3FO9B

Crystal structure of aldolase antibody 33f12 fab' in complex with hapten 1,3-diketone
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
218
structure length
218
Chain Sequence
EVKLEESGGGLVQPGGSMKLSCVVSGLTFSRFWMSWVRQSPEKGLEWVAEIRLKSDNYATHYAESVKGKFTISRDDSKSRLYLQMNSLRTEDTGIYYCKIYFYSFSYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Immunoglobulin IGG2A - light chain
publication title Direct observation of an enamine intermediate in amine catalysis
pubmed doi rcsb
source organism Mus musculus
total genus 45
structure length 218
sequence length 218
chains with identical sequence H
ec nomenclature
pdb deposition date 2008-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fo9B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fo9B01
1KCLA 4ZFFB 1U95A 3C5ZB 2LVEA 1F90L 4LQFH 1HQRB 3HMWL 1QRKA 1HQ4A 4KVCH 4U1IB 1BVLB 4OQTL 1CFQB 2NNAB 4X0KB 4RQQB 3IFPB 4M61B 4WTZA 3AFLA 4QRQA 4EI6B 2FJGB 5FYKD 5BW7C 2A38A 5HVFB 2HLFD 2P8PB 4OTXH 4Z18A 3WD5L 3QNZB 3O8XD 4KHXL 3SDXB 1DEDA 3H6JA 3TV3H 3RWCA 1KJ2L 1N3NB 3BPNB 2D0GA 3HI5H 4NCC1 5B38G 4X5WA 5F21B 4Y1AD 4HCRA 4ODSH 1T1YB 1MY5A 4TSAH 3BHBA 2KL6A 3MCLH 3ZKNC 2YKLL 5LJYH 4N8CL 3UYRL 4I2XA 4XRCA 3LV3A 1OPGL 3NGBC 4Q58C 4MJ2A 3BIKA 4BJLA 35C8H 4OF6A 5JORA 1OQXA 4XNQB 4Y89A 5GRYA 4CVXB 3BVNB 5INDB 5DRZA 1NBYB 3ESUF 1HK6A 4ZSOB 3A6CL 1RUPL 4L8BA 1AXSB 4YHYC 3E6HB 5CILL 4PTUA 3RZWA 1ONQA 1QBBA 4WGWB 2P46B 4JY5H 1J8HE 4MLIA 1KOAA 4Y1AA 4UU9B 5E8OA 5DHVA 3TBWB 2VXTH 3KDMA 1K8IB 4KPHH 3Q2CA 4UAOB 5IJVA 4IOIA 2YUZA 1PKQB 1OGAD 2E9BA 3RNQA 4EUPA 4P3DB 4CUCA 1KN4H 2DQEH 1KXQE 2CD0A 1AE6H 3MUZ1 5CUSL 1DN0A 3BGFB 4Y8AA 4UQ2B 5HYQB 5D1QB 3AM8C 4XP4H 4JKLA 4NM4L 3AMLA 1DTUA 4JO3L 3FZUD 1V3LA 1BHGA 4AYFA 4ALAH 3EAKA 1YN6B 3MNZB 4BSVA 2D03H 2ADGA 3RZCC 1BJ1H 1TVBB 2H3NB 2FCBA 4N68A 3QBTB 1MJUL 3GEWB 3VI3E 3K46A 1UWGL 1NKOA 1MRDL 5IEKB 3IJHB 3BZ4A 1J0ZA 3EOBA 3U0PA 1X7QB 4FTVB 2YPVH 4OFIA 3EDDA 5DD0L 3EOAA 2L0DA 2R2EA 3OKLA 2RB8A 3TPUB 5IQ7L 2Y36H 4YO0A 3GSXB 4GMSL 3TN0C 2YD9A 1A6PA 1J0KA 3WHXB 1UXSA 1IKNC 2HFTA 4GRLB 2EE2A 1AGDA 4XWOD 3FRUA 1MRCL 4FFZH 1M7IB 1AH1A 1Z5LA 3PGCB 1FGNL 2MCPH 5IVZA 4K3EL 5K9KA 3K4AA 4PLKC 3CX2A 1ZSDA 4N0CC 3U9PH 2Q8AL 1NDGA 2YZ1A 3ZMRA 5CZVH 5A16B 2R0WH 3BIBX 2YA1A 3SKMA 1XGPA 1TJIL 3TO4D 2HTKC 1YY9C 2OI9B 1EDQA 1BREA 1JPGB 4CDHA 5FYKH 5E7BA 3UTQA 2QKIA 5GJTH 1OGTA 3D1MC 1GPOL 1UB6B 4ZOAA 5FV1L 1K4DB 3EFDL 4JFDE 4XP1L 2QEJA 3JV4B 2PXYB 4MB4A 4L29A 1G1YA 1RJCA 4LCWB 4LVOB 5IF0A 4UTBL 5DHVH 3S35H 1BOGA 4YHKH 2CQVA 2LU3A 1F3RB 2XZZA 4ZOCA 1FH5L 3GSVB 4I3SH 1YEEL 5DC4B 5HYJE 2WM0A 5HY9A 3ZE0F 5TE4L 2Y07H 3TO4A 5D6DC 3F7RA 5A40E 5HYEA 5EBWB 3CVIH 3LEXA 5F7FA 1QO3B 1ZOXA 4A6YB 3CLEH 4JY4A 1X4ZA 1FZJA 4U6HA 2FHCA 4PBWD 1FFPA 3RA7H 3PDOA 1NH6A 3SDXE 2HMID 5ADOH 4H1LA 4XGZA 3X13A 4EN3B 1WT5C 3X14B 4HH9B 1EXUA 4YR6B 1IC7H 4RGMC 3TIDA 5T1LD 4NPYA 4YZFE 2AJ3A 5DS8A 2NZ9C 4HXBL 1LDSA 1EHLH 2DI7A 1UM5L 2XIDA 1U8MA 1ADQA 1IC4H 3MJ8A 4JFFD 4JEGB 4RSVA 1P7QB 2R0ZL 1MHEB 2B2XL 4M7KH 4ZNEE 4NRYA 3V9FA 1UJ3A 4Z7UB 4CU7A 1AGBB 3HNSH 5IROC 3S5LA 1X5HA 2GEEA 4ZDHB 5CIPB 1J11A 4ZSOE 4Y4KB 5I76A 4YHML 3BFOA 1NL0H 4Y5VA 4XI5C 5I1GH 3PWJA 3S34H 3L7FA 5I1JL 4NNXB 4GW4A 5FYJL 5GQBA 1HHIB 3FT3B 4D2NA 5IEHB 2XFXB 4MXQD 2EO1A 3WCYA 1ZS8B 5DJXA 2YD7A 5EN2A 5T1LA 2BVPB 5E8PA 5LQBL 3BKYH 3ZDYF 2W38A 4YX2L 3RVXC 3RWJA 5E8NB 5D7LB 4LFHD 4PREA 5SX4H 1T66C 1DR9A 2BHYA 1F11B 3GMOA 4JFFA 3SGDI 1UA6H 2ZG1A 4HUVB 1DLFL 1AJ7L 1IVLA 4IS6A 3JV0A 5IWLA 3S4SB 3CFEB 3QPXL 2R4SH 4U1KA 4LNVA 5DFTA 1I8KA 4PG9B 1WZ1L 4LCUA 2D7OA 5JHDB 1LK3H 5DVNA 4DGYH 5E2VH 4C4KO 2VKXA 3IT8D 2X4UB 3GBLA 5AYUH 3AU1B 1REIA 2PN5A 4NNYB 4LLMB 1Y0LB 4WHTA 4NKOB 2FO1A 3U4EA 1HZHH 4XCEB 4U2YA 4M1DH 3GGWA 1IM3A 1EEZA 4ZO8A 5DFVD 4LLAA 4M6AA 5GGSA 5HHNA 3MV11 2KUTA 3DO7B 5E6IC 1IM9B 1KLFA 2WBJA 1J18A 4FTVE 3QP3A 1UACH 5D72H 3O6KL 2YXFA 5FGBC 1QNZL 4ZPTA 3G04B 3OXRB 3VWKB 3NCYP 4JFOA 1MFAH 2QR0A 2MPAL 2V5MA 2FYYB 5F93C 2NW3A 3EIFA 2KH2B 3MLXH 2YPLD 1XGRB 2OS7A 3DRTA 4H1LH 4RWHA 5AG9A 3GJEA 3P0GB 1KTDB 1Y6KR 3LH2L 4XBEH 1VA9A 3GSNL 4XCCL 1XF4A 1J0YA 2V2WA 2VXSH 4M1GL 2IG2L 2F8VA 1IKFL 5DO2C 3VXQB 2ENSA 3R8BB 2YUWA 5JZ7D 2BK8A 1WICA 1VEPA 2ORBL 2HVJB 3RWFA 4YDVB 2AW2A 2WIIB 2JCCE 4D0CB 5FHAH 3CFBA 5DEFA 1L0QA 1N4XL 1G7JB 1PY4A 1YC7A 4YDJA 1VCAA 1CS6A 2CPCA 4HSQA 3QCVH 2X4OB 1MHPL 4NQDB 4XNUH 4F7TB 4GJTB 2NQCA 4FFVD 2BMKB 1LO2H 4R8WH 3DBXB 3P9LB 3NGBB 1YNLH 5DUBB 2VXUH 2V2XA 2FEEI 4KKNA 1A4KA 4WU5B 2A6KB 2A74B 2YPLA 1SJHA 1RZIB 3U0TA 4ODVL 4LCWE 4PJAF 5MEPB 5CCKH 4NKMB 1HHKA 5H8DA 3J7HA 3DROB 3SDYH 1FFOA 1X5AA 2HP4A 5I18L 4UT7L 5EU6D 3VD9A 1MCHA 4YHYB 1BAFH 5DJCA 3V7AE 4OLVH 1CDGA 1XFPA 2GIYA 2OLDA 3BP6B 4FNLL 2XV6B 4PGCA 3LQAL 1S9VB 3HAEB 4PS4L 1I3GH 1MJ8L 5DSCA 5T1KD 2OJEA 2O61A 1JPFB 5C3TA 1YY8A 4HK0B 5F1NB 3BKCH 3P77A 5BOZG 1YQ2A 3PABB 4OFPA 3QO0A 3QEGL 5CEXA 4CU8A 5JNYA 1ZLWK 4LHUB 5DURB 1KV3A 4H88L 4MXWH 3T0AA 1HINL 1NMCC 4GQ9H 1BZ7B 1MHHA 1E27B 5EU6A 1NBZA 1WZLA 1TTFA 3RZCB 1ZT4B 1QFUH 3L3GB 3H9ZA 3H0TA 3MBEC 4Z0BL 3MBXL 2Z92A 4PJHA 2JK5A 2VDQH 4LAJH 3BIAX 