5JXED

Human pd-1 ectodomain complexed with pembrolizumab fab
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
218
structure length
197
Chain Sequence
QVQLVQSGVEVKKPGASVKVSCKASGYTFTNYYMYWVRQAPGQGLEWMGGINPSNGGTNFNEKFKNRVTLTTDSSTTTAYMELKSLQFDDTAVYYCARRDYRFDMGFDYWGQGTTVTVSSASTKGPSVFPLAPLGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVTCNVDHKPSNTKVDKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 1
publication title Structural basis for blocking PD-1-mediated immune suppression by therapeutic antibody pembrolizumab.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 197
sequence length 218
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jxeD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jxeD01
3QIUD 3VFSA 3VW3L 3IU3A 2P45B 3OAUH 1MRFH 4QRSB 5KANI 1A7NH 3KYKL 1FYTB 1LDSA 3LKQB 1G7PA 3RVUD 4HAGA 2AXGA 1QFHA 4CADB 3U30B 3V2AR 2VSCA 1FZMB 4XNMA 4DJMA 1JYXA 1FE8L 1BGXH 5DRNB 4E5XA 1QA9A 1C1EH 2NX5B 4Z7OE 4BZ1H 2BVYA 3LS5L 4K7PL 2H26B 2VQ1A 5HHOD 2QBWA 4X5XB 3GBMH 3VRJA 2GQHA 2GCYA 1J8HA 4JRXD 3WFDH 1FSKB 4UNUA 4CBPA 1LP9E 4KKBC 5FHBH 2DLEA 3GJFB 5D5MA 2FEEL 5D7KD 3UROR 3L1OL 4TNWK 1YUHB 3W2DL 4EDXA 1WBZB 2HLAA 4NKOA 4HFWB 1HEZB 3WUZA 1BWWA 4NCC2 3FQNA 5FO7A 5AZ2L 4Y2DA 4X6BB 4HWZB 3MV7B 5TPWH 4XNQA 4Q2ZA 5A40E 1UT9A 3BUTA 2QSCH 5F9OH 3GMRA 2JJWA 4OLEA 1SEQL 4TOYL 5I15L 2YN3A 2CLVB 4JFYB 4D3CL 2V17H 5GRVK 4RCAA 5CD3A 4OQ1A 1MLCA 1P2CA 3DECA 3EOAB 4HJJL 4NQEE 2FHBA 1RZKH 2UWEB 2A6DA 2RBLA 3BGAA 2GITA 2Q8BL 1FC1A 2CRZA 3O6FA 4Y4KA 3V5DB 4EN3D 5J1AB 3MRMB 4ACPA 3TYFB 2YC1A 4AM0B 2CRIA 2VSDA 2H32H 2X89D 3SCMC 4FABH 3PNWA 1GL4B 5KSVB 1N7MH 5MEQB 4FNLH 4JFZL 4BUHA 2DQTH 4U2YA 1EUTA 1MLBB 2D03L 2ZKHH 3ZL4L 4QRRA 3QG6B 2EH8L 3O41B 4N8PA 5B3JE 5TDPA 1YPZB 5DYOB 3QEHA 4K23L 5C08B 3RKDD 3SKMA 4PLNC 3OB8A 1RFDL 1JNLH 1DUYB 3KPLB 3F5WB 3RAJH 3VFTA 1GZPA 1I7ZB 3GGWA 3HNSH 3NCCB 4Z8FL 4GRWB 5CD5C 5DQDH 4MDJA 3ILPA 4UV4L 4X6CE 4K3EL 3SDAC 2YPLB 2EICA 3U36B 5JOEA 5T1KB 2J8UF 1I1FA 1KJ2A 1X44A 2BVOA 2HVKB 2YUWA 3AREB 3MLSH 1F3JB 3KPRE 3RX5A 3QEGH 2APFA 3I2CL 2A6JA 4QGTA 4GG6B 1KIQB 1ZANL 3ARDD 4DFIA 1JBJA 2X40A 3QUYC 1MCRA 3NIGE 4N0CD 1OGAD 3TA3D 1LE5A 3MJ9A 3TJEH 4JQXC 4U1GB 1U8KB 5CZVL 5I1GL 2NY0D 4IOIA 4Y5XC 1KPRA 4N0YH 4UU9B 4PRHE 4J3SA 2PR4H 2F8OA 4O02L 3VXMA 2AJSL 2UZIH 1HHGB 4DEPB 2V2XB 2NY3C 1KFAH 3L5JA 5IQ9A 4G6MH 1U42A 4NQCD 2YD3A 3PDGA 35C8H 3NH7L 1AR2A 3EOBA 3SBWC 1VKXB 3ABZA 4CVZB 5K9OB 3NN8B 1KLGA 2CDEB 3H9HA 1AXSB 1GC1C 3VWKC 3UJIL 5EU4B 4M62L 3TBWB 1TCRB 3N1MC 2YXFA 3HUJE 3ARGB 3CC5B 3RY4A 2BSTA 2XTJD 4ODXA 1U8LB 3TIEB 1DVFA 3MRFA 4JQIL 3HNVL 3UTSD 1C12A 2GFBA 4BQ9A 5ICZA 2EDYA 5IQ7H 4IM8A 4BSVA 1NGQH 2X4OB 3DGCR 4XBEL 1U8HA 2Q86A 1ZHNA 4MXVE 3IFPB 5DWUH 4LCYB 5E1HB 4CMMB 2OJEB 2BSSB 5E6IB 2Z8SA 1AO7D 2A74A 4M1CD 4MGXA 2LAAA 4KV5E 2HTLC 3X12A 4DKEH 2MJWA 2HMIC 2NYYD 4KAQH 1MREH 1NBYB 1KIPA 4TVPH 3T1WA 4YHKH 5IV2A 2EDTA 3HZMA 4HIXL 3U7YL 2UZYB 4GS7B 4TNVF 5GRWA 4NNXB 1CFSA 4G9FA 4NOFA 1DEEB 4LNVA 3OKEA 5IR1B 4Y8DC 5CSGA 3DX8A 1HINH 5EC2A 2Y06L 2J8OA 1ZMYA 3D0VA 1TNMA 5BQ7B 3BHBB 1NCTA 4QOKB 2XKSA 1FH5L 4DWHA 1K8DA 1AE6L 1GCFA 4HUMB 3DWTA 5IBUG 1T0PB 1QLFA 5DJAA 4ZUVA 5ID1B 3PE9A 3P40A 3P9LB 4PIRF 3HKFA 3Q6GL 2C3XA 3T3PE 4U6XB 3HPJA 4XCYB 3DHMA 1Q9WB 3Q2CA 2B39A 2ZSVB 4PP1D 2VLKA 3BMVA 4U1NA 1YN6A 1L0QA 1CS6A 3G5YA 5D72H 4JJ5A 3OKLB 2P8PA 2W65A 1Y18B 4YUEH 4RDQF 3ULUD 4M9OA 5F1SA 4KVCH 2GJ6D 4I77H 3SJVE 5CIPH 1B0WA 4YDIH 3FCTB 2QSQA 4XPGH 1OARH 4D2NA 2NXZD 1UFUA 3UTTE 5C2BH 3MXVH 1RAMA 3TN0B 1SM3H 2B4CH 4OZFG 4P3CL 1CDJA 2CDFA 3QIUB 3BKJH 4L3AA 1XGRA 4Z0BH 3MRPA 3TJHD 4ODWB 4HBCL 5DUPH 1A9EB 2G75A 3UAJD 2CQVA 5FO8B 1WAAA 1P69B 1EO7A 4XC3L 4ZO8A 2HKFL 5E2JA 1OSZB 4YFDB 1KLFA 3DNKA 5DEZA 5C9KA 3D39E 5L6YL 3LKPB 1J1OL 5HHOB 1YMHB 5A2JH 1ORSA 5I1LA 3OKDA 4ZSOE 5E8NB 1R3JB 4X9BA 1MHEB 5HHNB 2O26U 4RISH 4PBWD 4J4PA 1E4KA 4F7PB 4JFOB 1EV2E 4JRXB 4NM4H 4BQ8A 1XIWC 5HYEA 1D5IH 3FT2A 5IKCB 4ODHH 3JSSA 3DROA 4LHUG 5D7IE 1INDL 1PZ5B 2OJZL 1NEZB 4HT1H 4LSSL 3MRIA 2YZ8A 3H9SD 4XRCA 4L4TE 4Z9KB 3PDDA 3AVEA 4PG9B 1DBML 4CVXB 3WSQL 5F93C 1CL7L 2I9TB 4OFYD 4CN1A 4OM1H 1XMWA 2GSIB 2R29H 3HI1B 1E27B 3NIFE 2DWDA 4WV1B 3L5XL 5D71H 3O6ML 2BNUB 1J05A 3WIIH 2XWTB 4XP9H 2BFVH 4K8RD 5CIPA 3MLUL 3UJTL 3EDFA 4UNTA 3O81A 3E6FB 5KSUB 4TNVK 3T77A 4M5YL 4EN3B 2GAZA 1VGEL 4HXBL 1K2DB 1YYLL 4PJ8D 1X5HA 3V79C 2XN9D 4FQIH 4G80B 1KCLA 1S9WA 1UEYA 5E2TL 5EIIB 1A7PH 1ITBB 3O6KL 4UIKH 4G7YL 4W70A 5HYSB 2WANA 2G60H 3HCVB 3BIBX 1WISA 4C58B 4DK6A 3QUXD 3ARBD 1BD2E 5B38B 4L9LB 1HQ4A 4HLZG 3BSZL 1Q72H 3WV0A 2Q87A 2FR4B 3LMJL 3EYOB 1IZJA 2UWEF 2P8MB 3KNBB 4R7NB 1LEGA 1I75A 4I4WB 2YMXL 3TH2T 4WIQA 4ERSL 5KS9F 4YK4B 4NC1E 2PO6D 4LKXA 4M7KL 4WFGD 1UVQB 1XF5A 3CCHA 1OPGH 2Q3AA 4S1QH 1UWGL 4ZDHB 4Z7WF 3P77A 4NC1C 3EO1A 1AQKL 3I75B 1Z6JT 3OB0K 2X70B 2EH7L 5IUSA 3OX8A 4JHAH 1EBAA 4Z77B 2EC9T 1ZWIA 5I18H 2G9HB 3ARDB 4JM2D 3OAUL 2EE3A 4LEXL 3LSOB 1A7NL 5F7LB 4AEFA 5ACLA 4K71B 2K9UA 1OGAB 3BP6B 5F7KC 3TA3B 1SYVB 3STZA 1HDMB 2UZXB 5FOJA 3ZMRA 4RFOL 4LSQL 3KPPA 3P9MB 4PV8B 3F7YB 4F7CB 