1A66A

Solution nmr structure of the core nfatc1/dna complex, 18 structures
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
178
structure length
178
Chain Sequence
MKDWQLPSHSGPYELRIEVQPKSHHRARYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the core NFATC1/DNA complex.
pubmed doi rcsb
molecule keywords DNA (5'-D(*CP*GP*AP*GP*GP*AP*AP*AP*AP*TP*TP*G)-3')
molecule tags Transcription/dna
source organism Homo sapiens
total genus 15
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 1998-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00554 RHD_DNA_bind Rel homology DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.340 Mainly Beta Sandwich Immunoglobulin-like Rel homology domain (RHD), DNA-binding domain 1a66A00
1UURA 1LEIB 1NFKA 1LE9B 2O93L 1LEIA 1PZUB 1LE9A 2RAMA 1IMHC 1SVCP 2I9TB 1VKXB 1VKXA 1IKNA 1UUSA 1OWRM 2I9TA 1A66A 1P7HL 3DO7B 1BVOA 1LE5B 1NFIA 2AS5M 3DO7A 1LE5A 1S9KC 2V2TB 1A3QA 1NFAA 3GUTB 1RAMA 1GJIA 3QRFM 3GUTA 2O61B 2V2TA 1OOAA 1A02N 2O61A
chains in the Genus database with same CATH superfamily
4EO5A 3CX5J 2DQIL 1E4WL 1W8NA 2MQ0A 2Z0BA 3OXSA 1DZ0A 1T6WA 4POUB 5DK3A 1T66C 2DEYX 3DVNB 3Q1SL 5HHOD 2X4TB 4PRBA 3VD5A 1HXKA 5I8CB 4JREB 1SVCP 2EE3A 4YR6B 1G7LB 4ZMNA 3KGUA 2GG1A 1BD2A 5E8NA 5HHQB 2X2HA 5EIIG 1FFPB 1ZAGA 4AVIA 4UILH 1TNNA 2ZUTA 3MJ7A 4S2SA 4CDHA 1W8EA 5GSRB 1QFOA 1CICA 4L8BA 1EGJH 5IOKA 2YJQA 3C5SA 3CPLB 4FKEA 4HS8L 3RVUC 4N9GA 4B9IA 1XH3A 1FVEB 3ZE2F 5CSZB 2ZQKA 2W60B 1TZIB 4WV1C 4L18A 2OI9C 2EDHA 2OP4H 4TSCL 1S7TB 1NEUA 3LVTA 5FGSA 4MLIA 1NBVL 4KNQA 4E9XA 5IHHA 2VMDA 1TQWA 3W38A 1D5IH 4OZFA 3QIUC 2HX9A 3TJHD 4XX1E 5I1KH 1CLOH 1N4XL 1G9NL 2Y25A 3KXFD 1M3JA 2PR9A 3RZCA 4OGAD 4G7YH 3MMEA 1J9QA 4NC1E 5JW3H 4LCCC 4QRTB 3IVKA 2FEEL 3MRLA 2EXYD 2ZXDA 3QEHA 3ZKSD 5FYJE 4WI6A 3VSVA 4F58L 3NQIA 4OB5H 3Q05A 1BX2B 2R15A 2B20A 4QKTA 2AAVA 1CO1A 1G7HA 1MJUL 4FYTA 2ZAIA 2ZOLA 1FCCA 1GTNA 3NA4A 2HLAA 3ATEA 4HFUL 2HG5B 1KIQA 4Z7UB 3NFNB 3CZUB 3IJ8A 3BN9D 1ZLWH 1MI5D 2QPFA 2VDPH 3FQXA 3QS2A 4OLZL 1HNGA 5EZIL 1NCHA 3VYNA 1EERB 5C0JB 4DKFL 4I3RH 3DV4A 3ZR6A 2E9GA 2DM4A 4GRMB 1N59B 1K6QL 3FUIA 1WAEA 5JYLA 4EJ1C 2XTLA 1H6EA 1QNIA 4QOKD 1MVYA 1IB5A 2J1KA 2X4PA 4NN6C 4R7XA 2Y3NA 1CLZL 5E1QA 4DW2L 5FM5O 4RIRA 1OV8A 3OAUH 4LCUB 1GGTA 3RPIB 5D1XA 1BDYA 4XB8A 1SJVA 5FO7B 1KCKA 3RI5F 3FSWA 3QEQD 1T0OA 4QLRA 3E9TA 2WQRA 4ZS7L 1TFHA 3L6FA 1P6AB 1EIBA 3MLWH 4WUUB 3WDJA 3NOIA 4GEJA 2H32B 2AQNA 3C8DA 1BVKA 4NYLB 4I2XA 5F7FA 3PU7A 5ID0A 4TNEA 3GS7A 4JPWL 3FXIC 2VL4A 4MX7B 4NO0B 1AYRA 3NIDE 1TF4A 3PGFL 3L9EA 4M4RA 3OJDB 3FTWA 4JJOA 3NN8A 5GGTA 3FULA 3CN1A 4JX0A 2J8HA 3LNIA 1EFXA 4AQOA 4ZOBA 4K71B 2C3VA 4JO2H 5C0NC 3NSFA 4P2AA 1XGPB 4L8CA 3FB5B 1LO5B 3V9EA 1G7QB 5FM4A 3PJSB 3NZHH 3ZTNH 3RL2B 2AV7A 1MH5A 3Q2VA 2ENJA 3K2KA 4NM4H 4NQUA 3R8QA 3SDCA 5HPMB 3VW3H 1UADC 3ZTCC 3O9WA 4I13B 2AKRB 2AQTA 2NY3D 4QYOB 3ZQ9A 2X2JA 4G9DA 2Y7NA 1X5FA 2LOEA 3D18A 3IXAA 1RURL 4URTB 3QQ3B 1IFRA 1FNSL 2OP4L 3CXDH 1WTLA 1EJ8A 1A7QH 4NFCA 3QNXB 3UPCA 4LU5L 3GMOA 4R0LA 4R97B 1BFSA 1D5IL 1WCQA 1CLOL 1IC5H 1EHXA 5F9OL 2TAAA 4JQIH 2WB7A 3O3EA 4Q6YA 1X7QA 5DJCA 3ZO0A 1IAKA 3S3PA 2QLYA 1FGVH 1TQBB 4FA8A 5DWUL 4DGVH 5LBSH 1RJLA 2YD5A 5T3XL 1WD8A 1IM3A 3WSQH 1IQWH 1UCBL 2PUQT 3CBKB 4K8RH 4OGYH 2PPAA 4JKMA 1KTBA 1WFUA 2WKOA 3PWUA 4R4FL 1JE6A 1UOKA 3U9UA 1TPXB 1GHFL 1FFQA 2XZCL 5B4MC 1I75A 2F15A 4MBRA 3IJSB 4P2YA 1I4FB 3RTQA 3PUCA 1S5IH 4F33B 1HZLA 2Q3ZA 3OKOB 1VAHA 4C8XA 5JOFB 3M07A 5HYJA 2HFTA 2XWXA 4OD1L 3JT2A 4I77H 5F7UA 3RNKB 3COOA 1N12A 1I7UB 3INOA 4DP4X 2VXSH 2WD0A 1QEXA 3VD4A 5SWZD 4PRAB 3ESNA 1B0WA 3HBZA 5C0GB 2G2RA 3V6ZB 5FHBL 3FAXA 3IETB 3K8LA 4M7KL 3U4BH 5IHBA 3ARRA 2OYPA 4HEPA 3MJGX 1WEJH 5FYKH 1NDGB 1Q72L 3B7YA 2HUHA 4Z76A 1WS7A 5KSVA 4AL8H 4Z7VF 2O5YL 4BWUA 2VDOL 1CGYA 3MA9L 4XCFH 3FT4B 4JRXA 1Q94A 3GI8H 1QD0A 3MLWL 2AK1L 4FTVE 4HJTA 3STBA 3WO4C 5B38A 1UWGL 3WJMB 4D7BA 1WBYA 1VFMA 2C9AA 4XAKE 3DDFA 3GI9H 2WBXA 3HVNA 4X9BA 5DZVA 1YEHL 1ZPUA 3SE3A 2P8PB 3LRMA 4HK0B 2EVHA 2MHAB 4X6BB 1NCBH 5J1TC 1CI3M 1UC6A 4IIQB 1BAGA 2KPNA 3F7YB 4HBCL 3F00A 5D6DA 4HPOH 1F4YL 4O2CB 3I50L 4HX1A 4Y4HC 5SWSE 2E7HA 4X6EA 1S7WA 2BX5A 1FVCB 2E5EA 4AE0A 3BDBA 2A9CA 2EYRA 2OSYA 2VZTA 1OP5H 1QWHA 1DANT 3ZYZA 1E7UA 4QJ4B 1I8AA 2XX1A 4IEFA 1U3JA 4FA6A 5HJDA 3SD2A 2CO6B 5D4QA 5GS0H 3LV3A 2Q5BA 1DLHB 5A6LA 3TNMB 4NERA 4AG4H 1UA7A 2NT1A 3RGVB 4YGVA 2WOYA 4OLUL 3S34L 3B9EA 1E3XA 1A7QL 3I84A 5DJDA 1KV7A 5MHSE 1Q4NX 2YGNA 4PVMA 4X83A 2CKNA 4UV4H 1MIEH 3PREA 1UXSB 3GIZL 3PFUA 3TYFB 1IL1B 3OKKB 3NSXA 3ILPA 2HLFD 4RGNB 1GYCA 1BQHG 1FVDB 3DX8B 4G1MA 4D0BB 3S3BB 5C0FB 2HWZH 1YEIL 1VADB 3IKCB 5AB9A 3S3DB 4PY7A 2C26A 5C97A 2ZUXA 1QWUA 2ODIA 5D55A 1JK8B 1HHHA 2WXKA 4LOVA 2IANB 3K2IA 1INEL 3FTXA 3A4DA 2FWSA 4X5WB 3HCVB 1JZ2A 4AUJA 4DP7X 2VNCA 1T7YA 1U6AH 3QWRD 3UPAA 1RK1A 4O2EB 4U1JA 3LQAC 4R2GC 2NXZB 3FT0A 4YBQD 1IBGL 3UIYA 5GHWH 4HLEA 4OLVL 3RY5A 3ULVC 4AT6A 1PKOA 3VXRA 3DJRA 3MRIA 5A43C 1HL9A 2C5DC 1X3DA 2MQGA 5AAWA 3AREA 2VDNH 4KI5D 5HY9A 2VN4A 1CF1A 2UUDH 1T4KB 1FZKB 3D07A 1SBSL 5CN2A 1E5AA 3VNYA 1MREH 5JPMA 