3FO9B

Crystal structure of aldolase antibody 33f12 fab' in complex with hapten 1,3-diketone
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
218
structure length
218
Chain Sequence
b'EVKLEESGGGLVQPGGSMKLSCVVSGLTFSRFWMSWVRQSPEKGLEWVAEIRLKSDNYATHYAESVKGKFTISRDDSKSRLYLQMNSLRTEDTGIYYCKIYFYSFSYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin IGG2A - light chain
publication title Direct observation of an enamine intermediate in amine catalysis
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 45
structure length 218
sequence length 218
chains with identical sequence H
ec nomenclature
pdb deposition date 2008-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fo9B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fo9B01
5I1HL 2JELL 3AREB 1NUNB 4Y4KB 4W6XB 3PL6D 1K6QH 1BOGB 1JGVH 1QSFD 4MDIB 5DMIH 5F3HA 1J0JA 1XH3B 1ZT4B 2NTFA 4GKNB 4NZJA 1J87A 1NMBL 5LJYH 4NO5A 5BRZA 4YPJA 4E41E 4KROB 1I3VA 1JL8A 3UBXB 4OI7A 5IMMB 3QIUC 4MLIA 5EG6C 4PLKC 3T0WA 4HWEH 3CVHA 3N85L 4OAWA 4U1KB 3NN8B 3ZKXC 4QTIL 5J3HC 2N7AA 3T0BA 1Y6MR 1FN4A 4UIMA 3I6LD 4KXZH 4NO0A 3ZT5A 1TLKA 4L8SC 2D03H 1FORL 2DDQH 3VWJA 1MRFH 1T21B 1ZVYA 3V6OC 4X6DF 1C5BL 5EUOB 4CDHA 1VERA 2FRGP 5DWUH 2VITB 2OR8A 2IAMD 1TPXC 1YC8A 4FABH 4U05A 3EZ8A 2AJSH 3BSZL 1HCFX 3BT2L 4OLWH 2XKSA 5EOCL 5EULV 3VXTA 1T83A 2OBGA 5CINH 3FZUD 1H5BC 1T0NB 4B53A 4DVBB 3RKDC 4Z7VB 4YFLI 2EDDA 2E9JA 4P3WA 2BNQB 4PRHA 2IWGA 4J2XA 4LLYB 4AIZA 2EIBA 3X13A 4PGBB 1CLYL 1WAAE 1G0XA 1DANU 4Y1AB 5E70A 5KG9A 1CDCA 1T22A 3DUUB 4IBLT 1ZXQA 1DUZB 3GK8H 5GS2H 5J13C 4Z0XB 1GPOH 4QLRA 1FL3A 2E7HA 2JB5H 1ZGLP 4AG4L 4LCWB 4GW4B 2NY6B 1CD0A 1DJSA 1RPQA 5DJCB 2CRZA 3ES6A 2FJHB 2IAND 4J3TA 4PGEA 2VLKE 3BHBA 3JWDH 2Z91A 3H0TB 4Y4KA 3AREA 5IM7B 2B0SH 4MDIA 3S88L 5MEOA 3MRLB 4LDLB 1XH3A 1JPTH 1ZT4A 4P49A 3H3PL 1CXHA 4QOKB 3QHZL 1KJ3L 3IDNB 2EDXA 3UBXA 1CLZL 4S10A 3VD7A 3TGXA 4G43B 5IMMA 2Z93B 3L5HA 3NVQA 4JGUA 1O0VA 1FPTL 3RVXD 3PGCB 1NFDE 4UAOB 3BW9B 3SEPA 4U1KA 3NN8A 4ISVB 4UINL 4ORZC 3F6LA 4H25B 3FQNB 3UAJD 1YPZB 3Q6GL 4QHUA 5KTEH 4Z7WF 5I71C 1MFAL 1UEMA 4W6WB 4JLRB 1MQKH 3QEHB 1KFAL 1T21A 5HJ3B 3ARTA 4ODWB 5EUOA 1MF2L 4G8GE 15C8L 1ZA6B 3CFCL 2VITA 4OB5H 2RR3A 3QXAB 1RZJC 4WCYH 3NFPB 5JW3H 3PIQB 3ARDB 4NUJA 4K55A 4EOWH 4KQ4H 4LHUD 1T0NA 4DZ8A 4DVBA 4Z7VA 4L4TD 2DYPA 4YIQB 4H5SB 5GJSH 3TN0A 2HT4D 3WIHA 5AYUH 4UU9B 3D18A 5GS1C 4X4XB 3V8OA 1OLLA 3U0TB 4M8QB 1H8OA 2EICA 1T5XA 1LO0L 2BRRL 4PGBA 4UV4L 4Y1AA 4D0CB 5ISZD 4NN6C 4ODHL 3HFMH 3ZDZF 4Z0XA 3V5KB 1QYGH 5J1TC 2OJEB 1N3NB 4GW4A 4LCWA 4OZFH 1H3VA 5KN5B 2DS4A 3HMWH 5DJCA 5I75C 5IB1B 1UJ3C 4OUUB 4PS4H 1NCBH 4U1LB 4L4VE 2AV7A 4JG1H 1H3WM 3H0TA 1OSPL 4QRSB 1J05B 4PRNA 4LF3B 3HUJE 5IM7A 1WSST 4M7JH 4P2OD 4PP2A 3ZTNL 5ETUB 3MRLA 4R97C 3S6CA 4GAJH 3LKOB 3MUZ1 1T7XA 4WEBH 3F7YA 4P0DA 3MSPA 1I9RL 3QR2A 3IDNA 4QHKJ 1MI5B 4FZEL 4Q9CA 2Z93A 4HS8H 4P2QD 4Z7UB 5D7LE 3SPVB 1MHPL 3TPUB 3BW9A 3SDCC 1A7QL 3IRPX 3LKNB 3ZHDA 4ISVA 2R4SH 1MWAH 4U7MA 1U0QA 1QFOA 1RZJH 4H25A 3FQNA 4XP6H 2NLJB 2DL9A 1YPZA 2X4UB 2B4CL 1FSKB 2R2EB 2BSSB 3NPZB 3SDAB 4Y19B 4PJBF 4JLRA 3QEHA 3VFRB 3OKEB 5HJ3A 3CVHH 3BWAA 5KAQF 1JF1B 3QIBA 5ALBH 1QRND 1B4RA 4S11A 3GMOB 4GMSH 3NFPA 5HDBF 1S9WB 4ONFH 3PIQA 5ESVA 4OLZH 5F8RC 3LRSB 1S8DA 4HUNB 3C60D 5BO1L 2MMXA 2F74A 1PG7H 4H5SA 3U79A 4UU9A 2W9LA 4X4XA 3U0TA 3QI9C 2GQHA 5BRZD 1SEQH 1OQXA 4D0CA 2AQ2A 4QXUL 1A7NH 4XXDB 2ZKHL 3T3PE 4HWNA 3EYSL 3U4EB 1MCHA 4ZMAT 3QQ9D 3H3KA 4JQXA 1K3IA 2VE6B 3V5KA 3CFEB 3WFHB 1V3JA 4JZOB 2OJEA 1N3NA 4LSTL 5IVXF 2DQJL 5KSBB 1PD6A 5KN5A 2AABH 1QBLL 1P1ZB 1E6OL 5ACMA 4OUUA 4CDGC 4QRSA 5I1AA 2VDPL 4NO0D 3SE3C 4TNWF 4LF3A 1BFSA 3VWJD 5I1CL 1ORSB 4NZRH 3REWB 5FOJA 1ZVHA 4XT1C 1ZA3B 2R29L 1U3JA 5ETUA 1A8JH 4E5XA 2DQTL 5IFHL 5TDOA 3UP1A 5KZCD 1UCTA 1MAML 4GQ9L 1MI5A 1OT2A 2FX8H 1UFUA 2NY7H 5I15H 3BSZH 4R0LC 2R39A 1JNNL 5ITBH 5AAWA 2AJYL 2YD3A 1S9YB 3BI9X 2YRPA 3SPVA 5I9QC 5BS0D 3HZKB 1DBJH 4OF7A 4MA3A 1VB9A 3DI3B 3LKNA 1V3KA 4MQTB 1MCOL 1UKQA 3ULUC 3BP6B 4GBXD 5D1ZA 2ESVE 5JMRA 1IAOB 2X4UA 4XVTL 1G7PB 1KB9J 2R2EA 3SDAA 1KG0A 4XC1L 4Y19A 4RX4A 3OAYK 5I1IL 3VFRA 3OKEA 4IRSB 1MHEB 1ZT1B 3FFCE 2XKNA 4FFZL 1CDHA 1JF1A 1O7SA 4OF6A 5CSBA 1VA9A 4AG4H 2CQVA 3BYYA 3GMOA 3BPNB 1ZSDA 3BX7C 4OQTL 5DJDB 1RJLB 4OT1L 4AL8L 2EDHA 3CNKA 5T1DH 2DWEB 2YPVL 1UXWA 3QDJA 3PDDA 4EDWH 1TQCB 1ZTXL 3KYOB 2HH0L 1JI2A 3ARED 4OCMC 4Y4KD 2P48B 2QHLA 3HMXA 2DQCL 4JREB 4QYOB 1YMME 3MJ8B 5JUEL 3MLVH 4P3DA 5MEQB 1FO0B 2BERA 3QHZH 3U46B 1AR1C 1OCWH 4KROD 5DJ8A 5FYKE 4OZ4B 3UYOD 3HE7C 2HRLA 1UM4L 1VGEH 3LN4B 4U1GB 3H6JA 2VE6A 3JV6B 1LO4L 3M8OL 4JZOA 4FRWA 2FGWH 4DUWA 3WIHH 2JKXA 1LNUB 4WHCA 5DEGA 3ZKNC 5ESQA 4I48B 3MJ9A 5D70H 3SDXF 3ZLQC 3T65A 3ULSA 2A6IB 3KPPB 4TSCL 1EDQA 4UUJB 4Z7OF 2HJLB 5B39G 4N8CL 3RVVC 1ORSA 5DO2D 5B21A 2HVKB 3REWA 2DLIA 1ZA3A 2GJ6E 2O5YH 3PWPE 1MF2H 4TRPL 4QWWC 4GRLC 4WHYH 1B90A 3BDYH 5FKAA 3HRZB 2NMSA 4M3KB 1XF4B 3GRWL 1S9YA 3IDMA 3HZKA 4R96A 3H2WA 1F6AB 2BNQD 3SGDH 3AUVA 2AKRB 1EXUA 1OAKL 3BP6A 3MV01 2KKQA 4L8DB 4F9LC 4Z5RB 5HYSB 1FO0L 1MAJA 1IAOA 2AEQL 2D4DA 2JJSC 