2KLRA

Solid-state nmr structure of the alpha-crystallin domain in alphab-crystallin oligomers
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
82
structure length
82
Chain Sequence
RLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-crystallin B chain
publication title Solid-state NMR and SAXS studies provide a structural basis for the activation of alphaB-crystallin oligomers.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 13
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
A PF00525 Crystallin Alpha crystallin A chain, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2klrA00
3GLAA 2MNWA 2O30A 2Y22A 3QORD 4RZKA 2BOLA 3AACA 3Q9QA 3Q9PA 2N0KA 3VQMA 2XCMC 2KMWA 3AABA 5LUMA 1GMEA 4ZJ9A 3L1GA 3GUFA 4PCKA 1X5MA 3QORB 3GT6A 4MJHA 2CG9X 4YDZA 4YL9A 3EUDA 4I88A 4YLBA 5DS1A 1WGVA 5DS2A 4YE0A 4M5SA 3VQLA 4ELDA 1WFIA 3L1FA 4M5TA 2RH0A 4JUTA 1RL1A 1EJFA 2Y1ZA 1WH0A 4YLCA 2N3JA 4FEIA 2WJ5A 2Y1YA 3QORA 2CR0A 3IGFA 3J07A 3W1ZA 2JKIS 4JUSA 1SHSA 2KLRA 2K8QA 2WJ7A 3L1EA 3N3EA 4PBDA 3QORC
chains in the Genus database with same CATH superfamily
2JJSC 1JHKL 1BXXA 1E2ZA 2ZWLT 1DDHB 3II3A 2XY2A 3IFLH 1QSED 4WIQA 1IC5H 2C4FT 1U91B 4JN1L 3DGCR 2ZKWA 5IIEA 4JVUA 4FLOA 3OMIB 4B97A 1TZOA 4OZFG 3RFZC 4JCLA 1A4KA 2NRDA 4ADGA 4C4BA 4ONFH 1CD8A 5DR5H 2CAKA 3VFNB 3ZOAA 4KXDA 5HVWA 5IW1A 1UGNA 5AUMB 1L6ZA 2WMPA 2WXGA 4NQEB 3SOBL 2X4TB 3UXFA 3OLIA 1S7UB 1SM3H 2Z8VC 4CAGA 2CBMA 5LXVA 5LWYL 3GXPA 5LBGA 3FUJA 1LP9F 2A38A 1MJJA 2WBXA 2VUKA 3MROB 4O4YH 3FTYA 4MA1B 1KB5H 5TD4A 1OAZL 1U33A 3CVHA 3GSUA 1EHKB 5KYUA 2VLJA 4LKCB 2BZDA 3K2UL 1MHCA 3K71B 3H3KA 4MD0A 5ERWA 1F86A 2I07A 5FFOA 2ZKMX 2WQXA 3CBJB 1SGKA 3OKMB 1MQ8A 5C70A 3V52L 3TH3T 2W1NA 3VWKA 2X9XA 3LXAA 1LO2L 4GBXD 1RIVL 3S5LB 1KBPA 4UQDA 1M7IA 1A47A 2YPLB 4GOSA 2V7NA 5DWPA 1BG1A 3UBXB 2KZKA 4J28A 3N9GL 4POYA 5DMYA 4M6ML 1U8IB 3UTTA 5MERA 3M1BB 4XOCA 4AVHA 3BP6A 3KPPA 5DEZA 2ZSWB 3C6LD 4MA3B 1RUQH 2VB5A 3QULB 4PJ7B 3LQMA 2DIEA 3TA3B 3I6LD 3TYGH 3CUPA 4XPAL 2Y7NA 5FA4A 5IMKB 1AD0B 2VXSL 1JRHL 1BD2A 2F53D 4NBXB 4LLWB 2VLKB 4M7LH 1QWNA 2L7UA 4ANKA 2FEEL 3QEQE 4ZUSB 1KCBA 3C9NB 4Y5YA 4OFYD 5GSRA 5GS0H 4MQXC 1E3XA 3BAEL 3WY1A 3NJJA 4ZG1A 4IEFB 1OGPA 2HG5B 1UACH 2Q7YA 2WSDA 2APBA 3LZPA 4FFYL 3CLFH 4DH2A 1PYWA 3IJHA 1DJWA 1A21A 1QBML 1XAUA 4J3UA 5FO7A 1ZIAA 5ICXB 3SHSA 2GJ6D 1KENL 4MASA 1F4YH 5DHVA 3RDTC 5D7IA 5ITFA 5E08H 5F9WC 5FKPB 1MLBA 3MGOA 4JAMB 4LSPH 4LMQI 4PV8B 4CJ1A 1KIUA 3BX7C 3FT2B 3BHBB 1FZOA 4FXGC 1W16A 3AS2A 4B9JA 1XGQB 3II2A 3IDXL 1TTBA 1KIRA 2CXKA 3E9UA 4BWUA 5D2LF 4PTUB 4PJHE 3HN5A 1ZHLB 3WFCL 2R2BA 5KVEE 2YAOA 5D96B 4B6ZA 2HH0L 4IRJA 2K3TA 1RZKH 2UXGA 3TFKD 3FN9A 5C0GA 1WZMA 1QA9A 2V3FA 1YA5A 4QHNA 5D7EA 5KVGL 1Z9NA 1Q1JH 2QR0B 1A3QA 1LE5A 2MHAB 1WZKA 1HSBB 2EDEA 1EMTL 5FCUH 4WGKA 3P4MA 1OM3H 4HEME 5A16A 1FGNL 1I8UA 3ABGA 3Q5OA 3UACA 5I74C 4EQ3A 2PYFA 3MRNA 5ECGA 4H20L 1QSFA 2YEVB 4I3RH 3WXVL 3D34A 2CHDA 5L88L 2GUOA 4NLHA 5C0EA 1BOGA 4ZD3L 4EI5C 1T03H 1X9RA 2ODHA 4XBEL 3D3VE 4HETA 2VR4A 5CJXC 3VFRB 1MHPH 4M43L 1T20B 2L3BA 2CCWA 3HS0A 3DDGA 3MYJB 1AQ8A 2L04A 2YD7A 4ODUB 1RLBA 3PWJA 3DJRA 2UZIH 4DN4L 1OAKH 2RR3A 1I1AC 3FH7A 5D4IA 1NCGA 1THCA 1TEGA 3WAKA 4MXVE 5EEXA 1M57B 3LRLA 3W9DB 3RG1C 1U2CA 1NCCH 3HPJB 2JTDA 4GG8B 3VXQA 3KS0J 3MRHB 3I6KB 4HS8L 4NKMA 1HILA 2EYRA 2WLKA 2WN3A 1HL5A 1SOXA 4AMKL 4HJJH 4QRRD 5ID1A 1MRDH 1JDDA 4TVPE 1IAOA 1YPZE 2AJYH 3FN0L 5SWQB 4JE0A 3V6OA 3QEQB 5FUOH 1E2WA 1PG7L 2ADYA 3TCLB 1NIFA 1RK7A 1EAPA 3ZUCA 2ESVD 4E9VA 4R4BB 3RUGE 4BK4A 1HESA 3L6FB 1M4KA 2JKLA 4EVNB 4LASL 4NJAL 5SX4H 3IFOA 1E9PB 2DQUH 3VX0A 3ZYZA 4JG5A 1QATA 3SDDC 1L4IA 5E5MB 3RAJH 4Y2DB 4YXHL 3NK4A 4JDVB 1KOAA 3C5ZD 1PZCA 5EA0L 4QXTB 3QPKA 4XPHL 5DJAB 1W72B 4OZGE 2P9RA 3IFPA 4MNQE 1KTKE 3C60B 4M6NL 5DA0B 2FQDA 1DL7L 4HLEA 1YY8B 2OP4H 3CH1A 1EO7A 3CDZA 4B96A 4JPQA 2EVIA 5AQ0A 1QBBA 2OS7A 4NFDA 4AGOA 1TCMA 3UZEC 1RUMH 5LBSL 3CZGA 4EI6B 5DSCB 4IKKA 5KANI 1WO2A 1XCTB 3HG1D 2BNUB 3HRZC 3TNNB 4ELMB 4NPKA 5BVPH 2UZYA 4X5LA 5EBLA 2MQ0A 3BISA 4N8PA 4XH2B 3HS8A 5GGQL 4DGYH 3KPOB 2W59A 3BE1L 4MX7B 4H1LH 1IEBA 4ZTEA 4LZKA 3QI9B 2K4AA 3BIKA 1HHGB 5J8OA 3H0TA 4OCSH 3VD3A 1PG7X 4HUCA 4IBYA 3RWJB 3VQLA 2FGZA 3PE9A 3H7BA 4IRSC 1QASA 1G7LA 2BHUA 5FB8B 4G5AA 4N5EC 4R4FH 4L8SC 4ZK8A 1J88A 1A3RL 5HYSG 2ATPB 4OU3A 4TYUA 1AQKL 5BZDA 5JORA 3GZPA 4R96A 1ZHBA 3UC0L 2EH7L 4PPTA 4JNXA 1A6PA 4GLRI 5I0WA 3D3VB 4A2MA 1T5WB 4U3XA 5ELIA 3TIDB 2NNFA 3QIBB 4XCCL 2CIIA 3ZT5A 2F1AA 3KLHD 3BUTA 4PY8J 5JDSA 3DX2A 2AF2A 5F7EL 15C8H 5LAXA 3FQRB 3BVNB 1P2CB 4OLYL 4YUEL 3CFNA 3VJ6B 4Z7NF 4KPHH 5EOCJ 3V0DA 2P7TB 2E6QA 4TSCL 1EVTC 3GMQA 1LGVA 2JCWA 1ED3A 1UT9A 3QRLA 5IKCB 2J71A 2FYVA 3H4HA 3WEOA 2IH3A 3VXOB 1YC8A 1GGBL 1ET8A 1JXJA 1WG3A 4QXUH 3WEMA 4PLJD 5CIPA 5ENWB 3WHE0 3WJMB 1AKPA 5J1AA 3TEXA 4HG4K 4XAKD 1YCSA 2H41A 3WXWL 4WWKD 3TGXA 3QPXL 1UJTA 3U83A 1YPZB 2E46A 3F6JA 4B50A 3GHEH 4GFXA 4TQIA 4BQ8A 2FYYA 2YPVH 2XZQH 1GJWA 2DWXA 3ZKNC 5I76B 2FD6H 1DBBH 1KCRH 1Q72H 2WQ8A 3QAZB 2NY5H 1BAFH 1BDYA 4HWBL 4M5YL 2WOYA 2IDSA 4TM9A 3N0PB 3RUGB 3DX0A 