2KLRA

Solid-state nmr structure of the alpha-crystallin domain in alphab-crystallin oligomers
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
82
structure length
82
Chain Sequence
RLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solid-state NMR and SAXS studies provide a structural basis for the activation of alphaB-crystallin oligomers.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Alpha-crystallin B chain
total genus 13
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
A PF00525 Crystallin Alpha crystallin A chain, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2klrA00
1EJFA 2Y1YA 2WJ7A 2WJ5A 2CR0A 3Q9QA 3GLAA 2BOLA 4PCKA 3L1GA 3GUFA 3Q9PA 2RH0A 4YL9A 3L1EA 1WH0A 3QORD 2K8QA 3QORC 3IGFA 3QORA 4M5SA 1GMEA 2KLRA 4PBDA 3EUDA 4M5TA 3W1ZA 3VQLA 3VQMA 4ELDA 1X5MA 1RL1A 1SHSA 3AABA 1WGVA 4JUSA 5LUMA 1WFIA 2CG9X 2Y22A 4RZKA 2Y1ZA 4ZJ9A 5DS2A 4I88A 2MNWA 2O30A 3GT6A 4YE0A 3L1FA 2JKIS 4JUTA 2XCMC 4YLCA 4YLBA 3J07A 3QORB 5DS1A 3AACA 3N3EA 2N0KA 4MJHA 2KMWA 4YDZA 2N3JA 4FEIA
chains in the Genus database with same CATH superfamily
4TL5A 4L3ED 5BO1L 3Q1SH 4P5TC 2BDNL 3BKJH 5TE6H 4LNRB 4BSWB 5IQMA 4NUJA 2ADIA 4GXUN 4AV0A 4NZRL 3T4AA 5CEXB 1CJYA 1PSKH 1JUFA 5IB4A 4JFOB 4PJ8D 2YFNA 4QRUB 2VJ8A 2ZXEB 3UZVB 2MKWA 4JG1L 1YYLL 2PWDA 5IW6A 1BZOA 4R0LA 2I27N 2NTFA 2DLHA 2X41A 3RVTD 3L1OH 3NIGF 1QNZH 4PJBA 3AXHA 4POZD 4ZZKA 5EHFA 1FZOB 3S3JA 3TIEA 5HHOD 1MXGA 3D4YA 2VO8A 3KM1A 4MAYD 3GMPB 4PUBH 1YEGL 2RMNA 2MIZA 1NEZA 2X2YA 1E30A 2VXVL 5HHOE 2BSTA 4UIMB 4JHWL 5FHBH 4GOSA 3V0VB 4DKAA 2ZKYA 3H1ZA 3BZEB 2RFXA 1P69B 3UTSB 5DUPL 5A43C 3MUZ1 3VFNB 1YEDA 1WYJA 2MNUA 5KSAC 4G72B 5LGHL 3CZKA 2R1WB 2PPAA 4MSWA 2XUWA 2VLJA 3PWLB 5HYIA 1N0XH 5B39G 1HOEA 1BVKB 3QJVB 2HFFA 3QEHA 1NGWB 3BLPX 1NAKL 4LHQB 3O3BA 4WGVB 4HPHA 5CD5C 2C9QA 4WV1B 4M62L 3ARBC 4MQSB 5C6TH 3R4DA 5HPOA 3I02B 4Y4FC 2ESVA 1H3GA 4XCNB 3DVNA 3SGEI 4DP7X 2VJXA 5HJGA 3X11A 3B7RL 1MWOA 4AEFA 4KUZH 1EEZA 3NFSL 4O51B 4W6WB 5JDSA 1O7SA 3KPRE 5C7ZA 1MRFH 4MJHA 4CU8A 5I9QB 2JB6A 5EWIL 5K9JL 4FQXA 1RZIA 3PAYA 2BVOA 5HGBB 2XYCA 3DDGA 2GTWA 4MNGE 3LS5H 5K1VA 1U8LB 4UBDC 3BLKA 3QZNA 4QRRD 1E6OH 1CDHA 1H8SA 2ATPA 1LWRA 4XAWH 5JHLH 4NNPL 1KPVA 3QAZB 1H3XA 4HWEH 3FQNB 4FQIL 3HE7D 3AQYA 5IMLB 2BS71 3VG9C 1JWMB 1DANU 1ZOXA 1ZJAA 5D1ZC 2ADJA 1UB6A 3W38A 3ZO0A 4NC2B 2FR4B 4WW1A 2YD6A 3QJFB 5SWSB 4EZLA 5IOPA 3ABMB 1MHHA 1FO0L 5HGAA 1DE4A 1G7PB 3O4OC 2VYRE 1C08A 3GJFH 1I85A 2NY2B 5IFHL 1PTZA 1YJDL 2IBBA 3EJUA 5BZDA 1DQLL 3CK0H 1T0OA 5IQNA 1H5BC 2YZ8A 4NAMA 2LTQC 1QLRA 3KPLB 1S9YB 3AROA 3WIHL 3U79A 1WIOA 4CBPA 4NO0A 5DQ9B 4A7UA 4RWYH 2F61A 2FO1A 1KLFA 4UBDD 4OIIH 5I8EA 3MRDB 1T1XA 1HOCB 4TSCL 4N6RA 4AUYA 4V33A 4HLZH 4L9LB 4LASH 4PJXB 3GB7A 2R4SL 4DJMA 2PCFB 1OANA 2ZP8A 4G8GE 4EZKA 5KBKA 1JZ5A 1U41A 2APXA 2UY6B 3S2AA 1J12A 4PRIE 2D3NA 6FABH 3X1FA 2WXNA 3ATAA 3QQDA 3CZEA 3OZLA 5D7LB 3CSPA 2QADC 4N24A 1DLHB 4UM9D 2QVMA 3MJ9A 3NTCL 2OMNA 1KGCE 2MOVA 1LEIA 8FABA 4FD0A 1VAHA 3FO2A 2RA1A 4DTGH 1XFPA 3G6DH 2CLVB 2EH8H 3P9WB 3LNGA 4IRJC 2K7QA 5DK3A 1D2PA 3LKNA 4E9XA 1URZA 2MNJB 2Z8VC 5L2KB 3MV7E 4RLDA 5JXAL 5ENWB 4MQ7B 4ZOEA 4C4BA 4WF7A 4TNVK 2VLKE 2P47B 4XP4L 2Y7SA 3THML 3U2JA 3H56A 1JTOA 1WT5A 2ODHA 4UI2A 3VDAA 3SDCB 5IGXH 1QHPA 1QSFA 1CPUA 4ALAH 1AGEA 3RZCC 1QKZL 4LVOB 3BUBA 1Q1PA 3CX5K 4WI2A 2GBTA 3BPNB 3KPMA 4N5UA 2X4UB 3VU2A 2QPUA 2Y07H 1EFXD 4NGHH 3RX9A 2XU9A 1GVIA 1J9RA 2Y9RT 4J3TA 2ARWA 1KNOA 2OMBA 3WO4C 1TVHB 4U1KA 5KVGL 1L9NA 4G7VH 4XWOC 1EXUB 5DTFB 5C0IA 1A1MA 4OU3A 3LRGA 4LU5L 5D7IB 5TTRA 1AXTL 4K5MA 1D6EA 3GGWA 1F11B 1EAJA 1U92A 5EC2B 4UDTA 3NRFA 4KJPC 1CLZL 1U8OB 3MRRB 3RA7H 5D7LD 3ZKXC 2FJGA 5KBDA 1OWWA 2DLIA 2AJSL 1WZ1H 3JTSA 2J3SA 2IADB 4AV5A 2Q8AH 2VQ1A 3CSTA 1L7TH 2GJZA 2B2XH 4DK6A 4P2RD 3O2WL 1LO4L 5CUSH 1G7LB 2OMVB 4WO4B 3O81A 1LO5A 2BPBA 1XF4A 1A2YB 2V2XB 2F5AL 4UZGA 3WJJA 4QRRA 3F7QA 1JG9A 2P7TA 3CLFH 3QUMH 2VKWA 2CDEB 4QRSB 3HUJE 3SGEH 4C57C 1XF3B 3O2VH 3F6IA 2BIOA 2OL3A 1ND0A 5FXCH 3C5ZD 4FXKA 4LIQH 3EYVA 2IOMA 2X87A 3KHQA 3LKNB 4X6CB 3RKPA 3VM5A 5FUCE 5KYXA 3SKOA 4LARH 2A77H 2OM5A 4KY1L 5FO9B 2DEYX 2I60L 2OMUA 1X7SA 2NOYA 3E1F1 2CE6A 2YN3A 3PGDB 3NGBC 3VWJA 4GXUM 1I1FB 2P5PA 4F7TB 5F6IB 4AIOA 2FRGP 3MFFA 4DFHA 1N70A 3LPOA 1FNHA 1SYVA 5JUEH 1CFTB 1AZRA 3GIZH 3QEQD 5T33H 1UWEL 2WQVA 2XG4B 4M00A 4PD4K 3B43A 2FL5A 4JCMA 4NNXB 1TETH 1NCHA 4FFZL 3HZYB 4HZ1A 2WQAA 3LDBB 3ME0A 5ILTL 4Z7OF 1OGTA 2JKLA 1T7VA 4OLWL 1T1ZB 5I73B 1RIHH 2ITCB 5DD1L 4LNVA 3QRBA 3L3JA 3IXAB 4FMFA 2GJ6B 2HLAA 2DIEA 4JRXD 1QI5A 3QWOA 2V3EA 2JKSA 2DKSA 2QELA 3C08L 4FG0A 4OZHA 5FPIA 5EZJA 2WPGA 2DL2A 3VQ1C 1XMEB 4PJEE 3REWA 3NT0A 4QI3A 1E90A 4G43A 2WNKA 2PCPA 4MZIA 3GSOB 1YEFL 3UOAB 2D03H 4MXQD 3D34A 3FU8A 1HINH 3WE6A 3Q2CA 2HLAB 3EAKA 4N90D 3TZVA 1HJCA 5I19H 2GHWB 5K69A 4LLDA 4P23C 1ZDSA 1NCIA 3BZ4B 1HL9A 1ZHLB 3Q9QA 5TE7H 4D9QD 2K4WA 5CHNB 1KDIA 3PIQA 3T1WA 4X6DE 5HD8D 4KZDL 1B3IA 4EIBA 3MOQA 5B8CA 5K39A 5AVYB 2Z4QB 5AW1B 1YUKB 3HE6D 4OCRH 3HZMB 3AGVA 3FSOA 1NWPA 2WLYA 3K8LA 2XY1A 4PV8A 4J28A 3CDGB 4YK4B 1ZPUA 2ZOWA 