2KLRA

Solid-state nmr structure of the alpha-crystallin domain in alphab-crystallin oligomers
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
82
structure length
82
Chain Sequence
RLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solid-state NMR and SAXS studies provide a structural basis for the activation of alphaB-crystallin oligomers.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Alpha-crystallin B chain
total genus 13
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
A PF00525 Crystallin Alpha crystallin A chain, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2klrA00
2KLRA 3W1ZA 3GT6A 2CG9X 4YE0A 3VQLA 4ELDA 2Y1ZA 5LUMA 2WJ7A 3J07A 1X5MA 1WH0A 2XCMC 3Q9QA 2N0KA 4JUTA 2CR0A 3QORB 3L1FA 2O30A 3QORC 4JUSA 2BOLA 4YLBA 3VQMA 4RZKA 3GUFA 1RL1A 4M5SA 2MNWA 4PBDA 3AABA 5DS1A 4YLCA 3GLAA 3AACA 3Q9PA 4MJHA 4FEIA 3L1GA 1EJFA 2K8QA 2Y22A 3IGFA 4PCKA 5DS2A 2RH0A 3L1EA 3QORA 2JKIS 2N3JA 3EUDA 4ZJ9A 4I88A 4YDZA 2KMWA 3N3EA 4M5TA 2Y1YA 1WFIA 1SHSA 3QORD 2WJ5A 1GMEA 4YL9A 1WGVA
chains in the Genus database with same CATH superfamily
2WBJC 2W0PA 2QVFB 3PF2A 1J1OH 1V3JA 4MDJA 1TJHL 2J8HA 1BGXL 1MJ8L 1BEXA 1EA9C 2OX5B 3CHQA 3HRZB 4P49A 4QOKD 2N01B 4XBEH 3TT1H 1JDCA 3ZHFA 5C86A 5C2BL 1H15B 2F0CA 1OM3H 4KKZA 1NIEA 4PRNB 1A14L 2Q8BL 4AGNA 3CN0A 5J06A 4AEIL 3BH4A 1KTKE 3V0FA 2V2WA 1S78D 3MLSH 3CVHA 2L8AA 4JQVA 3WIFA 5TPWH 2DWDA 3TVMA 4HIXH 2OMUA 1RK1A 4DUWA 1J05A 4K8RC 3U4EB 4LF3A 3MBXH 4MD0B 4DNLA 1YNTA 5H2BB 2X7LB 2YGPA 3QEUB 4BZ2A 2AJUH 3UAJA 1J1XL 1UOLA 4H0HB 3WBDA 4AL8C 3TESA 4HX1A 5GGSB 1A1MB 3MNZB 4ELDA 1DYZA 3F7KA 4ATTA 5I2IB 4J1UB 3VG9C 4A7SA 5DJZA 4ZAKB 3QEQD 1JF1B 1USQA 1FZKB 2FD6L 3X17A 5GS2D 2YD6A 4AJYV 5GISH 2WBJD 4GIOA 5C08B 4KBPA 4JFQB 4M48H 5FYJH 2VMJA 2NW3A 4TVPL 4PJ5A 3S5LA 1JGLH 4M8UA 2MNJB 1R5IA 4LLDB 4RETB 2FLBT 4MMZB 4GAJH 2WLJA 3FSWA 5H37A 2HFEA 3D18B 4FFYH 4JM2D 1UYWH 4GEJA 2BY2A 3PJSA 4JMNA 2CQVA 1PFOA 1W72L 3ZDXE 3KWVA 2X89A 2IIJA 5AVWB 3W5NA 2ZP8A 2E27L 1VIWA 1H8NA 1CLYL 3HZKB 1XGTA 3ESUF 3IFOB 4N4YB 4UT9H 1OP3K 2F18A 3UIYA 5F7LB 2J1XA 4X6FB 4POUB 2WUBL 4UTAL 4HFUL 4OGXH 4KTDL 2JCCE 4G7YH 1UFUA 1YEGL 4LOEA 3U6XS 3I85A 3LIZA 4JPSA 2VT0A 4PVMA 3T1FA 3WFZA 4PM1A 2R29H 4TSAH 1DVFC 4PJEB 5ID1A 2Z0UA 1Y0LA 1FYTD 3QIUA 1BWMA 2WP3T 2VXUL 2IWKA 3SY0B 4FFWD 4HEMA 3V4LA 5I23A 4LLUA 4AT6A 2AS5M 1HNFA 3JTSA 2X4TB 4NAJA 2EVIA 3LZPA 4D94A 2QMJA 3MRIB 3WXVL 4PB9L 4E42B 1GPOH 2X6CA 2FO1A 1ADQH 1X9QA 4Y7MA 3SGDH 5MP6L 3BDYH 5I1KL 2F19L 4Z7WE 3I6KB 4R5TA 3BWAB 3KVPA 3T3MF 3WN5C 1QKZL 2CBOA 1MCFA 4DGYL 1PF3A 3M6DA 2DQFB 3LQZA 1HHKA 3AADB 4KV5F 1QACA 4I0PC 4IOSD 2Q2EB 3L9YA 1F2QA 2FX7L 1QPPA 3E6FB 3K5SA 4ZMLA 2AKRB 2DWSA 3NBNA 1AXTH 5F89A 4Z7WF 2CRYA 4LBEA 5I6MA 2XPGB 1UOVA 1ASQA 4N2FA 4RWYL 1S7RB 2DYPB 1CGSL 3DX0A 2GSGA 3JVGC 2IDCA 4GRWF 3SDAB 5T33L 4GKOA 1KEGL 3QJUB 1BD2E 5E2TH 5CGBA 3FTUA 1A6AA 3GXIA 3M1CA 2FHBA 2HXAA 5FW7A 3TJHC 3K81A 3WY1A 5CEZE 1A6VH 2CCWA 3V0IA 5FO7A 4B9JA 1O6SB 1EUUA 1Z9MA 3WG7B 3QR1A 4NJAL 4P59L 3P4NB 1AGCB 3EHBD 4YDLC 1MCOL 2JKRM 3EDJA 4PJBF 4JPQA 1KB5A 2J43A 1XX9C 3U1QA 4GO9A 2FQFA 4A2MA 3APFA 4WGKA 2VDQL 3FF8A 3O45A 3T04D 2OTPA 4ODTL 3UTOA 2RGSA 2VN4A 4UIKL 1PZ5B 3PREA 3ZTJH 2NNXA 5ALCL 4XP6L 5C71A 5JOFB 3GMMB 2P5ED 4XHJC 4MRCA 4Q9RL 3D30A 1WISA 5KSAB 5DJAB 1T21A 3AU1B 3IGKA 5DR5L 1AZNA 2F54B 1EFXD 1G7IB 5BUAA 5B3SB 1A6ZB 2Z31B 5CD5D 3M46A 1E4WH 1GVIA 2ICCA 2CU9A 2V9RA 3MV7E 4U6VH 3R8QA 3TVMB 1HS6A 4ZAKA 1MJ7H 3L2NA 4G9FA 5HGHB 4NZUL 3FCGA 4TVPH 5HI3D 4NP4H 3PABA 3CDFA 5C8JB 5IQ9B 2XKUA 4ZOBA 3EJJX 1KLUA 2ZCHH 1RHFA 1H15A 1TZOA 1V3MA 4YL4A 2BJML 5ICUA 1MHHA 3RGVA 3WAKA 4U6TA 2HKHH 3SKMB 3SQBB 4E41B 3I3EA 4AEHH 5INDA 2OW7A 4ZI8A 2GJPA 1Y18A 3MJ6A 2P46B 2R1WB 2EXWD 1FUNA 1RJZB 3FO1B 4F2ME 2ZKHH 1KY6A 3QNZA 3NCJH 4NRYB 5DFVC 2OMTA 1KIQB 2D7TH 4FZEL 4PLJC 4XC1H 5E24E 2E7LA 2OMWA 1B2WL 4OCWL 3MA7A 2YEQA 3EOYG 3IXAB 4G82A 3TFBA 3FO0L 1TKWB 1BDYA 3QUML 4HWBH 4OCLC 1OIOA 4OLEA 3HZVB 4F3FA 1AO7B 2X4QA 1G9HA 1J0YA 1T20A 1DE4A 4G7QB 4Q9BA 5F3FA 3I50L 3KG5A 5BO1L 2J4WL 3REVA 1QFHA 4X4YB 2FJHA 1SJHB 2BO0A 5E5MB 3BFWA 3AQZA 4S10A 3PDGA 1FVCA 4RMUA 3UTQB 1OOWA 2J8UA 4JRFA 3BUDA 4TNVK 4XPBL 1V7ML 1QAWA 2E75C 5IB3B 3MI6A 5IW1A 4P9HC 1I9RH 2XACC 2C3VB 1EIBA 2VKXA 1A7QH 3MROA 3TBYB 4NDMA 4HUXA 1SM3L 3FUJA 1E9OB 1YN6A 4D9LL 4OD1H 4OH2A 1BFVH 3BMWA 4W9HC 2UZYB 3HC3L 4RLDA 2IH8A 2QPFA 4WEEA 3D4CA 2CLVB 1T0NA 2NUPA 3BUTA 3CMOH 3FFCA 4XVJH 1JZ3A 2EEBA 3QUZB 1I9IH 4G43A 2OSWA 4X6BA 4JE0A 2GCYB 2ZNXA 1Q9WA 1FAIH 1R3KB 1MFBH 2D4DA 4JFEB 1I1RA 1KPRB 1SM3H 2Z7YA 4PJ8B 5DLLA 2BHUA 2EDBA 2BIIA 1BBJB 2IPKB 3BAXA 2A6DB 4HFWA 1FFTB 4GAGH 3FZUD 3FQNB 4XCCH 1NPNA 3RA7L 4F8NA 2YUVA 4R7DB 5FHAH 2NX5A 2Q8BH 2JJVA 1JF6A 2EE9A 4IBSA 5AVQB 4G7VH 1W72B 2VDLH 5JDJA 3GO1L 1FZJA 3QDGA 2Z1PA 3TNNB 5IJBC 2NTFA 3T0EC 3OMZA 3QQNA 5ALBH 5KBNC 2YEVB 4Z76B 2CA3A 1YYMH 5C0FA 1BG1A 1OOAA 4NKDB 4JX0A 3WFBL 2H2PD 1C7TA 4DKEH 3IDXL 5FDWA 1I7TB 4MJ6A 1WWBX 4Q74A 4HJGB 2FD6H 1XBDA 4AENB 1NFDE 5T3XE 1S7UA 5IFAL 1A4KB 5FA3A 5B7FA 5EORH 3G08B 2H26A 4A7UA 