4Y1AD 2X4RB 5TQ0L 2P5WE 3IF1B 4ZTOL 2Z31C 2GAZB 1YEGL 1OWWA 3GO1L 4ELMF 4WRLA 1MHEA 2D3VA 4R4FL 5F1IB 4LCWD 4YHMH 5L0QC 1KCVH 3QDMB 1INDL 1TJIH 4NYLB 4WUUE 3IFLL 2NY6D 5KAQG 4FQQB 4JFEB 1RJLA 1JUFB 2FL5B 4GO6B 1UM5H 3BXNB 2DWEA 4PJAB 1REIA 4YC2C 1EHNA 3GRWA 4XTRD 3T0XA 3ZL4H 3KYOA 5GQBA 2J5LB 1OSPH 4F2MA 1XR8A 3IJYA 3HB3D 2NY3B 2GIYA 1ZHLB 4OD2B 4QYOA 4S0SD 4K7FA 3MJ8A 4PJXB 3I6GA 4HDIA 4QOKD 1MOEA 3BKYH 3C6SA 1FO0A 1I9RH 3KPNA 3S97C 3U46A 1WZKA 2VAAB 2J8UE 4OZ4A 2Q87A 1OARL 3UPRB 2VZSA 2XI9A 5SV3A 1R5VB 1LP9B 3SGKA 5CJQL 3KPMB 5CGYC 3KLDA 1UEYA 4H26A 1NDMB 2DBJA 1NLDH 4MJ5B 5C09E 5C0EB 5EFIA 2R8SH 1H3TA 2L4OA 4J3WA 3SKMA 4I48A 3RVTD 4A6YB 2A6IA 5I8CB 4UUJA 2AGJH 2V2XB 2EE2A 4PJEB 1FNHA 3RWEB 3H42L 3LPGA 2HVKA 3RL1B 1VFBB 5DVMA 3ZTJH 1JBJA 1LO5B 3QCVL 5JQ6L 4PJFF 4DGIH 3TO4B 3SE4A 1CFSB 1FYTE 3DSFH 4NN5B 3HRZA 4ZTPL 3ARDD 1XF4A 4YXLH 3NA9H 5C6PB 4OCXH 5I76B 5LVEA 5ANMA 4YHIB 3ARFA 1F6AA 4MHHG 4X5XB 4XMLH 3ARPA 2AKRA 4OM0L 3DO3A 4L8DA 4WFED 4Z5RA 4OLVH 2VDLH 5HYSA 1X5AA 3R8BB 4XCYB 2ICWB 2IBGA 3VFOB 3IDYB 1I7ZB 3IF1A 1BZQK 5E24E 1CGTA 3T0EC 2X5PA 5F9WB 5D93B 5T1MA 3OG6B 5D96C 1D5IL 3TCXA 3ILQD 3KPOB 2B7DT 1HZHL 3CFBB 5F1IA 3QDMA 1SJHB 5FYJE 5BVPH 4A6YL 5EOTA 4LVHB 2YKLL 3BXNA 3GIVA 3MRNB 4OCRH 1VCAA 1JPST 4OZGA 2VDPH 1KXTB 4M43H 5JHLH 1U36A 1Q0XH 3W39B 3S37L 3M45A 3K4DA 3MFFB 5DQ9B 4PJXA 4DQOL 5I8OH 1IGYA 2VAAA 4DTGH 3UPRA 1XGTB 4DEPB 1B2WH 4GG6E 1LP9A 4Y5XB 3VH8B 4BSJA 1KLGB 3SCMB 2YD6A 1HXMB 4TQEH 4I0KA 3KPMA 3S8WA 4JN1H 1CDYA 4FQCL 2XA3A 4HZLB 1A1MB 2IPKA 5E08L 3QDGB 4LVNC 3HMXH 5C0EA 2VR9A 3QNZB 1VHPA 1AJ7H 1OGAA 4OD1L 5DFWH 1JHTA 5E6IC 5D2NC 4A6YA 3TCLB 1TQBC 4I9WE 4XVTH 5I8CA 1MFEL 2V2XA 3GMPB 4RX4D 4Y19D 4XVSH 1K3ZA 4PJEA 4NBXB 7FABL 1R3IH 1KYOK 3RL1A 1VFBA 2D9QB 3MNZB 5I1IH 1MLCB 1LO5A 3VW3L 1A6VH 1I8IB 1HKLL 2WWKO 3TO4A 3HA0A 3PJSB 1P4IL 1QA9B 3H7LA 4KK9C 3UZEA 3WXVH 1CFSA 3MJ9H 5EBLB 5FCUH 3VD4A 1KIRA 4RIRB 1N5YL 2HFEB 4CAGA 3OKNB 5I76A 4JKLA 4ZODA 3CLFL 1ZTXH 5CS7A 1Q72L 2NX5B 4RAHA 4YHIA 1DFBH 3CFJB 4HHAA 4YHZH 5IROA 1INEH 5KW9L 3SE8L 5TE4L 1GGBL 1GGTA 4XCYA 2ICWA 4DFIA 3H8NA 3WJLC 1P69B 4JFPB 1S7RA 5D7IE 5HHOB 1UM4H 3WV0A 4H0IA 3KPOA 3CFBA 4WI6A 5LWYL 1SJHA 3RWHB 2QBWA 4FFYH 3RA7H 5C0RH 1YEKH 4RA0C 3MV8D 4UI2A 3QYCA 3U7WH 3QT2A 4ZFGL 3L3HB 2GKIA 5EDXA 4UT6L 1UM6L 1K4CB 5IMLA 1CL7H 3RL2B 5JIIA 3BUTA 2NY4B 2KQMA 3GUTB 4HC1L 1VSCA 2CRMA 5INCB 3W39A 2VDML 4LPCA 2NXZC 4NJAH 5DQ9A 5FUCC 1KIPB 3MRJA 4XPBH 1A5FL 3RY4A 1CD9B 5T33L 4Y5XA 1AGDB 1DDHB 1KLGA 4MXVE 4ODTH 4MS8C 3RHWF 3SBWC 3SCMA 2R9HC 1HXMA 4KKCD 4PRDB 5ILTL 5D72H 3V52L 4HZLA 5I18L 1A1MA 1LILA 3QDGA 5C7XH 2CPCA 1UCBH 4KDWA 3L3DB 3VE0B 3NZHH 1P4LB 2D9CA 5C1MB 3TCLA 2OK0L 3DGGB 1OTUC 4AEIH 2APTA 3U36B 3GMPA 4PYGA 2FEEI 1JP5A 5H37H 3RZWA 1KCRH 4IRSD 3MNZA 1VENA 1JZ4A 4WY7H 1MLCA 1I8IA 2VLJE 5FGBA 4IOSD 4M6OH 1U8HB 4RMUA 1INDH 4LOUD 1TJHL 4XNYH 5GGSA 5FV2A 2J88L 5JTWA 3O8XC 4RIRA 4R2GC 1BD2A 2HFEA 5EA0H 5ITFB 4WW1B 4L5FL 4N68A 3BMWA 3OKNA 1B4JL 4XP5L 3CFJA 5LXGH 3DV6A 4K7PX 2NYYC 4RQQB 2HTLC 3BJ91 1G9NH 3IU4L 1G9ML 3SKOB 3HC4L 5IWLA 1KJ2B 4WI7A 1R3JB 4YE4L 4U1IB 3JWOH 2P4AB 5HHOA 3O4LB 2FIRT 5C0ND 3MC0A 1T66C 1DBBH 1E4JA 3TBWB 3PV6B 4Y4FB 5JHDE 3RWHA 1XR9B 3P9MB 3QEUB 2D2OA 3KJ4C 3D39E 1C1EL 3S4SB 4M5YH 3RUGE 4BA8A 4U3HA 4XC3H 5EORL 1U8KB 1G7IA 1K4CA 3EYVB 2AEWA 3RL2A 4YHOL 3H42H 4PY7A 2I60L 4O4YH 3BMVA 5JQ6H 3K46A 2JCCF 4F9PC 4KDVA 4RGOL 4MVBC 3NFSH 1J1OH 3O3AB 1KCSL 1NCAH 1DDHA 5A2IH 4Z8FH 2XYCA 4RWHA 5DLMH 5E1AB 3UYRH 4PB9H 3GI8H 5D1XA 2I5YH 4Q7DA 3VE0A 4OM0H 1P4LA 3DGGA 4HFWB 5GZNC 3U36A 3O3UN 1FZJA 3QIUB 4N90D 4GRWH 2OJZL 2P44B 4EUPB 1N0LA 3WLWC 5FUZL 3QDMD 3LEYH 1U8HA 1QSFE 3V5HB 4JFED 3ZKXB 1JK8B 2W0FA 1EEQA 3GHEL 5ACZB 5T5NF 4A6YH 5TF0A 1HIMH 4WW1A 1Z5LB 5J11B 2YD7A 5EZIL 2NY3D 5EN2A 5DD1H 4R90L 4Y89A 4N8VA 5HGDB 5I19L 1S3KL 4ZUSB 1A6AB 3VWKB 1U9KA 1V5JA 4KK6D 2CMRH 1G1CA 4OJFH 1CLOH 5EO9B 1FL6A 4DKFL 5CEZL 3U0PA 3HI1B 3SKOA 4HWBL 1KJ2A 2DICA 1R3JA 1FVDB 4U1IA 3I6LE 5HPOA 1CGUA 3BH9B 3TBWA 4HG4J 3PV6A 4ZFOB 1BVKB 5J4MA 1KT2A 1A0QH 3BN3B 1XR9A 1MRDL 3P9MA 1MCBA 3S4SA 3BKMH 3EDEA 4YDLC 1II4E 4H0GA 4LARL 4ZPTB 3ISWA 5GS0C 1J88A 1RIHL 3LRHA 4JHZA 3ARGC 3EYVA 4RMRA 1M6OB 4DJMA 4BK4A 4PLNC 4DGYL 3JV4B 1FDLH 3TO4D 2WWKT 4JO2H 3QWRD 5INDB 1MEXL 3O3AA 4HWBA 4P9MH 2HT3D 4UNTA 3K81A 4KRPC 4YR6A 2EZ0D 2WBWB 2UWEB 5GGRB 3OXRB 5AUMA 4JRWA 4FQ1H 1JGUH 4HFWA 3WKML 1P7HL 3AFLA 4Z7NE 1ZLSL 2DQDH 3ARBA 3K80A 4KMQA 1YYLL 3DVGB 1CFTB 2Z9TA 4EUPA 5E2TL 4ZFOL 4PR5B 3IT8D 1QLEL 3P77B 1P5VA 5LWYH 4P23C 3V5HA 1QD0A 2VABB 2XZAH 1JK8A 5ACZA 3BP5B 3B43A 3TVMC 3TC9A 3C6LB 1Q9OA 2EXYD 2OXHA 5I71B 4JHAH 4G42B 25C8L 3N1QC 1JJUA 1G84A 3F5WB 1NAMH 5HGDA 5KSUA 4ZUSA 4B5EA 1A6AA 3MMEB 3VWKA 1C8PA 2KZWA 1EERB 4ZFZB 5EO9A 5F7MC 4KXZI 5MI0C 4DKEL 4HUXB 2VLRE 2GTWB 4BKLB 2W60B 4NQCE 2R4RH 5T3ZH 1FVDA 1OAQL 1IGFL 3SCMD 1WVZA 5T33H 3K7UA 3BH9A 3GHBL 3QBTB 4IIQB 4ZFOA 2ZJSH 3QDGD 4XNXL 2FATH 1ZHNB 5GS1B 4ZPTA 3UJTL 4WFHD 3RY6C 3ZE2F 2FHBA 2OK0H 1ZLWH 1MFNA 5TPWH 3W0WB 3TYGL 4NKIL 1U8IB 5F21B 1J8HB 5L9DL 5E7BA 3U9PH 