1A66A

Solution nmr structure of the core nfatc1/dna complex, 18 structures
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
178
structure length
178
Chain Sequence
MKDWQLPSHSGPYELRIEVQPKSHHRARYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*CP*GP*AP*GP*GP*AP*AP*AP*AP*TP*TP*G)-3')
publication title Solution structure of the core NFATC1/DNA complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 15
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 1998-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00554 RHD_DNA_bind Rel homology DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.340 Mainly Beta Sandwich Immunoglobulin-like Rel homology domain (RHD), DNA-binding domain 1a66A00
1A02N 1LEIB 1P7HL 2I9TB 2RAMA 1VKXA 1SVCP 1NFAA 1OOAA 2V2TA 2O61A 1GJIA 2AS5M 1IMHC 1BVOA 1LE5B 1A3QA 1LE9B 1LEIA 1RAMA 1IKNA 1NFIA 3DO7B 3GUTB 2I9TA 1UURA 3QRFM 1OWRM 1UUSA 2O93L 1LE5A 1LE9A 1VKXB 1PZUB 1S9KC 2V2TB 3DO7A 3GUTA 2O61B 1A66A 1NFKA
chains in the Genus database with same CATH superfamily
4XNDA 2ZX9A 3QQXA 4XB3A 4FFWC 1B0GB 1S7RB 5IQOA 4F80A 4A6YA 3V0EA 3NJHA 4KHXL 1T03L 2QHRL 2ESVA 3DPBB 3ARBB 3Q01A 3BWUC 3DJSA 3W2DH 2Z1PA 3GBNH 2FHCA 1QW9A 4Z23A 1OPGL 1ADQA 1NM9A 1UD4A 2XKSA 4ZUVB 1MI5B 4HH9B 4GW5A 4FL4B 5BOZG 1A2YB 1QSFB 2QGBA 3GT6A 3EDFA 5IMOA 3ZJAA 3LPWA 4KXBA 1T83A 4OLWH 3VMPA 2FT6A 3IS1X 3ARRA 4HLZG 3CK0L 4X5XB 1BVKB 4GOSA 2YFOA 4QRAA 2J6WA 2XPGB 3WELA 1BIIA 4A39A 4U3SA 1JK9A 4OF7A 4QHKJ 4XWOC 4MJ6B 4ZSOE 4XB7A 3DXAB 1XGRB 4JO5A 1LNUB 4NP9A 1RK1B 4F9LA 2IBZX 4TPRL 2XY2A 3Q5YA 1ZGLP 5D7KE 2EXTA 1VCAA 1MG2C 2DLFH 1O7VA 4HLJA 1KY7A 4MA1C 1H9VA 3TJHD 2IWFA 1X6LA 4EAEA 3APFA 1MHPH 1PG7X 1Q0XL 1XCQA 4KY1H 4KVCL 4W70A 4KOBA 2IFFL 2Q76A 2NTFB 2OL3B 1JDAA 1OLZA 1YYLL 1ZHBB 4J3WA 4OJFH 5KVEH 2J4WL 4UQDA 4I0PD 4GRWE 1T1ZB 2G60L 3EH5B 1P7QB 4Q6IB 4LRNL 4QTHA 4XB8A 4G2AA 2Y7LA 2ZOWA 2CIIB 1D5IH 4U6HB 1WBXA 2HT2C 3RJQB 1UWGL 4ODVL 1M2OA 2X42A 3ZPDA 4TTGA 5FGSA 1DEEB 2R9HC 5INCA 4X8JA 3GTVA 4H4NA 4F8TA 5DQ9B 1D7BA 1W9XA 5BZXA 4F8LA 1HZLA 4U1HB 1ODAA 4TOYL 3REWB 2M2DA 3UPCA 2A38A 3NA4A 1F45A 4KHXH 2QHRH 1T03H 4LCVA 1G5GA 1TQTA 1JF6A 3CFKB 4KKLC 1NGQL 2YPVL 4Q56A 1S5HA 2RMNA 3I9PA 4R3SA 1GA2A 4OV6F 3ZKQD 1CE6B 5CD3B 3T0EB 1CL7H 4I7ZC 2D31A 4XOAA 3SKNB 3SZKC 4ZTPH 1HOCB 4Y9EA 2NZ9C 4UNVA 4PJGF 5CEZL 2KI6A 3V6FB 4F2MB 5F9OL 3VXPA 4IHBA 3X2QB 3EYQC 3CK0H 4W9IC 3GMOA 3LIZL 5IOPB 4YWGL 2JK5A 4U1JB 4I9WD 5F7AA 4BFIA 2ADGB 4OIAA 1UGNA 3DRQB 3QIUC 5IJDC 3OQRA 3FFCA 3VI3E 5IIEA 4EDXB 4WV1B 5K9QI 1OGSA 3DX9B 1H3WM 4JFEA 2VH5L 3TNMB 4YDLC 4TPRH 1TENA 5BV7C 4EI0A 2FX8L 1QRNB 4HIXL 3U6XS 3O11B 3II3A 2EVHA 3VVWA 5FUZH 5AOJA 2R1XB 4K3GA 1CZ8L 1Q0XH 4MAYB 5CCHE 4MS6A 4KVCH 3L95A 2J12B 3QIUA 4LPXA 3AG3B 2H8PA 2IFFH 4JY5L 3SKUD 2YBRA 1YYLH 5HJDA 3I50L 3BDXA 2QDWA 2J4WH 3W11C 2G60H 3AS2A 4PJXF 5SV3A 3O45A 3B7SA 4JB9L 1UWGH 4ODVH 4XVUC 2YPLE 5AKVA 3BOVA 1M2VB 3RDTC 4K3EL 1N8OE 4G8GE 1XGZA 3OWEA 2DW5A 2NY3D 4LLQB 1I85C 3ZGIA 2GJ6D 4A2DA 4TOYH 3CH8A 4O2EA 4J6RL 5AW9B 3EADA 1NKOA 2NX5B 5IHWA 4LLMB 2FX7L 2VM4A 3HLKA 1NGQH 4Y9GA 5DD6B 3CDGB 2YD4A 2HLEB 1XZ0B 4PTUA 5DD0H 2JF1A 2DMHA 3QS3A 2GB2A 4U1NA 1IE4A 5JOFA 3EFFA 4HJGB 3TBWB 3UAJD 4L3EB 3TURA 1MXGA 1SVBA 3T1FB 5KG9A 5CEZH 4OFYA 1EWHA 4L8DA 5F9OH 1I1FA 2DYPD 3HC2A 4HGKC 3VG9B 3ETTA 2ID5A 3RZCD 1I1CA 4ZXBD 3KYAA 3LIZH 3NH7L 5FA4B 4GW4B 4YWGH 4A2MA 1I7TB 1Q9LA 1Z5LB 1JJUA 2H6OA 2KERA 3DX6B 3ZL2A 2WW8A 5MENA 2BOLA 2YMOA 2FBOJ 1Q72L 1MLCA 2VH5H 5DXWA 5KSAA 1NPJA 5HTSA 1PFCA 3QO0B 3SDAB 1OF2B 4ZS7L 1JK8B 4HIXH 4X6CB 1SEQL 3JVGC 3TO4D 1FL3B 3C08L 4IRZL 1CZ8H 2FYVA 1U8LA 3VQ1C 1XF4A 4Z9KB 2OZNA 2ZP8A 3EW3B 4JY5H 4YGVA 2LFGA 2AV7B 4IKJA 4JPSA 5F1SA 2EO1A 2YZ8A 2J2ZB 1U8KB 4AZ8B 2OMUA 5KSBA 3QUZC 3B5GA 1SQMA 2FSEB 4R2GC 4G7VL 1ZEAH 4JB9H 3WLWD 3IDMB 3JVGA 5DC9B 4PRPB 1KDIA 2IANE 2WVVB 4K3EH 2ZIDA 4PJDE 2LV4A 3DUHA 1IGML 2VQ4A 4ZMOA 2ZICA 4UDUA 5I0ZA 2VZSA 1BD2A 1PFOA 4Q9BA 3U0WL 3WO4B 3VNYA 4J6RH 4XMLL 3NJNA 5D6CA 1BQKA 2AI0L 5DJXA 2WXJA 2FX7H 2OSYA 2XZAL 5AOIA 3ERXA 3WEOA 2J55A 5E4EC 2VAAA 1TZAA 1S8DA 2FNBA 4E0RB 2MKWA 4XC1L 3QZNA 4UB0L 4IRSB 3VWJD 4DGVH 1AZUA 3I6GB 1F18A 3QDAA 4HZLA 1AXSB 1FGNL 4JPQA 4LK4A 3VD4A 3NEOA 1UB5B 2X4PA 3KWWA 3K4AA 1U92B 3MNWA 5KYXA 3NH7H 1CGXA 4YAQA 2LU4A 4CMMB 1G7MA 5BO0D 4J7RA 4GP5B 4D9QD 4Q9QL 3BP6A 4WI7A 4PV8B 4OV5A 4IBTA 4YIQB 2UWEB 1SXZA 1Q72H 4ATWA 1HEJC 2G75A 2H6PA 1J5IA 5KEZA 1H3PL 1GZPA 2B5IB 1NBVL 3CMOL 4ZS7H 1QFWH 4RZKA 3T3PE 1SEQH 3RNQB 2RCSL 1Z3GL 1XB8A 2DPKA 3ETBF 4PWKA 3C08H 4E9QA 3OZLA 2EE9A 2P24B 2NZ1A 4ABWA 2X4OA 1NFDB 2PXYA 2ZYIA 5FM4A 2VRAA 4BSVB 1UOLA 3DIFA 4ZG1A 1VDGA 5F7DB 2EJ1A 2IO5A 3T08A 4UIKL 4HX1A 4DPRA 5LNDA 3CFDB 3GSXB 4UOZA 4GBXC 2D0GA 4G7VH 4JFPB 3UBXA 1MCSA 4MDIB 3RKDD 4LL4A 5FOBA 4PJ8B 1X7QB 2GJPA 3OXRB 4G6FD 3FMGL 2GITA 1Z5HA 4KV5E 2B08A 3VXNA 1IGMH 3O3DB 4NWTL 1DDHA 1KLFB 4PJIF 4XNQB 3H3KA 4YN3A 4RISL 1J1PH 1OE1A 3MREA 1HVXA 3U0WH 4HBCL 1S4IA 4AUJA 1CXEA 3Q8FA 2VUKA 1UUSA 1M71A 3JWNC 2J8OA 4XMLH 2F8VA 2AI0H 3IBEA 4ZMWA 2XZAH 4GBXA 1UOWA 1E9PA 2EIEA 1R3HB 4GUQA 4M00A 