4CRPA 1LVEA 4ENEC 4K94L 4OIIL 3PP3H 3VXOA 1CGVA 3U83A 2CUIA 4LSRH 1NAMB 2Q7YA 4CMHB 1ZHBB 1SJHB 2EC9U 4OF6A 3HLAA 1T3FB 2AXJA 2ICWA 1S9VA 3CFCH 3MRGB 3MJ8A 4I48A 5DMIH 1LMKA 3INUH 3ZYZA 3ULSB 5LXGL 3GKWL 4NQCB 3TV3L 4H1LH 3GBML 3BE1L 3WFDL 1EH9A 1RU9L 3MFGB 4G5ZL 2QHRH 4KQ3H 1BX2B 3TZVC 4FA8A 3AS1A 1K4CA 2VDQL 1V7NH 4HHAB 5I71C 3RVXD 5DEFB 3DX7B 2XTJB 1UXSB 1I9RH 3HE6C 3QNZA 2YR3A 5EZJB 3LIZL 3TEUA 2FSEB 1YEDB 3UTSB 5DJXA 1MI5E 4D9QE 4YDVB 2ZUUA 4PUBL 2QSCL 5F9OL 1ZT4B 1A7BA 1HCVA 1BVKB 3H6JA 5TFSH 4RFEA 3SO3B 4UAOC 1GGYA 1CFVL 4JY4A 4KK8C 2DWEB 3PIQA 2V5TA 4ZO6A 1MRDH 1LP9A 5EORL 5D1ZC 4RGMB 4N8CH 5L8JB 1KT2B 2HJFA 2VQUA 5LGJB 1AO7B 3AXLB 3BUYB 4NZDA 5DO2D 4W4OC 1S5IL 3QWRD 2PKDA 1MOEA 2FX9H 5FUOL 1NMCC 5F7HA 4WVRA 1KYOJ 3P4OA 3DTXA 2B5IB 4C4KO 4OZHB 1EK3A 1I8LA 5K9KA 4PJEE 1DSFH 4FABL 5E24E 2CD0A 3IFOB 2PTTB 1DN0A 4UT9L 1UZ6F 1HNGA 3FQTB 2FO4B 1KCUL 4NQEA 1OF2A 1S9XA 2VJXA 1ZAGA 1UJ3A 4P5KA 4HWNA 3BP5B 1FO0A 5ILTH 1P4LA 1U3YA 1F58H 3NBNA 5ICYA 3MACH 4POUB 4LCCB 3QQ9D 4GRLA 5GGTH 1RJYA 2R2CA 4YEEA 3S96A 5CINH 2C3GA 3TFKD 2VAAB 3ALPA 1MFBH 4ODBD 3MYJB 4BA8A 3RAJL 3MTRA 1JNHB 2ZJSH 2N7BA 2PCPA 2CK0H 3LKSA 1F2XK 3CVIH 4ZO7A 4P49A 5C0RL 3C09B 2GJ6B 1OGTB 2PW1A 5BRZD 4HPOL 1KXVC 5EUKA 4XAWL 1UB6B 5DMJB 1NCCH 2NXZB 1YZZA 3SN6N 3D5OF 2BNRA 1F4YH 4K2UH 2ICEA 4XH2B 4S10A 3TPUB 3CH1B 3CGTA 2VDPH 1PY4A 2AEQL 5HPMB 3MBXH 4QKXB 4DN3L 5SWZA 1HXMB 3V4VL 1F6LL 1CGUA 3RL2A 3FTGA 4X6CA 2PR4L 3OL2A 4PJFF 4ETYA 1HIML 4GKSA 3QZWG 1YMMA 5C09E 3SE9L 5IVZA 3RIAK 2JIXD 3KPRA 2RFXA 4AG4L 3IDMB 3CFDB 1HYSD 4JZOA 3KPOB 4I9WD 4JQXA 4AMKH 3L6FB 1P84J 1WFOA 1JN6A 2HJLB 3TBYB 4Y5XA 4K7FA 5E9DE 1QFOA 5EPMA 2DIAA 3MRDB 1BEYH 4M3KB 1C16A 5IHZB 1RY7B 3C5ZA 4PRHA 4XP5L 5GISL 1RUKH 2IH1A 1FYHB 3ZZ1A 1BZ7B 3K8LA 4J4PD 4P2QE 2A0LC 3D85A 1JGEB 4PRDB 4WWID 3IFLH 4YQXL 5K9QG 4N90E 1G84A 1NGQL 3N1QC 4X8JA 5IMLA 4KUZL 1ERNA 5GGVY 3IKKA 3PQYE 4XMLL 3QWOB 4GUPA 5ESVB 4PYHA 1CU4H 1VDGA 3GI8H 4Y16D 2K7PA 4MA1B 3PWUA 3TGXA 3DX6A 3HUJA 5I66B 4KAQL 5CFHA 3GM8A 4FS0A 5DUBA 4YDKL 4CDGC 4XHJC 5EOTB 3OR7A 1FJ1B 3T2QA 4QHUB 4NUGL 3UBXG 4OZIF 4HZAA 4PJ8B 4HQQL 5M95B 2XN9B 1Z3GL 3SDCC 3QFDA 5D7SH 5JQ6L 4HC1H 3AGVA 3MREA 1FFNB 3EOTH 1NGZB 1CDBA 3QUXB 3ARBB 1YEFL 1IL1A 5IB4A 3WXWH 4OLUL 1V3MA 4LEOB 5HI3D 4QXTB 4K94C 2NY1D 4OTXH 2OR8A 3ARYA 3D2UD 4W6YB 4N1EA 3ZDZF 1ZLSH 2VLMD 4BFBD 1OAYL 1JWSA 1Z5LA 3KPMA 4P2YA 2NXYD 2DMBA 2EDWA 1FLTX 4UDTB 5JXAH 1UKQA 1XZ0B 1NSNH 5FK9A 2PO6B 5DZOA 1FFOA 4JRYE 3NVQA 4K9EH 3ULVH 3HE7C 1AGBA 4KJQC 2P4AB 2IGFL 5I19L 1T6WA 4XPGL 1CFQB 3O3AB 3MXVL 3T0BA 3BRFA 3CLEH 4JY6A 3IXAA 4Z0BL 4NO5A 4JM2B 3VXPB 3QDJD 1A1NB 1J0IA 1NBVH 1PD6A 1QZ1A 3MRRA 3HAEA 1EJOL 5E08H 3Q0HA 3B5TA 1VGKA 4M6MH 2ADIA 4GKOA 1G7HB 4YHPA 1RZFH 2VLLB 4WEBH 5FYKH 3SJVA 5C6TL 3QIBB 2DQDH 3VFVB 2DQHL 4XCEB 3UTTA 2XYCA 1IGYA 4PLJC 1KN2L 5JPNB 4J3OC 3T0ED 5FCSH 4WCYL 5JIHA 1E6OL 1D5BA 4RISL 2VZVA 1PEZA 2EDKA 1IC1A 1I8IB 1U58B 5CEXB 4G6AD 1IAIM 2YHGA 4M61B 2DKUA 2X4SA 5F9WC 5EBLA 4JZJB 4NM4L 2ZOLB 3IJHB 3QQ3A 4F9PC 1KPVB 1KG0B 3QEUB 3STBA 3M17B 4FQCL 4F2MB 1R3KB 3O0RL 2A77L 5BOZG 4Y89A 1YA5A 3MRCB 4AY0A 3X13A 2E9WA 5E8OA 4DUXA 3D39A 4LSPH 1CR9H 3BH9B 2NLJA 4KKLD 1O5DT 3FFDB 4ZSOA 4LCWE 3ETBF 2WIIA 1XIWA 2WWKT 3KHOA 3QP3A 4PJAE 1RHHA 4I2XE 1U8OB 2NNAA 3RL1B 3SEPA 5BVJA 1KV3A 4L8DA 4OBSA 3EFDL 3WDIA 4D0DB 4FQXA 3K0WA 4PJGB 5D7IA 3HPLB 3WIIL 1PX3A 1IMHC 3T3ME 2P5EE 1X4YA 4N8VB 3MLRL 1EGJH 3ES6B 2X4QA 2D0HA 4KKBD 3EDEA 1RUAL 4ZD3H 4L4TA 1I8MB 2ICWJ 4O2EB 1CTNA 5HI4D 1ZA6B 4YGAB 5HDBF 3ZKNC 4NP4L 5T1MB 1QR1A 4FQIL 3T65A 2HJKA 1AQDA 3F7RA 3OV6A 3VFMA 1AP2A 3G5VB 5DHYA 1OTTC 3A0OA 4NIKB 2WAHA 4MNHB 2ADGA 4UBDC 3QUMB 3FOMA 2NZIA 3MJ7A 1XR8B 1OLZA 3UO1L 4YC2B 1T21A 3NGBC 2GYSA 1DBJL 1AFVH 3BIKA 2X1WL 1YQVH 4FXLA 5KZCD 1I1AC 3K3QA 4I0PB 2NY5H 2APVA 1OPGL 1EIBA 1HQRA 2QSTA 4U1LA 2BY0A 3V8CA 1NMAL 4JN1L 3SCMD 2BC4A 1NGWA 1BIIA 1BD2A 1XF3B 4RX4A 2VDMH 3MGOA 5AWNH 4P5MA 4X99B 3JTSB 1I7TB 3QXAB 5I18L 4QHKI 4OGYH 5DRWA 3DVGB 3QPXH 4OCNC 4LRNL 2B0SH 1NL0L 1EEYB 5JOPE 2EYRA 3JUZA 4HJ0D 1N59B 2GK0A 2V9TA 2NW2B 2HT4C 5HYQA 2JIXB 1TXKA 4H20H 5KW9L 1EGJA 4YZFF 5CD5D 2F8XC 3SDDC 4JY5H 4NNPL 3SDAD 5IB1B 3H3BC 5DFWH 1VFBB 2DQIH 1MJUH 1QFWH 3QCUH 5HY9A 3WEXA 3EGSB 1F11A 4F7EA 1MAKA 2Y07H 3QUYD 1ORQA 1EBPA 1H3PH 3BIAX 4JEGB 4U6VL 1DTUA 4GLRI 4M02A 3BPNC 5JA8B 1MFEH 4X9FA 1AD0A 5C0BD 4LPUA 1FIEA 2XWBB 3BWAA 3S4SG 4LLYB 2WQRA 4WHTA 3HB3C 1I9RL 2FATH 1TZIB 2C1PB 3FT3B 3VXRE 4DGVH 5CKGA 2EECA 1QVOB 3UEZA 3UTOA 3MBEC 4CN4A 5L2KE 3VGEA 1TLKA 5K33A 1A6WH 2XACC 3S34H 5CLWA 3DV4A 4JFXB 2NY3D 4NZUH 5D8JL 2QHLA 4WI7A 5FOBB 1U93A 4Y16B 5EO0B 3TIDB 5J06A 3D85D 1PLGH 3LAFA 3HE6A 3M45A 2BY2A 3S3SA 1XGYH 3AS2A 3CLFL 5HHXH 3CVHH 15C8L 2IALA 1PBYA 5IM7B 3VWKD 4PGDA 3OG4B 2G2RA 2Z35A 1R3LA 3L3GB 1FVDB 3HRZB 1HHHA 5H35B 4NKDB 3HR6A 2BSED 5JHDE 3V4UL 1SY6H 1OAQL 2AJ3B 3ZTJG 2COQA 4LDEB 2OI9C 5GJTH 4W4OA 1JYNA 3BO8A 3BP7A 5JO5A 4DTGH 1DQQA 4FQ2H 3NCJL 5D5MF 1CBVH 4HMEA 5DMGC 3KJ4C 3PWPD 2MQ0A 4RNRA 2EDOA 4LU5H 5I6XC 2WMPA 1M71A 2OP4H 4PGCA 2NY1B 3MACL 1T83C 2H9GA 