1K8IB

Crystal structure of mouse h2-dm
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
190
structure length
190
Chain Sequence
GFVAHVESTCVLNDAGTPQDFTYCVSFNKDLLACWDPDVGKIVPCEFGVLSRLAEIISNILNEQESLIHRLQNGLQDCATHTQPFWDVLTHRTRAPSVRVAQTTPFNTREPVMLACYVWGFYPADVTITWMKNGQLVPSHSNKEKTAQPNGDWTYQTVSYLALTPSYGDVYTCVVQHSGTSEPIRGDWTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC class II H2-M alpha chain
publication title Crystal structure of mouse H2-M.
pubmed doi rcsb
source organism Mus musculus
total genus 33
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2001-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1k8iB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1k8iB01
3WN5C 1N4XH 3IDUA 4PP2A 4C83B 1CI5A 5HGAB 5C6PB 3MUGA 3P0YL 3M17B 1BBDL 1S9KC 1P4BL 1CXHA 4U0QB 1ZS8A 1OY3B 3AAZA 4Y19A 1RMFL 3L7FB 3WSQL 2W65B 2UZYB 1QRKA 2D03H 2NY1C 3BW9A 3I3DA 4JZJC 5ESAA 2P8MB 4LCUB 4UNVA 1JBJA 3OJDB 4XPFH 5DFTA 4PLJC 5E2UL 4WY7H 3MV7E 5JHDE 2FJGB 3MNVA 1RUML 1DUZB 2NNAB 4HMDA 3K8MA 1FCGA 4LVEA 5FUZL 3WNMA 1MHEA 2DYPB 5C0DB 3QIUB 2JJVA 1EUUA 3QIBB 2Z93B 1C7SA 3PP4H 2VDRL 2LAGB 3UBXI 1CLCA 4UNUA 4Z7VA 5T33L 3TN0A 1T1YA 3ULSB 1YEHH 1U0QA 4QXUH 4UQ2A 1XF3B 4HUWA 5DK0A 4Z95L 1CFBA 5EA0L 4PLNC 3V4UH 3CDGB 4PJGE 2BNUB 4IMKC 4U1KB 4UV7L 5CP7B 3HC4H 2P45B 2NY7L 1MCRA 4LVHB 4OFYA 3VU2A 4WFHE 4X98B 1KIPA 4NO2B 3C5ZD 5D2LF 3JWDC 2NY3D 3CVIL 4DQOL 1KTDB 3HE7A 4O9HH 3JWOL 4BSVB 3RBSA 1E28B 1NCNA 5D6DC 5TQ2H 4XX1E 4XP6H 3REVB 2X4TA 1JHKH 3L5XL 1QSED 4Y4KA 2R1XB 2WINA 5KSVA 2LVCA 4GKNB 4F8QA 2Y1VA 4R4FL 4FQQA 5T1LA 2YD7A 4IS6B 2RR3A 4ELMF 2HA1A 1K8IA 2AK1L 5FA3B 2JCCB 4DKAA 5MP6H 5C0EA 4OLXH 2APBA 3RTQA 1JYNA 4HIEA 2BOBA 1OLZA 25C8L 1NC2D 4KK6D 5T5NF 2GSGB 3UJJL 1LP9A 2B2XL 3VGDA 1NEZB 5C0GA 4HKJA 3UZVB 1A47A 3H42H 5IB3A 4L4VA 1MY7A 4OUUA 2F54B 1LO5B 4K3GA 4OZFG 1WV7T 2OXGA 3LOWA 1T1XB 3IFLH 7FABL 4YHYC 2WIIB 3BT2H 4X4YB 3OG6B 1T20B 4JRYD 4JREC 5DMYA 2OLDA 5GGTH 3EJJX 3X11A 3D3VD 4M1DH 3NPZB 2CPCA 5D1XC 4PRIA 5KSBA 4JDTL 4HDIB 1MFBH 5HVFB 3HR6A 3G04B 1MCOH 5TJWK 5IHUL 1XIWB 5BVJA 5CJQH 1MCJA 1N4XL 1HOCA 1DJSA 1I1AD 4KUZH 1JCKA 3ARGD 3QUZB 4OTXH 4W4OA 2BNQE 3EOAB 3E6FB 4NQDD 5DRXA 2BVUA 5K9QI 3ESVF 2D03L 3RPIB 1LO2H 4RGNC 5I1AB 1KV3A 4JFFD 5B8CB 1FYTA 2XYCA 4C57C 2YSSA 3VWJB 2WIMA 3D18B 1CGVA 4UZGA 1CS6A 3DMMB 3C9NA 2JIXB 4CVXA 3VXTB 3BESR 2X89A 1U3YA 5ANMA 5C9JB 5IB2A 4OZFA 1JPFB 3PP4L 5D1ZD 1OT2A 1FC2D 1OAYH 2CO7B 2AW2A 1MCBA 1S5HB 3FN9A 1YEHL 4Y2DA 2PW1B 4QXUL 3PXHA 1I75A 3JWDH 2CRIA 3VXSB 3V4UL 4LIQH 3QIUC 3W5MA 4WW1B 5LGKA 1YEGH 1T1ZB 5KZCD 4CVUA 3U2SB 1W0VB 3HC4L 1N64H 3FO9B 3RDTA 5AEAA 4MDIB 5D7LB 3LRSB 2HT3D 2P42B 4PRHA 1G7LA 2NW2A 1MRCH 1ZHKB 3MGOB 5A16A 4HCRA 4P2RB 5CEXA 1KIRA 3MRQA 4OZGA 4OQTA 1VENA 5TQ2L 2UWEA 4ZPVA 3HMXA 4Q74A 4XP6L 4YDVA 4P5TA 2OL3A 1JHKL 3SDXB 2HMID 4LLDA 2GAZA 3QHZL 1P7QB 3ARWA 4LVHC 4LSSH 2F15A 5D5ME 4ODUA 1WZ1H 3ESUF 5IIEA 5EU7E 4OLXL 3X12A 1CE1H 1D7FA 1ZHNB 1AC6A 2XZZA 4ZQKA 2V2WA 1P6FA 3EO0B 3RIFF 5HYSB 5TE6H 3ROOB 4PRBA 4EVNB 3GMMA 2I5YH 3H42L 1JHTB 3GSUB 3WV0A 2ZCLH 5A2KH 4GG6A 3EZ8A 4PJIB 4AZ8A 2HRPH 3QJFB 5TDNB 3SGJA 1G7JB 1T66D 1CCZA 4LHUD 3IFLL 4OI9A 3MRRA 2H3NB 4Z7UA 1NBYA 3BT2L 3MYJA 5IBUB 1BVLB 3RWIB 3OZ9H 1XR8A 1MCHA 5GGTL 4M1DL 3B4NA 3PQYE 2YPLD 5LCVL 4WUUB 4BFIB 5BJTB 1MFBL 1MCOL 1LE9B 2YZ1A 3IKCB 1G0DA 2YUWA 5JUEL 2GUOB 5J7CC 4ODSH 5CJQL 4OIAA 4KUZL 5KN5A 3PJSB 4DZ8B 2X5PA 4OTXL 3ZTJG 1PY9A 4K8RD 3RY5A 3VGHA 3Q5OA 3BXNA 1SEBA 4WU5A 1XH3A 2V5SA 3WNPA 4HS6A 2HTLC 5EDXA 5IF0B 4UOW0 1XIWC 2VLJD 1JZ8A 4FA8A 3MLSL 1JI2A 3QUZC 2GKIA 1D5XA 1BBJB 3FZUC 2VNCA 5KSAA 2ICES 4XBPB 5IMKB 3MV8A 2CK0L 3QXTA 4QWWD 4WTZG 3VGAB 3FN0L 1NMBH 5B8CC 3VWJC 4OV5A 1T2JA 4BUHA 4GBXC 4OKDA 2GYSA 4MMXC 5GGSY 1CD8A 5I1DB 2ICEB 1YJDC 3MJ9H 1OAYL 1M05B 3DMMC 3QEQE 3N1FC 3WUWG 2DQHH 4R7DA 1BX2A 5I9QB 2ZJSH 3JWDL 4TUOA 2VLKB 4LIQL 3O8XC 1I7TA 5EC2B 4NHUA 1MIEL 2OI9B 3E3QE 3IJHB 1YEGL 1S9YB 2ZKHH 4G6FB 3PWPB 2R29H 5GSVB 3T1WA 4U3HA 1CXIA 2Q8BH 4TTGA 1KLUA 3L3KA 1BFOB 4L4TD 5F9JA 5EN2A 1MRCL 1XF4A 1IEHA 4WENB 5CINH 4FXKA 5C07D 2OSLA 4Y7MA 4RAVA 5TE4H 4PRPB 5B21A 1KXVC 1HEZB 3VFSB 12E8H 1TZGL 2LU3A 4PREA 2XN9A 1M1SA 4FFWD 3KPOA 5A2JH 3O3AA 1FNSH 2X70A 1ZWIB 4IDJH 3IU3A 2A83B 2F53B 4LSSL 4NFCA 1U92B 4DN4H 1WZ1L 2X4UA 3DX6B 1CGTA 1FHGA 1RJYB 1U3HD 5HXMA 1UH4A 1CE1L 1Q1JH 4G8FB 5ACLA 4WTZA 5TE6L 4ALAH 2IPUK 1D9KB 2DTSA 2I5YL 4NO3B 2ZCLL 3CFBB 4J4PD 3MRNA 4RSVA 1JWSB 5GS0D 2OYPA 1YPZA 2HRPL 3C2AH 4U6YA 4KJWD 3WUWA 4MNGE 4QRQB 2VIRA 3DI2B 2P7TB 5DD0L 4OBRA 3O4OB 5C2UB 4PJAF 1I3RA 2NY0D 3VI4E 2NR6C 2Q20A 1DQJA 5DGQA 2GCYB 4GW5B 4BQCA 4CNIB 3OZ9L 5D72L 5HHXH 5C09D 5HY9B 3P9MB 2ICWJ 5F9AC 4CU7A 4MJIB 5EUOE 4GLRH 5T3ZE 2G9HA 1OP5K 1OHQA 4ODSL 5GGUB 3LQZA 2VZ1A 5DJ6B 2H8PB 2OX5A 4XXCA 4PJDA 3LKPA 4HUXB 1D5MB 5ABDE 4GRWH 1BFVH 4K94C 2GK0B 2VKXA 3HZYB 1MQKH 1MHPH 1YJDH 3QO0A 4Q97A 2ZG3A 3O3EA 5HTSA 1JIBA 1PG7X 3MQIA 5JO5A 2YC1A 3IVKB 5FM5M 4NIKB 3OSKA 5BS0D 1U8HB 1NUNB 2VSDA 4Y5XB 1NMBL 1INQA 2R23A 1LEKA 3ULUD 3INUH 5AG9A 1WAAF 3PIQA 1RIVH 1T5XA 1S9WA 