4G3YH 5CLYA 5CO1A 2JKXA 4XCEB 3QRBA 4X5WB 3G6DH 3HLKA 5DO8A 3DTXB 4FFVD 4OJFH 3FUMA 3E38A 1E28A 2MRYA 3NCJL 5EU4A 1DVQA 1H6EA 2WCSA 4HJ1A 2QSTA 3SOBH 5E4AA 2VDOL 2BSSA 3FFCD 3EFFB 4PTTA 5LQBH 4NI6A 5EOCJ 4WUKH 4AVIA 4YAQA 3ZYJA 5TGBB 5A2IH 2EIJB 5I1LB 5CILL 3VSTA 1S9YB 1TQCC 1NUGA 3QCVL 4G42A 1WFJA 4WI0A 2NSQA 3MREA 4YZFE 2FQEA 1RZFH 4YBQC 1KCRL 4FNTA 4GNKB 2VGLM 2OR8A 1NC2B 3ZL1A 1KG0A 1DQQA 3NSCA 5EC2A 3FQXB 5BQ7B 4OT1H 2Y06L 4AUJA 1WG3A 5AKRA 3GSNH 3HC4L 3NFNB 3VD7A 4F58H 5EF2A 3UTPE 4WJKB 3DOIA 5C0EA 2BSBA 1HU8A 1UOKA 3RURA 1LMKA 4MQSB 1A9EB 3P3YA 1FVDA 4K8RD 2G5RA 4P5TC 5F0PB 4NUMA 4YSCA 2E7LC 2PCPB 3FZUC 1G7LB 5CEXB 1IAMA 4IBYA 1NCDH 3VFPB 3ZDYB 3LKRA 2YGNA 4OLXL 2X28A 3KEHA 2X0WA 3FBQA 4KXDA 4UNUA 4FFWC 2JIXB 2YEZB 4Z78B 1DQLL 1GW6A 4JVUA 3SKMA 3NZHH 3SQBA 1P84J 3THMH 4QRRA 3APMA 3VW3L 1TO4A 5F1KC 1EANA 1JV2B 2CDFA 2NZIA 1UZ8A 1JNLL 4LPWA 3KYOA 1B6DA 5D1QE 3EXLA 4BFJA 1A6WH 4FG2A 2W9DH 1AO7E 1N10A 2Y6SC 3PUUA 3RWJB 2WLIA 4NGHL 3QDMA 2ZOLB 4NNYB 3INUL 4LSTL 3VFMA 4BDVA 2ID5A 1G6RH 1OLLA 1BQSA 1A1NA 3EOBB 2CAKA 5EC1B 1ZVYA 1RIHH 1BFOA 3ZQWA 3MV11 3X3FH 5FYLD 1BOGA 2VE6B 5C6TH 2ICEC 3ILQD 2HG5A 1YLBB 3TEXA 4ZFGL 1U8KB 4N8CH 1BVKA 5E00A 5BOPA 3CFDA 4BBWA 5GS3A 2MKWA 3WFCH 3BRGC 4JHAL 1UD2A 4AQEB 3C08H 1QBLL 4GQQA 3MBEB 1FV1B 2O93L 4X0KB 1QWHA 3QSKB 5K1JA 4GBXD 3OKEA 2HJKB 4XNQA 4NUGH 4QTIH 4GW5A 1MXDA 4X6CB 1S46A 2FH6A 1UHVA 3UJJH 4HPOL 4R6UA 2VDKH 2QR0A 1E27B 3IBOA 3AXLA 3MBXL 2AJSL 4IBTA 3IKKA 1X4ZA 3FYIB 2CKBL 3MUUA 3QUXD 4FLRA 2F54D 1DCLA 4PRHD 1QBLH 1CLCA 4CN1A 1A3QA 4N8VB 3IDIB 3DMMA 3EBHA 4O9HL 4OZGA 1RLWA 5J9PA 2PR4L 1LXMA 1R1CA 4PP1D 1OF2B 2IADA 2R9HC 1VGKB 3IJEA 4NFBA 4M8QA 4GH7B 1DVYA 4JO3H 3T5WA 4Y19B 2AEIT 2CUAA 2G2PA 3ZT7A 1UB5B 2LVCA 3GGWB 1I85C 1KT2A 4M5TA 5DHVB 4LSTH 3UAJD 1MFBL 3QJHB 1WITA 4Z7UE 5DYOA 3OL2A 1F00I 4BSWA 4NNPH 3LY6A 4UBDC 1S5HA 4ALAC 3CUPB 3FTZA 3FCBA 3V7AG 1FL5A 1YNKL 4DGIL 3Q2VA 2E27H 5K9OA 4HFWB 1KY7A 5JZ7D 1SBSH 1SOQA 1I3GH 1QOKA 3OWRA 4MA3A 2F53B 1WCBB 3S5LG 4WEBH 5HGBB 4LBEB 1G87A 3L1EA 4NM4L 3L5XH 5DT1L 1DJIA 3QUXB 4HXBL 1WE5A 2E76C 1FCGA 3STBA 1L0XA 2WHVA 4AGPA 2Y36H 1E9QA 1KXTA 2EIZB 2XWJA 1HQRA 1PZCA 4GKZA 4KKQA 3ZMEA 1PZUB 2XKNA 4HKJB 3IWVA 2OP4L 4F5CE 2YRLA 4XAKE 1XZWA 4DW2L 3T6XA 2YOAA 2OCFD 1H5BB 3LXAA 2PP8A 3LRGA 3DSFL 5J13B 3SHSA 5AVXB 1I3GL 1I7TA 4MJ6B 3LKNB 1AR2A 2VIRB 1RSYA 5CCKL 3EH5B 1QBAA 2ITDA 3BZEA 5AOZA 2V3DA 3FUHA 5D72L 3MNWA 3VGFA 2YSSB 4WWKC 1UB6A 4KRPD 3PHOA 5D70H 1P7HL 3SPIA 2YD1A 3PWUA 3PQYA 4UV4H 1YZZA 3GMRB 1W72A 3BUQA 1K3IA 4GSQA 5DJ2B 5GGVL 1IEAB 1JTTA 1SMAA 5I1GH 3WIIL 5MEOB 4GP4B 4FFYA 1KCSH 5DZJA 1GTFA 3WEAA 3QEQE 1EHNA 3QPXL 2VLKD 4N0YL 2JTYA 5F1NA 2Y25A 5HGAB 3LZQA 2XSKA 3HN3A 5GRXG 2JH2A 3RKPA 1AR1D 3QIWD 5HJ3A 2GJZA 4AE1A 3CX5J 4IGBD 4PLKC 4U3SA 2HLFC 2Z31C 2KL6A 4ELKB 1ACZA 2WWNA 2M2DA 3OJVC 2FWLB 4Y4KD 3DRQB 3FF7A 1E5ZA 1KFGA 5F1OB 3PWJB 4ZX5A 3QDAA 1M71A 2P3YA 4MXWH 3RZCD 3PABB 5IQLA 4WUUB 5ESVB 5C8JA 2WQSA 4MMXC 3ECBB 4I5BA 3DHUA 4GSDL 2ZF9A 4OGZA 3ZDXF 3ZKQD 5K33A 3IVKB 4J3OG 4MD5A 4P23A 4Z7UF 4YHKL 5C2UB 1UKSA 1QSFD 3LVEA 3NZHL 3FU5A 2PPDA 4HULB 4NM8L 2QV4A 4AXWA 3B5GA 3SCMB 4LLAA 4WFEE 4MAYD 5BOZG 5JXAH 1TFPA 4JGMA 1FAKT 4TTDD 1QSFE 2NYYD 1F4XH 2UX7A 2VDQH 4PREA 2XJKA 1GS6X 5CP3H 1IRAY 2AVFA 4FFTA 4X6CE 4L3FA 2ZYRA 1P2CB 2EQDA 5AAWC 4B0MB 4CMHB 2XIDA 1N5YL 1J9CT 2JV6A 3R06A 1I53A 4OV5B 2Z8VC 4NZTL 4QO1A 3ZZSA 3GJFH 3BVNA 5E2JA 2OL3L 1O0VA 3FHQA 3LOWA 4NZFA 1IAII 3FTYA 1PG7H 3QUZA 1BHGA 4LU5L 4MNQE 4HT1H 1QTPA 5E56A 3FFOA 2BIHA 3JV4B 1OPGH 1MW3A 1OARH 2YD2A 4I4WA 4RGOH 3N2JA 2Y3AA 4CVXB 1EAQA 3GMPA 4PRHE 3R1GH 3VMNA 1IAKA 2KHAA 3O6LL 3I9PA 3HG1A 4OJAA 1FHGA 5AVRB 1KPUA 5FUCE 4HWNA 4LLYA 2HVJA 4ODSL 4K3EL 4Z3FA 4MHHI 5DU7A 4F8TA 4JQIH 3HMWL 4WV1A 3CVBA 4Z7OE 4YDKH 4WO4A 5GRZA 3RWHB 2GFBA 4PCYA 1HX0A 1AOHA 1N59B 3Q8EA 1YEGH 2WTOA 4U6HB 3TGXA 3ZKSD 4ZJ9A 1N26A 5TDPA 1BLNB 1BOYA 2DI9A 2NY0D 3IMSA 3KPOB 4G43B 3BSHA 4G6AC 4FHBD 3IT8D 3JZ7A 1TJMA 3LKOA 1DLFL 1FNEA 5EOQH 2LU5A 5IB5A 3SDXE 5DO2D 3WNJA 1VFUA 3TT3L 2N56A 4WY7L 5EMYA 4AV5A 4ZUSA 5C7XH 3KPSD 3SYCA 2X6BA 4Q7DA 1IGCH 2YXWA 1E42A 1WFNA 3H4HA 3BT0A 2VLJA 4H0IA 2EYTA 2X1WL 4FP8H 4DKFH 5TDOB 3WIHA 1I7RA 3OZ9H 2OR7A 3VWJD 4WHTA 5AALA 5D7LA 2AANA 5A16A 1KFAL 1WICA 3K8LA 1F90L 1J5OH 1RJLA 2WWKT 5DMIH 3GI9L 4WY7H 5C7XL 3OD3A 4JZJC 2WLLA 3RY6A 4QT5A 1X5JA 2W07B 2WANA 5I73C 4Y2NA 2JTDA 2HT4D 4M6ML 3ATEA 1NLBL 3V5DB 4PJ9A 3S3SA 4F7MB 4EI6A 1IL1B 1JGDB 2XN1A 2ZWNA 3P40A 4NWTL 4H1LG 5BZXA 1JWMB 2IAMB 2I9LB 1GJUA 1KBKA 5I1GL 4ZTPL 3WEXA 1T89A 4H20L 1G7QA 3QDMB 3T1WA 3DUUA 2FSEA 4KQ4L 4OZHF 4YUEH 1P4BH 4S0HA 2EEFA 1QATA 3IJ9A 2Z8SA 5ANHA 3ZPDA 4G83A 4QRRE 2WXOA 4LVHC 4L2LA 3X3GH 1ACXA 4ORGB 2NY7H 2FHFA 1MCOH 2IQAB 3HUJE 2A9BA 2JIXA 2X4PA 2EIKB 3OLIA 4JO8A 1BCIA 1Z9NA 4KKLC 2EIMB 2ICEB 3RWFA 1TF4A 1WZ1H 4W9KC 1IGYB 3AXIA 4LCVA 4Q89A 5KVDL 2COVD 1J05B 3JUYA 4H8PA 5DWPA 1S78C 1GKEA 2YJQA 4JFVA 4TTDC 5TE4L 2DMCA 2F6AA 4H0GA 1BPVA 2R29A 1N68A 1WD8A 3E1ZA 5KUKA 3BUYA 1CBVL 3WDJA 1PLGL 5IVZA 3CH1B 1HCYA 1FJ1A 4LSDA 4GXUN 