4F9PC 2H6UA 3O6MH 2A6DB 4KRPB 4ZMPA 3PV7A 1JMZA 3SE4A 4ENED 3IKKA 3FB7B 1JWUB 3D87B 1QTPA 3WLBA 3RVTD 4JPKH 2MKLC 2FECL 1T7VA 3PHOB 5DYOA 1MCRA 5D93B 3GLDA 2ITCA 3GI9L 5SWQA 3CBRA 5IMLB 1WF5A 3U1PA 4G82A 4Y5YC 3TYGH 3NH7H 2ZX8A 1I9JH 1OM9A 4C57C 4NCDA 2DAVA 3UROR 2P1YA 5B1JC 2EYSB 3VG9B 5FLVA 3F84A 1ULVA 4Z0BL 4FQIH 4I8DA 5B1AB 3TEYA 4F5CA 1KJVA 4ZX3A 4XP9H 1RZ7H 2Q9OA 3NT0A 3SJVD 2V0AA 4QHMB 5FGBA 2AMUA 1H15A 1GZQB 1KB5L 4Z7WE 4OD2B 4AC2A 3MV9B 1BF5A 1IU1A 3ROOA 2NNAB 2CD0A 4B41A 2Q2LA 4IU3B 3BVXA 1TU2A 2EDFA 1PX3A 2IAMA 3CC1A 4NKMA 3RJDA 2EVGA 3R18A 3KNBA 4DKEL 3Q5OA 1C7TA 3N9GL 1Y6KR 4HISA 3OAZH 3CFEB 3CZJA 2ZWLT 3H9ZA 4Y5XB 1ADQL 1B90A 5IV2A 4U6XB 1FN4A 4FNSA 5D7SH 2VRKA 1Z9NA 2WN2A 3F7LA 3IYLW 2LFGA 1YY8A 4Z3JA 4J2XA 1ML0A 3BE1L 5GS1C 4L9LB 3TPKA 5J8OA 1X5YA 1U42A 1GYUA 3HG1D 4D9LL 4EIUA 4GINA 4RFNC 3MCLH 4DP9X 3OPUA 1HQ4A 1G6RL 3IB4A 3T5WA 4D9RE 1Y0LB 1NSNL 1UCTA 3WIIH 4PU2A 5I0XA 3T3MB 1YEKL 4JL1A 1J0JA 5CSGA 5L88L 4G8IA 1AGCB 2WYZA 1QQDA 3P77B 5AL0A 5AOZA 1N8OE 3OX8B 3IDXL 1A2YA 1HWGB 3V79C 4LASH 5J13B 3O45A 4YBHA 3EHBD 1GYAA 2R7EB 4MJIB 3CVIH 3NA9L 3VSUA 3RWCA 1LE9B 2D03L 3FT3A 4UIKL 4RFOH 2YA2A 4G7VH 4PRNA 2FB4H 2BFVL 1OGSA 4MB3A 4XVSL 1Q0EA 4TNVF 2OTWA 3V0VA 3SKOB 3TIDB 4FXKB 1DJHA 1WFMA 1H6UA 3TA3A 2P5EB 2IDTA 1OAUL 3LMJH 4LCVA 4MFHA 3DETC 3FBQA 1RFDH 1A6WH 2PCPA 3LRGA 4FS0A 1HVXA 2EXWC 1FAIH 3T2NH 4F7EB 2R9HC 2DLGA 1FCGA 4I3SH 3KHQA 4WTWA 5E8PA 2Y2TA 1G9HA 4PJGE 1JF1A 2FRGP 1E7VA 2EUZA 1A6VH 1RULH 2QV2A 4MXVF 4MKTA 1JFQH 2GI0A 5D7EA 3AS3A 1J8HB 4P5MA 5IM7B 3LHPH 2XV0A 4EUPG 4YDKH 5ITBL 2WHVA 1NJ9B 3SCMC 2J57A 4I48A 4YQXL 4DPRA 3H2WA 1MHHB 4OLYL 4TULL 2GSGB 1W9XA 4HJIA 3FW6A 2JMRA 3OF6A 5F3FA 3D4ZA 1J48A 3HC4L 2XWBA 3QCVL 3QI9A 5KANG 4J1UB 1W80A 4X9IA 1K3ZA 3N85H 4NUJA 1U92A 3WJLA 5KUKA 1J8KA 2VERA 1GYWA 1TO4A 4X5QA 4GUOA 2NZ9D 1YNKH 3BPOB 5A16A 4JFPA 5I6KA 1F3JA 4ZAKC 2WKOF 2BSRB 4J27A 4JZOA 2VR5A 3WUZA 1SEQH 2MIZA 1CDBA 5IK3B 1LO2H 3AS0A 3ABLB 1RK0A 5CIPA 1Y6NR 5GS2H 2OZNA 1D5ZA 3HHSB 2K0RA 2WQUA 3QIBA 3AROA 3IN0A 2CCWA 5F3HB 1VLXA 4AIZB 4JAMB 1KBKA 2YD8A 2VTFA 4NJ9H 5TPWL 1F58L 3I75B 4WWOA 2NMSA 5HI4C 4PIBA 2ITEA 4E9QA 2ZPKL 5KZCD 4MDIB 4PJAB 1QLRA 1BVZA 4HAKA 4OZGA 5HYQB 1N68A 4BZ2L 2A6IB 2LABA 4U1IB 2Y36L 3TT3H 2ZOUA 4G9FE 4H8PA 4IS6B 5GGUB 5JW4N 4E41B 3OG6B 4ELMA 5A40E 1YPZA 2IALB 3KWWB 3T2OA 1C7SA 4BFOA 1C9SA 4LASL 5IBLC 3BD5A 5IMOA 3KL3A 4PJBA 1U3HA 1IAOB 5CGTA 5IJDC 1MCDA 1I1YB 3A6BH 1M57B 5E9AA 1RMFL 1QTYT 2Y7QA 5DURD 1HSAA 2Y22A 4RX4A 3T4YA 1BJMA 5GGRA 4G6KL 3GMNB 5D1ZD 3HS0C 1MUJA 3NSYA 4MAYA 3L5HA 3QEQB 5I8EA 4ZSOE 5JIMA 3QZNA 3WFBH 2XTJE 1EZVY 32C2B 4UNTA 3BAYA 3TOPA 2NNCA 4UTAH 3BIBX 1IEBA 4H0IA 1MEXH 3LXBA 1OANA 3AXLA 1JNHB 4AEIH 4N86A 2DWDB 4OCSH 2F74A 4LLWB 1AY1H 4LGPB 4Z78A 1IGCH 3NDYE 4MD5B 3UTTB 1U2CA 4PRPA 4RGNE 1FFOA 1ADQA 2I26N 5HYEA 2EECA 2J5LC 4GMTH 4ZPTB 1P84K 3NUKA 2P42B 4XPBH 2G3ZA 3AU0A 3V52H 3VFGL 3BT2H 1MFDH 4X6DB 1T20B 3T77A 3GMPA 1K72A 1OARH 4KQ3L 1I8MB 2AS5M 3WUWA 5DK0B 2WYTA 4LSTL 4DK3A 2LLLA 1DBML 1OP9A 3FO2B 1M7IB 2R4SL 2WSDA 3O3DA 5LQBL 1G6RA 4BKTC 4PVLA 4V1DA 3WLWD 4JHUA 3P2DA 3HBGA 2YEZA 2Z93A 4BINA 5JXEC 3DBSA 1AS6A 1QHOA 2XX0A 3HMWL 2DYPD 4OCXL 4NZTH 2FO4B 5IESL 5GZOA 3BUTA 3FU3A 4OZHA 1RJCA 5INDA 2AXGB 1B88A 1M1SA 3U7WH 1VFOA 1WAAA 1T5WB 3UBHA 2UY6B 4H20H 4NQDE 1JGLH 3QW9A 1GJUA 4CADB 1AZBA 5FW8A 2IGFL 3VXMB 4IRJA 3O0LA 1FL5A 3WXWL 5EOCL 2F53B 4PP2B 2A74C 4L4VA 3EOBA 4AKPA 1YRKA 2G5BB 4EDWL 1NCCL 1G7JA 1PG7W 1NMCC 1UM6H 5I19L 1HEHC 4YFLI 4B6ZA 2KDYA 3T2LA 5IBUB 1XGYL 3VFRB 5IHLB 2CDGA 1IT9L 4O02B 4BQCA 2NQDA 4KC3B 4C4UA 4A68A 2OL3H 3K80A 1MSPA 1GCYA 4EN3C 2NXYD 2I7SA 2KC0A 3VNZA 4PJDA 1KTDB 1IAMA 2QELA 1DVFD 2VIRB 2H6PB 1I1AA 1M42A 3L3OB 4JG1H 4N87A 4S0SD 3DRTB 3RDTC 5D9SB 3S36H 1HH6B 2JKWA 3ARBC 1NCJA 2VDQB 3N43B 4Y2DD 3MGTA 1QR1B 1Z5HA 1SRDA 3IGUA 3DRQB 4E42A 4GG8B 4A6YB 1IBDA 2CA4A 1BAWA 3PPEA 1DCEA 1UUSA 4X4MA 4Z7NB 2GTWB 1AZNA 3CU7A 3OKDB 2B1AL 3O3UN 2NY1C 1XX9C 2L7JA 5C6PB 5FOBB 2H1PH 3CFTA 5AD0A 3FOMA 4K8RD 3TBSB 2QQKL 4LSVL 3U4EA 4ZJ9A 2ZKHH 2XV2A 1JPTH 1OZTG 1X4XA 4L48A 5IHZA 3T08A 1P7QB 3SE6A 1IQDB 2A4ZA 2WAHA 4KHXL 2FJHA 3PAUA 1HILB 3D9AH 4Z3TA 4P5TC 1CN4A 3LZFH 1JERA 3KYOA 4DHLA 3RPBA 1X5MA 2EAEA 3BFWA 3VGDA 1NIEA 4KJWC 4ZQKA 2AI0L 4P2QA 4XPGH 5IQ9B 2JIXD 3B2UD 3L2MA 2VZOA 3EYSH 1OHQA 3T3ME 1HHGB 2ZXGA 4G8GA 2I24N 1TMQA 4PREA 5B7FA 3UDWC 4CVUA 1RL1A 4ETYA 4JHAH 3KM2A 5FUOL 3F7PC 5FYKD 3MBXH 3O3BA 4G70B 4JB9H 4BZ2A 3V0GA 3NSDA 3QUYA 4LARH 4K5PA 1IM9A 5DJ8B 1AO7B 5DTFA 4X9FA 4G43B 3DUSB 4TNGA 1MHCA 3MNDA 1BAFL 1CE6B 5IT2H 2UZXB 5AW5B 4XMLH 1U8KA 3B3IA 3QJHB 1CZ8H 2EILB 5DJAA 4G8EA 4YXHH 1A4CA 1BOGA 1PFCA 2FE0A 7PCYA 2P5EE 4P23D 3PHQA 2OMZB 2X2IA 4K5NA 2XBZA 2H6OA 1IKFH 1AQDA 5AOLA 3O8XA 3W2DL 3WS6C 3IMSA 2WQWA 3MLRL 3NACH 1V7NH 4BGLA 2IWFA 4OCYL 5EC2A 2BIMA 5KS9A 1MCLA 1EO8L 4LHUD 3EGXB 3RWEB 2EKSB 3QG7H 4BIKA 1UM6L 4NQCA 3QPXH 3T0ED 4BGDA 1O7DE 2JLPA 4KUCF 3HRZC 4P46C 2BNUA 5ALCH 5EV7A 2OL3L 1F5WA 1WCBA 1PVHA 5GS0D 1JZ4A 2R2CA 4GRWF 3UXFA 5C0AA 3FS9A 2LU3A 3HZYB 2HJFA 4J4PC 1HS6A 2VERN 