3UG5A 5A6IA 1LTXA 2JIXB 1CURA 4F7MA 4BFOA 3DYMA 1F2QA 4GUOA 4R97B 1TNMA 3NESA 4RNRB 4AM0A 2GIMA 3BPOC 5AB1A 4LPTA 4KC3B 3V5DB 1X5LA 1F8TL 1N3NB 3V4PL 4UM9A 5E0FA 4OZGB 5I1AB 5E6RB 4MNQB 2C5DC 1ICTA 1C16A 4O02B 3C6SA 4N2LA 3CZNA 3PDOA 2F54D 4M3JA 1U41A 2DMCA 1BGXL 3P4OA 4BYHA 1J8HA 2E47A 2BP8B 3AREA 4NQQA 5HI3D 1UZ6E 1Z5LB 2PR9A 3LPFA 3N1PC 4FQCH 3VFMB 4RAHA 2NNAA 4NT6A 3WJJC 1UM6H 2O6PA 3J07A 4DHLA 3DVIA 4JM0A 5DD1L 1TZHA 1HOEA 3ARFC 1FSKC 4LVHC 4D8PB 1UQSB 4DSYA 5J6GB 5E8OB 3ZTCC 3CVDA 2XBTA 1J5CA 4GRWH 5GJSH 2PMZA 4LP5A 3TV3H 3OKYA 2R1WB 2BC4A 2W65B 1TCRB 1A7PH 3VI3F 5HYQB 1IM9A 2QQKH 4Y1SA 3GS7A 1IC0A 1BHGA 1VGEH 2FIRT 1AR1C 1DJIA 4UQ3B 1G6RH 3EOAB 2VDNL 3G6AA 5AB2A 2LTQC 2VM3A 3F7YA 4KAQH 5G5DA 4JKNA 4FNPA 1AIFA 4P23B 1U95A 2CDFB 4DKFL 4ZXBA 3DIFA 4L4TE 1CFVL 4JANA 4FG4A 2VLJE 3HZMB 3ZL4H 2WXHA 3Q1SH 1U4EA 3FTGA 3NJLA 4ONGH 4XVTL 4CGUB 1PX3A 4L3EB 5CD3A 1BZDA 1W91A 3FUHA 5SWSD 5I9QC 3HHSB 1AMYA 2Y7MA 3ULVE 1JPEA 2F74A 4YIQB 1OALA 2B1AH 3ZHLA 5HYIA 1RULH 1KJ2L 3L5JA 5JPNA 3QZWA 3FCBA 3JYBA 5AEAA 3EBHA 3NG5A 1SJMA 4M02A 4X8CA 1MFBH 1EVUA 3ULUE 4ABVA 2HTLD 1KULA 4TV3A 2X4PA 4OKDA 2G0LA 5C0DB 2IALB 3BRGC 3O8XA 4A7SA 2XPGA 2WKGA 4MMYA 1GS7A 3V6ZB 4GI8A 2CRYA 1OB1B 3ENEA 1MFDH 5I1IL 2VH5H 3CFJA 5FM5O 3SGEI 5GIRB 1IBBA 4GO9A 1KF9B 1SMOA 4FC3E 2AJSL 4PUBL 3JWOH 4OUUA 3IXTA 4YLBA 4N2IA 2CO7A 2Z92A 3GINA 5I19L 3FUMA 2CK2A 4RGOL 1FZKA 5D1ZC 1T22B 3ZHFA 5I16A 1WYJA 2XA3A 4FQXA 2WTRA 3D07A 2BY0A 4XPFH 5TFSL 4TF4A 2LABA 4QRUA 4NAQA 3V4VB 3LJ3A 1PZUB 4WI0A 3FPXA 5DI8B 5KUKA 3NIGF 1DQJA 1DQLL 1H5BA 3QNYA 5AYUH 3GJFB 4G6KL 1U4FA 1JFHA 3LB6C 4HWEH 3PWVB 5F6HJ 3IRCA 1U3HA 4I9XA 4BQCA 1ZT4A 2IC2A 5D7IE 3KPMA 3RNKB 4FNUA 1OPGH 2AQ2A 3OWRA 1G9NL 2IAAC 2E0PA 2ADIA 1UWEL 3JWNC 2DM7A 4K3EH 1N6VA 3GK8H 3TVMC 1BLNA 4YFDB 4X98B 1G9NC 5B1CA 4AC4A 5IIEB 5DEGA 1FYTA 4MZ2A 5FYJE 2M8XA 3TO2A 4XCYA 4XXWC 1A4KB 3BAJA 4L9LC 4KKAC 3ZBMA 5KN5A 4TULH 5IW1B 3SDCC 1RJYA 2WMPB 1RUKL 2EDDA 3BH4A 4BBWA 3POCA 2NTSP 4WI3A 4GSDL 5TE6H 2UUDK 4JFEE 5E56A 4AEIL 3LMJL 5F8QC 4FZ8H 1MJJB 1U8MA 2JXMA 3GWJA 4XP1L 4AKPA 3QVAA 1KJMA 4KO9A 5JHLH 4ODHL 1VEMA 4WWID 1QSEA 4YBLB 5A7BA 3CVHB 3GSUB 1A7RL 1YZZA 2PW2A 2VLJB 4UMSA 5KYUB 1MHCB 3HMWL 3MV01 4MD0B 5ERWB 1CQYA 2XX1A 5I8KH 3B56A 1QSVA 1QSFE 2I07B 5GRWA 3Q6FA 4AQ1A 1I3GL 3VAEA 2A6JA 3F84A 3QG6A 4FMFA 5AALA 3FU5A 4MCYA 5D8JH 4XR8C 1YY9D 4LHJB 3VWKB 5I1KH 1MRCL 1XD1A 5F0LB 2ARWA 3PCYA 4I18C 4JPKH 4BQ6A 4S1QL 4ZW7A 1M7IB 1E50A 3OPUA 5F7WC 2V7NB 1PDKA 1PZ2A 1CICC 3RJDA 4NM4L 4LSSH 5I1JH 1MFAL 3UTTB 1ADQL 4NZDA 5MERB 4GMTL 3HB3D 4N0FA 3BP6B 3MRIA 2K6YA 2X4QA 4HPOH 4YK4B 5LG6A 3CUPB 3IJYB 2W91A 1A6VH 5FA4B 1K8IA 1BD2B 2OTUA 4QF1A 1SEQL 1ETA1 5DT1L 3L3GA 2DJUA 2YQ3A 3V6OE 4GBXA 4ZFQA 1DFXA 2OI9C 3OQ3B 4Y5YB 3FTZA 3L9RA 5CM1A 5GSRB 4OCYH 1IJ9A 1KN4H 4XNYH 2OR7A 5DC2A 2N4IA 3DXAD 4QMEA 2Q7YB 3COOA 4IRZA 2IQAA 4FYTA 4PU2A 1PYWB 1B4LA 3IJHB 3C6LA 1BOYA 5FO7B 4MLSA 4GY4A 2VR7A 5CUSH 3QYMA 2VQ4A 5DHVB 3WIFA 1TZGH 4Q9QL 5D7IB 5ITFB 1NKRA 4MLIA 1MLBB 3IFNH 4Z5RA 3MGOB 4BK5C 3DSNB 3CFKA 3JTSA 4FEIA 4JRYE 1C5BH 1KIUB 2F58H 1FZOB 3GM0A 5F1NA 4KDVA 3RVTD 1FIGL 4OFYA 3TBYA 4JO3L 3UBXI 1OHZA 2Q9OA 4X83A 5D7KD 1INQA 2R2BB 4X9FA 3T3MF 4IRJB 5E0QA 5B39G 2EVGA 1ZGLM 2GJ6A 1OSPL 4W9CC 5C0GB 1HEZA 1FFTB 4QHNB 3KDMA 5IT2L 3VQ2C 4TNWF 4M93C 1EPFA 4EDWH 1LE5B 5H37G 4JFFD 4XBMA 3T08A 1JYWA 2GTWA 2ADGA 3WBDA 3GM8A 3P4MB 2OMUA 3W11C 1CDCA 5I0VA 1TF4A 8FABA 2CNZA 2PYFB 5HI5C 3MRNB 4JQIL 4GP4B 3QUYD 5C3IA 1QSFB 2P8LA 1FO0H 3B1TA 5K59F 2GUOB 4GINA 5C0EB 1BOGB 2OW7A 2WXNA 4K9EL 1RURL 4OY9A 1QMUA 5FECA 2PCYA 1HYSD 2PR4H 3F7PC 4JR9L 1GIGH 4JG9A 4S1SL 4JHVA 5IG7B 2FX7H 4K9EC 3HS0B 1NL0H 3CN2A 3CE1A 4JDEA 4S11A 2F5BL 3MU3A 1OP9A 3GZOA 3PWJB 5AD0A 2NXZC 5C9JA 2FQFA 3U36A 2J8UA 2VSCA 4N1EA 4CILA 1UM4L 2EC8A 2ZG3A 1R3HA 4KMLB 4G82A 1E67A 3VXQB 3BQUB 2P8MB 3APFA 4NKMB 2X2HA 3NJXA 3E0GA 1HILB 2EYRB 3OAYH 1DSFH 4BXVA 1P5VA 3RTQC 3AY2A 2EXWD 3BUQA 3GMLA 4NCDA 1HZHH 5FYKH 5ID1B 2Z7WA 2DTSA 5DMIH 5BNXD 1UWXH 4RFNC 1RJLB 4BKLA 5B3JF 4U31A 3GMPA 3FB6A 3I2CL 1D6VH 1SPDA 4GS7B 5I1EL 2AEOA 1I85C 1EAPB 3DO4A 5CZVH 1CG9A 3KPSD 1JZDC 3INUH 4J3SA 3I9PA 1T1YA 1YRKA 3C5SA 4XNUL 4KK8C 4K5NA 1KBGH 3CSGA 4FQIH 3KJ4C 2QKIA 1FDLL 3IFOB 4JFVA 1TZIA 1F00I 2G4GA 4Q14A 3DYOA 3TH2T 5AFAA 3CK0L 2ROXA 4HUKB 1GYAA 2R69L 3VDCA 4JHAL 5LN8A 3OMAB 2ZSVA 3ME0A 4HWZB 4QRRA 2FNWA 3RPKA 3IFPB 1V54B 1NCOA 3UJTH 1M05A 5IJBC 1C5DB 1OARH 2HRLA 4JRYB 3KPRE 1TETH 3CDZB 3CH1B 4P5SA 2W0KA 2JJVA 5K69A 4UQAA 5GGTL 3KW7A 2VXQL 3ZR5A 1YQVL 3ZTJH 5FR3A 2D73A 2ESVA 4E9QA 3FCTA 1A9BA 3QUKA 3MKGA 4UT9L 4K8RD 3SDAC 3ZX1A 4OF6A 2IV8A 3IPBA 4PJEF 1UUNA 4AYGA 1V7ML 4I87A 2HX7A 3EBIA 4FGMA 5CD5D 2UZYB 5EBLB 2YRLA 3UTQA 1DVTA 4J3OG 2C3XA 3SDXF 5T1DH 3BXNA 1I53A 2WXKA 5ACLA 1HE7A 4LNRA 1PGRB 3C5ZA 5IQ7L 3MJ7A 2WXJA 3ESPA 2HMIC 1IEBB 3KPLB 2KLRA 5DQ9A 1AANA 2VMCA 3BIKB 3MACL 1MCOH 1CYWA 3H0TB 3L95A 3GLEA 3LZNA 1MCPL 4H26A 2Q2LA 4I8DA 5IF0A 5KG9A 3D12B 5IV2A 3UMNA 1AGEB 1A3ZA 3DIDA 4K3GA 4XO4A 2Z8WC 3H7BB 2VKXA 1G7LB 3TC9A 4JO4L 5TDOA 3MXVL 