3GJEB 4EZMA 1LWRA 3RWGA 2B1OA 3U4EA 1TO5A 4JO4L 2XG5B 2XWRA 3W57A 1XF2B 4AW7A 1YEDA 2JKWA 2JWYA 4WFED 1RUQH 1CWVA 4OUUB 5I66B 1KN4L 1C16B 1ACCA 4WLCA 4ERSH 4M6MH 2EC9T 2B4CC 5T1DL 1S4IA 2WZPA 2BY1A 5FO9B 1ULVA 2CJSA 3WENA 1PZBA 3PLYA 4YK4C 4DVRH 2PPFA 5KG9B 3STLA 2OV0A 2FHCA 3X12A 1KF9B 2R51A 5ELIA 3JWDC 4CUCA 3K74B 4E2OA 2C7FA 4BQ8A 2WQVA 1XQ4A 2IBGA 2HFFA 5FV2A 3VFTB 2XJLA 1RU9H 4ZRGA 3VXUE 5EPMB 5D1QA 1VESA 3TH2T 4AE0A 4FI7A 5JO5A 3KPLA 1DQDL 1KXVC 4OF5A 4PRHB 5FC9A 5IVXA 4XMPL 3SGDI 4XC1L 1I1AB 3F12B 4Y16B 3QPQD 4N8PA 5C08E 3ILEA 3HG1D 1FNSH 2E7DA 3DHMA 4JN1H 2KKQA 4MKTA 5CR1A 2APXA 1TG8A 3MRQB 4LARH 1CD1B 5D8JH 2UZXA 3GMQA 3U1SL 2DN7A 3QJTB 4EEEA 1CLZL 3QUKA 1BSIA 3MJ9H 3V7AE 4OZ4A 4IJ3C 1SEBA 3HVDA 4MJ5A 5DJCA 4P2RE 3KJ6H 1EEQA 2D7OA 1A66A 1PG7L 3QS3A 4ZMXA 1B3JA 3BWUF 3VB9A 1JG9A 5T3ZD 3RWDB 3QAZC 4H0LC 2WN2A 3ZRFC 1E0OB 3IPFA 1GTNA 1U36A 2C9PA 2WVSA 5DRXA 3RVXD 5A2JH 5HYSA 3V9EA 3MZTA 4MA7H 3Q7JA 1E43A 1PVHA 5F0MB 5F7NC 4IRJD 3ARDC 2HFTA 1IQDB 2HVJB 2P42B 3B3BA 4I77H 2HMID 3MCLL 4M4PA 3BWUC 2X41A 1QTYT 3PGDB 4GRLA 2X9YA 5D6DC 4NZJA 4TULH 3GMNB 1R34A 3NJMA 4DVBA 5AB1A 4UYQA 1HXYA 1XFPA 4YXHL 1XCWA 4ZPTB 2OMNA 4NQEE 5C07E 4JDZB 3S3JA 4IU3B 3RP1A 5AZEL 1YMME 1FBIL 2MNUA 3CCHA 5EDXA 5EBWB 5TDPB 3BD3A 2A73A 3UERA 3MRBB 1J8HB 3FDWA 4L4TB 1NICA 3DI3B 2A9NH 5AYUL 1T5WA 2H3XC 1IT9H 1T5XA 3AM8C 2ORBL 4I7ZC 1DJYA 1KTDA 1H5BA 4KROD 3VRJB 2CR3A 3N85H 3SIKA 1YDPB 3V6ZA 3OKKA 2EE0A 3CLEH 3U46B 1QW9A 3RDTC 4MS8D 3BUPA 2UWEF 4HJEA 5AB9A 2CLZA 4F7PA 4J39A 4PRBB 5FYKD 2K9FB 3RY4A 4LHQB 4MAZA 1RPKA 2VLKA 4MXVF 5EU3A 2R69A 2VQ1B 3LEYH 4OCXL 2JK5A 4NO0D 5BZWA 5CN2A 3QUHA 4HHGA 5DD1L 1NBYA 3S98A 2FIKB 2OTUB 4Z7VE 4MD5B 2IANB 5GGRB 3V4UL 3FONA 5EZLB 4P23D 2ITEA 2IBZX 4X9FA 2DKMA 3FQ1A 1PMYA 4QOKA 5I5MA 3PP3H 1CICC 3VD3A 3ULSB 4YHML 5JQ6L 5MENB 4OUUA 5I66A 2LV4A 3KVDD 5I8EB 1DL7H 5GJSH 2F8IA 5LCVH 1RV6X 1V54B 3KYKH 2JB5L 5IJCC 3O81A 1F02I 1G4RA 2AQSA 5MP6H 3QGVA 3RVVD 1JYVA 1TTRA 3TN0C 5DQJB 5JXED 4TUOB 4PBXA 4K71B 1FO0A 1HWHB 5I1EH 4BFIA 5D2LE 4PG9B 2EDTA 4UF7C 3R1GL 3LKQB 3BPCA 3EJZD 3GJEA 2W9EH 5AG9A 4DGIH 3GFUA 2YPLE 3EYOA 3M17A 4HOWA 5I16A 3SE9L 2EKJA 4F7MA 1DQJA 1U91B 3CVHL 1HNGA 1WDAA 1QSEE 3HRZA 4NM4H 5DT1H 1KZQA 5C3IA 2QVTA 3DX8A 1GC1L 1KB5H 3F3HA 4EI5C 5AW7B 3SDCB 1XSJA 2F61A 1CG9B 3MGAA 1OCRB 5DUBA 2DWXA 5A2BA 5IEHB 5D7IE 5DZLA 4NP9A 1A6TA 4P23B 2FDBP 1KGXA 3VQ2C 2WGNB 3ESVF 5CCJA 4N1CA 3C5JB 1AY1H 2EH7L 2UYLA 2V2WB 3DURB 4PIBA 4YLCA 4DUXA 3F58H 4C4KT 1I1YA 1KIRA 1UXLA 3TCXA 4AVKA 1AGBB 2CK0L 3RTQA 3SZKC 2EP6A 4KVNL 4PGJA 4BH8B 5D6CB 5MHSE 1OSZA 3CFUA 5B1JA 4FC3E 3CZSA 3OGCB 3QQ3A 4PWHA 5LCVL 3R8BB 3PPSA 4HCRL 2HT2D 4KPHH 1U8LA 1D7FA 4P04A 5EZIL 5HVGB 2H1PH 3I84A 3S36H 4U1SB 5IMKB 4NKIH 3F8UB 4NUJA 2BOLA 1EX0A 4G6JH 3D39E 1J8HA 4L4TA 2JCCF 3GK8H 2J44A 3TWCL 3S96B 4R4FH 3F7QA 4UDTA 3QWNA 3MNVA 4GRLC 3KPRA 3MLWL 1PAMA 5DJCB 4AGMA 1BV8A 3EGXB 1Z1WA 3MRCB 4I0PA 1SOKA 2X1XR 5KTEL 1OGAA 4ZX6A 3LEXA 3TZVB 4JPVH 1VJSA 4P46D 2QVMA 1NKGA 3O9WA 4DO5A 4JO5A 5C0AD 2PETA 2O61A 1D7DA 2MQGA 3ML9A 1EVTC 4HWUA 3ZUCA 2A6IA 5TD4A 4HWBA 1J9TA 5CLXA 1UD4A 1HHGB 2Y9RT 5EIIA 5ICZA 1DTUA 1GC1C 1E4XL 3CZLA 2JKNA 4WWNA 2Y72A 3N85L 3NCMA 5EPMA 1XDTT 1YG9A 2O72A 2IPTL 1OCZB 4WENB 3TXAA 3VXMB 1MELA 4TMPA 2DTML 1U8IB 4KZDL 4IKIA 3MXVH 3IGLA 4NQDB 2BZDA 5EZPA 1HIML 4PBWD 1ROCA 4H7VA 3B83A 3K8KA 1IZJA 1T7XA 3OHMB 4PJ5E 3GBNH 2M8XA 4TULL 3NCEB 2A7BA 3W9DB 3IXTA 2XHNA 4BIKA 4R5VA 1DVZA 4R4BA 3RWEA 4KUZL 2H32H 2WSKA 3RB5A 3QEHA 4TXVB 5IFHL 1JZ4A 1MRDH 1HZHH 1NFDF 3EFOA 5FKPA 4QYOB 3GHBL 4TL4A 2H0FA 4NO5A 3MXVL 3QXDA 4U1LA 4ANWA 2JMRA 1OWRM 3ILPB 3KXFE 4G6JL 2JXMB 4FXKA 4NKDA 2BIOA 3LQAH 5ESQB 3T8VA 4XI5C 4ZUUA 1OP4A 3PIQA 1FNGB 5FOBB 3CPLB 1DVFB 2CR0A 1J18A 4P3WA 3QDMD 4HOXA 4XMUA 3MAWA 2OR9L 4D0DB 3CC1A 3P9WB 5J4MA 4BFOA 2YR3A 1BMGA 2VZ1A 2V8MA 4JGUA 4M6NL 4KMQA 5ENWA 2EINB 1ZE3H 3QDME 4OF6A 4B5ZA 5C9KA 3HZ3A 3QWQB 4KJYB 1UZ6F 1A4AA 3MOAH 5HGGS 5F6HJ 3AUVA 4ZOEA 2WMPB 1J11A 1NCBH 1RUPL 5IVOA 1FNHA 1DJXA 1H8SA 3PWPA 2JB6A 4OZHE 4OKDA 4OLVH 4PJXA 3QRGL 3HOGA 3B7UX 3EH4B 43CAB 5AZ2L 3U6RB 3B9KD 5DJ8A 4APXA 3JWNE 1PLCA 5H4ZA 1X9LA 2B08A 3EO0B 2YIHA 1IC1A 4JJHA 1SHMA 3HRPA 2Z6FA 4PLKD 5AOJA 5EA0H 2CIIB 3CSBA 1G0DA 2NPLX 5IESH 4Z0BL 3H6AA 2YPVA 3ZHDA 4UQ3A 2HH0L 2G75B 3QHTC 4GXFA 3C09B 4P2QD 1XGPA 1JD9A 4X6DA 2A9ML 2DH2A 4L4VE 3QJFA 2HKFL 2J6EA 3QJOA 2NY5H 4HUKB 4DZBB 4LSVH 3VRLF 3P9MA 5JMOC 4DPBX 4KK5C 1M3JA 3ZVVA 5HYEA 4F9PC 1BW8A 1HNYA 1FRGH 1K2DB 3D5OF 4YXKL 2UWEA 4QRFA 1XSOA 4HIPA 4OAWB 5IREA 3EH1A 4P3CH 1CD9B 4GRWH 2Y2YA 4Z95H 5HDBE 5FHAL 3DVGB 1PGRB 2A0LC 4WJ5B 3EO1A 3BO8B 1GGIH 4EMZA 4LSPL 3HB3B 1ZS8B 3GBDA 3O3EB 4DGVH 1A1OA 5E8DL 3FCSA 3NTCH 2GKIA 3NGBC 4JPWH 5L2KE 4J3BA 5FO8B 2W9DL 4QKTA 3HRZC 1JZIA 3BN9C 4G72B 3ALXA 1JNNH 1L4IA 4WWKB 1QBML 3MZGB 1R5VA 4FG6D 4IS6B 5H94B 3PG2A 5FECA 4NKMA 4EI5A 4JPIA 1RIVL 1ROWA 3ATFA 1FGNL 2W5PA 4OZIE 4LP5A 1GZQA 1C5BL 4JS7A 4KO6A 1MSPA 3CSYB 3IXTB 3LPFA 2CNZA 3C2AL 2ROXA 3OMNB 5EZIH 3OJDA 1G7PA 3VXUD 3H2WA 4MX7A 3SCMD 3VQLA 1OKEA 4QYOA 