3D2UB 2VABA 4NBYB 5GGRB 5GGTL 4MNQE 3B9KD 4PJEA 1LEKA 1ETZB 2NXYB 4KDVA 1W2KT 2AJXH 1U91B 3SPVB 4G8GD 2Z9TA 1T03H 3ELAT 1WCQA 4YHYB 5CP7B 1D5XB 4XTRD 3J8F7 4BH7A 2F58H 5IVNA 1FNLA 4LRIC 2F5BL 3QUZA 3S35X 1NCCL 4LSTL 2W0FA 3HZYA 1T20A 3CDGB 3RZWA 4YBLC 3QDJB 2A9NH 3RWCB 3MBXL 2O5ZH 2BK8A 3JWNC 4E0RB 3HN3A 2APWA 3LEVH 3SGKC 1ZGLB 1X7QB 1HH9B 1UXWA 4HIHB 3RIFF 1ZLUH 2FLBT 5INDB 4LSDA 4ZTPH 2ZOKA 5CCKL 1KTRL 4NN7B 2DN7A 5SWQB 1ES0A 4Y0GA 3T0EB 1SJEB 3B3IA 3X3GH 3L7FA 3B2UC 1L0XA 4WU7A 5GGVH 3P30H 1SY6A 3EAKA 3BRGC 5DLML 4LP4A 1RIUH 3VWJC 4Z5RB 4NT6B 5B8CA 3VG9C 2W60B 3A67L 3HHRB 3HTLX 5C09A 4I5BA 4IEFB 3FFCA 3S5LB 3UPRB 2ITCB 1NCWL 3H9ZA 5DF0A 4ZUWB 4PLKC 3U7AA 4RGNB 2DICA 5JMRA 2R15A 1VFAB 4QT5B 1RUQH 5E9DA 5HGBB 1KXQE 4R0LA 4DKDC 1DBKH 4H25B 4PG2C 5IROC 2VOTA 3OKNB 2EEDA 4M6NL 2DQGL 3U2SB 4C83B 4I3RL 4P9ML 2Z93A 2QQNL 2RR3A 1S8DB 2WINA 4PJ5B 3ARFC 1G6RH 3TH4T 4YLQT 3ZYOA 3K4ZA 4P2QA 1JPTH 5I2IA 3MJ6A 2J3SA 3D9AH 3MV8D 4OLVH 1MCIA 4JFFE 4DCQA 1S78C 3LEXB 4UINH 1A6PA 4LASH 3BDBA 4E41E 2C1OA 2QQLH 3CFIC 5I1CH 1OOAA 4OLWH 3LS4H 4HUXA 5F3HA 5C71A 3QULB 1N0XH 3QXTA 4PY7B 1ODAA 3G5ZA 4L4TD 5LAXB 1KEMH 4LGPB 4OZFA 3LEYH 1L9NA 3WXWL 1RZIA 4EVNA 1F5WA 3G04B 1I3GH 5F6IC 2GTWA 4OTXL 2N56A 2JJTA 3SDCA 2XZCH 1EFXD 4YHIA 1N5AA 4IDJH 5KZCB 2NY4C 4MA7L 4O00A 4OI8A 5K59F 5SWSE 3J7HA 3MUJA 3DURB 3D3VB 4HLZH 2I9LB 2AABL 2BMKA 3SCMB 3LY6A 5GJSH 3FO9A 2QKIA 3JTTA 4H8WL 3R1GL 3WCYA 1JF1A 5DHXB 1JCKA 1KNOA 2R69L 5FM4A 1TVBB 4M7ZC 1A6TA 3W0WE 1XGPB 4X80L 3QHZH 3TBSA 4RDQG 4MZ2A 4WFHD 1QYGL 4KU1A 1WWCA 5EOQL 3HE7A 4G9DB 4LLQB 3MV01 2X1OA 4PJ9C 5BV7C 4RX4D 4JRYA 1E4WH 3RIFK 4G8EA 3SGEI 4QXGL 5DZNA 3MLTA 2MMXA 4HPYH 1DLFL 1HILB 4ODTL 3UPAA 1FDLH 1EO8H 1N8ZB 3K2MC 3OJMB 2ZWLT 3GHEL 3GSNL 3NFPA 3IDJA 5D2LE 4J1UB 4M93B 3BGFC 3SDAB 3LCYA 4PS4L 5TDOA 1UH2A 5E95B 5IWLC 5CWSB 1NANH 2Q1EA 5KG9B 5J9PB 4KY1H 2DKSA 1Z2KA 2IPTL 4Y1AD 3QUYB 1JPFB 3QPQC 1H5BA 2VXQH 3VH8G 4HFUL 1PYWB 1CICA 1MVUB 4U6HB 4JPWH 1G9ML 3VRLE 4JCMA 5C0BB 3MOAL 1T2XA 3HG1B 5EC1A 2NY2C 4LSPL 4ODVH 1IC7H 5FYJU 2Q76B 4X5WB 3SGDH 3OWEA 1TVHB 2VN4A 4QWWC 3MO1A 3WLBB 4WW2B 1ZS8B 4P4KC 4BKLA 1OD9A 4GMTH 3WFBL 2GTZA 5D9SB 3RNQB 3GIZH 2JB6B 4M1DH 5E2WH 5DK0A 1JZ5A 3BEWA 4LQ1A 2NY3B 5F1IB 1UKTA 1LDPH 1V8HA 2ZCHH 5AD0B 4JREC 2FJGA 1IFHH 1WAAF 5D93C 4FFYH 4L29B 3GNMH 5HYJD 3N9GL 5DJ6A 2C3VA 3LZFH 2R4RL 1KYOK 5JHLH 4YFLI 4HX1B 3VWKB 5LQBH 3TZVD 2D0GA 2HWZH 3EW3B 4LLUB 1RZ8A 1J0HA 3EZJB 1D9KC 4FHBD 1KEGH 4LCWA 3C8KA 3QB7C 32C2A 1FN4B 3S98A 1U8NA 5DRZA 2IADA 1FG2B 4PJAA 1B0RB 4I2XA 1M7IA 1DL7H 2OXGA 3REWB 1I3RA 3UC0L 3C6LC 4RA0C 1X4XA 5MP6H 4DGIH 3PDOA 1HHJA 4U1JB 2YRPA 3Q1SL 4MS8C 3VXSD 5BO1L 2P5EA 1MI5D 2XZZA 3PWPB 4NM8H 4D9QD 4KK8D 1G7IA 3QQ4A 4XPFL 1FL3A 1RK1A 5D1ZD 2CLRA 5I8KH 5EBMB 3U46B 4R26H 1BLNA 1VADB 4APQC 1OCWL 4HS8L 3B9KB 1RZGB 4HCRH 2FD6H 4G3YL 1JTTA 4WI3A 3RVTC 4NQVA 5FF6A 2XQYG 3IJYB 4JN2A 1TPXC 5DJDB 1M6OA 4G8GB 5J1TC 2DAVA 3S35L 4G42A 3A6BH 3F6LA 2QQQA 5D7LD 3U0PB 2D4FA 2VDML 4XHQA 2H8PB 4W68A 5TE6H 5BVPL 4JGMA 1BF8A 2B20A 3CFKB 3LHPL 1I1AA 4U1HB 5T3XL 1U0QA 2AERT 1P4IH 5HVFB 2PTVA 4GLRH 4N5EC 3GSOA 4WDIA 1EA9C 1A1MB 3GMQB 2I60H 5KAQG 5TF1H 4HWEH 2ZUYA 4XNXL 2MHAB 4U0RC 3BDYH 4WO4A 5DD1H 1LO2H 1U2HA 1PAMA 5JA9A 4H20L 3DX9A 5EO9A 4RWYL 1P84K 3MODL 5K9JH 3NACH 3W39A 4R4NC 4JY5L 3NFSH 1BECA 5EWIH 43C9B 2DQIL 1BHGA 1MJUL 1MH5B 4KFZC 4JFDD 1QRNE 1CXKA 4L3EE 2XZQH 5HHVH 2SEBB 1UA6H 4OCXH 2F19H 4BSWB 1A6AA 2BVEA 1MAJA 2IPUG 1UM4H 4OI7A 3SDDA 4AEEA 2JLLA 4JM4H 3R8BB 2J12B 2HFGH 4XP6H 1GSMA 2UY7A 4FG6C 4QRUA 1JWMA 1KB5B 3TPKA 1J1XL 1A6WL 2ZUSA 4ZODA 5EZOH 3LKNA 3MGTA 3QHTC 4YO0B 3U6RA 5FHAL 4X6DB 4QHMA 4A2LA 5HGDB 3BQUC 1XGYL 4KXZI 4N68A 1JGLH 1GGBL 5MEND 4Z76A 4Z0XA 2I07B 1MWAH 3VXRA 1E4XI 1T5WA 3MV8B 1VHPA 3ZLQC 3DI2B 4IIQA 4HWBH 2Y23A 3FB6A 4H8WC 2DMKA 1HYRC 3NTCL 2A0LD 5GGQL 5DD6B 2ZG2A 2OK0L 1UACL 4NZRL 3T4AB 5CP3H 3WBDA 4EI6B 1T1XB 3V95A 1LO3H 2P7TB 4GW5B 4PJBE 1CBVL 1KJ3H 2X4UA 3QDGE 1ZEAL 3EYSH 2X4RB 3KS0H 5CHNB 1QSEB 3TVMD 4Z7OF 2O5YL 2OP4L 5SV4A 3G6JB 2BOCB 5IHUH 4ZXBD 2BVQB 3FN3A 3PQYD 4ORGA 1EFXB 1HCFX 4M6OL 4WW1B 1A7RL 3IRZA 4KZEL 3ARUA 5JHDA 4PJIE 3DVFA 5DR5H 2PYED 4HS6B 2B1AL 3KLAA 4MQXC 4GBXC 3HI5L 2P24A 3C2AL 3QZWA 3GSUA 3T2NH 1LP9F 2NTFB 4PD4K 4ZFFB 2F58L 1LEIA 1BOGA 1MF2H 4R4BB 3BZEB 1IAOB 4P0DA 5IMMA 4XBPB 3N1FC 3TBVB 4I0CC 5IVXB 4F7TA 2QADC 3KYOB 1WCBA 3TBTA 1G9MC 5IOPA 4MNQA 2GSGA 4WHCA 1FZOB 5JUEL 3O2VH 2A9ML 4WFFE 3V6FA 4OJFL 1I9IL 4XGZB 4UQ2B 1U6AH 2CPCA 1MRCH 2ESVB 2X42A 5J6HB 3IDUA 3IDGA 4JDTH 1S7XB 1T7XA 3GK8H 3MYZA 3K1KC 1S7WB 3SOBL 1U8JA 2W1NA 1IEAB 4IS6A 3BPCB 5DVMA 3HE7D 1WBXB 4OFKA 5FYJL 3TP4A 5CGMA 3V4PL 1KJVA 1YYMH 2ZPKH 3FRUA 4JRYD 2DQUH 3CPLA 3SGKA 4PTTB 2ADFH 5GGVL 1RI8A 3O8XA 3O2WL 5DHVA 4LF3A 3V5KA 1IGML 5A2IH 2HA1A 1BIHA 4Y1AB 4NQDD 4YXHL 3VXUD 5CP3A 2V6HA 3BWUC 6CGTA 2ZCKL 1VB9A 1PFCA 4WUUD 3MUGA 5DJ2A 4FP8H 4ZFGL 4AYFA 4Z7UE 3LV3B 5FKAB 1DBBH 4O9HL 2J5LB 3GJEA 3P4MA 1N6UA 1XGQA 1KENH 4HIEB 3SDXB 3U1SL 5B3JF 5CJOL 5E4EB 5TQ2H 4PLJD 3KPQA 4U6YA 1MVFA 1RQ5A 2ITDA 4X7TB 1DBKL 4N0FA 3UZVB 