1RERA 1JNJA 4XC1H 4FNRA 2E7BA 4L3AA 4UB0H 1UQSA 4GKSB 1FGNH 1XH0A 3O6MH 4U3HA 3BLKA 3QIWB 1KTDB 4L0YA 3SYAA 2EICA 1BMZA 1CBVH 4OM1L 1NDMB 1IBGL 2XY1A 5I9QC 4FX5A 1EGJL 4AVKA 3ZE0E 2EYSA 3ARFB 5DU7A 4Q9QH 3ETSA 3Q9QA 4M02A 3WEXB 3W82A 1N4XL 4HS6A 3US1A 3ILEA 1S3KH 3QZBA 1ACYL 2ZSWA 1KLGA 4J3OG 1TCRB 3UZQB 2Q7YA 3W0WD 4KROC 4FFYA 3U46A 5J11C 3CMOH 1NBVH 3FNKA 3VFVA 2NQ3A 4YK4B 3N04A 4ICWA 1BQHA 5HXMA 2RCSH 1Z3GH 2VR8A 5KBLA 4WFHD 5FW7A 2DLTA 4HULB 4QO1B 1TZ8A 3DURA 3HBGA 1H3UA 2R51A 3U0TA 5C3LD 4ZFGL 4GFXA 5T3ZE 2HZHA 3ZDZE 4UIKH 5HGDB 5IHUH 2P5WB 4P2RB 2D7PA 1CO1A 3FBKA 4URTB 1J10A 1SOQA 3D2TA 3KYNA 4KTYA 1DSFL 3DVNA 3GJFH 4OZGE 1ZWIA 1XMWA 5DURD 2XZZA 5F8RC 5C0AA 2P5EA 4X6DF 3FMGH 4CVZA 1RXLA 3F3HA 1A64A 2XKUA 4NWTH 3EOBB 2V9TA 4Y16C 5IFHL 1GSKA 1IM9A 4RISH 4MD0B 3VXQA 2E7CA 4HBCH 3MUJA 3PHSA 3G6JF 2DQGH 3PWUA 3CXDL 4GAFB 5CD5C 5B1KA 1NAKL 2SODB 1JCVA 3LHAA 4MXQD 4ETQA 2A7BA 2XWTA 3GQFA 4NQSA 4QEGA 4OCLC 1G1OA 4TUOB 4PGDA 5H4ZA 3ABLB 3JUZA 1FNHA 5A43C 1JN6A 3ZYJA 4EOWL 4G1MB 4LSQL 3ARTA 3BPOB 4Y16A 2Q8BL 1CLOL 1O7DE 3QAZC 4Z3GA 3PNWB 3LKOA 4U0RC 1DEDA 2XKNB 3JYCA 4X6FB 3TT3H 4OM1H 2EIZA 4DPCX 1EGJH 1UB6A 4KXAA 4LL9A 5CAYB 2LQRA 3FH5A 3U2IA 5LAPA 2IQAB 2PWFA 2YUZA 1HESA 4OD2A 1ACYH 4NQCB 4RGND 2RB8A 2NW3A 5IESL 3QDME 4ZD3L 3D4CA 3ZR6A 4Z95L 4UQ2B 1IAOB 1ZSDA 2MQGA 3MRDA 4MHHG 1KBGL 1WGOA 3S5YA 1A7OL 5DMKA 1MNUL 5DS8A 3X13B 4GRLD 1BXAA 4LQ1A 4P5TB 1MQKL 5T1JA 3VE0B 3Q2LA 4AQ8C 1X5MA 4Z7QE 5I16A 4AYMC 4MNQB 4LQFL 4ZFGH 4K71C 4QRPE 5ANMB 3ZE1F 5C0FB 2F53D 3FU7B 3H6AA 1YUHA 2XN9A 4KKPA 3O6FA 1NMCC 1DSFH 2WKLA 1VACB 3VWKD 3GHPA 6TAAA 3GJEA 3KPQA 3MNDA 4QHNA 3KPMB 3SDCD 4KK9C 3U36B 1OPOA 1G1CA 1YNTF 4LGPB 5HPOA 1D5XA 4J3OD 4AQ8A 5IFHH 1OOAA 4Z78A 5KANG 3UX9B 4CRPA 4DKFL 1B90A 1QQDB 3D09A 3E2HC 3G7TA 2W07B 3OAZK 4DOHB 1WISA 2FH8A 2BK8A 3LZOA 1V3JA 4FXGC 1AKJA 1NAKH 1ZSHA 1JPGA 2AEPL 3VFMB 4DK3A 3KAAA 1X5FA 2H5UA 3M07A 5IV2B 2GBVA 4Y5XA 4F7PB 3QUMB 1A6TB 3QZWB 2Q8BH 3OC5A 1CLOH 2C9SA 5D4IA 1HQ4A 2NOYA 3HN8A 4MQXD 3ULUD 3D3VD 4N2AA 4FQXA 4FXGA 4UOW0 3RWIB 5F7NC 5AOKA 2AEQL 2WBJD 1IIKA 3WKML 2D9QB 2Z1KA 4I88A 5C1MB 1FFTB 4PB0L 3CQQA 5TK2A 3US0A 3U2SB 3CPLA 2DQIL 2QQQA 3LS4L 3V4PB 3P73A 2WLMA 3CTTA 5IESH 3TH2T 4ZD3H 4IU2A 1O9WA 4FQHB 4X9GA 5ABZA 3AM8A 1OGAA 3AT0A 2CK2A 4Z95H 3F58H 1BJMA 3HBZA 1KBGH 2C7UB 2VLJE 1MNUH 4QKTA 3RWDB 4G6ML 1RJZB 2D7QA 3P2TA 1MQKH 2X9XA 1DDTA 4LLWB 4A7GA 2NNFA 3MLPA 4UZUA 5SWZA 4K9JA 4NRZA 4LQFH 4L37B 1X5ZA 2A83A 4TNWK 5J3HC 2JJWA 1A6VL 1WAPA 1P4LA 5AW7B 1QUNB 3PGCA 4ZSOB 2AC0A 4OF6A 3BGFB 2B4CL 3AB0B 5DEGB 1RZIA 5GRJL 4P3DA 1T04B 3OKNB 1OTSD 3TF4A 4J4PC 4PW9A 4ZUUA 1EH9A 4NOFA 2BSRB 3U1QA 1E9OA 1CFTB 3WG7B 5F9JA 5I1AA 3EJSA 2RAMA 1VADA 4DKFH 4JHBA 1GMEA 4I0CC 1MW0A 1WBYA 1NC2D 5TPWL 2HVKB 3JV6B 4JCMA 2ROXA 2YD8A 1OTUD 2AEPH 4P06A 2Y07L 3II1A 3Q13A 4FF9A 3NCYS 4GRWB 3ETBJ 2PYED 2J20A 4J4PA 4JRWA 1I53A 4LCWA 5DJZB 4YDIL 5EORH 5J9PA 3GBEA 2NW2B 4XO4A 4PJAE 1LO2L 5KVDE 1JMZA 5JORA 3EJRA 4P2OC 3KJ6L 2QSCL 5K9OA 1KZYA 1FVEA 1E4XI 5BOJA 2BHUA 2H32A 3A6BL 2WAQA 5H37A 4HUUB 2KUTA 2ALWA 1IEAA 4KKCC 1ETZA 3LRSB 1LGVA 3MV11 2AEQH 1KIUA 4XP5L 4CJ0A 2XBTA 1IM3A 2JNZA 4TNGA 1SMDA 3V4PL 2V17L 4PB0H 2P1YA 1U8HA 4N2LA 1EDQA 1K4DB 2D2CC 2DQIH 3LS4H 3QFJD 3KHOA 5DJ6B 4HKZB 2Y06L 3Q8BA 1JZHA 4YSUA 4G6MH 4PBXA 4WK0B 1KXTA 4N90E 2QKIC 3CDYA 3DJTA 4UILL 2XIBA 4LVOC 1JGVL 4PPTA 4AJWA 3L3KA 1FORL 2DJSA 3MROA 5IJVB 1A6VH 2FHBA 1IILE 4F57L 2ZCLL 3GM0A 3QGVA 2B4CH 3VI3B 4B7IA 5GRJH 4B60A 3QDGE 1TNMA 5HJ3B 4R7NA 4LF3A 4NSKA 1Z0MA 1I8MA 2JQMA 5CR8A 3S4SG 4JGJA 4AQZA 5KJRL 2GJJA 1EXHA 4O00A 4R97C 3V10A 1X9UA 3PDOA 2FH6A 3OKDB 1ORQA 1NC4B 1HL8A 4L0PB 4WHYG 5TPWH 1INDL 2CR6A 2VW6A 2WNWA 1ZA3B 3WS6A 1PDKA 1KYUA 3UJTL 4M6NL 1XIWD 2J57A 3FTWA 2FLMA 1JF5A 4XI5D 1N12A 1BZDA 4YDIH 5LHDA 3L5XL 2CHXA 4PH8A 4A2HA 4RFEB 4QYOB 1L9PA 1QLFB 3LZFH 1LO2H 1TVBA 2YPLB 3UAAA 4M6ML 4WO4C 43CAA 4ZZKA 3WFBL 3KJ6H 2QSCH 5DJYA 2NY2B 1R3KA 4G8GB 3TJEL 3A6BH 3DHPA 1GH7A 1FUNA 3UH8A 2WXFA 4XCCL 4MJIA 3QPQC 4FNSA 4XP5H 5BZZA 4F5CA 4E9TA 1TFHA 4OZHA 4HU2A 4IBZA 3ZZSA 4K23L 3BVVA 3ASNB 2V17H 3ARDB 5D2NC 2CA4A 5AVYB 2J8UE 3EG9A 5INDB 1URZA 2X53A 1UURA 5AB2A 3ULVD 1O5DT 3CZNA 4PRIA 5I66A 2Y06H 3RGBA 2J5LB 1AR1D 4LXFA 4BSWB 4X4ZA 4QJ5B 2VLRE 2HT3C 4N2MA 2FO4B 4W9DC 1R5VB 4UILH 5DHMC 4ZDHB 4QXUL 4BZ2A 3L17A 4OLVH 3CC5A 1N0LB 1UEYA 1FORH 4YHNB 2LVCA 4L8BB 1ETB1 3FO1B 4F57H 1Z7JA 3QEUB 1BA9A 2ZCLH 5DRWB 1LK3L 1FVCB 3SGDI 5DCCA 2J88L 1S7TB 2CO3A 1ML0A 2VDLB 1WWAX 3MO1B 5CZXC 5AW4B 1E5CA 1UXMA 1OHZA 4OSUL 5KJRH 1N5YH 3VXTB 1E5YA 2UZIL 1LEGB 4GH7B 5FEBA 2B9BA 2VABA 4KWUA 3B37A 2EH7L 3NFPA 1INDH 2Z8WC 3VGAC 4EUPG 2XQYG 3MV9A 4HK0A 2Y5QA 2XG4B 3MJ7A 4BQ9A 3K6OA 5IJBC 2DBLL 4WI0A 1WS8A 3UJTH 4M6NH 3UDWA 1Z9SA 2RHEA 4KXZI 1ZJBA 5GGUA 3FDWA 5E6YA 3L5XH 2R23A 4Q74A 4JRXA 2K7PA 3ZT6A 4P3CL 1DJHA 4M6MH 1JPSL 3WFBH 2IANB 2Y7SA 3HI5L 4U1MB 5E7FA 2ZUSA 4PJDB 5B4MC 1BLNA 3MBEA 3MRBA 4RIRB 5D4HA 2JIXA 3DDGA 2CK0L 4XCCH 2P7TB 2QQKL 3C9NA 2B59B 5I8KL 4J1UA 3ZUNC 3SD2A 2FJFA 1DQTA 4K23H 2D3VA 3SE6A 3V4UH 4DKEL 3IMSA 1J48A 