2V2XA 1B4JL 1JJUA 5CSZA 3HN8A 2OXGB 4YSTA 2H3KA 4X98A 3C5ZD 2QPSA 2NQ3A 4WHDA 3O4LE 1C12A 5JQ6H 1S9WA 1KTJA 2W59A 2CLVA 1C5DB 1MIMH 3QO1B 4OD1L 1RCYA 3D39D 1RZFL 5IP4A 2RFXB 5F7EL 4G71B 1NAKL 5KYUA 4OCNC 1J9QA 4MNGE 2C1OA 3X11B 1WT5A 1Q94B 3J2PA 2RTTA 1UD6A 4MS8C 4WTZG 4NS0A 3SDYL 4EUPH 5J9PB 5CJBA 4EN3D 2B5IC 4KTEH 4FTVE 3Q2LA 2ZUWA 43C9B 3AREB 1FP5A 1A4KA 2WKOA 1DSYA 1T4KA 3N0PB 4RVBA 4AYID 4NQTA 4D7BA 3IJHB 1QO3B 2P49B 4HWEL 1FPTL 1OGTB 4RIRA 2GCYA 3NIFF 5B22A 2NUTB 1MDTA 3H3PL 1UEMA 4WW2C 3VE0B 3L16A 4FEIA 1DLFH 2GJ6E 2AABH 1TQVA 4XHJD 4Y4HC 5KVEH 1EBAA 1XH1A 1J8RA 1QABA 2UY6A 4JW3A 4KAQH 1P4LA 2GJRA 3QW9A 4KZEH 1OEZW 1BX2B 3EJYC 4PU2A 2FH8A 5I6KA 2WYZA 1BQ5A 1ZT7B 4LEXH 5B7MA 1NCAL 2XWTB 4XP6H 1NL0H 2HRGA 2XN9A 1NFDA 3V6OC 4GB9A 3ZR6A 1OT4A 1Q9WB 4M1CD 5EUOF 4TRPH 3X3FL 2EIDA 1X44A 2WMPA 4CC0A 4KTYA 3UYPB 1A65A 2R23A 4DCQA 1NAML 2K6WA 4XN9A 3P3RA 4K9EL 4WFGE 3S0PA 3TEUA 2L3BA 5D6DA 3HR6A 5D4QA 3BIKA 2ZUUA 3KXFD 3VFPA 5KAQF 1DBJH 4YHPA 5LBGA 1V3KA 2Y1ZA 2R56L 4DW2H 4OGAC 3RFZC 2Z4QB 5TJWK 1IVLA 1QA9A 4W6WB 3ZKXB 1OAKH 4QRRB 4WFFD 5IZ7A 1Z9SA 3PWUB 4H8HA 2B1AL 2JVUA 3C6LC 3UMNA 3UZQA 4BUQA 3AZUA 2ZXCA 5DZAA 4HWZA 1L0PA 4D9RE 2GJZB 4KY2A 1U8HA 1BM3H 3ARFC 3V0GA 1RZJC 3MXWL 3SDCA 3MV8A 2I5YL 3MLUH 3ETSA 4X5RA 2A77L 3LS5L 1A7RL 1F1GA 4F92B 5F7FA 1MY7A 2V0AA 3PWPE 4YEFA 1TYEB 2XVGA 1UWYA 3LZNA 3MV7A 5FO2A 1JF1A 3KGSA 2SEBB 4NLAA 1G7JB 1I1AD 2GTZA 2NYZA 4XNZB 2ARJB 2ZXWB 3MBWA 2GJJA 2ESVA 4M7KH 1H3GA 4GY4A 5DJ2A 4GI8A 1B3IA 2XETA 4W68A 1VENA 3FJTA 1CL7L 1WTLA 3Q9PA 4NP4L 3VFVA 4Y2DB 1D5ZA 5DC0A 3MRRB 3WIFB 3BZFA 1JI2A 3QNXA 1M7DA 5CSZB 2XU9A 3V0EA 3J27A 1F2XK 3D3VB 4LCCA 5B3JE 2EXTA 2MOQA 5D96B 4ZUVB 1CXHA 1JHTA 1XR8A 4NKOB 1WJ3A 4DH2A 3IDJA 4WW1A 1R3JA 1LDSA 1I7UA 4GG6B 2F5BL 2XNAB 4PY7B 1SY6H 3LN9A 3JV6B 4N2DA 4LL4A 5ITFA 1EXUB 3RWCB 1HE7A 3LEXB 3TZVA 2NW3B 4NCC1 5DHDA 3SB3A 3MLZH 1R5VB 5FKAA 4B9IA 3SE6A 3STZB 3MJ7B 4NHUB 2C3GA 5KVFL 1Z9LA 2F53D 4IHOA 4YFDB 5K1NA 1ZPLA 1WT5C 1V7NH 4L8SA 1YEFH 3HCVA 5EZJA 3O2VH 4Z3IA 3U9PL 1ID2A 3M8OH 4IRZA 5EIIB 1RUMH 3L3GA 2ICWB 5BZDA 4XXCA 3V0HA 1N5YH 2XXCB 4U31A 3ZR5A 2WY3B 3CZUB 2YPKA 4A7VA 1AHWA 3H7BB 4L37A 4XPBH 3LZOA 4YO0B 3VU2A 1WS8A 2CUHA 4PRDA 2QGBA 4OZIA 1YUHA 4RAUA 5IROD 2FR4A 1ECYA 3VSQA 1A0QL 3VNZA 1JAEA 4XBGA 5JPNB 4XPFL 2AK1L 5EEXA 4DQAA 5GRWA 5E2UH 3T2PA 3WHXB 2IQ9L 1ZWIA 1AH1A 1GOGA 4Y2OA 3FQTA 3QG7L 2RIKA 4C83B 4OFQA 1TNMA 2B77A 1BF5A 1JGVH 5D5MB 3GI8H 4NPYB 3EYVA 2VYRE 3BISA 5KVEL 2ZIDA 2BSRB 3O6ML 3NZ8A 3VFNB 2IXQA 3IJSB 5GIRA 3TBWA 2FJFA 3HE6C 3IDYC 4LSRH 4Y8AA 2YK1L 5LLIC 1A3LH 1UKTA 5HHOA 5SX5K 4QHNA 1VFOA 1MCPL 4X8CA 4ZFFA 4XNQB 1AKJB 1D5MA 5F9JB 4JFFD 5L8LB 1LGVA 2BRRL 2W0LA 4TUJA 3LZRA 5HDOA 2R0LL 2Z65C 2P8MA 4XNUH 3KYMB 1A7PL 1OD7A 1YJDH 2YD3A 4OW6A 1DJZA 1T1XA 2QGEA 5DC2A 3K6FA 3QORC 2HKHL 3GBLA 4HIIB 4MLSA 4X2UA 1TTGA 3KCPA 3AITA 5DUML 5GZOA 1CFBA 3VFRB 5I74C 5BRZE 1WWCA 3VM7A 3SPVA 4I3GA 4X4XA 4TNFA 1AIFB 3EYFB 1M6OA 3QDJE 4V1DE 3VYNA 1YEFL 3QUMA 1BD2A 2OW6A 3B9KC 3PDOB 3IAPA 1NOAA 5B1KA 2DQJH 1ZTXE 1MAML 3L2LA 1DSFL 3JYCA 1XCTA 5I18L 4I18B 4AWJC 4EQ3A 5BUGA 1FNGA 1E8WA 1OE1A 4FYRA 1QRND 4PJXF 4P4KA 4PS8A 3J07A 5ISZB 2B4CH 3D09A 2FJGB 4OD2B 2Z8RA 4NKQB 4MJIB 1FLTX 4QEGA 5EO0B 3MCYA 5F3BB 1LK3L 3QNXB 4WUUD 2I5YH 3MLUL 5IQNA 4JN1L 1F42A 3VRIA 1W8OA 2Y5EA 3AU0A 3VGEA 4QYAA 2QQLH 3U2IA 1NGWA 2A5UA 4TYUA 5AW1B 5DEJA 2AQ2A 4MJID 2IDSA 3H55A 3RGVC 2Y5QA 1CL7I 1KBGL 3UZEA 2QQKH 3KWUA 4NFCA 3CHOA 1RZQA 1KB5B 3WEMA 2ZE0A 4M93B 5L6YL 2QZ5A 4Z3EA 3EJZC 1CL7H 4DF9A 5C08A 3X1NA 2GY7B 3ECUA 4QHPA 1O7DE 3SBWC 2AF2A 5DA0B 1BZ8A 5B38G 4K7FA 5SX4H 1RJLB 2NY7L 2WLYA 1JZ6A 4CN4A 4BA0A 1PD0A 4AGOA 2VZSA 3N41F 3AACA 3KPQA 1Q0XH 1G9ML 1PNCA 1SXAA 2J56A 3D3VE 5JIHA 2UZIL 5I1EL 1CICB 1BEYL 2IV9A 1RK1B 3EUDA 4PJ8D 2W65A 3AAZA 2CSPA 3IDGB 3GNMH 3P4NA 1PJ9A 4O4YH 2GABA 1JFQH 1H9VA 3A6BL 4P5MA 4GG6E 4R8WH 3NOIA 3TO4C 1MCBA 3QEGL 4HAKA 4Q6IA 3O6FD 3C6LB 5E6IB 1PDKB 4LLUB 3UP6A 3CJJA 3EYQD 5T1KA 1JHLL 4N3TA 3FT4A 4JFQA 3L48A 5C6WH 1SUJA 4YDIL 1JN6B 3EHBC 5JOFA 2I69A 3QUYB 3IRPX 1WWWX 1HYRC 1ZWIB 3CN4A 4KROB 2R2EA 3BQVA 5I75B 2VO8A 1T2XA 5GZNA 3TM6A 4PJAF 2AXGB 1IKOP 1U8MB 1SHSA 5EOTA 3KWWA 1UCTA 2OMUB 4K7PH 4WV1B 4FLSA 1FVEA 1PQZA 3PWNB 4OBSA 2X2HA 3RPIB 1IC7L 2FZ3B 4YDLB 5EB9A 2QT6A 3CLFL 4HCRA 4PEEA 5E70A 1SXSA 5IGXH 1AYOA 5DK0B 2XPGA 1DO6A 2E6QA 1OGPA 3EJUA 2HYMA 1VPOH 2V5MA 4PRDB 4RFEB 1ZLUK 3WUZA 4OZIB 5IJVB 3WOVA 1F18A 2BC4A 3C08L 4RSYA 2BNRE 2DM2A 2PTUA 2D31A 3LHPH 2Q3AA 4G9FE 2R4RH 1P6AB 1VSCA 2CRZA 1E2ZA 3OX8B 4PGDA 4HZAA 1MIEH 3GI8L 3KPLB 4LHUG 1KJ2H 2HLEB 4PRHA 5I1IL 4ZDHA 2OBGA 1YUHB 1MCSA 4RAUB 4XVOA 1Z6JT 4JFEA 4UILL 5D70L 1NBVH 2FR4B 2NY2B 4QHLB 2ZUQB 2BCMA 5I5IA 5HHVL 3SYQA 4PJEA 1F5WA 2OMYA 4YC2B 1I3VA 1UWGL 4Y2OB 3KPPB 3NEOA 4MHHG 2B16A 1FH5L 4MMYB 3INUH 3R4DA 4S0TD 5LCVA 4AT6B 3QUKB 5G2NA 3HNSL 5I2IA 3GRWA 3WEOA 1SNRA 5FYKL 3WYRA 3VD1A 4HS8L 4KDTC 4LP8A 3VFTA 1YAIA 1J0JA 4PWFA 1WAEA 5FDYA 4PV9B 1WZ1L 4Y2LA 1DUYB 1E65A 5AB0A 1JTOA 4A2LA 1FO0H 5IHUH 1JPFA 3HG1B 5C0GB 3DGCR 3GDCA 4HIHA 