4U1JB 1KNOA 2J1KA 4MVBC 2VISB 4Z7UE 5EDXA 5T1KA 2CDGA 4NCDA 5E99H 3DV4B 2P8LA 1YEIL 4LLVA 1A8JH 7FABH 2NX5D 2HFEB 1RHHB 4HK3N 2IBGA 5FV2A 3BUYA 3J8F7 4OCNC 5J1SC 3IFOA 1C5DB 3IS0X 3QEHA 4G3YL 4FABH 3D48R 5FYLL 4ZD3L 5SWQA 1PZ5A 3TN0B 4OCRH 3LZFL 3WEXA 4FZ8H 3IAPA 1XR9B 3U4BH 4I48B 4X7CC 3W2DL 1U9KA 3VFWA 1L4IA 1IZKA 3TBSB 3RKDD 1UZ6F 1EGJL 3U83A 4G6ML 2ZSWB 3KYNA 2VDMH 2EDWA 4TTDC 1Z0MA 1SY6L 4FQQB 2LV4A 4NQCB 4P4RA 5D7LE 4PRDB 3FOMB 1KPRA 2ZWLT 3K7UA 2QQLL 1JBJA 3F7YA 5L8JB 2FB4L 3MRLA 4M7JH 1T4KA 4TVPH 3GB7A 3HE7D 3OKYA 4H25A 3OKKA 2WINB 3VCLB 3LPWA 1LILA 2J8UA 32C2B 2DRUA 2X4PA 2ZCLH 5E7FA 1RZKH 5JHDE 2FEEL 3PHOB 3UJJH 2OK0L 1QKZL 1KB5L 5I15H 4MMXC 2CJUL 4W70A 3U0WL 1MWAA 1JZ4A 3RVWD 4WHYH 5J7CC 3NZ8B 5CEZE 4RAUB 3QIUC 4ODHL 4JFXA 1LP9B 5DRXA 3CCHA 5I16A 1XF5A 3P30H 1R5VA 3AC0A 5BQ7A 1VFMA 1A7RL 4XMPH 1E6OL 4N90D 2J7LA 5D2NE 3UTPE 2I60L 4J3OC 4K3DH 5ILTH 3SE9H 2AEWA 3R0MA 3GJFK 4PJFB 5JO5B 3MCKB 5JHLL 4PV9A 4YEEA 1AQKH 3I02A 4UNVA 4HS3B 1EBPA 5E94B 4HGMA 3MOAL 5DHXB 3HE7A 5EUOA 3R1GL 4TSBL 3BD5A 3VGDA 4BFEA 5SV3A 3DGCR 4O2FB 3ARBD 2CIIB 3QUKA 1DQLH 5GGQH 1O0VA 2KZWA 5JQ6H 4OF5A 1N8ZB 3BP5B 4GKSA 1GGYA 1W8NA 4G43A 3KPOB 4L8CA 3GI8H 5JOPD 1BD2D 2VZVA 1JVKA 4CADB 1HYSC 1JK8B 2A73A 4KJPD 1MH5A 1AD9B 3TA3D 3CPLB 4DQOH 3JWOL 5LGJB 3HMXH 2VSDA 3MMEB 5BXFA 3CMOH 4LHJB 1FAKT 3O11A 1S7TB 3SKJL 4RGMB 1GZPA 1JJUA 4RFOL 1V8HA 1BQHA 3QH3B 4NQDE 1I8IB 4CVWA 1NSNH 4ZO9A 3GMLB 3OAUH 4IMLB 2VJXA 4HWUA 4G7VH 2QLVB 4CBPA 2DI9A 4U0RC 3N85H 1DUYA 1OARL 5ANMB 3LKSB 1ZLUK 1HILA 4QHMA 3ARBA 4PJHF 1AXIB 2VR4A 3U7YH 4ZUTB 5IB4A 1KIUA 3O3BA 3PGDA 2FHFA 4J4PD 2YHGA 2PW1A 4HKBA 5I1IH 2VLME 5DXWA 3DX7B 3ZT6A 2OP4H 1BD2A 1KJ2B 4F3FA 5AWNH 5KW9L 6FABL 1F4WL 1VFAA 4P5MB 5DLML 4KZDL 2P1YA 3SE4A 4GXUN 3TA3A 4HLZH 5KSUB 3TF7C 2A1WH 2P8MA 5ESVA 1GOGA 3MV7B 4YQXL 1KG0B 5I1LB 3MJ7B 5D70H 1A7QH 3HG1E 3QT2A 3BN9D 25C8H 3MLRH 5KJRL 2GK2A 4KVCL 4YXKL 4AZ8A 4Y2OA 1JGDB 1YEHH 3DARA 3OJVC 2G75B 4MD5A 3P0VH 1MWAH 1SYVB 1LMKA 2H8PB 2NLJB 2W9EH 4IDJL 1C16A 3BWAA 4LSRH 5HHQB 1JNLH 1CLCA 1QFHA 4J4PA 1WBYB 2OX5A 1G9MH 2JJUA 1NCBH 4PGDB 2R4RL 2XPGB 1G9NH 4JLRA 4LEOB 4PJ9C 3QB7C 2J8UF 4HZLB 4OTXL 5CLTA 2FJHB 5ACZB 5I19L 1ORQA 1T0MA 5C8JB 4ENED 3NPSC 4M3JA 3TV3L 2W65B 2K3TA 2WANA 4PV8A 3HI5L 1EA9C 4M5ZH 3VXUD 1OF2B 4DZ8B 4XB7A 3T4AB 2DM7A 5EOCH 2JJSC 3X3GH 3RUGB 1NBQA 1GXEA 4DZBB 1NFDB 5E6IB 3A6BL 5FUCC 1I7TA 1AO7B 4H20H 4PB0H 4RBPK 5E95B 1CFTB 1J9CT 1BJMA 1INEH 5HGGS 5HD8C 2VXVH 4DKEH 5ENWB 1UB5A 3L5IA 3UXFA 4HUWA 3EOYG 1JUFB 2GSIA 2H2SC 1I1AC 2B4CC 1KLGA 4XVSH 4MQ7A 4PRBA 5SWZB 4J23A 3ELAT 1CXFA 5IB1B 1QR1B 4KQ3H 1T89C 4RAVB 3SDDD 3V6FB 5J9PA 5LGHH 4K3HA 2HLAB 3VXUA 4ELKA 1KGCD 3D3VB 4WNQA 4Y5YC 2VXTL 4KPHL 3OPZH 5C0EB 3QFDB 4XAWL 2OR9H 5TE6H 3MLTA 2IQAA 2IBBA 1AE6L 1DBJL 2JJWA 2RQ8A 1M71B 4MNGB 3KJ4C 2FWOA 3WNOA 1YJDH 5A2IH 2M2DA 3VMNA 2Y5TA 5B39G 4KRPD 3S37X 1RK1B 4X7EC 2FD6H 4XP4L 1RD6A 5EC2A 3HUJA 4D0DB 5JLZB 1A4JB 5KSAD 2Y6SD 1LGVA 1MQ8A 1FPTH 4ALAL 2P24A 3S98A 1FNLA 3SDDA 4O9HH 4P9HL 3N1GC 5FCUH 4BM7A 5E2JA 3DHJA 4RMVA 4WFGE 4UNTA 3QUMA 2FL5A 2C3XA 5FGCE 3MRIA 5KANG 2GJZB 3ULVH 1G0XA 1SEQH 1N7MH 3RBGA 2XA8H 1GOHA 3VXOB 1LNUB 2YPVL 5JR1L 3CNKA 4IRSD 5GGRA 4KK5C 5MEQB 4IIQC 3AUVA 5C9JB 1DEEA 5AYQA 4Z6AT 3V7AG 3AXLA 4ZAKC 3X17A 2CLVB 4PY8J 5C6TL 3LHPL 2HFFA 4MNQB 4B0MM 1N6QH 3M8OL 4PJXB 3HFML 5KSAA 1XZ0B 5DZLA 3SKNB 1QSEB 4QHNA 4HS6A 4JJ5B 2BHUA 4DK6A 2P47B 4FFZL 1NMCB 4PGZA 3HHRB 1EAJA 4KKAD 4IRJC 2MCPL 4XCNB 3QQ3A 1HNFA 1QHPA 3U9PL 3DOSA 5FGSA 3MBEB 5CZVL 3W39B 2WWMC 4NO0B 1GH7A 2R0WL 4GRMB 5ANME 4HDIB 4S1QH 3LKOB 1J10A 5L6YH 1YNTB 5F7MC 4IRSA 3OF6D 3ARRA 2ENYA 4CU6A 1CZ8L 1BFOA 5IM7B 4MDJA 4ZS7L 5FYKL 1DN2A 1NAMB 5GJTL 2MNUA 5GSVB 3PJSA 4Z77B 3JWOC 5HGBB 5FA4B 1F00I 1HEZA 2WQ8A 4MJ5A 1YN7A 2W0KA 3MV7E 3EYVA 1CG9B 4HW6A 4ORGB 4WJ5A 3UTTD 2ESVB 1Q9LB 3MOBH 4R26H 4WFHD 4MJ6A 2BP3A 4Y4HD 5TPWL 5GS2D 1MEXH 4HQQH 4I3SL 4JFPA 5EO0A 1G84A 3UDWA 4W4NA 1B4JH 5JXAH 4LCYA 3MRRB 2ADJA 4K7FB 2Y07L 3VRLE 4HF5H 3OF6A 5FB8B 1ZKAA 1J5OH 4P9MH 3CVIL 1F4XH 3BXNB 4LAQH 1UYWH 4OSUH 5ETUA 5F9DC 5HYSA 1WFUA 3CLEL 3L95A 3WUWA 1PYWB 4TUJB 3RA7L 3C6LD 2DD8H 4XVUC 4HEME 1IFHH 3QIUB 4G8GB 1HE7A 2XXMB 2DBLH 3S4SG 1TQBC 2GFBB 1ZVYA 2BOCB 3QUMH 4M1CD 3UTTA 4ETYA 1MFNA 4QYOA 2VITA 1HIMH 1RJLB 5DEGB 3RUGE 1IC7L 5JPNB 5E8EB 1NFDE 5JXEC 4FQXD 4Y4HA 1AO7E 4UQ3A 4FXKB 1K6QH 3ZE1F 4MX7A 1IQWL 2RJMA 3SDAC 3IDJA 3QJHA 4RDQF 1YUHA 2A77L 3IGAA 5GJSH 1IC4L 2VZSA 1K4CA 2NY4C 2FH8A 3WNPA 1KIQB 4M7KL 3PL6C 1KYOK 4HJGB 2F54D 4G9FB 5EC1B 5SWZE 5C0BA 3H8NA 4P2QD 3VGHA 2YUXA 4EIZC 3O4LD 1F02I 1ES0A 3C6LA 3DIFA 1NL0L 4YHPB 4AH2A 2DQTH 1ZHLA 3U7WH 3VFRB 5L8KB 4PP1D 5D1XC 4WEMB 2DIJA 3S34L 3F6LA 4PJGB 2ICEB 3FN3A 3IDNA 2DWDA 1P5VA 3D3VE 3L5HA 1KTRL 1ZA6B 2AXFB 4JANA 3CDGA 1CIDA 4U1NB 2M26A 4FQXA 3IKCA 4UTAL 3BMWA 2IMMA 1M4KA 3GSWB 4OCSH 4R2GD 1DQQA 4MNGE 2XZQH 1T03L 4LKXA 2EYSA 4JO1H 1G7LB 2WLZA 3EO0B 3PGFH 1UA6L 5F1IA 3FQRA 2AVGA 5DI8B 2EYRB 1ZVSA 3REWA 4OLYH 1SVCP 1GGCH 4U0RB 3C2AH 2F54A 5GISH 3K1DA 4L4TB 4DVRH 1DQDL 2R4SL 3RGVC 1IMHC 4P2QA 