3BIBX 4G70B 4K7PL 1CDGA 3EYVB 5DJ2B 3UBHA 3BVUA 1CDHA 4G83A 2MHAA 1RUAL 1BOYA 1RZ8A 1FJ1B 1QAWA 1NDGB 3OAZH 4YR6A 3ATEA 5JW3L 1WEJL 1ZLVK 3S36L 1U3HD 2HFEB 2FZ3A 4HJJL 4GEJA 3NZ8B 2GTWB 2VW7A 4OI8A 5K39A 4GKZA 3GMLB 3VB9A 4QXUH 2CG9X 3FB6A 4QHPA 1OM3L 1GS7A 1HCYA 2Z8SA 4OH2A 4XN4A 4ZAKD 4UV4L 1LK3H 1ZV5A 2X38A 3CE1A 3HVNA 5CMAB 2WLNA 1ONQB 2VDLL 1OOWA 1K8DB 1AP2B 2J88H 4FYSA 1ZLUH 2OX5B 5IROC 2O30A 1E50A 4AKPA 3KPPA 2DIAA 1DBAL 4OSUH 3KW7A 3T3PB 2LR4A 3Q7JA 2UZIH 3E8VA 1H6TA 3D0VA 4DWHA 1KJ2B 1MJJA 1LDSA 2YK1L 5EF0A 4N2GA 1NGYB 2XU9A 2BVOA 1S78C 3V5KB 5T5NG 2DBLH 3MRKB 3TN0C 4YHPA 3ZMNA 4B9YA 4E41A 5C0EB 3B1TA 2XVLA 4N1EA 5JO5A 2O26U 1H5BC 2R0ZH 3ZKMD 2IWEA 2BP0A 2VZOA 4AIXA 5B39A 4P3CH 1D7FA 1TFPA 1JPSH 3HUJE 2VXVL 4GYBA 4G7RB 2UX7A 3KYOA 5DEZA 4AIZB 5IM7A 1AH1A 2ZQKA 3LH9A 4XNXL 5AQ0A 1QW8A 1IJNA 4X8GA 1NQBA 2CK0H 4QNPF 1JI1A 2UXFA 1FZKA 3BZ5A 3R19A 4K4KA 1DHKA 1W0VA 5T1LB 5I8KH 1AAJA 1U8QB 1SLUA 2RTTA 3D0LA 1H5BA 4DKEH 1S9XB 1ODUA 4PJ7A 5I6KA 1A6PA 1C16A 4D0CA 2X0WA 4NUGL 3O81A 2YMXL 5DEFA 2CSPA 5HGHB 3RA7L 2LT9A 1WEJH 3HZVB 5DRZA 1C8QA 3MJ8B 5LBSA 4F7CB 3S36H 2G0LA 2W0FB 4HJJH 5E5RB 5M7QA 1JZFA 2EH8H 4NC1C 1M3JA 4U49A 5EEZA 4P04A 1T1YA 2AERT 2X4SB 4RMVA 1TTRA 1OM3H 2R69A 2R83A 4TQEL 3ZE0B 4I9WE 1RZPA 2FSDA 3OXSA 4JFYB 4LU5L 4DN3L 2ZF8A 2XWXA 4AC2A 2RALA 4UV4H 5DO8A 4NO3B 1KPVA 1NMAL 2VDLH 1FYTD 5EO9A 1E4XL 3T1WA 5D2LF 5F0PB 4I48B 5B1AB 3FUMA 4ODHH 3D85B 4P2QE 1FN4A 3O2VL 1DBAH 1XQ4A 3QJRB 4QRBA 3QJQB 4UT9A 5I73B 3MBXL 5HSFA 4OCNC 3MA7A 4CADA 5B38G 1T22A 4DT2A 4L4VB 4BM7A 2YK1H 3E38A 2GVYA 4AG4H 1NBZA 5HYSB 4BFKA 3MLZL 5ANHA 4H25B 3ZDZB 5AENA 1VEMA 3ZQ9A 1JDCA 3AMLA 3CCHB 2X6MA 4ELMF 2JCWA 1YN6A 2J6EH 4XNZC 4URKA 4OZGB 2QPDB 2VXVH 2I27N 4JCWA 4PGCA 2BCMA 3CVDA 4YBLB 2ZP9A 3B2UC 2DQEL 3KDMB 2IDTA 1FZMB 3AAZA 2UY6A 4XNXH 5LGHL 2VM9A 3LXCA 1TF4A 2DM4A 2GJ6E 4JM2F 5DFVD 1BYNA 3RILA 2MSPA 3QXDA 3AG1B 4PYHA 1H8NA 1ID2A 1N7ML 1S9WB 5I0DA 4HFWB 3SQBB 1DVUA 4L4TE 4OZFH 5EC2B 3WUWB 3U9UA 3X12A 2BXYA 4NUGH 1JZ4A 1BDYA 2YMXH 4LHUD 1IAIM 5DD5L 3ZKND 4NM4L 2BERA 3CHOA 4W9ZA 1YEFL 3FT1A 1LXMA 2CO7B 4HHWA 1NLBL 4GSUA 4RQQA 5DTFA 3KLHC 2XRAL 2NDFA 4XO8A 1HILA 2IDSA 1MWAB 1SEBB 1TUPA 4KXCA 4MA3B 2WIIB 3BUYB 4TQEH 1E27A 4UINL 5T5FA 4DN3H 4LU5H 4MD5A 4WQOA 1SF3A 2ZNWA 1JP5A 2ITCB 3STLB 2K8QA 2BSTA 3CX5J 1PAMA 5K9JL 1E4XH 3NK4A 3QI9D 1HHGA 3QDMB 1IRAY 2ZOLA 5CEXA 4YHIA 2FEJA 4B7LA 1UA3A 2E27L 5D9SA 1A4BA 2NSQA 3MBXH 2APWA 4ATTA 4I85A 4PW3A 5B7FA 1QFHA 3VM5A 4QI3A 4XT1C 4RH4A 5HHOA 3MZTA 3O9WD 3D5OF 5T3ZL 3SY6A 1H3VA 4Z7QB 1NIDA 5IP4A 4LLYA 2Z65C 1AGDB 1QFOA 4M5YL 1JRHL 3MLZH 4QRPB 1AGCB 2XA8L 4LARL 4NHCL 1DVFB 2ZONA 5DWPA 4P23B 5KJ7E 3VFOA 1K8IB 4IIQC 3KW8A 3P0YL 4Z3TA 4HIJA 1L6ZA 2WQRA 3DX8B 3IFOB 2AW2A 2H9GA 2BVYA 4R96A 4F33B 1JS4A 2HUEA 1IARB 4S1SL 4O2CA 3KVPA 5C0GA 2AS5M 2AFNA 2ATKB 3L3DA 3MRJB 2AABL 3PHAA 4H26B 1PL3A 5LGHH 1X7SA 3GK8L 4HD5A 2GSIB 2PPDA 4QJ4B 2ZD0A 5EULV 2KKQA 3KYMB 2ZE0A 2YOAA 2DD8L 5H35B 1HL4A 4D94A 4MCNA 3N42F 5IBLC 4TQHA 3C60A 5IR1B 2BHYA 1N7MH 4HJEA 4GS7C 2YD3A 3GSWB 3H0TB 3D50A 3BFOA 4K8RD 4UANA 4Y4FB 1JV5B 1EA9C 3VSTA 3RNKB 4X4XA 2GTZA 3W9EA 3JUYA 1A9EB 3KH3A 4NM4H 1MVFA 4H1LB 4JN2B 1IL1A 1YEFH 1RULL 2V2TA 5CN1A 2NUPA 1AHWB 1NLBH 4KMQA 1MWAL 4RDQF 3NVQA 3MRLA 4CKVX 1VRSA 4XPAL 1CLZH 1WWCA 3U4AA 4HCRA 5SWSA 3MLWL 5KBNC 2ORBL 3IGUA 4UINH 2IGFL 1Q9WB 5DZPA 5IB1A 3SPIA 2HLFD 4EN3C 5KN5B 2K6WA 4D9QE 3ZZ1A 2ESVD 4NO5B 5K1VA 3ZKXC 3KWTA 2PN5A 2KZWA 2IXQB 2RACA 2WKOF 4P4KC 5K9JH 43C9B 1AKPA 2RBLA 1FNAA 3CVHA 2APXA 4OZGF 4PP2B 1SPDA 4XNYL 1ZJAA 3QC5X 3GMRA 1A6WL 1S7UB 2E27H 1SXSA 3QXWA 1PYWA 2VLJB 5K93A 1WBZB 4NQDA 1Y1DA 4A55A 4NO2B 4KMTL 1R24A 4ZPTA 3LYRA 5T3ZH 4FFWD 3PHQB 4EN3A 2G3XA 3PXJA 3NQIA 5CP3A 2O93L 4M5YH 1JRHH 2XA8H 4LARH 1ZIBA 4NHCH 4OIIL 2H45A 1E3FA 1RU9L 3N40F 4Y9FA 3RDJA 3CHSA 4KVNL 3JTSA 3DUUB 3EDEA 2E7MA 2BOBB 1LLAA 2L7EA 4S1SH 2NY0B 4RMRA 2IC2A 1BZQK 2AABH 2FBRA 3GK8H 4DZ8A 3K1DA 2VDOB 5AW8B 4Y4HB 3DVGA 4HSQA 1CFSB 3EFOB 2DD8H 1EO7A 4P4RA 2E56A 4XWOD 4R0LB 4OR1A 3ECQA 3OKMA 1FNEB 4N9GA 2X2YA 4YSEA 1HHIB 4TULL 5TJWK 5BQ7B 1ZANL 1MVUA 4DEPC 4PJAB 3Q1SH 1B0WA 1RULH 4LSUL 3QXVA 4GT7A 2V9RA 1IGJB 1MWAH 5IB2B 1A4KB 5CP7B 1NUGA 2CDFB 2A73B 4XPAH 2YPKB 4O4YL 1OO2A 1VZHA 2XSKA 3D2UD 3MLWH 5F88B 3SBQA 2VW4A 2IGFH 1UT1A 2NQDA 3IJSA 4DHLA 4YNYB 1ED3B 3HFML 3UGXA 4UTAA 4FXTA 4U6XA 4Y1AA 4BUGA 2HT2D 1S2EA 3OSKA 1CI3M 3PL6C 4XNYH 5LGKA 2OYMA 3W0WE 4IMKA 1A6WH 1KENL 2R9HD 1GY1A 4NN6C 1KJMB 1M7XA 4WFHE 2Y6SC 2CUIA 4HV8B 5D7LD 4KMTH 1JGLH 1YSOA 2EDWA 3V6OC 3ILPB 3TLRA 3NSFA 2DQTL 4YQXH 3TYFB 4LOUC 1BAFH 2UUDK 3CU1A 3ESNA 3FRUB 1FAKT 4OIIH 1G0XA 1G7QA 1RU9H 3ZRCC 2PR9A 1MRDH 2M1KA 2WLYA 3TFBA 3PL6A 4JPKL 1TQBB 4KVNH 3FFCD 3PE9A 4M7LL 3QDGB 4BHUA 4RX4D 4V11A 5TQ0L 4NN7B 1LK2A 2VDOL 2NZ9D 5JNYB 5J13B 1JZDC 4BWUA 3V0HA 3F85A 1KNOA 1KIPA 4UZGA 4ZUSA 2AXGA 4WI2A 3EYQD 3BWAB 1N0XH 3V6OA 1BZ9B 1UD2A 5AG8A 4IMLB 3HZYB 3GDCA 4F3FB 3FH7A 5A7EA 4QHMB 2HJLB 5C9KA 5EZJA 4N6RA 3VGBA 3TBSA 5J5EA 1R47A 1UUNA 3CX2A 3QIUD 2FVNA 2C9PA 3TFKC 4R90L 2ZJSL 1UOVA 1EVUA 