2VRAA 4XXWC 4DH2A 1Z32X 3JBG7 2DM4A 4M48H 2KMWA 3PWUB 6PCYA 1OT1A 2A3TA 2Y7NA 2DQDL 3HC2A 3RGBA 4KUZL 1JZHA 2JMRA 4LP8A 1HHHB 2UVFA 1AQHA 4ODVL 1LEKB 3OKEB 4HWZA 5BZWA 5GZNA 2UXTA 4QO1B 1G7MA 4UAOB 2ZQKA 2QVIA 2FIKB 3H2WA 5DC0A 3H9SA 3TVMB 4KX7A 1MFBL 1R33A 3F7YB 1ZLEA 2VZUA 1U8IB 4TUOB 4P2QA 1T1WA 4JRXB 3Q6FB 3H3KA 5LKNA 1ASQA 2IAMA 2BOBA 1I3VA 4LFHG 4Y4KC 4UZUA 3TFKD 2IDUA 2EUVA 4MS8D 3PIQB 2PW1A 4N8CL 4F92B 1D5MA 5I28A 2YRBA 4JFSA 3T0AA 3GK8L 1A4AA 5C8JA 2BM3A 3SJVD 3BVVA 1QBBA 2Y7OA 4ZS6D 4HGWB 3EUUA 1AZUA 4XZ4A 4NLAA 3G04B 3PPSA 1DVUA 2FLBT 1A9BA 2ODIA 2NPLX 4M7KH 4E9TA 4PV8B 1T03L 5F9WC 5DWUL 1QUNA 2NYYD 3BW9A 1HDMA 4HWUA 4M93B 3IXTA 2PR9A 1MNUL 2ZIDA 3DMMD 1FFOB 3ESMA 3MLVL 3CXHK 1D2OA 4KZEH 3T3PF 4AC2A 1U2YA 4TTGA 3GNMH 3H7BB 4IOFC 5E51A 3PG2A 2OS7A 3HE6B 4GH7B 3TWCH 1DJZA 4XAWL 5JHLL 5FYLH 4DCQA 5DJ0B 3IAGC 1WFMA 3ME0B 4R7VA 1MCOL 5MEPB 2P5WB 5JQ6H 1KJ3L 3WU1A 2R2HA 3QUHA 4UTAA 3PE9A 5I9QC 1Q9KA 4EN2A 3LOWA 4OBRA 4K3DH 1GJUA 4YPJA 2Y4SA 3KNBA 5DJ6B 2OYKA 3EHBB 3GMNB 1IAKB 2AEQL 2PO6B 3ILQD 2H3NA 4H7VA 3KGTA 5I1AB 5JIPA 2HVJB 5KS9B 3U0WH 1UG9A 1TSHA 4L8BB 1FO0H 4U6HB 2HMID 4K15A 4MDJA 3T0VA 4Z7QB 4Q9CA 2R2BA 4MJID 4HGWA 2XWZA 1UVQB 1HSAB 1KPRB 5IMOA 3L4WA 3WY4A 4HCFA 4M9PA 1S3KL 4MDRA 3V4PB 1TFHA 5IFJB 1A7QH 2R2CA 5A16A 4LXFA 3RFZA 3DIFA 4JFYA 4FGMA 4C59B 4FJZA 4GAGL 4GMTL 1UZGA 4TVSa 4M3JA 3K8MA 2FATH 4OLVH 1EAOA 2BX5A 5T3ZD 1U8IA 3NFNB 3KZ8A 2KERA 3NIFB 5ESAA 4FQJL 5E8PA 4G3YL 1ZS2A 4Z77A 3N91A 1FNFA 1KJ2B 4J3WA 4GRWF 1TYJA 2FZ3A 4PRHE 2HTKC 1OAUH 1KBGL 5ACZB 3BFWA 3ETBF 2BS9A 2PABA 1ACYL 4KX9A 2XQ0A 5HYSB 2YO3A 5ALBL 4HVBA 5IEHA 1WO2A 3IU4L 4OLYL 4F7MB 4H8PA 4E9QA 2FQFA 2CD0A 2IGTA 3H6JA 4WI7A 2BY2A 3VXMB 4X8GA 1WZKA 2YGQA 3H9SE 4X5XB 2CM5A 5GHWH 1A14H 5LDUA 5AZEL 1U3YA 3TO4B 3TPKA 1O6TA 3L2MA 4LKCA 4TSAL 3VXQA 4D9LH 2F18A 1QLEL 1RK0A 3EFOA 2FEDD 3ARUA 5ITFB 2W95A 5E8DL 4F8TA 3VO0A 2ZZUT 3BO8B 4XBEH 4OCYH 1K72A 1CGSH 1H8OA 5DJ0A 3SDAD 4YDLB 1A4JB 2VDNH 1CF8H 1JK8A 2EDDA 3WJMA 4EI6A 5D7IE 3G6JA 1IGJA 3T0BA 2NW2A 2C1OB 1R3JA 3IDIB 3RWHA 3WN5B 2JCCA 3DX9A 3EXLA 1JGVH 1KYDA 2MSPA 2C9SA 4OH2A 5TQ0L 1NBVL 2VXUL 3KJ4B 4C83A 3OMZA 4JM2C 4L0YA 4PRBA 4UNUA 4WFGD 1DVFD 3QIBB 4HUUB 1L9PA 4KQ4L 4YDMA 2CJTA 3U2SA 3V4LA 3KPLA 4E68A 4JG9A 3VTAA 4MZRA 3TBYA 1UD5A 4Q6IC 5KOVC 1DO6A 2VLKA 3N1QC 5IEHB 5EA0L 5IROA 4Z3TA 1E9OA 3P69A 4M6MH 4ZUSB 4HCGA 2DQFB 1FVCA 3MV7A 2EUZA 3CFEB 3F3HA 3GLZA 5KYWB 4XB3A 3QRFM 3RWDB 1NCUA 3W11C 3OKKA 5SWSA 2H1LM 2Q8BL 4MBRA 1JRHH 1I8MA 2HVKA 4OD3L 2E5EA 3ROLA 4Z3GA 1CIUA 3C5JB 1T89C 2XKSA 3ULUF 1RZPA 4Y1TA 5GRZA 3QFJE 2Z91A 4IMKA 4M8QA 3D33A 4N28A 4XB7A 3AMKA 3P4LA 3RIFK 4NZJA 5KVFH 2ZAHA 3WFCH 1G9NL 2EO7A 4DK5A 2QMJA 3ZE2B 5IKCB 3A6BH 3K72A 5EU4A 1B2WL 4P4KD 4AE0A 5E6IC 4JFHE 3RL2A 1I8KB 5D7LE 4UV4L 2GJ6E 4PJ5A 1CDJA 4WTWA 2Z91B 1KPUB 5SV3A 4JO3L 4F33B 1BQRA 1NC4B 1TQBC 1T3FA 4UT9H 1ILSA 1R46A 1ZSDA 3DJ9A 4KWUA 2OBGA 1S4IA 2WCGA 2UVEA 3C8KB 4WSKA 1WQVT 5C0AA 4DVBA 4O5LL 4ZOBA 3HAEB 3GS4A 4EJ1C 3QT2A 1QSFD 4OUUB 3VFSA 4E9SA 1G1OA 2AVGA 3FAXA 3FJTA 4FA6A 1ZVSB 2QVKA 3U48A 4FMVA 4LQFH 1ZLUK 2I85A 3DV6A 2GUOA 3L1GA 1AOHA 3KPSA 2VC2L 1NGXA 4NPKA 3AXLB 1G9MH 5BQ7B 5IR1B 4M7LL 3SZ6A 5MEND 2BO0A 3ALWA 3EUDA 4OLUL 3NQIA 3CCHB 4W9ZA 5FK9A 2DI7A 5MP6L 3ERXA 4KZDH 4N25A 1CLCA 2E8YA 4OW6A 2NCMA 3WS3A 3R1GL 2FQGA 3VYPA 4KMTH 1G9HA 4JFOA 4IK6A 4FFZH 5ILTH 1G9MC 1H3PH 4D3CH 1NMAH 4ZT1A 1DQQA 3GXDA 3KPRB 4ATWA 3K74B 2BY1A 4OQTA 4TVUA 4OUOA 4ODHL 4X6BB 4LCCB 1QZNA 5KJ4A 2DQFA 1LGVA 1NLDH 4JQIH 4A37A 1OE2A 4JX0A 4MNGA 2FT7A 3KPSE 3RY4A 3ULUD 3CH1A 4JRYE 1SBSL 3AW5A 4XCEA 3RQ3A 5D71L 4F58H 1WITA 1AGBB 4LCWB 3EYOA 4ELDA 4U6XA 1ITBB 1JERA 1NAMB 5HHMB 4XXDB 3QIBA 4ZJ9A 4BZYA 4M4PA 1CT8A 2QSTA 2MQCA 2O5NA 2VDKL 4X7SH 2XJLA 3DKHA 3TNMB 4M61B 1BOYA 5EU6E 2ARJA 4AH2B 4GW5A 3V79C 1KB5L 5EDXA 3OKNA 5G4MA 4HUNB 4G42B 4MXQC 4M43L 4PJIA 1KLGA 3TPUB 2ZOLB 4O2EA 3QQ4B 1BGXL 1HI6A 4PWFA 3B2UD 2N1TE 4X4ZA 4X6DF 1F3JB 3SPHA 1U30A 4DP5X 2EP6A 1ES0A 1HKLL 1E67A 1ET5A 1U3JA 3VQ2C 2APFA 3VB8A 2EAEA 4P5KA 1ZVYA 5CMAA 2RQ8A 2W94A 3Q06A 2HYMA 3AREA 2Y2WA 3DBSA 2F58L 4OZIA 3LZOA 4F3FB 5FO2A 5BRQA 3GKWL 5IQ7H 3CXDH 2DDQL 25C8L 1KEML 2CGYA 3HG1D 4FI7A 3P0VH 3L4XA 3NZ8A 3LS4H 1USZA 4HPYL 32C2B 4JY4A 2GT9A 1FZKB 4L2YA 5I66A 1AVAA 1NC2B 2WBWB 4LRNL 5AALA 1A22B 2XTJC 1EAPA 3RTQC 5C0RH 3KYKL 1BXAA 1QW8A 4Z7OE 3ULVC 4LE8A 2XG5B 4L18A 2EIBA 3V0DA 5D1QC 2FJFB 1R6VA 4ZODA 3IPBA 1HEHC 3G5VA 1DVFA 3QA3B 3P4NA 5ICYA 2VRQA 1DSFH 3UDWA 2GITB 3ZE2E 1IGIL 1INEL 4LLDB 1DQDL 3G6JE 2Y5TA 5CINL 2APWA 2NTSP 4NZTH 5F70A 4GXFA 1KENL 1E4KA 1FGNL 3BGMB 5H37H 1JHTB 4LL1A 1DDHA 3T4YB 5FB8B 2JK5A 1YEEH 4QXWA 1S9VA 4BSJA 5EZLB 1A3RH 1WWAX 2FH6A 4YDKL 1GJIA 1UACL 2OMUB 3AMLA 3QIUC 1AP2B 2M83A 5JZ7C 2Z7YA 3AITA 3KLLA 4R7DA 1R5WB 4NEHB 3RTLA 4DW2L 4TV3A 3NAAH 2MPVA 3BSZL 3VWKB 5JXEC 1LO2H 2AGJL 4H5SB 1X5XA 4HA1A 1ZT1B 4FQ2H 4KDVA 2Z92A 3T0DA 3GTNA 3U0WL 1GH7A 1N5AB 4AENB 1G0XA 5DJDA 4AVHA 4XVTL 4LKXB 4MA8L 2OZ4A 3S7GA 1NFDF 5CGBA 3T0XA 3H9SB 3D5OF 5ABDE 5F7DA 1HEZA 4LDOB 5E9DD 4XWGL 2JJSA 