5H35A 2RFXB 2HJKB 4HJ0D 1YMHA 1K8DB 1LK3L 4DGYL 2EIEA 5E2VL 4EDWH 5A2LH 43CAB 4U31A 5DC0A 5FF6A 5AYUL 4XPHH 4X7SH 4PGEA 3AREA 3CFIC 3MCG1 3VFNA 2G2RB 1OB1B 1RURH 4XAKE 3E6FB 4M1DL 1IAOA 3W0WD 2V6HA 3IU3A 4O02H 4YPGA 4JHBA 2PYFB 1FFQA 4YNYB 3H9SD 3OTTA 4Z7VA 1MFAL 2FEDC 2PW2A 3QXDB 1S7WB 4MNQE 1HSAB 2AV7B 4PJXE 1OTUC 1A2YB 3HAEG 2HYMA 3Q0HA 1QSEE 1BLNA 4P9HC 4IHOA 3CK0L 3VFOB 1HN1A 4XBEL 3D87B 4PTTA 5AZ2L 4YHNB 5TDOA 1UENA 1CE1H 4XVJH 4WI6A 2VXSL 4PJ9B 4FQJH 3SCMD 1OAYH 4K55A 3THML 5F6HI 1HXYB 1IQDA 2KPNA 2ATPA 4NRXA 3NPSB 5GS2H 5CBAA 5IMMB 4LDEB 4LIQH 2D0FA 3QQ4A 3W0WA 4OCXH 4LHUG 4NJ9L 1B0RA 3TFKC 5FHAL 4HGWB 3MLYH 2NY5H 1LE9B 4OIBA 2CLRB 1MVFA 4HIEB 3T3PF 5HI5C 1M6OA 3H9SA 4HUKB 3FB5A 2F53B 3RWDA 3JSSA 1OW0A 4R8WL 1BVKA 4XCYB 4POZC 1YNLL 1XGTA 2VDPL 5L2KB 1JIBA 3ZKXC 3GK8H 4MDIA 2BERA 1INQA 3W9EA 1I1AB 1GAFH 3BGMA 3QSKB 3IU4H 5FM4A 4P23C 5CCKL 3SCMA 2ESVE 4JG1H 4WWKD 5EZLB 4KKCC 4AIZB 3GMMA 4M48H 2DL2A 2YEZA 5I1CH 5IHZB 1VEOA 3IFNL 1D5ZA 3HNTH 4Y5YB 1U91B 2VE6B 2XNAA 4JY6B 4ZTPH 2AJSL 3MPCA 4ONFH 4EI5D 4ISVA 4QRRB 5ICXA 1XGUA 2HLFC 4QXUH 1RIHL 3ZHDA 4BKLA 4OZFG 3BKCL 3LQZB 3KJ4B 4OAWA 1I75A 1AXTL 3KPSD 4WW2A 5FYJE 2YD5A 3KPNB 4G8GE 3PWNB 4JM2D 3GMQB 5F97E 1JTTA 5DVOA 3D9AH 4MXWL 5ISZD 1B9ZA 4GQ9L 4WWKA 3FCTB 4NGHH 2BVYA 4FQ2H 5D96C 3RBSA 1FZMA 4PLJD 4ZOEA 1FJ1B 4ELMA 2SEBA 1QFUL 3TBVA 5CZXD 5IR1A 2MOVA 3WDIA 5HVHC 4FQHA 5J8OA 4QT5B 1CDBA 5E2UH 4V1DD 1T80A 2FX9L 5DJ6B 1N5AB 2WWKT 4EI5A 3T1WA 3C8HA 1MQKH 3MRNA 4J3UA 3SJVD 4G9FE 5E99L 2RBLA 3I84A 3MNWA 4X9FA 4NKIH 5GSRB 5ERWB 1Z9LA 3GHBL 1BVZA 3FQTB 4IIQB 3KPSA 5E5UB 2C1OA 4OZ4B 4FABL 2ICES 1YEJH 1II4E 1D5MA 3FO0H 4QWWD 3F12A 2ICCA 4ZAKB 4JM2A 2B1HH 4FZ8L 3CDCA 4X6BA 4PJDA 3U4BL 4Y2DD 5ISZA 1A1MB 2F15A 2GY5A 4J1UB 5HGDB 1N0XH 5EPMA 4D9RD 3SY0A 2VDML 1V05A 3MRKA 3DJ9A 4IRJB 3W9DB 1UT9A 5DQ9A 4B41A 2HKHL 4V1DA 4G6FD 2FRGP 2I24N 2PKDA 3BW9A 3VW3H 4M7JL 3SJVA 4G80A 5DUMH 3SKOB 3FZUC 1HDMA 4L4TE 4RFNC 2H45A 2VMFA 1LO5A 3QA3B 5M95B 3EHBD 1FAIH 2C3GA 4ZUWA 1AGEA 2ZCLL 1RZ7H 3VGGA 1RZKL 2DLFH 5E5MB 4NDMB 3UJJL 4RZCA 4JCMA 2CLZA 1MHCA 2X1WL 3OHXA 1Z3GH 1F6LL 3HZKB 4NKQB 5DWUH 4Y2DA 4X4XB 5IW1A 1LD9B 1SBSL 5AUMA 3OB8A 3NA4A 2BVQB 3EZJB 3MRBA 1WC7A 3ROLA 4I0KA 3KPRB 4PUBH 1Q72H 1EJ6A 1HOCB 3OGCA 4K3DL 4KI1A 4GG8A 5ILTL 3QHZL 3SE9L 4PJBE 5ITBH 4TUOB 2QQKH 4BH7A 2A6DB 4ZODA 1NANH 5I8OH 1TFHA 5E4IA 2BNRD 3OMZA 4NWUH 3LVEA 1CGWA 5ESQB 4KJWD 3GRWA 1VPOH 3BP4B 2YBRB 4XWOC 4GRWE 1L9MA 5ABDE 5E9DD 1DBMH 4N9OB 5EZIL 4XX1E 1DQLL 1S9YA 4YDLC 1ITCA 3LAFA 5GGQL 3V5DB 2DM3A 4U6TA 1A6VH 5DD1L 3GI8L 3O81A 3VE0A 5CSGA 2FX8H 1Q94A 4X4ME 5EU7C 1DCLA 1RJYA 4WW2F 3CLFH 4KY1H 3B9DA 4KXZI 1SQ2N 3HI6L 4DQOL 4LLDA 1TQBB 3TO4C 2V5SA 3CMOL 3NFSH 2EDBA 3RP1A 1PQZA 4LPWA 5BVJB 5FUCE 1OHQA 1RZGA 4KGJA 1NSNL 2F53E 4M5YL 3OAUL 4WEBL 3SDAB 4ELMF 2BNRA 4QRUA 2X9XA 1OSZA 1UH4A 5L2KE 3QNXB 3N85L 2NY4B 1ZMYA 1OAUH 4XMKL 4ACPA 4R7DA 5H2BB 3U7YL 2OTUB 5E9DA 3PL6B 4MNHB 4ZFGL 3OR7A 3BH9A 2Z4QA 4NUJB 4UDTA 2NZIA 1HH9A 3MA9H 5I1IL 5I1KH 1JF1A 2OP4L 1UXWB 3LRGA 4QTHB 3VFTB 3N9GH 5I2IB 1P53A 2VQ1A 4X4ZA 3RL2A 4JGUA 5D1XB 1NGZB 3LN5A 4JM2F 2XWTB 1N2RA 3BRFA 2A1WL 2FHBA 4X6FB 4PJDF 3KPPB 4QRTB 1UJ3C 1QFWI 5EU4B 2GW5A 3G6AA 2AEQH 3FFCD 4QRRE 4LLQB 5AAMA 1A7QL 2JIXA 2PCPA 9CGTA 4HK3J 5EO1B 1IEAB 25C8L 3MLRL 4Y19D 5FYLE 5MI0B 4Q9RH 2HMIC 2F8XC 1A0QH 2XQYK 4F7EB 4Y5VC 4NBXB 2Z35B 3P0VL 1MWAL 4XBPA 4LSRL 2W9EL 5D9SB 4WCYH 1QQDA 4F9PA 1JNLL 2I07A 1L6ZA 1X5JA 4W6XB 1GGIL 3S37L 1G9ML 3RGVB 3D0LA 5C0DA 2OSLA 5IK3B 3RNKB 3EYOB 4L4VD 2DQHH 1NCBL 1YQVH 3QXAA 4CNIB 1G9NL 1NKRA 3U1SH 3BJLA 1QBLH 2J5LC 5BJTB 2YC1B 3QPQD 3V6ZB 5DRNA 3EYFA 3BEWB 4M5ZL 3BH8A 4R4BB 2QL1A 3QDMB 1EV2E 2YWYA 3OBAA 4TUKH 1OAKH 4QO1A 5ECJE 4KKLD 5EOCL 5IWLC 1T3FA 5CJBA 1AQDB 3HC0B 5T3XD 3X3GL 4R3SA 3FFCA 1IT9H 4KK8D 4HPOH 4KZEH 1MFCH 5HXMA 4PB0L 5BO1L 1VERA 4DCQB 1HH6B 1WIUA 3O2DA 4FMKA 4Y19A 3MRCB 5JOFA 2VXVL 2P5WE 3HZVA 1U8KA 2BNQA 2O5YL 3MNVA 4XTRD 3QIBD 4YWGH 4CVUA 1EMTL 3BD4A 4OD2B 5C0FA 4PPTA 4ZXBD 4MXQC 4TTGA 5CP7A 1NEZG 3H3PH 4L4VA 5MP6L 2VQUA 2CMRH 5HGAA 2GSGA 2NW2A 5IOPA 2WBJC 1GJIA 1X5IA 3I6KB 2WW8A 3LKQA 5FUZL 5LGHL 3MRHA 1U95B 5TGBB 5JIHA 3ZDXE 1NGWA 5D7IA 3FTGA 4C59B 1HQ4B 2P5ED 1BJ1J 4JFHE 4TN9A 2EDJA 2OR9L 2RCSL 1IGTA 4EOWH 5TE6L 1EH9A 1JHKH 3FFDA 5FHBH 4QRQB 4HWEH 1CGSH 2DI8A 1CDIA 1YJDL 5E00A 3TP4A 2ADIA 2V7NA 3QIBA 2FD6L 4DGVH 1OP5K 1EO8H 1BQSA 3TH3T 4EEEA 5CSZA 1ZLSH 3ZKXB 5DFVC 3RWCB 2EC8A 5F7EH 1FPTL 4KU1A 3KPRE 3MLSL 1CL7I 3BHBB 4O9HL 4P23B 5JQHC 1T7XA 5FCUL 4PJCF 2W91A 3IF1A 3V52L 1QFWL 2P5EA 2XQYG 3TBTA 4PRPA 2J2ZA 3Q5YA 4I2XB 4XRCB 5CMAB 3QCTL 1SEQL 1XIWC 5HDOA 3BIKB 1FBIH 1HHGA 2XA8L 1H3PH 1RZKC 5DRZB 2DQDH 5KSVB 4HLJA 4GW5B 4Q97A 4IRZH 4L8BB 4NQVA 1I7ZA 2NXYC 2UWEA 1F2XK 1EJOL 5JZ7C 2D31A 1DQML 4PTUB 1ONQB 1D7FA 4P2RD 1N6QL 4WFEE 1P5UA 4M8VA 5HDQH 4Y1AB 2PR4H 2CDFA 4P2OD 4UT9H 5E8OB 5DHVB 5HPOA 1HWGB 3F5WA 4HWNA 4WFFE 4IOIB 5IJVB 2DS4A 3RNQB 3P2TA 4EUPB 4K23L 2VUOA 4LGSB 5D96B 3C09C 3SN6N 2J6EA 5DJDA 1EHNA 1T83A 3TNMA 5HVHB 5EIIA 3DECA 3WJJA 5F7DA 4S1QL 5JUEH 3TBYA 