1XR9A 5KVDL 4TULH 4JFOA 1ZANH 1NGXA 1JWMB 2X7LA 4KFZC 3QHFH 2PWEA 2XN0A 4LSUH 3KS0H 2EADA 4PFEA 1IVTA 1Z2KA 4IYKA 5GS0C 5I17B 3IBOA 4EZKA 3D48R 4AIEA 1RIHL 3L3IA 3N6YA 2WCSA 4O4YH 4A2GA 3P9LA 1XXDC 3L1EA 3PFUA 1N2RA 1FNGB 5BZWA 4YE4H 3C6SA 1GOHA 4LCUB 4AVIA 1OE2A 1HHHB 1X6NA 4HUMB 3HFMH 3FOLA 3G9AB 3RU8H 3W11D 3N85L 4HXBL 4N0CC 3P11L 4FJ6A 2VMJA 5EF3A 4OLXH 4RGNE 2IAMA 1Q9KB 1S9YA 3PJNA 4XVUD 5EPMB 1KENH 3RDTD 3SGJC 1CF8L 4FQQA 4G9FA 4ZW6A 1THAA 2VLRB 3DX7A 4JREC 4D0DB 2Q9OA 3I75B 2BVQA 3BT2L 3CSTA 4HFUL 4S2SB 3VDAA 4BK5C 2DQTH 3FO2A 3BMWA 1KTJA 3DA0A 4MJHA 1VIWA 4LPUA 2F53E 2W5PA 2XACC 3UBXG 3UAFA 5K59E 1E28A 3VFPA 2IOIA 5MEND 4DO5A 1JUFB 4JPKH 1E42A 3FT2A 3AT9A 5BVPL 4M7LH 3CH1A 5F89A 4NC0B 3SGJA 4DP7X 3P40A 3LKPB 5TQ0H 1VSCA 4WNQA 2VDOH 2DMCA 4YLCA 1UEMA 1VCBC 1AZBA 2ZCZA 5F71A 5IQNA 5DUJA 2FIKB 4PV9A 5F96L 1RV6X 2Z0UA 1OV8A 3BUBA 1AQDB 4PWJA 5J6SA 4G7SB 3V95A 1QHPA 1C1EH 2A4ZA 2WZ0A 1UOKA 4Y0GA 4R90H 5F3FA 2ZJSH 3AROA 2BSEA 2H3NB 4NZUL 4H5SB 5KVDH 3AW5A 1CDBA 1WIUA 1XTMA 2DQCL 5AOLA 3QK0A 2BDNL 3OLDA 4H8WL 3JWNG 3BN9D 2J3SA 4X7DC 5D1QC 1U21A 4TNVK 3D07A 2ICWA 3OKLA 4Z7WF 1RIHH 3HBPA 3ULUE 4PBVC 4MCYA 3D3VE 5CJ8A 3SPVA 4HKBA 4ZYKB 1BD2D 3R1GH 5GRXG 5DYOA 5EEUA 4FHJA 1HXYA 1CFQA 5ITFB 4KHTL 5IFAH 3VXUA 2WGNB 3N85H 4HXBH 2I9TA 3QUZD 4NPYB 4R2GD 2XX0A 3P11H 1WCBA 3FO9A 3IFPB 1BQHG 3GXTA 1TJHL 1S3RA 1B2YA 2AF2A 2MTPA 3KPRD 3U48A 1S7XB 1ACCA 3L3OC 1U8JA 4LCCC 4Z7VE 5LN8A 4N3TA 2PKDA 1ZLSL 5IBUG 3OKOB 3BT2H 4HFUH 3M17B 4NUJA 2ZYSA 2FL5B 1WIPA 4CVXB 3GRWL 1NCHA 4LE8A 1MLBB 1O6SA 3H2PA 5ADOL 4R5TA 1EJFA 1A3LL 5BVPH 4L1TA 3V55A 3HB3C 5FR3A 5DGRA 1CMOA 2QR0B 4XWGL 5E2UL 3R0MA 5HYQA 3IE9A 5CKAA 5GGSY 1WD9A 3H3BC 5GISL 2GUYA 5HGBA 5AYQA 2BIOA 1CN4A 5F96H 2XWCA 5B8CB 3IDNA 1N59A 1NOFA 4U1LA 5LKNA 2G4GA 4OZIF 5JIHA 3P77A 1LP9E 4AUUA 5I1GL 1FLRL 1G9MH 3BSGA 5FM8A 2LTQB 3FQTB 4P2CG 1OM9A 1G7IA 3LS5H 7CGTA 4HZAA 3BSHA 2HG0A 2X4RA 4I18C 3T65A 4I0PB 4NZUH 5CCJA 2XWZA 2J8UF 4U4BA 4TV3A 2PYEE 2EUWA 2HMIC 2DQCH 5TQ2H 3VXSD 4ZMPA 3BD5A 5JHBA 2BDNH 4Z7UE 4H8WH 4NO0A 3TBVB 3VA6A 3HUJB 2ITEA 5KS9A 1HYSC 2I5YL 2VITA 3NFSL 5GZNA 1F1AA 1RZKL 3MRRA 1A1MB 4GNKB 1PSKL 2WLKA 2RD0A 3AU0A 3PAVA 2IBBA 2CBOA 3JTBA 2F1EA 3G5WA 5SX5H 3ARPA 5JW5A 2YC1A 4PB9L 1YPZE 4PRAB 1J0JA 2W65B 5D7JB 1WZAA 4GBXD 2GK0A 3LKQA 2OS7A 5FYJE 1RZQA 2LU5A 4BEIA 1TJHH 2DIEA 1L7IL 4LNRA 3B2PA 5DJ0A 3AMKA 4GKNA 3MJ9A 3EYFA 1KTCA 2YA2A 3GFUA 3KEHA 4WW2F 2G5BB 1N67A 3PQYD 1ZLSH 2K9UA 3BP4A 4EIGB 3MV7A 2VZ1A 4KRLB 4ZFFB 3J07A 5J1TC 3IGKA 2VR4A 3S35L 1P4IH 1XGTA 3UCQA 4LDEB 2X3CA 4OBSA 3EOAB 2IPTL 3GRWH 3MRMB 1MHEB 2E47A 3PIQA 5HDQL 4OI9A 3ES6A 2ZUUA 3B2XA 3TYGL 5ADOH 1A3LH 4MNGA 1OGTA 3Q8AA 3G9VA 2FB4L 3N2JA 4AQEA 4XWGH 2L04A 5E2UH 5B21A 5AYUL 1OAUL 2F8XC 4P2QB 1S7QA 5GISH 2BSSB 3FHEA 3QCVL 3TASA 5JPMC 4MZIA 1AMXA 1TJIL 4PR5A 1FZJA 3ZSTA 5GGRB 3GTTA 2OMWB 1CG9B 4WWKA 5I1GH 1FLRH 5IG7B 2E8YA 1ZHKB 3AG4B 2P80A 2X4TA 5F9DC 4LLUA 4X4YA 2H41A 4NKDA 2W1NA 4LDLB 3B2VL 4MD4B 5I8EB 2Z4QA 4S0TD 4ZO6A 5IHBA 4KROD 1D7CA 3AREA 1FZOB 5JPMA 1BW8A 2WTRA 1HXMB 3NFSH 2IOMA 1RZKH 5C0AD 2OSLA 1PSKH 5I15L 3TEZA 1N64H 2NY3B 3VX0A 3FO0H 2OPCA 3G04B 1DE4B 2GJ6B 2ENQA 5I71B 4RFNC 2HFTA 1EEUA 2WVUA 4KQ4L 1SYVA 2MPAL 4PB9H 3HG0A 2XVBA 4YFLI 4PJEF 1S7VA 1MY7A 2EQDA 3ARSA 2Z93B 4L4TB 4WUUD 1AC6A 3WNLA 2NLJA 2V0AA 3HG1A 5CJQH 5D1ZC 3KS0J 2A6IB 3ULVE 1L7IH 3U7WL 3MUZ1 1BX2B 2VXSL 3OHXC 1Q0EA 4Y16D 2DYPB 5D2LA 4AI7A 1PZ5B 1OSYA 4N2DA 3RZCB 3IFLL 1JGEB 2ETWA 1H8LA 2WWKO 3QEQA 4KKBC 3S35H 2X3BA 5HHQA 4NT6A 4QHUA 4ZS6C 2YRZA 3CWGA 3WGVB 1G7JB 1VHPA 4PWEA 5HDQH 1C5BL 3B9AA 3TYGH 1P5UA 1TMCB 5JIMA 1JWUA 1QTPA 3FSWA 4WW1A 2FR4A 2JELL 3CLEL 2FB4H 2RQEA 3HI6L 1MHCA 1UKSA 2DQMA 4JM2C 3OHXA 3ORJA 1CD1A 2VR7A 5L2KE 3L7FA 2HFGL 4OCWL 2EYRB 3TO4B 1TJIH 3P54A 4MMYB 4U6VL 4Q8BA 4JZJB 3TPKA 3A21A 4JQXC 4A04A 4C4BA 2DEWX 1IEHA 4ONFH 4ANXA 3O3UN 4NNXB 3LDBC 4Y5YC 4XCEA 3U6RA 2MQCA 3T3ME 1KV7A 1DR9A 2WLHA 3FJTA 1ZGLB 3L3GB 2XN9D 3HAEA 3Q05A 2BO0A 5CN2A 3P30H 4IOSD 4FTDA 3CVCA 3V52L 2FJGA 3D08A 2CLRB 2R7EB 4IOIA 3ATDA 1KBPA 2OMXA 4HWZB 3P4MA 4PJHA 5H37G 4AGQA 4BSJA 5JW4R 1UGKA 2IQ9L 2ZOKA 3THML 4DCQA 4BZYA 5I15H 3LKRB 4N87A 1MNNA 1EQWA 1SY6L 2DICA 4FNTA 2ARJB 3MX0B 3MRCB 3IXTA 4MLIA 1OSZB 4KQ4H 2V8LA 5E99L 1UFUA 1WIOA 2MPAH 4G8IB 2WSDA 4MMXB 4RMUA 4LHQB 3WJLC 4GUPB 3Q6GL 2PW2A 4QRUA 4XP1L 3ZTJG 1AKJD 3HG5A 1AYRA 4Q14A 2GAZB 4QT5B 5FIEA 1FLTX 1H3TA 5MEQB 3U7WH 1Z66A 4HGWB 5HPMA 4KK9D 3VWJB 2CBTA 2VXSH 3AS3A 5IB3B 3SDXF 1GTNA 5JQIB 3O3BB 1UD6A 3IFLH 1I3RA 4MX7B 5CBAA 3BH8A 4NENA 3BCFA 1HQRB 5KAQG 3WJLA 5LG1A 4L2YA 5FO9A 4GAYB 1E9QB 1T4KA 1C5BH 4RAUB 3EGSA 5K5YA 4CW1A 4FA6A 2JELH 4A2FA 3CLEH 4ZNEA 3HI6H 2C34A 4CBZA 3VQ2C 5K9KB 4E9RA 1TKWB 1TVDA 4UM9A 1CGWA 5ESVA 3RUGF 5CF3A 2HFGH 4OCWH 4JMNA 3L5HA 5GSRA 1BG1A 4PRNA 4J28A 2MFNA 1I1AB 5HHVL 3QG6B 3DROA 3RLSA 4M61A 1W15A 4U1KA 3ZZQA 4HLZH 2HRGA 4PJCE 3ECBA 5SWZD 3D12B 4GSDL 4RA3A 4A7VA 1T7YA 1A02N 2X2JA 2XHNA 2WYHA 1YQ2A 1NEZB 1QSED 5DHYA 3V52H 1Q8MA 4UWQB 4X99B 3O4LA 3D4YA 4M7KH 5I28A 1QI3A 4G6FB 5FCUL 3K5SA 1JV2B 3THMH 