1QRNE 4X6EB 5DJAA 5LGJB 3MJ9L 4PJHA 2VQ1A 5T1DH 4KXZH 2BNRD 1LMKA 4GT7A 2ZNXA 4NCC2 3BN3B 5HI3C 1NLBH 4KJQD 1MPAH 2BZDA 2ZJSL 3DJ9A 1BHGA 2HYMA 3ARDD 3T0EA 2Y5TB 1BWWA 5MENA 1R24A 4BYHA 2R29L 1XGRB 1OGTA 2C1OB 1SEQH 3UDWA 4LSQH 2Q8BL 4C55A 1NGPH 3QNXA 4XHJC 3NACL 1FG2A 4HKBA 4N8CH 5CINL 3D0LB 4LGSB 5TE4L 3MRCA 2CSPA 3DNKA 2XOTA 1TVHA 2GIYA 2OI9C 3RVTC 12E8L 4PJAE 3S88H 3C5ZB 4OAWB 4DVBB 4YC2B 1J8HE 1FNSL 1KJVA 2FL5A 3P2TA 1OP5H 4IDJL 2XZQH 3HTLX 1P1ZA 4DN4L 3FB7B 4NO5A 1T0PB 2WAHA 4HUUB 2NMSA 3SY0A 5EZJB 1C1EH 1Q1JL 1FL6A 3OKOA 4MJ5B 3RVXD 4ALAL 2WK2A 4Y16D 3KNBB 4ZD3H 3NMEA 2VXUH 4PG9A 1KPRB 1U3JA 3V6OC 3C2AL 3J7HA 4E9LA 1K8DB 4P46B 3IDMA 4LNRB 3TA3A 2OZ4A 4XCNA 1D9KC 3MPCA 5HHXL 1IC7H 3FJTA 2ZOKA 5GJTH 3VGBA 5CWSA 5L2JA 4KHXL 4JRYB 3CFEA 3OAZK 5HHME 1WAAE 1VACB 4K94H 3O4OC 4ZAKA 3V79C 5HHPA 3D3VB 3GJFB 1H8NA 3HE6A 4EDXA 4UIMB 1YMMA 1PSKH 3C6SA 5H35B 4G7YH 3PWUB 1OT1A 3FRUA 2Y9RT 4QOKE 1ZSDA 4U6VH 5F7EH 1BFVL 2RQ8A 3QB7C 4RX4D 4P57A 3OB0K 3H8NA 4L9LB 2QSQA 1LDPH 5ADPH 4NBXB 1MHPL 1YJDL 1XZ0A 4U1MB 1U8OA 4JFFB 3MBEA 2BMKB 4PY7B 1J86A 5F89A 5F8QC 4YHLH 3TYFA 5IROC 5HYEA 5CSZA 3INUL 1FZMB 3BP7A 4XNXH 1XR9A 1RIVL 4LP4A 4HGWA 1T6VN 3QUMA 4NKDB 5T1DL 3SDYH 2OTPA 1EAJA 1NLBL 4Y19D 1OAZL 1EEYB 1MPAL 3U0TB 2NTFA 4I1NB 3HFMH 5D1ZB 4Y5XC 4OGYH 5F1NA 2PCPA 4XXDB 4E5XB 2GY7B 2BXYA 5FEBA 1ITBB 3BPNB 2X4QB 5MHSE 5ERWA 4PV8A 4BQBA 5JZ7C 4KPHH 1X4YA 1ZT7A 4LSQL 2Q6WA 5I1CH 1NGPL 3G5VA 3BP4B 2OBGA 4XZUA 5KZCB 4N8CL 5I2IA 4LFHD 1I8MB 4M62H 3VFMA 3S88L 2DQTH 4M4RA 4TYUA 3B9AA 4NOBA 4XWGH 4WHYG 1AXTH 2FIKB 4EUPB 1U95B 3TN0D 3OAZH 1C5BH 1DEEA 5KOMC 2XZQL 3VXQB 1J11A 1KYOK 4K7FB 3G6JF 3DV4B 1C1EL 3K1DA 3C5ZC 3H7BB 2FCBA 4OLUH 4YC2C 3RUGE 1LEGA 4ZD3L 1W0YT 1DDHA 4OFYD 2J12B 2VXUL 3FT3B 3OB0H 3HE7D 4YE4H 1BQHG 4GG8B 1S78C 5T1LD 5SWZE 1IC7L 4IMLA 1AGEA 4LHUB 4KK6C 5GJTL 2YKLH 4PYGA 3T4YA 3RZWA 4P46C 3NFNB 4NNYA 3QXAB 4K94L 2VYRE 4XB7A 3RTQD 4OM1H 5JOFA 4ODHH 2XKNB 3MOBH 4XTRD 5D7JC 2B4CL 4UUJB 1PSKL 2CKBA 4O2EA 2X1WL 1FV1A 5EBWB 1J1PL 4G7YL 4L4VD 3BOVA 4ZFZA 5A2LH 4YGAB 3OXRA 5D7KE 3FOLB 3U7WH 4LARL 4U6VL 3IDIA 5EO9A 1F4XH 1I8KA 1LDPL 2DWDB 5ADPL 4DW2H 4HIJA 5HYJE 3P9LB 1CDYA 3O81A 5CKGA 4TNVF 3VGFA 2VLJB 1J87A 4U1GB 3IDYB 4PGBB 5A2IH 4PRID 5DS8A 4H0GA 4HPOL 4YHLL 4G80B 4XNXL 1S8DA 4AYFA 4L9LC 1JRHL 4N90E 3VFRA 2EO9A 3TNNB 3ZKSD 3SDYL 4PJCB 4RMVA 4JANB 2GTWA 4X9GA 3VXNB 2BSSA 5DZNA 2X2YA 3HFML 2BVOB 2R4RH 2WSKA 4EQ2A 2H2PD 2RFXB 4OGYL 1RUPH 4XCEB 3BISA 1FYTD 3G6JE 2ITCA 2BSRB 1DLHB 1KB9K 2NYYC 2DM3A 4EN3C 2AERT 1A6ZA 3C09B 4KPHL 4YZFE 4MA3B 5JXAH 2DQGH 5I1CL 3KYOB 2PETA 5DXWA 4XGZB 3OHXB 5DHYA 5IM7A 1MH5B 2RBLA 5FYJU 4P23B 5IB4B 2FH6A 4Y1AA 4Y2OA 2GJ6A 2WLYA 4M62L 4L4TB 2MSPA 2X89D 3BD4A 3BPNC 3HC3H 2P5WA 2DQTL 3SO5A 2DQDH 4XWGL 4F9PA 1X9QA 5C07B 4S2SB 1AXTL 3EGSB 4QY8B 3MRKB 1RZGB 3DIFA 4Y2DD 2DI9A 3RWCB 5JHDA 4X6CF 4YHKH 4JB9H 2COQA 1ZHBA 4Z77B 3TCLB 3K2UH 2HT3C 1V3MA 4KI5F 3WS3B 4OLUL 4YHNA 1MNUH 3RDTD 4LLUA 4WNQB 4YDJB 3OKMB 3GKWH 4PRHD 3QCTH 1U3HB 1T89A 3V4PH 2B0SH 5MEOB 4GO6B 2HMIC 1DEDA 1RVFH 4QXWA 1U8KB 4YE4L 5I8CA 3BUYB 1YEFL 3H7LA 4DTGH 1P4LA 4JQVC 3GMOA 1FH5H 3PV6B 4P5TD 1BQSA 1YDPB 1UB6B 1VEPA 1O7SA 2A1WH 2FX7L 3L3IB 1HHGA 4PJGA 5INCA 3TBVA 3SBWC 3PWNA 1Y0LB 3SN6N 2BRRH 3F7VB 1AC0A 3QJHA 1A4JA 3CX5J 2YKLL 1V5JA 4KKBD 1H5BA 5IVOA 1SJXA 2NY0B 2W0FA 5A1AA 4I0CC 4OM1L 5C09B 5DUML 3F12A 3MOBL 5HD8C 2YN3A 3V6ZA 1JTOA 2L4OA 1LK2A 4JFPB 4OGAD 5E8OA 5L8KB 1T66C 4M8QB 4FQXB 4PG2A 3EYSH 3U7WL 2EKSA 1S9XA 3G6DH 4HZLA 4GKSB 4P9MH 1OSZB 3SGDH 4YLQT 1K6QH 1F4XL 1TQCB 4LGRB 1RZFH 5FCSH 5F1IB 4DW2L 3O3DB 1DFBH 1CXEA 2EEDA 1KF9B 3DUUB 2DM4A 3KXFE 3F5WA 2FB4H 3VFNA 1UWGL 5DEZA 4K8RC 2EDRA 1UVQA 5DEFA 5K9JH 3QDGE 1BD2E 5BS0B 4X6DA 1ROWA 3WJLC 5M94B 3GSOB 3VXPB 3BVNB 3WFCH 5FYJD 1YY8A 3IDYC 2R4RL 4RIRB 4X6CE 5GIRA 4R0LA 2CUIA 2GFBA 2JK5B 2BNRB 4TVSa 1N3NA 3QXWA 1Q94A 4WI5A 1IKFL 4OCWH 1AGDA 3ARDB 1S7SB 5JXAL 4GLRI 2DQGL 2CR6A 2AV7A 2GTZB 2FX8H 1JV5B 5KSAD 4WWKA 4NQVB 3MV8D 1LQSR 3P4MB 5HVHB 1GRWA 3TFKD 3HB3C 4Y5VA 1JPTH 3FB5A 2J8HA 2EDWA 1KEMH 3NN8B 3QEUA 5I75C 1JZ3A 3HC3L 3GSNB 5EU4A 1BZ9A 1C08A 1HWHB 2DQDL 4EI5A 1I7UB 3C09C 1P84J 1TCRA 3TWCH 3H9ZA 3MRLB 1CTOA 3T77B 4EUPH 2P43B 2OXHA 3GSQA 3L1OH 4OLYH 4MX7A 1V05A 2XWJB 2SEBA 1UGNA 5E2VH 4F33B 5I8KH 3L3JB 4JB9L 1WBYB 4P23C 2EDKA 3CLEH 2VLME 3EJZC 1U2CA 3K2UL 5DSCB 4FFVC 2W1NA 4FZ8H 4OCYH 4DOHB 1I1CA 4MD4A 4XPTH 5C0FB 2DLGA 1FORH 1MNUL 3CFKB 3O2WH 4P9HC 2X4OB 1M7DB 1FVEA 4QHNB 3QCTL 4RWYH 3V4PL 1ZVYA 1ZTXH 3IJYA 1ND0A 1HXMA 1QLFB 5CKAA 4TUJA 4PJEF 4KJYA 1WEJL 2A9MH 4KXZI 2BSTB 4Y16B 4DTGL 3H9SB 4MA7H 1FH5L 1W8OA 2XN9D 1X5GA 2A1WL 2P8PB 2CRMA 4I9WE 1KFAH 3ME0A 1MUJA 3NH7H 1U3HC 2BRRL 1KG0B 3MLTB 4G8GE 3NFPB 4JAMB 4U1SA 5T5FH 5IKCB 2V5TA 1A2YA 3UTOA 1MWAB 1S7WA 4YGVA 4LLMA 3LRGA 2VISB 3AS0A 4X8JA 4S1RH 3TF7C 5GS0C 1VFAA 4KJWC 1FJ1A 4M5ZL 3MRHA 2IFFH 4XMKH 4GW1A 4LRIC 3BJLA 3EYSL 5MI0B 1KJ2B 2EIDA 3G6DL 2NY0C 4P9ML 4L8SB 5E95B 4K8RH 1WFTA 1K6QL 2IQAB 1RZFL 3UBXG 5DD5H 4FQXC 4RFOH 4XAKD 3RL1A 3QBTB 1OF2B 2PO6B 2FB4L 1AFVL 4BA8A 