2KLRA

Solid-state nmr structure of the alpha-crystallin domain in alphab-crystallin oligomers
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
82
structure length
82
Chain Sequence
RLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Alpha-crystallin B chain
publication title Solid-state NMR and SAXS studies provide a structural basis for the activation of alphaB-crystallin oligomers.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
A PF00525 Crystallin Alpha crystallin A chain, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2klrA00
4MJHA 2N0KA 4FEIA 3N3EA 2BOLA 3L1EA 1SHSA 1WFIA 3GLAA 3QORC 2JKIS 2K8QA 1WH0A 4RZKA 2RH0A 4PCKA 4YDZA 2CR0A 2XCMC 3AABA 3IGFA 3L1GA 1EJFA 3Q9QA 3QORB 3J07A 2WJ5A 4M5TA 1WGVA 2MNWA 2Y1ZA 3QORD 4ELDA 3AACA 5DS2A 3VQLA 3GT6A 5DS1A 2WJ7A 2KLRA 2CG9X 2KMWA 4JUTA 4YE0A 5LUMA 3EUDA 1RL1A 2Y1YA 1GMEA 3VQMA 4JUSA 4YLBA 3L1FA 1X5MA 4PBDA 2N3JA 4YL9A 3W1ZA 4I88A 4YLCA 2Y22A 3GUFA 3QORA 4ZJ9A 3Q9PA 2O30A 4M5SA
chains in the Genus database with same CATH superfamily
3G6DL 4PJDB 4PLKC 3KPRA 4TMPA 3ZLQC 5KTEL 5JQHC 1LO3L 3EJPA 4FX5A 2XV6B 4AQEB 1KBPA 1LEIA 5EU4A 1MWAH 2NT0A 3EXLA 1KCVH 2XVBA 3DROA 2APWA 1NGYB 3LEYH 5D6CB 5ADOL 3FCSA 3TN0A 1DQQA 3W3BA 1C12B 1GHFL 1BOYA 2KZBA 4XMKH 3GLZA 4OF6A 4DQOH 4XNZC 5EOCH 1AD9B 2BDNL 5C6TL 4F9PA 1T80A 3ISRA 1N7MH 5K39B 1MCOL 5F1SA 2XC8A 1WFTA 5TQ0L 3TWCH 3QI9A 5MENA 4M93C 3IDUA 3GTTA 1UD6A 3HZMB 5G5DA 3SCMA 3DXAB 3EFDL 3JWDL 1MJJA 1LD9A 3KVQA 4R3SB 2O61A 4NRYB 1QSVA 5AYUL 1E7VA 5D2LF 1QKZL 2BS71 3FQ1A 2OXHB 3CH1B 3P4MA 2XFXA 2UZYA 4DUXA 5I1LB 4DEUA 5J12B 2PPEA 2IH1B 3MJ8A 2CE6A 4GQ9L 1S7SA 3V9FA 1O6SB 3QZOA 5EG6C 4EEEA 3QNXA 5AOMA 4KV5F 2VDKH 4AX3A 2B2XL 4KI5E 3QCUH 4XX1G 1TMCB 1J8HE 5HDWA 3UZVA 1D6EA 3EOBA 3FB8B 3S98A 1Y18A 3WTWA 4QRRE 2BOCB 4UU9A 4XHJD 1UCBL 2J2ZB 2A6JB 1RUQH 3MVSA 1INQA 3CLEL 