4HSCX 5KYXB 3BCFA 4PD4J 4OIIL 2XKNB 4HUWA 1CFVH 4FNPA 3TCLB 5KBNC 5C0BA 3PHOB 5E6ZA 4G8EA 1D5MB 4GQRA 3HR6A 4XX1G 2V4LA 5DR5L 2EIDA 5LWYL 5C07E 1CI3M 4MKTA 1RZGB 1VIWA 2CDEA 3VXRE 4IRJD 1QFWL 3EJYC 4S1RH 4ELMB 1HCFX 3NCWA 1OAUL 4DETA 5LAXA 3UZEA 1N0LB 4FTVD 4ZZFA 3QHZL 2F7QA 3GPSA 4YHOH 4EUPA 2O1AA 1EJFA 1PYWA 2K70A 3BKJL 3EDEA 3CZFB 5I1CH 1T4WA 4UV7H 2YZ1A 1LMKA 1SXAA 5I1HL 1U8KB 1X5FA 2ZG1A 4X6FA 3DMMB 2C9XA 3D39A 1LP9A 3BFQG 5K9KA 3QW9A 5DRNB 3VWKD 4LP5A 4RIRB 5T5FA 2IBGA 3TCXA 4FL4C 5E8DH 5DJCB 1DUYA 3VMNA 1BD2B 3WKQA 1A9BB 1F02I 1PZDA 1OL0A 2J6WA 1OARH 4Z7NF 1XXDC 4LHJB 5IJBC 4Q52A 4AMKH 4X0KA 4EVNB 1U3HC 1S5IL 3TEWA 3QZOA 3TO4C 2X89D 4AQ8C 3I50H 2DLFL 2XRAH 2OI9C 4XVOA 5F3FA 1MWAH 4JFDB 4AC4A 1XZWA 4MVBD 3ZTCC 5KVFL 1FBIL 2GC4C 1T22B 1I7ZB 3JV6A 4XGZA 3UYRH 3K5RA 2OA9A 2UZPA 3SQBB 3VRIB 1A3LL 3VI3B 2AEIT 2VMJA 5IK3A 3MFFB 1UA7A 4DT2A 3J7HA 4P2QE 5K59E 1INDL 5C09E 2W0KA 2VNCA 5KVMC 1FQ9C 5DZAA 5J6HB 1LD9A 4W6XB 4POUB 4LL4A 1E27A 1J0JA 1MI5B 5D72L 4JJ5A 3VGAB 3PHOA 5D5ME 4OGAD 1JPFA 5TK4A 4Z76B 1YY9C 2IDFA 3B2DC 3VW3H 3X1GA 1F86A 1G7HB 2CO4A 3MTXA 4P48A 4PJBF 2AXFA 5FA4A 1G4RA 3D18A 1MFCH 3UYPA 1PZAA 4GUPA 2YKKA 4AKQA 4TKWA 5J3HD 3O2WH 1UH4A 2MKLC 2C3VB 1J87A 1ZHNB 5I1IH 5DO2D 3FB8B 3GBNH 3MLRH 4EIGB 5ES4B 2ZSVB 4XXWA 2IANB 1XH3B 3DHMA 3U1SL 4N5ED 2R69A 5J8OA 3WN5C 1VFBB 3OLDA 1XL6A 4HIJA 2WAHA 3L6FA 5E5MB 3GO1L 3RP1A 1R3KB 4WNQB 3ZL1A 4HUWB 4U1NA 1JIBA 3K2UL 2YKLL 4S2SA 4DP4X 3ARFD 2LAGB 2OL3B 4XC1L 3K4DA 3MRKA 2EEAA 2XN2A 4IIQC 3WGUB 2X09A 3QJTB 2DTSA 4JRXE 1H0DA 4E9VA 2JKNA 3X1NA 2H1PH 4JFDD 4XE0A 4PRBB 5EZJB 2AV7A 2DH2A 4Y4KA 3NZHL 4OTXH 3WSQL 2VM9A 3SOTA 2O26U 4AQAA 1KIUA 4PJCE 1ZXKA 4JKPL 3RWFB 1S6NA 4AYDC 3BH4A 4HS8L 4UMGA 5LGYA 2HX9A 2ICEC 5HD8C 5JW4N 2CCWA 2F5AH 2X3CA 3SE6A 4JCWA 4ZO9A 4MAYC 3Q0HA 4GO8A 4S1SH 2XWDA 2W59A 4HC1H 2WXRA 3VQLA 3OAUL 3V0FA 3VFWB 4CVZA 3S8WA 4GP4B 2H2PD 3KPNB 1MCPL 2CHXA 2WIMA 2EDXA 4LEXL 3FSZA 2PPCA 3O2VL 4X0NA 4QHLA 1KBVA 3ETTA 4NKOA 5IJCC 4IRSD 4PG9A 3E2HB 1PY9A 2OCCB 4OCSH 2NY6C 2C4FT 2WVUA 4UAOC 4L3FA 3DGGB 1XSIA 3STLB 1JBJA 3VSVA 3DX1A 3QORB 4KAQL 5D2LA 2GJJA 3LKOA 5EZIH 2I60H 3NPSC 4LSPL 5D8JH 3F00A 5IB3A 2HT2D 3CIAA 3HJ0A 2AFNA 4U3SB 1W72B 1WCBB 2V2WB 4WU5B 3OWRA 2CIKA 3P0VL 4ZFOA 5HYQA 4ESKA 1ZY9A 5ANHA 2QMKA 3FBQA 4YN3A 2MQGA 3VFRA 1TZ8A 3WUWB 1TMCB 1WA2X 2OJEB 3T6QC 1ZRUA 2BIPA 1IC1A 5MENE 1SDYA 4FNQA 3O3EA 4OCRL 1I9IH 5CN3A 1MJ7L 2AAVA 4W9JC 4DGVH 4Y5YB 1L9QA 3RVXD 4TN9A 4JJ5B 1M7DB 5DZLA 3DXAB 5I2IB 5IFAH 4J39A 1D9KA 2YOCA 1JVKA 5I75C 4XVJL 4EN3C 1IBGL 4ISVB 1G6RH 4LDEB 3U0PB 2BRRL 3UZVA 5CN2A 2K3HA 3HR5B 2LFGA 2W60A 3CGTA 4NOBA 3SYOA 1ZJBA 2YD7A 3WHXB 1BJ1H 4NQSA 4AK2A 3PJSB 2OMZA 4JFUA 2WQ8A 3CVIH 4HCRA 4YLBA 2KLSA 2NUPB 3JUYA 3SGDH 4RFEB 4LSRL 1ZLUH 3MCKA 5DGRA 3RI5F 1M9SA 1TQCB 4UIKL 2H5UA 3L16A 5EF1A 4OF0A 1J0IA 3A6CH 2VN5A 1CICB 4AITA 2HTLD 1JYNA 3E3QC 2GIMA 5IF0B 3FO1A 3MJ6A 5DC2A 2L7QA 4EI5A 3H0TA 1VZHA 4FTDA 4FQ2L 3BHBA 5GJTL 4AEHL 2VDMB 1E4WH 1QSFE 1OM3L 5C2UB 1YRKA 1JSYA 2RD0A 3BT2L 1MZYA 2DQDH 3IBEA 4RZCB 3QR2A 1T03H 1U8NA 2I9LA 1CICA 3LMJL 3ZQWA 3RTQB 1HVXA 4FMKA 2P8LB 5E9DE 2WO4A 3MA9L 1H19A 1GOHA 5DI8B 3MNMA 3DWTA 4PJDF 1JK9A 5IVZA 1NCJA 4E9RA 5K9QI 3FTUA 4RMWA 3I9AA 3QG6B 5JA9A 1IJ9A 2N59A 1DBBH 4M1GL 3WTUA 1SN0A 4M5TA 1PU0A 4IKJA 3ILEA 1Q4NX 3PWPB 4GLRI 4I2XB 2HVBA 2FNWA 3OKDB 1S9WA 2Q7YB 1F3JA 2A1WL 4NQEB 2BP5M 5CZRA 5IY5B 3DX0A 4YHPA 4X80H 4FQXD 1OCRB 3K5SA 3EH3B 4FFWC 4LSSH 2Z7UA 2WB7A 2WOBA 2RCSH 4YDZA 4A2DA 5CM1A 2XIDA 4G5ZH 5HDQL 3TN0D 5D1XC 2XN9A 4HF5L 2D31B 5TDPA 3QDJE 2BOCA 3QFGA 3M1BB 2XACC 5GGSA 1OAYL 3JTBA 3MRDA 4Y4FA 3QPXL 1AH1A 3MLVH 4KZEL 2AXJA 3GBLA 3C5JA 4Y2DD 5ANMB 4WV1A 2Q76A 3AU0A 3BKML 3S35L 3KLKA 4JN2B 2E7MA 3WCYA 4ZSOA 1MFUA 4ZUWB 2AZAA 1MREH 3U36A 3HVNA 2Y6SD 3HNTL 1MJUH 4PRID 4FYRA 4X8CA 2AJUH 3LN4B 4UQAA 5H35B 5CGYD 2YRZA 4ZFZB 2J56A 4PJ9B 3P9LB 1TZIB 5DHMC 4BH8A 5DMKB 2YUZA 2X44D 4ZQKB 2A73A 1HH6A 1GS7A 1HWWA 4LGSB 4XCCH 3KWWB 3ZE2F 3FU0A 2FQDA 4JUTA 4JAMA 4NUJB 5B4MD 2PTVA 1E43A 4P2QD 2JB5L 3PWPD 2X05A 1A7QL 3BPNC 2CRIA 5K9OB 1INDH 3D52A 3S37L 5JHBA 2RJMA 1CDBA 1CD1B 1A64A 3KDPB 4FQXB 3ZUNC 3GMMA 5LVEA 2L8AA 4GS7B 4WJG3 2EXSA 4AYEC 1O75A 1T4KB 2YWZA 2KZWA 1F4YL 4N85A 2AANA 5F88B 3NACH 3GSRA 2MTAA 4WRLA 2WZPA 3D48R 4ZDHB 5ABAA 4ODWB 3HVDA 1RXLA 2XIBA 4C4KT 4WK4B 1D6VH 4CADA 1Z7JA 2UZXB 5HDRA 5C08E 1IO4C 4UYPA 3EDJA 2R8SL 1WPCA 3WEMA 4Y2DB 3TBVA 1WUNT 2WQWA 4KROD 3BP5B 1IQWL 4PGDB 2OMYA 3QWRA 4FEIA 4AYID 1G6RB 1N59A 2IAAC 3WFHA 1ZTXE 2FLMA 4KTYA 1CC3A 3EO0B 3MV8B 3NCFB 4MMXB 1U4EA 1BBDH 2RFXB 5FW8A 1OB0A 3JWNH 3SD5A 3O8XA 2D9QB 4PJHF 1P7HL 4TNVF 3GMLA 3VA6A 4XMVA 4RDBA 4ZTOL 3H3BC 1ZSDB 3HG1E 4XBEL 5D72H 3ZVVA 5F8QC 3F64A 5IHWA 3A4AA 4Y1AB 5HI4D 2VZ1A 2HFFB 3QEHB 3KGSA 1CF8L 1OCCB 5FGRA 2VDLB 4G2AA 1U8JA 3ET9F 1GYVA 1MUJB 4WGWB 1WWCA 3HC4L 5HHME 3TT1H 4FQQB 1D5IL 1CBVH 1W72H 3HN5A 4YWGH 4ALAC 4IRSC 4PIBA 1UD8A 2P8LA 3ULVH 3NSXA 1TVBA 5EDSA 1C9SA 2VIRA 3A5VA 4KRPD 3IDXH 2V8MA 2PXYB 1DBMH 1RLWA 3Q05A 5GSVB 4WFFD 5EC2A 1WJ3A 1CFMA 4YXLH 3BWZA 