3VI3F 3V6OE 3U0WH 2ERJB 3UJJL 4GAFB 5INDA 4KTEH 4FNLL 4R7NB 1KCKA 4KHXL 5D5MB 5GRYA 3V4VL 2NX5D 4PB0H 2UWEA 5D7JC 3ULVF 3OXRA 4R97B 2HRPH 3VRIB 4M7KL 3HC3L 3GSRA 4D9RD 5GGVL 3KJ6L 2G5BB 4NBYB 3BGMB 3AB0B 3DVGA 4JY4A 4M93B 3G6JB 1JCKA 4PR5A 1HEZB 4JKPH 5B22A 3SDCB 2ICCA 3HI6H 3P77A 1X6NA 2VABA 3BP5A 5LAXB 4R7DA 3TJHD 3C6LA 2QADC 4QRPE 5SWSE 5C0FB 2DJ4A 1NGZB 5EORH 1ZLVK 2I9TB 4G42A 1ZE3C 1T7ZA 2NY4D 3F5WA 5FXCH 4YZFF 5GRXG 5BMFL 4YHOH 1BM3H 4NHCH 3MMEA 1I7TB 1NH6A 5DS8B 2DN7A 1FBIL 3VXQB 1A7PL 1F00I 4TSAH 5AD0B 1AD0B 4GLRH 4BKLA 2W60A 1OTSD 5IFJB 2DM4A 1OD9A 4P2RD 2F58L 1TFHA 3WFBL 1CXIA 2ZG2A 2J6EH 1YEIH 5HI3D 1CDJA 2PW2B 3RVWC 2EDEA 4IIQA 4BH7B 5I1KL 1A1OA 4JCLA 3FB6B 4HJJL 1LO3L 1IE5A 5IQ7L 1PEZA 1VPOL 2NR6D 1BZ7B 4UB0L 1KJ2H 43CAB 3W0WA 2KDGA 5C07B 3C08H 1WWWX 3F12B 3QRGH 4ZOCA 4NWUH 1A6UH 4H88H 5FUZH 1I8LA 3EO1B 3N9GL 2ADFH 3MGAA 3ETBF 5DJ6A 2BVOB 3T2NL 1W72B 1NC2B 5D5MA 5K33A 1YJDC 4NRYB 2UZIL 2GFBA 3EJYC 4R90H 4H1LB 1CVSC 1I8KA 3TO2A 4L3EB 3DXAB 1IKNA 2MNUA 2O5ZH 5CEZH 1WJ3A 4TVPE 5KSAB 2G5BA 4C83B 1AGBA 3O4LD 3BGMA 3G6JA 4J7RA 5EU3B 2NY5C 1F11B 4Y4FD 4Q6IB 1U8OB 1FH5H 4K3EH 1MRDH 3HTLX 4YBLB 5GGTL 5LAXA 4X4MA 2OTUB 2VR5A 3I50L 1ZVSB 3V5DB 5C0FA 2IFFH 4QGYA 2I9TA 1JZ6A 4X6DB 3U7AA 4J3OC 1KB5H 1OAYL 4JFFB 5C9KA 1I7TA 1U6AH 1A6PA 1GGIL 1NMAH 4HGKC 4G9FA 2Q3AA 3VXQA 1JWSB 2VC2H 4NUGL 4KJPD 2VLMD 4K9EL 5AD0A 4RAUB 5CEZD 4PRHE 5IFJA 1JNHA 4U2YA 5HVGB 1BPVA 2D7OA 2WINB 3VGHA 1TETH 1QFUH 4H0HB 4YDIH 3HE6C 3CDFA 1TIUA 5SWZB 1CGVA 2PW2A 4BH7A 5HHPB 4Q97A 3MA7B 4Q6YA 4TUOB 3FB6A 5IJKC 2HMID 2L7UA 1OAZL 1BZ7A 1MCPL 5D7KE 3OX8A 3WKMH 43CAA 3PNWA 1DQLL 4JM4H 1JGDB 5C07A 3HE7B 3QIUD 4Q0XL 4PLKD 3F12A 1YJDH 1T1YB 1ZAGA 5FO7B 1CR9H 4HPOL 3LN5A 5E2TH 4Q9RH 5IKCA 3ULUL 4HXAL 2A73B 5J3HD 4XNMB 4ZNEA 5I16A 4P4KC 1I9IL 3X14B 1W72A 3GSNL 5I30L 1U8QB 1MH5B 5H94B 3GBMH 2A77H 3RHWK 4H1LA 3GJEB 2IGFH 3VWKD 4KQ3L 4L3EA 3U48A 4DN3L 4O2CB 1LEIB 3TA3C 4NGHH 2XY1A 4LRIC 3VGFA 5DSCB 3WE6B 4XP9H 3HAEG 5IVOA 2EDLA 5KSAA 4C83A 4Z7QE 1RJZB 2A6JB 2X1PA 3CMOL 3TNNB 3I2CL 4GFTB 2V2WB 1F11A 2NW2B 4Q6IA 4PG9A 4B0MM 4V1DB 1G6RL 1CU4L 1S7WA 3RGVB 5C2BL 3I3DA 1MJUH 3MOAL 3UJTH 4Z7WB 2P42B 1IC1A 3D5OF 4AQ1B 4Y4HB 1ZVSA 3V5DA 4TN9A 2N1KA 2Z31B 5E9DB 1ORQA 4X6DA 1MHHB 3BPCB 2E27H 4D8PB 4JFFA 4Z7VE 4YH6A 5L9DH 3Q1SH 5SV4A 5EB9A 2R0LL 1JWSA 3EYQC 3UBXI 3WUZA 1E6JH 2PETA 3RWCB 2PR4H 3UEZA 5B3JE 2XWBB 4PJ5E 1XT5A 1NUFA 2L7JA 2YPLB 3JTTB 5DEZA 5SWZA 4KKBC 2GITB 3MA7A 2FD6H 1HILA 1HN1A 4N0UE 3FHAA 2VL5B 5F1NA 2XFXB 3BEWA 5JOEA 3A6BL 1T20B 3TH3T 3DO7B 5EOQH 3FT4B 4C56E 1G7JA 2OTWB 4P5TA 4OCNC 1JGDA 3DECA 2DQUH 2VKWA 3W82A 4DUVA 3SO3B 5FO7A 2XG5A 5AZEH 4IOFD 1NGWA 2A73A 2EYRB 3PV7A 4MYWB 4FQ2L 5CJOL 4XX1E 3VFWB 4XNMA 2HJFB 1IC4H 3X14A 3C6LD 1OTTC 5I6XC 4EVNA 5EU5B 2XZCL 3IDJA 4CGTA 5CJXC 1QR4A 3ULVC 1MH5A 5H94A 4PJGB 1AKJB 4PY8I 2HFGL 3KDMA 3HZYA 5EBWA 3K0WA 3QXDB 4O2CA 4HFUH 1LEIA 3JTSB 4KI5F 1P84J 1RUAL 5DSCA 3WE6A 3RU8L 4XNZC 1RJZA 2A6JA 4CMMA 3IFPA 5E0QA 3TNNA 5L7XH 2B1AL 1ONQB 3BZDA 3WO4C 5D7SL 2NW2A 4KJWD 5MHSE 2FECL 3PQYB 4V1DA 5FM5M 2QSQA 5EC2B 3RGVA 1Y18B 4NZUL 4Z7WA 1LO3H 4MCZB 5SWQB 1RAMA 4PJBB 3N1PC 4Y4HA 1LVEA 1NGXB 3W0WD 3DGCR 3SGDI 5E9DA 2Z35B 4HUUB 5AYQA 1MHHA 3BPCA 1J8HD 4P3CL 1EO8L 1K8IB 4I8DA 1DLFL 1FNGB 5DI8A 3TFKC 5F3BB 4I1NB 4HK0B 5LBSL 3RWCA 3K74B 2DBLH 1QHOA 2FBJH 4WFEE 2HWZL 3V7AG 1OB1B 4S1SL 3CX5K 2XWBA 1HHHB 3B9VA 1CFQA 4Q2ZA 5HHXL 3T2NH 3MXWL 3CSBA 4M1GH 4ZYKB 4YX2H 5KS9F 3EYFB 1F3JB 2GITA 1KB9K 1NGPL 4GS7B 2UZIH 5E5UB 4APQC 2XFXA 2BNUB 2AK4B 4LVOC 3DO7A 2AVGA 3HPJB 2LQRA 2OTWA 2DRUA 4GKZB 3OR6B 4AJ0A 1QNZH 1TVBB 1X7QA 5IVXB 4D0DB 3SDCD 1J5OH 4BZ1L 3NACH 3VFWA 1AXTH 1N64H 2HJFA 2QEJA 5K9JL 2VZ3A 5D2NB 1YNLH 4ERSH 1CFVH 4HMCA 5EU5A 3OTTA 3O3EB 1KBGH 2FLRT 4OFVA 1MI5E 4ZG1A 2OM5A 2YZ8A 1AKJA 1LE9B 4PREB 1V7NH 2ZUXA 5F7KC 3VI4F 1IBGL 4W81A 1L7IL 1R3HB 3NPSC 3LV3B 1I3UA 4YFLF 1NAKL 4M8VA 1OAXL 3CH1B 4NO2B 1W72H 3O4OC 3KPLB 2G9HB 3HS0B 5BZDA 4Y19E 2Q86B 1ONQA 2R56L 4M7ZC 1D5XB 2MQCA 5E6ZA 3PQYA 4H1LH 1MFDH 3QEGH 3D0VA 5EC2A 5F88B 3CVIH 1Y18A 4GRMB 1QKZL 1SBSH 1OAZH 4MCZA 5SWQA 1H15A 4AEHH 3TESA 1NGXA 1MCPH 1I7UB 1F4HA 4PJ8B 2NZ9C 4G8EB 5C07D 2Z35A 1DQLH 4HUUA 1RD6A 3VFTB 3I9GH 4CN6A 3QDJE 2F5AL 4HKBB 4Q0XH 2AAVA 2MWCA 5IV2B 1FNGA 5KVMC 3DX6B 5F3BA 2DKMA 4X80H 4MA8L 5I74C 1OB1A 3BP7A 1HHHA 3GBLA 1NC2D 2IQ9L 5I0DA 4XXCA 3HR6A 1ZANL 4ZYKA 1DR9A 1YN6B 1DVFC 4U7KA 4CVWA 1R6VA 3EYFA 4JN2B 4OLXL 3O0RL 1IEHA 1IFHH 3HI5L 3WJJC 1YC7A 3BZFA 4L3ED 3DXAD 2BNUA 4HT1L 2QV2A 4LIQH 3BPLC 4PLOB 2AK4A 2XN9B 1WAAF 1OD7A 1YZZA 4JKWA 4GKZA 5ADOL 3QUYB 3EUUA 5KSAD 4R8WL 2XTJC 4HUVB 3T0EE 3EYUH 5IVXA 3DTXB 3U6RB 4X6EB 5LQBL 3OJ2C 1XGYH 5J8OA 1AXIB 1RU9H 3BRGC 4JY6B 1O7VA 5C2BH 5F6HI 4PJ7E 3DETC 3IS1X 2QSCL 3HR5A 2VXUL 5KBNC 1LE9A 4XCCH 4JFFD 4KKAC 2A9NH 1UA6H 5TE7H 1R3HA 5K9QG 1PZUB 3LV3A 3VXPB 3BE1L 3P9WB 5A16A 3D9AH 5E2WL 3CH1A 4LK4A 1PZ5B 3O8XB 3TIDB 1FGNL 1UH4A 3KPLA 2G9HA 5BZWB 3HS0A 2Q86A 4O58H 1NFDF 2F53B 2V7NB 4KHTH 5SWZD 1CDIA 2DWDB 5F88A 3PP3K 1C12B 4GRMA 2DLTA 1GGCL 4YGAB 2A83B 5IBUG 