2VITB 3BHBA 2FX8H 1HIMH 1BVLB 4LL9A 5E8PB 5TE7H 2UV3A 4XC1H 1GOGA 1JNHA 3FF8A 1JZFA 3PP4H 1AS8A 2FBRA 4K71B 4KUCD 3STLB 8CGTA 3ARSA 4JKPL 4DFHA 2IH9A 1EDHA 1XXFC 5GZOD 2LU5A 3ROOA 2XPGB 5LBGA 3L6FA 2WO4A 5ALCH 4RFOL 4LLQB 1UZGA 1HQ4B 2HRPL 2Q7NA 3HS9A 4YPGA 4IHOA 4JFPB 2WOYA 2MMXA 1G0YR 4W9HC 4ZS7L 4Z18A 1ZLUK 3MHZA 4NPJA 3WNJA 1V7ML 4Q6YA 3SE4C 4GG6F 4B9CA 2R2BA 1SUHA 1YDPB 3H42H 4M1DH 3C5SA 2A1WL 4L1LA 1TQCB 3HRPA 4GFTB 5D2NA 5J6SA 3Q5TA 2PWDA 2QGDA 4XMXA 4B3EA 3KMDA 4NJAL 2ZOLB 1EHXA 3P4OA 1M42A 4DO6A 3CFBB 4LLMA 3REWA 1MHHA 5D7LA 2FRGP 3VDCA 3I84A 4P4KC 3O8XB 1MJ8H 5GGRY 2YKKA 1IKFL 4JE4B 1G7LA 5H35B 3QXVA 3MRLA 3K72B 3ABKB 4LHUB 4JFHE 4GBXA 1HL4A 3NPSB 5HVFB 3CFEB 3OAWA 4H5SA 2DL9A 4YE4L 2AXGB 4JRXB 5EEVA 2O4EA 3KR3H 4U6VH 3LH9A 1NBYB 5F9AC 1GSKA 2OMVB 3G5XA 3MJGX 2YD5A 1IGCH 3MV9D 2R23A 4HAFA 4JY5H 4TVPL 4Z7QB 4JJ5B 1KNOB 1OPGL 3G6JF 3AQZA 2DQJL 3A6BH 5LBSA 3G5VA 4DW2H 2B1OA 3WNPA 5JHMA 4HUUA 1NPNA 2A99A 3EDKA 1LEGA 2XA8L 4BHUA 1BPLB 1UM5H 1S7QA 1WPCA 3NJNA 3VU2A 4RFEA 5IQ9A 4OQTL 1NEUA 4YS4A 2J20A 3QZPA 4KAQL 3S4SA 5FO8A 2C7UA 3WG7B 1U92B 4G7VL 4PJXB 3KPSE 3L95B 4PJ7A 1DUZA 2FX9L 3NCEB 2VERA 3BVNB 2WB1A 4Q74A 5EV7A 3WKQA 3D5OF 3IJSA 4GAJH 1SQMA 1MCLA 1NCDL 3T6WA 3I85A 4QRTA 4L9LB 2Y9RT 3V5KB 3CX5J 3TVMA 2DDQH 4P4RA 1S5IH 2WP3T 3SBWC 1I31A 3TCLB 1JPSL 4XB8A 1DVZA 5B7EA 4OI7A 3BPCA 3WJMA 4AZ8A 4LQ1A 5LBVA 4QJ5B 4PCYA 5CZVL 3MNWA 1TUPA 2BRRL 2V7NA 2XPZA 4FNLH 2WZ5A 4RGNE 2CU9A 3OKDA 2DM2A 3KYOB 3RNKA 2PCPA 4UTCA 5FYJE 1J5OH 1BX2B 4KU1A 4R96A 2B0SH 3B9DA 6PCYA 1TDQA 1S8DB 3KPRE 3JWOC 5AVZB 3DX7A 4WEEA 5HYJA 1ZXQA 5E4EB 4ENED 1Z5HA 2BXZA 2ITDB 4HC1L 5D1ZA 3V55A 1KXHA 1EH9A 1KN4L 2WINA 1C08B 1R33A 5FGBC 2CO7B 1IGYA 3D18A 2ARJB 4J2QA 2EDHA 4ONHA 5I5IA 3F7QA 3JZ7A 3S34L 5D96C 5E95B 3UC0H 2VMFA 5HJGA 2QHRL 2Y6SC 3MREB 1T89C 1UHVA 2GTZB 1H3XA 1NAMA 1NLDL 3GHBL 4XBEL 