1KYOJ 4C54A 4OZHA 4EXPX 3IJYA 1TDQA 4BSVB 5LAXA 5L0QC 2ADGB 1B0GA 2VB5A 4P2RA 3HRZA 4RWYL 3LPFA 3HPJA 3CFCL 3PWPD 4NZUH 2YD8A 5CJQH 4P2OA 3BE1H 2E9WA 3P0YH 1OAXH 3BZ4B 4NIKB 4R26L 4HFWB 5T3XH 1TJGH 3EOAB 1MEXL 4LPYA 2IGFH 2R2EB 3OKLB 3BAEH 3VG9C 1U8PA 4YO0B 5JXAL 5D7IF 3V4UH 4O5LH 4DJMA 4UOW1 1U2HA 4HF5L 3H7BA 4E42A 1I1YA 3EJZC 1UXSB 5C6WH 1F4XL 3QRGH 4LAQL 4OSUL 3VXMD 4RFNB 4NSKA 5C07A 3Q1SH 4OGAD 1AGDB 1LWRA 5CEYA 1P2CA 3GNMH 3FRUB 1Z5LB 3PWPA 4ERSL 5IVZB 2DD8L 5K9KB 4S0TD 1FL3A 2HRLA 3DHMA 1CL7L 1NGQL 1E4JA 3QDME 1ZSDB 2DBLL 1NDGB 1IC5H 2GJ6B 2N7BA 3QUML 1ZHBA 3WO4C 1HIML 1A6TA 3Q6GH 3SKMB 2ATKA 1FVEA 1XGPB 1RK0A 4URTB 3RL1A 1SMOA 1DBAH 4NQED 1G1CA 4JR9L 4R90H 2QQQA 2D2OA 3SPVA 5F9OH 4NZRH 4X7FC 3UTQB 1CE6A 2QKIB 5LWYH 1LO0H 1OGTB 4OLWH 3ME0A 4MCZA 2EIZB 4NC1E 2E6JA 4WRLA 1K5NA 4Q6IA 1G9MC 2Z8VC 1RAMA 3VXMA 3D25A 4YDKL 4LLYA 5TQ0L 3RKDC 4L29B 5HPMB 5IF0B 4G8FA 3HR6A 3QXUA 4YDLB 2DTMH 3E8UH 1BOGB 3U7WL 3BQUD 5GHWL 2W1NA 4L8SA 4PD4K 3NIDF 2UWEF 2H6PA 2VKWA 2J6EH 5MEND 5IMKA 3HE7C 3LPGA 1GC1C 4JFED 4MQXD 5HY9B 3TO4B 1ZE3C 1EVUA 4NQEA 4Z7QF 3WN5A 4XX1G 1FV1A 2CUIA 2C4XA 3LEXB 2XZQL 3WFDH 4JY4B 4JO1L 3RVWC 3B2UD 5FUOH 3PGFL 1FZJB 1KPVA 2BRQA 4U6HB 3TM6A 5HBBA 4JDTH 2OQJA 1FFPB 1EZVX 1GGCL 3PDOB 3K81A 3GIZH 3C2AL 2VDKH 1UM4H 4NOBA 4H1LB 4XGZB 1J0JA 2VN7A 3IDXH 3DVIA 3X13B 1FP5A 4J6RH 1FO0H 1TITA 1MLCA 4EDWL 4OZHF 4XBGA 3LEYH 4ODTH 1EXUB 3BQUA 2X4TA 3TIDB 2PTTA 4XPHL 4X7SL 4NPYB 1WGOA 2R69H 5DS8B 1RURL 2DICA 2GITA 2UZYB 1GL4B 4I2XE 5MENA 1N6VA 1U8MB 4DTGL 4JFEA 1J7VR 3MJ8B 5MERA 3NIFF 2BXZA 3KLSA 3O3AB 1RMFL 4C56D 3ARBC 1WJ3A 4NRYB 1CD8A 1UJ3B 5B38A 4M4PA 3WO3B 3CFJA 1W0VA 1WWCA 1L7TH 3S5LB 1A1OA 4RGND 4F8TA 4JPKL 5C70A 1OVZA 3W5MA 5HHOD 4OKVA 1NCAH 4Z7OF 5I76B 3FB6A 4KAQH 3MGAA 5L88H 5DQJA 4Y5VB 1FN4A 4XC1H 3WFBH 4KJPC 4OD1H 3SE4C 3PWJB 3TA3C 1RSFA 3L7FB 3ZE0E 4GW4B 1L0YA 1MCFA 4XC3H 4DW2H 4DFHA 1CE1L 4NYLA 4XVJL 4FQJL 4MJIE 1OAYL 5EN2B 5T1LB 2J5LB 1NMBL 3ZL4H 1FNGB 2EDLA 3CVHH 5E1HB 3RWJB 5GS3A 4LARH 4LIQL 4PREB 1J1PH 1QLFB 3GMOB 4JFFB 2BHZA 4OCXL 3B2VL 3BRDA 1HCVA 3ZKQD 4XNXH 3PE9A 5ICYA 2D9CA 4UILH 4Y16A 1QPXA 3GSRA 4IS6B 3TCXA 3MLYL 1LDPH 5IHLB 4FQCH 2NY5L 1D6EA 4J4PC 4NHUA 3B9KD 3ILQD 4JPVH 1I8KB 2ZCHH 4R96A 4LCUB 4NQXA 2ZG2A 5HHOA 2ZPKH 4N0YL 4LCIH 4XPFH 5DC9B 3K2UH 5TE7H 1NEUA 3GK8L 4WHTB 3U2SA 3U4EB 2HH0H 1GAFL 1DFBL 1CDCA 1DVFD 1EEZB 5GGSB 4YE4L 3VG0L 4GH7B 4JG1L 3VFUA 2WBJB 3PWUA 4NFCA 3FT2B 5CD5D 4JGJA 4ZPTB 5I1CL 1I1RA 3TNNA 4JFOB 3G5ZA 3HNTL 2QR0B 4ZTOL 2DB8A 2FZ3A 2NW3B 5HHPA 4ONFL 1Q0YH 5EO9A 3B9KA 4N5UA 2VZ1A 2CK0H 4RIRA 5HTSA 3DRTB 5KSBA 1RPQA 4QXUL 1ZT1A 3GJEB 5J57B 4WI7A 4L3CA 4BZYA 3H42H 5GS1C 3ZDYE 4JDZA 1UJTA 1XF4B 4ENEC 1BPVA 2V2WB 4Y5XA 3QCUH 1T04A 4R4FL 5JMOC 1CGUA 2W07A 1FNFA 3TYGH 43C9A 3FMGL 4BK5A 2B8OT 2QJDA 1DVFA 3T2NL 4L3ED 3D9AL 2GJ6E 2OR8A 3RWFB 5CJ8A 1YPZA 4RMRA 1NBVH 4NGHL 1S7QA 4OM0H 4B5EA 4FQ2L 5E4EC 3FQWA 3CFBB 3MC0A 5IHUH 1RV6X 2FGWL 3N1FC 5EBLB 1CBVL 4YDJB 5D1ZD 1CLZL 4O2EA 1AHWA 4XPGL 5HI3D 1QA9A 3V95A 3TO2B 3V7MA 5E2UL 2XXCB 1MVUA 5CGYD 4NRZA 1S9KC 1XIWB 2AEIT 2EZ0D 3G6JA 5FXCH 2V2XB 1A4KB 2YPLB 3C8DA 4DUXA 1SJHB 4NKIL 5CINL 3U0TB 4W6WB 4D8PA 3SDDC 4TRPL 5B22A 4LEXH 1T2JA 1KEML 4Q9QH 3T0XA 1BIHA 2GTWA 1SHMA 2NXYB 1YEJL 4E41D 2X41A 1XEDA 2B1HL 1I9IL 4L3EA 4MAYD 2BY1A 5EU7E 4S10A 3ETBF 5KN5A 4JPWL 1N0XL 3WIIH 3VXTA 2AJZA 5DSCB 3Q48A 5D1ZA 3PUCA 2OJEB 2O61B 4PG2A 3C09B 1GIGH 1IGJA 4JKPH 3EYSH 2DJUA 1YY8B 4YBHA 2FR4A 1FNAA 4RGOH 4XVTH 3P77B 4NO5A 1BBDH 3VW3L 2R0LH 2XN9E 1IJ9A 3D85D 3QO0B 1RIUH 4MA7H 5DUML 3MV9D 5D71H 1A5FH 5JNYB 5KSAC 2Y6SC 2VRAA 4XCFL 1OAZH 2IC2A 4M8QA 1F4AA 4BQCA 1FAIL 3G5XB 1RZ7L 3DYOA 2DLFL 4DAGL 2DF3A 4KRMB 4X6CF 1EX0A 1VFBA 5IBLD 4YUEH 5L8LB 5EU6B 1NBZB 4E41A 1FNSH 2YA0A 3DX9A 5L0QB 1Z3GL 5KG9A 1A6ZA 3NBNA 1ZAGA 4MAYA 5DWUL 3DXAD 3MLUH 3T4YB 3H0TB 2W60A 2C3WA 1D9KA 1NGYA 4KWUA 2F19H 2Z92B 4PJHB 2JK5B 2X9YA 1UKSA 1KNOB 4PUBL 1Q72L 1ZA3B 1KJMA 2ICWI 4RMSA 5T1KB 4PRID 2CDGB 2H9GA 2P8LB 4LLVB 2DLEA 5ITBL 3IETA 3RHWF 2QQKL 3HZMA 3RWEA 3BUYB 2VR9A 3DGGA 3VG9B 3IFOB 3D85A 5FYJU 1WF5A 3HPLA 3MV9A 1F45A 1HNGA 5TJWK 5SWQB 1PZ5B 5F6IC 1VPOL 1KCSL 1ZT7A 3WEXB 1ZTXL 3QEUA 5M94B 1QUNA 3VFWB 3GKZA 4KKAC 3F7PC 5BMFH 4XPBH 3VFMB 1N26A 1TQCC 1P4LA 5KSBF 5D7JA 3KYNB 4AT6A 1A6VL 4H8WH 1G7MA 2X09A 2AQ1A 1BFTA 3DXAA 2FX8L 2VABA 2X42A 4B53A 4P4RB 1MAJA 3UDWC 1KPRB 4KY1L 1QR4A 4K94H 1A64A 4M9PA 3F7YB 3CU7A 3C60D 2ZP0T 3WO4B 3MRLB 1T4KB 4PRIA 1YDPA 1V3KA 4KMLB 3GB7B 5E56A 4H25B 1WISA 3OKKB 1UQSA 3L9RB 4OFDA 2J8UB 2X4PB 2HAZA 3JXAA 3T65A 4N0FA 1OAUL 3LKPA 4DWHA 5EG6C 2VDOH 4BK4A 1WWWX 4DGIL 5B3JE 4JFXB 5DRXB 3CCHB 4OCWH 1KELH 3NA9H 5I16B 1XF5B 2VDLL 1R5VB 4HEPG 4JRXD 5FCSH 5BQ7B 1QPPA 5DJ0A 5B8CA 4HIIA 3MA9L 4Y4HC 3P4LA 5I1KL 3QQ9D 5FECA 3KXFD 3N9GL 4JVUA 2GAZA 4N8PA 4PV9B 4WI8A 3C60A 3I02B 3DPBA 2NY5C 4AEIH 3S3PA 3MLVH 4WHCA 3HE7B 5DT1H 5EUOB 4LMQI 1WLHA 3P4NB 2AEQL 3ZDZF 3WV0A 1KFAL 4S1RL 5FEBA 3VGFA 4Q2ZA 5DD3H 3QUKB 4H5SA 3C6LC 1ZLVH 4Q9RL 2R9HC 2BVOA 3INUH 5F71A 3NCEB 3QNYA 4W4OA 4GKSB 4G43B 4PJ7B 4L8CB 3DSFH 