5DYFA 4JEGB 2PP7A 2K1MA 5BZDB 4GRLD 5EZJA 1E40A 1ZHBB 1K9TA 1TLKA 1V7NL 4G43A 1KB3A 4R96B 5C0BD 3HG1A 2OMVA 5EBMA 3REWA 3IJSA 1KYFA 3GHBH 2NR6D 3EJJX 2CIIB 4J4PD 5JDSB 4FYRA 4OIBA 1G9MH 1EEZA 2VZ1A 4GXUM 4YDIH 5LDUA 1JPST 4OGZA 1AFVL 2WZ6A 1WDAA 3EJSA 5FGBC 2OMTA 2FQEA 3GMQB 3DSFH 1ED3B 1LHZA 3T4AA 2IH3B 5CCJA 4P5KB 3FFDB 4IMKA 4AC2A 5CIPB 5T5NG 2XKSA 4PJAA 5CR8A 4Z0BH 5J1AB 2BXYA 1OAUL 3NA9L 4FNQA 4HOWA 1I3VA 1EZUA 5FUCE 4ZMLA 3W3BA 3LX9A 2J6EH 3U48A 1F4AA 3QUZD 1GHFL 3U82B 1JXFA 3WFDH 2VN4A 2FYYB 1RHHA 3QORD 4FXKC 1E8WA 1KGUA 1NAKL 2XWTA 3B2UD 3UGXA 4KRPC 1IBHA 5D6DA 3UAJD 4F7MB 3BSGA 2QFRA 3AXIA 1ULVA 3R18A 3K8KA 4JFWA 2HX8A 2BX5A 3QG7H 3CIQA 2IMMA 4MNGA 4WWKA 4UM9B 2I26N 4LOUC 1RK1A 3WNNA 4ZX4A 4XP4L 4NN6C 4DZBA 1U36A 2LU3A 5I8OL 1C16B 3I85A 3C6SB 4LIQL 2PTVA 1IKFL 1O6VA 1UXSA 3PDOB 4LCCA 2OTPA 4CW1B 3AREB 4JW3A 3P0YH 4PS4H 2NNAB 4NT6B 2FJSA 2CBQA 5EEWA 4H0GA 2NW3A 1TZHB 4DN3H 1FYTE 4XMPL 1KCSL 1F3JA 3FUFA 4Z7WA 1RKRA 4Y89A 4FYSA 4KDTC 4BFFA 1QHQA 2AZAA 2AHIA 1MAKA 5DLML 2BC4B 4HJTA 2BIQA 1IM9B 3E8VA 3IBEA 2NW2A 2IDFA 3D48R 1MJUL 3G6AB 3NFSL 4RDQG 1BQHG 3EJCA 1A7OL 1AIFB 3CVCA 4N3UA 5G5DB 3ARDC 2F54A 5A2AA 1K6QL 2PTTA 4G42A 3GSOB 4ZXBB 3SYPA 4DUWA 3DIFB 1QSEE 4E41E 4JANB 5EC2A 3E8UL 4GIOA 2Y36H 1KIQA 1RK0A 3FTGB 2ICEC 1PQZA 3WN5A 2KBGA 1FVDA 5CD3B 4P2QD 1ZD6A 3IT8D 2VJ8A 3F83A 1PTZA 4E5XG 5MEOA 1J10A 1OZUA 4N2KA 1KELL 1AXTH 4M56A 3TZVD 1KCKA 1ZPLA 3VG9B 5JPNB 1MH5A 3QZWB 4PW3A 4HISA 4YO0B 2HRHA 1K5WA 4OLWH 2OMWA 3NZHH 3QDGD 3GKWH 4WK2B 1AHKA 3DRQA 4WFGD 1WBXA 2QPFA 4H0IA 2X4PB 3O8XB 2XPGB 4BZ2H 1JP5A 4MMYB 1AZZC 3WS6C 5M7QA 1UH3A 3BJLA 4AJWA 3ZGHA 2WV3A 3A47A 4K3JH 4XWOD 4R84A 1K3ZA 3OLGA 5SWSA 3MJ9A 3CFJB 4RISL 1WT5A 2XQYG 4ACPA 4OUUB 5K93A 2CO7B 1OLZA 2Z92B 1W80A 2NY3B 5BV7B 1FZKB 2FECI 5JHMA 3VGAC 1IC1A 1DVFC 1SMAA 2BIMA 2P45B 2J3SA 5FOJA 5I16B 4FQXB 1MVUA 5LQBH 2LVEA 2WTRB 3QWQB 5CR1A 4QRUB 4A2EA 2FO1A 5C2BH 4KDWA 4POZC 4WI0B 5CINH 3WIHA 1DQJB 5AKSA 1LEGA 3H3PH 1H5BB 1I3RA 3L4VA 3QNYB 4KKLD 1HINH 4YXLH 5FYKU 4PJIA 4PGDB 3SPIA 3WNIA 3H6JA 3I6LE 4FP8H 1NCWH 4D3CL 4DUXA 1U3HB 3B7YA 2VSKB 1ZT4B 3EYOA 3VI4F 3KPMB 2F53E 3HG3A 4HLZH 4CGTA 1JGLL 1ZOXA 2ADIB 4MXWL 5TQ2L 5I24A 3PABA 1BLNB 3D33A 1NCHA 3Q5TA 4LDEB 4MZ3A 4R8WL 4ZODA 5E5RB 5F2FA 1J7VR 2R4RH 1SN0A 5AB9A 2YMTA 5DEGB 1FYTB 3A4FA 4URTB 3FT9A 1KG0A 3VVVA 2EEBA 5GSVA 5F0PB 4JUSA 3KPTA 3DX8A 3HAEA 2GJ6E 4P2OD 1DTUA 4OFKA 1AZNA 2WINA 3S34H 3ASOB 2CSPA 2CUAA 1U8MB 1GYWA 5HJDA 2DB8A 5I75C 3PFUA 1KJMB 4LSVL 1VB9A 1AGDA 1QSEB 4XI5C 4BDVA 5J56B 2PW2B 2OJZL 4TTDC 4ZMPA 5EIVA 3L3OC 2DQHH 4N2GA 2LOEA 1BIIA 3Q6FB 4AQ1B 1WE5A 5DYOB 3HA0A 3US0A 2A6JB 3QG6B 1QFWI 4MCYB 2H9GA 1EGJA 1M53A 5EPMB 2GBAA 4RMWA 5E4EC 3I3BA 2HKFL 5GHWL 4JBSA 1ZDQA 3CAFA 2CO6A 4R3SA 3V0WH 3QCVH 1PDKB 3KNBA 4JG1H 1NDTA 5FO9A 1RMFH 2JNZA 4IMLB 4A1RA 3RX5A 3IPFA 4N0FB 4OF8A 4QXWA 1Q0XH 3MRIB 3O2VL 2WXIA 4N8VA 4UI2A 2X4QB 2R8SL 3W37A 5C86A 4HIXH 1K8IB 2GG1A 4B95C 1S7RA 2OTUB 4QF1B 1Q9KA 2DF3A 3MLVH 4FJYA 4F24A 2WYIA 1S3KL 4IOIA 1BJMA 5HGGS 3L3GB 5JOPD 3ZDWA 1WEJL 4BGLA 4GBXB 4EIGB 4X2UA 5GGVL 3L9RB 3M8OH 1L7TH 3UG3A 1CGTA 5AOKA 1TZAA 4HOMA 1OWWA 1MPAH 1NPJA 2PPCA 2QHLA 2IQAB 3QUMA 4CSPA 2FCBA 4YDNA 4IGBC 3C6LB 3NJMA 1TQBB 4JHWH 1V55B 4S1DC 3WIFB 1QHPA 2F53B 5JPMA 4N2BA 4MB5A 4QRRE 1EFQA 1JTOA 3CHQA 2BIIA 4Z5RB 1WHPA 1OANA 3NFNA 5B8CC 3RKDC 2H5UA 3KCPA 3CFKB 1IGML 3JTSB 2A77H 2VRKA 4X5PA 3BUIA 4N8CL 5F1NB 1KC5L 3TBYB 2Z8RA 1ZK9A 1JYNA 1KCUL 2ESVE 3ZQXA 1TYRA 3S2CA 4EKJA 3IGAA 3DXAA 3N42F 2ZX6A 4JY4A 5LCVL 1UXWA 1INQB 2NNXA 3MI6A 3QT2A 3LS4L 2CGZA 3D9AL 1JZ5A 2GJ6B 1HEZB 4Q6IA 5LNDA 3KDMB 4B5EA 1JI2A 3CSTA 4FYQA 4JS7A 2SEBA 2MCMA 3BPCA 3G6DH 4RMBA 3TEUA 1QD0A 3MFFA 2GTWB 4GKZA 2ADGB 2OMUB 4PJ5D 1PVHA 3I50H 3AAZA 4X6FA 4YWGH 4XHJC 4BHUA 1K5NA 3OHXB 1TVHA 4YHMH 2FX9L 1K2DA 3A21A 3T2PA 4Z7OF 2P8LB 4RQQA 2WCPA 2J7LA 4P4KD 1RZJH 2Y23A 4JFOA 1CR9H 2KKQA 4I3SL 3U6RA 4CU8A 3HG1E 5FECB 1SLVA 1CFQA 3OKDA 3LH2L 4WFED 4WNQA 5CFHA 2XZZA 1NEZA 4Y9BA 3SBPA 3UC2A 1WV7T 4BFNA 4JFFA 3T0XA 5ITBL 2ZXEB 5DJDA 5AD0B 3VD4A 5C9JB 2YK1L 3IRZA 3U36B 3BEWA 1KEGL 5CAYB 2UXTA 1WAPA 2YSSA 5IHUH 1R3HB 2B39A 3ML8A 1TZ8A 3OG4B 4WGWB 3MAWA 1OAJA 2PYEE 2ENJA 3QUYA 2BVEA 2NY6C 2XZAL 4YSCA 5T5FL 3X3GH 4PJAE 4JO1L 25C8H 3GXFA 3HEIB 1P5VB 5JA8B 3GMLB 1FP5A 3T09A 5A7EA 2IH9A 1PIGA 3N41F 1TFHA 3RYMA 4MJIA 4BKLB 3GBMH 5KVDE 1IGJA 3FB6B 3GMPB 3T0ED 5EEUA 4KOCA 3TA4D 3P4LA 1BVZA 3LZLA 4WUUD 4XO8A 1QEWA 1WCBA 4FABL 4B5ZA 1CG9B 4OAWA 5LGYA 1T5KA 3LS5H 4L1HA 1KSRA 3EDKA 3QDJD 3UP1A 3VTAA 1JGDA 1T1YB 2IPKA 3C5SB 1N67A 2O6FA 4I5BA 4XC3L 2QKIB 3FH5A 3QXUA 4JN2A 3CMOL 3R06A 1TZIB 3R7RA 2XNAA 4ONOA 2Y06L 2FHFA 1W72H 2PP8A 2Y07L 4EBQL 2A1WH 3BUDA 1QR1A 2Q3XA 2ZSVB 3ME0B 4X0NA 4XAKE 5DC0A 4QRRB 1OAYL 3LKSA 3A5VA 5I6LA 2VJXA 3DI3B 4BZ1L 1AYOA 1KDIA 1M05B 2XG5A 2R0ZL 3RU8H 3ZE2E 1G7HA 3KLDA 1DEEA 1ZTMA 5E6ID 4ORGA 3ARVA 3SQOH 5KVEH 4KK5C 5KZCD 3Q13A 4AMWA 2ESVB 1AE6H 3FCTB 1A9BB 1P5UA 3KPSA 2EXYC 2XXMB 3QUKB 3JV0A 4GQZA 1ADWA 1IB5A 1RVFH 4GW5A 3AMLA 4UV4H 1E4XH 3WIAA 3GXMA 4ZMQA 