5E03A 5FGCB 1T7ZA 1YPZE 3LH9A 2XZCH 5C0CE 1I1AC 4L8CB 4URTB 1ZIAA 3TEWA 1RQ5A 2KZKA 4JM2F 3QWRD 2IPUG 5AOMA 2H5UA 4W6XB 4Z6AT 2HFEB 3D18A 3WKMH 4A2GA 1H19A 4B96A 3H0TB 4X9IA 1Q72H 2D3NA 4ZSOE 1JVLA 2VXSL 5DK3A 2BFVH 3P2BA 3A67H 2NDFA 3NABL 4QRPB 3NPSB 3F5WB 4K15A 4PWIA 2P43B 4WK4B 5L88L 1MCWM 4LDOB 4YJZL 3BJLA 5BO0D 3EYFA 4A7TA 4FOMA 1F8TH 1INQA 3FO9A 3MSPA 5BW7C 2X4PB 1MXGA 2HTLD 4LPCA 1LEGA 1X5AA 1E3ZA 4FFYL 3KCPB 3ETBF 2EDQA 3N44B 2NY6D 5I1CL 5E99L 3GF8A 4BQ6A 2ZUVA 3ROLA 1NEZA 2FVNA 3IMRA 2FRGP 3GMOB 2JSFA 3FRUB 3MLPA 4P2QE 1ID5I 1CZ8H 1NCJA 3SOBL 4L48A 4I18A 5DEFA 1F58L 5HHOB 1L9MA 1HN1A 3EGDB 2OI9B 3CBKB 4LKCB 2CKNA 3K71B 2KT6A 4JDTH 5IQ9A 4Y89A 4MAUH 4EPSA 2R0ZH 3NRFA 2J73A 4Y16D 2RQEA 3EO9L 3DUUB 3VI4E 1QUNA 1G9NC 4BSVB 1GZPA 3B9KA 2VC2H 1FPTH 3IDXH 4KHTH 4JDEA 4P5RA 4F93B 4HIIA 5L8KB 5AW6B 1Q4NX 4DTGH 2EABA 4NQVA 1G0XA 1KCSL 1JPSH 2YXMA 4PCKA 3HNTL 4S0SD 4M7JH 2R27A 4YBLB 1XVSA 2CGRL 3ISWA 1NQBA 2HJLA 2HVKB 2O4EA 4J3TA 2CLZB 5B1CA 4XNBA 4YEEA 5I30L 2EZ0D 2BY0A 3DARA 3RWJA 5KSAD 4WTXA 5CKGA 2P7TB 1U8OA 2IMNA 2ICEA 3RWFB 4KRMB 4Q9QH 4LCYA 2BC4B 2YRPA 5IESL 5IJKA 2NY5C 1HOCA 3F7LA 2KERA 4YHPB 4LO9A 1QFWI 1R0AH 4J4PD 2COQA 1TEFA 2BVQB 2CD0A 1U8NB 2F7OA 4E41E 5EUOE 1U93B 4IHOB 5ES4B 4LCIL 4PJDF 3WXWL 4KO7A 3UJIH 1ESOA 1QW8A 4M56A 5JIPA 2CUIA 4A04A 2X87A 2YPLB 4PVBA 2AQRA 5C09E 1FF5A 2WC7A 4LHUD 3RYMA 3WNMA 3FU3A 3MOBH 4LHUA 3NIGF 2CJTA 3AT8A 3DPDA 1OTUC 4X80L 1AHWB 3H7BA 1G94A 4L37B 1FL3B 2XZQL 1SBSL 2XQBL 5GGVY 3BRFA 4MDIB 2PCFB 4JANA 2BP8B 3NYKA 1GGIL 3LD8C 2ADJB 2BFGA 2OQJB 3EFDL 3BSZA 3PRZA 1ZVSA 2JCCA 3ARDA 3HJEA 4DEPB 1BQUA 1DQDH 5ISZD 5AW8B 1OAJA 3QUYD 4UZSA 3I2CL 2UX6A 1KB9J 3D1MC 1MREL 2DQDL 4JR9L 5DURB 3MODH 2JF1A 4OGQC 2C4FT 5CLWA 2CO3A 1ET8A 3ZE2F 3D06A 4C55A 1LTXA 5EZOL 1OF2A 2NRDA 1Y6NR 5A3ID 1C16A 2TRYA 3SE9H 1CDGA 3MRQA 3GQFA 4Y4HA 3DTXA 1TPXB 3DBSA 2PYEB 1R3JB 4BRVA 2LU7A 3FUDA 4J3VA 2LABA 4E36A 4EBQH 1RIHL 2JJTA 4HIJB 5CJXA 3I9GL 4L1SA 1SFHA 4N0UB 5CXPA 3HBZA 1T83C 2FJGA 5ILTH 5FK9A 3KLQA 1BZEA 5AEAA 2A6IB 1JXDA 4H5SA 1OP9A 4G9DB 5CMAB 3U7YL 5IBLD 5L7XL 2XTJD 2G2RB 3DXAB 3N1PC 2LOEA 5DI8B 5HDLA 2F08A 2UVEA 1XR9B 4ZG1A 1Q72L 2ADGA 1IEHA 1G7HA 4L3CA 1OGAB 4WJG3 4GUPA 2KZ1B 5DUJA 2VISB 1AD9A 3ARED 3E8VA 4W9GC 3QUMB 3AMKA 3MV01 2YLHA 2XTJE 4AYMC 3AABA 4OF7A 5DQDH 1KULA 1B6UA 4DESA 3AMLA 4CC4C 1KLGB 3DJ9A 2DQCL 2I85A 3LKSA 4GW5B 4JRXA 1FO0L 5IHUL 4U7KA 3OAWA 2DDQL 1NGPH 5CJ8A 2GBUA 4NO2A 3MU3A 1B4LA 1U92A 3M1OA 5JTWA 3LPGA 3FTGA 3CZEA 5F44A 1ED3A 1AACA 4WSJA 2YUWA 4F8OA 4OCYH 4MAYB 3SYOA 4KKLD 1KEMH 4FQ1H 4XNAA 3U0TB 2OYPA 2VB5A 4U6XA 5D7EA 1B9ZA 1P5UC 1BVKB 4JO1H 4X6DF 1JZ7A 1OAZH 4HBQA 2HVKA 4OQTH 4HMCA 2XZAL 3QUYC 5FCSH 2HRLA 4I3RH 4PJ7F 3VFNA 1CT8B 3D0LA 1JZDC 1OZTG 5C0JB 4MZ2A 5C08D 3MROB 3TBYA 1KBGH 2OX5A 3HHRB 2ZCKH 3A0OA 4J6IA 4BDVB 3L4WA 4IRSB 4DO6A 4I1PA 3CVIL 5MEOA 4P46A 4DEPC 5DEGA 1FFOB 3WMSA 3QFJE 1I75A 1BFOB 1T6VN 2APSA 3IU4L 5AKVA 3V6BR 2MCPH 3PJLA 3EGDA 1HHJA 3IN2A 4ZAKC 1HHIB 5D1ZC 3GIZL 2EH8H 4P2OA 1NSNL 3W0WE 3QHZH 3QXVA 1I9RL 2B4CL 4KMTL 4LF3B 3RX8A 2EIBA 1M7IA 2C1PB 3UPRA 2OA9A 3IAGC 4UTBL 1B2YA 2JB5H 2R1YB 4ZMYA 3MUJA 1ITCA 4ECNA 5DMGD 4KI1A 5D2NE 5EULV 1YECL 4TLTA 5I6LA 4N86A 4JZJA 5HYJD 3BPOC 2ZYSA 4XZUB 3TONA 1SZNA 4PW9A 4PJDA 1AC6A 3WI9A 4R97C 5C0EB 3DROB 4X6DE 4KKAC 2C9VA 1NCHA 4E5XB 4NERA 1J9SA 5HJBA 3DJTA 2DDQH 3VVWA 5IQ7H 5HGAA 5ACZB 5G4NA 2LAGB 4MYWB 3ZTJG 3L4XA 3WIHH 3KR3L 2MJWA 5DRNA 1QYGL 4HLEA 3HHMA 1ZVHA 4CBPA 5B21A 4LCWA 2NCMA 3B2VH 1KG0B 3KHOA 1DJSA 1CUOA 3LMJL 1TT6A 5HSFA 3MRLB 3B9AA 3E2HC 3KW7A 2OMBA 4M8QB 1NFIB 3DGGA 3DOHA 4M8RA 4QUOA 1T1WA 4XVTH 2A6KA 4WU7B 5IEKB 4X9HA 4F7TA 1UH3A 3QUXC 5LN8A 2VQUA 3OKMB 3TTYA 1HKLH 2AMGA 2EDDA 5KYXB 1QRNA 4Y9CA 2DRUA 5EFIA 4HLZH 4Z7NB 1VADA 1A1OB 4BSWB 1GL4B 1CGWA 4MCZA 1IJNA 2NY4D 3NFPA 4QRRD 5AAMC 4YDJA 3QQ9C 5GGQH 3T0VA 2NZ9C 4GINA 4NEHB 5LHDA 1EDYA 1RFDH 3IFPA 4NUQA 5DDHA 3ARBB 4K3GA 2BVOA 4XAWL 5TDNB 1CYXA 3VVVA 2PTTA 2R59A 2X4SB 3S9DB 2BH0A 5KN5A 1QFPA 1HINH 1MPAL 2BDNL 1D7BA 2C5DC 3QARA 2YKLH 4IBUA 2H1LM 4B50A 3V4PA 1N2RA 2FK9A 3NP4A 3QB7C 4FQLL 1F4WL 4FKKA 4KQ3H 3ZKMC 3O9WB 4WNQB 2YMOA 4J3OC 2VM9A 4D9QE 4M1DL 1DL7L 1BOGB 2VE6A 3Q5OA 3AXLB 1U58A 2R4RL 2ICES 4JRWA 1CZ8L 3DVGA 2GIYA 5LNGA 2GIXA 4GXUM 5JPNC 3EBGA 3TBSB 4NO0A 5J6HB 4TVPD 4K5NA 3QJZA 1IBGL 4X0KA 1BXAA 1VGKA 2WQRA 3IJEB 1EXGA 2OL3A 1AI1H 3TCTA 3MRGB 3V4PH 3OB0H 5JHAA 4R0LC 4G70B 1CYWA 3SE4A 1MCNA 3OXSB 4PJIB 1CBJA 4HT1L 2GBVA 1CDHA 1TEGA 4HGWB 3TT3H 4M3JA 5LVEA 3LZLA 2DLTA 2E6JA 4DSYA 5DLML 1OV8A 4H26A 2XWDA 5EOCH 1C7SA 2K45A 1CS6A 2ZJSL 3ZZ1A 3PNWB 5IQ7L 3K2KA 2DLGA 3Q6GH 4MNQA 4YFEA 4IBVA 3IDYB 4MJJA 3VXRB 4AX3A 4Z7VB 2FECL 3JTSB 3HBGA 4LLWA 4HC1A 1MWAA 5JW5A 1TZGL 4GUCA 2D3VA 1HC1A 1QO3A 5DMIL 1SLVA 1J5OL 5AW4B 3BGAA 4NO2B 2OZ4L 2YQ3A 1XAUA 3IMBA 2MH4A 2EEXA 1NUNB 1ZT7A 3JUZA 3W1ZA 3JYBA 3RU8H 3TURA 5C0IA 3PAZA 4BSVA 2ENYA 3LEYL 4XBMA 3CAFA 3U0TA 2WGXA 4NSKB 4UTBH 3W2DL 1UM4L 3BPLC 1RK7A 1QR1A 5CP7B 4G6ML 3QQ4B 3T09A 4YX2H 4GUPB 3H53A 2JI3A 4P9ML 3F85A 3RL1A 1MZYA 1DVFA 