3H3BC 4XNMA 4M1CC 4JRXA 1EUUA 2A73B 1B2WH 1SEBA 3RWHA 2E7LA 2DQHL 1YQVL 4WTZG 4FQXC 5BXFB 3U1SL 5I30H 2QSVA 4F7CA 1QBLL 3O11B 3KXFA 3HS0A 2VTFA 4HWBA 1GZPB 2AJYH 5CJOL 2IAND 4NQSA 1R5IA 3WDJA 1BQHB 4TQEH 4TUKL 4CN1A 1OAKL 1FYTD 4OM1L 1CD9B 1W72A 2G60H 1CXIA 2WMPA 3MSPA 1I9RH 5T5FH 4QHMB 3ARBB 3GRWL 1BEYH 4HPOL 4KZEL 1AI1L 5IB4B 2OYPA 2ARWA 5IB3A 3O3BB 3PGDB 3BKJL 2HVKA 3WS3A 2PW1B 1MPAH 4HKBB 3EZ8A 3Q6FA 4PP1C 4YWGL 4X5XA 5TF0A 1P69B 3AREC 1BD2B 4F3FB 1VFAB 4YHIA 3TA3B 3V79C 3E0GA 5J6GA 1J8HD 4HG4K 2P8MB 5ESVB 2AP2A 4GAGH 2K1MA 3CFDA 4NZDA 1PSKH 2XKUA 1F3DJ 2IANA 5EIVA 4BSJA 1G7IA 5FK9A 3UZQA 1FYTA 1H8SA 1QSZA 4WI3A 1K9TA 4HBQA 1P4IH 4PYGA 5HDLA 4MD5B 2EDXA 4EOWL 3AMKA 4HJ0C 1JHKL 5FHBL 1C16B 4HWEL 4HPYH 5IB5B 3VRJB 4EUPG 3D6GA 4Z0XA 5EU6E 5IJKA 2Y5EA 4JLRB 1R5WA 1EO8L 4U1SA 1ORQB 1NGPH 3CJJA 2HT3D 5C7XH 4JKKA 5K59E 4PV8B 1J8HA 3CFKA 5F7EL 5HI4D 4BZ1H 4PJHE 1I8LA 1Z9OA 1CGXA 1ACZA 1P9MA 3U6RA 5BZWA 3F7VA 1I7TB 1CFSA 1SBBA 3QJFA 4JPIA 3DWTA 1FNEB 2P44B 1OW0C 1I7UA 5KVDL 2V5RA 4HUWB 1FBIL 1J86A 1WCQA 4HULB 2DDQH 2GSIB 1KLGB 1TTUA 3OL2A 4JAMA 3ZKMD 1CLYL 4PGBA 2DQDL 4AK1A 4PRBB 4Z95L 4H0HB 3PNWA 1BGXH 3SCMC 4KQ4H 4P48A 5GS1B 3TT3H 1JGLH 3ZKSD 4PJEF 5J9PB 3RVVD 1NMAH 1BIIA 3FQXA 2J88H 3VXUB 4ELKB 5DUPH 4HWBH 5HDQL 1IGIH 1AR1D 2FBJL 2IPTH 4UT9L 4WNQB 3WXWH 1G6RA 2P4AB 5KVMC 5DMKA 3KNBA 4AY0A 5E4EB 5IFJA 1W72H 3MLTB 1VADA 2IQAB 2KQNA 4F7MA 2J8UE 1JCKA 2M8XA 1ED3A 3VH8A 2FWOB 4LNRA 3O2DL 3EDEA 3RVUD 2Y5TB 4WW2C 3V5HA 5IG7B 1HWHB 4YHLH 5EC2B 3HUJB 3UX9B 4N0RA 3SOBH 1CD1A 2B0SL 4FXGA 1QOKA 4JFDD 4X99A 3ZSSA 2P24B 3SDDB 3BKML 1ORSA 2UY6A 3GMPA 3S3SA 2EXWD 3UC0H 2HWZH 4HJJH 5CJQL 4C83A 1Q9OB 4PD4J 3QUMB 1D5BA 2FL5B 3BE1L 5DD5H 3C08H 5D5ME 2GHWB 3MRIB 5DVMA 3I3DA 5DTFA 3P0YL 4MS8D 4NHCH 3ALXA 3DMMA 4EI5C 3GSNA 5EUOE 5T3XL 3L3HB 1TJGL 5HYJD 5F9AC 3VGEA 2DKMA 5GGRB 3R4DA 4YAQA 4D9LH 3K8MA 4L8DA 1DEEB 3V4UL 1EEUA 4O5LL 3AXLB 3RRQA 4PJ7E 4JM2C 4KI5D 4Y7MA 2HFFB 1MCLA 5HDBF 1FL6A 2UYLA 2AERT 4ONHA 1PG7X 4P0DA 4CMHC 5KSAB 4JFDA 4QHNB 3Q1SL 4HS6B 4N90E 3GNML 1XR8A 3L3OA 4LSTH 4WEUD 3QG7H 1BM3H 3WNKA 3QQ3B 4ZFFA 3OJDB 3RWGA 2CXKA 1IC5L 1H15A 1U3HD 1PEWA 3WS6A 3RDTD 5D8JH 1U6AH 1J8KA 3Q6GL 1KN2H 5HYJA 1CLOH 5EZJA 1FVCA 3EO9H 4I5BA 4R90L 5IGXH 2LAAA 5F9OL 5DK2A 1BFOB 4MDJB 3PDGA 4OFYD 1I9JH 4QWWC 5LWYL 4OLWL 3ZO0A 1P4BH 1BD2E 3PJSB 4BFIA 2D9QB 1JN6A 4Y2DC 3NN8A 5TDNB 1RZ8A 3SO3C 5F6IB 5D7KE 5HVGB 4MJ5B 1YN7B 4I3RH 3S5LG 3EYVB 2B1AH 4U1GC 4WJ5B 2E27H 2DTML 5JW5A 1G6RH 1TQCB 1ACYH 4MJ6B 3M17A 2VERN 2J3SA 4LK4A 2UY7A 1FRGH 4M6NH 4NO2A 4PRHD 5GRZA 1U3HA 2ED7A 5EO0B 3RDTA 4CN4A 2J6EL 3L3KA 3RPIA 1S78D 4LCYB 2ADJB 4O2CA 3EHBC 5GZOD 5DD6A 3VI3F 8FABA 4BFGA 5D1QD 4NZJA 5IIEB 1JWSA 3D2UD 5ETUB 5HYSB 4OFYA 3WFDL 2X1QA 3L95B 2J8HA 5FUOL 3WUWB 2JE8A 1X4XA 2P45B 4LRNL 3ZE2E 4BQ8A 4JDTL 3VDCA 3GIZL 2VDKL 1UM4L 2X1PA 2NTFA 3B8YA 4HUUA 3UJTH 3IDXL 2FSEA 2VDRL 4J6RL 3UTTB 4LSVH 2IBZX 2VITB 2YD6A 3LEYL 4ODTL 3UBXG 1IILE 5JW3H 4MD4A 4Y4HB 3ARXA 5BVPL 4UQ3B 2R69L 2AQ2A 4PRHA 4MX7B 4WTWA 1XF1A 3IDJB 2NCMA 5HHVH 3QJHB 4KJWC 1YUHB 1DUZA 3IGAB 2BSRA 2DQUH 1PX4A 3GJFA 1K4CB 3MX0A 1A22B 2EEDA 1DBKH 3RX8A 2AJVL 3CUPA 4UQ2A 1EGJA 5DQDH 1S5HA 3D2UA 5IT2H 1L7TL 2QSQA 1OM3L 1SY6A 3JVGA 5C0BB 3G08A 1V7NL 3QQNA 5A2FA 3BGAA 4MA3B 2R2BA 4GRLD 4LFHG 1ZLWH 1ES0B 3C6LB 4KAQL 1WFTA 5L88L 2GCYA 3DIFB 3HLAA 5TFSL 4WY7L 3TJEL 4AH2B 5FFLA 1QLRA 1ZHLB 4XC1L 3WFBL 4OD1L 4G6JL 1QVOA 4LLUA 2H3NA 2Q8BH 3IDNB 3PXJA 2DWDB 5C0AB 5ITFA 3HTLX 4YGAB 4UB0H 4DW2L 4JANB 3CDGB 4OT1H 1EUTA 2WUCL 1KB5A 2PYEE 3IKCB 4DK3A 1U8NA 4W68A 4E0RA 4JFYA 2X70A 4PBVC 1AD0A 1ZHNA 4LARL 1J1PL 4LKXB 1MCBA 2D7PA 2EYSB 1I3VA 1Q8MA 5F1IB 3FQRB 3DI3B 5DJZA 4XNXL 2QQNL 1CQYA 1ZVSB 4UILL 3REWB 3HUJE 1JZ8A 1FFRA 2DYPD 1LDPL 3C8KA 4FQCL 2F54B 4F9PC 3QWRD 1QBAA 3FOLA 4P2QB 5H35B 4JPVL 4APQD 1UM6L 2ZCHL 4KROC 1JZ7A 1YMHB 2X4QA 2CKBA 4G6KH 2ZPKL 5KS9A 3ZE1E 5FF6B 1IAIH 4LCIL 3D39D 4XPFL 1M7IA 4F58L 2DKSA 4R0LA 3K2UL 4PGEB 5TE7L 1KGCE 3AREB 3VFNB 4KI5F 5KVGH 1MCQA 4FA8A 1PG7W 2HH0L 5B39A 2A6JA 1IAOB 2CGRH 3VU2A 4K2UH 1MFBH 2XACC 4JKMA 2NMSA 5F89A 2W9LA 5FIEA 2NXZD 5AD0B 3IU3B 5DDHB 4JQIH 5GGVH 4YPGB 4GT7A 2EDHA 2JCCA 4LDOB 2WK2A 4RNRB 3HB3D 1CDHA 4OZGA 4MCYA 1Q0XH 1G7HA 4Z7VB 4OJFH 2EDKA 4G42A 2DYPA 4BQ9A 4N0UA 2PW2B 1NCWH 3QWRA 4X7TA 1Q0YL 3BMVA 3QZWA 3VXPA 4APQA 3SDCD 1BLNB 1HKLH 3EKCA 4IHOB 1R3HB 3H42L 3MACH 4PTTB 3CSYA 5TDOB 1NDMA 3D39A 2F5AL 3QPQC 3VI4F 4KK9D 1IQDB 4MAUH 3TYGL 2ATPB 4R97C 4NRXB 4KKLC 4QXGH 5CBAB 3MRDA 3WSQH 1TPXC 3QQ4B 3W0WB 2XKSA 4KK8C 4X5LA 3AS3A 1B0RB 1NBVL 4OM0L 1I3RA 1AKJA 1YEGL 3GJFH 1ODAA 1N64L 1P7QD 2AXHA 5SWSD 1FGVH 5C0RH 5GRXG 3G9VA 3H9SB 4XTRC 3FB5B 3QIBC 4MSWA 3R0NA 3RY6A 1VFOA 1BVKB 1J0HA 1CTOA 5IBUB 1XGTB 2VXQH 4N5ED 3OKNA 5FO7B 5DMYA 1I1CA 3SDCA 1S5IL 1TZIA 4ODUA 4MDIB 2E9JA 1INQB 3RJDA 1WITA 3BGMB 1IE5A 2HT2D 4LEXL 3SCMB 2Q76B 4P2YA 2VZ3A 4M7LT 4I9WD 1T5XA 3GMMB 1YYLH 2YEZB 4NNPH 3RIFF 1TCRA 1D5ZB 3ALPA 3FO2A 1CCZA 1I3UA 2DIAA 3QFJD 2EDYA 5D7LD 2DKUA 3T0WA 3BESR 2XNAB 3WIIL 1JL8A 2C4FT 5SWSA 3T2PA 5FO8A 2HJFB 4U3HA 