3QXDB 4I18C 1KPRB 4PY8I 2HTLD 4K3JH 4U2YA 1YUHA 1KIPA 3G5ZA 5D7IB 1GGCL 5AZUA 1RP8A 2C9SA 2D31A 4HWBH 5I24A 3C2SA 2XXMB 5HP5A 4GT0A 3KVPA 4GP8B 4C83B 1MJ8L 4GAFB 2FBJL 2W9LA 5FYJL 3KZ8A 1A14H 2TSAA 1I8LC 1DDHB 3CFMA 4GLRH 3VD3A 2IDCA 4V11A 5HGAA 5T3ZL 4DAGH 4XN1A 2ADJB 4TNWF 2UY7A 3UTPE 3MXVL 2YSTA 3EJCA 1HKLL 3CZLA 3Q13A 4Q9RH 5JZ7D 1PG7H 2BHUA 2AGJH 4ODVH 1KGWA 2DM3A 1OAKL 2IPTL 1T6BX 4M9OA 4PJ9B 3EO1A 4LQFH 4GFTB 2ZKHL 4LL4A 2WLIA 4CJ0A 3MTRA 1MZZA 3S5LG 4HH9B 4ZPVB 1IZKA 5TQ0H 2YA0A 4OH2A 2QQLH 1UH2A 1ZANH 3OHXC 5FECB 2JQAA 3DV6A 5CD5D 3S98A 2R29A 3DA0A 4NZRH 1WRFA 1Z0NA 4L9DA 4PJAE 2BNQD 2X4RB 2YWYA 2OMBA 4OGXL 5C08E 3TP4A 2LU7A 3ATBA 3B5TA 4JN2B 3PDDA 3ZDXF 1TEFA 1OF2B 5CP7B 1ZLVK 4O4YL 2DW5A 1E5CA 3KPNB 1GS7A 2AJ3B 3A6CH 1KCSH 3W39A 4E41E 5ITFA 3EJQA 4X6CB 3FQ4A 3TJHC 3VX1A 4BKLA 5KG9B 3UIZA 4OGAC 3UCQA 4BFFA 1D7DA 4JM2F 5CILH 5GSVA 5KOVC 1SF3A 3MUGA 5EU6A 3WTXA 2BOCA 2I9LB 5FUCE 3VWJD 4OV5B 4BFIA 5C09A 1ZTXH 4ZMOA 4K5MA 1XQ4A 3MV8D 1VCAA 2V2TB 4WFHD 3OMIB 1OPGL 3S4SB 4Z8FL 3BSHA 3FFDA 1OTTC 1CXHA 2WUBH 4D9QE 1YPZF 5A2KH 5EU4B 1RIVH 2RJMA 3N3EA 1CXKA 3MTXA 1PDKA 4L1HA 2WBJC 1V7ML 3BN9C 4POZC 3VD1A 1SYVA 4FMFA 1U8CB 1OB1B 2EDDA 4YDIH 15C8L 5BVJA 3UTTE 1GCFA 4QRRD 1A8JH 3VRIB 1GAFH 4K15A 5DEJA 3UBFA 3AUWB 4WI2A 2JSFA 3ARSA 3OKEB 3IJHB 4ORZC 3IMTA 4HXBL 2X09A 5GGSY 2BOLA 3QPXL 5D7KE 4FQXD 4X6DE 3V7AE 4U33A 2AEWA 5BRZD 4W6WB 1J0ZA 1IGIH 4QXUL 4TRPL 2ZOWA 4HCGA 3SSGA 2BIQA 2HJLA 3MBEA 3EHBB 4K7FA 2P43B 1RZJC 4GOSA 3ALPA 4JDTL 4XZUA 3KJ4B 1A4AA 3O2VH 1RHHB 4NO5A 1HJCA 2DDQH 4PLKD 3NPZB 5F1OB 3TO4D 3MOAL 1G7IA 5DRXB 3GZQA 1A14L 4MWFB 1LE5B 3RI5K 4MB1A 3NAAL 4B27A 2GJJA 3WFZA 3MJWA 2V2WA 4LLUA 3VXME 1FV1B 1ZHKB 5L6YH 5I74B 3GMQB 2HG0A 4GSDH 1A9VA 2MOVA 3ET9F 1LM8V 4PJ5B 2F53E 3CDZA 1F1AA 2W94A 2DMHA 2WSKA 2ZCHH 1XF5B 2CDFB 2VMJA 2C3HA 3V6FA 4GG6F 4OZHF 3M8OL 1XSOA 1KDIA 4BFGA 1TYRA 4RMTA 4PV8A 5D5MB 4OZIB 2RD0A 4WRLA 1K8DA 2P80A 3H2PA 4JFTA 3PGCA 3HOGA 2WGNB 1SMDA 1FAKT 5IJKA 3ARDB 3JQOB 2NY3C 2M83A 4LSRL 4XN2A 2XCMC 5G5DB 2NW2A 4QI3A 2BHYA 4F2MB 5K5YA 1KIRB 2DQTH 1XTLA 2GY5A 4X6FB 4PWEA 4I7ZC 4J3SA 4U0QB 4WWPA 5FA4B 4G8FA 4K9JA 3GYRA 1HDMB 1BF8A 1ORQA 3OXRB 5JDSA 5BJTA 5KOMC 1LXMA 1AI1L 1JDDA 3W0WA 4L8SA 3UG3A 4ZG1A 1QOKA 5JQIB 3HPJB 4XXWC 3UBGA 4CNIB 1FL3B 3HC2A 3OJ2C 2AEPL 2KLTA 5K9KA 1ZTXL 2OSLA 4L3EB 1J5CA 5HVWA 3LJ3A 4A2HA 2FR4A 3GM0A 1YEFH 3VCLB 1WA1X 3TTSA 2R83A 1FNGA 5BXFA 2B2XL 2WK2A 3EDKA 1LHZA 4XXCA 4JRYB 3PPSA 5F7MC 2EYTA 4DPBX 1N9PA 1ZSHA 2ZE0A 3O6FA 4PJHB 3X1BA 4ATWA 1ANUA 1K3IA 3Q5TA 1B4JL 3VXOA 4ODXA 4G59C 1AKJB 3QFJA 1IGFL 3FN0L 1PCSA 1B0RA 2YMTA 4XWGH 2CE6A 2JFCA 2XWJB 3ARFA 2AC0A 3BHBA 5CLWA 4FTDA 3IFLH 3WN5C 4GQ9H 2K7PA 5KSBF 3HI1B 3ZKMD 1OAYL 3PNWA 2BS8A 5J6GA 4MGXA 3VAEA 3D3VB 3OR6B 5FB8B 5I71C 4ZUWA 3HC3H 2OV0A 2AABH 1B4TA 5I0VA 1DBAL 4OCMC 5GS2D 4PJEF 1G87A 2IH1B 4WW1B 1AO7E 4KZ0A 3HIZA 4UOQA 5AVRB 3UPRB 1N5YH 3BZ4A 5EDXA 1KNOB 3MVSA 5I76B 4PWIA 4NQEA 3ROLA 3OHMB 2YOCA 1Z9SA 2H3KA 5C07B 4U4IA 3IU3A 4LRNL 1UTDA 1JRHH 5GGTH 2VXQH 5IW3A 4CRPA 3UG4A 1L3WA 3GSXA 4MJ4A 1YEEH 2AANA 4PGJA 4XCCH 5KSAA 3IJEA 4PRHD 2VDPB 1JZ6A 2E9BA 2PF6A 1NUDA 1S7VB 4C55A 3BZDA 1WISA 3EUUA 3RWIA 4I87A 4N2AA 1CIUA 4BV1A 1UOWA 4XBEL 1E5BA 3DO3A 5D7LD 4NPYA 1XF4A 4XPFH 5DZ9A 5LN4A 3WAKA 1Y07A 1RV6X 2V5YA 3X3FH 3VQ1C 4AV0A 1S6NA 1TVBB 3GFUA 3G04A 4WGKA 4XNQB 5KBKA 1KUMA 5L2KB 1R5VB 3ZZQA 1ASOA 2DLEA 4N1HB 3SGKC 3D05A 5AUMA 5KBNC 3WKMH 4HYTB 1RZ8A 2P24A 1J1OH 1E8ZA 2Q8BL 2XDHA 2XQYG 4XVOA 3BJLA 2X3AA 3BH8A 2WO3B 5A2IH 3F58H 3D25A 4MA7L 4QRUA 5ISZB 3U9PH 1WWCA 4LZKA 2B0SL 2Q20A 3QCTH 4UINL 3NCMA 3UZQB 1V27A 3A5VA 2B5IB 1T22B 4AX3A 2D9QB 4LAJH 2HLFC 3ML8A 3WS3B 2V8MA 1L3NA 1FZJA 5F9WC 3D0VB 3OZKA 2QGBA 3NP4A 4OF0A 2XWTA 1Q9OA 3VGHA 2Q7AA 5MEQA 4WNQA 2V7HB 4GBXC 3O41A 1I8KB 3HAEB 3WO3B 2DI9A 5JW5B 1S8DB 2ICWJ 1T1XB 4U1NB 3U7YH 4UT9A 4X8JA 1CFTB 3WEOA 3VFVB 3GBMH 3KEDA 3OLGA 4HS3B 4EI6A 3F6IA 3BPCB 1NANI 1PD0A 3KPQA 4YBQC 4HMEA 3QQDB 3NQKA 4YL9A 4Z7AA 3BD4A 3BSGA 5I5IA 5ADPH 2MCG1 4UDUB 5LO7A 5IIEA 4LNRA 3NDZE 2CGRL 4FP8L 5GZNA 4WI0B 1E4KA 3K4DA 3LPGA 4XHJD 3M17B 4KI5C 4QO1B 1X6NA 4FFZL 1XZWA 1BLNA 2ATPB 3HC3L 1X44A 2AABL 4P2OA 4X42A 5D2LA 5D2NB 1AD0A 5D71L 5AWNH 5IROA 4AW7A 1MJJB 5DHVB 1O6SA 5IQMA 1G5GA 3IDJB 3IE9A 5IY5B 3G9VA 4KJQC 1N5YL 1Q0YH 4H2AA 2KHAA 3MUY1 3GKWL 4ENEC 3TCTA 3ARQA 3HE7D 1ZV5A 3L3IA 2BO0A 2XIIA 4FQQB 4HMDA 5ERWA 5SX5H 2F5AH 2XWEA 2CO7B 3NABH 4LVOC 3EZ8A 3RVTC 5HGHB 4FTVA 5KBPA 2OJEA 5MENB 2H45A 1VFBA 1FL6B 2QDVA 4BE5A 2WIIA 3ULUH 1E40A 4HAGA 3H3BC 3CFBB 5GQBA 4ABWA 5IEHB 4M3JA 1CYWA 3CVHL 2X6AA 1Q9KB 1QEWB 4W9CC 2OMYA 2R4RL 3P2BA 1T0MA 4XO9A 3L7EB 2YPVH 3VWKD 1AHWA 3FK3A 4YSSA 4PYGA 4CN1A 3CMOH 3DBXB 3FO1B 1DVYA 3U0PB 3VFMA 1DBKL 4KKZA 1ZTMA 2CHWA 5HGDA 5J1AB 5SWSA 2DJSA 2OR9H 1NA8A 2P46B 4NAQA 5DT1L 4LVHB 2YRLA 4YHNB 4LO9A 4QRFA 1C8PA 3T0DA 1M9SA 3GHBL 2NTFB 1QRKA 5JLZB 2WTRA 4BH8B 3OZ9L 4JVWA 1NCWH 3QR1A 1E4XI 3DHPA 4N24A 1CU4H 3O0RL 4RFEA 4XH2A 5DXWA 1KJ2L 2P45B 1UD3A 4W9DC 1FGNH 3P4NB 2NUPB 4JFXA 5LN8A 1U95A 4RWYH 3GK8L 3ULSB 5L8JB 3SDXE 2BHFA 