1OPOA 4KKBC 2DTSA 4XX1G 3B1UA 5F9OL 1JGEB 3UIZA 1OAXH 1KGYE 2EE3A 4TOYH 3PJNA 4D3CH 2JXMA 4FXKB 4FLHA 4RIRB 3ZSTA 1URZA 1Q9KA 2AJZA 4PR5A 1AANA 1I8IA 4QGTA 4KK6C 1OCOB 3O2DL 4NZRL 3RVUD 2R56H 1ZOXA 3TO4A 4CVUA 4NCC2 2NYYC 1U4FA 3UZVB 2Y1VA 4PPTA 1ZHNA 2MTPA 3O45B 4ETYA 2Q7YB 3VJ6B 3BGFC 5IUCA 1IKFL 3E80A 3MLSL 2I9TB 4NXKA 5LXGL 4JO3L 4KNSA 4EDWH 1RZGA 1MHEB 2RA1A 1ZMYA 4YBQD 2YAOA 2GBAA 4N0FB 4MA7L 2WWOA 1QSZA 3PP3K 5TK4A 4P57A 5J5EA 3G5WA 3UROR 1T1YB 2DI7A 5J0BA 2DQMA 3UTZB 3BKJH 1VEMA 3S35L 2EDHA 4IJTA 4RDBA 3V4UH 1JXGA 1YNTB 4Z7VF 1S7SA 2VZ3A 2MPAL 4O02H 1UA3A 5LDSA 3CSYA 4ZYKA 4Y4KB 4M93C 1TOXA 4S1DD 3V4PL 4M62H 3OKMA 2LLLA 3LVTA 2VXUH 1NANH 3M86A 1TJIL 1CIDA 4XPGH 2G60H 3FH5A 1IEBA 4PY8I 5A1AA 1ND0B 2MTAA 1WWAX 2IFGA 2ZKYA 4HXBH 4JLRA 5A6LA 1GYAA 4OU3A 3ESNA 5FM8A 4DP2X 1RVFH 2WJ7A 3PWLA 4MJ5B 1E5YA 2XPZA 5EORL 3ARFB 3HB3D 4XE5B 4OAWA 3GKZA 1WA2X 1BQHA 2IAND 2R7EB 4ZUTA 1CPUA 3A23A 1EWHA 1OXYA 2PUQT 3V4VL 3QULA 4ABUA 4X6FA 3NESA 1BIIA 5J13C 4FHJA 3GSOA 4FNPA 5HYSB 2BCKB 1I1AA 2HVBA 4ADIA 4TQEL 5F7YC 4F2MA 4MNQB 2IDFA 4WNSA 5LGKA 1KYDA 3RDTA 2VXQA 3GJFB 4OM0H 4L8DA 3MA9H 3ZDWA 3BO8A 4K94L 4FQHB 3H4FA 4R7DA 4UDUB 4PLNC 3ENEA 1UACL 4PB0H 4R5XA 5HYSG 5BQDA 2PR4H 4GXVL 3BQUA 4Q56A 3MCG1 5C9JB 3KMDA 5IB3A 4JHZA 3RZCB 5DVNA 2J88L 4CU7A 4YSUA 3FB6A 4CN6A 2DEYX 3UDWC 1R3LA 1BFSA 2DMBA 1LO2L 3OV6A 2Y6SD 4PJ5B 3QXTA 3S37H 3S5LB 1GH7A 3R19A 4PY7A 4E42A 2OZ4A 3PV6A 2IAMC 4XAKD 3VD2A 4X4ME 2ZPKL 3QS2A 3V52L 2X53A 1A7NH 3C5ZA 3ERXA 3IFLL 4HLZG 4IU2B 1P7QB 1V55B 2BIQA 3GMPB 4JKPL 1KC5L 5AD0B 4BE6A 3LRHA 4A6YL 3NSYA 1Y0LB 3QIUB 4HAGA 4NOFA 4POYA 4HWEH 3D69A 4OIAA 2VR3A 1AQHA 1D5XA 2F8XC 1KIPA 2Q0ZX 3ZHKA 1ORQB 4NQEB 3UJTL 2DBLL 2IH3B 4K5LA 3MC0A 2QQNH 1AGDA 5A43C 1BBDH 1JVKA 4GQRA 1X5YA 3DSNA 3HZKA 5HYQB 1P6FA 1G7MA 5HI3C 4FP8L 1HH6A 1UXSB 1V5JA 1ETJA 1WA1X 2R39A 3OC5A 3HZMB 1PL3A 5T3ZL 3PFQA 3ZZLA 3OQ3B 4ZMOA 2C26A 3NQIA 4KRPB 2OPCA 2ZONA 4F37K 3QDJA 3HB3C 3B2UD 3Q8AA 2XN2A 4JRYB 3IU4H 4U1HA 4V1DA 5I8KH 3CDZB 4JZOB 3J8F7 3DXAA 3TS8A 3G5YB 3BLPX 3I75A 4N1EA 2Z31A 3O0LA 2VRQA 4OJFL 2I07B 2EILB 2WINA 4QXWA 5B38B 2WNWA 4AQZA 2ALAA 2H47C 2NLJA 3BDXA 3PGFH 3T65B 3VXQB 1F13A 1TETH 4RISH 2APTA 4J3SA 2WAQA 3O41B 1NGWB 5FDWB 1G7QB 1V8HA 4I3RL 4QLWA 2XDHA 3D3VD 3WEXB 2WLNA 4DN4L 3Q5YA 5BPPA 3WD5L 1ANUA 1QA9B 3DK0A 1P5VA 1MFCH 4EXPX 1TZHA 3ARQA 3QVAA 3LRLA 4PJXE 4RNRA 3TPKA 3EF4A 5JW3L 2E3VA 3SE8L 3OPZH 5JW4R 4U1NA 5DJAA 1T21B 2IQAA 3X2QB 2MIZA 2ZUQC 5HHPA 3HI5H 1F45A 1QHQA 4L4VB 3LEVH 2NCEA 3AWGA 2B2XL 4OQ1A 3E8UL 2V17L 4RRPA 3BSZH 3WSQH 4ZPVB 1N5AB 4AQ8A 5EUKA 4ETQB 3WFEL 3ZE2E 1BYOA 1MH5A 1D9KA 5F7WC 1U8PB 1ETZA 1F4YH 2AP2A 3GXDA 3S5YA 3GEWB 4PMEA 1AQDB 4JJ5B 4JDZA 4WO4D 3MX0B 3UCQA 4XVTL 2X89D 4ZW5A 4P48A 5IG7B 1KJVB 4RX4D 1Y7VA 5FR3A 4QTIL 1H6FA 1HCFX 3UOAB 1HJBC 4RZKA 1I9JL 3AU1A 3VWJB 3VDCA 1A6AB 4KX7A 1I1YB 4WTZA 4F2MB 2NY0C 3P9LB 5CGYD 2DLIA 2YJLA 1G43A 3GSXB 4P5MB 1NGXA 3U83A 3G6AA 2Y2TA 5EUOB 4CADB 4LCUA 4PJCA 5D6CA 5DK2A 3FOMA 3DOSA 5JIMA 2CO4A 3GZOA 2J3SA 5GS0L 1IE5A 1ZJBA 1AZBA 1F4XL 5EO9B 2GT9A 4ZZFA 1V10A 3VX0A 1YHPA 3S96A 4Z7NE 3ULVE 3STZA 1T0NB 3IU3A 2K78A 3C6SA 2XA8L 3GS4A 5EOTB 2YA2A 2LLGA 3CXDH 3QPQC 2WXPA 3SGKA 3RQ3A 3TCLB 1LO3H 1TKWA 4MXQD 4YO0A 2Q7AA 4FYTA 4R3SA 5FPIA 1ZXKA 1I3UA 2F8VA 1DVUA 2VN3A 3WNIA 2C3VA 4GEIA 4BH8A 2XV3A 1JK9A 3FOLA 1QNIA 2BVPA 2AXGA 1KJ3L 1R19A 6FABH 3KAAA 4CC4A 3SY0A 1CG9A 2EIEA 1T1YA 2GI0A 4NC1E 2CO1A 5DJYA 2BSED 4JG5A 1NOLA 1P69B 1QMUA 2ADIA 2H6PA 2V7NA 1BVZA 3VFSB 2BOCA 3LNDA 5FKAB 5T1KB 4L23A 3V9FA 5LXVA 3MQIA 3D6GA 3MLRH 4PW4A 3BWAA 3C5SA 4L8BB 3ARGA 1Z9PA 4MCMA 35C8H 3KZ8A 1NCOA 4XCYA 1THCA 2N1KA 2VUOA 1JPGA 1UXWA 1YEDB 1X5LA 3BX7C 1UCBH 1RUKL 2WD0A 4Y5VB 2WSPA 1I4FB 3FT0A 5FYJE 25C8L 3MGTA 4KTEL 1XGYL 1GGCL 4NZDA 4JZNB 2W0FB 3KJ4B 4NO5B 5TQ0H 5L0QB 1AKJA 1D5MB 1WCQA 5F9JA 4IRJB 5B1AB 3QI9C 4TSCL 1KJ2A 4O4YL 3B9VA 1Z3GL 1KC5H 3P3UA 3HLAB 4DEUA 4L1DA 1S9XA 4H26B 1AQKH 4WNJA 1D7CA 3VRJA 5LUMA 3CVCA 3SPVB 1Z66A 2DL9A 5L4MA 1TVBB 3ULUC 2J1WA 1CLOH 4A55A 3QZNA 3VXPB 4DWHA 5IFJB 4IIQC 4KKRA 2PKDA 4X5WA 3WKNA 1WEJL 3AG2B 1OM9A 5FLUA 1G5GA 3GXTA 1D6VL 4P4KB 4AQ1A 4MVBC 2YGQA 4UNTA 5FS5A 3MLTA 4MD4B 5EO1A 3EXJA 5AWNL 3VD9A 1C08A 2OTUA 4G7VL 4HV8B 4RGNC 5DJ8B 3OTTA 1J12A 2AQ3A 2L7EA 4UNIA 5A2AA 4KHXL 4PW3A 1JZ5A 3QBTB 1FFQA 4H8VA 1RZ7L 1BAFH 1KCLA 1ZA3A 3GRWL 5AQ0A 1TDQA 4AIEA 2FYYA 4CSTA 5DD5H 3LQMA 3FNKA 2ZUTA 5HPMA 1KB3A 1QPKA 3IF1B 1ACYL 3ZDZF 1E6JH 2X9ZA 3UJJL 4BQCA 3DA0A 4M9PA 4I88A 3KD4A 3JTTB 3LH2L 1TZIA 1HT6A 4FNSA 1JMXA 1FVDB 5TH2B 1HH6B 4ELMB 3WTTA 2E7BA 3OPZL 4JCWA 5HP5A 4FULA 4P2QB 4WI2A 4XCFL 4XPHH 5E0FA 4O2CB 1MRFH 4ZYKB 2GI7A 4NT6A 4PB9H 4L4VA 1SJEB 3P9LA 4U4BA 3T6WA 5CAYB 2ICWJ 3BKYH 1S7XB 2BFVL 5CIPA 5FFOA 1Q0XL 2OMVB 2DBJA 4Q8BA 4L9LC 1ZS2A 4APQB 1KTBA 12E8L 2FZ3A 2ZCLL 2ILLA 3X13B 4IDJH 4TSBH 3O11B 5IHZA 2VJ8A 1FBIH 2GY5A 4EE2A 4BK5C 1CICA 4X9YA 2VN6A 2Z34A 2X9XA 3GLEA 5IEHA 3CN1A 1P6WA 5DUBB 3DVNA 3DOSB 4YFLI 2AJXH 3VI4F 5DGRA 4P3CL 1OAUL 4DUVA 1VZIA 5F96H 1EHLH 1SLUA 5JW4M 2CXGA 1ICTA 3QZBA 4WU5B 