2YOCA 1NFKA 4ISVB 1NCDH 2AJUH 1GIGL 5ICXB 1XGUB 2PTUA 3EYSL 4JKPL 4BKLB 5CIPA 3ULUD 4RGOL 2EEAA 4OAWB 3WNNA 5BOPA 4HS8H 1BBDL 2CKBH 4MA7L 4WW2B 5JHDD 5D71L 1A5FL 3PP4H 2WBWB 4WTXA 5C08D 1OAZL 1DZBA 5IEHA 3RTQD 2XFXA 4KUCD 4WFHE 4YUEL 1C8PA 1ZS8A 3VJ6A 1FZMB 2ZUWA 4JFZH 4LIQE 3LKRA 2SEBB 1KCVL 4ELMB 3MLUL 1MRFH 5T33H 5I75C 5IR1B 3OXSA 3QFJA 3VWKD 1T83C 5D7LA 4YXHH 3NCYS 1NAKH 4FQHB 2F19L 3NZHH 3WJJC 4LSQH 1DQJA 1F11A 4S11A 1GSMA 3KWWA 2ITCA 2YMXH 4EI5B 1KBGH 3MNWB 2AABL 3I3BA 5C0BE 3PQYD 5EOQH 4HT1H 5T1DH 2JCCF 1F4YL 2IPKA 3FQNB 3KPSB 1C5BH 5JHDA 2C1OB 5I66A 4OZGF 2AJXH 5ESAA 2X4SA 1KF9B 1D5MB 3F12B 5C08A 4JM2B 4P2OC 4NNYA 2XOTA 4X6BB 5C0AE 3EDKA 4PJDB 5ISZB 4CMHB 3RTQA 3MRJB 5BMFL 4XPBL 1T1WA 5EPMB 2WV3A 3TJHD 3SY0B 4AEFA 3FB8B 4H8WL 1RU9H 5D2NA 2ZCKH 3MODH 3VWKA 5DQ9B 4K94L 1MCNA 4V1DB 3ZKND 3QUYD 4ZUSA 3BW9B 4NQDD 4WU7A 4G80B 3SJVB 2IADA 2FYYA 2V7HB 1HDMB 3TZVD 2EDQA 3PQYA 1LO5B 2BFVL 3DYPA 4O58H 1AGEB 4U2ZA 3N0PB 1XGRA 4K7PH 4RZCB 4XNYH 3ZTJG 4L9LA 4U6XA 2CLZB 3CIQA 3P9MA 4MHHG 1F6FB 3OHXB 1MHCB 2VDOL 1JNHA 2MMXA 1FIGH 4OCWL 2VLMD 1FCCA 4Y2DB 3FAWA 5IW1B 3SO3B 5AUMB 1MJJB 1KEGH 3MGTA 5HHMB 3MRBB 1WC7B 3ROLB 4P57A 4HG4J 1IGYA 2BSSA 1BF8A 3GHEH 4U1GB 3HI1A 3OGCB 1IAKA 4GG8B 4UIKH 5GGUA 2X7LA 2B5IC 2ICWB 3QHFH 3VD4A 3MRGA 3QUYA 4Z7VE 1WBXA 4BH7B 4MD0A 4AEIL 3HG1D 5CIPH 4Q6IC 1JFQL 5J4MA 4L9DA 3AGVA 3TZVA 1NFIA 2VLLA 1IGFL 1TETH 1KC5L 3ET9F 4OGAC 4KTDL 2W59A 3BYTA 2A6KA 3LSOB 2EDFA 3BDBA 3UJIH 3WFEH 5DD3L 3IRPX 1S9YB 2PETA 3BN3B 4X80H 3INUL 3QI9D 2W0FA 4PY8I 3S36H 1FLRL 4LQ1A 4L8SC 1HSBB 3DSFL 3VE0B 2PO6D 1Q94B 3ARUA 4X6DB 3W0WE 3BP6A 2R23A 3UEZA 2ERJC 3WN5C 1PQZB 4DUWA 2ZOLA 1Q9KA 2B7DT 2AJYL 3O8XA 3H9SE 4AMKH 1RZGB 4JVPA 4TQEL 3H3KA 1AFVH 2BNRB 3HG1A 3ULUH 4QRUB 1OSZB 1RUAH 1GVIA 4K7PX 3STZB 1IL1A 1GGBH 1I9RL 5T5FL 4R7DB 5E9DB 3OR7B 3BH9B 2Z4QB 1CFNA 1FIEA 1MFEH 4DKFL 4UDTB 2DQIH 3IFLH 3QI9A 4LL9A 1MPAL 1HH9B 3BQUC 1OWRM 3ULUF 4L4JA 1BZ7A 1E27A 4YXLL 1JF1B 2PO6A 5HSFA 4EDXA 2VQ1B 4KUZL 3RL2B 4HXAL 4OLUH 3LN5B 4MQXC 1ZLVK 2D0HA 1N2RB 3VDAA 1UVQA 2IPUG 4GAGL 1EEYA 5JW4M 4U1JA 4KUCF 2C5DC 1PSKL 3G6AB 4FFWD 4I18A 3MYJA 3B2UC 2CRIA 2JIXB 2PCPB 2EECA 5A2KH 3DV4A 1S7XA 1I85A 1P4IL 3EJYD 4Z9KB 3EDJA 4XBPB 3MLZH 1OGAA 1QQDB 5KVFL 2I07B 2ZZUT 1L7IH 3NACH 3DX6A 4FZEH 4XPAL 1W0YT 3D0LB 5C0DB 2OSLB 3QXAB 4HIHA 1J1OH 4KROB 1CVSC 4CN6A 1NGPL 1Y18A 5C7XL 3PWLA 5DRNB 4OZFA 3EYFB 3BH8B 3EFFB 4BZ1L 3OZ9L 1QZ1A 4Y16C 2ZUYA 2IFFH 1T3FB 2G5BA 4Q0XL 4R3SB 3FFCB 2JB5H 4RGNC 4YK4C 1P84K 2EDOA 1FL5A 1FZOA 1A6UH 1DDHA 1SJVA 3NFPA 4Y19B 5JOFB 2FJFA 2CDEA 5BZDA 3KPSE 3HZVB 1U8KB 3GSUA 2BNQB 1F42A 3MNVB 2Q3ZA 2QSCH 4V2CB 5DEZA 1GCFA 3MUGB 5IQ9A 4EIGB 2DDQL 5C0FB 4LSUH 2GK0A 3HNVH 4PJDE 3QR2A 4QXWA 5CP7B 1YYML 5ISZE 4L4VB 2F58H 3K74B 1BGXL 4MWFA 2YN5A 4KQ4L 3MR9A 4LSSH 2GSGB 4MA8H 5HGAB 2NW2B 1GOFA 3LKQB 4P3CH 1PG7L 1JGLL 3DVGA 4U1LA 4ONGH 3MRQA 4JDVA 1R0AH 4ZYKA 1X5ZA 3HAEH 1NGWB 2Z8RA 4HWBL 3FTGB 4R97B 2Z0BA 2IPTL 1Z0NA 1A7OL 2HFGH 1TPXB 1RULH 3SJVE 2N7AA 2WP3O 2NZ9D 4Z78A 4NCC2 3B9KC 3ILQC 4IOSD 1W72L 3FFDB 4OIIH 4JN2A 5C0CE 1M7DA 1ZK9A 3KJ6H 4F2MA 1JHLL 1PDKA 4XNZC 4C58B 5F1SA 1U41A 5E00B 2ADIB 1TVDA 3QIBB 4Y5XC 2CO7B 3QISA 1YEKL 2DLIA 4F8QA 2R0KL 2W9DH 1S3KL 5CSZB 5F6HJ 3SOBL 2QADD 2OTWA 3H9HB 5HHME 3MJ6A 1JGUH 4XI5D 4H8WC 3ZZ1A 4WW1A 5CD5C 2AK1L 4GSDH 5CGMA 5LXGL 4HAFA 1QSFD 4K94C 5IMOA 3UC0L 4ZMAT 3IF1B 3MV7D 4HJJL 1AHWC 1V3JA 4NO3A 4XXDA 3WFCH 2NPLX 2P5EB 1IC1A 1KSRA 3TBTB 5GS0D 4PRPB 5IFAH 3GMLA 4I4WA 1MCOH 4NHCL 4RMUA 1HHGB 2IJ0C 1SM3H 2X2YA 3QDAA 3KS0J 1MI5B 3HRPA 5EH1A 4D9LL 1RUMH 4FS0A 2AXGA 1RHFA 5ID1A 2X1XR 2WLYA 3ECBA 1I7ZB 2BC4A 2UWEB 3IDGA 5C3LD 4IMKA 2OMNA 4KKBD 4X6DE 1F97A 4PJAA 2CDFB 1TXKA 4OZFH 1RUKH 1CFVL 3F5WB 3K8KA 3RAJL 3MJ9H 1UWEH 2D7MA 1BOYA 1QSFA 2Q86A 4LSTL 3MV7A 4NUGH 4PG2C 2XTJC 3B9EA 4KDWA 5CGYC 2BNRE 5I75B 3LEVH 5DJDB 3S35X 4K9EH 1H3VA 3TNMB 3T2QA 5D8JL 1U6AL 5EIIB 3QDJD 1KN2L 4M03A 5F7DB 2OM5A 1CLOL 3EO9L 1ZGLP 5CD3A 2Y06H 1PKQE 2YPKA 4OZHB 3FO9A 4OB5L 4KH2A 5IGXL 2NLJA 4DEPC 3IJYB 4GKNA 5LAXB 3EOTH 1I8MA 1OP9A 4M9OA 1B0GB 1P4BL 3IDUA 3HRZB 4MAYC 3HPJB 3VFPA 1WV7T 4P2OB 4U7MA 1Y6MR 3SE3A 1IAII 1D9KC 3FO1B 5KAQF 1XF2A 3D0VA 4I3RL 1OF2A 1WUNT 2E27L 2E7CA 1G6RL 2YK1H 1ACYL 1E6JL 3MGOA 1KUMA 2APFA 5GGTA 5EFIA 5F7WC 1FRGL 3CH1A 4ZQKA 4M6NL 4IJ3C 1BBJA 1U8PB 4JHWH 3QDJA 4KDTA 1Q1JH 2XICA 1W8OA 1XH3B 3QXVA 4RAHA 4BQ6A 3H7BB 5J0BA 4E42B 1RJZA 1I1YB 3OKMA 5EIQA 4O4YH 1F6AA 2MKWA 3LY6A 4NSKB 5F96H 5IBLC 5F9JA 5C07B 2WQRA 5CEYB 1P2CB 3GBNH 2ZUXA 5D7JC 2X5PA 5IB1A 2XKNA 3PWPB 4RAVA 2I26N 2YRPA 5F7HA 1OQOA 4KJQD 1FL3B 3UJTL 1CT8A 1W0WA 1F90H 4TVPD 2HLAA 4LSVL 3TGXA 3T77A 1A6TB 2VIRA 3V0VA 2ATKB 5CHNA 5CAYB 1FVEB 3KPQA 1RK0B 2APWA 1KXVC 2F74A 3ZSTA 4Y19E 2DQJH 3L3IA 4U33A 3SPVB 2B5IB 4G8IA 2DQUL 3KG5A 2BNQE 4QY8A 1CE6B 3NAAH 1DBKL 2ZOKA 1K5NB 4Q6IB 5DQDL 5IT2L 3VXMB 3KGRA 1OSPH 3DSNA 4LLYB 4XP6H 5B8CC 4G8FB 5DJ2A 1DP0A 4XP5H 3DI2B 1MCWW 5I8KL 4BH8B 4L8SB 4KK6C 5B21A 2Q8BL 2H6PB 3C60C 2GJJA 5GS0H 4UB0L 5IFHL 1QFOA 1DBBH 1G0YR 5IMKB 3MBED 4POUB 2ERJB 4NQEB 