4FG0A 1B0IA 3EADA 2GPZA 2OMNA 4BK8A 1QO3A 3UTQB 4F8OA 1MWOA 1QKZH 1DBKL 3BXNB 2Q87A 4LNRB 1BZ9A 2CR6A 3C5ZB 3CDFA 2WZPD 4M4PA 3MJ7B 1TPXB 4PLKC 5ACMA 4PWHA 4AGLA 3B2DC 1B3JA 4OW6A 4UBDC 1YJDL 5DQ9B 4MGXA 3C2AH 1G5AA 4H26B 4LSUL 4M3HA 2WQUA 5IF0B 5KG9B 5IV2B 1F6FB 4LSQH 4LPUA 1NGPL 2F54E 2WWKT 4U1SA 4DO6A 1SBSL 1UB6A 2YN3A 2NSXA 5TDOB 2C8NA 2CR3A 1RJZA 4PWJA 2PWHA 3DC0A 3LZFL 4RGMC 5E51A 3N3EA 2G2PA 3RJQB 4YDKH 4G43B 2RALA 5E99H 3HG1B 2OMVB 5EBMB 3REWB 3RL1A 3DO7A 3IJSB 3NCBB 1ZV5A 2GCYA 1XT5A 2X40A 4AEHL 2D31A 2DIJA 2G2RA 1EEZB 4TQPA 4UTBL 1DSYA 4N4YB 2DYSB 1UD3A 2ADFH 3TN0C 1MZZA 1FBIH 1NBVH 2PPDA 3L1OH 4ETYA 2OMTB 4RH4A 2CNYA 1TMQA 5EORH 2V5SA 5EO1A 3T4AB 1H0DA 3NMEA 4I13B 5HHPA 4JFYA 1ZLDA 3THMH 5DC9B 4TVPH 4PJAB 4K71B 3BDYL 4ATTA 1RUPH 2LLLA 4UZSA 5C0BA 1OZTG 5SWSE 3V95A 3WSQL 5LXGH 1E5UI 1AHWA 4OSUH 2NR6A 2DTML 4FD0A 4J4PA 4TUKH 5ECJE 2ZYHA 3FFCD 4NEHB 4YBHA 3K6IA 4WI2A 4C55A 1QNZH 3QGVA 1TQSA 2VR3A 2ERJB 4FFZA 3DX1A 1RHHB 3FMGL 4OT1L 3G7TA 3WHXA 1INEL 2DLFH 5GRZA 3G08A 1S78D 2XWTB 4WWPA 3V7AE 4PHXA 1ETZA 2E6JA 3KLKA 4U1JA 5EBGA 1E6JL 2BS71 2DQMA 1NGQL 3CLWA 4PBWD 1U8PA 1J9RA 4O02H 4PV9A 5AZ2H 3VG0L 4MNGB 5L0QB 1CD0A 1JMZA 4WWKB 3IE4A 4TMPA 1RK1B 4K15A 3ZW3A 4DZBB 1HZLA 4YZFF 3VSUA 1I8IA 1JZEA 1UT1A 4R26L 3ZE2B 3QUZA 3ESMA 2HLAA 4V11A 1UXSB 3KM2A 1GH7A 4LCCB 2OYLA 1L9NA 4JPWH 4WKZA 3QORA 3EUUA 1O7DE 1T89C 4AZUA 3QK0A 2NW3B 1E5AA 1UD6A 3UAJA 1JD9A 4RMQA 1F3JB 2IIJA 1DFBH 4JLRA 2XVGA 3Q43A 3D5OF 4KNQA 4Q0XH 4Z7UF 2D0HA 5AVWB 4QRAA 4HOXA 1GCFA 5EIIG 4HCRH 2XFGB 4FN0A 5HVFB 3RILA 5DD6B 3WTUA 8PAZA 5CWSA 1Q38A 2VMDA 5H94A 4MRCA 4Z7QE 1FCCA 2F54B 4GIAA 1IJNA 3IGFA 2BIHA 2PTTB 4G42B 3UPCA 4A6YL 4XVOA 5EC2B 4XX1G 5DEFA 1G94A 1KIQB 3BP5A 1ESOA 3H1ZA 1RK0B 4QRFA 4HXAH 4X9GA 4E42A 2XA8H 3D2UD 2D2CC 1PQZB 3WN5B 4KQ3L 2IBZY 2MMXA 1MHEB 1FVDB 1U6AL 1CFTA 4X4YA 1A1MA 1MWAA 2R4SL 4WNSA 4LRNH 5CEZL 2O6CA 5MEOB 2ZOUA 1NCDH 4FQLH 4DTGL 4ODBD 2HT3C 7CGTA 5D1XD 4R5XA 1WSST 2DMHA 1MH5B 2YQGA 1HL4A 4CRPA 1XEDA 4QJ3B 2OMWB 5DF0A 3GEWB 2QLVB 3PXHA 1R17A 1E4WL 2OSYA 5DGQA 4JKPH 1WBXB 3BSZH 1MELA 3LV3A 2GY5A 4P2RD 5AW2B 3ZO9A 4LE8A 3OG6B 1FH2A 1MCRA 2AK1L 4NPYA 3NZ8A 2IGFH 4JB9H 4P2QA 5SWSB 3INOA 5B38G 2LFGA 1KYDA 1OQOA 3PGFH 1WAAE 5I1GH 1TJHH 2VLLA 2X44D 3TZVA 3B34A 3IE9A 1FNHA 3TBWA 4NZUH 3V4VH 4EXKA 2VT0A 4PIRF 2ZG2A 2WKLA 3QDGA 1MVUB 3NJKA 1FC1A 3SSGA 3AY4C 4KQ4L 3GJFH 3GC3A 4JG0L 3QC5X 1UFGA 4GKSA 4Q9RL 5A2CA 5H2BA 2H1PL 1LEGB 1I3RB 4WI9A 2V6HA 2J1WA 4PB9L 3VH8G 4PJIB 1DQDH 1XH1A 3S36L 2B1HL 2QHRH 3KGRA 4H4NA 1XXFC 1J1PL 1HQRA 3EYOB 3KGSA 3BT2L 4NQVA 4YHLL 4XT1C 4X9BA 5CEZD 3U0WH 3GI9H 4DVRL 3P54A 3ZIMA 2J1YA 3QBTB 1OTUD 3PABB 3UJIL 4MVBC 3SEPA 4GO8A 2Q86A 3SO3C 2AP2A 1OCOB 3DTXA 4N90D 5AYTA 3I9IA 4C58B 1K72A 1NZRA 4QHUA 2VERA 3D87B 1KG0B 3DXAE 3PNWA 5DA4A 2JB5H 5GRJL 3WFEH 1MNUL 1EXGA 5GSVB 1XCWA 3LEXA 5GISH 3D2TA 5E94A 3HAEB 1JZ3A 4JGJA 1Z9OA 1CZ8H 1D6EA 4J2QA 3RP1A 3HCVA 5IQMA 3CVHH 5CJQH 1A14H 4KI1A 2OZ4L 5AB0A 2NTFA 5ADPH 5L4JA 4Z7QB 3AROA 5HDOA 2E86A 2YD4A 4CUCA 4BDVB 1KT2A 1T2QL 4L1BA 5B1BB 4NM8L 5GS3A 3CLEL 3LXBA 3BVXA 2TSBA 1FNSL 2R29A 3ARYA 5D7KE 3V4LA 2YMOA 1OP4A 4BH7A 4OZFA 2JELL 3ULUH 2SODB 3S36X 2VXVH 5FAAA 4E9RA 4P2OA 4M1GH 3E1ZA 4KNUA 1ZY9A 4BE6A 4JFFE 2ZD0A 2NXYD 2VDKB 2CO6B 4R3SB 3KNBB 3LQAH 2R1XB 3C09B 3ROOA 5FO9B 2LAAA 4JL1A 4PBVC 5E95B 1OP5K 2ATAA 4DGWC 2W94A 2CIKA 4HT1H 4U7KA 4N8VB 4ZMVA 1RPQA 3BLPX 4HD9A 4ZRGA 4EKXA 5MEQA 3DROA 1CE6A 1M3JA 1FLTX 4KOBA 4YHPA 4AYEC 3EO1A 1S7RB 2NY1D 3CHRA 1Q9KB 4P4RB 4EDXA 2AJXH 4IOIB 3KJ6H 1FI8C 3ARZA 4AGQA 3WNKA 2HKAA 3BEVA 2QTVA 1RZQA 5DVKA 1U8LA 3F3HA 2N0KA 4Y19D 5DHVH 1BJ8A 3HB3B 3QUMB 1U9KA 1DQML 4JZJA 1B88A 3F5WA 4QJ5B 4RFOH 1BYPA 3NCYS 1JPSL 4PJCF 1KV7A 2RH0A 2Y6SC 3MBEC 1JVKA 5JPMB 3T0BA 1WZ1L 3QQ9D 4I77H 3QZNA 3ARWA 1NKOA 2DH3A 3NFNB 3KCPB 4KWUA 2XN1A 3SPCA 4APQA 3ILQC 1RFDL 3OAZH 4EO5A 1XDTT 1S7TA 5FCSH 1MIML 3ECQA 4F58L 4LSRH 4M6AA 4JM4H 1PD6A 4ZX5A 4JFTA 1WWAX 1XR9A 4CSSA 1XCQA 1GC1L 4J5VA 3IGAB 3DXAB 2ZTBA 4JY4B 2EDTA 1TNNA 1UXWB 5B7MA 3O9WC 4N2HA 4KY1L 3MLXL 2AANA 3F62A 4PJ9D 1BQLH 2V8MA 1GC1C 4Q6IB 3B7TA 2SEBB 4BCZA 4H88L 5D2NC 3MFFB 4Z8FL 2JKJA 4YFLF 3TT1L 4GKZB 4QAWA 2IQ9L 3ETBJ 4IKNA 4M9PA 1LP9E 2VL5A 3AAZB 4X6FB 1K5NB 1NANI 4QR7A 1O7VA 1IQDA 1JMXA 1TVHB 3NH7H 1EUUA 1CBVH 1UOKA 4RQQB 4LU5H 1ZGLP 4IBWA 1SN2A 1T1XA 5DUPH 4G7RB 6PAZA 3ZTNL 2BHYA 3U6RB 1IGYA 5LB1A 4XNDA 1CFQB 2F6AA 2Z35A 3OKDB 4QXVA 2ZXGA 3WY2A 2YFOA 4NUGL 4N2DA 4WNQB 3VD7A 2A9CA 4BUGA 1NEZB 1XO8A 4KROC 5FHAH 5A2LH 5GZOD 3D0AA 4M7LT 2YD9A 4JFFB 1HN1A 1KGCD 4NQTA 3OSVA 5DJDB 1TTAA 5DZVA 2VTFA 4PJ5A 1A65A 3BEWB 2F8OA 3ZKMC 1T4WA 2YSSB 4OLUH 3CHPA 4NPJA 3WKNA 2CA4A 2VLRD 3HE7A 4XRCA 1VZHA 2OULB 3QUYB 4RWYH 3W57A 1VFBA 1UENA 4F57H 2IAND 3NPSC 3SBQA 3ARGD 3L9BA 1AJ7L 4P4KA 5C0BE 3WTYA 4TQEL 3GTVA 4UANA 3CQFA 2EIBA 3EO9H 3LNDA 3GNMH 3BWSA 1IGJB 2VUYA 4JKWA 2FWSA 4KRMB 4U33A 1QEWB 1WCBB 4OAWB 2NY2C 5D72L 1P9MC 3CTTA 1OAXL 1JGDB 2IPKB 3MRGA 4CDHA 4I5BB 4Z95H 4ABWA 3LDBB 4JN2B 3R06B 3JZYA 2XNAB 3ARBD 3QJQB 4JPVH 1ZA6A 2GIYA 