3GI8H 1FP5A 3GMRB 5B4MD 5K9JL 1TQCC 3NABH 4L3CB 5DC0A 4EI6A 3GIVA 5K59F 3A6CH 3FHQA 1RPQA 3WFCL 1XF5B 3PGDA 5E94B 5I18L 1DQQA 2WBJA 3L3OA 5I17A 3DYMA 4KRNA 4HK3N 5FYLD 2H9GB 3MUGB 3Q48A 1ZS8B 2UVFA 4Y19B 3C5JA 4OCWL 1I9JH 4E0RB 2EKJA 4K3HA 4RQQA 4YFLF 2FX8L 2HFTA 4N68A 3DETC 2EDFA 1OSPH 1JPTL 1KEML 1DQDH 2GT9B 1KJMA 3B9EA 4KJQC 5DJDB 1CFSA 1XF2B 1S7TA 3MO1A 3ARDC 1MHEB 4P9HH 3TWCL 5BRZA 4Q2ZA 1S5IH 3L1OL 2CK2A 3WIHH 2DQUH 1EZVX 5HVHC 3FQWA 3UBXA 1QZ1A 4U6HA 5E2VL 5I8KL 4X6FA 4BM7A 3T0ED 2ZUQB 3CLEL 1JGLL 4Z7VB 4OCYL 2M2DA 5MEND 4XPTL 1AGBA 4N9GA 1CQYA 4UQ2B 5E5MA 4HUWB 3O2WL 2P5EA 1EBAA 2EC9U 4OT1H 1IRAY 4RWYL 2M26A 3BQUB 2C3VA 4MDJA 4QHMA 1ZTXL 5DQJA 4J6RH 3TJEH 4ZO8A 1ZOXA 3AU1A 3GMNA 5D7IF 1D6EA 5FM5O 2A9ML 1GOFA 3TVMA 1T7VA 2WM0A 5ACMA 3C5SA 4CVZB 4MA7L 2QQKH 4D8PA 1ADQH 4LQFH 2XY2A 1H8SA 2GJJA 3HE7B 2XV6B 5IW1A 1KFAL 1CICA 1SBSH 3K7UA 1LO3H 5IB5A 2X4TB 2XFXB 3HI5H 5DJ2B 5T5FL 2WINB 2NCMA 4Y16C 4FQQB 1DQMH 5T1LB 3S34H 4MXWH 4S1RL 1FZJB 5K59E 1OTUD 4U4BA 4X9HA 2JCCE 2IFFL 4XMKL 5CHNA 3RTQB 4HIEB 2BOBB 2YRZA 1LP9B 2A6JB 2DB8A 1K5NA 1OCWH 1HNGA 5C0GB 4HKJB 4XVJH 1I8LC 1V7MH 3MX0A 4GS7B 3TA3D 2F54E 2FNBA 4XNMB 1OAKH 3CMGA 5DD5L 2HN7A 4TNWF 2EE9A 4HKXA 3ALWA 3SDXF 5MI0C 4KDTA 4L8SC 3FAXA 5CJBA 3BHBA 3GI8L 4ZAKD 3KWWA 3X11B 3NABL 4PRIB 5F6IB 4YBLB 3A6CL 4M4PA 1YMMD 1A8JH 3WEXA 4PTUA 5BVJB 2NY2D 4X0KA 2VERN 1CT8A 2PO6C 4K23H 1HOCB 1XCTA 3LKOB 4BK4A 1Q9OA 2RGSA 2C26A 1I9JL 1OAQL 2IH3A 4CMMA 1FNFA 1FYTB 2YSSB 1G9MC 3MBED 1HILA 3RGVB 5IVZA 5GJSH 4K2UH 5J1AB 4V2BA 1J05A 2YWYA 2CDEA 1DQDL 5AAMA 4KVNH 3BKYH 3C9NB 3GSNH 5L2KA 4CVXB 3BIKA 5DFWH 4P9HL 4TN9A 4FNLH 1S5IL 1KPUB 5ESVA 2DQUL 2XKSA 5E8PA 1CXFA 5IB2B 3BSZH 2EDHA 4OZFB 1ZGLM 2K9UA 5CP3H 3PE9A 1X7QA 4OM0H 4QRRA 5I6XB 2XTJE 4Z7OE 1KCSH 5BO1H 3VFVA 4Y2DB 3VXSE 1ZMYA 4OT1L 3QCUH 4I77H 4N8VG 3TJEL 3V5HA 5KG9B 5D7LE 3RDTB 4MD0B 2M8XA 1FAIH 2ZUQC 3PHQA 1RHFA 1R5VA 4PRHB 1PX3A 3H3KA 2QQKL 1SYSA 5FYKU 5HPMA 1ADQL 1KTLA 4P2RE 5IMLA 4LQFL 3QT2A 3K2MC 5CEXB 1X5IA 2EEAA 4QRPE 1CXLA 3MRQB 4OZGB 4P3WA 5CIPA 3BQUC 2R9HD 4ZPVB 1SBSL 1LO3L 3SDXE 4P5TB 1DBMH 3HI5L 4X8XA 2OL3B 3ELAT 4S1SH 4LLDB 2GAZB 2BFVH 2E3VA 1I7RB 4LVOB 1DQML 3S34L 4MXWL 4NKMA 1W2KT 4ODUB 3BWAA 1DZBA 3QIWA 5IIEB 5B38A 2QEJA 3LV3A 2VDQH 4ZQKB 4OIIH 1OCWL 4PRBB 5AZ2H 2HLFD 1V7ML 3GMMB 1HH6A 4WHCA 4P4KA 1XF1A 2X4NA 1CVSC 4PJIE 5M7QA 1EGJA 2YZ8A 3BPOB 4M3JA 1V7NH 1OAKL 4MXQC 1NUGA 5IGXH 4LU5H 3RTQC 1G0XA 4P48A 1PX4A 4XTRC 1QA9B 2H6PB 4Z7UB 1NBYB 4OZHF 1TJIL 2NW3A 4N8VA 1C16A 3ORJA 3TZVB 2AJUH 1XR8B 4GS7C 5CD3B 3OKKB 4P5KA 2DD8L 4RWHA 3V52H 4J23A 3DX7A 2VR4A 4X9BA 4K23L 5KN5B 3MRJA 3CNKA 4RBPK 4FN0A 5A3ID 4JFDA 3BXNB 4Z7WA 1SEBB 3P0GB 1KTKE 1XH3B 3FQTA 5I15H 5A40E 5F6IC 4HS6B 1MFEL 4L29A 4U1IB 4PS4H 2PYEA 5KANI 5GJSL 2C1PA 5J9PA 1GZPA 1S7RB 1Z9MA 1D5XB 2R1YB 5FGBA 4KGJA 4W4OC 4KVNL 3BKYL 2IWGA 5KSAB 3HPJA 4QHUB 5JPNA 3MV8B 2XRAL 2FLBT 3HZKB 4XVUC 4FNLL 1EAPA 3QULA 3SGDI 3RVVD 4OV5B 1KB9J 3UPAA 3RGVC 3S35H 2C3WA 3BSZL 3MCKB 5F9OH 3S98A 3VI3E 4OM0L 1IJ9A 2E8YA 5FYKD 3UTTA 3EAKA 4OFVA 4PJFF 1KCSL 4BQ6A 2H1PL 2VLKE 3O0RH 3PDOA 4PRAA 1C12B 1CXKA 1WZMA 3CZFA 2W9DH 1I7TB 4NHUB 3SO3B 3QCUL 3PWPE 3ZYOA 4LPTA 4K7PX 4I77L 1D5BA 1MIMH 1GGCH 5DVOA 1FAIL 2FIRT 1P5VA 4Y1AD 2GJ6D 3GSRB 3L3KB 2X4RA 5FKPA 3JUYA 3VE0A 5GS1A 2P5WD 3P40A 2I60H 1XF4B 3LQAC 1S7QB 1E4XH 4PJ7A 4FXKB 2OSLB 4PRPE 4RAVB 5FA4B 2O61A 2FJFA 3W81A 4LPYA 5SWSA 1OGAB 5L8JB 2C3GA 4JM2A 3S7GA 1DBML 5JQ6H 5JHDD 4S1SL 1ES0A 2BFVL 3H9YA 3KPOB 3D87B 3O3AB 4PIRF 1MVUA 3FQRB 1JFQH 2F53E 4LOUC 5GISH 4C58B 3BKMH 2X4UB 1AD9A 4RBPH 1LEIA 4XI5D 3HZMA 4B0MM 2VDQL 2BHYA 3GIZH 4P5TC 4Y89A 4OIIL 1ZT4A 4FMFA 1QR1A 2V2XA 4ZTPH 4XP5H 5HVGB 5L7XH 4JQXC 3MRNB 4KKBC 3QI9C 1SJHA 1YPZB 1AKJA 4KRPB 3MA9L 3ULVE 1FZOA 3KAAA 1V7NL 4HMCA 1SVCP 3WUWB 3CH1B 3MR9A 5IGXL 1JGVH 5C86A 2VIRB 4JQIH 4GFTB 4PRDA 3QPQD 5EG6C 3KG5A 3N85H 4G8IB 4HH8A 1BGXH 2CDGB 3TGXA 3VFGH 1ZE3C 4OGAC 1DQJB 3CK0H 3QDMA 2AJUL 3T3MF 4MJIE 4F8TA 2APFA 2CIKA 3BPOC 1V8HA 3V52L 5B3JF 2G9HB 3TBWA 3I9GL 1P9MA 3JTTA 4NKIH 4NP4H 1YN7A 1A1MA 4O02H 5C0AB 3LQZB 4J3XA 3VCLA 5SWZA 3TZVC 5JW4Q 4PJDB 4KV5E 3IXTB 4C56A 2EH8H 2FH8A 3NCFB 3LKPB 5CJXC 5I15L 3IRZA 3ARFB 5ALBH 3QQ4A 2WUBH 2QSVA 5DO2D 1JK8B 1TTUA 2D9CA 3QO0B 2ARJQ 2WQRA 3D48R 1IC5H 3VG9C 2J5LB 4G43A 4L8DA 1LD9B 4U1NA 5JO5B 3CD4A 2DQFA 1IGFH 2DS4A 1Y6NR 1INQB 2R23B 1LEKB 1AIFA 4J1UB 1EZVY 3PIQB 2V5MA 5F9OL 1T5XB 1S9WB 3UTPD 5DJAB 4RCAA 2VQ1B 1FGVH 3I6GB 5KS9F 2WNGA 1DVFD 3RU8H 3LQAH 3O0RL 1GGUA 5CEYB 5CS7A 2W9DL 3T0EB 2KL6A 1R24B 3OJMB 4WWKD 2IADA 1A9BA 3T2QA 1MIML 4JFXA 3WE6A 2VRAA 3QNXB 5C0ND 4M43H 1ZLWK 1QBAA 1KCLA 5E8EA 1FG2B 2I60L 5ETUA 4EI5D 1AHWB 1E4XL 3WCYA 3ET9F 2LE9A 2AP2A 3FB8A 3MRCB 3WLBA 1WZKA 5L8LB 1AQKH 3SO3C 4ZO6A 1JZ7A 2FECI 5T3XH 5JQ6L 4XRCA 2EDOA 6CGTA 4LNVA 5ITFA 5IB1A 5IK3A 1KJVB 1JFQL 1DBBH 1CN4A 5GISL 3BKML 3TT1L 4KMTH 3U83A 1P1ZB 3EOBA 3O2DH 4GXVH 4M6NH 1T7XA 2EXWD 5LGHH 5L0QC 3SY0B 3GIZL 2HJKA 2APWA 5TH2A 4HQQH 3OKOB 1KN4H 4ZTPL 1L0QA 1NGYA 4XP5L 3ZDZE 1YUHB 3SHSA 5L7XL 3RHWF 5FAAA 4PG9B 