1NEZA 3WN5B 3ARYA 4PJ5D 4MVBD 3HC3L 3ES6A 5MEQA 4W4OC 3RX7A 4HFUL 1KPVB 3A6CH 3OX8A 2OQJB 1QLEH 4QF1A 3GKWL 1R3KA 3QXTA 3WJLA 1F8TL 2E7LC 1NLBH 1UWXH 3A6OA 4ZFZA 5I1DA 3RWIA 2IMNA 3FN9A 4G6KL 3SKNA 5EBGA 1MLCB 3QQ9C 4XBGB 4X8XA 4JO2L 3U82B 1IAIL 3BQUB 2GYSA 2X4TB 3RPKA 5J13C 2PTTB 4HMEA 4HAGA 2BRRH 5KVGL 4OLEA 4BZ2H 2P5EE 5IBUG 2GITB 5GGTH 4PRPE 5MENB 2CGRL 4K2UL 1MFBL 5CUSH 4JFEB 1R3JA 2XZAH 1D3CA 1XGYL 2VL5A 5MERB 4JQIL 5GGVL 3X3FL 5B38B 4Q9CA 1TZGH 1W0VB 4PJ5A 1MI5E 4GW1B 1Q0XL 4OJFL 1CDYA 4OKVB 1NFDF 4PRAA 3LS4L 3FB6B 1IBGH 2UWEE 3HMXA 1X5GA 5F1KC 1NCWL 1S7SA 5KANI 3OKOB 1FN4B 4LBEA 1ZEAH 2NYYD 2GT9A 2AK4B 2YUVA 4AJ0A 1HKLL 3SHSA 2KZ1B 1M7XA 1FSKC 2DJSA 1MJUH 3UPCA 1O7VA 4Z7QE 5A43C 2FDBP 4GKOA 1MRDH 4UUJA 4NYLB 4BSWA 3QYCA 3HKFA 1K85A 4ORGA 2A83A 5ACLA 2NY6D 5EU5A 1Q9LA 4XH2A 1U8OB 1KIRA 4QXGL 2BZDA 1GGTA 5DD0H 3WSQL 3M45A 1A02N 2Y7QA 3MFFA 5CZKA 4Y4FD 1BF2A 5ICYB 4Y16B 4ZO7A 3GSRB 5JA9A 1D6EB 2EE6A 4OZHE 2C4FU 4RGNB 1FGVL 2YD2A 2MJWA 4NHUB 4YK4B 3O45A 1XGQA 3ILPB 4R96B 5HHOB 4NQXB 5IJKC 1U93A 4MQTB 4J2XA 3GSOA 4TUJA 1G7PA 3U2SB 1FVDA 2UUDH 1I8LC 5IVXB 1NQBA 1P9MC 2Q8AH 2NX5A 3LS5H 3VFUB 4N9GA 3PWUB 2QHRL 3VGBA 3NCFB 4Z7OE 4OUUB 1TJIH 2DQFA 4EBQH 3TNNB 3O2VH 2X05A 4WI4A 5T3ZE 3G5ZB 3O0RH 4Y4FA 3OB0H 5JDSA 2GQHA 2FZ3B 5HHPB 1EPFA 5BS0D 1GPOH 1KIQA 5EO9B 3B9KB 3QEQD 3BWUC 2AJUL 4RIRB 3OR6A 5KSBB 4XP1H 5C07E 4XNZB 3BEVB 4L3CB 3TEUA 3L5JA 4JDZB 3SKUD 3QG6A 2AKRB 4UTBH 4HS8L 1QTYT 2CKBL 2HT3C 4Y5XB 1T04B 4YH6A 5KVEH 5DJYA 3PP4L 5HI4C 43C9B 3T3ME 2Z91B 1CD0A 4DOHB 5JDJA 3ARSA 1YPZB 1S7QB 2BY3A 4PJXF 2F8OA 2AI0H 1MF2L 2JB6A 3FQWB 3RIFK 4GG6B 4JFZL 3BZFA 4X4YB 5T33L 1BQLH 1AHWB 4O2EB 2DJ4A 5E2TH 4D3CH 1QA9B 2XI9A 3MXWH 4RRPA 5ID0A 1CDUA 1NAKL 4Z8FH 3NZHL 4LSQL 1EHXA 1MVUB 3EO0A 4NRZB 1BQUA 3G6JB 5BS0A 4JGMA 2YMXL 4I0PD 3QEQA 5FAAA 4F7PA 1NAMH 1KBGL 4D8PB 4HT1L 5T1DL 3ZYOA 4B7LA 1JGVL 2DLGA 1TNMA 5F7UA 5A3IC 1JPSL 3RVVC 1F4HA 5DK3A 2AJXL 43CAA 3ULVD 4X9IA 1IZJA 2DQGH 1AR1C 4LCCC 4L3EB 1OCWL 2IH1A 4HXBH 3DMMC 1UM5H 5HYIA 3VXTB 15C8H 4NQEE 2AJZB 1RU9L 2R0ZH 5CWSA 2B2XH 1DANT 3CSBA 1H5BA 3FT4A 3MODL 3RVUC 1IGJB 1DE4B 1RVFL 2XTJB 3ZYJA 4FRWA 2FR4B 1JTPA 4PJBA 4E5XA 1U58A 4NO5B 4I0PA 4M00A 4YHMH 1KIPB 4CAGA 1RZFL 3JZ7A 6CGTA 1MY7A 5L2KD 4M8QB 3A67H 4O58L 1VGKA 5AZEH 4JO4L 4YFEA 5I1JH 4K7PL 4DEPB 5FYJH 4XNYL 4DKAA 2EXWC 2H2SD 3AB0C 4LQFL 5KOVC 4E41B 1Z9MA 3DX9B 4NQUA 3VMPA 5KG9B 1H3UA 3DVNA 4MAYB 5FO9A 1WCBA 5LQBH 1FIGL 3NIGE 2O93L 2IAMD 4HKXA 1QP1A 4MS8C 4FP8H 5MENE 1KEGL 2R1YA 4YX2H 3B6SA 3WS6C 1P1ZA 4X4MA 1D9KB 1A7NH 1NGYB 4JFEE 2O5XH 4D94A 3NABH 5DHYA 1AJ7H 2WNGA 1KJMB 4HZAA 2BY0A 1I1FA 4UIKL 3MRMA 4Z76A 4KRLB 3IETB 3QHFL 3ARDD 3HZMB 2BJMH 3RWEB 3ARTA 4IJ3B 3DGGB 3LQAC 4KI5C 1AGFA 2GKIA 1WTGT 1J05A 3JTTA 3HPLB 4ODSL 5L2KA 1ZT7B 2AK4E 4TSAL 4MYWB 1AP2A 5ELIA 4GOSA 3BP7A 3QEUB 3MCLL 3UTSB 5F3BA 1OP5H 4X80L 2MQ0A 4U3CA 5D7JB 4AT6B 4P46D 4TPRH 4RISH 1G7MB 3DXAB 2IAMA 2VABB 2MHAA 4NOFA 3SO5A 35C8L 3O6KH 4AIZA 1U3HC 5BV7H 3WBDA 2CIKB 3T8XA 3RDTC 3KAAA 2WP3T 2BOBB 1B88A 4G9DA 1X9QA 5DRWA 4PRIB 1YDPB 4X8JA 2YZ8A 3O41A 1P84J 4N8VB 4RGNE 1KACB 2APTA 3ARDA 4YDIH 1UQSB 3OKDB 5HHOE 2P7TA 2VUYA 3T65B 1AFVL 3ULUL 3S8WA 4JY5L 4NQCE 2D7TH 3QULB 1RUAL 3VXSD 3VFVB 5DYOA 4N0FB 4ETQA 2P5WD 2VQTA 12E8H 5I17A 2RR3A 2YD3A 5IVXE 5D6CA 4PLOB 1MUJB 5DJ0B 1KN4L 2DQIL 1UFUA 3H7LA 5B8CB 2DQEL 4HIIB 4P46A 3KLDA 4FXLA 1NGXA 2LQRA 3FCTA 4NFDA 3JWDH 1N59A 5FECB 4NT6A 2GAZB 5C2BH 1S78C 4OLUL 5HHXH 4IRJD 3C60B 1LP9E 4X6EA 1F3DH 5GZOC 2QHLA 4FG6D 5DJ6A 3FQUA 3KYKH 2MSPA 3JVGC 3OAZH 4HIXH 2D03L 2EH7H 4XWGH 4JFHD 4Q2ZB 5ERWA 3VXSA 4PJFE 2BVOB 4GRWH 3CSPA 3FQTA 2P5WA 3QNYB 2A6IA 4PJBF 5I18H 4UT7H 4XNMB 1IEHA 5I0DA 1TLKA 1L7IL 2CXGA 3NACL 4I8DA 1VHPA 4JRXB 4DOHE 4FZEL 1SEBB 1UKQA 2IALA 3RWHB 4OZIA 3FJTA 1CICD 4FNLH 1J1OL 1YPZE 1U8IA 3G9AB 4GG6E 1T2XA 4F7CB 2DTSA 3K0WA 3KXFB 4GRWF 2Y36L 2BDNH 3HS0B 4CGTA 3NMEA 5J13B 3WKMH 3ULVF 4NQSB 1R5IB 4IRJA 3X11A 1FCGA 2Q3AA 1VGEH 3SGDH 2I25N 3DURA 3PV6A 2Q7NA 2IFFL 2VLJB 2XWBA 3G6JE 2UZXB 5J6HA 3QEGH 1OTTD 5MEOA 5E0QA 5I71C 5IB3B 4QHLA 2HVKB 4LVHC 3WS3B 1U2CA 1ITBB 2XWJA 2B4CH 3CZFA 4R0LC 4X5XB 2CSPA 1EIBA 1QD0A 2HJLB 3TYFA 3CXDH 2Y25A 3HNVL 1UADC 4L3EE 4YHIB 2BVEA 1CICA 3HZKA 5SX4I 2F58L 5J6GB 1H3XA 2ED9A 4Z0BH 3U46A 1FSKB 3IS1X 3MBXH 4LSSL 4WUUB 4C4KT 2BVQA 3VFSA 3CFDB 4TNWK 2IANB 1R0AL 5FK9B 3KYMA 1HOCA 1Y6NR 2XTJE 1FYTB 5IW6B 3FN0H 1YEIH 1N5YH 2HFGL 4U6VH 2YN3A 4RA0C 1RULL 4P99A 4W81A 5FYLH 4APQC 4OF7A 2MKLC 4OIIL 3KJ6L 2CRMA 3LZFH 4JZOA 3S35L 1YMMB 1S9WA 1SJEA 3PL6D 4YHKL 3ZT7A 3W2DH 4Z0XB 2P49B 3VA2C 4E41E 4J3VA 1NLDH 1ZGLA 4X83A 1R5WB 2W9DL 4U1SB 4G6MH 1CIUA 1DLHA 1KB9K 5CBEA 3HA0A 2NXZC 3EO1A 3CFKB 1JGUL 3MTRA 5D1XD 2QQLH 4GSDL 3MJGX 4OCYH 3U6RB 1MCEA 2FB4H 5FA3B 5BZWB 4R9HA 3F7VB 3LQMA 2IEPA 4WVRA 3QRFM 1CFSB 4LSDA 4H26B 3QJFB 4JPIB 1KT2B 3RY6C 4XPTH 5ADOL 3RVTD 1LK2A 2CKNA 3MV8D 1MJ7H 2NY7H 3MROA 2CJUH 3SDCC 1SM3L 1X6NA 4JAMB 4PGBB 4JB9H 4ODHH 1U8QA 3JTSA 1RUML 3L6FA 3PL6A 5DZNA 3UTSE 3PNWB 1CVRA 3AS1A 4XP9H 1A7RH 3QO1A 1EHLL 3ARGD 3I3EA 4AENA 