3K3QA 2VRQA 2QFPA 5AW5B 2C9QA 4I0PC 1UD5A 3U46A 5KJRL 2P46B 4G83A 1QR1B 1N2RA 1YYLL 3LKSB 3RWCA 1NAMA 3WFBL 5HJ3A 2XG5B 1G7HB 5IQNA 1DEEB 3T0EA 4XNXL 4ORGB 3JWDL 3P0GB 5CSGA 4WUUA 1ZVNA 3K2MC 5BPPA 1JRHI 1P5UB 2J55A 3KPSB 3QDJA 2IWFA 3X12A 3JWDC 1PKQA 4GW5B 4NOBA 4JY5H 1U3YA 1BVOA 4TLKA 3BGFC 4MMZA 1KGIA 1QO3B 1PPIA 1JI1A 3L2NA 1BZ9B 2E7HA 4PRDA 1L5GB 2DI8A 4ISVA 1M2VA 4ZMNA 1J9SA 3RHWF 4J3OD 1HEHC 1GYCA 3HG5A 2VAAA 2QGCA 4WI4A 2O6DA 5HDLA 2FJUB 3GPSA 5E6IA 5J5EA 2BVPA 2HJFA 1BM3L 1UB6B 4RMTA 2B5IB 5F9OH 1RJZB 3NJFA 4HGWA 5EN3A 1MCIA 4LOEA 2AERT 3QEGH 3BRFA 1M6OA 1ZE3H 3DO7B 3RL1B 2MOQA 1PS3A 2PO6D 1IKNA 1P4IL 2KUTA 2XI9A 1PAMA 1QI3A 2GCYB 5HDWA 3MUGA 3ZU8A 2J5LC 3FU6A 2D31B 2WZPA 2G2RB 1HI6A 2YO3A 3RHWK 3WUWG 1GY2A 1WD8A 3IKCB 2AEIT 4WW2F 5CIPH 4FA7B 2COVD 3ZT7A 5EO1B 3WE1A 2QMKA 2NX5D 4ERSH 3EJRA 1H0DB 5DJXB 4JFYB 5HHPB 1DYZA 4W4NA 5CLYA 5TJWK 3HFFA 4HKXA 2W0FA 5DVMA 4GRLB 5C0BB 4FADA 1XMEB 3OAUL 4ZFZA 3OKKA 4X7SH 4P2QE 5HYSA 2Y5TA 4JKMA 1FNAA 1AHWB 2DQJH 2XV6B 1CB4A 2ED8A 4HDIA 3BCDA 4Z1PA 5FM8A 1T83C 1IM3D 1N5AA 4WSKA 2QL1A 1QZNA 1I7ZA 2WWMD 3QDGE 3WHXB 4EZMA 4L8CA 3G08B 4X4KA 4KXAA 4PI0A 3VWJD 1ETZB 4WFGE 1R3JA 4PS8A 4W81A 2N1KA 5TE4L 2EDJA 1YHPA 4U1JB 4WQOA 4LIQE 4DKDC 4W70A 4U1GB 3IGLA 4OM0H 3G5ZA 4AENA 1U8PB 5EOCL 4PV9B 1F58H 1PZAA 2HLFC 2BHFA 3KR3L 1DHKA 3HIZA 1I8IB 4KKNA 3FS9A 3B7UX 3GPEA 3QUZB 5D5MF 2HLAB 5B1KA 3FFCA 3TF7C 4YL4A 2KPNA 3Q6GL 4LVNC 2DQGL 3N91A 4WKZB 3QORB 1BF8A 3QZBA 2D0GA 2AXHA 5BRQA 5JW4M 3MUHL 4IOFD 4XZUA 3HG0A 1UKQA 1GS6X 3NSYA 1N6UA 4PG2A 1KLGA 4JLRB 4NQUA 2HT2C 5T3XD 3E2HC 3S3CB 1A6TA 2ICES 3TT3L 5KVMC 1LNUA 4G8EA 4QKXB 3WGUB 4ZQTA 3KD4A 2XN0A 1F6AA 4ADJA 3LRKA 2F08A 1SHMA 4FQ2H 2VQ1A 1MIEL 3QRGH 4BFJA 5H94B 4J23A 1R3LA 5JIIA 1BFTA 1OEZW 4KO7A 2YRBA 2KH2B 5CZKA 5BCAA 5DEFB 4WEBL 1BV8A 3BP5B 4E42B 4EZJA 3HFML 4GAJL 4YBQC 1WVZA 4OQTL 1MUJA 1FGVH 1CFTB 4X4YB 1A1MB 2DQCL 1FWXA 4V1DD 5CU9A 5HDBE 1ZPUA 3ZDYE 3IDGA 1UT2A 2CM5A 4KH2A 1JVOA 3NSJA 1IC4H 3PWNB 4DP6X 3EYFA 3EIFA 4N2AA 3REVA 2FT7A 4LSDA 3O3EA 3LV3B 1XEUA 4Y5XC 2RQEA 1D9KC 3WELA 2EZ0C 3ATAA 3D2UA 1IEAA 1L0QA 3K8MA 4LVOB 1K4CA 4NPYB 2AEPH 1IBFA 3NZ8B 1SHSA 3NGBC 4P2QB 4Q74A 5GZND 3VXRD 4U6VL 2EDWA 5BV7H 2VDLB 1RXLA 2K7QA 3A6CH 1YECH 3WKMH 1JWSB 2BW5A 2VLLB 3TZVB 4I0CC 5D1XA 1NSNL 2A0LD 3GXTA 1A66A 3TBWB 1JHTB 5CGMA 1UASA 2PETA 3QDGB 3HN3A 2ZOLA 4FE9A 5JHAA 1W8OA 4G6MH 1BG9A 4K3HA 1HAWA 3MHZA 5B7FA 4URKA 4L23A 5ABDE 4MNHA 4RWHA 4OCRL 3MC0A 4GKSB 4UT6H 2XFXA 3MRRA 4XB7A 4YSRA 1NIEA 3HNVH 2AXWA 3ARSA 4H8WH 5H2BB 5A3ID 4HJ1A 4JK0D 2GSGA 3BKCH 3SE9L 5A2BA 3RA7L 2ROYA 1XXDC 2G4EA 3VTMA 2E7LA 4NQVB 3GRWA 2YAQA 3UG4A 2ZKHH 3ZQWA 2VIRA 4U4IA 4TVSa 5JOPE 4PP1D 3W81A 3U4EA 5IFHL 5DD0H 3SYCA 1YC7A 4JJHA 2Q86B 3DTXB 4DESA 1DUYA 3M6DA 4BCYA 4Y4KD 5IQOA 4TSBL 1KACB 4QHUB 1BXAA 1DQTA 3PNWB 1CE1H 1IC7H 4MJ4A 3VD2A 3O6LL 4UIKH 1U21A 3B2VL 5KYWA 5C09D 3LEXB 3O11A 4ALAL 4JFXA 5E94B 2EH8H 1D6EB 4FXTA 4ALAC 3OGOE 1GGIH 3FQXA 3HCVB 5ILTL 5AWNL 2NTFB 2IBBA 1EX0A 4XP5H 1OT2A 2BJMH 3EYSL 2IPUG 4MJJA 4YSUA 4AVKA 1I8MA 2B20A 1KT2B 1FNFA 2WYZA 4ODTH 4W68A 5CILL 1XGTA 2AEQL 6FABH 4Q4IA 4DFIA 5CGTA 3L4UA 4YJZL 1UGKA 4DF9A 3OLDA 1RUAH 4PJXF 3BGMA 5IBTH 4X6DF 3KYKL 1IKOP 5D7LD 3I9GL 4BH7B 5HDBB 4OZFB 1M42A 3ZDYB 2Y7LA 3S88L 3DHUA 1E42A 4MA7H 3SKMA 1SVBA 2DEYX 4P2AA 4P2OB 2GSMB 2EYTA 2HLEB 1QTSA 4CKVX 1B6DA 1M9SA 1A2YA 3AWFA 4HKJA 1C12A 1WIPA 2B0SL 3ROOB 3FH8A 4YHZH 3JT2A 1TTRA 3EFDL 2CIKB 4XMKL 5GGRB 1DO5A 2B8OT 4M29A 4R7VA 5E1AA 2HVBA 2DAVA 1KY7A 2K7PA 3QNXA 2ALWA 4ENED 5CJOL 5MEQB 4MKTA 2JKXA 5D70H 4UM8B 2V2TA 1CE6B 4KJWD 4YHPB 3B9KD 1FC2D 3EO1B 4MDRA 3ERXA 4BSJA 4EDXB 3ES6A 4G3YH 1NANH 3F64A 4FFVD 4WFEE 1HX0A 1II4E 3RPIA 5C0AD 3MRPA 1YEEH 4H2CA 3S3PA 1A5FH 1SOQA 3FYIB 4QNPF 3QWOA 5FDYA 1UKSA 3EYQD 3VDBA 1VCAA 3BEVB 4QHKI 4D9RD 1P84J 3FB7B 5IMLB 3KYNB 1JS4A 5F7HA 4HEPG 4IU3A 3OHMB 4N24A 1U8LB 3W39A 3ALXA 4GKLA 3FOLA 4JZJB 4M1CD 2V9QA 1CTNA 4BA8A 4EEEA 2ZCKL 3F5WB 2HJKA 5F1OB 5L2KD 5TPWH 3TWCL 1OAQL 1AH1A 1MDAA 1UZ8A 3RWHA 3SBRA 4E9LA 1D7DA 1LEIA 2V5TA 2F0CA 4P3CL 4J27A 3RZCC 1FA4A 4QTIL 3T0EE 1S7TB 2X2YA 3EH5B 1JN6A 2QQLL 2H1LM 4LO9A 4WUUE 1OM9A 5K9KA 1XR9B 1XCQB 3QJZA 3H9HA 2G60L 3QDJE 4FKHA 2GHWB 1SEBB 4UQ9A 3BZDA 3AG1B 1PKQE 3K2UH 1FAIH 3X13A 5JUEH 1NINA 5EWIL 2FO4B 2YR3A 5DCCA 2I5YL 5EU4A 1Y6NR 4OFIA 4G5ZH 4OGXL 3ESNA 4Q2ZA 4Y8DC 4JFHD 2UXVA 4WTXA 3W38A 2X7LA 2FL5A 4IBLT 3EXLA 4GRWF 4HAFA 2ZXCA 3TCXA 2KDYA 1TQUA 2B1OA 4HU8A 1HS6A 2AITA 2WO2B 1NA8A 2IWEA 2WANA 3WLBA 2R0LL 3CZSA 4HIHA 3CSBA 2VL5B 1MFCH 1F6LL 3E7JA 3NEXA 5CZXD 2D7TH 5D7JC 2GTZA 1IQDB 2K70A 3KZ8A 3BN3B 3N9GH 4ICXA 1SXCA 3VMOA 4N2CA 1TVBA 2B4CH 3K0YA 2Q8AL 1T1XB 2C3HA 4DKEH 3TO4D 4U0QB 4F2FA 1IGYB 3RB7A 4PJ9A 1XR8A 2Z35B 4OGYL 2CGRL 3RWFB 4UILL 2Z93A 4LQFH 2VXSH 4QGTA 3RWEA 2F1EA 5B39A 5HYFA 3HE6C 4QPEA 4WAFA 4ZPVA 2ZG1A 3QJHA 4P5RA 3QQNA 3D6GA 5E23A 4PJ5B 5ALBL 3V9EA 3LVTA 1CGUA 5H37A 4R4NC 1IVTA 3ZN6A 3BZ5A 4D0DA 2X9ZA 1OCWH 2A6IA 4KHXH 5EF2A 3QNZA 5DHDA 4XRCB 5DJZA 3CFBA 1EH9A 3V6FA 2XTSA 4ZUTA 3W5MA 3KEHA 3MFGB 