1U8NB 1DJSA 1D7DA 4KNUA 1SY6H 3VXMA 2DMKA 4IGBB 1G7HA 3PUCA 1QPPA 4G9DA 3R7RA 4DESA 3H7BA 3POCA 4I1NB 1F3DH 5E99H 5J3HD 4BELD 3QYCA 4HISA 1JPST 1ZHNA 5ID0B 4OJAA 4PVNA 3LPOA 4U1IA 2YN5A 3WO3B 1LO4L 2EC9T 1JHKL 3Q6GH 1JG9A 4XP1H 1TTBA 3MBWA 1GGUA 2NY5L 3GMQA 4J4PD 4LCWD 1TJMA 1I7UA 1HH9B 3GEFA 5CHNB 4CC4A 4DJMA 5A40E 2AXFB 3G5YB 4GUOA 5AVUB 1CFBA 2JB5L 4MJ4A 4QGTA 4ETYA 2V5YA 4AT6A 3BUQA 4QCIA 2P43B 3VDBA 4LPTA 1P6FA 2RR3A 1OEZW 3OKKB 2DBJA 1FG2A 1FRGL 1IM3D 3IJEB 3DBXB 1FYTE 3LVEA 3PPSA 4LCIL 2I32A 3DGDA 3IJHB 3RFZC 1AD9B 3F65A 4HXAL 2Q86A 2XTJB 3BZFB 2Z7YA 4P2OD 1FF5A 1G0DA 3W0WB 2VN7A 3IKKA 2Q5BA 5JA9A 1XO8A 5C07D 4L5FL 4O02B 1UXSB 3TBYA 1HIML 4JMXA 5HHVH 3W57A 4F24A 4FQPA 4H0GA 4D8PA 4KKCD 3B9KC 1J0ZA 3UC2A 1W8OA 4ANKA 1OB1B 2JVUA 3DO3A 2EDNA 1R9FA 2QQLL 1KPRA 4P9HL 3OR7A 4GSDH 4IRJC 3T5WA 5KSUB 2QPSA 4BZ1L 3D25B 1UJ3B 2AGJL 3BO8B 3B56A 3CZEA 4BH7A 2IJ0C 4HUCA 4IU3B 2H4EA 3RFZA 3S3CB 2AITA 4FQCL 1AVAA 3MRIA 2OTUA 3CZSA 3HRZC 1KIRA 2VNCA 5DURB 5F9WB 5FCUH 1UH3A 4GT0A 1E65A 4I1RA 5DJAA 1XL4A 1PPIA 2VDRB 4NIYE 3UTTA 1U8IA 4GG6E 1RZ7L 3QUKB 4QR7A 1ZKAA 4TQPA 1LO4H 2CNYA 1JHKH 4A66A 4ODWA 2C1PA 1QLRB 4DVRL 3HRZA 3LN4B 3O41A 1X5HA 1C12A 2NY5H 2YFNA 3UO1L 2A74B 1P7KB 1L5GA 1YQVL 4JDZB 1L9TA 2TSAA 4HWEL 3CZFB 2IEPA 4XP4L 4I4WA 4KI1A 3X1EA 2OKMA 2JB5H 3BD4A 2EEBA 3TONA 3E8UL 4JO1H 4DN4L 1XSKA 4GFTB 3D9AL 4MJID 1XF5B 2BC4B 2HX7A 3D18A 4LKCB 3FB7B 1YJDH 5EBLA 1FRGH 3UTSA 1OCWH 2K6YA 1CE1L 4HS3B 2Q3AA 3RWHB 4FQ1L 3LQZB 3KBFA 4RGNB 3WS3A 3M1CA 4BUHA 4HXAH 4Z3FA 4WO4D 1XD0A 5F3HB 3TNNB 3S96B 4PRID 2KS0A 3V0JA 1IV8A 3AZUA 1IAIL 1AO7A 4L5FH 4WJ5B 1HIMH 2CKBA 3HCVA 3O8XA 4KRPB 4GRLB 2YD9A 3GO1L 3MMEA 4QXWA 5LO7A 1BQ5A 5MERB 3RGVC 4BFGA 3QPQD 3TCLA 4D3CL 2OAAA 3INUL 1R3IL 2OR9L 2QQLH 4P9HH 4PRBB 4UQIM 3DSFH 1DCLA 4BZ1H 4GRMA 2AGJH 2F53B 3UBFA 1A4JB 3FT4A 1S5IL 4FQCH 1VFBB 5A2FA 8PAZA 1HKFA 2J1YA 1VZIA 5H94B 2NT0A 4FNLL 1VF5C 4J3XA 1XGQA 3S2AA 3SDCB 3NJJA 4WHDA 3I85A 2ICEC 2VDRL 1CDIA 2L4OA 3RGVA 3GWJA 4R9HA 3EYOB 2FYYA 2HT3D 5BO1L 3VH8A 4HK3J 5IREA 1TTAA 3I02B 3MU3A 3E3QE 3UADA 5I6LA 1RZ7H 2VSDA 4IKLA 5C9JA 2EE3A 5E1IA 4J2XA 4DVRH 4XODA 3GB7B 4FN0A 1UENA 3UO1H 1CI5A 1YQVH 3LD8C 1YVLA 4JRXD 4M48L 5CZXD 1GAFL 3FFOA 5E5UB 3ZDYF 5FO7A 4XP4H 2OXGB 2VDNB 3BSZA 2EVIA 2W59A 3NK3A 5G2NA 3D4GA 4P46A 5E5LA 2HRLA 3E8UH 3WJMA 1DUZA 3D3VB 3MBED 4DN4H 4AYFA 3D9AH 4W4NA 5KSVB 4G8FB 2LOEA 1JXGA 1LO5A 3GLAA 3LSOB 2WBJB 4X6BA 5IF0B 2WYZA 4MYPA 1CICA 1NLDL 3JSSA 3HNTL 1CE1H 1V05A 2KPNA 2ESVE 3EGDA 4XAWL 1VFAB 3CDZA 4FQ1H 5C09A 5LBVA 3RWGA 3WN5B 4E42A 3SGEI 2FJSA 3TX4A 4NJ9L 4ANVA 2EIMB 1A66A 1XL6A 1URLA 5TDOA 3CHQA 3PWPD 3AQZA 2V3DA 2VDQH 1IAIH 4PREB 5KBMA 5E1AB 4Z7VB 5FAAA 5B4MD 1F3JA 4HIIB 4XBEH 1DO6A 2FEEI 4CILA 3GO1H 2EKSA 3GI9L 1IBYA 1RL1A 2J73A 3UP1A 3LJ3A 4AXWB 4DSYA 1R3IH 5CZVL 5JPNC 4HC1L 1UVQB 4MB3A 2D2OA 2J1KA 2QZQA 4AJYV 3OD3A 4NNPH 3FH8A 5BNXD 5EN3A 3DOSB 4IOFC 4NRXA 3S5LA 2HN7B 4TMPA 4FNLH 3I9GL 2CWRA 5ADPL 2FUQA 3H9HA 5DLLA 3F05A 3JBG7 4LKXB 1DQQB 1DVSA 4XCYB 5BO1H 3EKCA 2JH2A 2A1WL 5IEKA 2FQDA 2J1XA 3FZUC 2Y1AA 4MDJA 3QUHA 4WDIB 1NC2B 2VXTH 4WFED 3IDJA 5IB4A 3W39B 5JPNA 1LP9B 3K6DA 4Z7WA 6PCYA 4B9FA 1IFHL 2OJZL 3NGBB 2ENSA 4L9LC 2YGPA 3D39A 4XXDA 5T1MB 4ZMVA 4F7MB 4PWFA 4UIMA 2OMBA 2VDNL 4L9DA 3RG1C 1P7BA 1V55B 4GIOA 4M48H 4Z7UB 1JZ2A 1GAFH 4NRYA 3ULUL 3G5ZA 4U0QB 4G6AC 3UTZB 1IVLA 4PRDA 3RWJB 2WQSA 4QF1A 4YHYC 4OY9A 3MLTB 1G9MC 3BGMB 1DTUA 3D7PA 1N6VA 5K69A 1BJ1H 1BVOA 3D34A 1BQRA 3TVMA 3FRPA 1AGBA 1S78D 5G5DA 3TN0D 1YPZB 1NLDH 3LIUA 3HNTH 4ZOBA 2XPYA 2AK4D 4XAWH 2EDTA 4MXWL 2H26A 1M42A 1QOKA 4LOFA 4NJ9H 3ML8A 1R17A 3ARBC 3EF7A 3K72A 4YHKH 1T20A 4QOKA 1HI6A 3WFCL 3CN2A 3NDYE 3CNKA 3GUFA 3GI9H 2WKGA 4FL4C 5HDWA 5D7LE 4KJQC 2FWSA 4N5EC 1QZ1A 2ZXGA 3TIEB 2EVJA 5CZVH 3ZBMA 4ZFZA 1LD9A 3MRFA 3HS9A 4F15B 1THCA 1XF2B 25C8L 4HC1H 1T0MB 1S7RA 2VO5A 4FADA 2F8IA 3FT9A 2E75C 2HPTA 5AB0A 2L7UA 3FFCE 3ARBA 4ODXB 2RQ8A 3I9GH 5ADPH 4BE5A 1PZ2A 4J3OH 1WAAF 4N0FA 2A4EA 1EK3A 4HH9A 4Z0BL 1TT6A 2YPVA 1A2YA 1UWEL 5TGBB 3Q2WA 4QAWA 5BRZD 1KG0B 2OMTB 3KLAB 3L13A 3NJXA 2A1WH 1EEQA 1PG7L 3D33A 1A6AB 3I9IA 4GXUN 4HH8A 1XX9C 3RTQC 1IFHH 4X5XA 2OJZH 2FO1A 3Q44A 1BVKA 3AFLA 3FCTB 5FGRA 3S36X 4TL4A 2Q10A 5LNGA 3SEPA 1XIWB 2C9VA 4V33A 3B2MA 4MJ6A 4XAKD 3WE1A 1S7WA 2VDNH 2BVPB 4RGOH 2FGWL 3IXAA 4YFEA 2JKSA 3DXAA 4BGLA 4TQIA 4HKXB 3ULUH 3T0WA 1N5AB 1XGRA 1LNUA 4JRLA 3KR3L 4AM0Q 1RK1A 2DQUH 3T4AB 4PGZA 4GSXA 3W5MA 3BJ91 2KMWA 3RTQA 5CU5A 1NANI 3QWNA 3SPCA 2VMEA 2WJ7A 3L2LA 4HHAB 4MNHB 1PQZA 2ZG2A 4O51B 4LASL 4HDIB 4OJEH 4QHLA 2ED8A 1OANA 3HHMA 4LPVA 2J71A 3B43A 5ESAB 4TUJB 4MXWH 4UT6A 2DDQL 2OL3A 4ODTL 1SUJA 1ZHBA 2FLBT 2KHAA 2TSBA 3C5ZC 4R8WL 1T1ZA 4Q6IA 4TNEA 2VLKD 3B2UD 1JZ5A 1M7IB 1AR1B 4RBPK 3WFCH 4ONOA 1ZCRA 2Z31C 2MCG1 1RD6A 1WK0A 3ME0A 1DEEA 4FQIL 1UM5L 4R84A 5DQ9A 2X1XR 4U1HA 1YEDB 4Z0XB 1UTDA 25C8H 2EDOA 1JE6A 5F1OB 4EXKA 3REWA 3G08B 5MENE 4DP1X 1JFHA 1F5WA 2YQGA 3TPUB 3M1BB 4Y1SA 1QVOB 4FI7A 3CFKA 5EU7C 2D7NA 3OWRA 4JG5A 3VFWB 1ZLEA 3D1MC 5F1NB 3H53A 1CE6A 3V4VH 1I4FB 3OKYA 4G80B 5CD3A 2DL9A 