1GMIA 4LPUA 4KO5A 5C09D 4EZLA 1OK8A 4RFEA 3RFZA 2VRKA 1JMZA 1TLMA 4PRPB 4AV0A 4FN0A 2JCWA 2C4XA 2Y5TB 4AQ8C 3C2SA 4Z3JA 4MYPA 1M2VA 1YNTF 2NY5L 2GK0A 4JRLA 4AXWB 3GSWB 2EXWC 1CFTA 4M7LH 2AK4B 2AJVH 1VZHA 2CDGB 4Y19A 4B9CA 1JNLH 1F3JB 2HUEA 4EZJA 2BINA 4U6HA 4Y2DD 4PTUB 4PJ6A 4I89A 1ZLDA 2YQBA 2R7EA 2JJSA 1G1YA 3LSOA 2ZUYA 2QR0B 3PS6A 2IJ0C 3AY4C 4UV7H 1U2CA 1I8UA 2JELH 2HWZH 3B6SA 1N6QH 4LVEA 4FQQB 3U9PH 1E8ZA 5CR8A 3ARBD 3QH3B 1GIGH 3KL0A 5DWUL 5FV1L 4K94C 1NMCC 3WUWA 3CDZA 5CFAA 1MF2L 4OLVL 2ADIB 2V7NB 1Z32X 4TL5A 3PHQA 1K8DB 3X14A 4M5SA 3PL6A 2EC9U 5JXEA 5FUOL 4F80A 4LIQE 1CU4H 2CCVA 4M43L 4HIHB 6PAZA 5D1XD 2V2TB 1PIFA 1YMMA 1RU9L 3ZDYF 2WN3A 3GHEH 3OKEB 3QPXH 4EUPB 1PZ2A 3BVVA 1J0KA 3NEXA 2F5AH 4BZ1H 3CXHJ 2AMUA 2VKWA 1BAGA 1CLVA 1U30A 3HA0A 2OK0L 2WQAA 5LBVA 1IJ9A 5LBSL 1UWXH 3MV9E 5IB1A 1J8KA 2B2XH 2Y4SA 4R7NA 4JG0L 4NC1C 3VAEA 3HMXH 5CZXD 4E9YA 3O6MH 3ARFD 4P2RB 2LU3A 3K1KC 3EO0A 4NQED 5KYNA 1ETA1 4X5QA 1FQ9C 4UUJA 3T3PE 3AT0A 4PJ7B 5DVPA 1RVFL 3E1F1 2Z7WA 3D33A 3LB6C 3RVTD 1ES0A 1X7TA 2WXMA 1N7MH 2EUWA 1A7BA 2XQYG 3W9EA 4XO3A 5H35B 5KANI 4ERSL 3UTTD 3C9NA 1AGDB 1PZ3A 5D1XC 3UX9B 3IDNA 5DMYA 1HQRB 2CHXA 2HTKC 1IEAA 1QFWL 1XIWC 3DNKA 5CJOH 4D0CA 4HPYL 1CT8A 1I31A 2J55A 1FIGH 1GYVA 3IMUA 2Y36L 3N42B 4K3HA 1MLCB 3ZL2A 1N0XH 2EADA 5KYUB 4UQAA 1Y07A 4OCRL 4YHOH 3SD2A 2E8ZA 3FB5A 1T22A 3ARGC 2LAAA 3FUNA 3QWRA 1WAPA 5GS2H 4JCMA 4PJ8C 2OXHB 5T3ZH 2ITDB 3BZEB 1FL5B 4U3SB 2BHYA 3DXAD 2WIMA 4BGDA 4WI3A 1QI5A 5C07D 2D0FA 1T04B 3SJVE 1T4KB 4S1QL 1JZ2A 3GD1C 4ELME 5AZEH 3K8MA 4FTVA 4X7SH 4Z5RA 1KCWA 3JV5A 4NQSA 3BPNB 3FQRB 4XZ4A 2P8PB 3EDFA 1KGUA 1LK3H 2WB1A 5JA9A 2GT9B 3MRHA 5E1HB 4Y5XB 4K55A 4K7PY 2PCPA 3IJ7A 2E8YA 3IFLH 4WF7A 1LWJA 3EKCA 2FUTA 1COBA 1RURH 3V4VA 5D93C 5TTRA 1X6NA 3ZZQA 3VNYA 3B3IA 3VQMA 3TA3B 5CBEA 3D51A 3UH8A 5EN2A 5IJDC 2P24A 1YY8A 2Y22A 4JFZL 3HTLX 4AG4L 4YZFF 3LQAC 1J5CA 4FG6C 1BYNA 3CVHH 4F2EA 4L8SC 2NXYC 3DV4A 3G9AB 2AVGA 1R17A 2BVYA 2F58L 4QF1B 1JZGA 3ABGA 2JIXD 3BOVA 5FYKH 3ZGIA 1HEHC 4LHUB 5DZ9A 2CJ3A 1IKFH 1U3HB 2CIKA 2VXQH 4G6KL 3UGEA 1HIMH 1ZT4B 4JO2L 1IVTA 1IAIL 2EDKA 2FEEL 4R97B 3DRTB 5FGBC 4XTRC 2NY3C 4BXSV 3ULVL 2AQPA 4KU1A 4WDIB 4ENZA 5KYXA 3DROA 1LEKB 5B8CC 3CFDB 4U2YA 3OZ9L 4QJ5B 3CVIH 1E4KA 2FEJA 3N9GH 1OQXA 2WZAA 4HCFA 2WLZA 2CBMA 4UTAA 3T2OA 2PCFA 1IGTA 3FQ2A 5CU5A 4HQQL 1P2CA 1UQSB 4NO3B 5GGSY 5T1LD 4GO6B 4HAFA 1NC4B 1S7QA 5L6YH 2A6JB 3FTXA 1ZGLM 4OM1H 1IBBA 2GK0B 5EOQL 3SGJA 3L9RB 2XN0A 2G60L 5KN5B 4NFDA 4NKMB 1N9PA 1NFIA 3DGGB 5DHYB 43CAA 1Z0NA 3DLQR 5DDHB 3ES6B 4NX0A 4PV8B 1NCWH 2QKIA 3NCYP 4N8VA 4G80B 5K39B 3UZQB 35C8L 2VC2B 3BHBB 4FYSA 2ZKHL 4MVBD 1SXNA 2VMEA 4N1HB 1OAQL 1FYTE 2FNWA 5E2VH 4UQ3B 5DMKB 3S3DB 2C7UA 1XCQA 3KPSA 4Y1AB 1KTLA 5DZOA 5H2BA 5HHNA 3TIDB 1MY5A 2VLLB 4ZAKD 3CQPA 4X7TA 3IVKA 5IVXB 2H2SC 3FB5B 1T1WB 5CN3A 1U2YA 1OT2A 5CEYA 1INDL 3QUGA 4NZTH 1B0GA 4CNIB 4PJBA 4CVWA 1R3IH 4GMTL 3ESPA 3VXRD 1KELH 3K6DA 4PJ9B 3QCUH 1DQVA 3DGDA 1MFDL 3BWSA 4WNQA 4ACTA 1ZHLB 4NUPA 3GPEA 3KLAB 4ZUWB 4FTVB 2CGZA 3VUAA 4MAYA 2UY7B 3M88A 3D0LB 4AEFA 5AYTA 1WC7B 2CR6A 1IGCL 3L3HA 5FEBA 2H41A 2ZICA 3EOAB 4JFED 5C0BE 5I76A 3VA6A 1DSWA 3HE7D 5FX3A 1S3RA 3NIDB 3IB4A 1TVHA 4ALAL 1MWAH 2B7DT 1G9NL 1F56A 1XF1A 3L1OL 3SKOB 2WXKA 3BZ4B 2IV8A 2B9BA 2NNAB 4GAFB 2EYRA 3BW9B 2P5WE 3QFDB 4ZUSB 1QD0A 3P54A 2VM3A 3QIUC 4JDTL 43C9A 3QEQA 3ULVH 3APDA 3CLWA 4CJ0A 1D9KC 3EG9B 4G59C 4OQTL 4LNRA 3GWJA 5M7QA 4H5SB 4P2OB 1NLDH 4Z18A 1G7IA 1T6WA 1VLXA 1EZLA 4ZMAT 2QL1A 1CI3M 2L04A 1T1ZB 4A68A 2WQXA 4UANA 1PKQA 4L3CB 2JFCA 2CIKB 2GYSA 3WJJC 4GSXA 1DUZA 4JFYA 4F91B 1U21A 2W9LA 5AOKA 2IVFC 1CFQB 2B59B 3PY9A 4WDIA 5FYJD 3TWCH 4YSEA 3APNA 5ACZA 3NA4A 2VDRL 1MDAA 4Z9KB 1OY3B 4BA8A 5D1ZI 4BQ9A 2WK2A 1T04A 2DM4A 3S3BB 5GGVH 5EN2B 2R69L 4E5XA 3OLGA 5KSUA 5DS1A 1IC5H 5J6GA 1E9PA 2W8CA 1F4WH 2FEEI 4NO3A 3ZKND 4E9XA 1RXLA 3DV4B 5IY5B 2A6KB 3JVGA 5HDRA 3ABZA 3TV8A 1BVLA 4R26H 1RMFL 4DFIA 1R47A 3ZTNH 1KB9K 1KDJA 1OALA 2YS4A 2OSYA 3R18A 4FQQA 3GS0A 4NZRH 4XBPA 2WQUA 1CF8H 1W8EA 3SDAD 4KRLB 1E40A 3NFPB 4PJ5D 1D5BA 1HSBB 1MHEA 1SYVA 2AI0H 3GYRA 1IBGH 3GXUB 3T8XA 3GTVA 4DPCX 4IKJA 1T0PB 4QJ3B 1AR1C 3QIWC 4G6FD 2C34A 3US1A 3GSWA 1WFTA 4X8JA 2XI9A 3ZO0A 2UXFA 1A22B 5E6ID 2R2HB 8CGTA 2AJYH 2DD8L 2F54E 2ERJB 3IGAA 4PSRA 5CUSL 3ZL4H 5CJ5A 3S3CB 3RZWA 3WO4B 5IM7B 4PJHA 2EUXA 1BBDL 4QHMB 1WZAA 2VR7A 2MHAA 4GS7C 4H1LH 1PLAA 4NDMB 5HYJB 2YSTA 2CRIA 2EDLA 3QNFA 4PG2A 4X4MA 4E9VA 5IBLC 3U0PA 3F12A 3KCWA 1F86A 1IAOA 2YWZA 3NRPA 1CBVH 5BXFB 5FF6B 4X80H 3RGHA 1FYTB 2OJ1A 4N2LA 4FQXA 1A4JA 4A7GF 4AIZB 5JHLL 4RAVB 4JBSA 5HYIA 2H2SD 4YSOA 4G6AD 5GGTA 4LL9A 4POZC 3SGEH 3AGVA 2UYLB 1CE1H 3DURA 1AG6A 2X05A 2VLRD 2FJHB 3Q2NA 3BAEH 1P1VA 3X13A 4I2XE 1MG3C 3BGFB 1PY9A 1SEBB 4XP9H 5E51A 3C9NB 2O5XH 2DS4A 3NJNA 4WW2A 1K4DB 5L7XH 1AO7A 2X4QB 3MUY1 5DYFA 4AM0B 1ZV2A 2MQ0A 3FQXA 3TYGH 4MTMA 4CW1B 1UUSA 3C5JA 2FGZA 4A38A 4G9FB 5HGHA 1TCRA 3RVWD 2YXVA 4IOIB 4NWUL 2DY2A 4NNYA 5DRWB 1MLBB 3DXAE 3RWGB 4AEIH 4AKOA 2VM4A 5ADPL 3TIDA 2YBGA 4W9EC 4NQCA 1WF5A 4ZFGH 1GYCA 4KMTH 5GGTH 