3TC9A 2YOCA 4PJBF 1GHFH 3IDMB 1NBQA 4F58H 1JGVL 4JQIL 5JW5A 1K4DA 5DMKA 3TA3B 2WW8A 3N85L 4EIGB 5DVKA 1BGXL 3X3GL 4B7IA 3VFGL 4HUMB 4XCNB 3MLPA 5T1KA 3CK0L 2BK8A 4YDKH 4JGJA 2W0KA 4XP1H 3LPGA 3PWVA 5CWSB 4KRPC 4DZBA 4WRLA 2LU4A 4JRYE 4OFPA 5AD0A 4NP4L 3CFEB 43CAA 3D3VE 3T0AA 4O02L 5HHPB 4CGTA 4EDXB 3PABB 3CFJA 3HAEG 1YMMB 3C6SB 4RFNB 3NGBB 1WFOA 4KZDH 3EHBD 2AXGB 4OFDA 2NY2B 1GAFH 3KYAA 3FQUA 3KPPA 4PLOB 5ALBL 1FSKB 1ZSDB 4ZS7L 1UH3A 2FEDD 4NQDE 4U31A 2WUBL 4I18B 4P57B 1LE5A 5DRWA 2MQCA 5CJOH 4P0DA 4JFFE 1XZ0B 4IOFD 1AD0A 1IC5L 5F97E 4JLRA 4Z78B 3B43A 1F3DJ 4YDLB 1K3ZA 1IGFL 1J9CT 2Y6SD 5F89B 4YHMH 3ARFC 3TYFB 5CSZB 3OL2A 3BP7B 1A6UH 1XR9B 2WBJD 3GUTA 4HGWB 5TFSH 3QDHA 3QUMB 4V2CB 1FGVL 1Q72H 3RU8L 2GITA 2NTFB 4G5ZH 3MXVL 5CJ8A 2KZ1B 5JW4M 4X9IA 1BWMA 1ZAGA 1EHAA 3V4VH 3WD5H 2PCPB 1BJ1J 4IOIB 5GGTA 3QEHA 2BJMH 3QDGA 1CDHA 1TITA 5DURD 4PV8B 1ZT7B 3MJGX 8CGTA 1ZT1A 4M43L 4XZUB 4FQCH 5I2IB 1LNUA 4ZNEE 5F93C 5BRZD 1C5CH 2EDNA 2O5YH 3VFMB 1S7VA 4FABH 4DAGH 1IE5A 3UDWC 1WSST 1OVZA 1LO4H 4XCFH 5ID1A 4OLWH 4HXBH 1DBBL 4AT6A 4KMTL 1AHWC 2HVJA 3AUVA 3O2DL 2P5ED 4GXVL 3D85A 4M6NL 4R4BA 2NXYD 5LGHL 3OBAA 3CDCA 3VXOA 4HQQL 1F8TL 1FVDB 3DRQA 4YAQA 1KN4L 4IMKA 3TVMD 1WT5A 1LEGB 4NC1C 1DDHB 1N8ZA 4JVPA 2NY5C 3DYOA 1M7XA 2VQUA 2NXZD 4RAHA 1GHFL 5I73B 5JPMA 4WFED 4F58L 1UZ6F 1CICD 3KPQA 1OAXH 1QLEH 3BGFB 4JJHA 5H8DA 3WDIA 3DRTA 2EDLA 5D6DA 2FYYA 1MAJA 1F2QA 4XP1L 4IMLB 1AGEB 4WW2F 3T4YB 3VD9A 5IEKA 3S37X 3B9KA 4FXLA 4NNYB 5I8EA 1BFSA 4JO4H 2YD1A 1G9NC 3BD5A 4Y4HC 3BUTA 2YPLE 5JOFB 2V9RA 2X1OA 2DTML 2VWEE 4O2EB 2HFFA 2VUOA 1FV1B 2FWOA 4KZDL 4K71C 1CE6B 1GAFL 2E9IA 4TVPH 4QRUA 4ZFZB 1UWXK 4YEFA 2F58H 4LSRL 2VQTA 3IDIB 3B8YA 4S1DC 5EO9B 4PP1D 3DWTA 1I8KB 1OL0A 5MERA 4RGMC 4RFNC 3NGBC 3MACH 1PGRB 2VLJE 2NY2C 5DS8B 3TJHD 1P7KB 3CFDB 1BOGA 1FSKC 1K4CA 5IESL 4ZUWA 4U2ZA 2DL2A 4NCDA 1A6UL 4I18C 4LKXB 4GKZA 1S8DB 3WXWL 5TFSL 2ZUWA 1BQHB 4PJCE 4GAGH 1Q72L 3WXVH 2GTWB 1KIQA 3LKQA 4N0UB 5TDPA 2BSSB 4YDLC 4G5ZL 3OAYK 3V7AG 1IGIL 3U1SL 5F70A 5T3ZD 3V4VL 3WD5L 2VTFA 1REIA 2DWEB 2BJML 4GAJH 4K7PY 1NDGB 3IU4H 2VDNH 1B0RA 1A6ZB 1CF8H 2B8OT 2Q3ZA 3DURB 1KSRA 2ATKB 1CWVA 4FQCL 3RWGA 5L2KD 1D5ZA 4ZOEA 5DHYB 6FABH 4I13B 3GRWL 1C5CL 4Y1AB 4L4TE 3NZ8B 2O5YL 1NL0L 2W65A 4FABL 4DAGL 3K74B 5J4MA 2VXSH 3A67H 2P8MA 5C07E 2LABA 1WWWX 1P2CA 4LCUA 4MZ3A 1I1YA 1LO4L 4N0YH 4QRRD 1P69B 4YHPA 4XCFL 3ULUF 1KCUH 4OLWL 4HXBL 3RI5F 4OCLC 3DIFB 5FF6A 1FO0H 4I5BB 5CFHA 2A9NH 3KLHD 5CZVH 3O6LH 1VFOA 1O7VA 4EOWH 3LN9A 5C0DA 1UWXH 3QIUA 4YHNB 4FXGA 1JWUA 4G3YH 4JVUA 4LLUB 1QEWB 5F7KC 1RD6A 4GAYB 2Z93A 2R9HC 4HUVA 2VN7A 1HI6A 5GS2H 3BEWB 4B53A 3MJ9A 1ORQA 5KAQF 1Q9KA 1IM3B 2PTTB 4FTVA 2Z31A 5I8CB 5IBLD 1P4LB 1XF3A 4KI1A 3GMOB 4KK9C 1G9NH 1OAXL 1QLEL 3CDGA 3D6GA 4DJMA 1HHGB 5INCB 1NFDF 3TBVB 4U1KA 5BQ7A 3P4OB 3PWNB 3SKJL 4CAGA 5CP7A 3LDBB 1QFWH 3QFJA 1MJ8H 3O6MH 3QIWD 1H5BB 5I73C 4H26B 1B0GB 2W0FB 4JO4L 2HTKD 1XT5A 3G6AA 3GO1H 4PJXF 3CSBA 5C09E 4R6UA 3F12B 3P11H 2R0WH 3BGFC 3OAYH 1R5IB 3V6ZB 4D2NA 1LK2B 4P3DB 5E8OB 3EO9L 1O5DT 3QRGH 3REVA 4P4KD 3F8UB 3VRLF 4TVPL 5FCUH 2R1XA 3NCCB 2F58L 3RL2A 2EKSB 1S9XB 1FNAA 3MLVH 3GEWB 1AQDB 2A74A 2J8UB 4HBCH 1NKOA 4QRTA 5AG8A 4OIBA 1PVHA 3SDAB 1A02N 3N9GH 4KK8D 2GSGA 3R8QA 1M7IA 3PDGA 1UVQB 4JFZH 5DEFB 5LAXB 3BIAX 3PWJB 4PLKD 5BS0E 5TE7H 4X6DB 4GAGL 3IJSB 3GMLA 1MQ8A 5FO8B 3IAQA 3WXVL 3ULUE 4JFDD 4R96A 5DFVC 1T1XA 5IQ7H 4KWUA 1A22B 5K93A 2YA0A 5GIRB 4R0LB 2BNRE 2GFBB 5GGSA 8FABA 1N3NB 4GAJL 3SPVB 1Q94B 1DVFB 2PYED 3IU4L 1AGDB 4HDIA 1CF8L 3DXAA 3TPKA 1XIWA 2X4SA 2AV7B 4FHBD 2QQLH 5ICXA 2HRLA 1N6QH 4M00A 3JV6A 5D6CA 3DROA 6FABL 1HQ4A 4LQ1A 5FXCH 1KEGH 1X6LA 5DD3H 4MQ7B 4Y5VB 3FB5B 1VGKB 2NQCA 3EOAA 3E6FA 4GW4B 4JDVB 4HLJA 3QEUB 4ZNCD 3BIBX 3JVGA 5EU4B 1C08B 1BZ9B 3EDEA 2VXSL 2F5BH 3GZKA 5B8CA 1OAUH 1TCRB 1B2WH 4N0YL 1BLNA 4GBXA 3UTTD 1KCUL 2FBJH 4QHKJ 3GI9H 3BWUC 1FO0L 2SEBB 2A9NL 3O6LL 3DMMA 4PJ9C 3EOYG 2X9XA 4EOWL 4DOHE 2JIXA 4PJXE 3VXTA 2EO1A 3O8XA 4F9PC 4F37K 4G3YL 1FVEB 1X44A 4X99A 1JPFA 3VRLE 3IJYB 1IVLA 1ND0B 3HI1B 3NFSH 1HXMB 5L88H 4TUJB 4KJYB 4ETQA 5SWSD 1I85C 1HHHA 2FATH 3CJJA 1G9NL 5EBGA 3WIFB 4JM2D 1AH1A 5J89A 1OARH 4H0IA 4APQC 1CDIA 4XI5C 1W8NA 3O45B 3U2SA 4PGJA 1MSPA 1ACYH 1QFWL 3O6ML 1U41A 4U1SB 1A2YB 2Z4QA 1S7WB 4YGVB 4LLMB 3GO1L 4X6BA 4KY1H 4X8JB 3P11L 2R0WL 5KTEH 3UCRA 2AV1A 3HNVH 1VFAB 5T5NG 3QRGL 4IBLT 4GW1B 4WHYH 3LDBC 4OZ4B 1EJ6A 3EDDA 4UU9A 5F88A 2LU7A 3MLVL 3OPZH 4HBCL 4TSBH 5EZIH 3ZDYF 3N9GL 3HPLA 1A3LH 3K0WA 1CLZH 1DBJH 1ZHNA 1JGDA 3QDMD 4U7MA 4D9LH 3AVEA 3CC5A 3QG7L 3ROOA 2QSCH 3RL1B 4OLZH 4EVNA 4LF3A 4JFZL 3V2AR 3EO1B 3QJFA 2O5XH 3S9DB 5D2LA 3LD8B 5TE7L 3SDAC 4EI6B 3GIVB 4HH9B 4KAQH 3HG1B 1HHIA 2D4DA 1PJ9A 5SWZD 5DHXB 3PGDB 1SMOA 5IQ7L 2MMXA 4NWUH 4C56D 5B3NA 2MQ0A 3L3OB 1LP9F 3ZLQC 1CIDA 3Q6GH 3RWIA 2R15A 4Y19E 4NN7B 1IGYA 1PG7H 4WUUA 4BFIA 3C5JB 5BJTA 4ELMA 1A1OB 1XFPA 3H2WA 1A4KB 4MNQB 4RQQB 2QQLL 3HA0A 1N6QL 5DURB 5JR1H 1T83A 3TO4C 1KEGL 2IF7A 3L3DA 1QTYT 1WFUA 4NKOA 3OWEA 4NUJA 2BVTA 1KJMB 1DVFC 1XGTA 4AEFA 2F5BL 1CFSB 4JRXB 5IF0A 1I7ZB 