4WV1C 5L2KB 2XQYK 3T0EA 3KLHD 1UWEH 2KH2B 4ACPA 4TNWF 3SKNA 2XWJA 1HOCA 4WRLA 1DQLL 2YZ1A 4F2MA 1J8KA 5HHOD 4XRCB 5KVFE 4C83A 1WD8A 3DETC 2XC8A 1XGPA 2G2RA 1OAZH 4FCAA 5IOPA 3E9TA 3T3MB 5C0NC 1IBHA 2H3KA 5FFLA 3C09B 1CLVA 3TJHC 4MAYC 3ARGC 4WTWA 4PJ5A 1M1XB 2HPOA 2FGWH 3GKWH 4PJEA 4EDXA 4WV1A 3AITA 3QHZL 4G7YL 3DX9A 5J6GB 5EU3B 3KR3H 4QWWC 2H1XA 2OQJA 3IWVA 2UVEA 4M93C 4FC3E 2F2HA 1JYXA 1QRNA 5DJ8B 2QZ5A 3KGSA 5DVKA 2ZCHL 3MHZA 3O11A 5FK9B 3H8NA 3CFIC 1BD2E 2H47C 3S4SB 3O3EB 3AWEA 1BPVA 4U4IA 4LASH 4HUVA 5ID1B 2R1XA 1L6XA 5HP5A 4D2NA 5JHLA 4MAYA 3ARGA 2V2XB 4X6EB 3ULVL 2HJFB 5L7XL 3PAYA 4EQ3A 3W81A 2DDQH 4IRZA 4U6TA 4ODTH 1NL0L 3F7RA 4PJFF 4R8WH 1SJHB 4MASA 3OAYK 5GGVL 3KPRE 2OSXA 1U3HB 3NMEA 1DSWA 4YUEL 3RVXC 1M2VA 4FQIH 2BY2A 1JGDB 1CLYH 2R0WL 3QJSB 2N7AA 1DLHB 3EJYC 5IBLD 5ES4B 5SWSD 2YSTA 4ZAKB 5E94B 3MRHB 3L45A 1TYEB 3HMXA 3K46A 2M83A 3DTXB 3CSYB 2NX5A 2XDHA 3PGFL 2ED9A 4GUCA 4HWNA 4LLMA 4MMZB 1HK6A 5HYJD 2HT4C 3F7VA 1NTDA 3CDGA 3PFQA 3UMTA 1XZ0A 3KL0A 4LVHB 3FW6A 5B3SB 4LOVA 5FYKE 1MIEL 1Y18A 2VOTA 5JYMA 4NZFA 4KDTA 4Q6YA 3TBWA 4L3EA 1J88A 3NACH 1F13A 4EDWL 5CIPB 4R5VA 5E70A 1USQA 3SO3B 4UAOB 5FFGA 4EN3D 1U41A 2JTDA 1GZQB 2JB6B 5FA4A 4GW4A 3IJ8A 4JQIL 1OZUA 2Y25A 3V0DA 5BJTB 1I7TA 3WKPA 1Z5LA 4P4KD 1TSRA 4GG8B 3BEWB 1UM6L 3VXSE 4LT7A 1LYQA 2FEEL 1AI1H 3ULVF 1I9IL 3ATFA 3QHZH 4G7YH 2L7JA 4IKNA 3M86A 3WJJC 4HJ0C 2XFXB 3CVBA 5IBTL 1RJCA 2DQHL 3P9MB 3FT3B 3QO0A 3SDAA 1UZ8B 1OF2A 2VRKA 3BLBA 1ZDQA 1OP3H 5KYNA 3CZUB 4X6CA 2ZCHH 1AR2A 3UFIA 4N25A 3NCFB 3C87A 4OF3A 3NIFF 3EBIA 3U1SL 2ITFA 2X4QA 3ULVH 5L7XH 4BQ6A 2A6KB 1RSYA 1DFBL 1HWWA 5JIIA 3C5SB 1NL0H 4B9CA 1XBDA 2BFGA 2J2ZA 1U8KA 1ZHLB 4MBRA 4AZ8A 5GGVH 2PP7A 2FSEA 1P9MA 1YECL 3ZE2E 2GHZA 1MG3C 3HMWL 4JHUA 4FFZA 3WNJA 4YUEH 5EZIL 1B0RB 5D7IE 2WVVA 3PQYE 4Y7OC 1GS8A 3BVDB 3RUGA 3JWNE 2ENJA 1T3FB 3UEQA 1T2QL 5K1JA 3T8MA 3PGFH 2P4AB 4B5EA 1FYTB 5DEJA 5FDWA 4ZXBC 4GIPD 1CTNA 3VVVA 3NA9L 1MUJB 5MEPB 1F4WL 3G6DL 3ESUF 2E46A 1MIEH 4E0RA 3PJSA 1BXXA 3U0PB 3HG2A 4IRSA 4JUTA 4OJDH 1CFNA 3I6GA 1AXSA 4PJBF 2B5IC 4WWID 3N91A 2Y4SA 2ICWI 1U92A 3LB6C 1CYWA 3KGRA 3LN5A 4R5XA 4JQIH 2ZXBA 1C9SA 1F00I 2EABA 4BBWA 1MCHA 1UM6H 3O4OC 3PL6D 4PV8A 3IPFA 4YIQA 4WNSA 1I9IH 2UWEA 3EJUA 4LSDA 1I9JL 1UZ6F 3QG7L 5C0AE 2JQZA 2DQHH 1QZNA 5BS0D 4HJTA 1TQWA 2Y6SD 1GC1C 2IV9A 4WU5B 1MCJA 3RNQA 1KFAL 3EDJA 2X6UA 4JQVC 1AS7A 3PPEA 4GG6B 4LOUD 3SQRA 4WHYH 2P24A 3C6LC 2G9HB 5EOTB 1HWGB 2QVTA 4ADIA 1JVKA 2ADJB 4K5PA 1NFDA 1HTYA 4KX7A 4WUUE 4BSVA 2COVD 5F7DA 3S3BB 3VYOA 4LHUB 35C8L 5AKSA 3CFDA 3GSXA 2GBUA 2F5AL 4AKQA 1U2CA 1FFPB 1YECH 4B41A 1N3NA 2ZKXA 4MDIA 3HMWH 1L9SA 4NI6A 5L4FA 3VD5A 1VLXA 3Q0HA 4PJ8A 1X7QA 3OXRA 4I3RL 4PGBB 4JPIB 4WSKA 4XH2B 5EZIH 3CPUA 2FIRT 4NQXB 1R0AL 1YNKL 4XNQA 3OTTA 1QRKA 3C6LA 1QBBA 4PJCF 3DTUB 1T2QH 2EDYA 3F83A 2IH3A 3K4ZA 3TFKD 2XG5B 3K71B 4AK2A 5AD0A 1HDMB 1P84K 1QHOA 3QULA 3MYZA 2UXVA 3ARFC 4DGIL 5CCGE 1R3HA 2O72A 2EINB 2X70B 1F4WH 3G6DH 4M6OL 4Q0XL 2OK0L 5GS0D 4WHTB 1COBA 1EAPB 3KLKA 4G9FD 1G5AA 5C7ZA 4LP8A 5IJKC 3GDBA 2AV1A 3I3DA 1YJDC 3NPZB 3Q48A 1OARL 1JXJA 5BZDA 3QIWA 1KTDA 4YK4C 1TEYA 5JIPA 1NDMA 3B34A 1E2ZA 2OI9B 1RH8A 3NT0A 5CGMA 3CBRA 1KWGA 4N0CD 4XN8A 4EQ2A 2E7LA 3M1OA 1I7ZB 1O6TA 3AQXA 4LHJB 4QXTB 3ARFA 4Q52A 1H6EA 2XN9E 3ZHNA 2W91A 5CWSB 3WEXA 1B4TA 3HPLB 3OPUA 1K3IA 1J8HB 2PTUA 1NCBL 1I9JH 1SOKA 3ZDXE 3R8BB 3QG7H 2OMNA 2R1YB 2TAAA 4I2XE 4TYUA 2QFRA 3UZQA 1KEGL 5IJKA 5IVXF 1WYJA 3MNMA 2NY6D 4MSWA 4C4KO 4KZCA 1D2PA 5L8KB 3RKDC 1KFAH 2YXFA 3HZKB 3ARUA 4ODBD 3B9DA 4QO1A 4M03A 3KPNB 5I5IA 2E7HA 4EUPH 3RURA 2YS4A 4FP8L 4K3DL 2HX8A 4BCXA 2J25A 5HGDA 35C8H 4P2RA 9PCYA 4PS4L 2F5AH 3KM2A 4L1SA 5IKCB 1XXFC 1MCDA 3QJZA 2CLVB 3F6JA 1D6VH 1HNYA 1KIQA 4XX1E 4UUJB 1ZVNA 3EOBA 4U2YA 3S3PA 2R15A 4AV4A 4MD0A 2YEQA 4X98A 3NBNA 4A6YB 2O6PA 3B9EA 3U6XA 3ZR5A 1IU1A 4BA8A 3OMIB 2ESVB 2XZQL 1TLKA 3PDDA 1I9RH 4KBPA 4JVUA 3T8VA 4DGIH 2P8LB 4TUOA 1NDTA 4PQXA 1HHJA 1I7RB 4Q0XH 4M6OH 2OK0H 5D1QD 2PUQT 4PD4K 4Q9RL 1NANH 2VMFA 2C7FA 1AHMA 1J0HA 1X5GA 4NFBA 5AVTB 3LCYA 3PNWA 3EJZC 1ZV9A 3B3BA 2XKNA 4GW1B 3OAYH 4X6FA 1WLHA 1LL1A 5SWZE 4U3SB 1JK9B 2KQNA 4P5TC 1VPOL 2A9BA 4W9KC 5A7BA 1KJ3H 1Q90A 3RAJH 2JKTM 2N01B 4F20A 3SHSA 1QSEE 3CDCA 3HC0B 1KEGH 3I9AA 4HAKA 1GZHA 5DZJA 4UMSA 1AOHA 4UQ2A 1SN5A 1IAOA 4XNUL 1ZA6B 3NP3A 1QACA 4OGZA 4PSPA 3BESR 3X13A 3F7PC 4DTGL 1N70A 4P5TA 4K8RL 3VE0A 4FLRA 2ZWSA 3UG5A 4W6YB 4OKVA 2CU9A 4FP8H 2ZKHL 3HB3D 5ANMA 4K3DH 3ZXAC 5C0FA 3VD1A 2QEJA 4LCWE 5C0RL 1JNNL 1Y7VA 4PS4H 4ANUA 4JHVA 1PIFA 2D3JA 1VACA 3EUUA 4GO8A 4NO0D 3TCTA 4MXQC 1BEXA 1DYZA 5T1KA 1ETJA 3HE7C 1T2XA 1LVEA 3IRPX 3FQNA 3KPMA 4MA1B 4NPKA 4XBPA 5INCB 3V6BR 3GIVB 3U36A 5EU4B 4A6YL 1KLUB 3D2UB 4XHJD 2EILB 1FCCA 3I6KB 1QQDA 5GXBB 3DIDA 5IWLA 2W07A 3HFFA 1ADQL 3GKZA 3GS4A 2HMID 5CN3A 3ROOA 5G4MA 2E8ZA 3HA0A 1OP5K 4KPHL 3CIAA 3VFMA 4YLQT 5J1AA 1HYSD 3HE7A 3L5WA 4Q9RH 5IV2A 2D31B 2VLLA 2FCBA 3LNEA 1AZVA 2CCLA 1KYDA 5C07E 4F7PA 2BNQA 3QUMA 1CLCA 2YBGA 3B7YA 3F5WA 4PWHA 4DW2L 4P2YA 2IPUK 5D7LB 3EH4B 3MV7D 3GMOB 1XAKA 5AOMA 4B50A 3VJ6A 2Q7NA 3ELQA 