4P4KB 4N22A 2DD8L 4D0BB 3TJHD 2X0WA 2X6CA 1HH9A 1DLFH 3B5HA 12E8H 3DOHA 4AKOA 5CBAA 3LHPL 3IGUA 1LYQA 3E1F1 4ZO6A 4AWJC 1EHLH 3O6KL 3MRGB 3FL7A 4BHUI 2MSPA 3IDXH 1BFSA 2NCMA 3WO4B 3EGXA 4LNVA 1ZA6B 5BZWA 3VRJA 2VOTA 3N6YA 1EEUA 3UZVA 5F72S 1C5CH 4DQOH 3U46B 5F0MB 3OPZL 3UIYA 4DK6A 1N2RB 4HUXA 4S0HA 3VX1A 3RWCB 3VI4A 2OR9L 3ARTA 1NAMB 4L5FL 5HJ3B 3N85H 2PUQT 4GQ9H 3FZUC 4YQXH 5D9SA 3T6XA 4BM7A 1QBLL 3GKZA 2OMBA 3QEHA 3FFCE 2YMXL 3T0EB 2XV3A 4QRTA 3WDHA 3LEVL 4NGHL 5IJDC 2OV0A 4WUUB 2IVFC 5I15H 2OZNA 3EGSA 1EXHA 2PXYC 1GAFH 2E4FA 2EIDA 3QDJB 3DVNA 2IOMA 2WVSA 3FQUA 3X12B 3QIUD 1PKQB 1W0WA 3CC1A 3J27A 3LIUA 4MMZB 3ARBA 4U1IA 4CNIA 5IBLC 1BVNP 4J7RA 4ISVB 1M2VB 2BVQA 2VAAB 4P5TD 1MCFA 2WUCL 3MUUA 4Z18A 2XWRA 2Y72A 3GRGA 5DWUL 1J8SA 3VGEA 5E6IB 2FNBA 4NP4L 2BVPB 5DXWA 4DN4H 5KZCB 2GUYA 1FYHB 4HFWA 3L5XH 4HJEA 1D7FA 4HGWB 5J11C 4J6RL 4APQC 1JXGA 4M00A 2OXGA 5K59E 2VCOA 1M6OB 4NI6A 2J1XA 4R0LC 3GF8A 2BS9A 5I28A 2OL3L 2XTJC 3GSNA 2Y2WA 3GUFA 3IKKA 1ES0A 1S7VB 3HPLA 3UTPE 2MIZA 4Z78A 2EVFA 1YUHB 3MUGB 5ADOL 2DI9A 1TEYA 2IG2L 4GQRA 2B2XH 2AC0A 2JI1A 1HI6B 1ZAGA 2MEJB 1LO4H 1MREH 1H3PL 2CH8A 3KVDD 4GH7B 4DGIL 4GXVL 4AVIA 3T65A 1VENA 4QTHA 1UM5L 3AWEA 2ZUUA 3MLUL 2H6UA 3WL9A 1F3RB 5SWZA 1HU8A 3RY6C 3T3PE 3AUWB 5AVSB 3GO1L 1JZ6A 4M61A 5TDPB 2V8LA 4XGZA 5ETUB 2W0FB 2UZPA 1U92A 3HZYA 3AABA 3IMWA 3D08A 4ZFZB 3OKKB 4YSAA 5KVDH 2BO0A 2C9AA 2X1OA 1YEIL 2BZCA 2Y5TB 35C8L 5HYSB 4HDIB 3CFUA 4U1LA 4AE1A 2JQMA 1W6WA 4ELDA 2VWEE 4UTAL 2DJ4A 3BOVA 3GLDA 1NIBA 5D1XE 1YO4A 4JHZA 1ACZA 1N5AB 4P06A 5B3JE 4K23L 2ATKA 1ZS8A 1NOAA 4L8CB 3CXDH 1R3JB 1J0IA 3NK3A 4KJPD 4Y9GA 1JSYA 2NX5A 1AXSA 4QCIA 4P2RE 5LBSH 5JW3H 1VEOA 1JZ7A 3G5ZB 5G4NA 4AENB 2CPCA 4O00A 4RRPG 3TONA 5GS1A 1ASQA 4CN4A 3IU3A 2PPAA 4N2OA 5IB4A 5JXEC 3HE7C 1GGTA 5C0NC 4WO4D 1YYMH 2EEFA 1CGSL 4A39A 5CBEB 3FFCB 1JCVA 3V5KA 1IM3A 1Z7JA 2CO4A 3QHFH 3ULSA 3KL5A 4IQHA 4EIUA 4PRID 2D3JA 1DANT 3B8YA 5DK3A 3VWJA 3HRPA 4XZUB 1WZLA 3AMKA 1YEKH 1PU0A 4QKTA 1KLGB 2D7PA 4LLUA 4PJEE 4X6CF 4TQ8A 1O7SA 1P7BA 1W2KT 3ASNB 3VRLF 1UA3A 1A6TB 3KBFA 3O41A 2CKBL 5IHHA 1LNUB 4G8EB 3V2AR 3SDXE 4MMXA 5KVFE 1A3LH 3IFLL 1F6AB 2WK2A 3GD1C 2C9RA 1IC5L 1IFRA 2BP0A 5CEZE 2VQ1B 4LFHG 2DEWX 1LJMA 5F7EH 1AACA 2IO5A 1R3LB 3CN0A 5JYMA 1T7YA 2P5PA 2EAEA 4QLRA 2F15A 2PPFA 3RVUD 4DWHA 2VERN 4I9WD 4TSCH 2AQPA 4N90E 2WW8A 3HNTH 3IAPA 4ONFL 5DR5L 5DHYA 1MUJB 5K9QI 1XAKA 3IDYB 3WKYA 2DQTH 4Z6AT 4JVPA 4UT7H 1KGXA 1SM3L 2DRUA 5DUBA 3VVWA 2KLTA 1SVZA 2Z91A 2DM4A 3CFIC 1GTFA 1H8LA 1MSPA 3IDGB 4BSVA 4O4YL 3SPGA 4OD2A 5SX5H 1KB5L 2AQ3A 3EYFB 3O4LD 4AOFA 1U93A 5F3BA 4A2GA 3HBPA 4ZW3A 4G1EA 3MJ9H 3T3PB 1BQHA 2VC2B 1F4WH 4Z77A 3PS6A 1OTTD 3D2UB 2HFFA 4M03A 1IEAB 3HKZA 1BWMA 4AIEA 1K4CB 4PRAA 3NCWA 1FVEA 1SY6L 3I3EA 4LEEA 4V1DA 2EDYA 1SYVA 5I17A 1M7XA 3T1WA 2PCFA 1R0AH 4JM2D 3RTLA 2V3DA 5D1XB 4P9MH 1JJUA 4E5XA 1NLDH 2QPDB 2Z4QA 3ZHKA 3GJEA 2CK0H 2ZOLB 5INCA 5F21B 4LPXA 2XSKA 3E3QC 1XTMA 1RUQL 1BGXH 2DWDA 4Y2NA 1KFAH 3TYGL 2XFXB 3MRRB 4P2RB 2DBLH 1PZ3A 3VXSD 2XQBL 2IEPA 4S10A 3VMPA 5CKGA 3WS3A 4KI5F 4NOFA 2GSGB 3MV8D 1ANUA 4DZ8A 4M7LL 5GZNA 3VXRA 5C7XH 1CXIA 2X2JA 3EF7A 5GPRA 3B37A 3WNOA 2WYHA 3L3DA 4V33A 1P4UA 3ZDZF 4MAYD 2DBJA 3OAYK 5GS0L 2KYIA 2VIRB 3CFCH 1HNFA 3WTSA 2D7NA 3NCEB 3UPAA 5HVHC 3UP6A 4HS3A 4HK3N 3U4EB 2XQYA 1AG0A 1UWXK 1UACL 5GS0C 3MKKA 1DUYB 3CIAA 3CLFL 5EIQA 5HGHA 3HAEH 4X7DC 1F4YL 4Y19E 4PJEB 5ALCH 1TOXA 2QBWA 3VYPA 4YHYC 5KYWB 5E08L 3O11B 2ICCA 3L1FA 4YR6A 4DP9X 4LKXA 4ZUVA 3SDXB 3ZMEA 3U7YH 1FORH 3ZRFC 4PR5A 3WLWD 2YPKB 3E38A 4PJ6A 2V2WA 1KTDA 4HX1A 2Z6FA 2D3VA 2RIKA 3FQXB 3QISA 5E6ZA 3SJVE 3KWVA 4F7TA 4MBOA 1DQIA 4X5QA 4FTDA 2JCCA 3DX7A 1T66C 2J2ZA 3UEZA 4U0RB 1I8MB 2AXJA 3PPEA 1NMAH 3GZQA 1QRKA 5JMOC 4BRJA 1XGTB 3HUJA 4Y4KA 2IWKA 4Z7VF 1ZCRA 1RZKL 3CD4A 1EGJH 4OCWH 1DJHA 4Q56A 3B6SA 3BGMB 5KAQF 3ABZA 1Z66A 1Q1JL 3NPZB 1RZKC 5C09A 2HPTA 4OZHF 4Y4FD 5FCUL 2VDKH 1JFQH 4ZDHA 3SKMB 3M7FB 4ZAKD 4AZ8A 4Y4HC 2P26A 1DZBA 5B21A 1OM3L 1I8LA 2EYTB 4AIXA 3KWTA 2FTAA 3EFFA 3BP4A 2ITDA 1A2YB 1J0JA 3HW7A 1C12B 3LTVA 4HKJB 4KKBC 4QLWA 3TJPA 1HKLH 2IH1A 1QW9A 4XVSH 4R9HA 4ZO7A 5GS0D 5TFSH 4IIQB 3GDCA 1T03L 3QNXB 5E8NA 3KS0H 5I6XB 4GP8B 2CJUH 1MHPL 4L1TA 2V2TB 5CGYC 4BINA 1CBJA 1J8KA 5D7LA 4CDGC 2YXVA 3ES6B 4FHKA 4NQCE 4GSQA 4NHUA 3RPIB 1XD0A 1JWMA 2UZIL 1OAKL 3MRPB 5AYQA 1MFEH 2AV7A 3QWOB 3RLSA 1CXHA 1KGCE 3H2QA 3QUMH 2NXYB 3RWGA 4AG4H 2XWBA 1NCCL 3QO0A 2FBOJ 4IU3B 5DZLA 4PJ8C 5EF1A 3W39B 2VZUA 5CS7A 2A9DA 3HLAA 3FB5B 4N6RB 3S8WA 3FOLB 1IRAY 2OLDA 2VLRE 4MRBA 4HJJL 4Y16C 3CH8A 1MRDL 2WQSA 2HJKB 2R39A 3MYZA 5F96H 3QA3A 2AJYL 5DO2C 2IANE 1PBYA 2NQ3A 3B9KA 5FUOL 4J3TA 1UZ8B 2ZUQC 2NY1B 3RWHB 1S5IH 3CHXA 3KWWA 1LEIB 1OY3B 2AJVH 3VI4E 1S6NA 4U3CA 5C0AA 4GSDH 4LAJH 3EYUL 3RJOA 3UYOD 1FL6A 2YD1A 2JWYA 4AEIH 3LMJH 3TCTA 1JN6B 5EO9A 4X4XA 4ZSOA 5K9KB 2Z1KA 2FWLB 1LO3H 2P8PA 2DQUL 2ZOWA 3H9HB 1CU4H 3NZSA 4PW4A 3QWNA 1ZEAH 4Y19B 5IB3A 3RAJL 4LSTH 4U3SA 3R4RA 4N2EA 2XIDA 2WM0A 3NTCH 4ELKA 5L2KA 1RZPA 5EU4B 2WZ0A 5AL8A 4Q2ZB 3NT0A 1X5XA 2OP4L 2X7LB 5EU7C 2FL5B 4HJSA 