRA 4PFEA 2HKHL 3MV7E 4X6EB 4KHTH 4NJAH 5HGHA 4N5UA 3MLZH 2WAHA 3GHBH 3JTTA 3I02A 3A67H 3MRJA 5HVGB 5GZOC 3U0PB 1CG9A 1DUYA 4C56D 4M9PA 1T1XB 3NA4A 4PJ9D 4ZUVB 3FZUD 2OXGA 4PJHB 5I1KL 4GQPH 4O5LH 5BZWA 4DVBA 3C9NB 2AV7A 4D9QE 3I3EA 3VFPA 4WNQA 3SDDA 1OGAA 3VGAB 1T7XA 3UZQA 4DN3H 1P4IH 3OJMB 3HC0A 1T0MB 4ONFH 1AQKH 4MA7L 5DZNA 3FO1B 1JIBA 1LO4H 5A2FA 2PO6B 4OD3H 1A4KA 3BP6B 3RI5K 5CJOL 4KJPC 2HH0L 3BPCA 2OP4L 4XI5D 1S9KC 3IETB 4LLQA 5DJYB 2V5TA 3QIWB 1CE6B 4LPUA 3ARUA 4QXTA 3RDTD 4K94L 4OKVB 2WIIA 4W68A 1FN4A 4U1LA 1E4WH 1PKQB 3FONB 1QLFB 2FSEB 2AJUL 4M7LT 5BCAA 4MA8L 1SEQL 2X4TA 5TE4L 1ZT7B 5FM8A 3W2DL 2PTTB 1WAAE 1P4BL 4QRPA 3UJIH 4X7TB 1X3DA 4JR9L 1MH5B 2XPGA 1AD0A 1WK0A 5FYLE 3V6ZB 2MFNA 2OSLB 3LPFA 4JPVH 2CDGA 4MD5B 2ESVD 1CGXA 3HAEG 3L3OA 4F8QA 5T3ZH 1A6WL 1OL0A 3I6KB 1FH5L 3DROB 5DA4A 2XWTB 1XR9B 3Q0HA 1LO0L 4LASL 2ICEA 4FZEL 3GJEA 1MVUA 2AXGB 5CJXA 3MACH 1A22B 1JV5B 3ULVF 4MLIA 5DQ9B 1R5IB 3DX7A 3TFKC 4YGVA 2YPVL 5ITFB 2Q7YB 5JOFB 1IAIM 3U82B 4WW2F 1S8DB 1U8QB 3TJHC 1CICD 2Z8RA 4LIQL 3MLRH 2IPTL 5EG6C 1QR1B 5FK9B 4CBPA 3O2WH 4XAKD 5KS9B 4XP9H 1JGUL 3PWUA 5CHNA 5M94B 3MXWL 1F4AA 1I9IL 1ZANH 1F6AA 1HK6A 5GGSB 5C7XH 3QXDA 5MERA 1ACYL 3WO3B 3K2UL 3AAZA 1TENA 4BSJA 4M93B 3NIDF 5INDB 4GMTH 1A64A 2VDRL 4YDLC 4NFCA 5CGYD 4LSPL 4G8GB 3UROR 4UBDD 2NW2A 1HINL 2W0PA 4W81A 5ALBH 1OGAE 4OFDA 2DL9A 5FUOH 4EN3D 5IB1B 3GMMB 4HKBB 1A6PA 3FB8B 2A6JA 1DJSA 4FOMA 5EUOB 5IF0A 3BQUB 3QQ3A 4JFXA 1A6AB 4QO1A 4QTHB 4DGIL 1AGDB 5HI4D 5CWSA 3QUZD 5LQBL 2XWJB 3T3PF 4JQXA 4L8SA 3T65B 1YUHA 1ETZB 5E8PA 2QKIA 1V5JA 3ES6A 1K8DA 5MP6H 4OFYA 4ZUWB 4CN4A 3TH2T 5EULV 1K2DB 2P1YA 2X7LB 1DTUA 3L3DA 1XF2A 3QUYC 2MHAA 2R0LH 3QBTB 1S7RA 4ZPTB 2PW1B 2FBJH 1U3ZA 3UYRH 2I27N 3RUGA 1EBPA 1WCBA 1GOHA 5E4IA 3CFJB 4PREA 1YEHH 3A6CL 4OD3L 3UJJH 2GY5A 3FQXB 3QUXC 5D5ME 3U0TA 4M48H 1FVDA 1P4IL 1JWUA 1E0OB 1XIWB 4YDJB 3P30H 3T1FB 4P2QA 3VMOA 1JHKL 2O5YH 5DMYA 1RQ5A 1CD0A 1WWBX 1QSVA 1U8JB 2OBGA 2F5AL 1FO0B 5D7KE 4MD4B 3LEVL 3ZDZE 1RZJH 3MV9B 3U7YH 3L3OB 3QQ3B 4FMKA 4OZHE 1G7MB 4WU7A 4TQEH 4AY0A 1GZPA 3P77A 1Q9OB 4F9LA 4YO0A 5DO2D 4HXAL 3BP4A 3VFVA 1LEIB 2V2TA 4LRIC 2R23A 1A1NA 4GXUN 5IBTL 1HH6B 3DMMD 2XKUA 1KFAH 4IS6B 2CUIA 3RFZC 1RI8A 4ZAKB 3RWCA 3NIFE 1XMWA 3WCYA 3NGBC 2RFXA 3BP5A 3EJZC 1R3IL 2I9TA 2R4SH 1PKQA 4R7NA 2YK1H 1MHHA 1QBAA 1WTLA 4JJ5A 1WBXA 2Z0BA 4N0FB 4WFGE 1EEYB 2ZP0T 4OFVA 1CE6A 3VFRA 5L0QC 5IEHA 2IADA 3OV6A 4NN7B 4DKDC 3ILPB 4QHMB 3SY0B 3EOTL 2FECL 2BVYA 5F8QC 4F7MB 2IPKB 4S1SH 3CSPA 5HI4C 2H9GA 1AE6H 4XPGL 1MIML 4JHWL 5IESL 4QHKJ 3MRBA 5E00B 4HS3B 3O6KH 2BY1A 4ZSOB 5T3XD 3IS0X