1UENA 4KMTL 1GOGA 3ZYJA 4PJ8A 1UZ6E 4G8EA 4ELMB 3HE7D 3VFTA 2ZCLL 3QH3B 4HKBA 2CXGA 2PKDA 2MQ0A 2RCSL 3JXAA 1U3HB 5IV2A 2EKSB 5CJ8A 3HPLA 3STLA 1AGEB 5TE6H 5C6TL 4YNYB 3PWNB 1FGVL 2CIIB 1S5IL 4O51A 3ZKND 4CJ0A 3F7RA 43C9B 4KZDH 2VAJA 2EXWC 3WDJA 1RUKH 2YD8A 5L8KB 1NCDH 2OZ4L 3BGFC 2ADJB 4NT6B 4BK5A 1S9VA 4TOYH 2XZCH 3KYMA 1YN6A 4JN2A 2BNRB 3FQUB 1N7ML 2FH8A 5JQHC 2C1PB 4LSSH 3LSOA 4RDQF 1VEPA 4QWWD 3K1DA 2AEPL 5KJRL 1DBKH 4JDTL 4MJ6B 2XN9A 1F3DJ 1RUAH 4OZIF 3OKDB 1PDKA 1F4XH 3QUYA 3NOIA 3RU8H 2XXCB 4HUVA 4NNPH 3DTXA 4XCNB 4X6EA 3TNMB 3U6RA 3I6KB 4I4WB 2QQLH 4PJIF 5I1GL 5D7SH 4V1DD 3SDXA 3MGOB 4DOHE 1IAIM 3RGVD 5MEPA 1F4YL 3MV11 5IHZB 2FX7L 3IFOB 1L0QA 1TNNA 4NZUH 3QPXH 4Y4HD 2GCYB 8CGTA 2Z31D 4GAYB 5E9DD 2LABA 1B0WA 1KTRL 1S7XB 5T1LA 3HUJF 2DAVA 4PJFB 5JNYB 4OUOA 4X7CC 3O9WA 3RQ3A 4TSBL 4HXBL 4AM0B 1W0VB 5ANME 5C0CE 5CZVL 1LEKB 4PRPE 1TZGL 3IXAB 1IILE 5FUCE 3FB7B 5T1KA 2K7QA 3VXPA 5DEFB 4YBQC 1U2CA 2BVPB 2VXSH 2Y07L 2APWA 3TIDA 5J06A 4Y16C 4ALAL 4LCCC 2CSPA 2YPLD 5HHXH 4N1CA 1JF5A 1UJTA 1ITCA 2V7NA 3MXWH 3MCG1 3QJFB 4XNQA 2FO1A 1RVFL 2BX5A 3OG4B 1C12A 5C3LD 1QFPA 4AY0A 2IALB 3KPSA 1M7IA 1H0DB 2WSKA 4DGVL 1LO2L 1J10A 2KQNA 3QH3A 4JKKA 3C09C 2I24N 1U3HA 4OZGE 1IZKA 1EMTH 3GJFK 4ENED 4UNVA 5CFHA 3BZEB 1AGEA 4ONHA 4YNYA 3PWNA 1KENL 1MFCH 2CIIA 1CS6A 4PJDE 5IT2H 4CBPA 4BZ1H 3GSQA 4M9PA 2OP4H 5TQ2L 1BBDL 2ADJA 1HK6A 4NT6A 1LHZA 1QFHA 3ARGB 4CVXA 1DL7H 3DOSA 4FZ8L 1FZKB 1AKJD 4GRWE 4XI5D 2BNRA 1EFXA 3VXRB 5F7NC 2C1PA 5T3XH 3ESVF 3WEXB 4BQBA 4JFOB 1C5CH 1ND0B 3OKDA 1OGAE 3T3PF 5CMAB 4O2FA 1YYMH 3LS5L 4K8RC 2A38A 5AWNL 5J1AB 2JIXB 3UTTE 4K3HA 5DC9B 5IFAH 4XAWL 4X7TB 3TNMA 5B4MC 3CK0L 4KRPB 3I6KA 1NFKA 2OS7A 3NIFE 3PQYD 3MGOA 12E8L 4LCYB 5MERA 5CBAB 5MP6L 5HHQA 4HQQL 5D71H 1ZEAH 2HN7A 2GCYA 4XVUD 4GAYA 1S7XA 3MGTB 4JFZH 2YUZA 1KPUB 4PJFA 3UDWC 4AM0A 1R3LB 5E03A 5DMGD 4G6KH 1DUYA 4HIXL 4MLSA 5DF0A 3AVEA 3WS3A 2GY7B 5DEFA 1IM3B 5GS0L 4K2UH 1SJEB 1NCWH 4HIIB 4HBQA 2EH7L 2W9DH 1UWXK 3QUML 4UT9L 5J1SC 5HVHC 2R23B 4OLXH 4PJCB 5M95B 4DCQA 4TTGA 2VZTA 4K07A 3QIWB 5AZ2H 2AK4D 2IALA 2W9EL 3VFUA 1H0DA 1WZ1H 3HZMA 4OTXH 4JKMA 4WFFD 2BY1A 4NKOB 3S3JA 5I2IB 2FEDC 2N7BA 1HH6A 4R8WH 3ZE0E 1WT5A 3BZEA 3UC0H 3HNTL 2P8MA 2NY1C 1MUJA 1I3RB 1U8PB 3GIZH 1YNKH 2CXKA 2YWYA 2R15A 4GSDH 1RZIB 4K8RH 4XRCB 4C4KO 2YD4A 4GAGH 1Z3GH 1A1NA 5GS3A 1WISA 1WIPA 1FZKA 2B1HH 2V5TA 3TPKA 3VXRA 2ICWI 3GNML 3L9RA 4Y88A 2EE6A 4LDEB 3WEXA 5K9OB 2BMKA 1S5HB 4JFOA 1N0XL 3QDGE 3WSQL 3T1WA 5KSVA 3BPOB 2AK1L 5AEAA 1AY1L 4WUKH 1XCTB 4K7PH 4WFHE 3PWVB 5J1AA 1HINH 1A9BB 2JIXA 3VFNB 4Y2DC 5GRZA 1HYSD 4NFCA 4OGAD 4X7TA 4POZD 3FAWA 3LMJL 3R1GL 3V6FA 4DK3A 1FFPB 3BGAA 4NNYB 5DRXB 4QXTB 4MA1B 5GXBB 5CBAA 1JTOA 3GSOA 4NM8H 3X3FL 3U1SH 5DMYA 1GGCH 4LGPB 4PJ8D 4JM2F 5T3ZE 3MGTA 4X6FB 1BD2E 5HVWA 5ICYB 3HZVA 4FMKA 1FFRA 1R3LA 4U1HB 4YDKL 3HHRB 3QWQB 1IGMH 1D5ZB 4PJ9C 4G6AC 7CGTA 2BSED 1IM3A 3NFNB 4WI9A 1SJEA 1XF3B 4HIIA 3QQNA 5C0GB 5F9AC 1IGIH 2A6DB 3T77A 3VDAA 4GKOA 5HHOE 1G0DA 1WEJL 4LSDA 1ES0B 3DYPA 1CLCA 2R23A 5I73B 5KSBF 2NXZD 3MJGX 3LAFA 5DRWB 1CGXA 5DZOA 3WYRA 1B6DA 3QIWA 5EBMB 2JJWA 2XN9D 4WI4A 4JDTH 3K4AA 1A4KB 3QUYD 2KUTA 2HFFA 1J0ZA 4JQVC 5DR5H 3S34L 3RWIA 4NKOA 1I9JL 2R9HD 4JJ5B 5JR1L 3ARSA 5BVJA 1F8TH 1PG7X 5DD0H 1A02N 3THMH 5CCKH 1J86A 1U8PA 3DV4B 5DZNA 1F4YH 3CMGA 3QFJE 4J3VA 1RZIA 4U31A 5CKGA 4FXKB 2GUOB 5B8CC 1MY7A 5IF0A 3S5LG 1K9TA 1LDPL 3PDGA 4ORGA 1CXEA 3F65A 5BXFB 2JCCB 3MRRB 4LNVA 4WGVB 5K9OA 1NGQL 1S5HA 4WO4C 4F3FB 4HG4K 2ZUQC 5CJ5A 3TH4T 1WCBA 3O8XD 4PBVC 1CZ8H 1XCTA 3PHQA 1XF2A 4HKZA 5EC1B 5FM5O 4LSQL 1PKQB 1HHKA 5CZXD 5IBTH 1A9BA 3VFNA 1CFNB 1OP5K 3EYOB 4MXQD 2E7MA 2F53D 3QZWB 2D7QA 2YSSB 3B9KC 2Q6WB 4RFOH 1FFPA 2NYYD 5DRXA 1UYWH 4F15C 4S1DC 1RVFH 1N6VA 3KR3H 5L2KB 2WBJB 4X7DC 4M00A 4FQXB 5F72S 1N4XL 5C71A 4ZS7H 4R26L 4NZTL 1LO2H 2IPTL 2EDFA 4Q9QL 3NH7L 5ICYA 5CUSL 1WBYB 3MLRH 1U3HD 1L7TH 2W0PA 1T66D 3ZYZA 4U1HA 4R3SB 2I25N 3KYKH 3DX8B 3EW3B 4QT5B 1D5ZA 2Y36H 5A1AA 3WFZA 4L9DA 1K2DB 3NFNA 3O6ML 2H9GA 5TQ2H 2WWMD 4XBGB 5HDOA 1NMCB 1XF3A 4N5ED 5C0GA 4JZJC 3KLHC 4EBQH 2A6DA 2E7BA 3VDBA 2BNRD 4FZ8H 3DMMA 1ES0A 2DQHL 4DAGL 5DRWA 4FXGB 5C08A 3GBNL 5EBMA 3RNKB 1DQML 4K94C 3RKPA 3NBNA 3IKCA 1KN2H 4U1JB 5DQDL 4MAYB 1MAKA 4JY5H 1OW0C 3UO1L 4JJ5A 5H35B 3NCJH 4GLRI 3GSVA 3RBGA 2ZUWA 3BKCL 4JPIB 4X7FC 3DURA 2CKBL 3WO3B 12E8H 1JV5B 1V05A 3E8UH 3DV4A 2CJUL 3ROLB 2VDOH 4ZO8A 4F37F 5CEZE 5DA0B 4UIKH 3VG9C 4FXKA 2GUOA 2ARJB 3F58L 5MENB 2B39A 4UQ3B 4OSUL 5F89B 5BXFA 2WANA 1S9XB 2JCCA 3QO0A 2V2TA 4H20L 2E7CA 2NQCA 5ECJE 3ARYA 2FBOJ 3LH2H 5DMJB 5CEYA 3MRDA 2C3VA 3V4UH 3MV9E 3EDJA 1OP3K 5F9DC 4DFHA 4GG6F 1PKQA 3MX0A 5I1EL 4MSWB 4YWGH 3EYOA 1HCVA 2H1PL 2CK2A 4LHJB 3QZWA 2YSSA 1A9EB 4LMQI 3BOVA 4JFHE 3IJHB 1GAFL 5L2KA 2WBJA 3NCBB 3BQUC 2VISA 1PY9A 4FQXA 2IADA 1VKXB 2LU7A 3TA3B 4XPAL 3WNLA 3O6KH 2ZPKL 4KKLC 4KK5C 1KIQA 4FHBD 4HW6A 3VXMA 4M4RA 1WBYA 5KOMC 3G9VA 4R3SA 3PHSA 4NKMA 2ICES 4QT5A 3DX8A 2MHAA 4XWGH 4RGNC 2C3GA 4LLVB 4J4PA 1K2DA 5GZOC 3TIEB 5GS0D 1U3ZA 1AI1L 4QHMA 4C4KT 4LASH 3ARGD 3FKUS 3FN0L 3O6FC 1N26A 