2JK5B 3HAEG 4KK6C 3BWZA 5AVZB 1VPOH 3RWIA 4BFIB 3DYMA 3SJVA 5JW4M 2PTTB 2WP3O 2DQDL 2G30A 3P69A 2C1OB 3GM8A 3C2SA 2PPEA 3FFCB 2CHZA 5EFIA 3K1KC 3L7EB 3NJVA 4FKHA 3U2SA 3V4PA 1BFSA 3QNZB 3WNNA 2ZSVA 4A63A 1KPUA 4FQHA 3WY4A 1K9TA 4XNUH 2EDHA 4JFDD 1KGJA 2C7UA 3RWDA 2WM0A 1KWKA 4DTGH 3QORC 3U83A 2NNAA 4K8RH 4LLWA 1PLCA 4OGXL 4XX5A 3V6ZB 5I76B 3L95B 2K70A 1Y6NR 3QIUB 5D72L 3FCBA 2YBRB 2NZIA 3P02A 2P80D 2ZKHH 2QV4A 4DETA 4P5RA 1RLBA 2Z7ZA 4DAGL 1QUNA 4JJ5A 4YDLB 4ZSOA 4JZOB 5C0RH 5J8OA 5BV7B 1KB5B 5DEGA 3KLQA 1VFOA 3P3TA 3TZVC 5CXPA 1T04A 3OKNA 1IZKA 1XZWA 5HHMD 3DSNB 5DHVB 5I8OL 5BUPA 4DPBX 2EDLA 4KO9A 2XA3A 1CFTA 1HSAB 2PCPB 4L0ZA 3S5ZA 4A6YH 3QH3B 2CR3A 2NXZC 1IGFL 1OGPA 4MJIE 4PJGE 4X50A 3IVKA 4N2FA 4H44C 4I5BA 1T5XA 1NSNL 1IBBA 3QJTB 2V8MA 1ADQH 4OZHE 4ZUTB 3JV6A 1DQKA 4YDVB 1Q9OB 4BQ8A 1ZVYA 4GLRI 4CMHC 1ET5A 2BNRA 4KPHH 3H4HA 3RDTB 1PKQA 5DJZA 4PRIE 3EFFB 4GAJH 5TK4A 2NY7L 2Y3NA 1KXVC 2NW2A 3WOVA 1X4XA 3M88A 5ECGA 1I1FB 1WC7A 1WAAA 2ZX5A 2VERA 4YJZL 3N40P 1CYXA 3QEQD 2IGTA 4HUUA 5JXEC 2G0KA 3RL2A 3NJIA 5D2NE 3N1QC 3U82B 4M62L 2DQDH 4KUZL 3T2NL 5D1ZD 1P5VB 1GOGA 5CGYC 3I6LD 4JG1L 1V54B 2EO9A 2G9KA 1V27A 4NBYB 1K4DA 5DJ6A 4RMWA 4M8VA 1HNFA 1RUPL 4PJXE 4PVLA 5KTEL 4Q2ZB 1XR8B 4KKBD 5JXEA 2HRHA 2ZXEB 4ZS6D 3DNKA 2F54E 1NJ9B 2GSGA 4OGXH 1ZS2A 3GPEA 5DYFA 1XF4B 2HG5A 4MCZB 5GZOC 5BV7L 5IJVA 1KB5L 5IW6B 4JM2D 4MGXA 4QRRB 5HI3C 4DAGH 1F1DA 5C0DB 3S35X 4WI8A 3VI3A 2A6JB 5CFAA 4JRXE 1A7RL 3KXFE 1QWUA 5I5JA 2ZCKL 5HJ3A 1YMMA 2MOQA 2ERJB 5D5MF 5AUMB 5I8OH 5EUOF 5EUKA 2CKNA 8FABB 2WWMC 4E68A 1BD2B 2VRQA 4BYHA 2W0LA 3NCJH 4CAGA 1ESOA 4F37K 1LE5B 4C56E 1SYSB 3OKDA 5GZOA 1NC4A 1KCVL 3H2QA 4GXUM 1NSNH 3MUUA 5D6CB 4YX2L 2C4FT 3QUZB 4R2GB 1ZA3A 3BVNB 4AMXA 1E3ZA 2VAAB 5HHNB 3WD5L 3UG4A 2WNKA 4DPAX 5L9DL 2X87A 3PWPE 3KPRB 1OALA 3QE5A 4RFEA 4L3CB 4QYOA 1QLFA 5EF1A 1HL9A 2YPLA 2KZBA 5F72S 4RAHA 3D69A 3TO2A 4G8GA 2J5LC 3KWWB 1B3IA 1YY8A 1WO2A 4XCNB 3BT0A 4BDVA 1HH6A 2IBGA 3FK3A 1PNDA 5F8QC 2QGDA 4L3FA 4M62H 2DN7A 1EV2E 4KUZH 5E4EB 3T2NH 3BP6B 3QJOA 1JZ7A 5D1XC 2K3TA 4JG1H 2FRGP 4YL9A 4DFHA 4PLOB 4NYLA 3SBRA 2EE0A 2FWUA 3TBBA 4UM9D 1KT2A 1RUPH 1SHSA 1AFVL 1JZIA 3T6XA 1HCFX 4WFGD 5KVFL 4FTVD 3MLSL 5KTEH 1SMOA 4NN5C 4Q97A 4OB5L 1YEJL 3KJ4C 2CIKA 3NAAH 2W9EL 5IMLB 1N0LA 5BV7H 4YHNA 1KB5H 3OM3B 4L8BA 1EEYB 4HX1B 4E36A 3FO1A 3VXSB 4PY8I 1L9QA 1KXQE 3APNA 5DRWA 4NBXB 3N43B 1FVCA 3SKJL 1A7RH 3K2UL 2X6AA 2ZCKH 1S7TA 2E4FA 3O4LD 4WJKB 3ULAB 2UZYA 1WFJA 5EEWA 4HIEB 4CNIA 1O6VA 4PJFA 2YAHA 4MTMA 3A4DA 3MO1A 3VXNB 4JGUA 2YAEA 5TE4H 4YXHL 3T09A 3VXMD 5F7UA 3LRGA 1LEGA 2B20A 4TLTA 4JVPA 3NRFA 4ZMYA 4U7SA 3PABB 4YX2H 2AK4E 1ZXKA 4GBXB 1E9PB 2XG4A 4JNXA 3ESPA 3RI5K 1AIFA 3WD5H 4P8QA 4G3YL 2JLLA 1W72B 5L9DH 2XV3A 3B83A 3IN2A 3BRFA 1F4YL 3ESMA 1WS7A 1E40A 4XXCC 3SE3C 1UQSB 4NOBA 2YD6A 4U7KA 1WGVA 5D7IB 2IANA 2P3YA 3PQYB 4U1MA 4NS0A 4PJDA 3TGXA 3FUEA 3QIBB 1KCUL 2BXZA 5DMIL 4P5SA 1EMTH 2XYBA 4NC2B 5DQJA 3MACH 4JUSA 1RJYB 5IHZB 2X6VA 3GRBA 3ARVA 5KSBF 1X9LA 3Q43A 5DJ2A 1KLGB 4XXCA 2YKLL 4ZJ9A 1SMAA 2DMGA 4FLOA 1IKOP 1FJ1A 4UCFA 3ZYOA 3S37L 1AFVH 2WQUA 3D87B 4NC1E 5BRZE 3MLSH 2EVGA 1DQDL 5FX3A 3RPKA 1FNSL 1S9VB 2HFEA 3DURB 4IHOB 3PWJB 1MFDL 2Y6TE 3BN3B 1XH3B 3GMLA 1YEJH 3FUNA 2YD0A 1TO5A 4U05A 2W9EH 3L5JA 4XAKE 4FFVC 3FTYA 4KROB 3WE6B 5CMAA 2LLGA 4Y8DC 3SKJH 5J11B 1ONQA 3K2UH 1X4ZA 1CFVL 1K8DA 1AP2A 4ZFZB 3TH4T 5C0AB 3IPBA 4BCYA 3L8QA 2OX5A 3C5XA 3KPOB 2AANA 3B9KD 5EDXA 1HE7A 1Q94A 4AQ1C 4OD3H 1KJ2A 4IRJD 3UTTD 1HNGA 1BCIA 3TF7C 5A6LA 1YEWA 1ZT1A 3PWUB 2R1WB 3VGGA 3SBWC 4WUUB 4JBSA 4ETQB 4JAMB 4HQQH 3V5KA 4NQSB 3NEXA 3MRKA 5C0EA 2HTLC 4G3YH 5DUML 2VLKE 1F4YH 2E6QA 3HN3A 4IDLA 4PJ9B 3BAYA 2OYPA 1IZJA 2WBKA 1KTLA 4AE0A 3EBGA 3UJJL 5AL0A 5J12C 4AIZA 1OXYA 4N85A 5LDUA 3IB4A 3LKOB 4N26A 4OUUB 5JR1L 4DUXA 5DMIH 3SBWA 1UWFA 2QELA 3S5LG 1GJIA 1CL7I 5T1LA 5GJSL 3UTSD 5HHPB 2ZP0T 1S9XA 3ILDA 4Y7MA 4E5XG 1EHXA 5F0MB 5I5MA 2NNCA 4JX0A 1RZJL 2YKLH 2BP8B 3LN9A 2N3JA 2PP9A 3TEUA 2A77L 3QAZB 4ZODA 3S37H 4U0RB 1WT5C 4XVSH 3EJPA 5FWRA 1AO7D 3KGUA 4FNUA 4AYBA 5DMKB 1QNZL 2IVFC 3LNDA 3MJ8A 1DQDH 3O8XD 1Y0LB 3EDDA 5HVWA 2W0FA 1FNSH 3C8KA 2OYLA 5HHOE 4X6DE 5I1DB 1MFDH 3L08A 2C3HA 2GKIA 1KGCD 4EI6B 1QO3A 5E8EB 2X4SA 1TZHA 1PD6A 2V9QA 3UYOD 1Y07A 4QRSB 2V2WB 3EO1B 1JXKA 1I1RA 4W9CC 5GS1B 4NO3A 4HYTB 9CGTA 3OX8A 1CB4A 5E9AA 4HKJB 3AS0A 3GJEB 1IKNC 1CFVH 3ZDXB 1WT5A 4Y2DC 4KC3B 2DAVA 4I2XB 3ZE2F 3R0NA 4I48A 2CO2A 1DVYA 3RGVD 3D85A 2WGXA 4LL1A 2EDBA 3FRPG 3OB0H 2GJRA 4K7PY 5E2TL 2PR4H 4L4VA 4K71B 2AQ1A 2NY1C 5DUPL 4ZFOB 1FL6B 3HR5B 4K55A 1AKJB 3VGDA 5HYSA 2VCOA 4CJ1A 1NMCB 4EXPX 1U36A 4H25A 1FG9C 3FU8A 2VZ3A 1MY5A 4M3HA 2DI9A 4LBAA 3QJFB 3JWNH 4FKEA 4IM8A 4XOCA 2H1PL 4NWUL 4JG0L 2YEVB 3KDMA 3E2HB 2DEYX 1JYVA 3NYKA 5JR1H 3N55A 4L23A 2PMZA 1GPOL 3W38A 5SWSE 4FXGB 5EOCJ 2Q8AL 1BOGB 4YC2C 1B9KA 4JN1L 1JHLL 2A9DA 5GJSH 1HOEA 5C0BD 5LVEA 4X9IA 2OCFD 1LHZA 2BPBA 4FFYH 4OI7A 3SQBA 4ZNCD 5HYJE 5FC9A 5C09D 5EC2A 3WUWA 1A9BB 3ZU8A 3ZE1E 2WLIB 1O5PA 3P73B 1RZJH 1A1NA 4TLUA 3AJ7A 3KPSD 3K0WA 3NP4A 2O6CA 1T1WB 2OLDA 1QNZH 3PGDB 3UPAA 