1S7TB 5KSBF 1OAUL 3MO1B 3CXDH 3VFWB 4Q2ZB 3GI9L 3HNSH 3NCMA 4X4ZA 3QG6A 3FQWB 3UBXB 1DUYA 4U6HB 4Y5VC 4Z7VE 3ZT7A 4CN6A 5IMKA 1ED3A 5E03A 4MXVF 1AGBB 4N9GB 3QQ3A 5E5MB 2DICA 2P5EB 4YO0A 3ZO0A 1F4AA 3ZE1F 1UACH 2NXYB 1NFIA 2H45A 4J3VA 2BDNH 1L0YA 4MDJB 1ZV5A 3GMNB 2ICEA 1D6EB 5L88L 1ZGLP 3NIFF 3TVMB 2FATL 3L5WA 4D8PB 1BZQK 4AIZA 1OARL 3U48A 4I0PB 2PF6A 5IW1B 4ONFH 3UTSB 4LMQI 1CICB 1ACYL 5IB5B 2ARWA 2YPVH 5CZXC 3AREB 4QRSA 2RJMA 3W5NA 4KY1L 5JLZA 1QACA 1RZ7L 5KTEL 3HNVL 1MRDH 5BCAA 5CHNB 3BN9D 2ZUYA 1LP9E 3NA9H 4ZDHA 3JV5A 3ARBA 1K5NB 3EDJA 3OPZL 2A83A 5BOZG 2JELH 4L4VE 1U92A 3V6OA 4TSBL 4NN5C 1A3LL 5DDHA 1CLZL 2E6QA 5T1KD 3T0BA 2HN7B 4D9LL 2UWEF 4G8FA 4PD4J 2QSCL 1UCTA 4OLZL 4R2GD 1IQDA 3HHRB 1MAKA 2MJWA 1CK0H 1JWSA 2CLRA 4CW1A 3BHBB 2G60H 2EECA 2O5XL 1RV6X 2BY3A 2DOCA 2FR4A 4PRIE 1WISA 2CDFB 4KAQL 4JN1H 2P7TA 5I1HH 2V2TA 2FEDC 2DLFL 2DN7A 4NWUL 1DN0A 4BSWA 4GOSA 3AY4A 3WO3B 4X0KB 1CT8B 2GCYA 3Q6GL 5BOPA 3IDXH 1EH9A 1XCTB 3KS0H 4GG6F 4ELKA 2OJZH 1PG7L 2XNAA 3LD8C 1UADC 2Y6SC 4WO4A 2IH3B 3ZE1E 3BGAA 4AEIH 1FYTE 2RCSH 5GGUA 1HILB 3MOQA 4GMSH 5C0BA 5IVZB 2IMNA 5JR1L 2CDEB 4BFEA 4PYHA 5L2KB 5DVMA 1M6OA 4HUXA 3CXDL 1NAKH 2CH8A 3D0VB 2HT4D 1RIUH 1PKQA 3HNSL 5ESVB 3BPLB 3DOSA 5E8PB 1MCKA 1U8NA 4TSCH 3IDJA 1X7QB 3UPCA 3U7AA 1K85A 5F7DA 4QRRB 1JYWA 3QDGD 3VFVB 4Y4FA 4HG4K 1IAOA 1NCTA 2W38A 3KLAA 3ZKXC 4N1EA 1IAIL 2BDNL 3C87A 4EDWH 3VW3H 3VG0H 4JFHE 3JV4A 5LBSL 4PLJD 3DBXA 2XTLA 3AMLA 3V5HB 2P4AB 3WMSA 3AM8C 3PHQB 4JHAH 4PRHE 1R5VB 1SYSB 5HPMB 1KTLB 3TBYA 3NIGF 4KROC 3JWNC 4OZGE 4YX2H 2NXYC 4ONFL 5DJ0A 2UWEE 2C1OA 5CIPB 4K07A 1JMXA 2YPVL 4BZ2H 3D85D 1T2QH 3TVMC 4U1JA 3KJ6H 4NKMB 3EBAA 5KANG 3MLXH 4I0PC 1TNNA 3SGKA 3BWAB 3L3GA 3QIWB 4V1DA 1QSZA 1KT2A 3DV6A 3LV3B 1CICC 5FGRA 2ZG2A 4DVBA 4S10A 3NA9L 4BSJA 4GXUM 3OKDA 4ZODA 4O5LL 3AREC 3DO7A 1UT9A 2JELL 4GG6E 4IRSB 4P4KB 4BZ1L 2X4NB 1WTGT 1YNKH 2LTQB 1PBYA 4LCCC 4QGYA 2UUDK 4LLWA 1F2XK 5HHNA 1L9NA 5E4IA 3V5KB 4Z7UE 4QXTA 3B9KD 2IAMB 4N8VB 1C16B 2G60L 4G6MH 4H25A 4HF5H 4P5KB 4P46A 4AMKL 5LKNA 4JN1L 1Z9OA 5I1HL 5FOJA 4JCMA 3VA6A 5D7JA 4NRYA 5CBEA 5FGCB 1DANU 3MLYH 3IDXL 4F7EA 4KDTC 4OF7A 1RAMA 3FQXB 4JFDB 5FYJE 2OJZL 1RUAL 3GDBA 3BRDA 2PNDA 4HWBH 2FGWH 4AEIL 1MCQA 2RCSL 5I76B 1JF1B 2ZOLA 2NLJA 3BDBA 1PKOA 4D9QD 3FFCB 4GMSL 4WGWB 4R7NB 4JGUA 2C1PB 4MJ6B 1GZPB 5CD5D 1EX0A 1SHMA 3TIEB 5DT1H 2VLLA 1NLDH 3MV8E 3RZCC 3HPJB 5DJXB 5JPNB 4X7DC 1NCUA 3V0WL 1NAKL 1AXIB 1RIUL 3QULB 1ETZB 2BSED 4JR9H 2GSIA 3TO2A 3QUXA 4TSCL 3BMWA 4F7MA 1VGEH 4XH2B 4PY7A 4HK0A 5E5RB 4P99A 4RGND 3PDOB 3TH4T 1FZMA 4LMQE 5HDLA 3VG0L 3FO1B 3BPLC 4FQLH 4EN3A 3TNMB 1T03H 1Z2KA 4JHAL 1FE8H 2UUDH 4U0RB 2X4RB 3PF2A 4PBXA 5GS1B 3U0TA 1X5KA 2HT2D 4XNYH 3KR3H 4PJ7B 2DRUA 2MWCA 4XXDA 4YX2L 1G6RH 2FJFB 2FSEB 5SWSB 4F80A 1MLCA 4UT9L 3ULUL 4JM2B 3Q6FA 1ES0B 4LASH 4BZ2L 4PJHF 4PJ5A 1T22A 1T2QL 3RBGA 2C9AA 5IVNA 2XKUA 2WP3T 1JPSL 4M61A 1I8MA 3QIUD 3MLXL 4ZNEA 1PLGH 1AD9B 4XPHH 7CGTA 1LEIB 3LB6D 3HZMB 1T0NA 1LILA 3EFFB 1ZT4B 4XHQA 1QR1B 4EUPA 1WCBA 2V2XB 3T3PF 4FTVD 2Z31D 2YD5A 1NGZA 3CGTA 1YPZE 1YNKL 1FZOB 2E7LC 4JQVA 3MR9B 1ZA6A 1DBKH 5F9DC 4PRDB 3MLUH 4NGHH 2VAJA 5IV2A 3QFJD 3SBWA 4OD3H 5C0IB 3OB8A 4G9FB 3FT3A 4FMKA 3QDMB 4IRSC 4XAKE 5LG1A 1N0XH 1FPTH 1ULVA 2R56H 2CIKB 4YH6A 1TXKA 2E7BA 2LTQC 3G5ZB 5FUOH 3WNKA 2FHCA 3TBWB 2I25N 5I1EH 4QGTA 1YN7B 1A1MB 3MLYL 5DJYA 4GG8A 4O2FA 2IAMC 4JPVH 3VCLB 4PJDE 4LHUA 1A3QA 3O3BB 4M6MH 4C56B 1NC4A 4L3EA 4XWOD 4B7LA 1Z0NA 5FYLE 5FB8B 2R2EA 3A6BL 2FGWL 1FFPB 1OTTC 3VFUB 4BFBD 3BRFA 3NPSB 3D2UA 2J8OA 2GW5A 5SX4H 1NLDL 4GRLC 5ISZB 3QQNA 3FOLA 2VKWA 4L8DB 1INDH 2BHUA 4MJ2A 5ENWB 3C60C 4E41B 1AIFB 5I1IH 5ECJE 4JR9L 3D9AH 5DMJB 1OB1A 3WJLA 3P9LA 4PJHE 1VGEL 4X4MA 5FGBC 5J13B 4PGBA 3DXAD 3T0EE 3GSXB 2XQBH 3HR5B 1XIWD 1F97A 1T03L 2ICWA 1A9BB 3ZHLA 2CMRH 3BDXA 4JFXB 4PJCA 3WE6B 2AJSH 4JANA 2XWBA 3TM6A 3FZUD 2Y7QA 5DVNA 2F8OA 4ZYKB 1FE8L 3OR7A 4MVBC 5IVXA 5E8EB 1KLGA 4XNYL 2X41A 3KR3L 3VFTA 1W72H 2XA8H 1IILE 5GZND 1J0ZA 3WLBB 1G6RL 2BSRA 3H0TA 4GBXD 4CBPA 3HUJF 3NAAH 4X7EC 4XRCB 4LASL 2KDGA 3DMMD 4OLVH 4NC1E 5IK3B 2JIXD 2A6IA 1KNOB 1MH5A 1CDGA 5F1OB 2W9LA 4P23A 3O8XD 5IB4A 2QV2A 4WUKH 3EOBB 1PLGL 1Z5LB 1JNHB 5CMAB 1NMAH 2AABH 5C07A 4JM2C 4S2SA 3EGSA 3H9HA 5TH2B 3I6KA 1LK3H 4QY8A 5IFAH 3WIHA 1UEYA 2CXGA 4PB0H 9CGTA 2E9JA 3RWCA 4AIXA 2PYFA 3FO2A 2DDQH 4Z77A 3TCLA 2AJXH 3MLZH 1U91A 2NZ9D 3R0MA 1DBKL 2EIEA 2VZTA 1K4DB 3A0OA 5DMKB 3MLUL 4WNQA 1HCVA 2CUMA 4OD3L 2FRGP 2CRYA 5T1KB 3ZT6A 1N0XL 2VR5A 1FPTL 1E4JA 4R2GB 1U8KA 2R56L 3BUYA 1FYHB 5FUOL 1NGQH 1R5WA 5AD0B 1JGUH 2LQRA 3PV6A 3T4AA 43CAB 5I1KH 3K8KA 1ADQA 4NSKA 2AEIT 2WWKO 1YMME 3DX8A 1Y0LA 4FFYH 4JPVL 4U7KA 4LRIA 4M6ML 3MREA 5KW9H 4F15C 4KJPC 3FQUB 4ONHA 3P4NB 3SJVB 4EZMA 3V95A 1HDMB 2QL1A 4TTDC 1LE5B 4JFPA 2IC2A 3ISWA 5JNYA 2MHAA 3I3BA 5IP4A 4M8QA 4FQXA 2ZSVA 4ZG1A 1IGTA 1QUNA 1IEAB 2DQIH 5IBTH 1INDL 3ILQC 4XNQA 5I1IL 3D9AL 3NPSC 3ZZ1A 4W81A 4M6AA 4ZFGH 1J0HA 1UQSA 2PXYA 3EFDH 4HJGA 2QHLA 3PP3K 5I19H 4WUUD 3OGCA 4WGVB 2XQBL 2F5AH 4LSTH 4P2YA 5KVEH 1OP3K 1M4KA 2K3TA 1ZT1B 3VDBA 