2AQ3A 3CUPB 3VXRD 3MV7B 2VDQL 4JFDB 4L8BB 4G6FB 5DRZB 2BHZA 1G9EA 5IBLD 4E9LA 5E4EB 1FRGL 2QQKL 4MAYA 5D7IF 2JIXD 1R5IB 3JWNC 2ZCKL 5H35A 4KRPD 2ICEB 1N6QL 1JTTA 3RDTB 4GW5B 1P4BH 4I0PC 1JV5A 5A3ID 4ONOA 1EJ6A 3BP4B 3ROLA 3PDOB 3ZE1E 1KSRA 4FG6D 1EUTA 4PV9A 1IGTB 1I1YB 1X9QA 2W65B 5MENA 3P0YH 4UQ3A 1I8MB 1S9XA 2P24B 4HUWB 4M62L 2B2XL 5E8PB 4D94A 2LTQB 4WV1B 3QAZC 2UWEE 1KPRB 2JJTC 3GI9L 4JDVB 5IW6B 4Y5YC 4I2XB 4KMLB 1T7WA 4FQJL 5EWIL 4MXVF 3MNWA 4IJ3C 4CVZA 3TH2T 4MSWA 1A4JB 1JHKL 3DARA 3CXHJ 4X6CF 1A9EA 3R06B 3GDBA 3OKOB 3IJHA 1H8SA 2VLLB 2DM2A 3GSXB 3HAEB 2YK1H 1RIUH 4G5ZH 1JTPA 3QIWD 1VKXA 1I85A 1CIUA 1FFOB 3HRPA 3IGAB 1K5NB 4RISL 4F33B 1DQDL 3S34H 3WS6A 2OSLB 3GM8A 4LLVA 3OZ9H 2NXYC 3LQZA 2W92A 1JWUA 4KY1L 5IW1B 4N9OB 3E6FA 2IMNA 5E6YA 3KXFB 3CUPA 3QXVA 2VH5H 4AMKH 3QCUL 5CIPH 3MV7A 4ZO6A 4JFDA 4L8BA 5JOPD 5DRZA 1T04B 1HDMA 2D7TL 2ZSVA 3MXVL 4PY8J 3LKSB 3MRKB 2OMBA 1T4KB 1LEGB 4YUEH 5JXEA 5J12B 1SM3L 3VFPA 4G6JH 1BX2B 2DMKA 4Z18A 3LEXB 5DT1H 4ZPVB 4X7SL 5HYFA 3ULVL 2G75B 3OAZK 2ICEA 3M07A 1RUQH 3CCHB 2JJVA 3RDTA 4GW5A 3BP4A 1AO7E 3BN9C 3PDOA 4WTZG 2EDYA 2LAAA 3ZDXE 3Q48A 4LVOB 5C0IB 3BD4A 2NPLX 1IGTA 4NM4H 4YHLH 2W65A 5FGRA 2WLYA 3MYJB 1QBBA 2BHUA 3AY4A 1I8MA 5FK9B 5D5ME 2EC9T 3NTCH 5E8PA 4WV1A 1J12A 5GISH 4F7EB 1KPRA 5AAMA 1KC5L 4JDVA 5IW6A 3P11L 2FYYA 2OTPA 4I2XA 4XPFH 1DN0A 2HT2D 3ECBA 3SDYH 4QHLB 1A4JA 4G8IB 5C9JA 4HLZH 3MLUL 1NCUA 1RUPH 3R06A 2CLRA 1L6ZA 2YS4A 3G6JE 3OKOA 1CF8L 2DQHH 4UQ2B 1YN7B 3GBNH 4CUCA 2P45B 3WFDL 1FFOA 5ABDE 5KVGL 2X4SB 3IGAA 4X4ME 1K5NA 4HMEA 4F33A 3O4OB 4UDUB 4ZUWB 1NBVH 4J3SA 2R0WH 5HDQL 1AQDB 4P59L 4M7ZB 1FIGH 2X41A 4FQPA 4I0CC 2AJUH 4YHYB 2PYFB 4G9FE 4PUBL 2ARWA 3GJFB 5HHMB 4L3AA 32C2B 1G7QB 2F54B 3D25B 3TZVA 1QR1A 3QHTC 4NNXB 1NKOA 2HAZA 5I8KH 2R69L 3KXFA 2DQGL 2BC4B 3T8XB 3MLWL 1T04A 2VZUA 4G3YH 4I13B 4HUKB 4UTAH 3MRKA 1E27B 1NCTA 1LEGA 1J0KA 4CU7A 1HI6B 1WWBX 2YHGA 3RVUC 1BX2A 1F02I 3DRQB 5EU6A 3LEXA 1G7HB 2G75A 4WWKA 3VD3A 2PXYC 4OLUL 3FQWB 5FYLL 4EI5B 5L2KD 2WBJD 4NIKB 4U0QB 3U7YH 2K1MA 1W8OA 4FQXD 3LQMA 2VTFA 1PKOA 5EIIB 4UOW0 2DB8A 4OQ1A 5KVFL 5C0IA 1LK3L 2PCPB 1R3KB 1X5ZA 1BHGA 1UH2A 3T4YB 4XMKL 1UWEL 2WW8A 2XTJB 1CICC 3JV0A 5HI5C 1SY6L 5IB4A 1NKRA 5FUOH 2VDRL 5C0DB 1VESA 1JGLL 4OGYL 4AH2B 4F7EA 1JZ3A 1YDPA 4QTHB 3BISA 4J4PD 3SJVB 1RFDH 1DANT 1X5IA 2X4QB 5M7QA 1F90H 4G8IA 1C7SA 2AXFB 2VDKL 5FM8A 1E4KA 2R1YB 3WBDA 3MFGB 3DNKA 2VDQH 1V7ML 4UQ2A 2HLFC 3D6GA 4ONGL 4Z7NF 3OB0K 1A6ZB 4MAYD 1FRGH 4HIHB 3OKKA 3MOQA 5F6IC 2EIDA 5DUBB 4ZUWA 3AXLB 3D48R 5F93C 3MRFB 2F19H 2V5SA 1PVHA 1RZGB 3RPIB 3MRCB 1YECH 3AS1A 4H8WH 2PYFA 3LQAH 3OR7A 3EIFA 4O9HL 4LIQE 4PD4J 2FSEB 3I84A 3WL9B 4HJGB 4PGJA 3SQOL 1KTKE 1Y0LB 1G7QA 32C2A 3D25A 3M1BA 3QNXB 3QUKB 4QKXB 1YEJL 2IH3B 5MEND 4NNXA 4OLEA 1E4WL 1SYSB 5F6HJ 3LPWA 2P47B 1UXSB 1J0HA 4YHNB 2IJ0C 4EI6B 2BC4A 3T8XA 4EJ1C 2B2XH 4JG0H 4I3SL 2QTEA 4HV8B 1MPAL 1T03H 3P4NB 1E27A 1CTOA 1HI6A 1ZHKB 3D85B 4LPTA 1JWMA 1UC6A 3DRQA 3FOLB 1FHGA 1G7HA 3KPRA 5IUSA 3L95B 3P4OB 1WC7B 3G5YB 2EDRA 5GRWA 5DJ2B 2YPKB 3KS0H 1U92B 1NBYB 4EI5A 5CSZB 2IANB 3IU3B 3TT3H 3DIFB 4CL7A 5EIIA 3WHXA 3TA3D 3W2DL 5K9KA 3VD9A 2PCPA 1CE1L 1R3KA 2QR0B 1ERNA 5JPMA 3PL6A 4NP4L 4KTDL 3T4YA 3S9DB 5CILL 5CD5C 5C0BE 1LE5A 5IESH 2GSIB 1V3MA 4LEXL 4JO4L 4QF1A 1D9KC 4AH2A 2WM0A 4JFQB 3OWEA 2P5EB 4F57H 5HYJB 3V4PL 3EFDL 5TFSL 1P2CB 3MRHB 2Y7QB 2X4QA 1IKFL 5DQJB 1KPVB 1MIMH 2AXFA 5EZJB 2R1YA 3QPQC 3MV7D 4ZXBC 4YQXH 4JFDD 4G6FD 4HX1B 1QOKA 4P9HC 5E99H 2P7TA 5I8EB 3QQ3B 4NC1C 1F6LL 4V1DE 3MODH 3UTSB 3AMKA 4NQXA 1Q1JL 1A6ZA 1A3LH 5C0JB 4HIHA 4MD4B 4LL9A 1KACB 5L6YL 1IVLA 3AXLA 3MBEC 3MRFA 3FAXA 4KKBD 5IBUB 2UYLB 4Z95H 4MNQB 3RDTD 3RPIA 3MRCA 2R0ZH 4M48H 4AEEA 1MLBB 3OAUH 4NSKA 1BQHA 1OAUL 3MLSL 2FSEA 5IVZA 5BV7C 3S37X 1SBBA 4U0RB 3KYNB 4HJGA 3QUKA 1IC5H 1CD1B 1OY3B 3QNXA 3CFDB 4XPHH 2IH3A 1PW3A 4JPKL 4HSQA 3HG1B 1SYSA 1UXSA 4M1DH 3SKJL 4AIOA 1ZHBA 2GI7A 3C09B 2QHRH 3A6OA 2CIKB 2BSTB 1UWGH 2F5BH 2ZP0T 4CMHC 4ODVH 5CLWA 4M7LH 2JB6B 4J6RL 1E4XL 1RIVH 3INUL 3IB4A 2LU3A 1I1AB 1IAKB 3P4NA 3VJ6A 1C16B 3D85A 2EO1A 2Q8BL 3V6ZB 2BVEA 1F13A 3FOLA 1RJYB 2R0KH 4XBEH 1FG9C 1RI8A 2VXQL 3L95A 3SOBL 3VXUB 4IS6A 4OD3H 3ULVD 5DJ2A 3CSGA 2YPKA 4QXGH 4TULL 1U92A 3MRPB 2IANA 1EK3A 3ARRA 3DIFA 4MD0B 1IT9L 1Q8MA 1T0PB 4WW2C 2CGRL 2QR0A 3RPKA 3GEWB 4UBDD 4JRXB 3TJEL 2X05A 3QB7C 2GSIA 1S7QB 4GUPB 3AC0A 1QG3A 4JFQA 3O2WL 5HYJA 2P5EA 4O2EA 3L3JB 1P2CA 4JO3L 5DC4B 3MRHA 2Y7QA 4WEUD 5DTFB 3RAJL 4P2QB 1RZ7H 5DQJA 1NEZG 3N1MC 4YGVB 5EO1B 1IQDB 3MLTB 2ZCHL 3JVGC 2X4PB 1KGCD 5FHBL 3DWTA 5EZJA 2FIKA 5IJVA 1ITBB 4D9LH 2OI9B 3KXFD 2Y1VA 4YHPB 5ICXB 1F58H 2Y4SA 5FGCE 1RZKC 3DRTA 3U4BH 1T6WA 1B9ZA 3MLXH 4B7LA 3TFKD 4NWTH 5I8EA 3QQ3A 3MLWH 4E41B 5BOZG 2WUCH 3UTSA 2ENYA 3BVNB 5C0JA 1RSFA 4MD4A 2X10A 3SE9L 3X12B 1YA5A 1J0IA 1W0YT 2V9RA 3DVNB 4PJHE 2UYLA 3VU2A 4MNQA 4TNVK 1YEHH 5T3XE 2CUMA 1MLBA 1UZ8B 1TJGL 5HDBE 3PWLB 3KYNA 4G7VL 4LHUA 1CD1A 4Z77B 1LK3H 2YMXH 3CFDA 3WD5L 4L4TA 1EGJH 1FNSH 3L1OH 5FHAL 2V5YA 4OGXL 2CIKA 3OPZH 3WNOA 2F9BT 4WJ5A 2JB6A 1ACYH 1A64A 5IHBA 1T1XB 