5F96L 4P46C 2FDBP 5HYJB 4X6CF 4YPGA 3B2VL 1INEH 4XVJL 1CGYA 2Z8VC 5A16A 3TZVB 2EDLA 1ADQH 1OAUL 5T3XE 4PJHE 5IEKA 1FNFA 5IROA 3NIGF 4NZTL 4TSCL 1MAMH 1VPOH 2YBRA 5EOCH 5BW7C 4QRPD 3R06A 1JZ2A 1ZLWH 3BEVB 3B43A 3D25A 1N6VA 3AAZB 2A1WL 3ARFA 3VXSB 4P2RD 3T4YB 2WLYA 2ZNWA 3D0LB 3ZDYE 4UAOB 1NEZG 3HNTH 2MPAL 1YDPA 4K3JH 4PGEA 5D1ZB 5GS3A 3PGDA 1FGNH 2OCFD 4JFFA 4GMSL 4LARH 1EERB 3UTZB 1R5VB 4KPHH 4K3DL 3WIHH 3TYGH 3W11C 1K6QH 1WIUA 4E41A 1IAMA 4LLVB 3MQIA 1Y6NR 2D7MA 4QCIA 2YPVL 1L0YA 3QCVL 4WTXA 1AXTH 1T22A 5EA0L 2E7HA 4HIIA 4HKBB 2R2EA 3ZKND 2X1PA 4K3GA 5FKPB 4NRXA 4F80A 1I9JL 4AH2A 1A5FH 4ZUTB 1MJJA 5D7LB 3WFEL 1NCDH 3OAYH 1MCLA 4FQHB 1DBAL 4UOJA 3RI5K 1OTTD 3UTQA 3HUJF 7CGTA 5TE7L 2J88H 3WD5H 1CE1L 1FYTE 2Z31C 4UBDD 2D31A 1YEGH 3MA9H 3CXHJ 3IDYB 5HYFA 1D5ZB 2QLVB 4MXVF 3TCXA 5SWSA 3U30C 3O3DA 4PJDA 2OQJB 4GKNA 2NX5E 3VFOB 2HTKD 5HYSG 5IBTL 4RMTA 1CGTA 2NY6C 3PP3K 1I1AD 4ONGL 5DK2B 1T0NB 4UIMB 5B38G 5T1LA 2Y1VA 1HKLL 4KV5F 1LK3H 4R90L 5IT2H 2DQFA 4ZUSB 3EO9L 1DLHB 2R0ZH 3IKCA 2D7TL 3QH3A 4JDZB 5FDWB 2Z92A 3W0WA 3C5JA 1VACA 3VFUA 3KR3H 1LO0H 1S7RA 2OZ4H 5E8PA 4JFDB 1ZE3C 43CAB 5L7XH 1QO3B 1QTYT 4MYWB 4RZCB 3ARVA 1FSKC 4C4KT 1CT8B 2VXQL 3BXNB 3RWJB 1NDGA 1IAKB 3MV7E 2FBJH 1W72H 2ICES 3NFNB 3RWDB 4PBXA 5IWLA 3E8UH 4CL7A 3L3IA 3MRNA 4YHZL 4HUWA 1NLDH 2FEDD 1HSBA 3BT2H 4DVBA 3T3PF 5JOPD 3JV6A 1MHPH 4QHNA 4PR5B 3VCLA 3GSWA 1LDPL 2ZCHL 4PY8I 4I18C 5IFHL 5IW1B 5F3BA 1BBDH 1IFHL 5E8EA 2CUHA 3HC3L 3PGCA 4NBZB 2IPKB 3OGOE 1JMZA 1OTSD 2AEPL 5MENB 1MJ8L 5FYLE 4XP1H 3MCG1 4HKJA 1CLYH 4P4KA 3RWIB 2HWZL 4YR6B 1TENA 3KLDA 4S11A 5D7JD 5DS8B 3RY5A 3QUKA 3T0AA 2R0KL 5CSBA 3NIDE 2YSSB 1GPOH 5C0GB 3MOBL 5IESL 3MBED 5GRXG 5C0NC 1FZJB 4AIOA 3RDTD 2FWOB 4OCYH 4Y2DB 1J5OL 3S36H 1MHHB 3PHQB 3G6AB 5I75C 3MNVA 4X0KB 3MNZA 1AGEA 3MC0A 1X5LA 1NLBL 4FZEL 5L2KD 3LQAL 3TVMB 1GGIH 4WJ5B 1EO5A 5A1AA 1YPZE 4ZXBB 1AGCB 4NO2B 3PQYB 5C08E 1RIVL 3IDIB 5HD8C 1CDYA 5F1NB 5IF0B 4G8IB 4HK0B 3U82B 5EBGA 3C6LA 4YGVA 2EKSA 5CJXA 2QTEA 2PYEB 2XWJA 4GRWE 4OD2A 4HSQA 1IAIH 4L8SA 4OD3H 4LAQL 1IKFH 3WFZA 4KI5E 5C0DB 2Q8AH 3QSKB 3KLHC 1DP0A 1RZ7H 5BCAA 4Q6IA 1A1OA 2VISA 5D7IF 5JIKA 4GG6E 1WZMA 5IMKA 2BRRL 4KI5C 4TSAH 2YKLL 3AREC 5DQJB 3N85H 4WU5B 1W72A 3F62A 5T3ZH 4U1SA 4NYLB 2WQ8A 4U3XA 3WIFA 4MCZB 1R5WB 1IRAY 1B2WL 5ENWB 4LNRA 3CAFA 2VB5A 3CX5J 5KVDH 5EUOB 3KXFA 1NBZA 2FYYA 1YNLH 1UYWH 2LQRA 1PQZA 1G7QA 1FV1A 3NIFF 5FM5O 5DUMH 3S4SA 4EUPH 1OB1B 4NKIL 2B2XH 2FNBA 5AUMB 4EBQH 5DD1L 1IE5A 5E2VL 3N0PB 2GT9B 4DEPC 4LIQH 3RWEB 3FQXA 1OM3L 3BVNB 4LLWA 3GMNA 1ACYL 4XPAL 2FCBA 1A9BA 4WNQA 1TTUA 5DD5L 4MNGE 4XC1H 1TJGH 5JQHC 2F19L 4ONOA 3PWVA 4QF1A 4TPRH 4NQDB 4Q0XH 3VXUB 3CK0H 1RHFA 1LO5A 4JLRA 4WUUB 3STLA 3U48A 3ARGC 2XKNA 1B3JA 1ZKAA 4YHNA 4A6YL 1LE5B 5F70A 4I0KA 1IM9D 3FMGL 3U4EA 2J6EL 2WUBH 4QRTB 2A73B 4HS3A 1ZLVH 1A21A 4MAYC 4TTDC 5C0AD 5EZOL 1QRNA 2FZ3A 3D18A 3NZHL 2FX8L 1U3HC 4L3EA 1JGUL 4WY7H 3DO3A 1R24B 3SKNB 1FAIL 5E6IC 4KHTL 1U3ZA 2A6KA 1RZJL 2CIKA 3BN9C 4P3DA 5F9WB 1QBMH 4OAWA 3E0GA 3VGDA 1ZSDB 4LCIL 1AKJD 3VWJD 3MMEB 3ALXA 2H32B 4QO1A 1G7JB 5KTEH 4HWBL 1P1ZA 1A3LH 3HA0A 3TO4D 5A2FA 3IJSB 5FECB 1IJ9A 4W6WB 5FDYA 4CN6A 3X11A 5D2NC 4AT6B 2DTMH 4QOKE 3KPSB 4BELD 2CRMA 3BQUA 4QRPB 4KZDH 2R1WB 4X7EC 1NGYB 5E00A 2A38A 1LO3L 3CSPA 4P2RB 1FVEB 4TYUA 4PRAA 1AY1H 4JZNB 4OM0H 2BSRA 3IAQA 2VL4A 5J12B 4R97B 3S36X 2Q6WB 4F8QA 1KTDA 4AEHH 3FQRA 4MJ2A 2VC2L 5DRXA 4AQ1B 3KPTA 5EZIH 2W9EL 2VXUH 4XCCH 1YY8B 4MD0A 2DLTA 2J4WH 4HUUA 3RU8H 2V2WB 1FFRA 2Y5TA 1F45A 5JW5B 3LB6D 2ENYA 1PVHA 2FL5B 4IOFD 2X9XA 4PJBA 3QDGA 4JFFD 1JWUA 1IQWH 1Q9OA 1CD8A 1C08A 3VJ6B 2EXWD 3SDYL 3VXNB 5L8LB 4DGYH 4S2SB 4YWGH 4E41D 5HHQB 4AENA 3ECBB 3QIUC 3GSNA 3TO2B 1IM3A 5HHPB 1CGXA 4GBXA 2F74A 1YEJL 3GUTB 1KXTB 3K2UL 4DAGL 3V7AG 3CUPA 2QSVA 3IFNH 4PJIA 4UI2A 4UUJA 1FORL 1YNTB 4OKVB 2LU3A 2KQNA 1MRCL 1NMBH 1Y0LB 3X14A 1G9NH 5DQ9B 5I74B 4RMVA 1JI1A 5I1AA 2NY4D 4FQJL 1HXYA 3EDDA 4TULL 4MZ3A 2DLGA 3OGCA 5KVGL 4XWGH 5HHOE 4X6EB 1KSRA 4HUVA 2EDFA 1BFVL 1UENA 4PFEA 1J88A 4M8QA 2D2OA 2EE6A 4EOWL 2AV1A 4JRXE 4MMXC 4O2CB 3QIWD 5ACZB 5D7KE 1BQHB 1ZHKB 2MKWA 3DBXA 4O5LL 4R96B 3WHXB 5J0BA 2OL3A 3NA9H 2FB4L 1I8KA 4XNUL 2VE6A 4PJ9D 1XGRB 3DLQR 3PJSB 4JAMB 4FP8L 5T1DL 1MQKH 1A0QH 3WFHA 9CGTA 1AD9A 3HZVA 3REVB 1MUJB 3SO5A 5J8OA 4RGOL 3GSXA 4MA3A 1FLRH 1XF2A 1B0GA 3LQAC 3RZCA 2PXYB 4PJ7B 5IW6B 4PB0L 1X5ZA 2F54D 1S5HB 2EEAA 3FB7A 3FB8A 4X4YB 1UCBH 2XT1B 4WV1C 1C7SA 1ORSB 25C8L 1LO4H 2P5WD 4NDMB 2IFFL 4Z7UA 4Q74A 3QPQD 4P2CG 4PRPD 1HHIB 4MB4A 2ENSA 5ERWA 5SX5H 1GOFA 4X9IA 4U7SA 4N5UA 2VDKH 4RBPH 5D7JB 4CW1B 5DC4B 3O11B 4KMTH 2FGWH 5IEHA 2MSPA 2NY2D 4RAUB 1JHTB 5E1AB 4P46A 4NUJA 1M4KA 1KUMA 5E4IA 5MEPA 2AJYL 5F7DB 3L3KB 4QWWD 2OTPA 3VD5A 3RDTB 4WUKL 5C9JB 4GW4B 5D6DC 1CQKA 4N9GB 5EOCJ 4NHCL 3BKCH 3GMPB 3QNYB 5GRVL 2MKLC 4NQXA 3R8QA 5L2KB 3P4NA 4L9LC 3CH8A 2W9LA 1FGNL 4OLZL 2ICCA 5GS0H 5BW7A 4PV9B 4PJHA 3KYNB 3GJFH 4OIBA 3DYPA 2QQKL 4PJXB 4TQEH 4YK4C 1D9KD 4EXKA 1BZQK 1NJ9A 5GRZA 3NZ8B 5CUSL 3L95B 4R7DA 5KVFL 1KN4L 4I8DA 3AMKA 4OGXL 4OQTL 2ATPA 4N8VG 5BZWA 1L9MA 