1RJCA 2H2SC 3GB7A 3HAEB 1X5XA 1W72L 2XA8L 2JK5A 1JZ5A 1LNUB 2V6HA 3R1GH 3NAAL 1S7VB 2A73B 4NWTL 1S7SA 2FJHA 1DN2A 4CKVX 4OLVL 1JV5A 5HI3D 5FO7A 5ID1B 3VJ6B 3F7YB 2HVJB 3D39B 4WUKL 4RISH 2MTPA 3NN8A 5HGGS 4R4BB 2A2QT 3GSNA 3MRMB 3HNTH 1NMAL 2AABL 2OMBA 3MRLA 1LK3L 3RKPA 3DRQB 4YAQB 3VMNA 4XHJD 4UB0H 4PB0L 1URLA 2XIDA 1H0DA 4F33A 3QDJA 2C4FU 5CP3A 2DDQL 2AJXL 1EDQA 3U6RA 4ODVH 3UMTA 5T33H 3K4DA 2B20A 3MLZL 4Q58C 2D7TL 2VZVA 3MV9A 3KPQB 4WI2A 2OS7A 3CSYA 1IC4H 3DRTB 5DRNB 3X17A 5J0BA 2FYYB 1DL7H 4UDUA 1ORSA 4WHTB 5DJCB 4UV7H 1QLFA 5IEKB 3B9KB 1NGQL 3RNQB 3H9SA 4BKLA 1JGUL 2W60A 3PP3H 5EU3B 1KCKA 4RZCA 4HK3J 3ARBD 4L3AA 4FFYL 3ZYJA 3BP6A 1CFQA 2HFFB 2FWOB 4NM4L 5F3BA 4JAMA 4QRUB 4R2GC 5KW9L 4HULB 1I8LA 5EIIB 3DVIA 4U1HA 4AJ0A 5EC1A 2GEEA 3QDAA 1KLFA 1CR9H 5CEZH 2HJFB 4PJGF 1QP1A 4HBQA 4LPUA 2EDXA 25C8H 3WO4B 4ZPTA 1LGVA 4HV8A 4IIQB 2B2XH 2JE8A 4I4WA 2DQIL 2O26U 3D25A 5IBTL 1BOGB 1EO8H 5F44A 1K4CB 3B5GA 1QSFA 4JG1H 4ZFOL 3E2HB 4WV1C 4GKZB 4ZFGL 4MCZB 3PL6C 3CVHH 3EFDL 4GUPA 5E9DB 4TUKH 1HNFA 1KIQB 4N0UE 5I19L 3LKQB 2LFGA 4M6OH 2PO6A 4X80H 1SMAA 3E6HB 4WO4D 4J7RA 2F5AL 4LSTL 5KVEL 5C0BD 4RGNB 1B0RB 5HGHB 5AYUH 5E94A 2CJUH 3RWGB 1J10A 2P49B 3AXLA 1D5ZB 4MS8D 3HS0A 2H9GA 4B5EA 4Y1AE 2GJ6E 3R1GL 1FIEA 2P5WE 5C6TH 4E0RA 2QR0A 2HG5B 3CFIC 3UAJD 2Q8AH 1P2CB 1I1YB 3L7EA 4YHPB 2H41A 4Y4FD 4WEUD 5FF6B 4RISL 5IHZB 3ZKQD 2OR8A 3L5IA 2GT9A 3HNTL 1NKRA 5DJDA 1XF2A 5JZ7D 3DARA 1BVZA 1R3LA 4UV4H 1PZUB 4FXGB 1JWUB 3ARVA 3DPBA 4UB0L 3EYUH 1U8PB 4CDHA 4U7SA 4DKFH 4HUVB 1Q0YH 5EWIH 4PB9H 1HI6B 4GAFB 1ODAA 1ORQB 4ODVL 3U0WH 1Q9KB 4FTVB 2Z31B 2NY4B 3NCYP 3LPFA 5EH1A 5J3HD 3BO8A 2Y5EA 1IC4L 5DVLA 3BQUA 1WT5C 5BQ7B 1DL7L 1MCFA 4QNPF 3QFJB 3LKNA 4V1DD 4Y88A 4N1CA 4CVZA 4UAOB 4NYLA 3QNYB 3G6AB 1K2DA 4NT6B 1W0WA 2FO4A 3LZFH 4W6YB 4KU1A 1EHLH 2XFXA 5DJ2A 4AIOA 5CGTA 3QHZH 3UP1A 3RL2B 3B9KC 1JZ2A 2AJZA 3KJ4B 1FZJA 1OTSC 1CR9L 2A74B 1N6VA 5CEZL 2AKRB 4QRTB 3F6IA 2D3VA 2DF3A 1S78D 3OGOE 3QAZB 2A6JA 5JORA 4HWUA 1J0YA 1BECA 4P46D 1M7IB 1EO8L 4F7CB 4PJEA 1EIBA 3EUUA 4JG1L 4DFHA 5D7JD 2YK1H 1H3WM 2ORBL 4XNMA 4X6DE 3WNLA 3CVHL 3ZKNC 3GMLB 4JHZA 4TUKL 4P2QB 4R96B 3WO4C 3VD3A 4IIQC 1QFWM 4M6OL 2EE6A 4X80L 3UTPE 3DHMA 1VDGA 5CD5C 4PGCA 5GGSB 3KPRA 3U9UA 8FABB 3QHTC 3E2HC 1AE6H 5EU5A 5D5MF 5LCVH 5J6HA 3DXAB 1YC7A 5F21B 5AYUL 4NCC1 5JUEH 2X4SB 2CJUL 3I75A 2EC8A 1I8IB 5ICXB 3JV6B 2J2ZA 3DROB 1L0XA 1HQ4B 3HAEH 4WFFD 2P8LA 3LKOA 5D6CB 4M3KB 4OD2B 3BDYL 1F3JA 5C6TL 4FQJH 3RWEA 1CLOH 5BZDA 3E1F1 3QUXD 2Q8AL 4GRWB 3STBA 5KVGH 1BLNB 4GBXB 5JIIA 3EYFA 3RGVA 3RY4A 5J1AA 4QNPE 2Z9TA 3MLSH 2DQJL 5DD6A 3X14A 3L95A 5DJZA 1G7IB 2NYYD 4EN3D 3CU7A 3ZDXF 2HT2C 2E5EA 2CK0H 3O8XB 4KMQA 4UV4L 1KPUA 2R2HB 3FN0H 3EYUL 4X9FA 1P4IH 4X99B 4DKFL 1UCBH 1Q0YL 5EWIL 4PB9L 4ETYA 4XB8A 4ORGA 2AJ3A 4HJ0D 3U0WL 4ZUUA 4ETQB 2XQYG 1HHHB 4O51B 2XWTA 2ZUUA 1FLRH 4PJ5D 1MIEH 4TULH 3LB6C 1CTNA 3LKRB 2QQQA 4XAWH 5KG9A 2NY6C 1E27B 4MD0A 2Z31C 2Z4QB 4HIHA 2NY4C 4X6BB 2QADD 2AV1B 4L4JA 2ZUSA 3LZFL 1TETH 1TZGH 1OWWA 1X5FA 1EHLL 1X5YA 4UU9B 4XT1C 4Z7QF 4D3CH 5F88B 1I7RA 2WUCH 3BEVA 3AMKA 4OF5A 2VO5A 4JQXA 4UAOC 3QI9A 1IKNA 5CILH 3O2DA 5GHWH 3HPLB 4RFEA 3GSVB 2QJDA 1JGDB 5HGDA 4R4NC 1X5AA 3CC5B 2P1YA 5D7IA 1LVEA 4DCQA 3KJ4C 5IR1A 4NQCA 4LF3B 4G7VH 5HD8D 2YK1L 4XWOC 1ZEAL 5D2LB 1F6FB 3HG1E 2ATPA 5DD0H 1HHIB 3QAZC 4JFEA 1JGEA 4RRPG 3VXUA 3MMEA 3AC0A 1QA9A 1UM6H 2H6PA 1NC4D 3NCEB 2IBGA 4L3ED 3TZVA 2DQEH 5D72H 5CD3A 3OKKA 1AE6L 2E27H 1A7QH 5CJXA 3ZDXE 1IGYB 4JY6B 4ELMB 4PBVC 2FEEL 3D2UD 2DL9A 3KYNA 5D9SA 1I1FB 3WFHB 4NZUH 2G2RA 3CXHK 4QHLA 3SCMD 4YXHH 3L3DB 3MFGB 1TZIA 2BVEA 4NKOB 4NUJB 4FQJL 1L6ZA 2EEBA 1XGTB 1CLOL 5LVEA 1CGYA 4H1LG 2XACC 4U1IA 5BRZE 5KVGL 1WTLA 5J1TC 1FLTX 5JIPA 3QG6B 1S7RA 1DUYB 3VI4F 3PWLA 2R1YA 4QHUA 1ED3B 3BYTA 2N1KA 3JVGC 3HZKA 1T6WA 2YUVA 1G7HB 3W39B 3QQ3B 5EUOF 2P5EE 5GZNC 2C7UA 4YO0B 1FFNA 1JPST 5HYQB 1NFIB 1P4IL 3WLWC 4IRJD 3MCKA 1UCBL 1RUQH 4Z5RA 1KXTB 3HB3D 1KB5B 4Z7QE 1AR1C 1RZIA 4RRPA 4KK5D 2KQMA 3RAJH 2IMMA 4NFDA 3L5WB 1N59A 1C12A 4AIZB 1FLRL 1T04B 4KMLB 3P9WB 4TULL 4WFEE 3ARPA 3UTSE 1IARB 1JTTA 2IFGA 4O00A 4XAWL 1RK1B 1FFRA 1OM3H 3KYMA 2YXMA 4P23D 4LLVA 5J6GA 3EJZD 1FZKA 2B7DT 3GSRA 5IEHA 4FFVD 4QRSB 3NACH 3B5HA 1S7QA 1FC1A 1KCRH 3VWKA 1BEYL 3AFLA 5FA4A 4MZ2A 5JLZB 3PQYB 3PV7A 1QFHA 1OGAA 1G7PA 5FUCE 1TETL 2NZ9C 3OKNA 4ONGH 4ZS6C 4D3CL 4X7CC 4ZDHB 3ARBB 3FQRA 2ID5A 4LEOB 2WUCL 4LSVH 1MCSA 3QNZA 2Z91A 5CILL 2Q76A 3TIDA 4HFUH 3RWJB 3VH8G 4MAYA 4Q0XH 1DE4A 1MFDH 4W6XB 5GHWL 1IAIM 1T5WA 5DDHB 2C5DC 4YFEA 4M1CC 3F65A 1IQDB 1MREH 2MPAH 5E6ZA 5CZKA 2P48B 4PR5A 1N6UA 4G7VL 4RMSA 4CW1B 2CLRB 2FR4B 4CN1A 3CH1A 1KC5H 4DEPB 4QTIL 3UTQB 2P46B 2V2TB 1F90H 5A2FA 4G8IA 4BSWB 1DN0B 2V5RA 1UM6L 2CDGA 3QEGH 1UWEH 2DQEL 4UINH 5EORH 2VE6A 2E27L 1A7QL 1P53A 3WNNA 4ELKB 4XPBL 2CKNA 2XNAB 3FL7A 3NZHH 4FQIH 4NJ9L 4WO4B 4FQXD 1MJUH 4KHXH 32C2B 4NZUL 1HQRA 5C0AA 4YXHL 5J11C 5ILTH 5C0BB 2AQ2A 1OOAA 2Z92A 3MC0A 5FDWA 3IXTA 1JI1A 4DUWA 5L2KE 2B1AH 4JY5H 1CFTB 2APTA 2JF1A 4IHOB 4A6YH 1M6OB 3ARFA 2PXYD 1PKQB 2CKBL 3VH8A 4MD5A 