4AZ8A 1I1AA 1IAKA 2WV3A 3SY0B 1C16A 1I9EA 2FO4B 35C8L 3C9NB 5F7HA 4M6ML 2AK4E 5HSFA 5KS9A 3V6ZA 1QSZA 1RJYA 3G6AA 1YQVL 3MACH 4YHKL 1F6FB 4YXKL 2IAMC 5FYLD 3QWOB 2DD8L 3BAEH 3DYOA 4EDXB 4CW1B 4MD0A 5KVDH 3Q5TA 1AHWC 1SJVA 2VL4A 3G08A 3OKYA 3S36L 3FZUC 4W4OA 4RSVA 4JGJA 4M03A 4P57B 3V0WH 3TBVB 4G6ML 5GGSY 1IC7H 1KULA 5FAAA 1RZKH 4GUPA 3BKJL 3LIZL 4KVNH 3PGFH 2VLKB 5KZCB 3L3JA 4UTBH 3BZ4B 5DTFA 2D31B 4P2QA 2DF3A 5HHMD 1GSMA 1BVLB 2HKHH 4YGVA 2F54D 5EO1A 1IQDA 2VZ1A 3MLTA 4LSUH 2JF1A 2X4PA 5FB8B 1IAIH 4YHPA 5DD3L 5ICXA 2QQNH 2DQFB 1D6VL 3PP4L 2K3TA 4GBXB 2A6KB 1UQSB 2ZWLT 4ZOEA 4E41A 2KPNA 4PJ9B 2ICWJ 3T4AA 3SGJC 2A1WH 3BVNA 1C7TA 5H2BB 3NAAL 3MBXL 1WFOA 1DEDA 5HHVL 4Z7QF 1NFDB 3X12A 2ZUUA 1QRNA 3RTQC 3E2HC 1MREH 4YLQT 4EI5D 2Q3ZA 1AGFB 1OPGH 2DJSA 1WK0A 3PWLA 4CADB 1AE6H 4CKVX 2ATKB 3C60A 4EIGB 3A67H 1QBML 2H6PB 1F3RB 3RVXC 5JXAL 3NABH 2XTJD 4P2YA 4OBRA 1A7RL 3WDIA 4OCYL 1H3GA 1IQWH 5DHVB 3SDDB 5FA3B 5I1LA 1T1XA 4YXHH 2B5IB 4OZFG 3JWDC 3UAJC 1DBAH 5SX5H 3SJVD 2B8OT 3SY0A 1JIBA 3CFKA 5ENWB 1ADQL 3D69B 5DD5L 1NCCL 3P73B 1ETZB 5LCVL 2AJXH 4KKAD 3MRGA 3QWOA 1WAAA 4WO4B 4EDXA 4OZIB 3ULUF 4CW1A 3SDXE 1BGXL 2GSGB 3FB5B 4NQVB 3T1FB 3CLEL 3E6HB 4JPWL 3MLZL 4Z7OE 4F58H 4J23A 4P57A 2F8OA 2OXGA 3TBVA 4PJIB 2AEIT 2HT4C 3LEVH 2WNGA 1YY8B 3WLBA 1B0GA 4Z9KB 3W9EB 2X4OA 4X0KA 4OZHE 4G80B 2D31A 1P6AB 1BVLA 1J1XL 3HUJB 5BS0A 2EDBA 3HNVL 5FB8A 5HYQA 2I07B 2GTZB 2BXYA 2DQFA 4GBXA 1A6WL 3WFCL 2VXVH 4AT6A 4NZDA 1IMHC 4K23L 2V17L 3WIIL 3L3IB 1FFNB 1KNOA 4JAMB 5C92A 3U30C 2PTVA 3D85D 4I18A 4PFEA 5D7LB 3KPSE 1EJOL 1MJJB 1Y6KR 1NFDA 1KTLA 2F15A 4P2OC 3DVIA 2EEDA 3KGRA 3EO9L 4HIJB 4S1QL 4JRYE 1IM9B 3X3GH 2C3XA 4Y5VC 3MCLL 3NCCB 1HKFA 1RZFL 4CADA 1IT9H 3V0AC 2ATKA 2CGRH 2H6PA 3D3VB 1P9MC 3EJZD 1BOGA 3C5ZB 1T7YA 1KJMB 4OCWH 4GKNA 5HYJD 5DHVA 2P5ED 1SMAA 5FA3A 3SDDA 3L3GB 4OCSH 1T6VN 3O2WH 4JO3H 3S5LB 1Q94B 1RULH 5D1QB 1B6UA 1NL0L 3ARXA 2VZVA 3D69A 4RWYL 3FRUB 4YDVB 1ETZA 4UNUA 5JA8B 2AI0L 3WFEL 1K8DB 5EPMB 3O3BB 4KI5D 2FHFA 2MPAL 4KAQH 2X6MA 2G60L 4OZIA 3LD8C 5J56B 2YXMA 5IW3A 4LAQL 3UTSD 3T1FA 1DBML 1FAIL 1BQLL 1CYGA 3TV3L 1GGUA 2DLFH 4PJIA 2A9MH 3K8LA 4PGDB 4BYHA 1YY8A 4WHTB 4XVJH 1TTUA 4MNQD 4CRPA 3H9ZA 3W9EA 3BEVB 4XB7A 3SN6N 1PSKH 4GXVH 5F1OB 3BQUB 1GIGL 5T5FL 5HGGS 4G80A 4K94L 4L29B 4LCIL 4BFIB 3HUJA 1QFWL 3HG1D 1NSNH 3UBXG 1EAPB 2BNQA 5BQ7B 2I07A 1MNUH 4LLYA 4P46B 5DYOB 1HHIB 2RB8A 3KPQB 1I1AD 2VMFA 3L3IA 4ODSL 1FFNA 3DUUA 4JAMA 1L0YA 2DM3A 1DUZA 3QFDB 5D7LA 4FA8A 1MJJA 3FOMB 4G9DB 4EQ2A 3VWJC 1TXKA 3VXUD 2FB4L 3QEQB 2Q8AH 2QSTA 2P8PB 4MZ2A 2ESVB 4E0RB 4JO1H 2FJHA 3P4MB 2ORBL 1A7OL 2DD8H 3TM6A 4G7YL 4N0CD 1T83C 5I1JH 5GRUH 2MJWA 2YN5A 4DN4H 3D3VA 3EHBD 3MA9H 4JRXD 3FFCB 3C5ZA 1KJMA 1U8JB 3R8QA 3HNSH 1BAFL 3WN5B 4PJGF 4G6MH 5B4MD 4YEEA 1DSFL 1HOCB 4XP1H 4QOKA 2ID5A 5E4IA 4RBPH 4DK6A 4G43A 1Q94A 2WIIB 4XCFL 2WP3O 3K4ZA 5D1QA 1A2YB 5ALCH 3PGCA 3H7BB 4XAKE 1TZIB 4YDVA 3NGBB 2OX5A 5JW4M 1CGSH 1I4FB 5F9OL 5L88L 3G5VB 5E2JA 1CTNA 1K8DA 1U58B 1YMMB 1N6UA 3O3BA 5EPMA 3A0OA 3LCYA 5LGHL 1JGEB 5DUPH 3QAZB 5CLTA 4E41D 1Z9MA 3AU1B 1NEUA 3VFGH 4MXWH 2VXTL 4WHYG 4Y4KC 3AREC 3AAZB 3MBXH 4IJ3B 4DVRH 3AS0A 4ODWA 3V79C 2KZ1B 4S1RL 1T89A 4PGDA 1JFQL 2ADGB 1ZA6A 4ESKA 1FZMB 3QXAA 4MZ3A 3BEVA 3RBSA 1GXEA 5GGUB 1WTLA 3ARDA 4XX1G 4LPXA 4JM2B 4PJ7F 4JFXB 1SVZA 4BFIA 1GGYA 2DOCA 5I1HH 2JELH 1AP2B 4YIQA 2GJ6B 1QBMH 3QUZB 3PWPB 3L7FB 1YY9D 3HLAB 4M8QA 4P46A 4TPRL 5DYOA 1HHIA 3NA4A 2X70B 3V0VB 3KPQA 5EU7C 3T2QA 1NMBH 5JO5B 4ZD3L 1ZGLB 3QFDA 2H32B 2AXHA 3FOMA 4G9DA 4XBPB 5DO2C 5CP7B 1NPUA 4A2LA 5C2UB 1PLGL 2EH8L 3MLYL 1DLHB 3QEQA 4WI3A 3N85H 2P8PA 4U6YB 4E0RA 4QTIH 3MV8B 3QHFL 5IB1A 2DL2A 2VDNL 5FYKL 4PYHA 4U1LA 2P5WB 4HIEB 2VN7A 1J05A 2YUXA 2XQBL 4JHBA 4HULB 5BW7A 4HCRL 1FORH 1U8JA 3MCKB 4NQTA 3WN5A 4ZAKB 4WUUB 3TN0C 1C5BH 3LKOA 4FTVB 3BESR 2VLKD 3FFDB 3TEUA 4RGNE 1BWMA 4IRJB 2WIIA 3BT2H 5EOCH 4X8JB 4L9LB 4Z7UA 1A2YA 4HGWB 4PLJD 1J1XH 5FOBB 1TZIA 4BFEA 2QJDA 3TPUA 2OCFD 1MJ7L 1I4FA 3V8CA 5BJTB 3G5VA 3QXUA 1U58A 1YMMA 1FCCA 4WI5A 1O5DT 3RP1A 2NY6C 1JGEA 5JZ7C 2YRZA 3ZTJG 2NLJA 3VXSB 5DHVH 4MA7L 2J8UB 1CLYH 1D3CA 3AU1A 2BSSA 4PJ9D 5E8DL 3WIIH 4N0FB 2BCKB 4XTRC 3VD5A 3LZFL 3AAZA 3F7VB 1EJOH 3GGWB 4HCRA 1WUNT 5C09B 1LK2B 1KEML 4LSVL 5FIEA 3F7PC 1SJXA 5KOVC 1S9WA 3K2UL 1K85A 5L8JB 3LRSA 1EUUA 2EO9A 2H2SD 4JM2A 3ZHKA 1WWAX 4JFXA 4XPGL 5F96L 3QUZA 1X5GA 3PWPA 4UAOC 4QRUB 3L7FA 3S88H 3V0VA 2X70A 3MZTA 3H3PH 3L7EB 1FYTB 3ZYIA 3SDDD 5HD8C 5JO5A 3LB6D 5GGQL 1ZGLA 1KJ3H 4XXDA 5LGKA 3U4EA 5C08E 1CLZH 2H32A 4XBPA 1FPTH 3CFEA 3WFHA 4RWYH 5I17B 3WNNA 2QQQA 1WITA 1DLHA 5KSBA 1IGJB 5I0ZA 3QIBC 4U6YA 1HE7A 4K3DL 1X4XA 4W6YB 4OQTA 1D5BB 3MV8A 4UINH 1P1ZA 3EOTL 4WO4D 4JB9L 5FECB 1CBVL 2I9LB 4HIEA 4NN7C 3Q6GH 1T3FB 4JPVL 3QDAA 1MFAH 3I75B 1RV6X 3MCKA 1KFAH 4ZAKA 1IJ9A 4WUUA 2QSVA 3TV3H 4YK4B 15C8H 1HNFA 1MJ8L 1J18A 3CFCH 4PG2A 4PJDF 4FTVA 2JCCE 2JK5B 3FFDA 3RZCB 4FFWC 1H8NA 4C55A 3IFNL 3GB7B 4IRJA 2B4CC 5T5FH 3P30L 4L9LA 4NKDB 4JQXC 5FOBA 2VN4A 3ILQC 4M61B 1BJ8A 3KNBB 5BJTA 1PKQE 4UV7L 3V95A 1NBQA 1GZQB 2EIZB 2GJZB 