3DXAE 3AROA 1BIIB 3L3JA 3FQXB 1P6AB 5D1XA 5DVKA 1NCCH 3HNSL 1RUKL 1G6RB 3JWNC 1UWEL 5DMKB 2HT4D 4QHUA 3KNBB 4OZIF 4NUGL 5IFJB 1VADB 4XZUB 5FOBA 4F7MB 4TSBH 4M6MH 3ULSB 1T21A 1ED3B 3VH8B 3MV8A 4LNRB 5I1GL 4K9EL 3MRPA 3IJSB 3N1QC 2F9BT 3V5HB 4ODXA 4OF8A 3BPLC 3ROOB 3ZDXF 4S0SD 4QKXB 3QDHA 3MV01 2GI7A 4OV6F 5FDYA 2Z35A 8CGTA 1CD1B 3L7EA 2HT2C 4FXGB 5J56B 3BKYL 1V3MA 4X99B 3VXRB 3EOTL 4KHTH 1ORSB 3ARGA 4Y8DC 2QV2A 1KJ3H 3GMPB 4P5KA 4YFLF 1TVHA 3UPAA 5F70A 3P73A 4C83B 4GUPA 4LCCB 5IMLA 1D5BB 2FO4B 5DTFB 4HKZA 4LF3A 3WL9A 3DMMB 3GSNB 1WIPA 3RJQB 1VENA 5JIIA 3O4LA 5DA0B 3ULUC 3RKPA 3TFKD 4YAQB 1T20A 1A9EA 3B83A 2XRAH 4L8DB 1QEWA 3VWJD 4Z7WA 2GUOA 1HZHL 5KBNC 1Q1JL 1CXKA 5HI5D 4QRSA 4J3SA 4LPVA 1I7RB 1PY9A 1FL6B 2UYLB 2D3VA 4MXVE 4JRXE 4ONHB 4O4YL 5F96L 3RTQC 3T0ED 4JFDB 4KZDH 5DLMH 3KLAB 1UACL 5D72L 4EVNB 4CW1A 1XR8B 3GBNL 3L3OB 3UTOA 3ORJA 3ZYIA 2EIBA 4HD9A 3AB0B 1FG2A 5D2NC 4KVNH 1MCCA 3I6KA 4P23D 3BRGC 5EBMA 1MCJA 3KLHD 4UOW0 2VL4A 5T5NF 5TGBA 3RWGB 1GZQA 3U9UA 3OKEA 2R8SH 2IWGA 3MLXL 4KKCD 4OBRA 1H15B 2VLJE 5J1TC 5KJRH 4YXKH 1H8OA 1PLGH 3CDYA 5GXBB 1E28A 5HYJB 4NN7C 4R6UA 1CXLA 5EZJB 1FVCB 3DUHA 4I5BB 2DQJL 4GXVH 4IDJH 5DK2B 3VWJA 3DLQR 4L9LC 3T0BA 4ZNCD 1T7WA 3AAZA 1FNHA 5E70A 3SEPA 3QWQB 3C5SA 2R4RH 1JE6A 3NAAL 4PP2A 5INCA 4BFIB 1JN6B 1C12A 4LSPH 3NN8B 3WLWC 5I19H 1RZ8B 3T0EA 1OSPL 3LB6D 4XP6L 5D93C 3TJHC 5E03A 4KV5F 4WUUE 1NC4D 4G8EB 3PP3H 1J88A 1NPUA 3QCVL 5JW5B 4P23A 4XP5L 4XNUL 4D0BA 4UT6H 2IANE 3MREA 4R7NA 3M17B 1CR9H 1LO2L 2ICWJ 3A6BH 1FYTE 3QUYC 4MJID 1A6AA 3FHQA 2VXUL 3OGOE 4J7RA 1U3HB 4NO2B 5HDBE 3RDTB 5GS0L 3L3KB 3MUHL 3RPIB 3V4PH 1DBBL 5CMAA 5H94A 2GTZB 3TZVC 4O2CB 1E4KA 3LKNA 5DD6B 8FABB 3SDYL 3LRHA 4AIOA 1YMME 1JWSB 4WHDA 2JF1A 4RA3A 2Q7YA 2KBGA 5KSVA 1BAFL 4OLVL 4GW5A 3LN9A 4PB9H 1QLEL 3KHOA 2NTFB 5C0GB 2BVUA 4HUUB 3T08A 1I3GL 1VEMA 1NLBL 4YGVB 2FSEB 1NC4A 4GBXD 3OAYH 3ALWA 3Q3GA 2W0LA 1WK0A 1LVEA 4MD4B 1TZHA 3O8XC 4MJIA 4XAWH 2BRRL 4PRHB 4BZ2L 3PDDA 5GGTL 3IDIA 1DUZB 1DBJH 2BSRB 3GJFB 2XZAL 1E4XH 3GMNA 2IQ9H 3CUPB 3GSQA 1S5HB 1TZGL 3D2UB 2R29H 4JE4B 2KQMA 3QI9C 3G08B 5IW3A 4HUXA 4MZ3A 2R2BB 3IVKA 4UIMA 1IBGL 2GCYB 3HLAB 2PO6C 4P9HH 1QLRB 2CRYA 2OJZH 1ZEAL 4Z7WF 1NCNA 1QVOB 2VDQL 4LLUB 5C09D 5MHSD 5AG8A 4KTEH 4GBXA 5F3HA 4YJZL 5ITFB 5F8QC 4OGZA 4WI2A 1UEYA 1IAIM 2C9AA 1CI5A 7FABL 1KB5B 2EYTB 2GJ6D 4HV8A 1U8NB 1U3ZA 4I18C 2KKQA 1BFVH 4HFWA 2EC9T 1H9VA 3KPLA 1IAMA 4E0RB 4JFYB 1UWXK 2X70B 5IB2A 1AD0B 5JR1H 1ZHNB 3ARQA 1I85C 4OCRL 4PJGE 5K9OB 3VDBA 1WAAE 5DJZB 3BO8A 1QFPA 3LRSA 3WMSA 1WBZA 3C8KB 3HZYA 4NN6C 2EKSA 5C6TH 3LHPH 3FOLB 3MFGB 4JZNA 4ONOA 3M8OH 2NY1D 5F88A 1U36A 4GS7C 3HFMH 2X4QB 2CKBB 3VXRE 5I71B 5F8RC 1B0WA 5KS9B 1VKXA 1BJ8A 4JM4H 4LVHB 4NN5C 4PIRF 3K4ZA 5IVNA 2LU4A 4OLXH 1EAPA 4HCRH 5C09A 3ZHLA 4R0LB 2R56H 5B39B 2A6JB 4TVPL 1JHTA 5F89B 3UROR 1JZ3A 4LOUD 1ZHKA 1J1XH 2GJ6A 4FFWC 3LS5L 1U92A 5K33A 1F58H 5H37G 5I15L 4DVBA 2JCCB 1FC2D 1WSST 1RIVH 3IAQA 4K9EC 4EBQL 3EJYC 2FIKA 3O2VL 3UZVB 4TVSa 4OZGB 3O0RL 4MCYB 2X4RB 1G7HB 1CZ8H 4G42B 4ZS7H 3P30L 1TJHH 2C26A 2DYPB 3F7QA 4N0UB 4EQ2A 2EIZA 4X7TB 4XMPL 4DN3H 3QZWB 3VXPB 4APQB 2XN9D 1LEKA 2FECI 4I77H 3CSYB 5HPMA 4ZPVA 1NDMB 3D39B 3PHQA 3B5GA 1AQKL 5KVEL 3FRPA 5TPWH 4EUPH 3MRDB 2NXZB 3WNMA 3QDGD 1HYRC 3HR5A 1UEMA 1I3RB 1AKJB 2A9NH 2AI0L 3ZHKA 4BUHA 5JQ6L 5C0JA 4A2LA 2UUDK 1DANU 1BQLL 5E2TL 4D3CL 1D5XA 3MXWL 3RQ3A 4MSWB 1CGYA 2MQ3A 3O9WD 4Z8FL 4KI5E 1PVHA 3V2AR 4IOFD 5F1OB 5JMRA 3OKNB 3HMXL 3SDCB 1TZIB 2XN9A 4ODUB 1NAML 3OB0K 3I50H 3WIFB 3SGEH 4D9QD 3TIEA 2G9HA 3HE6D 2E3VA 3X12A 4G7VL 4DKDC 1T5XB 2DQGL 3WDHA 1TCRB 1T1XA 3FO2B 5T1MB 1OL0A 1IQWH 1OTSD 3QDGA 4XB8A 5K93A 3WNLA 2A77H 2BSTA 3VRIA 1R6VA 15C8L 4PJ8D 4PJCA 3O3AA 5SWSB 5FO8B 1S7UB 3CXHK 1OLZA 4ZS6D 1VACA 5GGSY 1YEDA 3VI4E 5I73C 3O9WA 4CVZB 5AWNL 3HCVB 2AS5M 1I4FA 2QADC 3W5NA 4IMKC 1JF6A 4JRWA 5DMJB 2P43B 3BPLB 1MIMH 4Z7NE 3U79A 3A67L 3KYOA 4TNVK 3TCLA 3B3IA 5AZEL 1JWUA 4ZUUB 4N8VG 5D70L 1MLBA 1PAMA 3HE6A 2Z8SA 3VJ6B 4O51B 2L7UA 2X1OA 4AL8H 4UTAH 5GS0C 1YEHL 3C5JB 3LKRB 4PRHE 2WBJD 2VSCA 4FP8L 1UZ8A 3OXSB 3QFJB 1FNGA 4HIJA 1A7NL 1QRND 1T03H 2O5XL 2BXYA 1DQJB 1QLFA 3NABL 3NPZB 1MCIA 4PJ8A 3WYRA 2FGZA 3KWWB 2ITCB 3IXTA 5DK0A 1AIFA 4JHAH 4OF0A 1T5WA 3DVFA 1DQDH 2BJML 4IEFB 3UBXA 2IPKB 3O3EA 5I66B 5ESAB 2X4SB 4KKBC 1K2DA 2FECL 5C08B 4YHOH 3SE3C 1JP5A 4ZUVA 5FDWA 1LO3H 3UO1H 5JIKA 3RTQB 5F7YC 4H20L 3GMRA 1PD6A 2HTLD 1T1WB 2FIRT 4TPRL 1INEL 4RISL 4DKEL 4K07A 1ETZA 5D2NB 3FT2A 1S7RA 5BV7L 1MCDA 3DX8A 4U7KA 1QRNA 4KDTC 4XVSL 4ZUSB 1HI6A 1OT1A 2VH5H 1R3LA 4WU7B 5EA0H 2IADB 5L2JA 4TULH 5E5RB 4KQ3L 4NN7B 4X9HA 1XIWD 3PQYB 4HWZA 4YDIL 2FLRT 3ARWA 4QCIA 2H1PH 3FB7A 5KS9E 1FE8H 4L9LB 2D7TL 4U6XB 2OZ4A 3L5XH 2ZJSH 3CK0H 2H41A 5AZ2H 3P9MB 4K8RD 1GHFH 12E8L 1JNHB 3THMH 3OPZL 3VD3A 1JGEA 2ZUTA 2NXYD 5ICZA 2VZTA 3MGTB 5D93B 5IUSA 1MCPH 3GUTA 4P57B 1IGYB 2BSSB 3WHE1 3RIAF 4NJ9H 4QGYA 3JWDL 1ADQH 1ZWIA 3HI1B 1IAKB 3VXNA 5GGUB 2X7LB 5EBLA 4J8RA 4OZGE 3UPRA 5C2BL 1T7ZA 2R2HA 3MRGB 5HHXL 4ZXBA 1MFDH 4QRPD 3OG6B 2DMBA 3I6LE 3QUYB 3V5KA 1WBXB 5CJ5A 4UDUA