2PWFA 4PBXA 3UGEA 4LHQB 4YHNA 1MRCH 2JSFA 5DVLA 4NC1C 3WLBB 1RUML 2FGWH 4HIHB 1BBJA 1PF3A 1MCKA 5IQ9A 2HYMA 2WSPA 2GTZB 5J3HC 3K46A 2QADC 4DEPB 2ZAGA 2KQNA 4LGRB 2WLLA 5BVPL 3WEXA 5DLLA 1XCXA 1T0OA 1QYGH 1TVBB 3UABA 1IEHA 1BEXA 3QW9A 3SGJC 5DRZA 4DGYL 1E3FA 4PJ9B 5T1KD 1XR8B 3R1GL 2H3NA 4TUJA 2WIMA 2Z93B 1G9HA 1X4YA 3RB5A 3RWEB 2VR6A 2WKOF 1SFHA 5B39B 1NKGA 2E4TA 4ZPVB 3QJHB 1ZJAA 4G7SB 4R4FL 1QFUH 3UTSD 3L3JA 3OX8A 4PY7A 4JKLA 3UEQA 4D0DB 2NSQA 2A6IB 5JHDD 4K3DH 3QNZB 3RVXC 1WWBX 4PJDA 4OLZH 3CFBB 1TJXA 3V6FB 5BOZG 3ATBA 4ZUTB 4X0KA 2YBRA 4R90H 1Q0EA 4UNVA 4N0UA 3L4CA 3TO4A 3W1ZA 15C8L 3EJYD 2EEDA 1HH9B 3V0HA 3OD3A 1DQQA 2WQVA 4L4VD 4WU5A 1CQKA 4A2LA 3BD5A 4MBRA 5CBAB 4GAYA 4X9HA 4BFGA 2ZKYA 1VLXA 1X3DA 3MV9D 2HP4A 3CSYA 4QXUL 5AVQB 3B9AA 5IZ7A 5JA9A 4LP4A 3TM6A 1WZAA 1GPOH 2NX5E 3WNMA 3P9MA 2VLRB 2W5PA 4L4TD 2MH4A 2ENYA 4PYHA 3WE6A 3ELQA 3EGXB 2EDXA 1F18A 4OF5A 5BZWB 5TTRA 3ZYOA 3VRJB 3UZVB 2IANB 3GHEL 1VRSA 5CFAA 3ARGB 2AQNA 3MOBH 2YA1A 1IGFH 2YPVL 4HUXB 3TFBA 3ULVD 3VI4B 4HJGA 4YSEA 3VFNA 2HFGH 3HHMA 1Q72L 4KZDH 2NY5L 1BAFL 3MCLL 5D9SB 3QEHB 5AZEH 4QRTB 2J8HA 5TH2A 4G7VH 2DMBA 4F9LC 3FHEA 2NY5C 4DCQA 3EGSB 1JZ4A 2Z1PA 3ZE0E 1NCBH 2EVHA 1M1SA 3DVNB 3FQUB 4OFVA 3MROA 1TR7A 3AB0C 1JXKA 1W0WB 1W9XA 1QZ1A 4WFHD 2A2QT 3ARBB 1NMBH 3MJ6A 1VADA 4HZLA 4U1IB 2YBGA 4AXWA 4CNIB 3D18A 3QQXA 5F0JB 2Z31D 4MB1A 4JR9H 1DBJH 2BVQB 2PCXA 3EZ8A 3IMRA 3Q9PA 2ZOTA 5EZIH 2HCZX 2QGEA 5T3ZD 4S1RH 4FQCL 1FE8H 5BW7C 1UM6L 5AVYB 1HWHB 2F5BH 3JWNG 1EDYA 1TG8A 3ECBA 3W9EA 4ABUA 4K8RH 2X2IA 2XICA 4HFWB 4F91B 2ZX8A 5EOTA 2X4NA 3NRPA 2HG0A 4JREB 4WEUD 4Y9EA 1CO1A 2FJFA 2CMRH 5FYLD 4R2GC 2W60A 4Z7OE 5HPMA 2OXGB 1SRDA 4BWTA 1P53A 1XSKA 5DJ8A 5FOBA 5GJSL 3TV3L 3DMMD 1FFNA 1A7PL 3GSNB 2QQKL 5J12C 1ES0B 3HPLB 2ZSWA 4Z78B 5FW8A 5T3XE 5H4ZA 4E68A 2H2SD 1G6RL 3MLSL 4PJ7A 4CJ0A 4KAQL 3TJEH 4ZO8A 1ZDSA 4KJQC 1GOHA 4P5TA 1Y07A 2XT1B 3TTYA 1HKFA 3ZL4L 4W9FC 4QY8A 2CO3A 3Q1SL 1IAIM 3UDWA 4WDIA 3T65B 2WLNA 4ONGL 1RIUH 1B90A 2H6PB 5HBBA 3WL9B 4ZUSA 3WGVB 4I1NB 4PVBA 2YIHA 3Q0HA 3QCTH 4NN5B 1EXUA 3CZEA 3QRBA 1BYOA 4LCIH 4M61B 3L13A 4XGZB 2B1AL 5FYJD 3HZYB 1U92B 1QR4A 3B5GA 4YPGA 5ANHA 1RULL 2ZJSH 5EOQH 2NY4D 4YX2H 4TLUA 4FFZH 2PO6B 4V1DE 4U1LB 2P24A 2KT6A 4PB0H 1MFBL 3BGAA 1CK0H 4TUUA 3G9VA 4N1HB 3T6QC 1DZ0A 5A6MA 3FK3A 3OTTA 4HUUA 2ATKB 1EFXD 4JFED 1SJHA 3MPCA 5TQ0H 4L3CA 4LLYA 1CDBA 1CTOA 1EBAA 2WBJC 4KQ0A 1NMCB 5BUPA 2NX5B 1AXSB 4QCIB 4AQZA 1MFDL 4FFWD 1HHIA 2VH5L 3AS1A 3L54A 5CHNA 5GS1B 3JVGA 1Q90A 3IU3B 1PW3A 3GSXA 3VXRE 2ID5A 3T8VA 5IB4B 3L48A 3ILEA 1PEWA 3L3IA 3JWOC 4TOYL 4YEEA 3V5KB 1IM3B 4XPFL 5J7CC 2YGVA 2LE9A 4P46D 5DFTA 2AAAA 2C9XA 3ULSB 5C8JA 2MTPA 4MWFA 3QAQA 3QH3A 2Y0SA 3IAGC 3ZE0B 3FUIA 3T4YA 3VWJB 4NO3A 3E6HB 4KTGA 3NDZE 5AYUL 3N42B 1WK0A 4HWEL 4LLUB 2F9BT 5EO0A 3QDHA 3GXDA 1SUJA 3O41B 1V7NH 3DOIA 3I6SA 3GLAA 1BVKA 2HRPH 1OPGL 2NZ9D 4MMXB 4AV4A 3SKJH 4JJ5A 4K3EL 5D1QD 1PFCA 3MV11 1BECA 1DLHA 2YKLH 4XXCA 5E2TH 1UOWA 4WO4A 3K5RA 2BP0B 1E28A 2CG9X 2XG4A 4J3WA 3N06B 2OPCA 4NCC2 3MYJA 3AXLA 4X8GA 2GHZA 4OZIA 1OE1A 4PRIA 2JKWA 2IV9A 4Z7OB 5DHYB 4TULL 3H9SD 1OF0A 4CADA 2Z9TA 4X50A 3DV6A 1JD7A 1A6WH 5DUBB 3BFWA 3H7LA 2Z91B 5ID0A 5C09E 3V7MA 3S3SA 2PABA 4PJBA 1ZWIA 4FZ8L 2B3IA 3GLZA 4UTCA 1MCSA 4BSVB 4KXZI 2QQNH 4OD2B 5JHLL 5HD8D 2A73A 2LQRA 4N5UA 1YQ2A 5F1IA 4GXFA 1XVSA 5F3BB 5EIIA 5I8KL 1RSYA 3BZFA 4G1EB 4DETA 1BQHB 2VDLH 3DHPA 4Z77B 2O5XH 3MX0B 5KJ7E 5KEZA 2R56H 2HFFB 5I1KL 2TSAA 1ZSDA 1WTGT 2DLHA 1RERA 1FVEB 3BKMH 4HMCA 1KYOJ 4MAUH 5D93C 4A66A 4ZX3A 4JPKL 3MRDB 4V1DB 5JIMA 3NJNA 4IK6A 1SYVB 5I17B 2X3BA 2PCFB 3BP7A 5D7LE 2VMFA 4A55A 1GMEA 4HKBA 5J1SC 2YLKA 2C9SA 5E5MA 3IJEA 2O5NA 1NOLA 2X6MA 3Q2NA 1YEDA 2Z4QB 3GJEB 3RZWA 4LSSL 3S5ZA 2P28B 5I1JL 5I8OH 2FO8A 1AS8A 2O5YL 3NACH 1SMDA 3O4LA 5EHFA 4WUKH 4RA0C 2DWDB 4FQHA 3TOPA 2R9HD 4HPOL 1TSHA 1LMIA 1WFJA 2LGNA 1LEKA 5D71H 1WGOA 5E7BA 1R46A 3P2BA 1A6VL 4N85A 1B4JL 4Q89A 1EANA 1X9LA 1Z0MA 3OZLA 3WS3B 1BZOA 3EHBC 5DRWA 4DZ8B 3LYRA 4PJHA 2XC8A 4HIQA 4LOFA 5AVUB 1E4KC 3VXRB 1CDGA 4ZZFA 1GVIA 5IVXA 3L4ZA 5B4MC 3L3DB 4C54A 2XDHA 4MA8H 4LDOB 4YZFE 1IBYA 2HTKD 1SXNA 2YWZA 1CF8H 4JM2A 3VGFA 5B38A 3QUXC 4OCYL 5ISZD 1XZWA 3MBWA 3L3KA 5IW3A 5C0AE 4HS3B 1KN4L 2UY7A 4HQQH 4XNYL 5LO7A 2VQTA 3V8OA 4CN1A 1JYXA 1MJUH 3NFSH 2ZONA 5HI4D 4LEXH 2AS5M 3X11B 1MJ8H 3A6BH 4X4ME 4ZSOE 4D9RE 4ODSH 3H53A 5HGHB 5LJYH 1IAIH 5IJKC 4KK9D 5CUSL 4ELMF 1BF5A 4ZS6D 4W93A 4OJAA 1TZGL 3CFQA 3PQYD 3VXSA 3BW9A 4TNEA 3ILDA 3ML9A 1HFUA 3IFNL 4YR6B 1T6WA 3MV8A 3RVVC 4OR1A 3V0JA 5L2JA 3RIKA 4Z7UE 4WFFD 2DN7A 1C5BL 2V2WB 1KTDB 1DE4A 2L4OA 1RZGA 4HX1B 1X7QA 3U6XS 3VH8A 4MAYA 2FX8L 3PL6C 4F7TB 3DURA 1TJGH 5C2UB 2A4EA 1D5BA 4OH2A 1HTYA 2J2ZB 1QABA 2AGJH 3PP3H 4AUUA 4R6UA 2BFVH 3DVFA 3JXAA 1P84K 3FQNA 2R29H 3RVWD 2WVVA 5AAWC 4Y4KB 4N2MA 4OZFH 4NKDA 1UTDA 3LKRA 3B6SB 4GT0A 5E9DD 4YDLB 2WPGA 4WO0A 1EO8H 4EDWL 4JFPA 4X5XA 5C09B 4QGYA 3K6OA 3MZTA 2V5YA 4KUZH 4M8QA 3CN3A 3FRPG 4AZ8B 4U6YA 5DK0A 2B59A 4JFHE 3VE0A 2DQDH 1TTUA 1OKEA 3EFFB 1F4HA 1CUOA 2ITDB 2JJTC 3BP4B 3D25A 3QUXD 4WWNA 