4UV4H 3QCVH 1UYWL 2X1OA 5BUPA 3AFLA 1A1NB 5ISZB 4JY5H 3LIUA 2DD8L 3H2PA 1FVEA 2RBLA 4TTDC 4M6ML 4HJGB 4JPVH 4CC4C 5JOFA 2CRYA 4Z7QE 2Y5TB 5IESL 3ZZSA 3ZR5A 2HP4A 3T5WA 5E9DA 1K8DA 1TU2B 2P43B 3DXAE 3TH3T 1DSWA 1UOLA 3UCRA 1IEAA 2V3DA 3QHFH 4OBSA 4X6BA 3ULUC 1A3QA 1OTSC 3K6FA 3T8MA 2FSDA 3FU7A 4H0HB 1I3GH 3HG4A 2UZIH 1CTMA 2OZ4L 1IC0A 1B88A 2JTYA 2VXTH 4JKLA 1JV5A 2NQDA 1G9ML 2DIJA 4PVNA 5IB2B 5E4EC 4Y9EA 2D7MA 1GL4B 4OF8A 1SLVA 3RJOA 4EIZC 3NP3A 4GQ9L 2LLGA 4LCYB 4WFGE 1NPUA 2EDHA 1ZV2A 4LRIA 2CO3A 3GJFA 2WXHA 5D70H 3ECBA 4R9HA 1OO2A 2A4ZA 2YD2A 2F08A 1Y7VA 1KB3A 4ODXB 2WK2A 4Y1AD 1MJ7H 2CGRH 3HS0C 5DO2C 1I7RA 2H7WA 1WGOA 5AOLA 2FO4A 3M07A 5GPRA 5ID0B 2NT1A 4PREB 5C2BH 4G3YH 2XPZA 4OCSL 2YA0A 1Z1WA 1P1ZB 2JQZA 2IOIA 3ATBA 5HYJE 5IW1A 4POYA 2IH8A 3QJQB 4QRTA 3UTPD 3IDYB 5E94A 1I1YB 3I9PA 2BNRE 3H4HA 2PXYD 2R56L 1BW8A 1JGEA 3PPEA 5D7SH 3V4UL 2GVYA 2ITEA 2BSCA 1S8DA 5D1QA 3ZTJH 1NC4D 5F71A 1NKGA 3JT2A 2Y25A 3GM0A 3IU4H 3MUUA 1JOIA 1MFAL 3L6FB 4Y1SA 3SBWA 3CC5B 1DQML 2DM3A 4ZNCD 2QPFA 1K8IB 5CP7A 5B1JC 5I8EB 3Q2WA 4KMTL 4OCMC 2CJ3A 1S7RB 3COOA 2I32A 4I2XE 5K9QG 1TTCA 1PKOA 3GMLB 3MLTB 5HTSA 5T3XE 1I9RL 2J6EA 3GRWH 4GUPB 3AS1A 3UJJL 4ZW5A 1KULA 3G5XA 1UXMA 5DC9B 1L5GA 4NZFA 3D51A 1ADQL 3WTTA 1AOZA 6FABL 4KVNL 5C0AE 3TURA 1XZ0A 1WRFA 2Y2YA 4O02A 4PJ8A 5DZVA 2RH0A 3QEQB 4AJVA 1IX2A 1X4XA 3VXME 1RFDL 3QJSB 2P24B 1ZLVH 3NVQA 3TNMA 3RUGA 3MRIA 2VN6A 3P2BA 4FC3E 3VWKC 3CMGA 4DPBX 2YWYA 1B4RA 3MNZB 4FFYA 2OP4H 4B53A 3REWB 1MCWM 1OP4A 4YBLB 3FCSB 4O2FB 1ZS8B 5EEXA 3D2UB 2X4TA 3BDYH 1CMOA 2HWZL 2PNDA 3FUMA 1XCQA 1YEHH 3TZVD 3DGCR 4MJJA 3F12A 1R5IB 4EMZA 4M29A 3TU6A 1FFNA 1IGYA 3TT3H 1KFAL 3TFBA 4QTIH 3BZ4A 1VGEL 3I2CL 4JR9H 5ALCL 2QFPA 4AIZB 2YOAA 4WIQA 2HH0H 4YFDB 4M1DH 3TS8A 3H9YA 4NHUA 3L9RA 4W9HC 1AGEB 1P9MC 2HX7A 1T1WB 4JRXA 2FLRT 4OI7A 1G9EA 1NUGA 4UMSA 3P9MB 3OF6A 1QSED 3P77B 3QPXH 5GSVA 5SX5K 2G5RA 2A7BA 3I6GA 4KRLB 3B3IB 2BVEA 3FQWA 3MRKB 3US1A 5FUCC 3N9GL 4PWHA 3WTYA 4AQ8A 2ICWB 4HOMA 1IE4A 5CEZL 4PHXA 1J8HA 4JN1L 5ECJE 2ENSA 2UXVA 1D7BA 1R3HB 3PV6B 4GBXB 2W8CA 3CBKB 4WHDA 3VQMA 2EDTA 4Y8AA 3C2SA 3REVA 3P2TA 2X4SA 2HTKD 3LEXB 1GXEA 3HB3C 1K6QH 3NJXA 1R1CA 1TEGA 3T8VA 2VN4A 1AHWC 2JTDA 5CBAB 1I7TB 5EUKB 4XOEA 2AJSH 1MXDA 5FKAA 5HHXL 3M86A 4K94L 1V27A 4GBXA 4ABVA 1DQDH 1T04B 3QUYA 1O0VA 1C5CH 5DHVB 5JHDD 2CPCA 3SO5A 3S2CA 4PJ7E 4X4MA 1P6WA 1QFUL 4U2YA 1SVBA 3BAEL 2VN7A 4OGXL 1OSPH 5FF6B 5IZ7A 5ADPH 1CZ8H 1QASA 3BPOC 5BNXD 4A7GF 1XGZA 3TZVB 1L6XA 1MW3A 5BRPA 1TNNA 1WA0X 1FNGB 2EYSA 3IJ8A 3DGGA 3N04A 5EUOE 3STLA 3VJ6A 3F5WB 1FA4A 3NP4A 3KHOA 2ZNXA 3B6SA 3P77A 5D2NE 2HVJA 4ANKA 1U92B 4ZUTB 5DR5H 2BFVH 3CX2A 3WNIA 1MREL 2UXGA 4D0BA 3BP6B 2J8HA 5DJYA 5AKTA 1DDTA 1CD0A 5D7JD 2I5YL 1T66C 1OGAD 2FWUA 4GMSH 3FRUB 4WU5A 2H3XC 1ZT1A 3KJ4C 5C6WH 4MCMA 1G1YA 4JG5A 4PB0H 4JO4L 1I8LC 3D30A 5I18H 3IDGB 4PM1A 1DUZB 3QHZH 1I1AB 1ZIAA 3ZMEA 5L6YH 3HFMH 4FFYL 5KAQF 4EN3D 3I6SA 3CN2A 2L7UA 5GGRY 3W37A 2CDFB 4B0MM 4X7SL 4OZGF 1AYRA 4PR5A 43CAB 2BZDA 4MA3B 2IQAB 1QRKA 1LP9E 3OWEA 5ERWA 5DRNA 5IF0A 2GIXA 4JANB 3BUDA 3WN5A 3IXAA 2N0KA 4Y9BA 4B9ZA 1E4XH 1MPAL 4I48A 4K2UH 3VH8G 2JNZA 2FX9H 4I4WB 1QVOA 3MO1B 1U95A 3U4KA 3SBQA 4XTRD 1GW6A 5FECA 4HD5A 4NKIH 1ZGLM 2WD0A 4GAFB 3RNKB 3ULUL 2SODB 1RSYA 3STZA 5DLLA 1VZIA 2VM4A 4MHHI 4TRPH 1DBML 3BXNA 4KXZI 4JFPB 3GS7A 4PS7A 4KXZH 3LZPA 2EIKB 3WFDH 1ETB1 4HK0B 4AKPA 5IQ7L 3O6MH 5BZWB 2JKIS 2YA1A 4UQ3B 1D9KB 5E03A 3QH3A 1BBDL 1WP6A 1ANUA 1DVFC 5DCCA 3SDXE 5EZOL 4K7PY 2GEEA 5E5MA 3VD7A 43C9A 3Q2LA 2E7DA 5B7EA 1IILE 5J6HA 4M5SA 3LB6C 4L3EB 1KBBA 4NQDD 4ZTOH 5FM8A 3VI4E 1XH2A 1HHIA 5F96H 4I8DA 3N06B 3H6AA 1I3GL 3BEWB 1P0SE 5T1KB 5F2FA 5J0BA 4IQHA 3MRLB 5D96B 2FEDC 2D7TH 4L8CB 4DEWA 3G7TA 3S96B 1RPQA 1KCSH 2XWJA 2W38A 4JY6A 4KFMA 2OSLA 5KJRH 4V1DA 4ZTPL 1FFQA 1DQJB 1S2EA 5LN4A 1FC2D 4L37B 4KH2A 4PQXA 1MSPA 1BECA 3IGUA 3UEZA 2TAAA 1LQBC 3ARSA 4U3HA 3APFA 5EG6C 4FQHA 4DKDC 3IEAA 4HUXA 4O4YL 2AP2A 4NKDA 2R59A 3SO3B 4MA3A 1RK1B 3U2SB 1PG7W 3QIWA 5AB2A 1M3IA 4U31A 4JHBA 3QUKB 1J48A 4GRMB 4MYWB 5F21B 1JI2A 4UUJA 3G08A 3FN3A 5BQ7A 3U9UA 1ORQA 5B1AB 5JYLA 4PWKA 4K9EC 1C7TA 5H4ZA 1T04A 3QUYB 4MAUL 5DHVA 2GY5A 1MVFA 3GSQB 1PY0A 2KLRA 3TIDA 4X6DA 1GSMA 4TVPD 2IANA 4KHXH 3IGAB 4ZSOB 1UJTA 1CDYA 3FL7A 3HTLX 4QF1A 1KTJA 3MRLA 1BPLB 5AZ2H 1J0ZA 3VFMB 3VFTA 3BIKB 4OGAC 2Y36H 4X42A 3RPKA 3HHSA 5I1DB 4C4KO 4W9KC 4XNBA 4PTUB 3DRQA 4W70A 5JOEA 4U1GB 5IROD 1NL0L 3KE0A 4ZW8A 1RMFH 3GHEH 3HUJB 3PQYE 2OLDA 3M1BA 4Z0BL 2PW2B 3UJIL 1E9QB 3VFOB 4M1CC 2DYSB 4P46B 1S9XA 2DRUA 5C0AD 5JW5B 1IARB 4AYFA 4PJ6A 3GSNH 5FC9A 3BP5A 2QGBA 5E9NA 1MNNA 4P2RA 4NQDA 5BUGA 2GK2A 2FIRT 3X3GH 4FLSA 4R4FH 3HMWH 4CC1A 3OX8B 3SPVB 1MFEH 3C5ZC 1DFXA 3KLSA 5FYKD 1ZLWH 5SX4I 4IIQB 3O3AA 1H9VA 4YHKL 3PGCB 1AZZC 4ZFOB 5HYQB 3HOGA 4DQOH 2BIQA 2H2SD 4WCYL 5CLWA 3MRFB 1S7SA 3BISA 4ZW6A 4IBSA 3GI9L 3PP3K 5DSCB 2HJLA 1DEEB 3TXAA 1KTBA 4FF9A 5ISZD 5D1ZB 2C3HA 3VSUA 4YSSA 3KD4A 2VLKB 2D7NA 1U91A 3S5LG 2EYRB 5LQBH 1VGEH 2FBJH 4LLQB 4JM2D 1OCWH 3LPFA 5GGTA 2VXQA 1YDPA 3FZUD 3L08A 4NN5C 2ZAIA 