3OKKB 4YIQA 1OGAE 2AK4E 5FB8B 1JYVA 4R6UA 3MRBB 3HFMH 3RUGE 3ARDC 3KJ4B 2G5BB 1TDQA 1DUZB 2H6PB 4NNYB 2HFEB 4Y19E 3MRKA 5DSCA 2X4PA 3MA9L 3GHBH 1RK0A 2OTWB 3TA3C 5F9JB 3VH8A 5EU6B 4X4ME 4YXKL 4NO0A 3SY0A 4NRZB 3GO1H 5TH2B 4APQD 4NO3A 4CNIA 3DUUA 4FXKB 5FYLH 2Z31A 4C55A 4NQCE 4JB9H 4QRSA 1FYTA 3LKQA 4LKXB 5JW4N 1RZJC 4CADA 1LK2B 4FFWD 1EZVY 4FOMA 5GGSB 1FZMA 3P77B 1JTOA 3V0WL 3KPNB 4JO1L 3VGAC 3PHOB 5DRNA 4Z18A 2NX5A 1CDUA 3O4LE 4YBLB 4N5ED 1JYWA 2XTJE 2H26A 4WFED 4KUCF 1VENA 4MQ7B 4X5XA 1HZHL 2XTJC 5TF0A 3E8UL 3STZB 1IM9B 1BWMA 4RRPG 1WZ1H 2BP3A 5C0AB 3VXOB 2P44B 3RHWK 3QJHB 2WBJB 3GJFA 3SO3C 1AXIB 1YUHA 1AO7E 1WBZA 3SKOB 4UQ3B 3H0TB 3L9RB 4HFWA 1HEZA 3MCKB 4KDWA 2BNQA 2V7NB 3G6DL 4RGMC 3JWDH 1GRWA 3QO0B 5I8OH 1RULL 4QXUH 1PG7H 4X6BA 4HWZA 3MV7A 3TWCL 4XP1L 2NYYC 1QFUH 1OTUD 5JW3L 1JHLH 5FV2A 4OZHE 5DDHB 1AKJB 3VWJB 5KSAC 4XT1C 5HTSA 2CLVA 4JFYA 3TO4B 1RJLB 2B5IC 3NMEA 4N1HB 1N64H 3VFRB 5CBEB 4ZPTB 4FG6D 4LP5A 1T6VN 1GGUA 2UWEA 3UYRH 4OCYL 4I3GA 3S36L 5C0IB 1TNNA 4WENB 3V5DA 4P9HH 5J1AA 3MRMA 3TYFA 4ZS7L 4NWTH 4AM0A 2FH8A 5BJTB 4PTUB 5KSVA 2EDXA 3A6OA 5I30L 1FP5A 5MEQA 1JZ3A 3ULVD 4PP1C 1WITA 3ULUE 2GJ6E 1MLBA 2XQBL 2Q8AL 3ULUC 3C09C 1RIHH 3QG6A 1Q9LB 3EYQD 1IGIH 2IAMB 4HUKB 3HMWH 3O41A 5LGHH 2KPNA 2NXZC 1YPZA 5DYOA 5C08A 1PEWA 3RQ3A 1DUYA 3KPLA 3CMGA 3F5WA 1G7MB 2JB5L 1ZVSB 1I7ZA 1Z0NA 3BD4A 4X98B 5F1OB 2AGJH 3H42H 4PJAF 2ERJB 5KVDL 1A6UL 5AYUH 5FYKD 2YPLA 4X6FB 3UAJC 3U36A 5C07D 5D1QC 5T1KA 5ALBL 2HVKA 3KWWB 3AREA 1F3JA 2NY4B 2E27L 1ZLUK 1WC7B 4GG6A 1KIQA 3T3MF 4MHHG 3S96B 1YJDH 4F58H 4H1LB 4PJCE 2CLZB 1ZTXH 1U8KA 4OGAC 5LBSL 3QIWB 2N1KA 2QADD 4UU9A 4M4RA 3T2OA 4LK4A 1E4XL 1J1PL 1HHGA 4KQ4L 4PJ9B 2V2XA 4FZ8L 3DYOA 4A2MA 5E99H 3LKRA 3S37X 4HIJB 2R39A 3O9WD 1HSAB 3BH8B 1W0VB 4M1GH 5SWZB 1FFPB 3P0YL 1VKXA 4CVZA 2ZSWB 5K9OA 3NN8A 4XVTL 2EE9A 4BFEA 2GHWB 1AXSA 3O3BB 3RA7H 5GPRA 3RPKA 5EU4A 5C3TA 3TBWA 1TCRA 2F54B 3CFBB 3ARGA 3CC5A 1CXIA 5D2LB 1U8LA 3TIEA 5A2KH 4ZS6C 3LH2H 4U05A 1OP3H 4Z7VB 2P5WB 4K8RC 4KHXH 1KCSL 1P6AB 1E0OB 4WI4A 2X4OA 4PRPB 5CJ8A 3VFNB 2XN9E 3V7AE 4YXLL 3IFPA 1MFDH 4ZFZB 1F4XL 1URLA 4LCYA 4CMMA 4PJ8C 1QLEH 2OJEA 3VFGL 3NA4A 4HF5H 2BSSA 5E6IA 1ROWA 2AP2A 1T7YA 3BGMB 1WWBX 1UM6L 5I1DA 1NBYA 1CIDA 2EKJA 4XBGB 1N4XH 4F3FB 2DIJA 3QUXC 3ARBC 4JG1H 4S1RH 1HWGB 1RJCA 5CS7A 1XR9B 2FIKB 4NNXA 1DEEA 5IR1A 3NABH 5D93B 4JDVB 2QR0B 3BZ4B 4RAVB 4XNYL 2VXUL 2D7OA 3OAZK 4UTBH 2J4WL 4M5ZL 5BQ7A 3BHBA 3WKMH 2IMNA 1JGDB 4QOKA 1HWHB 4TUOB 5E5UB 5D70H 2PO6C 1CD9B 1D9KB 5DUBB 5FFLA 1GGCL 3GMOB 3Q5TA 3RVVD 5HDOA 3S3JA 2EIDA 5ID1A 5BS0D 3QCTL 4N0RA 3P9LA 4AIZB 1F00I 5T3XD 4U6XA 3MUZ1 4XCYA 3ARWA 1Q9WA 2JELL 3UTPD 3MPCA 2CKBL 2ZSVA 2V7HB 2VQTA 1KELH 1CVRA 3ESUF 3OKLA 4JPKL 3IFNL 1Y18A 3IETB 1RUPH 5KJRH 1EAPB 4LLDB 5A43C 4LDOB 1CLCA 1NMBL 1G9NL 4APQB 3FCTA 4NWUL 3W11D 2J2ZA 2W9DL 3TN0A 2I5YL 3QIBC 2EC8A 3QIUA 2H1PH 2BCKA 5FA4B 1CDHA 5I1HH 4GKZB 3B83A 4Y5YB 1A9EA 1Q0XL 4XCFH 4MJ6B 1DQTA 4Z7QE 5TGBB 2YWZA 5ETUB 5FUZH 5I1IL 5FO8A 2BX5A 3BZDA 3QFJE 2R1YB 2BVPB 1JK8B 4GXVL 4JZJC 3OF6D 1L7IL 3BFOA 1BAFL 3RPIB 4MAUL 3QXUA 1U36A 3LKPA 2VXTH 5HHOA 1YMHA 4HLJA 3V0VB 3CFEB 1A14L 4Y7MA 5EZLB 5I8CB 1G1YA 1MIEH 1R3JA 3BZFB 1MHEA 1S7UB 5HHNA 2NY6D 4U0RB 2V5YA 4F7PA 4JFOA 1LGVA 3OKMB 2VIRB 4FQLH 4JRXA 2M26A 4U33A 3T2PA 1QR4A 1SBSL 5IKCA 1I7RA 5F88B 1JPSH 4PJGE 4U7KA 1FNSH 4FFZL 1PZ5A 3K46A 1UG9A 4ZUUB 1UCBL 3BKYL 1NEZA 1UH4A 4XMPH 5FCUL 4ZQKB 5IHBA 4G6JL 5CILH 1ZHLB 2E9IA 4PG9A 1DQDL 3MV11 1WZLA 2I27N 2Y72A 3PL6D 3VG0L 1R6VA 4OIAA 5EO1B 1D6VH 8FABB 2XRAL 4XMKL 2I9TA 3WL9B 5ITFB 2C7UB 2FGWL 3MLXL 2GSIA 3HI1A 1NAMH 1E27A 5LWYH 3PGFH 4WV1A 3BYYA 3TNMB 2BNUA 4P23D 1X5JA 1XAUA 2XWTA 4FQ1H 4LHQB 5L88H 3S6CA 3C9NB 1SJXA 3E6FA 5KSUA 2X10A 5CGTA 3JV5A 4EN3A 5I16B 1RVFL 1N5YH 3QDMD 1K2DA 1RHHB 4YC2C 2BY3A 3C5SB 5E5MB 5BVJB 2X89A 4G80A 1A7OL 5EIIA 4Z7NE 4BQCA 3QRGH 4KTDH 2YD8A 4KROD 2C4XA 5HYSA 5D6DA 4LVNB 1I85C 3HCVA 2HVJB 4I0PC 3JXAA 5T33L 4EDWH 1WT5C 5B38A 4F57L 2VXVL 3THML 3WUWB 4L9LA 1XCQB 4KRMB 3M1BB 2OYPA 2FR4A 3EYOA 5C0ND 2DI9A 1VEMA 1BFOB 2P8MA 2HJKB 1MNUH 3KNBA 2VDRL 4R7NA 5J13C 4I4WA 1NGXB 1KCVH 4TRPH 1NCAL 2XI9A 1UVQA 4YDLC 4O58H 4ZDHA 3RWFB 4HGWB 4JHWH 3H3PL 3GO1L 4I3SL 5GRJL 5C07B 3I75A 5IB3B 2X70A 5GS2D 3U9PH 4GAJH 3MSPA 2L0DA 4Z77A 4CJ1A 3B4NA 3L3HB 5FYJD 4I9WE 4G7VL 3Q3GB 2G9HA 1D6EB 1H15B 1IBGL 1UM5L 3ARDA 3RKPA 5FEBA 4JB9L 3P0VL 2XG5A 3LSOA 5AZEL 4D9LL 1OGAA 3BP6A 1HYSC 3TA3A 5HYIA 1SYVA 1JZ6A 1HDMA 3OPZH 5ANMA 1QSZA 3P9MA 4PV8A 3F7YA 4KI5D 2NW3B 4XPBH 3P2TA 1CGSL 1ZV5A 1T80A 2J6EA 1ZVYA 2O5XL 2R9HC 1XFPA 4X4MA 1NAMA 2DDQL 2VUOA 3BKMH 3OTTA 1G6VK 3MGOB 3OR6B 3X3FH 4M7JH 1ZHBA 1SJHA 3S37L 1FFQA 1T3FA 3IU4L 3KLSA 3QO1B 1WFTA 3MRGA 2DQCL 2Y6SC 3ULSA 1T2QH 4X83A 1BQLH 4NQCA 4P3WA 3O9WB 1INQB 4QXWA 4WWKC 1N6QH 1IC4L 4MCYB 4ZTOL 5HBBA 1BX2A 1AGFB 1F6FB 3SQOL 4HHAA 4AJ0A 4OLYL 4J3XA 1H3VA 5DEFA 3JWDL 2X2YA 1CCZA 1UXSA 3DX7A 4NCC1 4S0TD 5I8OL 3O3UN 5EZJA 3RWHB 2FSEA 1YEDA 3UTSA 5DD3H 2DJSA 4MJ5B 4YDVA 4ZYKB 1ZT4A 4NJ9H 5DA4A 4QTIL 1U8IA 1BVKA 2EYTB 4MXWL 3FT4B 3ARGD 4DFHA 