4PD4J 2PP7A 5EHFA 5C2UB 3V4VL 2WJ7A 2P28B 2BY2A 4LSUH 3U7AA 4YBLC 4J5VA 5LXVA 5ID1A 1M7DB 1E9QA 3RIAF 4QWWD 4AQ1B 5AG8A 4XI5C 3LN5B 4RMBA 2XYBA 4NKOB 3SYCA 4K07A 1IJNA 2QGCA 4PJ5E 4DP2X 1FH5L 4Z0XA 4L05A 4LHUB 4PS4L 2H0PA 3LQZB 2MNUA 1QFWL 3U7YL 4Y2OA 1G9NC 3SYQA 1QFPA 4G3YH 3CDCA 5D5ME 1EV2E 3KCPA 1EAPB 5E9DD 2NOYA 3ZDYF 3FCTB 1E50A 2DLFL 3DXAD 1B9ZA 2ZYIA 3QDAA 1CIDA 4CSPA 5F44A 3CLEL 1W0YT 1QSEE 3BP4B 2VSCA 1FBIH 1KELL 4LT7A 3UTZB 5C0CA 3GKZA 3FDWA 5GJSH 3JWOL 1BQUA 1NFDA 5CSZA 2GTZA 4TUJB 3LKQB 5EOTA 5F6IB 1YN7B 3RWJA 3VI4B 2QZQA 3C9NB 2KERA 3G6JB 4YWGL 5FPIA 2ETWA 4YDVB 3GSQA 5JQHC 1CFNA 2WVSA 5CEXA 2D4DA 2EDYA 2WC7A 5HHME 2Y1ZA 3G08A 4QXVA 4HWUA 5IUCA 2PCXA 3QO1A 1Z66A 1A9EA 5F7LB 3TU6A 3T8XB 3QHZH 1PZ2A 1RH8A 1FO0B 1KXVA 5E94A 4L3EE 4OIIH 2ZCZA 2PXYC 3FH5A 1KN4L 4LDCA 4PV9A 5BS0D 3EFDH 2CIIA 2VWEE 3DSNB 3FOLB 3HZKA 4HCRL 4RDQG 5AW9B 3HLAB 2YXFA 4JRYE 3TZVB 1AGBB 5C70A 3DYPA 5CCJA 4A2GA 4DOHB 4GS7B 2QVIA 5KJ7E 3SY0A 5CWSB 1W72H 5LXGL 3WBDA 3D30A 1ECYA 5HSFA 4WJ5B 1BXAA 2KL6A 3QZWA 5E8OB 4LFHD 5CLXA 3V6OC 1KJ3L 2NZ9C 5K1NA 4YSOA 3VXUA 1UFUA 4P9HL 1MCOH 2CM6A 3WNNA 2DBJA 3U6XS 1SDAB 2XN9B 2IQAB 4DEUA 1TJHH 2VDKH 1MW2A 4I4WA 1A3RL 4Z7WA 4N90E 3D3VE 4AEHL 2E7MA 1WC7B 1A5FH 2NZ1A 2X89D 1SF5A 2ITFA 3CN3A 2AK4D 2JJSC 2VDRH 3FUKA 4X80H 3GSRA 1IKNA 1M53A 5GRXG 1FNAA 4JFFB 3C5ZA 3L4CA 2PCFA 5BMFH 5BVPL 1XIWB 1PFOA 2R1WB 1A6TA 4HS6A 3TCLA 3X1NA 3UAJD 3MCKB 4FFZA 4WK4B 3WDHA 1IEAB 3SBQA 1AOHA 2G3NA 1C12B 4GAGH 3LEVH 3MV8B 3NIFF 2CBPA 2DQJH 2Y6SD 3BYYA 3BZFB 1P2CB 1LTXA 2Z64C 1VDGA 1OAZL 2NRDA 1T3FA 2BNRA 4Y16D 2CJUL 3B5HA 2QFRA 3L1OH 3PL6D 1A8ZA 4L4TB 1KENL 2D7TH 1P5UB 1NEPA 3ALXA 5F3BB 3ZX1A 1MRDH 1OCRB 3HE6D 3ULAB 3MXWL 4O2FB 3T9WA 2F8XC 2PTUA 3CVHA 4BSWB 3QIWA 3KDPB 4MMZA 3UZEC 2GT9B 3QQ4A 1FNHA 1GYVA 4WU5A 3RE0A 2F6AA 1P7KA 2YKKA 2OX5B 3I6LD 1CUOA 1UA6L 1OL0A 1ZWIA 2AQRA 3TJPA 4UQBA 5L2KE 1AJ7H 3MLUL 3SBWC 4UOW1 5D1ZC 4HF5L 5CD3A 5JHAA 2DWXA 3TV8A 2B4CL 4LP5A 3U0TB 2J8UF 3EXJA 1S5HA 3RU8H 1AZZC 5KVGH 4QNPE 3QZLA 3JTSA 1NAML 2W5PA 4JRLA 5ISZE 4YS4A 3C12A 2VO5A 4JFDA 2QQNL 2GJ6D 1QBML 3CDGB 1BXUA 5D7JA 4DGYH 2X6VA 5I1JH 4YX2H 3HZ3A 4PJGA 2FD6H 3S4SG 1N2RB 1TQUA 1C1EH 5INCA 2B59A 5CEZL 2AQ2A 1T1YB 5D7HA 3U1SL 3T0AA 4D8PB 1RUQL 1A25A 1NIBA 3QFDB 4PRDB 1SOSA 4G11A 3AB0C 5H37A 2H0EA 4J12A 3RFZA 3WLWC 1G9ML 1TZGL 3DLQR 2AQ3A 4QUOA 4E0RB 5CGBA 4XBGA 3IJSA 5MP6L 3DO7A 2ICWB 3FFCA 3NMEA 2E27L 5GRZA 3NCJH 5FUZH 2J4WH 1IC7L 4R5VA 5EPMA 4N9OB 2FJSA 5F7EH 3ZT5A 2R8SH 3FU0A 3WHXB 2C4XA 4F9LC 4UT6L 1N3NA 5AVQB 3QQNA 4N0YL 4N6QA 3DPDA 3JUYA 3ZL4L 1SDDA 2LQRA 1MQKL 1NIDA 1A5FL 5I2IB 2ENPA 2WINB 5EF1A 1F6LL 2PR4H 3HUJB 5D2NE 5I6OA 4KXBA 3I2CH 3KPPB 1BGXL 2I9TA 4I0PB 2VMCA 2AV1B 3RL1B 1T5XA 1A1NA 3UAFA 2Q3XA 4FA7B 1EAJA 1USZA 3AWFA 1QSZA 2ZNWA 2VLRD 2ZONA 1JGEA 4JFYB 4ONGL 1IAIL 1VGKA 3GSNH 5MENE 3MKGA 2OFQA 1EAOA 4WSJA 2Z31B 3FT2B 1D2PA 1SUJA 1PD1A 1JJUA 2K7QA 2NXYC 5D2LF 1XD1A 2GCYB 1DVFC 2F7IA 3HNSL 3MZTA 1I3RB 4LVNC 3FFOA 4HIEB 2PNDA 4BZ1A 1B0IA 1W16A 2KBGA 3JWNG 4XGZA 3RZCD 2A38A 5DO2D 4G9FA 3ZGHA 3V0AC 2F54E 4Y2DC 2NR6D 4MNHB 1RAMA 1BQSA 3QUZA 4NQTA 4HCRA 4X5LA 2R0ZL 4U1MA 1SQ2N 4MXWH 2EVJA 1Z3GH 1OLLA 5I1DB 4WTZG 5F96L 4I85A 4ODUB 1IGJA 3FRUB 3BUDA 3LEXA 3H9YA 4OT1L 5HGGS 3IDNA 2R1XA 2VISA 2WANA 2AHIA 1OE2A 3BQUD 3MX0B 1L6ZA 3FYEB 4PLOB 4Z5RA 3VRLF 3RU8L 4ZSOA 1SOQA 3GGWA 1F11B 5MEOB 2N01B 4M6ML 3SDAD 1E9PB 3ULVE 1FF5A 3BT0A 4NUMA 3NJIA 2VABB 3H53A 3MRDB 4MCZB 1G4MA 3GRBA 1VPOH 3GJEA 1OPOA 2WZAA 1FLRL 2IG2H 2QSVA 4LF3B 4PRHB 4Q7DA 4UQCA 1F4XL 3P11L 1A21A 1IFHL 1JPFA 1N64L 2YWZA 3QDMA 4YO0B 4GRLB 4W6XB 3B2UC 1TZHA 1RUAH 2C3WA 5AOKA 5FW7A 1ZLWK 4APXB 3F5WB 4KVCL 5D72H 1JK8A 1WFNA 5D7LB 4N5ED 3FQUA 2J21A 3LRKA 1H3UA 1CXLA 2ZX6A 3O6KL 1NKRA 2IC2A 3B6SB 2GC4C 2NY4B 2YO3A 3GWJA 3OAWA 4X5WA 2BOBB 4AL8C 4JM2C 4M6NL 4X4XB 3SHSA 1KWGA 4O2EA 4KTYA 1AQKH 1Z9PA 5KVDH 4WI5A 5CJBA 2L3BA 2YARA 1D9KA 4JK0D 3VFTB 3K6SA 2R8SL 4C56D 2JWYA 2CLZA 2ZKYA 1EFXD 2ZG2A 4Y4FD 5BO0D 3JV0A 3NZUA 4LKXB 2BLFA 3H9SE 4P23C 2RGSA 3MLYL 2ZX7A 2F19L 3VI4E 4NQDA 1HINH 1NGWB 1XWVA 1IBYA 2C9PA 1MFUA 1OIOA 3I2CL 2PYEE 4AXWA 3T1FB 1IC4H 5B1CA 1OGAD 1UXWB 2J5WA 1IEHA 2X0UA 5DJ2A 3SDCD 2MJWA 4RNRB 1CFQB 4LIQL 2ADYA 2QSTA 3UC2A 2APFA 1YMHB 3LKSB 4IGBC 1QZNA 1NAMA 3T0EC 2A99A 4X5XB 5I18L 1NFDF 2WLLB 3QXWA 1JOIA 3KE0A 1G9EA 3PHOA 1VFAA 1WFJA 4FJZA 3UBXG 2QKIC 4MD4B 5GS0C 4M62L 2Z0UA 4XXDA 2CJTA 2W07A 4WY7H 4Y4KB 1KGYE 2P5WA 4YSDA 3W5MA 2EINB 4Y89A 3HG2A 1J05B 3L4TA 4G5ZL 4KK9D 4YXLH 2XC8A 1WE5A 4B50A 1YMMA 4KZDH 2A3TA 4FHKA 4MD0A 2D9CA 2GJZB 5F21B 4L37B 5I1IH 2OLDA 4YZFE 4TNFA 4WU7A 1KYDA 1LEKA 1S3KL 1JXFA 1S2EA 3E3QE 4UB0H 1MHPH 4N0CD 3LS4H 1NICA 3B7RL 3LHAA 3CH1B 3GUFA 2H3NA 2NY2B 3Q8CA 2XN9E 1MFEL 1F4WL 2XFGB 3N1FC 4U1GC 2MPAH 4UQDA 1EEQA 2AJVH 2M1KA 1A7NL 3NGBB 3QB7C 4F7MB 3IXTA 1WZAA 2E76C 3L5JA 3MI6A 5F89B 2PYFB 2K8MA 4UT6A 2WBWB 4JFFE 1QRNA 3UZVB 1U8IB 4KKAD 1UG9A 2C9UA 4PJ7E 4TNWK 5B8CA 5KVFL 5I82A 2FLBT 5FXCH 4PB9H 4LCWE 4KUZL 1FG2A 2X5PA 4DFHA 5DSCB 4HHGA 1JPST 2IADA 2ADGB 3V5DB 1NIAA 5CD5C 1AGFA 1CD1B 