2R1XA 1TTGA 2F53E 4I2XA 2CO7A 1JV5B 1DBJH 3H0TB 4UZSA 5JHLA 1SOSA 4WWKC 4Y4KD 3TFKC 3B2XA 1O6SA 5D8JL 3LQMA 4WTQA 3CH8A 4B5ZA 5EPMA 3VXUB 3TH4T 3UO8B 1TZGH 3ATDA 3NRPA 4DAGH 1SNRA 4JDEB 3KPRD 2W0PA 2IFFH 2YPLE 4UIKH 4OJEH 4WKXA 2BSEA 5KUKA 2ZPKL 4UM8B 5DQJB 4HPOL 4LAQL 4DGVL 3VFPA 5HP5A 2V5RA 1FPTH 1N3NB 1H6EA 2CXGA 1XB8A 5DEFA 4BE6A 3R8BB 1UUNA 4YUEH 4L8DB 1Y1DA 1T20B 4PVMA 1ZGLB 3QUMB 3N43F 3N40F 4MNQA 2DN7A 4PG2C 1E5YA 1AO7E 5IHUL 1EO8H 3X11B 2E47A 4X7CC 3IRCA 2IWEA 2X38A 4P3DB 5E6SB 5L2KD 1URIA 1ES0B 3U1SH 3K71B 4JFEE 4FHJA 4BZ2L 2ILLA 1S7RA 1M6UA 3ZDYB 3MLXL 1K2DA 4UQEA 5BZXA 5EOQH 2IBZY 2Z4TA 5JZ7D 3DO4A 3JVGC 4G6KL 3A6CL 4DZ8B 1SDDA 4HK3J 4LO9A 5CN1A 3VXSD 5A3IC 1JPTH 3BYYA 4DKFH 5BJTA 2CRZA 4ZXBA 1H9DA 4N87A 4OM1L 4KO6A 1FV1A 3TBSA 1S9VB 2YD9A 5I8OH 2TRHA 3EGXB 4MB4A 2YJQA 2BCMA 4YDNA 1VB9A 3E1ZA 1ZDQA 2DEXX 1NPJA 2Q86A 3MA9H 3WEBA 5DVOA 1ZT4A 2HJKB 4H0GA 3T0EC 5ID0A 5G4NA 2X2UA 4IS6B 3WFBL 4AVJA 1E6JL 2GITA 4XN2A 1TMQA 2PUQT 5EMYA 2EUWA 2DLTA 4YX2H 3R06A 1YN7B 1N19A 3OMNB 4DF9A 2JJVA 3L3KB 2BNRD 2LQRA 3DX4A 2WP3T 3O8XC 1EZUA 1A1NA 2O6CA 5DFWH 3IFLL 5ISZA 4ZMAT 3AXIA 3NIFE 5JOPD 2BHZA 2VITA 3FPYA 4OLZH 4K4KA 3GSRB 4NN7B 2CKBL 3NIDF 4QGTA 4XCEB 1NGPL 4R5TA 3VVWA 4MNQE 4HIIA 2D7QA 1D5RA 3HI1B 5BJTB 3HE7C 5I8CB 1IEAB 5TE6L 3EJPA 1P2CA 1ROCA 1TJGH 1I8IA 3S36L 3K91A 1ZVNA 2W81C 2KKQA 5MP6H 5J56B 4OZIB 1VKXB 1JCVA 3TA3A 3LNEA 2VC2B 3NJFA 2JKRM 1RH8A 4IJ3C 4YO0A 2CLZA 3K2KA 4J8RA 3CFKB 3F58L 4RESB 2IPUG 3REVB 1F4YH 1T7XA 2IO5A 3AUWB 2XX1A 4P9HH 1FFPB 3GSNA 2ZXAA 3MA7B 5C6TL 2XZCH 3HLAA 3GLEA 2FX8L 3OR7A 4OZGB 4PRHA 1RJLA 2D7TL 4J2XA 2WO2B 3NFSH 5EO1B 1FP5A 2H6OA 1KCSL 3PAZA 3QQ3A 3MRNB 1OIOA 3X17A 3FO0H 4BQ9A 1BPVA 4OD2A 2DBLL 4CMMA 2VAAB 3C5XA 3AB0C 1MCBA 1PAZA 4WFFE 5E4EB 2ALWA 2XZAL 2GK0B 2FX7H 3CFCH 4RBPH 4PJ9D 4PRDA 5FUZL 2DEWX 1PDKA 3DNKA 1JZ6A 4HDIB 2FGWL 3GINA 5BUAA 4CL7A 1SMDA 4BRVA 3U0TA 4QLRA 4XI5D 5A7BA 4NRXB 4A7VA 5C86A 3KPPA 4APQC 4IRJB 2BP8A 4CSPA 1KWKA 2A4EA 4HHGA 1CFNA 5L0QB 1MIEL 4FQXC 3DPDA 2JELL 5EU5B 4GP8B 5IFHH 3D2UA 2PWGA 2X0UA 1OM3H 3KVPA 3RVTC 4OLEA 1SQMA 5TDNA 4OZHB 1A7OL 3QR1A 3Q2VA 3UL4A 5MI0C 2E7HA 1VZGA 1ED3A 1UKSA 3FQ4A 2E3VA 3IE4A 3RWCA 4NQDE 4DFIA 5DK2A 3MLYH 3CHXA 1XL4A 2XIIA 4KKBD 4ZTEA 1AMXA 3BH9B 3VG0L 4GPVA 3VGBA 1U93B 4GRWH 1ZGLP 3QI9D 4U2ZA 2QADD 2VDQL 1E4KC 4XX1E 5IHBA 1A6UH 4CU7A 3KW7A 1BD2D 1DO5A 1E50A 5KAQG 5DUMH 4LVHC 3OKMA 2VE6A 3K6SB 1XGPA 5EH1A 4MRCA 3T04D 1SY6L 1MCWW 1Y07A 2A1WH 2R1YA 5F0MB 5T1JA 4HJEA 2B15A 4G8IB 1OGPA 1DYZA 1BM3L 2XPGA 5DD3L 3TCTA 3MREB 2IANE 1FNGA 2EYSB 2EADA 4G80B 3UGEA 1UFGA 3RPIB 3L9EA 4MAUH 3ZMNA 1OGAA 2QTEA 4FN0A 4RGOL 2AK4E 3UGUA 3BLBA 3QZWB 4G8AC 2PCYA 1GKEA 4HS3A 4Q6IA 3TF7C 3FUJA 3QORC 1KCBA 4FZ8L 3BN9D 1G87A 1PVHA 4NWTL 4TS6A 4AVIA 5DHEA 2JXMA 4ES9A 3QAQA 4DERA 2C3VA 5KSBA 1Z0NA 3ABKB 1ETZB 3VI3A 5E95B 2ZUUA 2WTOA 1NDMA 2PETA 4H88L 1OTUC 4ACPA 1BVLA 4XP5L 5F6HJ 3O2DA 4UNIA 3WKMH 1A6AA 5HY9A 5DFVD 1E4HA 1UA3A 1M56B 4JFEB 3UACA 3VXNB 1RJLB 4R4FL 2Z1KA 5GZOA 2FVNA 3MJWA 3SPIA 2ZXGA 3UYOD 1AO7B 2KYIA 3LH2H 4LOUC 4U1IB 4ZAKC 2EDRA 2G60L 2J25A 1Q38A 2J4WH 2VOTA 4PJ5D 5F7KC 1KXVA 4PG9B 1DQMH 2JI2A 5F9AC 4C47A 4YHKH 1JS4A 4PJHA 4URTB 1XR9A 1DP0A 3BH8B 5G2NA 3X1EA 1LL1A 1F45A 5BOZG 1E5CA 2W9EL 1QTPA 1WAEA 5ETUB 1C16A 1QQDB 4OF5A 1BZDA 5JXAH 4U3SA 3RA7L 2AEPL 4YAQA 5K33A 1HCYA 1JXGA 5IMOB 5FLVA 2H9GB 4Q2ZA 1IGYB 1G7IA 1EZSA 2X4UA 2YGPA 4K8RH 3K80A 4ETQB 3QFDB 1GHFH 3IB4A 4A7TA 4X4YA 5ICZA 5MENA 1L7TL 2V9TA 1J5CA 3TA3C 4LSVH 2NUTB 1AJ7L 4I87A 2CALA 3BGFB 1UT1A 2WZAA 1RUML 1WGVA 3BP6A 1SYVB 5EBGA 2R9HC 5HI5D 4QHMB 3ARBA 4HJJL 1C5BL 5CU5A 5JORB 4M4RB 3ZRCC 4IBLT 4P5TB 5FM5M 5E4OA 4GRLC 1M1XB 1QR1A 3QFDA 5ICZB 1YAIA 1FRGL 3HC0A 4FFVD 3GUTB 4Z8FL 2IVFC 1CF1A 3L5JA 4UM9B 3IFPA 4LCIL 3B4NA 5F1KC 3OJVC 3EYVB 4DEUA 4MCYB 4NKQB 1B0IA 1XGRB 1C12A 5J11C 4LSQH 4ENEC 5DDHB 4AK1A 4WFHD 4E36A 1AXTH 4A2GA 3VX0A 4I13B 1ZMYA 1AY1L 1IBDA 2IAMB 5IBUG 4HPOH 1F6LL 2XPYA 2UUDK 1AGFB 4ELMA 2XXMB 2A77L 4KY1H 4ZUTA 1I1FA 1XF1A 1OKEA 1A2YA 2V2XA 3WJJC 2IQ9H 3CFDB 1IBHA 3Q8FA 4YQXH 2DLFH 2HMIC 4XBPB 4NM4L 4OFQA 4JFXB 1IL1B 1LTXA 1HZHL 1Y18A 2H47C 2P26A 1FNEA 3ULVL 1EHLH 1WFJA 1THAA 3A4DA 3TCLA 4Z7NB 2Z93A 4PCSA 1A3LH 3FAWA 4PJCA 1ZHBA 4KZ0A 4X7TB 5GQBA 1UYWH 5CEZH 4M4RA 2NY3C 3MOAH 2EEBA 2YARA 3BDYL 1E40A 1CGWA 2AQ1A 2XWEA 4KOCA 3OC8A 5J5EA 43CAA 2KZBA 3U2IA 2ITDA 5F89B 2E0PA 4CVZB 5I0YA 4WO4A 4X6DB 4G11A 4PJDA 3D4CA 1WICA 2NX5E 1G7HA 5DRZA 1BQUA 3BAIA 1BFTA 1DLFL 4P2YA 5D7KE 1BLNA 3NK4A 4CSSA 5L2KE 1BLIA 3PDDA 3ESNA 2FEEL 2DM2A 1JZDC 2F1EA 4B9GA 3AREC 3WEXB 3MPCA 5EIIB 4AQAB 4GJTB 5BV7B 2WXGA 3MLRL 3ZKND 1SMOA 4QHMA 4PCTA 3V7MA 3AY4C 4GSUA 1JPST 1R3IL 3NDZE 4TXVB 4HH9B 1MIMH 2CDFA 4IU2A 1JZ4A 2IAMD 1ZK9A 1HU8A 3DPBA 2VUKA 2DYRB 4YGVB 5CCKH 1Q1JH 1CICD 1FCCA 4WI4A 4XXCC 1BX2A 3RB5A 3FW6A 2YKLH 1J1PL 4BELD 1CK0L 3BKYL 4C56E 3SDDA 3CG8A 3QG7H 3MCKB 2IV9A 3Q8BA 4XPTL 4PJXE 4OLXH 4Y4FD 2YD5A 2YSSB 4A2MA 2J6EH 5AOIA 5E6IA 2VO5A 4ECNA 1S7WA 5JIHA 3JV4A 1Z9SA 4OB5H 1QPKA 2ITDB 2NX5A 3GSVB 1HQ4A 4N3TA 