5KOVC 1JK8A 2B4CC 2VJXA 4RMTA 4BELD 1XGQA 1T83C 4AG4H 1U8NB 1V3LA 3IDJB 4QRRE 3SEPA 5F7DB 2VZUA 1LD9A 2DI7A 4Z7WF 1RJLA 3Q0HA 4CDGC 1YQVH 2V7HA 4Y4FB 1IAOB 3CSGA 3KLAB 3O6KH 4J1UA 3JV4B 3DETD 1RUQL 3PHSA 2JJUA 3DBXB 4DUVA 4NN6C 3I6GA 1ERNA 3RAJL 1OAZH 4Z76A 5CEYA 2WP3O 4G42B 3TBYB 3BZFB 5DA4A 5BV7C 3TEUA 1N26A 2VXVH 5DJ0B 2VITA 4LP5A 1AGCB 5E1HB 1OM3L 5ADOH 3TYGH 5E1AB 1MHHB 2X1QA 4U1JB 1AHWA 2A0LC 1I1RA 1KCRL 5FYKL 1PEWA 3AS2A 4HEPG 4Q6IA 3L3GB 4V1DB 4WU7A 3RX5A 1KT2B 2MKWA 3DV6B 5I1JH 4ONGL 3QDJD 1YY9D 3OKDB 4RAUB 4H8WC 4LSVL 3DO7B 3ZT5A 1FN4A 1BJ8A 4CMHB 3MV9D 1LO0H 4PJFA 4D0BB 3IGAA 4ZFFB 4HFUL 4Q0XL 1MFDL 3S37H 2O5ZH 5GRXG 4G6KH 1P5UA 4LLWB 3HMWH 3GM8A 2UY6A 2AJVL 5HHNB 3O41A 1MREL 2MPAL 3ARBC 1AI1H 5BZWB 4QXTB 1YUHA 3HN3A 3H9SD 4L8BA 5F71A 4FP8H 4JFYA 5ICYA 3DECA 4H25B 3O6FB 1KC5L 4NQEA 2BHZA 4NQSB 1F90L 4Y4HA 3V0AC 5FGCE 1U36A 5D7JB 1I9IH 4NRYB 5CBEB 5EUKB 3QEGL 3VD7A 1UWEL 4F7EB 4UINL 5EORL 4JFDE 4KI5D 2N7BA 5INDA 4AEHH 4AENA 3P77B 4Z7WE 5AUMA 5EO0B 4UIKH 3NZHL 4FQIL 1UFUA 4NPYA 4DEPC 1MJUL 2ZOLB 2NLJB 3LH2H 2GHWB 4ZUTA 2PYEE 1WFNA 1UH2A 1YA5A 2B4CH 3AY4C 4NNXA 5ILTL 3PABA 3RUGF 5DF0A 4Z9KB 1J1PH 3SGEH 1JWMA 3T2PA 2AXGA 1QSFD 2VLLB 3P30H 2NX5A 2B1AL 4JY5L 3D5OF 4A6YL 2OK0H 4LARH 5FHAH 4WO4C 3SKNA 4UI2A 4I18A 4OBSA 2GSIB 2PO6D 3TO2B 4AG4L 2HAZA 1XGYH 3QUXB 4YHIA 2AQ1A 4F7MB 1Q9LB 5HHQA 4MWFA 3UTTE 4Z78A 1J8HB 4MQTB 4OD1H 4HK0B 1YQVL 4HPOH 2WLZA 4MS8C 4LAQH 1A6TA 5BV7H 3O6KL 1UJ3A 2ZNWA 1G9EA 1JRHH 4EN3B 4KHTH 4TQEH 1KB5H 3UAJC 3EYVA 4PJ8A 1WCQA 3SDDC 4Y4FC 4PJ7E 2J88H 5DZOA 4IOIA 3RIFK 3S5LG 2VXVL 5SWSE 4NZJA 2AXHA 3BPCA 3LS5H 1MLCB 3W9DA 1QD0A 5ADOL 3BZ4B 1TENA 4X83A 3TYGL 5C3LD 2FEEI 1KGCE 3Q6FB 4H8WH 3S3SA 5LQBH 4PJ5B 1T22B 3KDMA 4I3RH 1MRFL 4BZYA 2QTEA 2CLZA 3DUSA 3WL9A 5IMMA 3DVFA 4M61B 3Q3GB 1CQKA 2HFGH 1T0NB 5I1JL 5HHMB 3TBTA 5EBLA 5J3HC 2QADB 1WCBB 5EOQH 1LO0L 5KS9A 3R4DA 1BIIA 1NGZB 3GJEA 4AK1A 3S37L 3LRHA 2O5ZL 3SGKC 3OX8A 4G6KL 3BQUD 2K7QA 2YHGA 4UT6H 4QOKB 3HMWL 3QUYA 1ZA6B 3BGMA 3LEYH 1FVDA 1P6AB 1AXSA 1FGNH 4YZFF 1TCMA 1AI1L 5IV2B 3MGAA 4QO1A 1IAKB 4NHCH 3QDME 4FP8L 1PG7W 1J8KA 4G8EA 4CMHC 2CUHA 4POZC 5DUBA 2IPTH 5HBBA 1ZA3A 2EDEA 5JHLH 4R26L 1GC1C 3VRIA 1YEFH 4OSUH 3C08H 1EEUA 3F58L 1I9IL 1VA9A 5I74B 1TNMA 3S5LA 2FX7H 5DJYB 2DI8A 2X9YA 2YRLA 4HC1H 4O2FB 2J1KA 4AEHL 4LSUH 4C56E 3GBNH 3O6FC 4KFZC 1NC4B 4L3EB 4UIKL 4MXQD 2R2EB 3QISA 4OF0A 1IEBB 3LH2L 4MSWA 5DUMH 3MSPA 4X4XA 4JKPH 2PR4H 2WBKA 3D2UB 1G1YA 1I3GH 4OGZA 4Q9RH 1CE6A 3IFNH 3P30L 1WIOA 3SCMB 5JA9A 2OK0L 1E6OH 5FHAL 4PJBA 1J1OL 3O4LD 4G6AD 3MRGA 1OB1B 1XGYL 4I2XA 3S8WA 3KPRD 4OD1L 3DVGA 1P7KA 5HHVH 3CFDA 4LAQL 3KLSA 5BV7L 1UWGH 1GXEA 4LKXA 1PQZB 2IBBA 4KHTL 4TQEL 2ICWB 1KB5L 1BQHA 3QUXC 2HH0L 2XWBB 2EH7H 4JE4B 2Y7QB 3OR7B 4N0UA 4IRJB 5IVXB 3SOBH 1VHPA 1KLGB 4XVUD 3VFTB 2J88L 2R0LH 5GZOC 3H0TB 2DWEA 5I75B 3RGVD 3ZYZA 1NDGA 1IKFH 3LS5L 3PNWA 1Q0XH 3B2VH 4XBGA 3UJTH 4FQ1L 3DURA 4H8WL 5LQBL 2ATKA 3BE1H 4I3RL 5C0CA 3SE3C 2A6IB 4JFOB 5I1LB 2ERJB 3GK8H 4PTTB 3G9VA 4HJ0C 2A77H 4PJ9A 3NZ8A 2HFGL 3B2UC 5E4EB 5TPWH 1HHKB 4HUNB 1SYVA 3RA7H 1EPFA 3H9HB 1DSFH 2YA2A 3I6KB 1OW0C 5DMGD 2DMCA 1IBGH 5EOQL 5KSUA 4I5BA 2PYFB 2DJUA 3FO2B 4WI9A 1GC1H 3LN4A 1I85A 1I9EA 4ODBD 4UT6L 4JFHD 1IL1A 1YEKH 5DLMH 1U91B 1KIUA 3LEYL 4ODWA 3NTCH 1UM4H 1FGNL 2QADC 4LLQB 4APQA 3IAGC 1QEWA 4GAYA 4NHCL 4LOUD 1OWRM 1GVIA 4KTDH 3BEWA 4EQ3A 2IPTL 4N5UA 3VXMA 4J3OC 5JHLL 1VEOA 1IM3A 2PTTA 1WEJH 2R2BA 4F2MA 4P5MB 3H6JA 4OSUL 1R5WB 1X4ZA 3C08L 4P59H 5T3XD 3T4AB 4NSKB 4NNPH 1TVDA 1NGXB 3DX8B 3P4OA 4HC1L 1KELH 3UJIH 4LSUL 3QI9D 3GBNL 1H3VA 1UG9A 2NPLX 1RJZA 2P24A 3MREB 4H26A 1B0GA 3RKDC 1XGUB 1CU4H 4ONHB 4M7LT 5DQDH 2D0FA 4LLYA 5I74C 1R5IA 3S35X 4JY4B 4JKPL 1YQ2A 3KVQA 4P3DA 2PR4L 4M5ZH 5JNYB 2MHAB 5GRVL 2IH1A 3U36B 4ACPA 1FG9C 1I3GL 4Q9RL 4NQCD 2ZSVB 3IFNL 5E70A 5B22A 4Q7DA 1E6OL 1IGTB 1Q8MA 4AH2B 3ZHDA 3FONA 2B5IB 1AQDA 3KHQA 4JFED 4XNQB 3VXUD 2J8UA 4YPGB 3SDAA 5JMRA 1QLRB 4XNUH 1UQSB 3TZVD 4HIXH 2PXYB 4HJGB 5T1MA 2QQNH 1YZZA 3SCMC 5DQ9A 2DAVA 1X5JA 5HHVL 2HJLA 1AFVH 4L1DA 3OGCB 3I2CH 5TF1L 5C2BH 2E6JA 3ZYIA 5LAXA 2I9LA 4AQ1B 3PWJA 3IJSA 1JL8A 3MBXL 1HSAA 3O3UN 2I27N 5FO8A 2EH7L 2D0GA 3WJJC 4ISVA 3CFCL 5I18H 3SOBL 3U9PL 4WI4A 3EJYC 5JIKA 3RX7A 3TO4A 4PY8I 3GB7B 2R0LL 1K3IA 3SPVA 1DVFA 5JDJA 1Q0XL 3B2VL 1I9RH 3UJTL 2FJHB 2NTSP 3L6FB 1X5ZA 3BE1L 2FZ3A 5FO7B 3EYOA 4IRJC 2X9WA 3GK8L 4MQ7A 2A77L 1VGKA 4GW4A 4JDVA 4KK5C 2BY0A 4HD9A 1KOAA 5D2NA 5TPWL 1JYVA 4NZTH 5T3ZL 3RA7L 3ZE0E 1CDCA 3RWFA 2C3HA 1DSFL 5H37H 1JTPA 1N5AA 2BY1A 1IBGL 4P2OC 1N0LA 5KAQG 1H0DB 2ERJC 3QDJB 5HJ3A 5H2BB 3EDFA 3U6RB 1GC1L 3LEXA 1JGLH 1H15A 1TQBB 5E4EC 5DLML 1YEKL 1IGCH 4X7TB 3MTRA 3MV9B 3NTCL 2OR9H 1UM4L 3VD5A 4LIQE 4X5XA 1OLLA 3CSYB 4KH2A 1ONQA 5EU6A 3K81A 3M1BB 4UDUB 1ORSB 3HI1A 4KTDL 3VWKD 3HZVB 3IF1A 5HSFA 1MJJA 1OGAD 3KXFB 4ODXB 4BKLB 4P59L 5DR5H 3WIFA 2W60B 2JJSC 4WCYH 2Z8VC 1KULA 4NNPL 4RZCB 1A6AB 5IW6B 1F42A 2ADJA 1WICA 3BP6B 5EIQA 3O45A 4QT5A 1KELL 1CFQB 3UJIL 5F3HA 1RIHH 5F3BB 3W11C 4MAYD 1HXYA 2OR7A 1CU4L 4YBHA 4U1HB 4DN3H 1S9VA 