3EOAA 4EBQL 2NY7H 4GKZA 3BKYL 2RAMA 1PZ5B 2X1QA 4OQTH 3LKOA 5A1AA 1GZHC 4PGCA 5I23A 1WUNT 4BDVA 4L4TE 3M1BA 4OIBA 1NGQL 3X12A 1JF5A 1CL7L 1ZDSA 3MNVA 3DOIA 5IQ7L 2W65B 4LLDA 2ADFH 3SO3B 4JKPL 2DH2A 4UOW0 3QH3A 2R23A 2ZG3A 4G7RB 4DERA 1CDYA 4HIIA 5E2TL 2YC1B 5EZJA 1S7UA 3C6EA 3PQYD 4YDJA 4MMXC 3K46A 4BK4A 3MBWB 2VLKB 4G6ML 5J12B 3VWJC 2IH3A 1JVLA 4WKZB 3ULUD 2WMPB 2OCFD 1A64A 2XG4A 3JTTA 4RESB 1BBJB 2ZCKH 1NMBL 2HB0A 1QLEB 3RIKA 4D8OA 2W0FB 1A7PL 4FLOA 4WEMB 4J3BA 3VJ6B 3SPHA 5FKPB 1ORSB 3V0IA 1AP2B 3VXPB 4TQEH 3A4FA 1KN2L 2L7UA 4YN3A 4FQPA 2ZNXA 3OLIA 1AR2A 3QUXD 2MRYA 1IBBA 4FFTA 3QXUA 3KYMA 4FQXC 2RTTA 3MLSL 3NCYS 5T1KA 2I07B 3FB8A 1T5KA 2V9RA 1UA3A 4P3DB 2CKBL 1CK0L 5IM7A 2VQ1A 1MCNA 3S97C 2FX9L 1NJ9A 1ZXQA 1DFBL 1UJTA 5AW0B 1KMGA 2YHGA 4DVRH 3IFNH 5KJ4A 1G1YA 2P5PA 1MAKA 1U4FA 4OKDA 3TBCA 2TRHA 4XPHH 3QSKB 4NM8H 2A1WH 3MRHB 4IIZA 3DTXB 4HALA 5IFAH 5HVHB 1XGRB 1OP5K 1ZRUA 5EUOF 4KKNA 5F7KC 3GMLA 3LS5H 3D6GA 2WTOA 3LQMA 3T6VA 1QYGL 1EH9A 3UTQB 4ODWB 5FF6B 3TO4C 1C5DB 2EDBA 3EJSA 3O3AA 3WYRA 3DGGA 3VRJB 5KVEE 1X9QA 1NCAH 4YFEA 1XTMA 3CUPA 5ICUA 2RFXA 3QQ9D 3PUUA 3CSYA 5IWLA 4Q6IC 3HUJE 1CDJA 4H5SA 4MNQB 5IGXH 2H9GB 4KXAA 4ZDHB 3VMOA 1YJDL 1L7TH 4MJ5A 4PG2C 4BQBA 1SLUA 1UWXK 4W6YB 5FHAH 2E7CA 1SY6L 1V3KA 3VGAC 2D7NA 3MRQB 4PB9L 1RVFH 5BZDB 5BW7A 1AZCA 2CBQA 5CUSL 2BXYA 3S3JA 1HOCA 3C09C 1JWSB 1F3RB 4UDTB 4XBPB 5C08A 2EICA 1EMTH 2VQ4A 5F9AC 5IJVB 4TSBL 3I9GH 3N6YA 1I7RA 4K9EH 4LHUG 1KY7A 4AQEA 4YAQA 3I02B 2V3FA 4JZJB 5FDWA 2QLVB 2YGOA 2CR0A 2H41A 1DUZB 2YD7A 3MRFA 2KPWA 4XC1H 3KPRB 2FSEA 1NGZB 2AP2A 5HYIA 1NEZA 1YUKB 2CUIA 3II3A 3N55A 3K7UA 1IJ9A 5DD1H 5ENWA 5ABDE 3HTLX 1A7OL 4NJAH 5SV4A 3TN0D 4DGIH 3NCXA 4DNLA 4EF3A 3REVB 3TNNA 3AG2B 2UUDK 4EDXB 1N6QH 3SQBB 4GP4B 3EDEA 2R2HA 3ULUF 4OKVB 1BP3B 2KH2B 4Z9KB 5L4JA 4GQZA 3VMPA 1MWAH 1V10A 3Q7JA 4KWUA 1BFVL 3C6LC 4TVPL 3SDYH 3CFQA 3C60D 3S36X 3G9AB 3X14B 3OGCB 4PJFB 4WSGA 4JQVC 4HOXA 4RCAA 5C3LD 3QDGA 4IRSA 3RKPA 3QORC 4WW2A 4Y16B 4FL4C 5FO9B 4HKJB 3MLTB 1NC2B 3AJ7A 2APXA 2GJRA 3ABGA 3GXFA 5E6IB 2Q7YB 4W4OC 1HIML 4LAQL 5EFIA 3ZKMC 5HYSA 1PTZA 2JXMB 3KWUA 3UJIL 1P5VB 2W91A 5FCUH 4ZMQA 3TBWA 1JXGA 1Q9WB 5DUML 4OF7A 1CD8A 3UCRA 2HMID 5FS5A 1P4LB 3UAEA 3K6IA 4BBWA 4HFWB 5DLMH 3ME0A 2NY5H 2GITA 1K2DB 2BFGA 2VXVL 1RZGA 3ZGIA 3ESUF 4IBTA 4PJ8D 2FZ3A 2DYRB 3LS5L 1S7SB 3GJFK 4YNYA 5E08L 2ED7A 1UENA 3MO1B 3BIKA 4KVPA 1ZMYA 3O6LL 2DMKA 5BZZA 2AXGA 1NCDL 1QUNB 4K23H 2WNWA 3KL5A 4OJAA 4Z95H 1S9YB 1TUPA 1EWHA 4JO1H 3OAZK 1LK3H 1LP9A 2EIKB 4BWWA 4LEBA 5BOPA 2DTMH 3KW8A 1ACXA 1KPVB 4CU7A 4KMTH 3S35H 2GY7B 2YR3A 2GJ6B 2OYMA 5BV7B 1AD9A 1FFNB 2F53A 2WNKA 1SN2A 3MODH 2HFFB 1HHKB 2WXIA 2QEJA 1IGML 2PPDA 5GGSA 3BUBA 1DL7L 3FO0H 3KLKA 5EEWA 3D0LB 1BQ5A 1R3HB 5GGQH 5CCKH 1KXTA 3WNIA 5FO8A 3V4PH 3MRKB 3JVFC 3P54A 2W80C 1RIHH 4RQQA 3HC0A 1MIMH 5IB5B 2EUXA 1WIPA 3REWB 1EMTL 4JO4H 3CFDB 3SD5A 3I9GL 3H42H 3V4LA 4OBRA 2CKBA 4UBDD 5A6IA 3OXSB 2NY0D 1A6PA 6PCYA 4IDJH 2DI8A 1U8MA 3UJTH 3VM5A 4HOWA 2EUVA 4PRBB 4S1QH 2VMFA 3ZE2E 4FXGC 2YUVA 4LDOB 4R5TA 3PWPE 3UGUA 5HYFA 1BD2B 3HZMA 2DH3A 2LT9A 5E8NB 4DGIL 3H54A 1INQA 1YO4A 2D2OA 1Z32X 1ND0A 4KHTH 4QHNA 3BGFB 3FRPG 3IPEA 3MUZ1 3S7GA 4WWKA 1JGIA 2E4FA 5BUAA 5TF1L 1JZFA 3MJ7B 4S2SB 3IK2A 4N8CL 1CICB 3GHEH 2W9EH 4L8BB 2FIRT 4TXVB 3C5SB 2CXKA 4N9GB 1C5BL 4EXPX 1XH3B 2WUCL 4PI2A 3MV11 1D5MA 5DJZA 2VC2L 4Q9BA 5MI0B 1NINA 2E6QA 4EI5A 4AIXA 1SY6A 1F6FB 4OZFB 3B56A 1Z5YD 4GUQA 2BIPA 1CFVL 2LLNA 5LCVA 1IFGA 4H13C 4KPHH 5DGQA 4ZNEA 5EIIA 1HN1A 3WV0A 4U6VH 2K6YA 3S96A 2BC4A 2GK0A 4XHJC 2E75C 4HGMA 3MMEB 3WEBA 1J5IA 3QIBD 3SGEI 1RPKA 1UWFA 5JHBA 1PG7X 3IVKB 3MRLB 3QEHB 4NENA 3UTSA 2ILLA 4YFDB 1KFGA 4RGOL 1DQMH 1DQDL 3V8CA 4AVKA 3WFEH 4ACPA 1AACA 3AT9A 5F7AA 5GJTH 1G7HB 2ZSVA 4HK3N 1R47A 3CN0A 3T6XA 1FYTA 2VLKE 3D2UD 3HE7C 4QHUA 2F61A 1T04A 2HLAB 1RUMH 4P4KD 1KIQB 1LO0L 5B22A 4JR9L 4MCNA 4NN5C 3FQXB 4D2NA 1T83A 2HKAA 4H44C 1GC1H 3CN4A 3GF8A 4A2DA 2XQBL 4R96A 3DV4B 4CL7A 1C5CL 4U4BA 1ID5I 2OMZA 4U7KA 1CBVH 4L4JA 5C7XL 4QDGA 3VWKC 4PJIA 1OD9A 1OW0A 1BOYA 2X4PB 2XVBA 4KROD 4MA8H 4EXKA 1TENA 3K2UL 4NOFA 4NDMA 3DMMA 3ES6A 4RIRB 1ZA6A 1QHPA 3GEWB 1VKXB 3QVAA 2NW3A 5D1XB 2Q86A 1MVUA 2FTAA 3RVVD 5C9KA 1A6AA 3L6FB 4H8VA 3WJJA 1HTYA 2DMCA 2AAAA 1H5BA 3JYBA 5E8DH 3HLKA 1BVKB 4I2XB 2LTQB 5I1HH 5ID0B 1NM9A 1ES0A 4KTDL 3AU1A 4BSVA 1RIUH 2K6WA 3VVVA 2VAAA 3N44F 4MQSB 1H6TA 8PAZA 1KPUA 4DZ8A 1MFVA 1XBRA 1QW9A 4M4RB 1LEIA 4YJZL 4BFNA 3NN8B 4CA4A 2A5UA 5E2VH 1XXFC 1BZDA 3DROA 1M6OA 4R83A 5LAXA 1EFXB 2BINA 4CU6A 5EO9A 2J25A 3CFNA 3QAZC 3TONA 3DUUA 4B0MB 2C3VB 4LPUA 1DVZA 4QWWC 3MC0A 3CZKA 3SOBH 5TDPA 4L8CB 2VLME 5IQNA 2OCCB 4J28A 4MNQE 4V1DD 5EEUA 4UT9H 4P06A 1U3YA 3HG4A 2VLJA 2AV7B 1MH5B 4E68A 3SDCB 1QSFD 3O9WB 1P4BH 4AV5A 1NBZA 3P3UA 1J86A 5BPPA 4QJ3B 4YDNA 4G9DB 1HCZA 5GZOD 3NPSB 5HI5D 1I8UA 3D18B 3CIAA 3IXAB 2PP8A 2P7TA 4NWUL 4HJJH 2EZ0C 3QDJD 3U83A 2YMXL 5K9JL 2BMKA 1E30A 2RBLA 2WLYA 4PUBL 2MKWA 3BDYL 3GMOB 3GXTA 4R0LB 2O26U 1PLGL 3O3EB 2BZCA 4JN2A 1X7QB 3GINA 4QXWA 5DJCB 3MYJB 4U6VL 1IAKB 3ZE1B 2RA1A 5C0RH 3S5ZA 2GHWB 5C71A 