5F1SA 1EV2E 1N59B 4NFDA 4LU5L 4S2SB 3VXSA 3VA6A 1LO0H 2BRRH 3I85A 1XZ0B 1G7PA 4IRZL 1ZLUH 5HVFB 4UV4H 4GG6B 4N0FA 2BCKA 4ODHH 5FFLA 5D7LD 5C0AE 4IRSA 3B5TA 3F7VA 3GSUB 1ZT1A 1V3LA 3KLHD 3J7HA 2DTSA 2EC8A 1WIOA 1LK2A 3VXME 5JORB 3NIFF 3HN3A 5DJDA 5KANI 1IM9D 4FFVD 4FQIL 2XZZA 4XHJD 3U9UB 3VCLB 4EN3B 5JW5B 3LS4L 3TP4A 2XWJB 4XZUB 5EBGA 1WLHA 3D3VD 1IGCL 5IMOB 3C5ZD 5FYJL 1RHHB 4RGMC 4QRUA 3ZTNH 4YDJB 3PUCA 2Q76B 2DQEL 2IEPA 1BFVL 4WGWB 1AFVL 4P2CG 1DSFH 1FYTA 4MQSB 5MEQA 2J7LA 5D1ZC 4LSPL 4I77L 2QKIB 4JQIL 3CXHK 1FSKC 1TCMA 3LN4A 1QPPA 3SDAC 4FZEH 5D1QD 5DDHB 2WP3T 5E2UL 4XCFH 5D8JL 1R0AL 5IK3B 3JV6A 1XFPA 1M4KA 4LQ1A 3QUXB 5I17A 5GRVK 1DN2A 1MHPH 1IGJA 1A7QH 1LNUA 5F9OH 2OR9L 6FABL 3O41B 2J8OA 1H3UA 1A6TB 1NQBA 1XIWB 5FECA 3KPPA 3TYFB 5BCAA 1MCLA 2B4CH 1T3FA 5D7IB 3Q3GB 2HJLA 2EEBA 3BDXA 3ZE0F 3T09A 5J7CC 1JFQH 2PO6B 3KWWB 5JOFB 3SO5A 2UV3A 3RZCA 3BQUD 3GB7A 1AIFB 1J1PL 2FWOB 1GC1L 5IGXL 2X89A 3CC5B 1H3PL 5GRJL 4YBHA 1MCEA 4J8RB 2VRAA 5BO1H 1CD8A 3KNBA 1U3YA 4MJIB 2ZUYA 4KPHL 1GZQA 1FL5B 4P46D 5H37G 5DMKB 1T1WB 4U1MB 1N59A 4S2SA 1D9KB 1V8HA 3LOWA 3GKWL 2X4RA 2MOVA 2GAZA 3B2UD 4HF5L 4QXUH 2ZKHH 1FFQA 3EYSH 4HBCL 3MZGB 3GSUA 1N8ZB 1XEDA 4I3RL 5J9PB 3A6CL 4X6CB 1CCZA 5FCSH 3O6FD 4MNGE 1FLRL 4NYLA 3QEQD 4M5ZL 3OKLB 4FQQA 4LSTH 2EH8H 5JORA 4JFEA 2DQJH 2IG2L 2ESVD 1GHFL 4TUKL 1JUFA 4XCEB 2FL5A 3U9UA 4EN3A 5JW5A 2FR4B 1QBLH 1E6OH 4PJAA 4XNUL 2XWJA 1EZVX 1QHPA 3BIAX 4JEGB 4OM1L 3P40A 5IMOA 4KKCC 3FFCD 3ARVA 5DUML 1RHHA 5I1CH 2VLJB 1ZHLA 2O5XL 4YDJA 4OD2A 2Q76A 2R29H 3MRIB 4QRRB 3T0VA 4U3XA 2DQTH 5IFHH 4I0PD 2DMCA 2EDTA 3ABZA 1MAMH 1FQ9C 4GQ9H 1R5VA 1A22B 4U1SB 4BSWB 1JNNH 5HYSG 3TT1L 2Y5TB 2CR6A 3WHE0 2AJYH 3C87A 5E8EB 3QUXA 2ZZUT 5EZOL 1NDMA 1VFAB 4MJ5A 1YMMD 5DVOA 1X5XA 4M3JA 3O41A 3QXWA 2FX9L 1MCOH 4LOUC 4O02L 1A6TA 4CMHB 1Q0YL 3TYFA 3NCEB 3C8HA 5FYKD 2BK8A 3K8KA 4U6VL 5CWSB 3OHXB 3ZE2E 5D7IA 3S98A 1X6LA 3Q3GA 2NNAB 4XC1H 3RWEA 1TQCC 2H32H 3NCYP 1EZVY 4KDTA 3SQBA 3FO0L 3I02B 3P4LA 1GVIA 2FZ3B 5JHDB 1CK0L 4FFZH 4X5WB 3W5NA 3ZT7A 2PO6A 3AM8A 3D39B 3KWWA 5JOFA 4OQTH 3QWRA 1BREA 1KYOJ 3K2UH 1AIFA 2FWOA 4OT1H 1KCUL 4AL8H 1EHLL 3CC5A 3DROB 4JM2D 2YPVH 3VGAB 2B20A 3EOAB 5F7EL 3SGKC 4BQ9A 2HH0H 5C0NC 2GJ6D 3QUZD 3B5HA 3PWPD 4MJIA 4X5XA 5F96H 5FM4A 1FL5A 2DQCH 4U1MA 4PJCF 3VFOA 5JUEH 3FB8B 1JI1A 1I7ZA 3C8KB 4GH7B 4OIIL 1CN4A 5J9PA 1NFIB 4X6CA 4LCUB 5DVKA 4K3GA 1LO4H 3M8OH 4NRXB 3U2SB 2AW2A 2NZIA 3S35L 1B3JA 3EDDA 3OKLA 4A2MA 4IMKA 3G6DL 1G9NC 1RK0B 1MFBL 2E9WA 4KZEL 4CN4A 4OFYD 3SE4C 3OGCB 4V2CB 3MLPA 3EJJX 2P5WD 3MRNA 4LLUB 3VA2C 3GZKA 4LRNL 3JWOC 5E2VL 5HTSA 4TSCH 5LG1A 2ZG3A 4N5UA 4N8CH 3H3BC 3ARFC 2VLJA 4LLMB 4ZAKD 1I3GL 4WUUD 4WDIB 4YZFE 5FF6B 3DX9B 3MFFA 2XT1B 4HEME 4FP8L 4QRRA 1XCQB 3KXFE 4TRPH 4UZGA 4FTVD 4MCYB 1MJ8H 2Q1EA 3FN9A 4RA3A 5GJTL 5DK0B 5L2JB 1XGTA 4IRJD 4P2RB 4J3UA 1FV1B 4JGMA 3VH8A 4LLQB 3U4AA 4BSWA 3GRWH 2Y5TA 3P30H 5E8EA 2Z4QB 4X9HA 3MREB 4MAUL 5JDSB 3LVEA 1U41A 3QNZA 4UV7H 5EU6E 5JPNB 1OAKH 1HH9B 3VXSD 2FJGB 2XA8L 1A14L 1FO0H 4LU5H 5CWSA 2AEQH 4NC1E 5IEKB 5TQ0H 1YEEL 4P99A 3KVQA 1BQSA 4ZTOH 4O5LL 2C4XA 3SHSA 1WFTA 2WZPD 3I02A 1YEGH 3GO1H 2NY3C 2FZ3A 5JHDA 4HC1A 2D7MA 2NY2C 5C09D 3PJSA 4R4FH 1QA9A 3D39A 4KK6C 3IFLH 5EBLA 1JNJA 1JZ7A 1YEDB 3EOAA 4XPTL 1TVHB 4Z0BL 1AQKL 2EYTB 1GZPB 2NX5A 1DE4B 5K59E 2M26A 3L3OB 1INQB 4ACPA 5D2LF 2NW3B 1VFUA 2DQEH 1FYTD 3C2SA 1NEZB 3L5XL 4WU7B 1WV7T 4HLJA 3C8KA 3OMZA 1QSEE 4JFPA 3UJIL 1OARH 3IDXL 3CXDL 4LCUA 5CJQH 4FQLL 2BOCB 3U2SA 4NRXA 3TO4C 1RK0A 2D7NA 4LLWB 4MDJB 3N1FC 3OGCA 2OR9H 4NC0B 4XWOD 3O3DB 5GIRB 4LLUA 2R2BB 3L3HA 1U8MB 5FKPB 3IDGB 5HI4D 2HT3C 1K6QL 2PYEE 3RVUD 3GUTA 4BM7A 5DMIL 5INCA 4WDIA 5FF6A 3DX9A 3QCVH 5IROC 1KIPA 3RTQB 4K7PY 3E2HB 1KLUB 1XCQA 4MCYA 4N0YL 5EUKB 3RZCD 1JPFB 5DK0A 3IDYC 5L2JA 4P2RA 4ZTPH 1FV1A 2X89D 3GMRB 1AGDA 4LLQA 4ZUVB 2BY0A 1GC1H 5IIEB 5F9WC 4PRDA 2Z4QA 4F7PB 4HWEL 3MREA 1BP3B 5DJYB 5HI5D 3DX7B 3KPRE 5JPNA 2V7HB 3L3DA 2F8XC 2VLRB 1HH9A 4NQCB 1HQRB 4LVHC 5IEKA 1F97A 1JZ8A 1UVQB 4AIXA 1T5WB 2D03L 2DDQL 1MRFL 1D5IH 3DYMA 3A6CH 1HZHH 3RY5A 5F8QC 5DWUL 5D6DA 4FABL 3FT3B 4EN3D 4I9WD 2AJSL 2YKLH 4OLWL 5ITFA 5CINL 2UUDH 1YEDA 4DEPC 4Y5XC 3SCMC 2EYTA 1GZPA 4L8SB 1KTDB 1FE8L 1CXKA 1TZHB 2ZOKB 2EECA 4RQQA 3U83A 4PBWD 3L3OA 1INQA 2NW3A 1NUGA 3S37H 1TPXB 1NEZA 4WU7A 4DQOH 5LGJB 2AXGB 3Q2CA 4BELD 3G5XB 2A2QT 3O4LA 3GK8L 1H5BB 4QEGA 1GPOL 3VG0L 2GK2A 3TT1H 3QUXD 4UT7L 2JB5L 3B5GA 3ESUF 2GYSA 2BOCA 1WWCA 3UTZB 4UOW1 1MRCL 2FJFB 4FQCH 4Y4FA 2D4FA 2BFVL 2CKNA 3QEUA 3UZVB 5FGBC 5E08H 3BDBA 4LLWA 4MDJA 1WQVT 2ITCB 1XIWD 1L6XA 2LU4A 2L0DA 1BJ1H 3O3DA 4OD1H 5GIRA 3WNMA 3JWDL 2R2BA 1U8KA 1U8MA 1TTFA 1IAII 4X4YB 3IDGA 1MFEH 5J13B 4ZNCD 7FABH 3QCTL 2B0SL 3FO0H 1S9KC 5ICZB 4GXUN 3VW3H 1JPTL 2PO6D 1HKLH 1KLUA 1OM3L 1QQDB 2R2HB 1P4IH 3QISA 5EUKA 2OYPA 4N8VG 1JPFA 4QRPB 5IWLC 3TBTB 5SWSB 3VRLE 4QRQB 3VRJB 3GMRA 4ZUVA 1N5YH 1EHLH 5IIEA 3UCRA 1YNTB 1UKSA 4F7PA 3CLFH 4WU5B 5E1AA 1Q72H 5FO9B 4MJID 2BOBB 5DJYA 4OZFB 4KTYA 2V7HA 2Z8WC 4N0RA 5KW9H 3SE8H 5TE4H 1I1RA 1D9KD 1GGBH 1HQRA 4CJ1A 1IAMA 2IANE 2XRAL 