2Y6SC 4QXVA 5E70A 5I76B 3IDNB 1HDMB 4MMYA 4UT6H 3OPZL 3V4VH 2Y1ZA 4DVBB 3BRGC 3B9EA 3QUXD 4UQ2A 2MTPA 3QWOB 1X6LA 5FOBB 1TTUA 1QBLH 4QHPA 4P2OB 4Y2DC 3WEXA 4Y16C 5FUZH 4F93B 2QR0B 3EH2A 2F9BT 4GO9A 2V5MA 5CGTA 5JPNC 3PP4H 3RE0A 4ZUUA 4ANWA 4NZUH 2VW4A 1U58A 3OR6B 2YEZB 3F58H 3NSFA 2CXKA 1MJ8H 5LNDA 1VFAA 2UX6A 2CIIA 1CR9H 1OAXH 2APBA 4HBCL 1JWSB 3QNYB 4PB9L 4Z7VB 2J21A 4KTGA 1T3FB 1RZ7L 1T7ZA 4PRIA 5J13C 5JA8B 3V9EA 4YC2C 4LSPH 1BVKA 4JFFD 4NENA 5FWQA 4Y8DC 1EXHA 1WCBA 3S8FB 3QQ9D 1FZOA 2BDNH 4EDWH 4OVUA 5CZVL 1NFIA 4NFCA 3PGFH 4OF6A 3V4PA 4LAJH 2UY7B 3ARQA 2O5YH 3MACL 2FAUA 4ZMQA 2FJHA 2R69H 3AWFA 2XBDA 1RZJL 2ADFL 4PN6A 5I1KH 4JRYB 1N3NA 3ZL4L 4JANA 5EIQA 1J5DA 4ZW7A 4PYHA 2YEQA 3HBQA 4JVUA 3V55A 2OW7A 5L7XH 3T6ZA 3O41A 4GFXA 3ZT7A 3OXRB 3SDYH 5DEGB 4F7KA 3WY2A 1DN0A 1I1AD 4NKDB 1E4XL 3DX8A 3DETD 3FSAA 3PV7A 1SXSA 4L1DA 3SCMA 3Q48A 2K45A 2W65B 5DMJB 4GI9A 5DHYB 4NKIL 4N26A 3S8GB 1HQRB 1U4FA 3H9ZA 3P4MB 1ONQA 3W9DA 3L3GB 2G2PA 4QHKI 1YNKH 1QFWM 4B3EA 3TP4A 3GFUA 1XR8B 4NRZA 2O5ZL 4R4BB 1RURL 4JZJA 5HHOB 5FYLL 1SOQA 5B7MA 1MQKH 2DQIH 1NGZB 1JK8B 2BSSB 4YSUA 2WBJA 2YGVA 4KKLC 1N7ML 5FYJL 1NAML 5C0CD 2WQRA 1BQLH 4JFZH 3EYFB 1UD2A 3B5GA 4Z1PA 1ACYH 5T5NF 1XMWA 2VISA 1A66A 4LZKA 2WBXA 4R26L 5HHPA 4Z7UF 1JWSA 2AVFA 2XTJD 3LH2L 3ZR6A 5A6IA 2WXQA 1MRFL 1E42A 3EKCA 2Y3AA 5AZ2L 4JFFA 5EBLA 3VGDA 1L0YA 4XCYB 2EECA 5HDLA 3WIHH 4YHZH 3BAEH 4LF3A 4ODSL 2YJLA 5D2NC 4CJ1A 2I69A 5CO1A 1A9EB 2XV3A 3OKOB 4HFWA 3IFNL 2SEBB 1WFUA 3LEYH 4P23A 5HGDB 1U6AH 2V9RA 1G6RA 1N59B 3QUZA 4FYSA 3BQUB 4HUKB 1LM8V 1XGQB 1I9JH 3IJYB 4XCYA 2V5TA 3UO1L 5T1MA 1XIWC 5HHOA 1MRCH 2E7LA 4JGNA 5GJSH 5AEAA 2VDLL 1AC6A 5F3BB 1GHFL 5JIIA 3CQFA 1JGVL 3PNWB 5L4IA 5I15L 4CW1B 4LOEA 5H4YA 1Z9SB 2IOOA 2J1KA 3QQ4A 4FHKA 1XB6A 2PP8A 5C6PB 1D3CA 4MQXD 4HIXH 1C08B 5IG7B 5T3ZH 4YEFA 3HI5H 3HLKA 4N8VB 1E9OB 4TOYL 3SODB 2XN1A 4P8QA 5MEOB 3F7VB 3BEVA 4ZPTA 5HPMA 4IKKA 4IGBD 4JZOB 4JAMB 2D7OA 1S7QA 2H2PC 3QJUB 5BV7C 1X5LA 3EOBA 1HXMA 1EBAA 3BHBB 4HFUH 5IMLA 5CZXD 3NJNA 5I1JL 1MCHA 4OCYL 4EKJA 2GHZA 1TQSA 3HNTH 4I9XA 4OD3H 4E41D 4GRWE 4PJIE 1YNTA 4Q4EA 2Q0ZX 3CDYA 4BSWA 1UTDA 1WBZB 3HG0A 3FT4B 5ENWA 4MNGB 2A9AA 4TPRH 1J18A 2GUOB 4LGRB 1P4IH 1IZJA 1SDDB 2VQTA 5HGAB 5MHSD 5E9DB 4G6FB 1PMYA 2JV6A 4N1EA 2V7NA 4XPHL 3V5HA 2Y07L 3MXVL 4JDTL 2FJFA 3MJ9H 4HDIA 3A6BL 5C71A 3S3PA 3VRLE 2XVBA 3VXOA 4YNYB 4Q56A 4J4PA 1UM5H 1YMMA 3EFDH 3UJTL 1RULH 3EGXA 5J6SA 5C0AB 4U6YA 4DTGL 4JDVA 5DMGC 2R29A 3GMOB 2MNWA 5EU6D 2EYRA 2HRPL 4LAQH 5J3HC 1G1KA 5C9JA 5H35A 2VDMH 3I75B 4PYGA 2VXQH 3B1UA 4XMZA 3HS8A 2PCFA 1F56A 3LKRA 5GISL 4A68A 2YUWA 1G7JA 4LMQE 2IPKA 5TDOA 2OR8A 4N2KA 1VFOA 5IGXL 1FDLL 2UZXA 2YD8A 4LDCA 1L7IH 4P5KB 3V6FB 2VXSL 4AUUA 4JM4L 1KC5H 3LJ3A 3ZDYE 4XXDA 2ZP9A 3CHSA 3P73B 4HJTA 5KANI 3MV9A 1NC4A 1G9NH 3MFGB 4AM0Q 4E9YA 3OKMB 3KLHC 3OZ9H 3PV6A 3T3PE 4AIZA 3OKNB 1ODUA 1DJYA 3HHMA 3E6FA 3HBPA 1EXGA 3BKCL 4FCAA 4KY2A 1AI1H 3OHXB 4WW1B 5IQ9A 3BRFA 1FGVH 4F57H 1OV8A 1YZZA 1ADQA 2P5WE 5DRXA 3GIVB 1F11A 4G6FD 1EIBA 4U6XB 1TO5A 2WBJD 3MLUL 4X9IA 3AT0A 2X9ZA 3E2HC 4NJAH 2FT6A 1E5ZA 5LO7A 4EZMA 3RWEB 3SPJA 1CBVL 1I75A 2B2XL 3ABGA 3MBWA 3OV6A 2YQGA 2N3JA 1UWEH 2WZ6A 4IRJA 1WIPA 3Q43A 5IVOA 5CFAA 2CNZA 4KTEH 1B4JH 4M93C 3DV4A 4EVNA 4YSAA 1EH9A 3U7YL 2GTZA 3JZYA 3W0WD 4GUCA 3V6BR 4OLWH 1QBMH 3DVNB 1BEYH 1DZBA 1SGKA 3OQ3B 3FPXA 3ZZQA 2W1NA 5HDBF 2IDTA 5DJAB 3CPUA 5T1MB 3ZSSA 4HMEA 2GAZB 3DOIA 4XOCA 1HKLH 1NLDL 4GRLD 4JQIL 4OZ4B 1SXBA 2R0WH 3N1PC 1ZEAL 1I1RA 2QQLL 3CFMA 4LARL 4MSWB 2QQKL 2Y24A 4F7CB 4APQA 5IV2A 3OR7B 5CZVH 2ZXWB 3BZFA 4F2ME 5KYUB 3WG7B 5GGSY 3F7LA 4LLMB 1W6WA 1X5MA 2GBAA 1KV7A 4FXLA 5DJZA 1W6LA 1R0AL 1G5AA 2IH1A 1RPUA 5DZJA 2A6KA 4H1LB 1YMMB 1MW1A 5AQ0A 1E3XA 2VDPL 4BJLA 5F9DC 4EOWH 2VZ3A 3HKZA 5TF1L 3FH8A 5EBWA 4LCWE 1A6WL 4GBXD 4BH7A 1I7RB 1UH2A 4YHNB 5EU3A 3KLDA 3S3DB 5AVXB 1KGXA 2F7IA 1UD4A 1N6UA 3QUXC 2ICWA 3O11B 4FL4B 4M48L 3FT4A 2I26N 4F2EA 3ALPA 3CFIC 4M61A 4JFWA 4Q7DA 1M1XA 4ZAKD 4LOUD 3LQZA 3EIFA 1QFPA 2LU3A 2VLRA 5EO9B 1HJBC 1SOXA 1YECL 2XV2A 1OT2A 2D03L 2VDKB 3QXVA 1JHTA 3IU3B 2K9FB 1FGNH 2IFGA 2PLTA 2H4EA 1MFBH 3S34L 5GXBB 2O5ZH 2X1XR 3MNVA 1T22A 3JV6B 1JXDA 2HN7A 4XGZB 1QWNA 1UKTA 5CJOL 1ZT7A 2YPLA 2ZUSA 3OF6D 3SBRA 3HA0A 5CJBA 4UINH 4YEEA 2ZOKA 2M1KA 4N2HA 4HMDA 1MFDL 3BH9A 3SEPA 2DQIL 3NABH 5E8NA 5C0EB 5LJYH 1C1EL 1UWGH 1S7XA 2EKJA 3WNJA 5JPMB 4P5TA 2Y7QB 1I9RH 3G5WA 3BH8A 3CVHL 4NFBA 1BIIB 1UOKA 4FNLH 3HHRB 3MV7D 4BWUA 4QLWA 1JYWA 1TR7A 3D9AL 3SBPA 2ERJB 3SGKA 3BD3A 5EU5A 4D7BA 4L29B 3FDWA 4U05A 1OTTD 5HI3C 4H25B 1M7IB 4GKZB 1U8PB 3RVXC 3SIKA 3FU6A 1OD9A 5J1AB 4HS6A 3S4SB 4BQCA 2Z9TA 1YEEL 1GGBH 1FFOA 4LOFA 1YNTF 1YEIH 1KCUL 1ZTMA 1VEMA 4PW4A 4NQXA 1DJWA 1KB9K 4WWOA 1CQYA 2HUEA 4FXGC 1RZKL 1BIHA 1BOGB 1BWWA 4HKZA 4I88A 1XQ4A 1JFQH 3TYGL 2B16A 4G7RB 2H41A 1G7LA 2OMVA 3ILPB 5I15H 1N7MH 3TVMD 1EEQA 3QIUB 1KBWA 3APNA 4PP2B 4TLKA 4OCNC 4G9FA 4MAYA 1E7UA 2Q2EB 2Y06L 1U8CA 3QQNA 5BW7A 2ZYHA 3TH2T 1WFNA 1JGDB 3T3MF 1MEXH 1RL1A 1J1OH 4JB9H 2JE8A 1XTLA 3F6LA 3FCTB 4LDLB 1A7BA 4YSPA 3WHE0 4APQD 3F7YA 