1TNMA 4L4VD 5AVWB 2ZSWA 1RJLB 2WJ5A 1AXSA 3H3PH 3B7UX 4HUWA 1IM3B 1MHEA 3PWUB 1NL0H 4JY5H 4UUJA 3U9UB 4XNXH 4QOKE 4Z7QB 3FO9A 1P9MA 3ECQA 3RTQB 1AGEA 4X9HA 1L7IL 3LD8C 2IBZX 2QVMA 3T4AA 1H3WM 4AMWA 1GC1L 4EPSA 5HYJB 1ZLUH 1GIGH 3CX2A 4N2LA 2HVBA 2V3EA 3D51A 2A73A 1NM4A 1ESOA 3VFOA 3BH9A 2HN7A 3AG1B 4J8RA 4XPAH 5A2LH 3ZUNC 2BVEA 2IQ9H 4M1GH 2G9HA 3AG3B 4DN3H 1WZ1H 2WLMA 3HVDA 2G2RB 2GSMB 4GUCA 1E6OL 2B9AA 4M5ZL 1MRFL 4UIMA 3GBNL 1KTCA 4JO3L 4WEUD 3O4OB 4QTIH 3TF7C 3UG5A 1FPTL 5KSVB 2BVOA 1DSFH 1UKTA 1K9TA 3QEGL 3V0WL 2Z4QA 4JRXB 1Q94B 2XI9A 3ECBA 5B38B 5GRYA 4FNUA 2YKLH 3AT8A 4NCC2 1UB5A 2WXHA 2YAPA 1WBYB 3FQWA 4CC4C 4POYA 1DSYA 2CHXA 4FJYA 4WW2F 3FMGL 4UMGA 3UAJC 5CJQL 2JCWA 1KYOK 3IS0X 4P2QD 5CFHA 5IFHH 1ZVYA 1RQ5A 2Y6SC 3SDXA 2BS71 3KR3L 2WW8A 1NC4A 1URZA 3B7SA 4I0KA 4HX1B 2BWIA 4FCAA 1ITBB 4OCRH 5C0DA 3OJVC 4X6EB 1S7WB 3DTDA 4WV1A 3H85A 1T1WA 2EYRB 3PL6C 1PAMA 3UO1H 5CJOH 1XAKA 1XGTA 4CVXA 4FDWA 12E8L 5JUEL 3QIUA 3CE1A 3BVTA 4IEFB 4ZTPL 3HE6C 3LZOA 3Q0HA 1DANU 1P4BL 3LV3B 5HJGA 3V95A 4FQ2H 3CZFA 3K81A 3ZKND 2WXNA 2BWDA 4LCCA 4YGVB 1LP9F 4HU2A 1GGBH 1F6AA 2PABA 3AABA 4UQ9A 5KJRL 5DJDB 3MRMA 5DJXA 2FNWA 2DKUA 1QSEA 3O8XD 2H8PA 2XFXA 4OW6A 4KITB 1AFVL 4ADGA 5KBLA 3ILPB 3VFNA 2PW1A 2DB8A 2HTKC 3K74B 2TRYA 4GYBA 1I1CA 5LB1A 1TLMA 2JLLA 3FTGA 3UMTA 3LIZH 3LIUA 3VMNA 1KGIA 2K70A 2I7OA 1HDMA 4CC1A 1BEYL 4PY7B 4B53A 1R3IL 4W9HC 1HHHB 3L4VA 4UWQB 1BD2E 1PLBA 1ZGLA 3HRPA 1U0QA 4P2RD 2EIEA 2FX8H 4NNPH 4ZMTA 5B3SB 3EO9L 3GDCA 2LLGA 2ZTBA 3P02A 5BQ7A 3W37A 1RK1B 4JG9A 3CSPA 4U1JB 5TGBA 1G0XA 3GO1H 4ONFL 4ABVA 5FYLL 3V5KA 4GXFA 4GLRI 3CHRA 4HT1H 2NLJA 5C1MB 3P30L 2WY3B 1A4KA 3CK0L 4AT6B 3VXRB 4AGQA 3MRIB 4AQ8C 2ERJB 5DHMC 3QG6A 2DD8H 3N0AA 4HPHA 3AREB 4RGMC 3B1UA 4PWGA 5HY9B 3BCFA 4J3OG 4JM4H 3P4OB 3A0OA 4N2DA 3KLDA 4N28A 4YUEL 3PP3K 1E4HA 1TMCB 4QTIL 2HKHH 3SE8L 2DEXX 5JPMB 3BPLB 1OCOB 4GSRA 2VH5H 5IVXA 3SDDD 2YUXA 3KH3A 3H6JA 3LPFA 5T1JA 3WLBB 4TPRL 2QSCH 5IB1A 2X70A 3DX0A 4HV8A 2ITCB 1DBBH 3ARGD 5SWQB 2H32H 5EZOH 1X5LA 5T1MA 4X7CC 2NYYD 3IDYB 5K39A 1XSIA 1XF3A 1MW0A 2BDNL 1KCUL 2WSPA 4OLXH 4ES8A 4JHVA 2FEDD 1KJVB 1AC6A 4OCRL 4ZZFA 3DWTA 4GIPD 1UURA 4X7FC 1AQ8A 2YGQA 4QRPD 1G0YR 5C2BH 1H15B 2BXZA 3KHOA 3FCBA 2Y7MA 3RZCC 4MAZA 5DO2C 3NZ8A 5TH2B 1J1PL 1PYWA 3KJ6H 4OUUA 1T0PB 5FFGA 3ROOB 1TDQA 4K3GA 2FJFA 3PWVA 2NR6C 2OZ4H 1EDQA 1TU2B 2IAMB 3BPNC 1BZ9A 4NKMB 4B5ZA 3AMLA 4DJMA 3JWDH 3KNBB 1LDSA 5D1XE 1J88A 5AYUL 2HT3D 4ZO9A 4ZMVA 2VDRB 2O5XL 3O4LA 1KZYA 4LEXL 5IV2B 1FN4B 3KD4A 2ZUWA 4WO4D 2PWGA 4FABL 1YY8B 2R69A 1O9ZA 2WXJA 4HIJA 2VZUA 5I5RA 4OCWH 3BQUC 3PWJA 2XWCA 1UQSA 3BAXA 2MCMA 2O6FA 4NXKA 4LFHG 4ZS6D 1PW3A 1HQ4B 5TE6H 3OPZL 2N4IA 3INUL 1CLVA 1DO6A 3SDAC 3B9KD 2F2HA 2A9MH 3NRPA 4UTBL 3APDA 3CVBA 4G8IB 3UX9B 5C6TL 2DM7A 1QQDB 4JHBA 4FNLL 1DBJH 3FB6A 4Z7OF 4NRYA 2DQDL 5C0BA 4CSTA 1A2YB 2FX8L 4NNPL 3O45B 3FUMA 1EZUA 5KEZA 4JMNA 2EDQA 3KWVA 4MMYA 1NCTA 5H37H 4UZSA 3KGSA 2VQTA 3FT3B 2EJ1A 3KGTA 4N5UA 1BJ1J 4FN0A 1W0VA 1I8KA 4X99A 1X4YA 4N5EC 3V0VB 2OTWB 1GSKA 3F6JA 3WNJA 1G1CA 2BJMH 4MXVE 4R3SA 4QAWA 4LPXA 3HMXH 3TA3B 1RUPH 2XPGA 4BUGA 5EZLB 3QQDA 5DLLA 3V5HA 1FORH 4MASA 3V6BR 2E6JA 4R5XA 4GKNA 2HKHL 2IBBA 4Y4FC 1BMZA 4OVVA 2ZIDA 5E8PB 4LPWA 5T5FL 4YK4B 4AIEA 1A65A 1JF1B 5I73C 4NT6A 3ZR5A 4NQSA 4P5MB 5I8OL 4Y4HA 1ICTA 4S0HA 3NCWA 4GO8A 3FU6A 4I48B 5ACZA 3QUML 4Z7QE 1HEZA 2V2XA 2XVGA 1HSBA 1VFUA 2XBDA 4XMKL 1HT6A 4NGHL 4RETB 3VI3F 1DVSA 1FNEB 5EWIL 4YH6A 3RURA 2XWBB 3ZL1A 2X9XA 1U8LA 2MMXA 3QI9B 5HYJE 4BZ1H 4OLXL 4NUJB 2O5ZH 1U92B 5AOJA 1BM3H 2EEBA 3CFBA 3ISWA 3KMDA 3HW7A 1ETA1 3HFML 3K4ZA 5A16B 5TDOA 4KK9C 5C2BL 1F3JB 4WEBL 2V5TA 1ZEAH 2R0WH 4JFOA 4JZOB 4EUPA 1J5HA 1CDUA 4X4KA 1QACA 1LO4H 4YDLC 5D1QD 5F1IA 1NOLA 5ALBH 1GL4B 5D8JL 4N0CC 1RK0B 2F54A 1T7XA 3HG1E 1OP3H 3WIHA 3I6KA 5CIPB 2X4SA 5JTWA 1D5ZB 2UXVA 3B2VL 3SKNA 3V4UH 1X7SA 3GHPA 5EOCJ 3AQZA 5KSUA 2CDEA 1EANA 5KYUA 3L5WA 4RMQA 2XPZA 5JLZA 4FCHA 4MCYA 3VD9A 1PGRB 2YA1A 4YSRA 1WWAX 1S46A 2E9WA 3O6FD 2WXRA 4N2MA 1WDAA 3WXVL 1B2WL 4U3CA 1QLRB 4JS7A 5I1EH 1QPKA 4KKAC 3O2DH 4KI1A 3KYAA 3KPLA 4YHYC 3F7VA 4RRPM 3SBRA 1L9QA 3P9LA 1NDTA 2DQUL 4X4YA 3L9YA 1KZQA 4M7JH 4AYEC 4ELMB 3BUIA 1YPZB 2XZQH 1IKOP 3JWOC 2VW7A 4EIZC 5IMOB 1R24B 1WLHA 5GISH 1OE3A 1JP5A 1U3HB 4IU2A 4L1SA 5IR1A 2LAGB 2V7NA 4V33A 4LE8A 1I1FB 1JRHI 1JZGA 3V9FA 3F64A 3Q43A 1HSAB 3KLHD 3P0VL 3T4YB 5EBMA 1R3LA 4ANUA 4JFSA 4F9PA 5GGRB 3KVQA 1MUJB 5KWYC 4MAYB 4FQLL 5I8EB 3HS8A 3HN8A 1OTSD 3M7OA 1IEBB 4M5SA 3VU1A 3P2TA 3AXLB 4FFYL 4Y1AA 5TD4A 4QY8A 4E5XA 1AE6H 3ZQXA 3ULUC 4M5YH 3OMNB 4EI0A 5HBBA 1OALA 3N40P 4Z78B 5AENA 2V9QA 3TVMD 4Y5YA 3AY4C 1MW1A 3DX9A 4PRPB 2CSPA 1FFOB 1IE4A 1KCRL 2BY3A 3FU7A 4TUJA 5B1JA 2OPCA 3H9SA 3QJQB 4ZFZA 4HUKB 3OAYH 4F1SA 3KDMB 4R90H 1YYML 2GIYA 4EN2A 3T77B 3GMPB 4YDVA 3EJJX 5DQ9A 2PYEA 5T1LD 3V6OE 1Q90A 1KB9J 2CNZA 3WUWB 4Q0XL 2XV3A 1VZGA 3O3DB 4P9ML 2GBTA 3RKDD 3QUXC 1EXHA 1G6RB 4JUTA 4V1DB 1WWBX 2ED6A 4GNKB 1AOZA 4UTBA 3RJOA 2YEZB 1NPJA 2Z93B 2O6DA 1XCTA 4G6FD 4TLSA 4YEEA 4XWOD 4OZHB 1Y1UA 3DSFL 3VXRE 3VB9A 4FZEH 3MV7D 4HIXH 5INDB 