2DWEA 1F4WH 2VO5A 2CJUL 5LCVL 1IT9L 1MFCL 5LGJA 1AO7A 3AXLA 1XCTB 3BUYA 4V1DD 3GI9H 4WI5A 3N1PC 1QLRB 4HK3J 4MAYD 4URTB 3UDWC 1U3HD 4HBQA 1NCBL 1AJ7H 2HKHL 1FRGH 2E9JA 2IMMA 2XPGB 5HI3C 2VLME 4OZHA 2NY1C 5D2LF 3IFOA 1EEZB 2PTTA 3BN9D 4F9LC 4Z95H 1CLOL 4LVOB 1S7VB 2BDNH 3FQTA 1T7ZA 5CEZL 3SE8H 5JR1L 3RTQD 1CG9A 3PV6B 2DL2A 1QFWM 1U2CA 3BP5A 4ODUB 4MB3A 2RCSL 3IAPA 2Q20A 3FO2B 1JTPA 2GY7B 1R3LB 4UOW0 3AFLA 2XV6B 5F97E 3VGFA 1OSPH 3HZKB 3VRLF 5BS0B 4LCCA 1Q1JH 2H41A 4YHLL 2UVEA 2D9CA 4ZOCA 4UTAH 1DANU 1EMTL 5E2UL 5CJQL 1R0AH 2VAAA 1QACA 2CIIB 3EHBC 5EBWB 2R56L 3MYJA 1FIGL 1JNHA 4AEIH 2DTSA 1PDKA 4JKMA 4U4BA 2FIRT 2GJ6A 1OGTA 5E7BA 3ET9F 4M43H 4JGUA 2BJMH 2ICWI 2IQ9L 1UB6A 1YEEH 2DM3A 4LGRB 5J3HC 1YY9C 3H8NA 5I1KH 4XH2A 3T0EE 2YD7A 3VE0B 3TPUA 3CH1A 1F8TH 1A3RL 1YJDL 5ICXB 5HPMA 4NN7C 3QNXB 1S3KL 3F7VB 1ZTXL 3RGVD 2DQJH 4HH9B 1HXMA 3SKJH 3WS6C 4G6AC 4OT1H 1CFNB 4BFGA 4FQQB 4MD5B 1MCPL 5J89A 4OCMC 4XP4L 4R3SB 3EZ8A 2VERN 3ZKQD 1KCKA 3IDMA 3CFDA 3F12B 3KPOA 6FABL 4RGNE 5L2JB 3L6FA 5DVOA 2HJLA 2NY6B 3TBYA 3K4AA 4KKLC 1D5MB 1OAKH 4RGNC 4OD1H 3MRDA 2F53D 3P11H 5IHZA 2VITB 1M7DB 4KVNH 1OAXL 2FHCA 1U95B 1TCMA 5DVLA 4PJ5E 1MCSA 4OB5L 3CVHB 3KDMB 4B5EA 3N50A 3QG7H 1JGEA 4MJIB 4PRDA 3S88L 3H9SA 3MLPA 1MFAL 4KHXL 1DQMH 1Q0YH 3QDHA 4OFIA 2AJUH 3PL6B 4DQOH 3FOLB 1KJ2H 3QWOA 4IMKA 5ESVA 4OFYA 5HI4C 1NAKH 2W0PA 1QLEL 1IGTB 2OR9H 3T8XB 1TZGH 2EDQA 5B8CB 3PWJB 1MPAL 1QNZL 2DM2A 2E9BA 4P23B 1ZLWK 5I66A 2HG5B 2FX7L 3MJ9H 5DEGB 5EOTA 4JVPA 2CK2A 1KB5L 1FJ1A 2DD8H 2MQCA 4QHUA 4JG1L 4YE4L 1MSPA 3H7BB 4OQTA 4YNYB 1JI2A 4I18B 3QDMB 3I50L 2DBLL 1JNJA 3T0XA 4PJ8A 3VD7A 2XN9A 4HMDA 4KKCC 4R0LB 4P5TC 5JDSB 4LMQI 1P9MA 1BM3H 3V7MA 1VCAA 1J8KA 3IDXL 3ZKMC 3MV9D 4KROB 3D3VE 3ARPA 1TITA 1WEJH 5GSVB 4R8WH 1JIBA 2R2BB 1BQSA 1NGZA 1KC5H 2MFNA 4ZAKC 3QUXA 3ARBA 5IFAL 3P73B 5ADPH 1A2YB 4LEOA 4QXTA 1NUNB 4UV7H 1LNUB 2VDNH 1TETL 3OAYK 4UT6H 3IDNB 5ECJE 4KRLB 4XAKE 5I75B 1Z9SA 1XZ0A 3JWOH 2PO6A 3V52H 1I1YB 4HG4J 1II4E 1YECH 3K4DA 1GAFH 1KJMB 3KVQA 1NC4D 2IG2L 1CFQA 4YHOH 3O3AA 3RJDA 2DBJA 4HJ0C 5E56A 2H1PL 1IC5L 2Y4SA 4JM2A 4YHMH 1F90H 1KF9B 3VXPA 5I1HL 5HGHB 1A1NA 3BX7C 1S7TB 3JWDC 1K8IB 1MFNA 4M93C 4JG0L 1NFDB 3UZEA 5FUZL 4Y5VC 4Q9BA 1C8PA 2R0WH 2VLLA 4PB9L 3LN9A 3QIBA 4M03A 5C0BE 3VFVA 4JKPH 5JIIA 1KCRL 5GS1C 4XCEA 3GMMB 3HG1E 4ZOAA 3RX8A 3MRJB 1NKOA 2AK4D 1BZ9B 1CD1B 4PJBF 5JPNA 4Y19D 5I1JL 1B4JH 2AJVH 1C5CH 1TJIH 2R4SH 1U58A 1I8IA 5DJ8B 5CEXA 4LHUB 1T1YB 4M61A 2CGRH 2VR4A 1W8NA 4JZJA 4WW2C 1SVZA 2ZOLA 3IJHA 2PTUA 1KPVA 3RWGB 1YNKL 1KG0A 3QEUA 1AGDB 4PJIF 4KK5C 3M17A 4F2MA 1R3KA 5CEZE 1FNSL 3BAEL 3AY4A 3MRCA 1CLZL 1G6RB 2NMSA 3EO0B 3ZE1E 2BVTA 4GQ9H 1T04B 4HD9A 1OP5H 1MEXL 5IBLC 4JQVC 3BH9A 4ODSL 3MROB 3FFDA 4TUKH 3H2WA 4XVUC 5CKAA 5M94B 4X7DC 1PX4A 3V6ZB 4MNGB 1FHGA 1GHFH 3O6LH 2MCG1 4JGJA 1U8OA 1RMFL 3RL1A 3KJ6L 3QT2A 3O4LD 5ADOL 4MA8H 3MA7B 5J57B 1FPTL 3LPFA 4D0DA 4W6XB 3HMXH 4KTEH 4MWFB 1E6JL 2X9YA 4PJGA 5KSBE 3HPLA 4V1DB 1OQOA 4FQ1L 4J6RL 3PWPE 4N8VA 3ES6A 4MAYB 1CZ8L 3QWRA 4OZGB 4WI6A 1SEBB 5DTFB 1MIML 4P2OD 2Y36L 4K3HA 1NUDA 7FABH 1U3HB 1I8MA 4O2EA 2HRPH 1ZA6A 5J7CC 2XFXB 5T1MA 3T08A 5DT1L 1ACZA 2JJVA 2E5EA 3G5VA 2VXSH 3B9KC 3MR9B 3PHSA 4MX7A 5LJYH 2OS7A 4G8GE 4XZUB 12E8H 2IANE 4MNHA 4QY8B 5SX4H 3MCLH 3RTQB 5KSAD 3LVEA 1KBGL 5HDQH 3QUMA 4IHOB 1IGCL 4DKFH 5EIVA 1XR8A 1P4BH 4XTRC 5D2NB 3JV0A 3C8KB 3O4OB 4JFED 4JKWA 4Z7UF 5HVHB 3VXQB 3ZKXC 1I85A 4I0PA 1NGPH 2GUOB 1QEWB 1FNHA 2XY1A 4KJPC 2V9QA 5IMOB 1FG9C 2VDLH 4DN4L 3FO0H 2B1HL 5BRZA 5ITBH 4BYHA 1XF3A 2VDOH 1IEBB 1G7LB 4LQFL 4AK1A 3QHFL 3CU7A 4OSUH 4X99A 3RFZC 1EHLH 2YPKB 3JTSA 4XXCA 1I7TA 2ATKB 3QXAA 3WNPA 4B41A 2VZSA 1DFBH 1T1ZB 2VMFA 4RRPA 3UPCA 3BOVA 3I3BA 3DVGA 4UILL 4I13B 2XXCB 3H7LA 1A7QH 1CDGA 3RGVB 4ONFH 3MX0A 4OCWH 3LD8B 1EEYA 4PJHF 1BOYA 1SJVA 4WTWA 4JVUA 4HDIB 1N59A 4H88H 3GSQB 3HMXA 4OCSH 2NW2A 3L5WB 3BESR 2JIXA 3C6SB 5E94B 1Q9KB 4PRBB 3C08L 3CSGA 2FJFB 2LE9A 2GW5A 3ZDYF 5B4MC 3WFCH 2P48B 5IB1A 5C0CD 2EIZB 5D1QD 4XB8A 3TC9A 3EGSA 3U4BH 2ZG3A 4Y8AA 1BJMA 3GRWL 1ZLVK 4D0CB 5C0EB 2F53B 4X6DE 4YPJA 5FGBC 4NGHH 5GRUH 4DZBB 2IWGA 4L9DA 4LSUH 1U92B 5CBAB 2XWBA 5IGXH 4K55A 2KH2B 4OGAD 4M9PA 1GZQB 1TZIA 2C1PA 3FT3A 5DC0A 2OM5A 3MV8E 1QVOA 3O2DL 2JCCB 3VI3E 5D6CB 1R3IH 4GAYA 2E6PA 1QBLL 3QAZB 3IVKB 2YK1L 3WO3B 2C4FT 2HP4A 3NAAL 4JFXA 2A83B 4EQ2A 1RUMH 3QA3B 4LVHC 1AI1H 5FOBA 1NH6A 1OT2A 2M2DA 4Y16A 5EO0A 4R4FL 5ISZD 5L9DH 5BMFL 1KULA 2ARJB 1I7UB 4J8RB 5CJBA 5TQ0L 3P9WB 4P59H 1QSEE 3UYOD 3FN0H 5JXED 4RSVA 1VFMA 4L8BB 5IM7A 3G6JE 1JWMB 2P42B 1GH7A 3LN4B 1D7FA 3TT1L 3L3GA 4Y4HD 1FVDA 3HRZA 5H35A 2C4FU 4NKDA 2YS4A 3MUHL 3S9DB 4JFHD 5CGYD 2AJ3A 4ZS6D 4MQTB 5I8EB 3MV9B 1UB5B 3UJJH 1NUFA 4KMLB 3UDWA 1WK0A 1OT1A 4BQ6A 4ALAH 4GW1B 5E7FA 5IVXE 1UQSB 2P1YA 3D2UA 3VRIB 1X6NA 4J7RA 5GGRA 2JTDA 4OLXH 4F9LA 5JPMB 2WP3O 4WFHE 4P57A 5CJ5A 1HHKB 1ETZA 1U9KA 4U49A 2DLFH 5BZDB 2XA8L 1U91A 3SPVA 2ESVE 4HH8A 5DI8B 3KYMB 3M8OL 5CP7A 1D5XA 4OCRH 4LSVL 4IRSC 5T5FH 2D9QB 4M43L 2ZG1A 3WN5C 3WXVL 4JPVL 4AL8H 4GXUN 1NC4B 1YEEL 4NJAH 4L5FL 2VH5L 4BZ2H 1MHCB 