5EC1B 3VRJA 5DQDL 2IALB 1H3GA 4HS3A 4OCRH 1UKTA 4Z6AT 2HP4A 4D9QE 4OZ4A 4U3CA 1NGWA 4ZPTB 4KRPD 2AXFA 2EICA 4HV8B 4I4WB 3D25B 1BM3H 4CRPA 1QSFB 3H3BC 4NJAH 4W6WB 4OCXL 3V6FA 2MCG1 4XNUL 4RA3A 4GRMA 5LWYH 4HIXL 5E9DE 4JHWH 1NFDA 4GUPB 1MCNA 2QQNL 3MNZA 5IJVA 3U79A 4OI7A 3I2CL 3T1FA 2B5IC 5C2BL 1U58B 3EO1A 5C0AD 4RGNE 1BMGA 4HH9A 2JCCF 3HG1A 2PXYC 1FL3A 4JPKH 4E42B 4TVPD 3S36H 1XCQA 3AXLB 3HS0B 3ARFD 5E24E 1GGIH 1I9RL 1A1OA 4HWBA 1Q38A 1T21A 2QR0B 1A4KA 4MLIA 1OAQH 1T0MA 4MNQA 1TPXB 1N7MH 3L7EB 4PV9A 3QYCA 3KYKH 1X3DA 4IRZH 2EC9T 4IDLA 5IJKC 4XVSH 3SGEI 2IGFH 1L7TH 1JF5A 2B39A 4NZTL 4JRXA 4UT7H 1I7ZA 4JPWH 3VFWA 1R3LB 4GSDH 1YECH 1F11B 1B0WA 5F6HI 4Y5YC 3AM8A 4FTVE 2IEPA 2FBOJ 4UNTA 1H8OA 1IGCL 5I16B 4EJ1C 3MGTB 4YFDB 2OR9L 3V7AE 2YA1A 4M7ZB 5DI8B 3BO8B 3T0XA 4GRWF 3L3HA 2UZXB 1D3CA 5C71A 1JRHI 4H0HB 1U6AH 2ED9A 1YY9C 3VGEA 2A6KB 3QFJE 3L5JA 4KDVA 4BQ9A 3LKNB 1TQBC 5DR5L 1SBBA 4NYLB 4TNVK 1GZQA 4WCYL 4I0PA 1K2DB 4QF1A 1G6RA 1CGXA 1W0WB 4WVRA 4OFIA 3UTSA 1TIUA 2FO4B 3L9RA 5FOBB 1NMCB 1RIHL 3C2SA 1UYWH 4HX1A 3AREA 3S3JA 2AJZB 4Z7OF 4DN3L 5IMOA 3ZSTA 4ZOBA 1R3HA 4OCRL 3GFUA 3GMQA 3T8XB 4LCCA 1A1NB 3BD3A 3MRIA 5GS2D 5JORB 2AS5M 1BM3L 4NQED 3SDCB 4PJEB 3ECBA 5L9DH 4KI5C 4NJAL 4Y4HD 2D2OA 2IBZY 2V9QA 1VADB 5LWYL 1HWGB 3B9VA 4NQUA 4YNYA 4JHWL 3O4LB 1WBZA 4P2QE 4K3EH 4D0DB 2R0ZH 5H94A 1TJIH 4JKKA 4PGCB 2L7JA 3KPRB 4S1DD 3U9UB 1IZKA 2DD8H 5EU5B 2CDFA 2ZSWA 2GI7A 3DXAE 5J6HB 2VDMH 3I75B 4JPKL 5CUSH 2K7PA 2N4IA 2NX5D 3S36L 1ZVSA 4ERSH 2P8LB 4LCWA 4I8DA 1GGIL 3RZCA 1F3JB 2DBJA 4PJIF 2PUQT 3RWEB 5BZDB 3LEVH 4GRWE 5IQ9B 1MFEH 3RNKB 1N7ML 4H88H 3EYFB 5ICZA 3D69B 3KYKL 2H32H 3MRDB 1U2HA 4IRZL 5GGVY 4XVSL 3RX8A 5DD6B 2IGFL 3X14B 1L7TL 3L95B 5DJZB 3ROLB 4HXAH 4UT7L 2XRAH 3FCTA 1MFAH 2Q7YA 4JPWL 3D0VA 2ZZUT 4GSDL 4PJ8D 1TPXC 3F7PC 3QWOA 4HIIA 5F7YC 3ETBF 2W9EH 1YECL 3Q1SH 2IPKA 4ORGB 3UXFA 2AJ3B 3MUHL 4ZUUB 1J1XH 2VMFA 4HS8H 2HKHH 2H1PH 4JZNB 5EOTA 2XWTB 3VDAA 4JO1H 5E6IB 3AB0B 1U6AL 5IOPA 1YEEH 4HIHB 1UEMA 5D1QB 5DD1L 4IOSD 1KYOJ 3FMGH 1W72A 2IQ9H 1HYRC 3O9WC 4M7ZC 5HI5D 3DSNA 3C8DA 1KUMA 3MUJA 1UYWL 4JDZB 5EULV 1JMZA 3VI3F 4ZXBB 4LSDA 1CFVH 4YEEA 3BEVB 5M95B 3QUYD 4KK9D 3QI9B 1IM9A 3OV6A 1MF2H 3GHEH 4JJ5A 2E7LA 5GXBB 4RFEB 1BPVA 5ID0A 2AXJA 1NMCC 5HGDB 1UXWA 2D7PA 2VDPH 5DHVH 1UKQA 5K9OA 4XPFL 5D7IB 2I26N 3DTXA 4WY7L 4DCQB 5L9DL 4IRSA 5IR1B 4OB5H 4NQCB 1EFQA 1BIHA 5F1KC 2XT1B 5GGVH 4XP4H 3MA9H 5D2LE 1FDLH 2HVKB 1VFBA 4CL7A 1JN6A 2ATPB 4IEFB 4JFEB 1M71A 1JGEB 3VXUB 3MMEB 3V5KA 4K3EL 3WDHA 2R0ZL 4G9DB 2IAMA 2DM7A 3SDCC 4KKCC 4JVWA 4NKQB 3QXDA 1G0YR 2XTJB 4WUUE 5SV4A 4ELME 2BY2A 3KYNB 3MFFA 2DIAA 2VDML 3I9GH 4M7KH 4RGOH 4G6AC 5D9SB 3B5TA 5CUSL 5DWUH 3QIBC 3HRPA 1F00I 2G2RB 4QHLB 4ERSL 4Y0GA 4ZO7A 2GQHA 4ZSOA 4BH8A 3FQXA 1TJHH 1TTGA 1TZIB 3VG9B 1JP5A 4GRLA 1AO7B 4POUB 3LEVL 5GSRA 3ULVF 4R90H 1J12A 5AYQA 5I76A 1JF1A 4O9HL 5DFVD 1JVKA 3C60A 3FFCA 2X4PA 4QRPB 4H88L 4R7NA 4MJ6A 3PWLB 3TIEA 3W9EA 4HXAL 3PGCA 4PRNB 5DJXA 3M07A 1MFAL 2KZWA 3F7RA 2MOVA 2C7UB 1ETZA 4LPXA 5IUSA 1EXUB 1FFNB 1FFOA 4ZFOA 2W9EL 5MP6L 3Q1SL 2OP4H 3CX5K 4Z5RB 5HVWA 1PZ5A 4F7TA 1RZIB 5F7WC 4XH2A 4N5EC 1J1XL 4HS8L 4KV5F 5J8OA 2HKHL 4X5WA 1N59B 3RVWD 3IRPX 4OCNC 3FO1A 2QKIA 4JO1L 5C0CD 3TNMA 1ZK9A 2W0PA 3CUPB 2X1PA 1YEEL 3KYMB 4LLVB 3V9FA 5GRJH 4PJ9D 5J6GB 5IEHB 1FZKB 5DMGC 3FMGL 3U30B 3VWKB 2IQ9L 2FSEA 5L0QB 2MNUA 4QCIB 1G7PB 2OTUA 5E6IC 4J3UA 3AB0C 4KKAD 3OKNB 4H1LB 4HWNA 1WBXA 4MLSA 2BVPB 1MJ7H 1FL5A 2JJTC 1CFVL 1J0IA 5D1QC 3TT1H 3S97C 1YEDB 3QNZB 2Z91B 3V6OE 2R8SH 5HYFA 1MF2L 2Q76B 3GHEL 3TIDB 1RQ5A 2ITDB 1DE4B 4MAYB 4APQD 2WBWB 2JTDA 1LO2L 4ZOCA 1T5WB 3EFFA 3STLA 1RK0B 3OAUH 4YK4B 2VDPL 3VXMD 4HGMA 4KC3B 4ZXBC 1MY5A 4PR5B 2JB6A 4OB5L 3I6LD 2YD4A 5GGVL 1IKNC 4XP4L 1FDLL 3K1KC 3V0VA 5GRUH 1MCWM 1PEZA 3IFPA 1RULH 1HZHH 3X3GH 5C0IA 4HKZB 1VERA 5JA8B 1CDUA 3FTGA 1A21A 3MJ8B 1QFPA 2BC4B 4G9FA 4DFIA 4AM0A 4WDIB 2VE6B 5AZEH 5DEGA 5J12B 3G5ZA 1CL7H 1P84K 3FB6A 4M7KL 1T3FB 5DWUL 4RGOL 4BJLA 5EPMA 3WHXA 1HQRB 5C0BE 2Y06H 3QZWG 1N64L 1RZKC 1TJHL 3ZDZF 2Z92B 3O3BA 5FDWB 1DP0A 5DA0B 3QP3A 2OJEB 3WBDA 2XTJC 1WC7A 3SDAD 5FB8A 4R90L 1FFPA 3RGHA 4ZS7H 2DJSA 4JHBA 2E6PA 3K46A 5KVFH 3VFUA 1PKQE 4MAUH 4Q9CA 3VH8B 4MD5B 2WQ8A 1XGQB 4XCYA 3BZEA 4HFWA 2XQYK 4OZHB 5ISZA 2YD8A 4C54A 1RJLB 2V7HB 4KKNA 3GSWA 1QYGH 3FQNA 2AK4A 3WHE1 5ENWA 4NRXA 5GS3A 4E41A 4OUOA 2CRZA 4P2CG 2I24N 2OP4L 3TO4D 1Q9WB 3CVHA 2V7NA 1MI5A 2BOCA 5GRWA 4Z76B 3MRPA 2YN5A 3GSXA 3KPSA 3MXVH 3HR5A 4DGYH 2ESVA 1AGFB 4DKEH 2VITB 2DLHA 2ICWI 4OKVA 5GRJL 4ZYKA 2F8XC 3QFDB 3P0VH 3QZWA 4QKXB 1GIGH 1AJ7H 3W82A 4TNWK 4Q6IB 4V1DE 4WU7B 2AEWA 5DK3A 2XZAH 4KUCD 3OJ2C 2Q7NA 2DBLH 4HWZB 1MJ7L 5CAYB 3BP5B 4ENEC 2E7MA 1KNOA 1A64A 1FN4B 1FO0B 3U30C 2R8SL 3VWKC 4PJFB 3IGAB 3CLFH 3WYRA 5SV3A 1Z5LA 2V17H 1JNHA 3UO1H 1FRGH 1CGUA 5EU6D 5CMAA 2Z35A 4HHAB 2WWMC 3OAUL 3C8KB 1F8TH 3O41B 3E8UH 1JUFA 5CZXD 4L8BB 4JFYB 5ICYB 2VR9A 3VXRA 1NQBA 4MAYC 1H9VA 4NQEB 5GRUL 3IFOB 3RY6C 1SY6H 4WFGD 4Y4HB 1RULL 1HZHL 4YK4C 1FNEB 3OR6A 1RZKH 2YD9A 1F6AA 4K71B 1NCBH 5AZEL 5INDB 4AENB 2LVEA