3TF4A 2DBLL 2IPKA 3GNML 3FSVA 5HJBA 3DHJA 3ARWA 3BUPA 4Q8BA 1I9RL 4LMQE 5EBLA 3E0GA 4OUOA 2VE6A 3B37A 5ALBL 1D6VL 5CWSA 3KL0A 4IRJB 5GS1A 5AZ2L 2Y7SA 1FL5B 1OM3H 4WJ5A 2YSSA 2YAQA 3KLQA 2I32A 4L4VB 4RSYA 4XO8A 5AVYB 3NIGF 3TFKD 2V9UA 1PY0A 3QQ9C 1G7JB 3IU4H 2PO6C 4R4BA 5MEPA 1EJFA 3MLPA 1ZHLA 3CTTA 5IB2A 2V17H 1XFPA 2CDGB 5I1AB 1YC7A 3VTMA 5T5FA 2I25N 2IH9A 2B08A 3GTTA 2CRZA 4NBZB 2MCAA 5I1EL 1QA9A 4PJDB 5DRWA 5AZEL 5I6LA 4PJ7A 4YC2C 3O2DL 5AVSB 5T3XE 3SODB 2G9KA 1I1AB 3II2A 4OIAA 3CIQA 4LCWA 5IVXF 3SKMA 3UYPA 1Z1WA 3RFRA 2YFNA 2XA8L 4GPVA 2A83A 3MGTB 4LGSB 1DJGA 1EO7A 1PZDA 3P0YL 3QUMA 4PBWD 4PGBA 4E42B 4M93C 3L3KA 5EBWA 2CK0H 4GMSH 4R7DA 4PIRF 2ZXBA 5T33L 2W0LA 1DVXA 3MA7A 4RMUA 4WKXA 2F18A 4APQD 1NLDL 1VRSA 5AD0B 4LLMA 3FOMB 4FTVD 2L7QA 1FIGL 3BAWA 3CZGA 3K71A 3U4EB 1HZHH 3ILQD 5CU5A 3ZYIA 5D96B 3PJNA 4DH2A 3TN0C 2E7BA 4XAKD 2CLRA 1O5DT 3L48A 4ZMAT 5IHZB 1SJHA 3HG5A 1J0IA 2FJHB 3SCMA 1TTAA 1U8JA 4AJWA 1ZLSL 3KYOB 1TJGH 4IOFD 5DDHA 4TTGA 4TUKL 3TV3L 3HNVH 1FRGH 4CW1A 4XNZC 4ZQKB 4P2QB 1UM5H 5SX5K 3C60C 2XWZA 5SWSD 4X7DC 3LEYL 4G8GB 5EZPA 4PQXA 4PREB 3PXJA 3U2JA 2YUWA 4KY1H 1U2YA 4ZAKA 3O3BB 1MCBA 1GY1A 3QUYB 1HWWA 1IM9B 3CDGA 5KW9H 5LDSA 5DTFB 2GJPA 5A2CA 1ZJAA 4K2UL 2X41A 3TPUA 1MHCB 5DMIH 5CF3A 1R3JB 1U8KB 3RUGA 1RZQA 3ARXA 1YQVL 3WGUB 2HMIC 4FZEL 4G8EB 2VMEA 5MHSD 2WXGA 4ODTL 2R0LL 3EZJB 1BOGB 5E5LA 4HOZA 4OF6A 3PHQB 1PKQE 4HEPG 1S9WA 4PJ8C 3DVFA 3D85D 3DIVA 1AQDB 4GRWE 2CIKA 4L1BA 3M7FB 3O8XB 3E8VA 3UABA 5DD5H 5JHDA 4FRWA 5I8KL 5EC2B 4O9HH 1COBA 5B38G 2G60H 1FHNA 3HI5H 5KS9B 4B3EA 2P48B 2X4UA 3N41F 3FZUD 3IU4L 2CH8A 2GKIA 5HHVL 4FFYA 2BVUA 4NQCB 1KV3A 4LMQI 1AZVA 4UV7L 1UHVA 2BSED 1GGIH 2BNUB 3N91A 5CEYA 4P5KA 2Q1EA 1WCBB 1D2OA 1HU8A 1JD7A 5C0AB 2J3SA 5JHLA 4I89A 2HJFB 1R3KB 2O4EA 5B3JF 3AWGA 1NCGA 3M1CA 4AC4A 2EE9A 3QUGA 5I9QB 1BZ7B 3QRLA 1YUHB 1KIPB 3G5ZB 5DC0A 3J07A 1RJYB 1XV8A 2D31B 4K3HA 2D3NA 4GXUN 1DQLL 3HS0A 4AM0Q 1JUFA 5FGCE 2OMUA 3NESA 3F83A 1JGVH 1TQVA 3QJTB 4W9JC 2DTSA 1BPLB 3IEAA 4J7RA 5HGAB 1R5IA 1FYHB 2R27A 4W1TA 2KZBA 1RPUA 2UY7B 4H1LA 3FCSA 4UBDC 5F0JB 1G1OA 1KBGH 4IHOA 2NY0C 1MZYA 4WAFA 1A0QH 1UJ3C 3ZDXE 2IJ0C 4LCIL 1XB8A 5DQDL 1UB6A 2YAHA 1ZIBA 4KO6A 3BGMA 3EO1B 3KYKL 1HZHL 4AMKH 1B6DA 2X0WA 5D70H 2WLIB 3DVIA 3IAQA 5I1DA 4D3CL 4R26H 3K6DA 2VITA 4XP5H 2X6BA 2WYHA 4MTMA 2FL5A 4RRPA 3DV6B 3PF2A 4NPJA 2EC9T 1BVNT 3BWAA 3CFCH 1FSKC 1QKZH 3WEXA 1HEJC 2CGZA 4X7SL 43CAA 3CFJA 1DLFL 4Y1TA 1WGVA 1JTTA 5GRJH 5JXEA 3T3PF 3M46A 5J89A 4UM9A 1WZMA 2CBTA 4P59H 4WHTA 3UACA 5B7MA 5I15H 3JTBA 3W39B 1T7ZA 1CMOA 4KK6D 2ESVA 5A2BA 1YPZE 5ITFB 5AKSA 2DI7A 3S5LA 3FU8A 3CFKB 1VGEL 4HIHA 5EG6C 4XC3H 1UD5A 4NUGL 4BKLB 3CXHK 4YE4H 2V3DA 3JBG7 3ETBF 1F1DA 3HJEA 5DS1A 5GSVB 3QIBC 3MUGB 2X53A 4L1TA 5EU6B 3BI9X 3BLKA 4QMEA 2BOCB 2YPLA 1BIIA 3CNKA 4NN7B 5C09B 4BFIB 1TETL 4XB3A 7PAZA 1NH6A 2A74A 1WSST 4WUUD 4Q9CA 2IF7A 3C8KA 1VB9A 2ICEC 3KPSA 2APBA 2YAEA 3FFDB 1KEGL 2WO2B 4M1DH 2P3YA 1PCXA 4KXDA 3F65A 4NO0D 5PCYA 4WUKH 1F8TH 2AEOA 4P4KC 3RG1C 1PDKB 4O00A 4NKDA 4PW3A 2VRAA 2OTUA 1SYVB 4D9RD 4EN3A 3FH7A 5BVJB 4CILA 2FHBA 3BKMH 2IOMA 3QCUH 5EN2A 5L7XL 2NX5E 4O9HL 4PRPE 2B1HH 3PDGA 1FIEA 1WHPA 4XPTL 1YEWA 3UEZA 4GI6A 5IKCB 3BP5B 5BO1L 4HZAA 4YZWA 4DUWA 3RDTA 1G84A 4N2IA 1UWEH 3ARBA 4X9GA 2PPCA 2LHAA 4KNSA 3SGDH 5GGVH 1RZIA 4KROC 5B39G 1JS4A 4Y5VC 1UXWA 2HJLB 2W9DL 3MBEB 4NUQA 2WZ5A 6TAAA 3NYKA 4O02H 5F9DC 2AJSH 1A4JA 2I5YH 5EUKA 4K7FB 1YDPA 3W9DA 3MROA 4XZUB 3CLWA 5BQDA 1MFNA 4Y19A 3VFPA 2CLVA 3RVVC 3WFHA 1V8HA 2P9RA 4NO5B 3ARPA 4GG6E 4OZHE 4IK6A 3TIEA 5I30H 2YEQA 2ZKMX 4QRBA 1G7IB 1A6UL 5HTSA 2VDQH 2Z1PA 3ZDYB 5IP4A 3VDBA 1TYJA 4KAQL 5E6RB 2NSXA 3ARUA 4A6YH 4NCC1 4W68A 4W9GC 2ZUQC 1Z7JA 2WXPA 2V2WB 4LLUB 4M7ZC 3P73A 4ZUTA 2WYIA 1MQ8A 1A0QL 2Y1AA 4P5TA 2EDTA 5JOPE 3OKLA 1HXYA 1UYWH 3CDZB 1T2QL 3CH1A 4HIQA 1EHLL 3PWPA 1OWWA 4JBSA 3V6FB 4MYWB 3DX3A 4JFEA 2IWEA 1OAXH 1RZJL 3Q44A 1M56B 3A24A 1U8OA 1FFTB 5EIQA 4PV8B 1TO5A 5L4MA 1K8DB 3NK3A 4OSUL 2AEQL 1ZHBA 4MZRA 5F1SA 3PGCB 4K3DL 2V5MA 3THML 4IOSA 4KO5A 4JHWL 1QKZL 2ARWA 3EYFA 1BYOA 1EAQA 2I60H 2UWEA 3BYTA 4Z7UF 3ZPDA 5F1NA 2NW2B 3SZKC 5HI5C 4B7IA 3Q06A 1SGKA 2GBVA 2ROYA 2XG5A 1N67A 4UQAA 4OTXH 4XX5A 3JYCA 3ZKQD 4LP8A 1HYSD 4CSZA 5K1JA 4XAWH 4XP4H 3BP7A 4LEEA 3D1MC 4G8FB 2KKQA 1ORQB 2WZ6A 5JDSB 4DN4H 4DK5A 3GS0A 2YD0A 3HN3A 2ZD0A 1MCCA 3UC0H 5BJTB 3W0WB 4L8SB 4YE4L 2DN7A 3QEUA 3C5XA 4FERA 3N50A 3OB0H 1MCPH 3WS6A 1WZKA 2XIDA 1WIUA 3OQRA 3OM3B 3FT1A 1RI8A 4XCNA 3GMMA 5K9KB 3WTYA 2BRRL 2FR4B 4IRZH 2IOOA 3NRFA 5J1SC 1N0XH 2WWOA 4M1DL 1FNGB 4Z3GA 5BXFB 4EZKA 5BRZE 2AQ1A 3BX7C 3HRZA 1P4UA 3PWLA 4G2AA 4JPVH 4P46A 1SZNA 1F8TL 2VLKA 4A7VA 1XEDA 2EYTB 4KXZH 3O6FB 1JPEA 1MELA 4PJEE 1Z9MA 4N1EA 5HDRA 3VXOB 4YXKH 4ODXB 2X4QA 4J4PA 3QFJB 4G9FD 3FPXA 3WENA 3LH2L 5MERA 1B0RB 3R0MA 3ARFB 4I18A 3BHBB 3N42B 4JNXA 2APSA 3E8UL 4Z77A 4IBLT 3SPCA 4P57A 4LLYA 1JNLH 4NC2B 4PLJD 5T1DH 4G8GE 1X5XA 3PNWB 5J6GB 3MRNA 2WP3O 4NXSA 1F56A 4ZUWB 4G6JH 1I8LA 2BVQA 4O02L 2AJYH 2HLEB 3FQ2A 4QKXB 3BZ4B 3QFGA 3BWZA 1SOXA 5JO5A 5E6SB 2DWTA 3CQQA 4NQEB 4PW9A 