3CDGA 2HT3C 4QYOA 4PBVC 1WV7T 3O45B 4Q97A 5I1EL 3RWCA 3QDJA 2RB8A 1V3JA 3HS0B 2IBGA 4E0RA 3C60D 4EI5D 3GSUB 5KAQF 4Y1AE 5KVEL 1ZGLA 1X7QA 3QI9D 3NIDF 1HH9A 1H8NA 4HIHA 4IRJC 5INDA 1MRFL 2RJMA 4IJ3B 5FUCC 1SMOA 1FL5A 1FNGB 2L7UA 2AK4B 4A6YB 3RUGB 5SWQA 2C9AA 3T0EA 1SJEA 2GSGB 1CE6B 3SDXE 4GJTB 2PF6A 4Y19B 1MJ7H 1GIGH 1LILA 2J5LC 1YPZF 1BGXL 1JL8A 1FO0H 3QIBD 1C1EL 4BZ1L 4D8PB 1WBYB 3FQUB 5E4EC 4MDIB 1N2RB 4Z5RA 4JO2H 2DLHA 2HFTA 4GRWF 4NT6A 5A2LH 5HYJE 3B9EA 3T1FB 2W60A 3GM0A 2WUCH 4GSDH 2VUYA 4M7LH 4KI5F 1FGVH 3Q6FB 1MWAB 3DMMC 3FB5B 1J0YA 1KJVB 1OP9A 3QG7L 5ALCH 2ITCA 4ZUWA 2WZPD 3VGAB 3UPRA 4GG6F 1WTLA 4LBEB 5FHBL 4O4YH 1LD9B 1VFAA 4Q9RH 3T0WA 3QFJD 4HZLB 4QT5A 5SX5K 4MB5A 5HGBA 4H26B 4RBPK 1NAKL 1OAZH 3O4LB 4H25A 5ESQB 3ZT5A 4L4VE 3OKNA 1BQHG 1P7QD 3U2SA 2DF3A 3VXSE 4C83A 4X7SH 1PSKH 3DVNB 3K1DA 5TPWL 1S8DA 4PJ5A 4L3CB 3UBXB 2P47B 4P2OB 1T2JA 2AV7B 4PREB 2V17L 4H5SB 3R0NA 2AI0H 4GOSA 3LEXA 4G8FB 5I17B 1O7VA 1QFWI 4Y4FC 3GFUA 3SGJC 1RZKL 3I6GB 2X05A 1EVTC 4C59B 2XICA 4HW6A 3GJFK 2MWCA 1HKFA 3GBLA 3QULA 4PY7A 5LAXA 5KSAB 5D7LE 5HGAB 5ADPL 1U8MB 4XPHH 5I73C 3E6HB 3G04A 1A4KB 1ZOXA 2CH8A 5D1XD 4HAFA 1JZ8A 1N7ML 3V6OC 1OQXA 4JFEB 4FNLL 4LPVA 2DQTL 2CMRH 4YFEA 1GGTA 3FONB 1PKQB 2ZKHL 3DURA 2DYPD 3U9UB 3JBG7 4OZ4B 2I9LA 3CX2A 3IDYC 3SCMA 1CDIA 1T5XB 1GC1H 3OXSB 3T0VA 5MEOB 3HC0B 4ZNEE 5EFIB 1JNLL 4I0PD 1TVBA 1V7MH 1XGPA 1E28A 3HNSL 4POYA 5HPOA 5DQDL 4G9DA 4JFDE 4LLQA 3U7WH 4WEMB 3I9GH 4X9HA 2BVUA 1FBIH 3MLSL 5MHSE 3QEGL 4MVBD 3HI6H 3VFPB 4EQ3A 3W9EB 1HILA 3TJEL 4CU8A 2ZCLH 4JO3H 1RV6X 2R2HB 4J1UA 4J3WA 3SDAA 3AROA 5C0CB 5D1QB 2XZAH 4WI9A 1B4JL 5E6ZA 4HXAH 1BJ8A 1P6FA 2QV2A 3CMOH 1M05B 4N0YL 5CWSA 3OMZA 5KG9A 2IEPA 5J9PA 1QFPA 4ONHB 3ALWA 3TLRA 5MI0B 2FRGP 2R1XB 2UZIL 3QUYA 1JPFA 3AB0C 5CSZB 1PYWA 1MVUA 4U6HA 2YD9A 1I9EA 1KFAL 5C0BA 4G6ML 5IJVB 3CFJB 3VW3H 5MENE 2BHUA 4E42A 3HG1A 35C8L 3KYKH 4PJCB 4ZPVB 2HYMA 2R9HD 1J12A 3QRFM 2Q76A 4X5WA 4Z6AT 1TVHA 1UJTA 3WLBA 1J7VR 4WW2A 1ZS8A 2Z91B 3ARTA 4HMCA 5D9SA 3RNQA 2JB6A 1FE8H 4QRQB 2Y6SD 4EIGB 5F1IA 2EDBA 5AD0A 2CDGB 3LS5H 4ELMB 4WWKD 4JQVA 3SBWA 5ISZB 1IEHA 1XGUB 5IQ7L 5JLZB 3EYFB 3IXTB 2VLRD 4WEUD 3BISA 4Y2DC 3HAEH 4DOHB 4HX1A 3VWKA 1MCBA 4LLUA 5DWUL 4OF7A 4Y4HB 3ZE2E 4LPWA 3TVMC 1FN4A 2VNCA 4JR9H 4ZXBC 1Z0MA 5F44A 1ZT1B 3L1OH 1MELA 3W2DH 1B0RA 2PYEE 3CJJA 2D7PA 4DKEL 1WQVT 3REWA 3L7EB 1HH6B 1MREL 4Q58C 4F15C 4TVPL 4WHDA 4FMFA 5F6HJ 4YHKL 4U1JA 5AZ2H 5H94B 1AC0A 4KC3B 4UDUB 5HDQL 3PWPA 4DKFL 4U1IB 1DE4B 3O6FC 3VMPA 1HINL 4Y4KC 1SEQH 1V5JA 4TOYH 5EBMA 5I15H 3U46A 1VADA 4D3CH 3B9KA 1RZGA 4QLRA 2KZ1B 2Z4QB 1I4FB 3RRQA 2X5PA 4HJJH 5ID0B 3IJYA 5DJDA 3MJGX 4ZO9A 5EUOE 1S7QB 2CO6B 4PRNB 1IKNC 2FH6A 4G8GA 2Q8BH 4QRRE 5FA3A 3WNMA 4LOUC 3G9AB 4LFHD 3U0PA 2VDOL 5KANG 2H8PA 3D69B 3CFKA 5D72L 3VMNA 5DJYB 3NPSC 2WV3A 3PWLB 3ROLB 1YN7B 4YUEL 4NQUA 4JFZH 1AIFB 1A4JA 1ZXQA 4RQQB 4KVCL 1A1MA 4I77L 2YD5A 4HJGB 3GMQA 4YDIL 1SVCP 3VA6A 3C60B 3OXRB 4ONFL 1P7KB 4EI5B 2D03H 1BPVA 1OARL 5C2BL 3ZL4H 4NQDE 3VXUE 2MHAA 1SM3L 2B4CL 3L3OB 3QI9B 4KK9C 2EH8H 1BF2A 3BKJL 3EHBD 5AG9A 4WUUE 3MLVH 4X9GA 3I6LD 5DUPL 1RFDH 5FM8A 3W5NA 5IB5B 1YC7A 5EU3B 43C9A 4Q9QH 1JP5A 1MH5A 3EDJA 4Z8FH 3D87B 4RIRB 1HOCB 3NCMA 4UV4H 1K4DB 5J3HD 1YY9D 4K3EH 1NBZB 4OF3A 2SEBA 2X41A 3ME0A 4D0BA 3ZYIA 5DD0H 4QGYA 4U6TA 4BSWA 4ZMAT 3I2CH 3VDCA 1ZANH 3DIFB 4XPTH 1RZKC 3NCYP 4GG8B 5IGXL 3E2HC 4ESKA 4FTVD 1OP3K 3BPOC 1KB5A 1D5IL 5CZVH 1A9BB 4ODHL 5I1GH 4H1LG 4LKCB 2UY6A 5FGBA 3QFJB 3KPSE 3WS3B 4R2GD 4QRPE 4YO0A 3RUGF 4O02H 5HSFA 4EKXA 2AJSH 2XNAB 4HT1L 1CFTB 4X6DA 1J86A 2YD2A 1P7QB 1LO5B 4P2RE 3K8KA 3OG6B 1X5AA 5HGDA 2V2TB 3VFWB 3ARXA 4RGND 4JKKA 4BFIB 5DJZB 1DVFC 2I07A 3QBTB 1T4KB 3NH7H 3MV8A 3MNWB 1BMGA 4OM1L 5J12C 4R97C 4HV8B 2R29L 3UJIH 5D71L 4LPTA 1NANI 4M62H 5DD6A 5AG8A 4XP9L 1R5IB 4PJ5D 4IMLB 3T4AA 2BFVL 5J11C 5FV1L 4EI6A 1T1XA 2X1QA 3UJJL 4GW5A 2P7TA 4JQIH 3HNVH 4RMWA 2X4RA 2YD6A 2WSKA 4M48H 5CHNA 4WHYG 2QEJA 1QSEA 3T09A 4X4XB 2GJZB 1FC2D 4XBEH 3G6JA 2BOCA 4LAJH 5F9DC 2BVQA 1A7PL 5D1XB 4D9RE 1EFXA 4WW1A 3SGDI 4UIKL 3X11B 1D3CA 2G60L 4NQSB 2DLFL 4HS6A 2VLJD 4HG4K 4KKAC 1JFQH 3QEQD 4DK3A 2DYPB 3DUSB 1Q72L 2NTFA 4KKCD 4EUPB 4P5TD 1BVLB 4HIXH 2CR3A 3U7YH 3IS1X 4R4BA 3BZEA 5I74C 3V9FA 1IAOA 3ZKMD 2HTKC 1KTDB 4XBPA 3PWNB 1Q94B 1KGCD 4NKMB 3DO7B 3MRQB 3TBVA 3ILQC 5IIEB 5IVXA 2Y06H 2J8UB 1JPGB 3KYOA 1EEUA 4ZAKD 3PABB 4S1QL 2J1KA 3D3VD 1FZOA 4CJ0A 4KJYB 1OD7A 4L1DA 4OZHF 1FH5H 4XGZA 5HI5C 4UQ2A 3H9YA 1AE6H 1FNEB 2ESVA 5J6HA 4JHAL 1F3RB 1JWUB 5J13B 1S7XA 2P8LB 5HJ3B 1S7WA 2QL1A 1IEAA 4AENB 3BPCA 3F8UB 4XAKD 4ISVB 4YDLB 1WBXA 1H0DA 3E3QE 4LCUB 1ND0B 4LSRL 3ZE0E 4UT7H 1FO0L 1ZA3B 2FEDC 2WNGA 3E3QC 4PTTA 5ESAB 4PJ7E 3RBSA 2X4NB 4Y1AA 2WK2A 3CFCL 2PXYC 5DMIL 2FECI 4TVPE 3INUL 4P3CH 3ULUF 1QQDB 1YQ2A 4P4RB 3LV3A 5FKAA 1GYAA 4HBCH 4OV5A 1YEKH 5L0QB 4HIEA 1OTSC 3SDXA 2QHRL 4KQ3L 4RA3A 1E4KC 3LPWA 1UADC 5FYKU 1V7NL 2HKFH 1ED3B 5D7JC 2Q7NA 1A64A 3HG1D 4X7CC 3ZHKA 5L6YH 4X7SL 4WWKB 5HYJA 1J1OH 1WSST 4RMUA 5F89B 2VLRB 3BRDA 3RDTC 4GH7B 4XCNB 3IB4A 5TFSL 3HZVB 2L7JA 3TZVA 2UVFA 