3QIBC 4WK0B 3VG0H 2Z4QA 4MD5B 5IVXE 1TO4A 2W9DH 1CDGA 4JRYD 4TNFA 1TQTA 4CUCA 5HVHC 3KR3H 4ZG1A 3RFRA 4ZMVA 3T1FA 1CDCA 5GRXG 4KRNA 1YYML 2V0AA 3IFPB 1SM3H 1IQDA 3PWPE 5DXWA 3IF1B 5AW7B 5LWYH 5DRWB 5F0JB 5HSFA 3KXFA 4Z3FA 2VGLM 3GMQA 3KL3A 3FRUA 1OAJA 5FFOA 4TNWF 3P9MA 3JWOL 1QWHA 2H3NB 1D6EB 3DC0A 3FT2B 3GGWB 4K94H 3WD5L 1JZ2A 4NYLB 2YD3A 3WNOA 2P5WD 4HIXL 3SDDD 4R97C 4GUQA 3F62A 4QHKJ 2X3BA 1Z3GL 1CZ8L 1OXYA 3NFPB 5FEBA 1BQHA 5JNYA 1FIGL 1M1SA 3DIVA 1QO3A 2AABH 4MJIE 4IBUA 2PW1B 3OPUA 4FX5A 2A99A 2VDML 1C16B 1QQDA 1ZWIB 1HAWA 2VXQL 1XHHA 4RNRA 4RFOH 1LK3L 1EGJH 3LNHA 4N5EC 5AVRB 4NIYE 3W2DL 3ZO9A 1XF2A 2ZXBA 2DWYA 1PQZA 2NDGA 3ZU8A 1DL7L 3RWIA 5L8KB 5C0CB 4LSVL 1L7IL 4Y5VA 4AMKL 4PGJA 3ISRA 1G7MB 1OALA 2DQTL 1FO0B 3WIAA 3TVMC 3ARGA 3MRMB 4F2FA 5CD3A 4GIAA 5CFHA 3S88H 2NY4C 3MJ9L 4P46A 2BOLA 2A9BA 3OZ9L 2J4WL 3HCVA 1C5DB 4HOZA 3OGOE 3L3HB 1E27B 2YAMA 3MC0A 1QEWA 1AIZA 1DJGA 2MMXA 3CQQA 1U3NA 1KZQA 4OKVB 4JNXA 3QHTC 4PRIB 3UPCA 4B95C 1AI1L 1CFTA 4G70B 4XC1H 1J86A 4BK5A 1BA9A 1GMIA 2ZG2A 3IM1A 1CGSL 5EF3A 3O6KH 4PJ5B 4HWZB 1LEKA 2I25N 5FECB 5FHAH 4HZAA 4N4YB 3VW3L 1E9PB 3ZDXF 4U1LB 1T5WA 4CC0A 2ZWSA 1Z66A 3GJFK 4JM2A 3CPLB 1NBVH 2VXUH 3TO4D 1G7QB 1IIIA 3ELAT 4PI0A 1CB4A 5FA3A 2VXSH 3U9UB 3BN3B 3IBOA 3QULB 5AWNL 5AVQB 3FUNA 1T21B 4RZCA 4HJJH 4RAVB 2X53A 2A6IB 5I16B 4Y5VB 2A9ML 1RZJC 4Y7OC 4NYLA 1Y1UA 1T5XB 4HXAL 4OAWB 3MJGX 4ZDHA 2VM3A 4AYGA 4DP1X 2CM6A 4FNSA 3BMWA 3PUUA 4MMZB 1A7NL 3FOLB 4QF1B 1FN4B 2WXJA 3T65A 2WLHA 5DDHA 2WWKT 4ZMXA 4KKBC 1PKQE 1IKNA 3V52H 3MO1A 2H0PA 2EKSB 4O2CB 5KVDE 2DWTA 2H6UA 4X4KA 4G9DB 2BSED 3J8F7 1XCTB 3VG9B 4OF7A 2JSFA 2XQBH 5KW9H 5EZIL 1DQQB 2BY0A 4YHYB 2V9UA 3PY9A 3V0EA 1BM3H 1CLYH 1EZVX 1QOKA 2IQ9L 3MNDA 3EJYD 3FT2A 2BJML 2F8XC 2PP9A 2CUMA 3BAYA 5IUCA 2E86A 3HZ3A 2B1HL 3OB8A 1XGQA 1ZHBB 2CK2A 2ORBH 3H42H 3MLWH 2P28B 2BVPB 1WAPA 4Y2OA 3N41B 4DN4H 1E28B 1BXVA 1N9PA 1OB1A 4XZUB 2EXWC 2G0LA 2ED9A 4FYTA 4ZX3A 5LXGH 3BIBX 3L1OL 5BXFB 1JWUB 1KIUB 2NY1C 4WI8A 1JCKA 3OLGA 3DA0A 1KBPA 1NUNB 3CSYA 4HCRH 4BFFA 2XTLA 3PJNA 3CBRA 1EHAA 4KVCL 2XI9A 3K71A 2ZUQC 3ARFB 2F54A 4XP5H 3LEVL 4F58L 1G6RL 2NY5H 3V6FA 3NIGE 1BM7A 1Z9MA 1BJ8A 1YEKL 4TTDD 3TPUA 1RIVH 4PFEA 4Z95H 1T0MB 2BOCB 3IGLA 2CBPA 2VDKH 3CPLA 3QEGL 5ITBH 4PP1C 2WXMA 2ZX7A 3CN4A 3TEYA 3MGTA 4X9YA 5F7EL 2WWKO 3BVNB 3E8UL 5J11B 4WSJA 3U6RA 2PWEA 4YHIB 1KG0A 3GBML 4Y2DA 5BQDA 5GS0L 4PRPE 1GS8A 4KMLB 3R1GH 3DSNA 2L0DA 4S1QH 2N7BA 5BOPA 2BVYA 1D9KC 2OSYA 1DJSA 1QA9B 4AKOA 2VMFA 4BFKA 2R0KL 3P3SA 1U2CA 4P3DA 3VWJC 4ELMF 3QCUH 4N2MA 1I8MB 3UJIH 1GKOA 1O5PA 2YSSA 4AEHH 5JR1L 5A16B 2NNFA 4QRBA 1MOEA 1M4KA 3T77B 1A5FH 3WXWH 5D71H 1X4YA 3BOVA 4OQTH 4EDWL 3K1KC 2JH2A 3MRMA 5CLTA 2DMKA 3QORD 3V7AG 3B7SA 2ED6A 4H8UA 4JLRB 1O6SB 2XG5A 5JW4Q 4GT0A 1F0LA 4FQPA 1HH9A 1CXFA 1DEDA 2ZX9A 3FQ1A 3WY3A 5GRUH 2FGZA 4I0KA 2ZUVA 5F9OH 5MHSE 3GC3A 3DMMC 2MRYA 3W0WB 1DVZA 2JCCB 3DX9B 4X5RA 4I3SH 3NIFF 5TE4L 5C3TA 3GDBA 4W4OC 1MFDH 4CILA 4YJZL 2XQYK 5HVFB 2E59A 5EUOF 4G82A 2FD6H 4FG4A 2WLJA 3K46A 4LFHD 3RVWC 5MI0B 2BHFA 4MB1A 5F7LB 1Q0XL 2EEFA 4X6CE 4NO3A 3SCMC 3KYOA 2P8MB 4GYBA 2V7HA 3L4TA 3DHPA 2DQJL 3DVGA 3TO4A 3F83A 3RWJA 4MS8C 3DXAD 1GZPA 3L3DB 3AWGA 5F97E 4NM8L 4UT9A 1FG2A 5D7JC 2J88H 7FABL 2A6IA 3PHQA 1A7PL 5I16A 3BWUC 4L8SA 5I1EL 3B2UC 5IQ9B 3MACH 3ZDZF 4WUUE 3VXPB 4LHUA 3T2LA 3H9HB 3H2QA 1KB9J 2ZSWB 1AQKL 4GW5B 1ASOA 4BKTC 2RR3A 5ACLA 5INDB 5KTEH 5DJ8A 4N6RB 4P9HC 2YMOA 3INUL 5DT1L 4M8QB 3ZKQD 4TVPH 1K3IA 1EVTC 1YQVL 1NANI 4OD1L 2JLLA 5CD5D 3TEUA 4U6YB 2D3LA 3HG1B 4E42B 3LXCA 4LSUL 4P9ML 4RZKA 5CJ5A 3GYRA 2CR3A 2VH5L 3GSWB 2CLZB 2YPVH 5L9DH 1KTDA 4G6JL 4G5ZL 5HDQH 4ZAKB 4EF3A 4PRHD 3GBEA 4RISH 1NC2D 1INEH 1I8AA 3RWDA 4NO3B 2VZOA 4NBXB 5E8OB 3S0PA 2MCPH 1TEFA 2EABA 5KUMA 3IWUA 2BCKA 1YNKL 1ZLSL 4U1GC 1S7VB 2AKRA 1B0WA 3T8XA 4QHNA 2R0LL 4J6RL 3STBA 1TT6A 2JK5B 4X9FA 5IMMA 3NSYA 2MOQA 4AGPA 4NXKA 4KUCF 4XN8A 1JYXA 4HJ0D 5HJ3A 5IB1A 5I71B 5T3XH 2E7LC 2ZXQA 4XNXL 4KNUA 4HX1A 3F65A 3O3DA 3E6FB 3EFFB 1FVCB 3MV7B 1ECZA 3GLAA 5IBUB 3MJ7B 1BFOB 1T6VN 3VMOA 3RGVC 4U33A 3QDHA 2F54D 3P30H 2CJUH 4RRPG 2G30A 1JGLL 3UC2A 2OX5B 1A1OB 1TJIL 2NR6C 2FJUB 4GW1A 1BZQK 2DQEL 1PZ5A 5KS9E 1KEGH 3ALXA 2J55A 3QI9B 1N4XH 2AJYH 1QBLL 2QADB 4QXGH 3EDDA 4PTTA 1A6ZB 3MU3A 3V9FA 4K8RD 1D5BA 5E5UB 4KKAD 4FI8A 2H26B 3UAJD 2Q9OA 3D39B 4AW7A 4G8EB 4I85A 1PG7L 1JN6A 1K4CB 3O6KL 3MX0A 1DQVA 1YEDB 5C9JB 3G5VB 1MJ8L 3I3EA 3DO7B 1RUAH 2IGLA 3FQTB 1A9VA 2TSBA 2Q8AL 1D5IH 1QSZA 1QFWH 3C6SA 3CLEH 1BFSA 4YE4L 1BZ7B 5E94B 1OPGH 5I1LB 4NT6A 1BDYA 4NN6B 4WW2B 1SVZA 2VR9A 3O3BB 1PIGA 1QFOA 4DUVA 4YXLL 3MOBH 2E7CA 2ZUTA 4UYQA 3JTTB 3QRLA 1V3LA 5AUMA 2M2DA 4XMPH 1VKXA 3TLRA 5GS1C 2C4FU 4APQB 2A9NH 1OGAB 4BUGA 1BAGA 3I9GL 5DUBB 3L45A 4CGUB 4EDXA 5A2CA 2BNQB 2EYTB 3CXHJ 4G59C 2FCBA 2FJGB 1JHKL 1XCWA 2ENQA 2ICES 3BIAX 1IVTA 3CTTA 1NBYB 4PV9B 5I6OA 3ZHNA 2PWHA 3KWTA 5INCB 2E27L 3MRQB 1IC4L 1ZTXH 4P5MB 4AW4A 1KC5L 4DO4A 1FLTX 2J2ZA 5E6YA 4MB3A 4D94A 4ZRGA 1NDGA 1TVHA 3PS6A 5E4AA 4AE1A 4MCYA 2C1PA 2WLMA 2QKSA 1WK0A 3MJ7A 5EEYA 4XAKE 5D6DA 