4UTCA 3RGVD 1UH4A 3ROLB 1Z9SB 2HRPH 1KCVL 4A2LA 3IU3B 1SMOA 2DKSA 4XNUH 3GUTB 2IV9A 2FATH 3GSXB 3EF7A 2Z6FA 5KSAB 3P9MA 3IJEB 3NIDB 3OHXA 4FE9A 4RGND 2XXGA 3FQTA 3QHFH 3HR6A 3QPQD 3U79A 2F7OA 1F18A 2O6CA 3PFQA 4KTEL 4FQ1L 3RWIB 1OVZA 3RUGF 4S1RH 4IOIA 3BISA 2KI6A 1ONQA 3K4AA 3BP6B 4WDIA 1UXMA 4BFRA 2IAND 4NP4H 2HVKA 1XF4B 4NHCH 4O58H 2BM3A 3G04B 1NGXB 2NXZD 4FQHA 5E1IA 2I60L 2FGWH 5C0AE 5CZRA 4B0MM 4XP1H 4GKSA 5AUMB 4BQ8A 1D9KD 1DR9A 4NWTL 3DUHA 3ZKNC 4JN1L 1R34A 1RZ8B 4C4BA 1ZT7A 4ZFOA 1ZVNA 3BH8B 1RUKL 2RR3A 3GTNA 3I3DA 3D25B 4QRUB 2OR8A 3U30C 3IT8D 4NQDD 1QP1A 4M48L 1BZ8A 4YFLF 3QXTA 4DN4L 1NUNB 1JWSA 1CFBA 1OB0A 1I3GH 4J8QA 4H0GA 3H4HA 4H25A 4LOUD 3S35X 2R59A 1VF5C 5F1KC 1FZJB 2WBJA 4PR5A 1MI5A 2XWTB 1Q9OB 4Y7OC 2J1YA 5MEQB 3MLZL 4YHOL 3O41B 3EH3B 3RBSA 3NG5A 2YQ2A 3BMVA 4JLRA 2CRYA 4E9TA 4X8JB 5CN3A 3ECWA 4QOKA 3D50A 1INDH 2RH0A 2VM4A 2ZXCA 4EI6B 3QDHA 2Y07H 2ZCLH 3KPQB 4GXVL 4AI7A 1H19A 4OKVA 5M94B 4OF3A 1NFIA 5IIEB 5AL8A 4LNRB 4Z7VA 1JHKH 4PVBA 5I75B 1JXDA 4LHQB 2D7MA 1E4XL 3F6LA 2VW4A 2DQFA 2ZXAA 3X14A 3D69A 5J5EA 3GZKA 4JDVA 2X87A 2ZWKA 3MV9D 5I6NA 1BLNB 5LAPA 3PJLA 1W0WA 4P2OB 5D2LB 4RWHA 4OJFL 1AD0B 1UWYA 1O6SB 3CHOA 3DOSA 5ILTH 1NC2A 1NAKL 4B9CA 1SHSA 2J6EH 2NY6C 3TBVA 1VSCA 3SDDC 4GAJH 4BCXA 2YFOA 5ERWB 2OS7A 3L3IB 1CBJA 1GR7A 4HJUA 5C09E 1O75A 1FE8H 1PMYA 2IV8A 2FLMA 2OJEB 5JR1H 5JXAL 1VFBB 3US1A 1JPSH 2WIIB 3GLEA 1ED3A 1IGYA 3ARGC 3HEIB 3Q1EA 4U0RC 1LQSR 2FQDA 4DK6A 1E6JL 3KH4A 2Q76A 4KQ4H 5DS8B 5ADOH 2NYYC 3C6SA 4G7SB 1EDHA 2OMYB 1TQSA 5HDLA 1QVOA 3L9RA 1T0MB 4Z3FA 1AHWB 1EQWA 3F01A 3RA7L 5C9JA 3NJGA 2FEDC 4QXGH 4WZ9A 2HP4A 3VFMB 4P49A 5HGDB 3EGSA 1T0NA 2XACC 2OYKA 4K9EC 4P04A 3UO8B 2K8QA 3GQFA 4GJTB 2EE0A 1GXEA 3MR9A 4PVNA 3TX4A 5HHPA 4U1HA 4MJID 2CUMA 2AJUH 3K72A 4WGWB 1GS6X 5GRUL 4FYQA 2HRLA 2DQCH 1SM3L 3QXAA 4RFEB 4JFWA 4XH2B 4XXWA 3EBHA 2EDMA 1LDPH 2HT3C 3ZRSA 3MNMA 4JFXB 1U95B 1HESA 3T04D 3RDJA 1T1ZA 2P5ED 3BRGC 1FP5A 4UAOC 1KULA 4PMEA 4WO4C 1AC0A 2VN7A 3ZDYE 3HJ0A 1F00I 4NKIH 1CF8H 1XF1A 1J9SA 4MZ3A 1LWRA 5ID1B 2B9BA 1E9QB 4P3CL 1E5UI 1QFUH 1TVHA 3C75A 1MFAH 1OQOA 2CRMA 3N1GC 4ZS6C 4JANA 3B9KC 2C3XA 2COVD 4AEEA 1CD9B 1KCBA 2R56L 3G5YA 4HG4J 2ZWZA 3EJYD 2AJZA 4Z0XB 1M1XA 1NZRA 4NZUH 1J8HD 2ZJSH 4DFIA 3HZVA 3WN5A 1L5GA 4Y2OB 5DZJA 3NFSH 4R7VA 5SWZA 1NCOA 4K94H 1ZKAA 3KCPB 5CGYD 3R19A 1MN4A 2IDSA 3MLXL 2X4NA 1CDHA 1BBDH 2Z8SA 2Q8AL 5JPNC 2VDML 3JZYA 2W59A 4XP6H 1CYXA 1WG3A 1BPVA 3MJ6A 3MREA 1W2KT 2XRAL 4YMPA 5C0CB 2XN2A 4BK8A 3IGLA 4XO5A 3RZWA 1JCVA 4JCWA 5DMJB 1NFDB 5I0ZA 5B3NA 2GTZB 5EOTB 1S9XA 3BSZL 3RWJB 5H2BA 1WGOA 4LLQA 3GTVA 3AT0A 3QHTC 3GSQB 4HKXA 1CFNB 2UX7A 2XSKA 3ZTJH 1NLBH 5CEXB 3BC9A 3OMAB 3G08B 3W0WE 5KVMC 3QO1B 2D3VA 1A9EB 2UWEF 5E4EB 2J20A 5E94B 1X4ZA 2E7LC 3OMZA 2X9WA 1WFTA 4P07A 5CNHA 5JR1L 4EZJA 2PWDA 5F0LB 5T3ZE 1CVSC 4PV9B 1M71A 3QRGL 2J8OA 1KLGA 2CIIB 3GSWA 4PTTA 1YVLA 3RPKA 3HZKB 5DZLA 5A7EA 5CN1A 3QWOA 5C08D 3VA2C 3IPFA 43C9A 1PY4A 2E59A 2EH8L 2YRPA 3DURA 3SY0B 3HKZA 3SGKA 1X5AA 2Y1YA 3Q3GA 4QR7A 1TKWA 3QFJE 4FD0A 5AW2B 5DMKA 3DX7A 5TFSH 5DRZA 1CGSH 1JNNL 3QZWB 4E41D 3SPVB 3VXUB 1AZRA 3NIFE 4PJ6A 1BV8A 2JELH 1Z0MA 3MHZA 1SFHA 3AW5A 1DJXA 4I4WB 4YL4A 4Z7WB 5D1QC 4HZ1A 5LWYL 1LILA 1ZV2A 3B9AA 1YHPA 3U0WL 3MRRA 3GSRB 4J3TA 1JHTA 4N8VG 4FG6D 5DWPA 3VX0A 4MNGE 1CQYA 4KBPA 1VKXA 35C8H 3C5ZB 2PCFB 3MKKA 3NTCL 5KUMA 4HS6B 1MAMH 1A6TB 2EH7H 3P4MA 3RAJH 4R84A 3TCLB 3VH8A 4NQEE 3N1QC 1GOHA 2CQVA 4D9QD 4GBXA 1AR1D 4H8WL 4J6RL 1ZIAA 3FTYA 4GEIA 3ZKXC 4JGMA 4BRVA 2EC8A 4CMHB 4F15C 1QI5A 5A2AA 2F5BL 1BVLA 1T3FB 2BNRB 3QWRA 5CMAA 3UTTD 4QJ5B 3OLDA 1N6UA 1WICA 2QADC 2DWEA 5LBGA 1QR4A 4BWTA 3Q8AA 1JXKA 3MJ9H 1H8LA 2QZ5A 4JE4B 1HCVA 2Z1KA 1NMAH 5HHNA 3AS2A 3CVHB 3TEWA 3QIWB 1OF0A 3HAEH 4MMZB 3QQ4B 2WXLA 4WU5B 5FK9A 4HKZB 4UILL 1P7KB 4ZXBC 1ZWIB 4HK3J 1X9LA 4R8WH 1J0KA 1IUZA 1EGJL 2QMKA 3N40F 3BDXA 1MVFA 3QULA 5CD3B 3U36A 2QMJA 1S5HB 2DMGA 4OAWA 4AM0A 4B3VA 1N7MH 1OTSC 1UOVA 4F92B 4AGPA 3JTSB 3TJEH 5AB0A 2Y69B 4ZTOH 3QWQB 3GT6A 1GC1C 4JFDB 1YYLH 4O5LH 3VXMD 4EEEA 2Y1VA 1CTOA 5I1KL 3TTYA 1BQRA 3TVMC 4A39A 4IMLA 1Q9LA 2WXOA 3MYJA 5DHVH 2F53D 4G7YL 5D7JB 2VN6A 3L13A 4HA1A 4PJGB 5JW3L 1P7BA 3GD1C 4HP5A 5INCB 2B59B 3V4VB 4FAAB 2D0GA 3LPOA 4OB5L 3EYUH 3SJVA 3K5SA 1WA0X 5G55A 2CRIA 3EH2A 3TBTA 3RKDC 4LESA 5CBAA 1U93A 2Y06H 3RFZB 3DARA 4AYFA 4PJAF 5CR8A 4PH8A 4XBGB 2AK4E 3DO7B 1HOEA 1PY9A 2DL2A 4JPQA 3FFCB 4UT7H 5HDWA 2VDPL 4KDTC 2EDLA 4XWOC 5EPMB 5J6SA 4PJCA 1H8SA 4I3RL 1N3NB 3E38A 3EO0A 2JELL 3I3BA 3P9WB 4XVJH 4XMWA 4JKLA 4D0DA 1SDDB 1W91A 5I6XB 1L0YA 5D2LE 2I9TB 2BSTA 3BVWA 3ECVA 4PP1D 3S37H 2FX7H 4DO4A 2YK1H 1E65A 3HG1A 2UZIH 1T5XB 1P7HL 3OAUL 5I28A 1A1NB 4BYHA 4FC3E 3TFKC 3QJRB 4TVUA 2DQHH 2NTSP 1P69B 5TE4H 3BSZA 1VACA 2CAKA 4JZNA 3OKYA 3FTVA 1JGEB 1R4XA 4MA1B 1VGKB 3SE9H 2XUWA 3LQAH 1P7QD 4F57H 3DI2B 1DCLA 4PRIE 2QHRH 3ULVH 3D34A 1OSPH 1WBZA 2FJGA 1YAZA 4GSUA 1ZTXE 3I6LE 3E80A 4ZO7A 1P4IH 3VDCA 5L4FA 1BYPA 2KUTA 1N18A 4XGZB 5A7BA 5TQ2H 1R46A 4G9FB 3EH1A 3VRLE 2B3IA 1YSOA 4HJ0D 3QWNA 2DQEH 3QUZB 4GW4A 2JKNA 4U1MB 4JO2L 1ZK5A 4GI9A 1HL5A