1GVIA 4KK5D 2AS5M 1MRDL 1O7SA 1QG3A 4N8CL 5CAYB 5IBLD 4PJXE 4PJCF 5CEZD 5GQBA 1INDH 5F71A 2KUTA 3VXTB 3BEVA 5C0FB 4XVUD 3AAZA 2FX9L 2W59A 1ONQA 3UZQA 4LSSH 3VXSA 3D0LA 2PN5A 5TDNB 2EO1A 1MI5A 1CTOA 3AS3A 4PP2B 5BXFB 1J0ZA 1DBMH 1DSFL 3GZKA 5D1ZA 1L7TH 2CKBB 3WO4B 3WSQH 4C57C 2B4CC 1CL7H 4LGSB 5IEHB 3UTZA 3FN9A 1R5VA 5IFJB 3O6MH 4LLVA 3QXDB 4L1HA 5EU6E 2EDDA 3EBAA 5ILTL 4HKBA 2PYFB 1F58L 3MLUH 3UJTH 5FKPA 1RJZB 2KL6A 3TM6A 3ZDXE 4ZUTA 5K9QI 5D7LA 1GC1L 3ARZA 4FQHA 4HXBH 5CINL 1YYLH 1QRKA 5DJCB 1SYSB 1MFBL 3DPBA 1NC2B 5E2TH 2ZJSL 5J6GB 2CK0L 3O6KH 3CVIL 3MRHB 2IAND 4DVRH 1NUGA 4UOW1 3U0TB 1D5ZA 1B4RA 2ZUXA 2K3TA 5H37G 3VFOA 2OQJA 3GRWA 1ZGLP 1M7XA 3BSZH 5KVMC 1CFBA 1F4YL 5DK2A 4K2UL 1T0NA 3LMJH 4UIMA 5HHMD 4I1NB 1J9CT 1CXFA 2VDPL 3WUWG 3UBXI 1QSFB 5DGRA 2VAJA 4ZUSA 4KJPD 1DLHA 3OKYA 4ZNEA 2YMXH 4JDZA 4JO3L 2ARJQ 5FDWA 4ERSH 4M7KH 4WGVB 3O2DA 1UWGH 5C0AE 5DFVC 1F42A 3CMOL 5TJWK 4JFDA 4BH8B 4OZFH 43CAA 3PV7A 1QO3A 1W0WB 4PLOB 2JE8A 4ETQB 4RZCA 1OHQA 1AQKH 4U3HA 1X5FA 1CT8A 2EH7H 3BXNA 3I02B 2WBJC 2HN7B 3DXAD 5KOVC 4AMKL 1IAKA 3BP4B 4LEXH 2X4TB 3NFNA 3RWDA 4YFLF 3EYVB 4FTVB 2NQCA 4RFOH 4LSQH 1BEYL 2OSLB 4JM2F 4K94H 3OJDA 4OIIH 4FXGB 4PR5A 4NCDA 5I0ZA 5B4MD 1G1CA 3EUUA 4R2GB 4N0UB 1H8SA 1OVZA 4HKXB 3TO4C 1RUKL 2D3VA 5IW1A 4QHLB 3FQWB 4JPIA 3IFLL 4NC0B 2IPKA 1F6AB 2RGSA 5LXGH 5MENA 2FJHB 3GKWH 3HR5B 3TV3H 4N1CA 3EDKA 3RWIA 2HT2C 5FGCB 4YR6A 2ADJB 3BE1H 4UB0H 5I76B 1CU4L 3D48R 5DS8A 5IB2B 1P7HL 1RU9H 2ED7A 4G5ZH 3GI8L 4JR9L 1FCGA 3DJ9A 2YSSA 4HEME 1B9ZA 1X6LA 5C0GA 2VDQH 4C56D 2BNQB 1FZJA 1L4IA 4Z7QF 4JFPB 2FWOA 2D4DA 3P4LA 1MHHA 3PHQA 4FFVC 3FKUS 1U8PB 5C3LD 3LIZH 3G6AA 4X0KA 3LB6C 1HE7A 2C3HA 4IOFC 4PUBH 3D6GA 3TVMA 1FL6B 4WJ5A 4ZXBA 1AGCA 4NO2A 3PQYA 5D7SL 1CFVH 2EXWC 3LQZB 3IDIA 2F8VA 2IAMC 5F1NA 2OTUB 4HC1L 5IF0A 1I8LC 4G8IA 4HK0A 5EORH 3EOTL 3L5IA 4UNVA 2PYEA 1DCLA 2VLJB 1S5IH 1QSED 3QEQB 5FUOH 5C0DA 5KS9B 1UJ3C 2ERJC 4P5TB 2AXFB 4JHBA 3B6SB 4PJGF 1ZLSL 4Z7WB 1VEPA 3OAZH 2VZUA 2GKIA 5DQJA 1RD6A 4WU5A 5JXAL 5JZ7C 4GRLC 1NSNL 4PRID 3RBGA 4NYLA 4LMQE 1JV5B 4UT9H 4K9EL 4MCZA 4F33B 4ZAKB 3ULVL 1R5WA 4UMGA 1IKNA 1KCUH 5CEYB 5C0JB 5ENWA 1HNFA 5EB9A 5EUOA 2YRLA 1BVZA 2NR6D 3QIWC 3CLEL 2BNRE 1OB1A 5AUMA 1VA9A 1A6ZB 3RP1A 3MLVL 5IK3B 1NBVL 2GT9A 4S1DC 3RWEA 2YN5A 4IRSD 3BVNA 5SWZE 5E08L 4Q9QL 3ZHLA 2ESVD 2X09A 4JANB 4M6ML 1J18A 3MRLB 1RZFL 5INCB 5C0RH 4WEBL 5FYKL 2IBZY 2DQDL 4HPOH 1YMME 2F54E 2HT3D 5DD0L 4Z7NF 4XAWH 2EO9A 2UYLB 1EXUB 1X5KA 2W0LA 4NQDA 4U7MA 3VXUA 3WE6B 2W92A 4XPTL 3HC4H 4WUUA 4Z7VE 2P5WE 2AEQH 4Y5VB 4BK5A 4OV6F 4PRPE 4DN3H 3LPGA 4IRJD 5GGUB 4MQSB 4U1MB 1JZ4A 2H45A 4QRTA 3V4VH 2A73A 1UWXH 5GS1B 2P46B 1HIMH 1S7SA 3SE9H 2WLZA 3C5ZC 1R24A 1BBJA 1CR9L 3EJJX 4AG4H 3SKNA 4U2ZA 1OL0A 3LKRB 1VERA 3TF7C 4LL9A 1JF6A 1FVCB 2H3NB 1X4ZA 4U1KB 1ZSDA 4F9PA 2CXGA 3MMEA 1IVLA 1F97A 2H32A 3L3JB 4CGTA 1G7JA 1SHMA 3NCBB 3IJSA 5FECA 1GOGA 2PETA 3DMMD 1Z9OA 4M6AA 4AT6A 4MD4A 2R23B 3KPSA 4XP5H 2KQMA 5F7EH 5GISH 3SKUD 4W81A 4QRPA 1EGJL 4JFQB 2HFFB 2R1WA 1NGYA 4B7IA 3NCYS 4ZD3L 2BZDA 4P2RA 1FVEA 4M48L 4YQXH 3X17A 4JZNA 4TUJB 1H3XA 1KLUB 5JOFB 4KUZH 2Q6WA 3QJFB 4XMLH 5JORB 1BQUA 2JK5B 1KIRB 1YY8A 1N3NB 3VA2C 1FZKB 4L4VD 4LDLB 4JE4B 5KSBB 2V2WA 4Z78B 2Y7QB 5GSRB 5JW5A 5I1DB 3IF1B 1JFQL 1T0MB 4YDKH 2FL5A 2CR6A 4E9LA 3RVWC 4Y4FD 2FO1A 3VJ6A 4NUGH 1AFVL 3VXNA 1YQVL 4S2SA 4HQQH 5C6WH 3DI3B 3FO1B 1Z3GH 5HHQA 3ECBA 3RGHA 4J3UA 2NY5L 3TO2A 5H2BB 5JQ6H 5HHPA 2VL5B 1MCCA 5HXMA 1NFIB 3GUTA 1ZVHA 3LOWA 2IANB 4Y5YC 3LDBB 3DGGB 5FGSA 4N9OB 1YNTA 4OKVA 1HI6B 1YEFH 1Y0LA 5AWNL 4FFWC 1A02N 5DQ9A 4OLUH 3PUCA 4KK6C 2AXHA 3G5XA 3EYUH 5HHMB 4OGYL 3ZKXB 1UZ8B 4WFEE 3QPXL 1DQJB 4X6EA 4PJFB 1A22B 1OAYH 2DLIA 2B0SL 4YH6A 4UT7L 4O2CA 5ACZA 2IGFH 1BQHA 3OJ2C 2AJZB 1ZHKA 2X44D 5I19H 1NBQA 1IAII 4R96A 3WHXA 1XT5A 3RY6C 3B5HA 3DXAB 2BCKB 3PJSA 4JAMA 3G08B 4XXDB 1F3DJ 2F15A 5KN5B 2IH3B 1QFWL 3QCUL 3BW9B 1YEIH 1OP5K 1YEKL 3REVA 2IQAB 1MUJA 3ISWA 4F7MB 1EJOH 2Y07L 5MHSD 1OTUC 4O51B 1H3PL 3GSRA 4P48A 1MFEL 1NKRA 1A6VH 2GIYA 2PXYA 5C6TH 4PJ7A 5IW6A 1S5HA 1C5DB 2DQHH 2FATL 3LRSB 4X4YA 4DGVL 1KN2H 4WCYH 1E6OH 4NDMA 4OUOA 3S34L 1HHIA 4NPYB 3BPLC 4NZUL 5D7JA 4CW1A 2A6IB 3G9VA 1I7RB 3O11A 4RAUA 1PLGL 3ULVE 1JHTA 5E1AA 4XNZB 4FQCH 3U4AA 3O0RH 4OZIB 2A77H 3OJVC 2PW2B 2RAMA 5F7DA 4NRYB 3L3KA 3MBEA 3LN5B 3MFFB 4C56B 4FQXC 1WGOA 1XH3B 3CVHL 4K9EC 5F7MC 5HHXL 3ULVC 3RDTA 5DXWA 2ZUQB 5C9JA 4GW4A 3QXVA 2YA1A 3CZJA 4N9GA 2VZTA 4LVNC 1J8HD 5MERB 3TCLB 3V5HB 3GMPA 3OKOB 3ARSA 3QNYA 4R9HA 4LVHB 5L2KA 3GB7B 1SY6L 1L7TL 5E0QA 5DHVH 1F2QA 3AU1B 3EYQC 2H2PC 5GJTL 2BOBB 1ZT7B 4PV9A 1S9YB 1IGJB 1JMXA 3EFDH 3KYNA 3TNNB 4DTGL 4Y2DD 4FQ2L 1X5YA 3IS0X 4PJXA 5T5NF 4LU5L 3CZFB 3BYTA 3L3DB 5DMKB 5FYKE 2P49B 3MLRH 5SV3A 5C07E 4OFVA 3AUVA 3NZ8A 2F5AH 1NEUA 1RUAH 1NCNA 3L95A 2O61B 3E1F1 3F58H 3O3EB 5DJ0B 4NP4H 3OKKA 3S7GA 1MCWM 2AJXL 5EU5B 5FB8A 4MSWB 3MRBA 4PRIB 3U0WH 5LGKA 2G5BA 2ORBH 1DUZA 4YDJB 1T03L 2H6PA 2Z8WC 1CXLA 2HFEA 4NNYA 4TSBH 3O6FD 1WICA 4DVRL 1AHWB 4Y4KD 2OTWA 3B9DA 5F9JA 1T83A 5EU6A 3CU1A 4NRZA 5HGGS 5TH2A 3WLWC 2W07A