3SPVA 1ND0A 4MS8C 4WW2A 4MXVF 5JW4R 2YOCA 3KPRD 1NDGA 1FO0L 2IH1B 2UY6A 4L18A 2GTQA 5KTEL 4PJDE 5E8NB 2PR4L 3L9EA 2BZ7A 2XJLA 4HXBH 4TQHA 5C3LD 4NZFA 3QJTB 5BO1L 3BDXA 4IBZA 4N0UE 1YPZF 5DUMH 4GKNA 4OJFH 1NL0L 4WEEA 5D7LB 4ZW8A 4FG2A 4Y4FA 1JL8A 4NHUB 4ZAKA 1JWMB 3HI6H 4Y5VC 5DUJA 2AV7B 3BPNB 2WQAA 3O2DA 5T33H 3ELAT 4FF9A 4U05A 1X9UA 4OZGA 3QHZH 3O6FC 3RUGF 4NYLA 2N7AA 1WICA 2XWBB 5D7HA 3QO0B 5DFVC 2IAMC 1XF1A 1PLAA 4R8WH 2FT6A 1DSFL 3HLAB 5BJTB 1HZHL 4OVVA 2VN7A 5FYKL 4PJGA 5DMIL 5I18H 3QA3B 2WQRA 3VFVA 1KTBA 1S9YA 5CNHA 3B9KB 1D6VL 3TNMA 5EFIA 1QQDA 3KWWB 3MRLA 5E8OA 5EULV 1KXVC 1GZHC 3F8UB 3RKPA 5C0AB 3DBSA 5CZVL 4OF3A 3INUL 4LRIC 4U6XA 1FL6B 1N59A 4BH8A 3BWAA 3CSYB 3FT4A 1KBGL 4FQIL 4X4XB 1YYCA 4ZSOB 2P8PB 9CGTA 2FLRT 3S96A 1JNNH 3WJLC 2C7UA 3ZSTA 4RGND 2OJZH 3T0VA 1KZQA 5GGRY 5IB3B 1IQWH 1FNEA 4U3SB 3NSDA 1BVLA 3ZDXB 2X70A 1O5DT 4ELKB 1T1WA 5L2KB 3FO0H 3IBOA 5I1HH 2WY3B 3UJTL 2EDBA 3QS2A 1OARL 5IBUG 4A63A 1TETL 3HHSA 1AP2B 1XSOA 4YHNB 4X4ZA 1BM7A 5C0RH 1KMGA 1BBJB 2WCSA 2BPBA 2ITCA 1ML0A 5IQ9B 3BH9A 2APWA 5I26A 5DZJA 3SZKC 2WLLB 1B9ZA 1EJOH 3K91A 3ZPDA 1UYWH 4CVWA 4F37F 3S3BB 2UYLA 1YNKH 4NFCA 5T1DL 3PHAA 4DK5A 4PVNA 3LN5A 3SE6A 2P80D 2Y7OA 3BMVA 3BD3A 4IIZA 3ZKQD 3OLEA 4KX8A 4TUJB 2X5PA 3RGVD 1MCOL 4ZUUA 4F15B 3FT0A 2X0UA 4BD4A 2A74C 43CAA 2GI7A 3EJZD 1YNTA 3QFGA 1EZVX 2HVJA 4ZMAT 3OX8B 4PY7B 1MCLA 3S37H 1QWUA 3HVNA 4C59B 4W9ZA 3Q2CA 3GBNH 4HFUH 4PJDB 3VGGA 3OZ9H 3ZZQA 3GHBL 4F37K 1O0VA 4KI5D 2YBRB 4X0KB 3V4VA 3O0RH 4N0UB 4AL8H 3TO4B 1A0QH 1G9ML 2ZOKB 1JNHA 5SV3A 2E5EA 1KZYA 5T1KA 5C6TL 1T7XA 2M1KA 1DQQB 2QPEB 4B9PA 1G7JA 3O0LA 4WU5B 5KSBF 1HNYA 1A8ZA 1G9MC 1QACA 5BOJA 4AQ8A 3BN9D 3DSFL 4GAYB 1NFDA 1CVRA 3P2DA 2A6DA 3B9EA 4YPJA 4ZFGH 3DYPA 5DD5L 1DR9A 2P5WD 4G71B 2G3MA 2EDKA 3UTSA 4Z0BL 1CLVA 3O6MH 1MCHA 4L5FE 5HP5A 3LAFA 5JHDA 3BLKA 3P9MB 2G9KA 4E41D 3WE6B 4X98A 4WJ5A 1H3UA 3VXUD 2J6EL 2FWUA 1NAMH 3EH2A 4QO1A 4JQXA 3ZQ9A 5J6HA 3PWLA 5FLUA 3WFDL 3APCA 5KSAC 2H45A 3OF6D 2NY0D 4HJGB 3ESOA 4L4VA 5CCKL 4B0MB 3PXJA 5TH2B 4KTDH 1UZ6F 2L7EA 5EN2A 4DCQB 1O6TA 3FU8A 3GBDA 4W6WB 5BQDA 2HKHH 3CFDA 2BDNH 5KYXA 4NNPH 3QG7L 4B9ZA 5I8CA 1TEFA 1DJGA 3ZHNA 4NZ8A 4L4TA 2X3CA 5IMOA 5GGVY 2QQQA 1VADB 4HZLB 3GJFK 4NNXA 4AXWB 5C1MB 3DO3A 2DEXX 2X4OA 3D18B 4N0CC 4I3SH 3FQTA 2VMEA 3APNA 2E74C 2VABA 3RDJA 4EJ1C 2F18A 3SCMD 2HWZL 1ZKAA 2R51A 3LRHA 4XTRD 2OXHA 3BUYB 3P0YL 4FL4C 4PS4L 2VQUA 5GRUH 5IUCA 2C9PA 3P11H 3ECBB 3W9EB 4DN3L 3UFIA 5F3FA 5K9JH 2YK1H 4K5PA 4DW2L 4Y9CA 1XIWD 2H2PC 2X4NB 5EOTB 4OZIE 4HSAC 1GW0A 3QDMD 4PRIE 5HJBA 2EDHA 2FJFB 1Q94A 3SYAA 2W60B 3V79C 1XV8A 2IPTH 2P52A 5HPMB 3QIUB 5FOBB 5DJ8B 3OWEA 1FFNB 1X5GA 5T5FH 2MNUA 3EH1A 1KBKA 1CDUA 5F97E 3ZLQC 4LPYA 4RDBA 7PAZA 2Z31A 4JFDD 4PJBE 3IJYA 3A0OA 2P4AB 1N64H 5TE7H 4P5TB 4XMTA 1HWGB 2Y36L 4QY8B 4Q6KA 4WDIB 3A22A 1U3JA 4C57C 4WU7A 3LNHA 1UOLA 2C9UA 4NKIH 4FABH 3ARXA 1KY6A 4JRLA 1EXUB 4I9WE 4F9PA 1AXTL 4YPGB 4L3FA 4I0KA 3QIWC 1I31A 4NZTH 3A6OA 3DMMA 4XX1E 1YEJH 4OLWL 1OTSC 2P24B 2YC1A 3GKWL 3NZHL 4S2SA 5EF0A 4UV7H 3ZYIA 5IWLA 3MDJA 2EC9T 2H26A 1VESA 5IOPA 4HUUB 1SJHB 3EH4B 4BZ2L 4NHCH 4L3CB 3FTVA 2YLHA 3LKQA 4LLYB 3DSNA 4TTGA 3CVIH 3O4LE 3LRGA 2GABA 4K3JL 1JOIA 4F7PB 3DJSA 3WUWA 1O9ZA 1HHIB 3Q48A 3MNWA 2WWKO 5CHNB 4FCAA 4HPYL 4PRPD 2WWNA 1FV1A 2RCSH 1JF6A 1YUKB 2F7IA 3GSXB 3E80A 5L4MA 5IVXE 3L3IB 2ENSA 3AQZA 2W95A 1MOEA 1MAMH 2NYYC 1XHHA 2K9FB 4M7KL 4QHKJ 5HGDB 3FC8A 2J1KA 1VJSA 1TSRA 5C2BL 1YJDH 1MJ7H 5FKAA 5C8JB 1EFXA 4JFEA 4MWFB 4LSUH 3QH3B 1KJ3H 5CINL 1M71A 2NUTA 2LHAA 3T4YB 5C6WH 4NO3B 4G59C 4DP1X 4YXLL 5HYJD 3Q06A 1HINL 2F61A 3LD8C 2Y3AA 1N5YH 3BZEA 1SBSH 3UPRA 3ZKXB 3D0VA 4FP8L 1NCWL 3LZFH 4MQXD 4HS6A 4HUWA 5FA3A 5EO0B 1BBDH 2JQZA 4NO2A 3VXSE 4TUOA 3ET9F 3RRQA 1QLEB 4HJ0C 1BVKB 4YC2B 3MV8E 4H25A 2CJ3A 32C2B 4JJ5B 1UURA 5HHMD 1DLHB 4WO4B 1JWUA 4P57A 4UDUA 4BGDA 1E28B 1JAEA 3VA2C 3NAAH 2XG4B 2HRGA 2R4RL 3RDTD 4F27A 5IG7A 5IUSA 4P46A 3KLAB 3UYRL 4OJYA 4FAAB 2AXGB 3AXLB 2J57A 3BPLB 4LFHD 4OZIB 2PWDA 4PRIB 1J87A 3OAZK 4L9DA 3T2OA 4YL9A 4CADB 1V5JA 3VFGH 2GQHA 3DV6B 1PJWA 3AG4B 5EUOA 1NPNA 3HKFA 3L7EA 3S34L 2EINB 5ID0B 3BQUA 2P8MA 4ES8A 4HP5A 3M1CA 3SOTA 3NYKA 4PJBB 1ZWIB 4PSPA 1VACA 4MZRA 3T6VA 4MXQC 5D1QA 4MA1C 3U4BH 1NH6A 2A73B 3PF2A 2J44A 3FAXA 1EAJA 1GOFA 4H8QA 5DO8A 1NCNA 2HFEA 5F1IB 5B1JA 1AXIB 2VC2H 4CSTA 1QOKA 1RJLA 1GS8A 5EIIB 2FR4A 2C3GA 2DQHL 3CBKB 3U9PH 3PAZA 1Z1WA 4XCFL 2J4WH 1DDTA 3BZFB 4NN7B 2OKMA 4PRBA 2ED7A 4XPBH 1KYUA 3CDYA 4XVJH 1EZLA 2GITA 3H9SA 4WTZG 1ZSDB 1OO2A 5F6IB 3VDAA 1JPFA 2J88L 1ET5A 4IDLA 3BP7B 3KWUA 1TLMA 1FHGA 5AW8B 3V0WL 4HKBB 3QCVL 4JG1L 3IJEB 4N0YH 5MEPA 3MA7A 4EI5D 1T3FA 1YEDB 3FPYA 4HWZA 1RMFL 3VRIA 2VNCA 1VERA 1F02I 2E8YA 3KEDA 4G6AC 5BO0D 2E9JA 4GRMA 5KS9A 1X5HA 3O4LB 1Q0XL 1OW0A 2AZUA 2D3NA 4FQHB 2ZPKH 2E27H 1C5DA 3QCUH 1LEKB 4JRYA 5F7UA 3TA3C 2W38A 3EW3B 1I1RA 3K4DA 5AOIA 1EJ8A 3W0WD 4N8UA 3NP3A 2CDEA 1J5OH 3GRWH 1I1AD 3MLVL 1EHAA 1JPTL 5DRWB 4PJGE 3DWTA 4PJHB 4NWUH 2EIMB 1KJVA 3W2DL 2DICA 3JTTA 3V4UH 5LGJA 5IVXB 3HBGA 4FX5A 2FDBP 5IVOA 2FBJH 4JM2B