3JSSA 5KTEL 1F42A 1VADB 1HQ4B 3QIUA 1XGRB 1MCRA 3S4SG 1T5WA 2NY4C 2XV6B 4R4BB 3HKFA 2YEZB 4OB5L 2CLZB 4WCYL 1G9MC 5HXMA 5JW3L 1OTSC 3ZDXF 3LD8B 5HYJE 4EOWL 4ZFGH 1NBZB 1Z5LA 4LRNH 4UT6H 1UM6H 1M7XA 4L8SA 1KTDA 1TZHA 2VLJD 3NIGE 5GJSL 3V6OA 4HC1H 3ROOB 5D1XC 1I3GH 2VDMH 3ZSTA 1WBZB 3QG7L 4QRRD 1MWAB 3HI1A 5JLZB 4MB5A 3G5XA 3HFML 1A5FH 3CU1A 2GW5A 1H5BA 3J8F7 4WTXA 1QYGL 5ILTH 4LKXB 3UTZA 2FJFA 1BVKA 4NJ9L 3V52H 5I18H 1JYVA 2RHEA 3HMWL 5DURB 2ITCA 1T2QL 4MNQE 4D9QD 1NCBL 4JG1L 2HJKB 4NN6B 4X4YA 4M1CD 1M6OA 3IJSB 4M7JL 2X2YA 5JHDD 4L4TE 3JV4A 1XF1A 1MCWM 4GAJL 3D39D 1QQDA 2VOTA 3BIBX 1JNLL 1TJHH 2KL6A 4W68A 5I75B 5DHYB 1UJ3B 3TBTA 4QRQA 2J88H 5JIHA 3VRJA 4HJ0D 3S96B 3F7QA 4HS8L 1CFBA 5ISZE 5K9QI 4L5FH 1YNTA 5FV1L 4Z0BH 1B4JH 4YFEA 4XP5H 5KS9E 2BOBA 5GGRA 4OZFA 1MWAL 1RZJL 3IU4H 4PRHB 1G9MH 4WFGD 3L5XH 3HC4H 4HAFA 1VADA 1HQ4A 5KG9B 1XGRA 1WCQA 4YE4H 4AENB 1CFTA 2PW1B 1A7BA 3VFVB 4R4BA 2Z92B 3CVHL 2ED8A 4KK8D 3SKNB 2BVUA 4GMSL 3MRMB 5M94B 4KJPC 4NHUB 1C1EH 3ES6B 4ONFL 3B6SB 4TVPL 1WFUA 4OLZL 3BHBB 3F8UB 1NBZA 2Z91B 4NCDA 3RJDA 1PG7L 4P2QE 3BIKB 3ZDYF 1UKTA 4X83A 3ROOA 2I60H 4ZFZA 3G04B 1WBZA 3ILPB 5MEOB 1MWAA 4HUXA 3VI4E 5JLZA 2GTWA 2IC2A 2HMIC 1SEQL 4N0YH 1A7NL 4RGOH 3LN9A 3ARBC 1KCSH 3ZSSA 1NGYB 2HP4A 4LKXA 4U7SA 1A3QA 2A0LC 4LFHG 2ZG1A 1ZHNA 5GS1A 3QI9B 1QRNE 1D5MB 2AABL 2XOTA 2EIEA 1DTUA 2HJKA 4EQ3A 1JN6B 4HMDA 4QHUB 1U8IA 3IJSA 5J11C 1J8HA 1FVCB 4NZRL 2YUWA 2OJZH 5DZLA 1AC0A 1S78C 2W91A 5CBEB 3VWKC 2W0LA 3JUYA 1H9VA 4DW2L 3GHEH 3BD3A 3IAGC 5DHYA 1UJ3A 3GMMB 2FX8L 2NY7L 4IMLB 5BRZE 5I15L 3S96A 3FONB 5CEXB 5ITBL 4R7NA 4NUJB 4DZ8B 1DBJL 4OIAA 5EZIH 4M6AA 4N9GB 1FE8H 2DYPB 5F44A 4PRAB 5I19H 1S3KH 1ZLWK 3TN0B 3VRIA 3D18B 2Z8VC 4DKFH 4FS0A 1T5XB 1WIUA 2V9TA 4PJ5B 4HWBH 4R0LB 1N5AB 4AENA 3OQ3B 2OLDA 2PW1A 5I9QB 3VFVA 1HEZA 2IMMA 2Z92A 3VG0H 4UT7H 3SDCA 4N0UB 3SKNA 2XY2A 2MCG1 1MRCH 2BFVH 5JW4Q 3MRMA 1JYXA 4NHUA 5GRVL 4C56B 3B6SA 4LARH 5T1DL 4Z78B 4HGMA 3O81A 1NGZA 4EDWL 2AV7B 1RIHH 4AEFA 3GSNB 1AGCB 4BZYA 1RJCA 3BIKA 2Y6SD 1XGQB 4PRNB 2X09A 4HWZB 4EUPH 5BS0E 3QCTH 5DS8A 4PP2B 3G04A 3ILPA 3RTQD 4B41A 2BY2A 4DGYH 4RMTA 5SX4H 3MLVL 2I26N 1AD0A 1OM3H 3BJLA 3F7YB 1OCWL 2IPUG 5IMKB 3RGHA 1MEXH 1VGEL 1NGYA 5GS2D 1ZK9A 2FGWL 3WIHL 1B88A 4KV5E 4IOFC 1G6RB 2VLRD 3D1MC 3QI9A 1D5MA 2FDBP 5D70L 4NQCD 5GGTA 4BQ6A 3C6LC 1JN6A 1FZOB 1ZLSH 1CWVA 2XRAH 4F80A 1YYLH 1FVCA 3QA3B 2O5YL 5CBEA 3BWAB 1QLEH 1LMKA 3QIBB 3EO1A 3BDYL 3GMMA 2BVOA 2QL1A 4IMLA 5ESVB 3FONA 5CEXA 4NN7B 1NC2A 3SE3A 1S8DB 4M9OA 2PTUA 4BZ2L 3E3QC 1SQ2N 25C8H 4N9GA 2F74B 4NRYA 4IIQC 4PRAA 4KJWC 1MSPA 2HKFL 3DXAA 1SVCP 2APXA 5ELIA 1CIDA 3QG7H 4GRLB 3QO1B 4DKEH 5AG9A 5EU7E 4PJ5A 5E5MB 4OZIE 4R0LA 1N5AA 3ZKQD 1X5KA 1OAQH 1IGFH 4IDLA 3T2OA 3RKDD 5EU3A 4X5LA 4X4ZA 4N0UA 1U8OA 3GHBH 4YHML 1KCVL 1TJIL 4XNXH 4NJ9H 4GT7A 2Y72A 5EUOE 4PJIE 4QNPF 1I8LC 5EH1A 2ERJC 1UM5L 4C56A 1DEEB 2OTUA 1T2QH 4Z78A 4ZQKB 3ZL4L 2AERT 1AGCA 3GSNA 5I1AB 4N1HB 3TYGH 4NKIH 1EVUA 1XGQA 3X11B 4HWZA 4I5BB 3BD5A 4GJTB 5L0QB 3NCMA 2BNQE 3OAYH 2YZ1A 1IKNC 4E5XB 4RAUA 3BKYL 5TDOB 3UJJH 4QRPD 4H1LG 1JNLH 2WINA 5CSGA 5IMKA 2HTKC 5SWSD 2EE3A 4Y1AE 4FNLH 4YC2B 3AB0C 4M93C 4KHXH 4KRLB 2W59A 4RFEB 3V4VH 5HHPA 1X5JA 4RGMB 4MA3B 1NLDL 3O2DL 3CFIC 2R8SL 1G6RA 5JDJA 4OKDA 4TUOA 4LCWE 1NC4B 1PX4A 4M7KH 3HC3H 2DTML 5D1ZB 2AGJL 1FZOA 2K9UA 3HE7A 5GGVH 1KG0B 1U91B 3KJ6H 3QA3A 1T1YA 4Z76B 3D3VE 2XKNB 4DGIL 3N50A 4PJHF 4D2NA 3FCTB 1YQ2A 4GMTL 1ZSDB 3DSFL 5B39B 4QOKE 4RZCB 4TVPH 4XMPL 4YXLL 3NA9L 1UXWB 4OCXL 3QDJB 1U8QA 4KFZC 1VGKB 1FVEB 3GJEA 4XMLL 5BMFH 4PP1C 4OIBA 3O2DA 4OLVL 2VDLL 1FBIH 2V6HA 1A7PH 4GRLA 3QO1A 1CGWA 2DLEA 5B3NA 4P3DB 5E5MA 5DJ8B 1W8NA 1YPZE 2IBBA 1JMZA 2F58H 3WFBH 3OJDB 2J12B 3BO8B 1LWRA 2V2WA 4L1DA 2WQRA 5ID1B 5I1KH 5IHUL 3LKQB 5BVPL 5DURD 4F9LA 5DEGB 4K9EC 1DEEA 5ESQB 1HWHB 3WKNA 2JJSA 4HJJH 4TVPD 5IQ7H 4OCRL 1VPOH 4ZQKA 1QFWI 3T65B 3ULSB 1FNEB 4UB0H 3Q0HA 1BVZA 2Z31A 3T0EB 4KUCF 1WF5A 4TTDC 3B2VL 4D8PA 5JHLL 1GRWA 4M43L 3X11A 5D96B 1UGNA 5JIKA 5C70A 4I5BA 1Q0XL 1X5YA 5I8OL 3N9GH 4DW2H 4PJ7B 4MMZC 4DTGL 3KLAB 1BF2A 5FKAB 4E42B 1B2WL 5KSAC 1XGUB 2YPLA 3JTTA 4TQEL 1G1YA 4JN1L 1Q9KB 5JA9A 1BZ9B 4RFEA 3IDMB 4R96B 2D0GA 3HMXL 4Q6IC 2VL5A 3O11B 3CX5J 5HGBB 1AH1A 1NC4A 1AJ7L 4GW1B 4PRHD 1EXUB 1T20A 3QEQE 3WXWL 1QSVA 4YBLC 3P0GB 3FT4A 2IF7A 2Y23A 4MB3A 1F2XK 4XVSL 5ESAB 1U91A 5FDYA 1R3IL 3CD4A 3HC0B 4Z76A 2X7LB 1A6VL 4LVNB 2EYRA 3WXVL 3FCTA 3T08A 3MJ9L 5FCUL 5D7KD 5E6IB 5GGTH 5B39A 4RZCA 1TQBB 4JCMA 4RFNC 3I50H 1VGKA 3PF2A 4PJGA 4Z7UE 1DFBL 1FVEA 5IB5B 1VFMA 1XR8B 3IJYB 4F2MB 4YHZL 1OAYH 1INEL 5CJBA 3B83A 1AD9B 3QXDA 1GGIH 3JTSA 4HPYL 2HVJB 4NUGH 4K7FB 4K9EH 3RWFB 3I6GB 4HDIB 3DSNA 3C6SB 2M1KA 3KPNB 2P1YA 4P5TC 4MJ4A 3OJDA 3BO8A 5ID1A 1J8KA 4H26B 3LKQA 4FFYL 1PGRB 3RA7L 2WMPA 3QI9D 5C0RL 1YEKL 5EFIB 1QTYT 3SKMB 3U7WL 4PJBA 3BYTA 1FNEA 3FO2B 3T0EA 1CL7L 4NFBA 1K8IA 2XQYG 1QZ1A 4DOHB 4NJAL 4HPOH 3UMTA 2EEAA 4HK0A 3ULUH 4HXAH 4OZHF 3MUJA 3WDHA 4PJ7A 4BH8B 2XIDA 4XPBL 1RHFA 3KLAA 1I9IH 4E42A 2Y9RT 1XGUA 4ODTL 2IPUK 2YA1A 3GSNH 1Q9KA 5D72L 5I30H 1BZ9A