3H42L 4JQXC 3NFPA 2BW4A 4E41B 2MJWA 3KPQB 4X5LA 3GO1H 4ANUA 4WI3A 1NCBL 5DYOA 1ED3B 5LNGA 5E2TH 1OP5K 2Q6WA 2J5LC 2JIXB 4JY5L 2UYLA 4K07A 4Z7QF 5AD0A 2GSMB 2C9RA 4NC0B 2ZF8A 5A2IH 5LB1A 2XWBB 3NN8B 5F9JB 1KBKA 1MJJA 1YPZA 3D0VA 3VXTB 3ZYJA 2NY1D 3AAZB 4GBXC 1BEXA 3IVKA 1A65A 1JF6A 3QQ9C 1AGCA 1BQLL 3HC3H 1KNOB 3NZHH 4JFZL 4OTXL 4N6QA 5LBSA 2V2TB 1F1DA 3EFFA 1FZJB 4CGTA 3BFOA 3ULVF 5I19L 3LAFA 1A6AB 3VMPA 2YD1A 3QEGH 5JOFB 2AERT 2FL5B 2RACA 5AAMC 5I1IL 2AV7B 2FB4L 2WLLA 4GQ9H 1XB3A 5T1DH 1ZHNA 1HE7A 2CKBB 5BMFL 1QUNB 3DK0A 1KCVL 1Z9NA 4XN7A 3TVMA 2N0MA 4Y4HA 4HJ1A 4NI6A 3KH4A 1MDAA 3IFNH 3OLEA 4NO5A 3K1DA 3TZVC 3WL9B 4LPTA 2DLEA 1BAFL 1SPDA 3CFBA 3IMTA 4NQCA 4OJYA 4RA3A 2YQ2A 2OK0H 1PZSA 3BP7B 1OW0C 3B7TA 4P2OC 4U1NB 3EYSL 2GABA 5GS0D 4ODUB 5M7QA 3LDBC 1IEBA 2YSTA 3GXUB 2R0WL 3OAWA 3EH5B 4OZ4A 3W81A 4ZX5A 1Q94B 1X7TA 1H5BA 1UWXH 2YR3A 3SDXF 3T2PA 4N0CD 4MJ5A 4OQTL 1EV2E 1Q90A 5CBAA 2X5PA 3OZKA 1O7VA 4XPAL 1UM4H 4AM0A 4NT6B 4HKBA 1OE1A 3C6LA 3MR9B 3IE9A 5C0BD 1N5YH 1IEHA 2OI9B 2XETA 2E9BA 4WHYG 2J12B 5B3SB 1E0OB 3L1FA 5GGQH 3ETBJ 2GTZB 3JWDC 3UBGA 4ZUUB 4AQZA 2P46B 3CHQA 3D7PA 1ULVA 2LTQB 3P0YL 3V0WL 3UROR 2K78A 4H25A 5A6LA 1I9IL 1PLGL 2VWEC 3NESA 1UJ3B 1MI5A 4YSRA 1UOVA 3QZMA 1WBXA 1KIPA 3S4SG 3L5XL 3T71A 5DQDL 4WKZB 1U33A 3HRZA 4AWJC 1JXKA 1V5JA 3TM6A 3KLHD 5E1GA 4ZFQA 4TUJB 2HH0L 4M1CD 1LWJA 4NKOB 4MXVE 4N2DA 4UT7L 1U3HA 3BIKA 3POHA 2VZSA 4RAVA 1F58H 5C07D 3WDIA 5CEZD 2Y7MA 1MNUH 3WMPA 1J1XL 1EWHA 1RJZA 4UOJA 1RFDH 3PWJA 4ELKA 1Z9OA 3VFUB 1QEXA 1TTBA 1LWHA 3MN8A 3ML8A 5CLXA 1YO4A 1GGIL 1KCLA 1HTYA 2VDPH 3D0AA 2FBRA 3INUH 1NMCC 3FCTA 3BSGA 3CMOL 4FQCH 1UD3A 5KS9F 4X98A 1RU9L 2NZ9D 4BZ1A 1GCYA 3X13B 3UZEC 1VGKB 1X44A 2GKIA 1Q0XH 2LHAA 3DX2A 5T5FH 4TQEL 5I5IA 3VCLB 2RIKA 4ODUA 3BVUA 4NBZB 1A4JA 2PPDA 1OGTB 4H8WL 5K1NA 2YGOA 4JG0H 3KLAB 5DSCA 2K6WA 1AS7A 1UCBH 5FCSH 4W68A 4APXA 4MRBA 4YL4A 5KSAA 1MHEB 1FL5B 5IVXA 1S3KH 3RIAF 1VENA 3GHBL 2DI8A 1AHWA 1H6TA 3L4CA 4XNQA 4PJ7F 4KNTA 4P2OD 2G75B 4MZ2A 4F8QA 5I1EH 5KSBB 3O6LL 4IOIB 4GI8A 2R0LH 2XNAB 3H3PH 1MVYA 4NUGH 2ZCLH 4I3RL 2OSWA 2AXFB 1MHEA 2OQJA 5IVXB 5D4IA 4X7FC 5MEQB 2DQCH 1ASPA 4KFZC 3V0HA 4ZFFA 2F8IA 3C60D 4AV4A 2GSGB 4ZUSA 3D2UD 1I31A 1OAZL 3ZHDA 1PNDA 3WDJA 1SJEB 1ND0B 1JZ8A 3O9WA 3MVSA 4KU1A 2YUVA 4KRPC 3UPAA 2CA3A 4JFFB 3BMVA 3Q1SL 1RVFH 5EBLB 4G6JH 4R4BA 5JORA 4A7SA 3DK2A 5L8LB 3ROLB 1TJIH 3UFIA 1ZLWK 4UM8A 35C8L 4POZC 4L4TA 1WCQA 3R18A 3SY6A 4LLVB 3HFFA 3T2NL 2AJZA 4JCLA 4K5PA 4NQVA 1BSIA 3JT0A 1I3UA 4ELKB 1QSEB 2HAZA 4GEJA 3FTVA 4U7SA 4I48B 3FB6B 1WA1X 3RIFF 3DX6A 5KVEE 1BP3B 1FH5L 1MW2A 3QORA 5D2LB 5EOCH 1B6UA 5E08L 5AAMA 1FZMA 3F84A 5CKGA 4X80L 4QT5A 9PCYA 3BEWA 3TYGH 1XR8A 3UX9B 2L3BA 3VFVB 3LXUX 1RUKL 4AVKA 3ZTNL 4P5RA 1ACXA 1CUOA 1XD0A 1U8CB 2HT4C 5HPMB 5DA0B 4XCCL 3TV8A 2ARJQ 3FQ2A 3NTCH 3QC5X 1T7WA 1OP3K 1BBJB 5JQHC 2F5BH 5G4OA 5BPPA 4DZ8A 5EEZA 3B9DA 1IM9B 3KM2A 1MEXL 4WFED 4Y9CA 1ECYA 2Y0SA 1OQXA 3OVUB 1LNUA 3L3IA 1RK0B 1GYCA 3C60B 3MJ8A 5EZOH 4K55A 3WMQA 4Z77B 1N0XL 2BLFA 3BE1L 4CW1A 3A4EA 3VFGL 3AG4B 2V5SA 2B1OA 1FG9C 1T5XA 4QKTA 4FQLH 2BWQA 3UMNA 4NKMA 1XT5A 3BKYH 4ISVA 1MJUL 3TF4A 1NGWA 1YYMH 2BH0A 3HEIB 3OR6A 4N2OA 1ZK5A 4I7ZC 3MYJA 3QG7L 1Q9OB 5JW5A 4TULH 5IFJA 5C0FB 3IKCB 2HJFB 1UENA 2EQDA 4U49A 3VCLA 5E5LA 4HYTB 3RLSA 3G9AB 1E9PA 2KBGA 4BZ2A 1XGUA 4OSUL 4M8VA 1BZ9B 5FX3A 4A67A 2HT4D 1JRHI 1E3ZA 1YSOA 3ASNB 5A2BA 4MQTB 4OI9A 1X5HA 1DCEA 5GGTL 3KBEA 2GJRA 5C0ND 2Y72A 4QIRA 1ZAGA 2EDFA 3LKQA 1BAWA 1DFBH 2H32A 1BF5A 2ATKA 4WW2F 4KV5F 4LESA 4L2LA 3SY0A 2YXVA 4HU8A 5LLIC 2W0FA 3BAXA 4MD0B 4JDZA 1OGAE 3HB3B 4ATTA 4KNQA 1CD1A 1CFSA 1E28A 4XZUA 3MYZA 4RFOL 3LV3B 4LCCA 3BVXA 4CDGC 4D2NA 3C5SA 5H37G 2BSRA 4NUQA 4HBCH 1LMIA 3D06A 3KEDA 1R5VA 3QBTB 3K4AA 1UUSA 2QLYA 5IIEB 5AFAA 4XH2A 5B22A 4OCWL 5AW0B 5AWNH 5L2JB 3EG9A 3KNBB 5DJ6A 4HUXB 5EWIH 2WTRA 3QCVL 4KKRA 4PJFF 3NPZB 5TGBB 2YAHA 3G6JB 3MRGA 2EDBA 3L48A 3D85D 4NNPH 3C8DA 4JVPA 3D39E 1GGBL 4PJ9C 2CHDA 5DZOA 5IESH 5MEQA 4LASL 3PDGA 3UTSD 3O3DB 4N86A 3S96A 1IKNC 2VN3A 4KROB 1MCDA 4HGMA 3D39D 2DWEB 4PLKD 3AS3A 1BQHG 4NQSB 2H32B 3TN0A 2ESVB 1MHPL 3FULA 2CO7B 3MCG1 3MLSL 2OL3H 4LHUD 4N20A 4K71C 2OZ4H 2VXTL 3DTDA 1DJXA 4WTXA 4ABUA 1CXLA 2MQ0A 1V7NH 4UILL 2AKRB 3NZUA 3FUHA 3WKYA 5EBMA 4ZXBB 5I0WA 5DJ8B 2PYEA 1FHGA 2R2EA 1YNLL 2HJFA 4LMQI 2QR0A 5F1OB 4FZEL 4D0CB 4DQOL 1F18A 3G6DL 3HLAB 3S37X 1XAKA 2AJVL 4PS8A 1IU1A 2HTLC 5KBPA 5GS2H 4MNQD 3PL6C 2DI9A 1OHQA 2WIIA 3B8SA 1CFQB 4F1ZA 3GZQA 4N2BA 2D0FA 4R90H 4H2CA 2BSTB 1UQSA 1RZFL 4KK8C 4GKSA 4AMXA 4F8LA 4LBAA 4UT7H 4MD4B 3O0RL 1CICC 2Z8WC 4W9LC 2WVTA 5KYUA 4P4RA 3QG6A 3Q5OA 3FQUB 4HIEB 2WAQA 3MXWL 5CLZA 2K7PA 4YDIH 2ZOTA 3ZDXE 3FU5A 2GQHA 1WBZA 2P5EE 1PX8A 4HJUA 4XPBL 1TZGL 5ITBL 4JGJA 4PGBA 3VAEA 4PRNA 5KVGH 3EG9B 4Q14A 3WNKA 1GGIH 1FL6A 1MH5A 4XO8A 2ADIB 5CEXA 3ROOB 5C08B 3AWEA 2BY3A 1WUZA 4YXHH 3KPSB 1BHGA 1NKRA 1T0PB 5LQBL 5AL8A 5G5DA 3B9KA 1ADQH 3ZIMA 2VSCA 1TQCC 2G5BA 1UZ8B 4KVCH 1CN4A 3SE9H 4DKEL 1YNTB 4ETYA 3ZGHA 2Y6TE 1IGIH 4M7LT 3FB7A 5D4HA 1RP9A 1F58L 3LPWA 4GEIA 2HT2C