3WAKA 5CR1A 3WSQL 4YEFA 2EKJA 3DUSA 2CUAA 3C2AL 2JTYA 3DK0A 3L1FA 3T2QA 3U2JA 3FOMA 5SWZB 1MWAA 2CRYA 2A83B 4MA3A 3KD4A 1PZAA 1F42A 1T89C 5DJDB 1BP3B 1QSEB 3EO9L 4H0HB 2WTPA 2YARA 4LMQI 4P3DB 3V2AR 4AW4A 2ZTBA 4PCYA 3C12A 4P23C 3PV6B 4N8VB 3D6GA 3QDMA 5FA3B 4K2UL 1NKRA 1U8CB 1TMQA 5LNEA 1FQ9C 3GSOB 5E2TH 4FD0A 2EDMA 3MV8D 4DP8X 3ZGHA 2B8OT 4RZCA 5DDHB 5E6RB 1AGDA 5IT2H 4IOFD 1AGCA 5F7FA 1DVFA 5GGTA 2JKJA 1XGYL 4P23A 4LCWB 3FUJA 4OLYL 1K8IA 1IBFA 4CDHA 5ISZD 3QDJD 3DX8A 3JV0A 4R4NC 5F7WC 4F33A 2W38A 2A0LD 1MOEA 2E76C 2H1PH 2MQ3A 4JG0H 4NWUH 5AW1B 3FZUD 4W9EC 5M94B 1V7NL 4H26A 2OV0A 1NGWB 1XGUB 2HJKA 1GPOH 4J8RA 1UA6L 1ETZB 1UH4A 2GSIA 4PG2A 4KQ3L 4WKZB 5SX4H 2Q8AH 3WMQA 1PLAA 3KYMA 4B27A 4B95C 4JN1H 1KIUB 3BP7B 1JHLH 1BAGA 2DLIA 1IM3B 3KVDD 4L29B 5H35A 3KZ8A 1JD7A 4LLAA 2HUHA 5IR1A 1EXUB 2BX5A 4YSRA 4QRQB 3R4RA 4D9LL 4OD1L 1KCLA 1U8HB 3H0TA 4Y4FA 1JV5A 4P2OB 5EU5B 3SYPA 4G6AD 3RNKA 5LG6A 2ZX7A 1A9EA 4PS7A 5ICXB 5C07B 2CRMA 3K4DA 4H1LA 4JN2A 4QOKD 1J9TA 2BNUB 4GQQA 1AHWA 3WSQH 5KBPA 1KXTB 4S11A 5J06A 4A38A 3C2AH 4OQTA 2GSMB 2BOCB 4N6QA 4R4BB 2E3VA 2I9LA 1AANA 3MRGB 3MV01 1E5ZA 4JKMA 3STZB 5KN5A 1QFWI 4UQCA 3EO9H 3ZYIA 3ARBD 5HY9A 2CDEB 1TZIB 1OL0A 2ZX6A 4OIBA 4BRVA 2IXQA 5JW4Q 5ICUA 1RAMA 1KC5L 4PP2A 1XSIA 3T4YB 4F9PC 3WFHB 5BS0E 2F58H 3GBNL 3S3DB 4K2UH 1I8MB 4QTIH 3AGWA 2QKIB 3QUXC 4KJQD 5D96C 4LVOB 1XB6A 4N5ED 4BCZA 2VLJA 3V6OE 2ZUXA 3H85A 2CD0A 4NKIH 4NO2A 2XETA 3EHBC 1A14L 3Q3GB 2WC7A 5I5RA 2OBGA 5E23A 1UATA 1PDKB 2YLHA 4S1QH 3FU9A 5L4MA 2CBMA 5K1NA 1XGYH 3QJVB 4OLYH 2DRUA 2D0FA 3DUUA 3NZSA 2I7SA 3L4XA 1TVBB 2AJYL 1M56B 3DXAD 2V7NA 5F6HI 5DF0A 2BOBA 4R97B 3CFQA 4K0OA 4NQEB 4DERA 4M3JA 4XPGL 2YAFA 1V7NH 5E51A 2VQUA 2ZAGA 2EDRA 3RTQD 5LAXB 4A7GF 2EO7A 2D7TL 4PJGB 4KQ3H 4BRJA 2DM2A 2YR3A 1CFSA 2EDKA 3EFOA 5IFJB 4ENEC 5HVHB 1RHHB 1HX0A 4R0LA 1PU0A 3RHWF 4D9LH 3FSVA 4OD1H 2PCFA 3CHPA 1FNEA 4WO4B 1HHIA 2Y36L 4PRIB 5F7BA 1OSPL 4ZQKA 2WO4A 4G9FE 3K7UA 4XE5B 1ZXQA 5DZNA 2WQVA 3FL7A 4ONHA 1IGJA 2PABA 1NGZB 4LPCA 5DQDH 5D8JL 5IB2A 2HH0L 1A4KA 4MZ3A 2GFBB 2CDFA 5A16A 3NIGF 2YPKA 5C6WH 2E74C 3N1PC 3CC5B 2ROYA 3BDBA 5D2NB 2MCPL 5DSCB 2WN3A 1TIUA 5F88A 4J3SA 1XD1A 3BVTA 3S48A 1T83C 5IOKA 2WWOA 1JZ8A 1UD5A 4J6IA 4NZ8A 4LEBA 1ED3A 3C5ZD 3OPZL 5FYLD 2JJSA 5AVWB 3MUGB 1KC5H 4KH9A 3UTPD 4NQUA 2Z31D 4PJXB 4QRTB 1CL7L 2DJ4A 1KJMA 4Z77A 5E6IC 1Z9OA 4N2EA 2F54B 4ZTPL 3CD4A 4F9LC 1RHFA 1RP9A 1TEFA 4X80L 1MSPA 1T7ZA 1D9KB 2ZKMX 4FI8A 1A14H 3ILPA 1T0PB 3TBCA 3MJ7B 1ZVHA 3OGCA 3FRUA 3P2DA 2HAZA 2VSKB 1NFIB 4PJ5D 5GGUB 5F7YC 4JRXB 1PW3A 3KXFB 4JFVA 1YEGL 2AJYH 3QDGA 4OAWB 2H32H 2KQMA 3F8UB 5H37H 3OMZA 4ISVA 5JNYA 5E6IA 5I30H 2DTMH 2PPFA 1RY7B 4LP5A 4XPGH 1BLNB 1RK0A 5EO1B 2WLLB 3MRBB 5A2KH 3N06B 4YZFF 1B9ZA 3BWAA 2HWZH 3EZJB 4UOJA 2D7TH 4C56B 3DETD 1DN0B 4IMLA 3NIDF 3DMMC 2MMXA 4F3FA 5C0ND 4RVBA 4QHMA 5DRNA 1GYVA 5F7KC 4MAYD 3ARGD 5FUZL 1IC7L 3T77B 3ZTJH 5KAQF 1NCGA 2BMKB 2C3GA 5KYYB 3E1F1 2MHAB 3UMNA 1RZ8B 4NKMB 2Y36H 3CQPA 3PWPB 4RRPA 5D1QE 4QWWD 1JWMA 1OSPH 3A67L 3SCMB 3RKPA 1BECA 5JDSB 1CYGA 3GLZA 3DECA 5DD1L 3ULSB 5D8JH 2HH0H 3WTSA 3DMMA 2ZXAA 3ZRSA 3AU1B 4B0MB 3FB6B 4JGMA 1BF5A 3RIAF 3GZQA 3AY4C 2MCPH 1E8YA 2PYFB 3BWSA 2AK1L 4LCUA 4JHAL 2NYYC 3SODB 3OPZH 4PGEA 5EPMA 5CCKL 3IJ9A 3RVXD 5EIIA 4GO6B 5DD0L 3VG0L 4L3ED 5TH2B 1EHLL 3DYPA 3EJYD 3GXUB 2VLRA 3FC8A 3AY4A 1J9SA 1G9NL 5D5MA 5EUOA 4X80H 3UABA 3I75A 4D0DA 4S2SA 2F1BA 4PM1A 4Z7NF 2BVOB 2EDQA 4OZHF 3GJFK 5JO5B 1YA5A 2HT4D 1EFXB 2UYLB 2Y2WA 3PWNB 2O5ZL 4A7QA 1JUFA 2BP0B 3GRWA 2OULB 1YEGH 2E9WA 4ALAC 5KS9E 4JJOA 5I1CL 3J7HA 1LEKB 2XCMC 3QVAA 1KDJA 4HJIA 3LKPA 4AL8C 5I1HH 4EIUA 1YC8A 3GXNA 1ZVSA 4G43A 2ADFL 1SDYA 4Q58C 2PTVA 5IM7B 4ZMTA 5ABDE 1WFNA 4BXSV 2E7DA 1LEIA 4C55A 2FIKA 1XBRA 2DB8A 2IOOA 3M8OH 4PTTB 3LPGA 1X5IA 1FZKB 2R59A 3EBAA 3TN0B 3WFZA 5K9QG 4U6YB 2K1MA 1XF3B 3L9YA 1H5BB 2Q2LA 1WRFA 2AK4B 1IC7H 3ALXA 4XZUB 4HGMA 3LZPA 3QR0A 1C16B 1FL5B 1QNIA 2F7QA 3BKCL 2H3NA 3RB7A 4H5SA 3U9WA 4ENZA 3EJCA 1CGTA 4HJ0D 3A67H 4UF7C 3JT2A 1WDAA 5DRZB 3QWOA 4KTDL 4PG9A 1RCYA 4BZ2H 4U31A 5DD1H 1H3GA 1ZEAL 1D5RA 3HI1B 1HAWA 3KBPA 1FP5A 3MV7E 4P57B 3SPGA 4FI6A 1EDYA 1MH5B 2EEDA 2Y3AA 5EBMB 2ADIA 2FBJL 4ZYKA 2AK1H 3OXSB 4JM4L 3NCWA 4Y9BA 5ITFA 1ITCA 1J86A 2PP8A 4JHAH 4JL2A 1KPVB 3U7AA 2CM6A 4F58H 2NY4C 5EO9B 4N9OB 1AJ7L 3LEVH 4LEXL 4V2CB 5A2IH 5JQ6L 1LQBC 4NPYA 3W3BA 3IFPA 4XCFL 4UM8A 3T8XA 5CCKH 3T0DA 5KOVC 3PYCA 5BRZB 3OC8A 4Z3EA 1Y1UA 3VG0H 4CADB 4JFDE 1EHLH 1HXKA 1T22B 2V37A 3J2PA 2ZWLT 5KSAC 3MLYH 1FHNA 1G9NH 3L3JA 1F02I 3OKOA 4DGVL 4I3GA 4PJIB 3ZIMA 3TEYA 2BP5M 4YOKA 3M17A 1WA1X 5DA4A 4QNPE 2AKRB 4LEEA 4M29A 3RBSA 1EO8L 1MLBA 5FGCE 5GIRA 3UCRA 4CVXA 3K8KA 5JOPD 2O5ZH 5EF2A 3ASOB 1AZCA 4UTCA 2YAOA 5I1CH 2QR0A 3ECWA 4MS8C 4WI3A 5HHME 4EJ1C 1CDYA 4Y2OB 2ADFH 4YFDB 3AAZB 3D52A 2UX6A 3VUAA 4GQZA 4KUCF 2V3FA 2K0RA 3KHQA 3BN9C 1QFWL 3LB6D 4LZKA 3QW9A 3QXDB 3W9DA 5EG6C 5TTRA 1LMKA 3FQTA 3OAUL 4XNZB 4ES9A 5HBBA 4KAQL 1FAIH 1V10A 4HUXA 3BKCH 5GRWA 2VLKB 1FFOA 3TBVA 4KTDH 2CPCA 1OW0C 2X12A 5D2LE 1A1MA 3UIZA 2YIHA 3QEQE 1GKEA 4AWJC 1L4IA 3DGGB