4IM8A 4JM2B 3C87A 4OCXH 4KXBA 5C0RL 1ETB1 5DMKA 1IGFH 2UY7A 4F7PB 1Y18B 5AYQA 4WWPA 3REVB 5LQBL 4ZNEE 1N18A 1FH5H 4LSSH 1JVOA 3B8SA 1M05B 4KTDH 3L13A 5FB8A 1PEZA 4UV4L 4M7KL 3H9SE 3T0WA 1J8HE 3FHEA 4L4TE 5AVSB 5C0BD 1BEYH 3FHAA 3LSOB 5E9DE 1DZBA 2NSMA 3BUBA 3J7HA 2VDOB 1TTBA 2P5WB 2N3JA 2FTAA 1QFWM 5F7AA 5AYUH 1GZHC 2J5LC 1G6RB 2CM6A 3ECVA 4MCYB 1YRKA 2YBRA 4GKSB 1ERNA 1F6AA 3QK0A 3OKDA 3GINA 3GM0A 5CINH 3DYPA 4PRBA 2ZAHA 4GMSL 4L5FH 3S48A 4NQDA 3MREB 1VACA 2XXFA 3GIZH 1I8KB 3ZBMA 3OLDA 4J3XA 5DMJB 2ZXQA 3W9DA 1GIGL 5DWUH 4FXLA 1IBYA 4AL8H 1PYWB 2BWDA 2G3ZA 3FB7B 1E5CA 5LNEA 3WTYA 3RWDA 5GGRA 4ZW8A 4DP6X 1ZE3C 2G2NA 2W95A 3HUJF 4D8PB 4EIBA 1T03H 3U46A 2E86A 3T4YA 2ZTBA 4FF9A 4M5YL 5T5NF 2H26B 3BT2L 5D2NB 5ISZE 1H6TA 5K59E 2DIAA 2G9HA 1XL4A 3IMWA 4WSGA 5GJTL 1AOZA 3EYSH 4J3OH 5L4JA 4UQ2B 2F9BT 1QG3A 4KKNA 4B9PA 4PJGF 1CXIA 2J72A 4FHKA 4AL8L 4BK5A 4FFZH 1BZ7A 3OG4B 1QQDA 1N4XH 4ZPTA 4GKNB 2EYSA 3IGUA 2ZSWA 3FBKA 3VGDA 2A4ZA 4HIEB 3L3OB 1KN2L 3F5WA 4BE5A 1ZT4A 3GBMH 1GS7A 3GKWH 2VLKE 5F88B 5HYJA 3SKUD 3FQWA 5KSBA 1SPDA 1BMZA 2DQGL 3CFCL 4JB9L 3S37X 4A1RA 1IGJB 1SXCA 3K2MC 3ZW3A 3QUYA 2DJUA 5SWQA 3VWKA 1CQKA 4KJPD 4Y0GA 3ARDD 3L3JB 4HOZA 1ETZB 4ZDHB 1ET7A 1IQWH 3WS3B 3NP3A 4L1TA 1ZA6A 4HFUH 4OGXL 1IMHC 1M53A 4CADA 4ISVB 4ONFL 1HQ4B 2A9NL 1FVEB 1PQZB 5HHXL 4Z77B 1SF3A 2PP7A 2XV2A 5KOMC 3EYQC 4LSSL 1W15A 4FXKC 3UCRA 2DMHA 4LVOC 2V9UA 1PDKA 4GS7B 3LKPA 2R2HA 4IGBC 4ZMVA 2BRQA 2IBZY 4L0YA 3EYOB 3M17B 5I16B 2BCKA 3QJXA 2XTSA 2DJ4A 1JN6A 2QTVA 5E5LA 1MI5D 3PL6C 4FJYA 4EQ2A 5IW6B 1A6TB 4GYBA 1AQKL 1H0DB 1TSHA 3H9HB 2AV1A 1ZRUA 1U8MA 2AJYL 5C09B 3JWDL 3PV7A 1D5RA 2HZHA 1GCYA 5IMKA 3DWTA 4PRPD 4YZWA 4BSJA 3LS4H 2JKTM 2R4SH 1MFUA 4ZPVA 1PZSA 1CO1A 1N3NA 2HT2C 4L3EB 4HCRH 1RIVH 4Q9QL 1J88A 1V7NL 3BLKA 5I1CH 3E8UH 4YDMA 1WZLA 1MHCA 3TWYA 3U9WA 4MZRA 2VNCA 5DK0A 4EF3A 4UQIM 4BH7A 4L3AA 2MNWA 2YHGA 4GRLD 4IKLA 5D2LF 3RGBA 2PP9A 4DT2A 4KUCD 1DANT 3ZKXC 5DR5H 2P48B 1JK9B 3FRPB 1LEGB 1GZPB 3B9KB 3Q8BA 4OY9A 5J8OA 2R2CA 3B5TA 1X3DA 4DN4H 1FV1A 4R4BB 3RWEB 3SKJL 1PCXA 4ZMTA 3SE3C 1NCWL 3KPQB 4KY1L 3EJYD 5AOLA 3AG1B 3OKLA 4PD4J 3VXNA 3BVTA 1ITBB 1BQLL 2GTQA 2WVVA 5FB8B 2X88A 4XWOD 3PE9A 4BGLA 2CALA 3CTTA 3IDMB 3DRQA 1W6WA 4KGLA 1DDTA 4PJIE 4TF4A 1FZKA 2CGRH 4PJGA 2P5WA 5K93A 4IMLB 3VX1A 4AZ8A 3QAQA 4XC3L 3KWXA 3RUGE 4AJVA 5IBTL 4IHBA 5C0RH 3ZYOA 5ICZB 3WV0A 1WRFA 2HKFH 4U1GB 1QBBA 3IETB 4HKZB 3BRDA 5I1JH 1OAYH 1IIIA 2V5RA 4H8UA 2WWMC 3FCUB 4FQHA 2BRRH 1LE9B 1HYSC 5IB2B 2HG0A 2D7TL 4FZEH 4AIOA 4JE4B 3KM2A 1HL8A 2LQRA 3UBXA 1YPZB 1PPIA 5C0CB 2Y7MA 4CAGA 1NIAA 3DIFB 4PBDA 4OCMC 3NIDE 4XCNA 2E4FA 4JL1A 3ML8A 3V0WH 1DCEA 2VZUA 4DP8X 1T66C 1XF4B 4BK8A 2W88A 3ZE1F 3IPEA 4HIQA 4ANXA 1J1XH 4PWGA 3LMJH 3TF4A 3GSVA 4QRPE 1YYCA 1N59A 4LEEA 5CD3B 1SYVB 3E9TA 2GIMA 5HYQA 2YA0A 5I1HH 2R2BB 3BIBX 4J8RB 4JFDD 3FN3A 1F8TL 3PGCA 1DBAH 2BNQA 4PRIE 1RUAH 4YN3A 2DIEA 1P4LB 5B1BB 2XWEA 5F21B 5IGXL 2IH1B 3ZT5A 5HVFB 3FUKA 1RZ8A 5K9QI 1P7QA 3L3IB 3AT9A 1BF8A 3ORJA 4MA3B 4MRBA 3HPJB 4HH9A 3NCBB 4U1MA 3BAYA 2R4SL 2PYFB 3CFBB 3NQKA 1U6AH 1UM5H 4ODXA 4EOWL 1J0IA 3MRMA 2VDLB 3D34A 3O41A 1NGQL 5E4EB 2DQEL 4RFNB 3VXSE 2JELL 5FF6A 1EHKB 5KJ4A 4QKXB 4UILH 5D2NA 2OSLB 4ZFQA 2I07A 5JYLA 4HKJA 4LMQI 4NI3A 1HZLA 2K9UA 1RL1A 3Q43A 2GC4C 4JFHE 5C0AA 3CV5A 4YGVB 3DX8B 1QR4A 3UXFA 3VMPA 4YGAB 4WUKL 5AAMA 1NCCH 2Y24A 4MMXA 5K1VA 2X6AA 3JVFC 3QG7H 5I8OH 5GS1B 4HIEA 1KJVA 1P5VB 3RDTD 3TA3D 2CO6B 4UIKH 1U8OB 2P7TA 1XB6A 3HNVL 3OHXA 3BPOB 2WXGA 2B8OT 1W9XA 3LD8B 4BCZA 1TNNA 5TE6L 5KSBE 4PJAA 4TNWK 3SEPA 3FQYA 4I1RA 3R06B 1W91A 2FO8A 3BP7A 3GSNL 3HC4H 3KLLA 4LLDA 2P8LB 4S1DC 4ILDA 2EUZA 4WJ5A 1N5AA 1NIBA 5IBTH 5IG7A 1QFOA 1OF0A 1A4CA 3VXTB 3GUTA 3RUGF 1NAMB 4HKXA 4A7GA 1HILA 2CRMA 4LPXA 2AZAA 4Z7QF 3F7PC 3QCTL 1YY9D 2V7HB 2OCCB 1KENL 2GW5A 3KNBB 4L1LA 3UAFA 1WA0X 3OB8A 5FXCH 5D1ZD 5TE6H 5GGSA 4WWKA 3P30H 2ZSWB 4TM9A 5EUKB 5D7IB 4U49A 1E30A 1PD1A 2ARJA 4FMKA 5J1AA 4ZMPA 1TQCB 4MZ3A 1HCZA 1KPVB 1FI8C 2EXSA 4MA8L 3RVXC 3B7YA 3L7FB 4HJSA 5DGQA 4LEXL 4XI5D 5JOPE 1PLGH 4UM9B 1RERA 4HA1A 1MI5A 3ECBA 4I5BB 1HEZA 3BH9B 3E6HA 1R5IB 1VEPA 1VADB 1Z3RA 3EO1B 2YUZA 1CXKA 1M7DB 4LLQB 2Q76A 1TQBB 5GGUB 4MAYC 3WN5B 4Y5VA 4ZTOL 1DQIA 4G9FD 1U0QA 3UTPD 2YC1A 4F8QA 3DHJA 2FWSA 5I19H 4CGUB 4DVRL 3MRLA 4NQCD 2G4EA 3KWTA 4U0RB 5T1KD 2E56A 3LTVA 4QXGL 4XPFH 4DZ8B 3PCYA 5DD1H 3W82A 3DTUB 4LE8A 5IMMA 3K80A 5D9SB 4RA3A 2X4NA 2BZCA 4C4BA 2PYEE 4X7EC 4YBHA 2HAZA 2NQDA 4UIMB 3I6LE 3DKHA 5IVXE 4E0RB 3RI5F 3D2UB 3QI9B 3QNYA 1ZLWK 5IVZB 1SMDA 2WXQA 2PPAA 4JM2A 4ZXBA 4RAVA 2J8OA 2WXRA 2A77H 3LS5H 2H0PA 4N0UE 2BSCA 3VG0L 3FFDA 1ODUA 1CXLA 5ALCH 1ZANH 3NJIA 2APFA 2FWOB 2VUKA 3RNQB 1P9MC 3KYAA 3FO2B 4DP1X 4NRYA 4I0CC 2QFRA 1P1ZB 1GCFA 3I6GA 3L7EA 3WJMA 1B4JH 1IFHH 3OBAA 3REWB 2JJUA 4KGJA 4OGAD 1YY9C 1RD6A 1KLGA 3B2VL 2HPTA 1UZ6E 4XRCB 4IOFC 2J1ZA 1CURA 4TSCH 1XIWB 3VB8A 3BP4A 4F8LA 5HTSA 4F1SA 3EH2A 5FHBL 4D0DA 2Y7QB 1J8HD 4L4TD 2IF7A 3C60B 3FB8A 1NFDB 4XGZA 4DPAX 4HWZB 3CQFA 1IAIM 4OM0L 5HGDB 5BRPA 1UWXK 1LNUB 5HHOD 1BPLB 1XO8A 1HQ4A 1FN4A