2VR8A 2WOBA 2BRQA 5I0XA 5CSGA 4OBRA 1W6LA 2JV6A 3RY5A 2D7QA 4XZUB 4I2XB 1S7UA 4S1DD 1TXKA 5J57B 2BVOB 5CSBA 4HIHA 3RI5F 1M2VA 5CLWA 4JGJA 2P80D 2RH0A 1HSBB 1CURA 4QLRA 3UFIA 1A6UL 3QUZC 5I1DA 2VZVA 1I8KB 4KK8C 1K4DB 4HUXB 3MX0A 2NY5C 5CP7A 3O6LL 4OD1H 2PW2B 3MYZA 5FYJH 4L5FE 3QVAA 3CBRA 4LDLB 4P48A 1PLCA 4WTZG 2N0MA 4AYMC 2NR6D 4CN1A 3UBXI 3VXOA 2F74B 4OVVA 3KCPB 2IMNA 3JVGC 2V8MA 3UZEA 4KHTL 4YHZL 1SDDB 2GITB 3DI3B 4HG4K 3PHQB 3K5RA 3ULVF 1ZWIA 4LOEA 3UCQA 2B08A 5TH2A 2IDUA 3BP6A 5CF3A 4K9EL 2L7JA 4JKLA 5FS5A 3EJSA 3CLFH 5B39B 4U7SA 1FYHB 1M7IB 2BSED 4GUPA 3AAZA 3KDMB 1PU0A 4AXWB 1EXHA 5GIRB 3FOLB 1QRND 3HE6B 3DOHA 3U48A 2FL5B 2X41A 3MLWH 3OR6B 2VKXA 2CO3A 3RL2A 3HKZA 5HI3D 4XWGH 1MXGA 5ACMA 2VLRB 5HGGS 5CHNB 1IEHA 2F2HA 3LPGA 1TQTA 3HI5H 5E70A 5HYSB 3LNHA 1U93B 5EPMA 1ZPLA 3BEWB 5A2CA 2YAEA 5BZZA 4JNXA 1FL3B 4G8GD 1N18A 3GMQA 4J3VA 1HAUA 5E4AA 4K7PX 1CXFA 1KB5B 3D25B 3J8F7 4MRBA 4RAVB 2OK0H 3CBKB 1HHGB 3P3UA 4OF5A 5F7UA 5CJ5A 3UADA 2VAJA 1UWGL 5HDRA 4KKBC 4XN1A 1INEH 3TFKC 5KYWB 5DXWA 4PBDA 3RKDD 3QIUA 4NLAA 3WMQA 5DSCA 5HHNB 4PJ5E 3KYNB 3GSNB 1P2CA 4TQEH 2BNQE 3OJDA 1MQ8A 1G7PA 1SHSA 2YBRB 3DBSA 3LN4A 3POHA 4P23A 3MRCB 1HHIB 3W5NA 4JFSA 3P9WB 2UZIH 4X98B 3LQAL 5I6MA 4RMQA 5LCVL 1RH8A 1JRHL 4FULA 4M5TA 1MHCA 4CC0A 1HI6B 4YNYB 1AOZA 5FK9A 5HHMD 2YGOA 5GJTH 4LLDA 2AXWA 3I2CH 3C08H 3SKOB 4N5EC 3GSRB 3H4FA 3L3JA 4L3CB 4URTB 2X9YA 4N8VG 1I7ZA 4U1HB 5EO1A 4PJ7E 4XO3A 3X1EA 2ZOTA 2NY3D 4OLXH 4G8AC 3IU4L 4P9HH 4X8CA 5AD0B 2CKBH 1OZUA 3AY2A 4U4BA 5C7XL 2F53D 3CVIH 3JXAA 2AEPH 4YGVB 4HKZA 2ZYHA 5HYIA 1BW8A 1K85A 4B41A 4L3EE 3EHBB 4F5CA 1PBYA 1LEKB 2ZUQC 1BD2D 5I74B 3MLUH 4JZJA 3EYQD 2XWJB 4XHJC 1TJGH 3NACH 5L2KD 3BUBA 4H88L 4JRLA 4OGXL 2X4TB 2DMGA 4ZUUB 4IS6B 2ENYA 3X1NA 2D4DA 2J12B 1XSIA 1R3IH 5IMMA 5ABDE 4P49A 2L04A 3GINA 1KGYE 3IDGB 4A6YH 5C0AA 3IFOA 5DUMH 4G8EA 3CC1A 1JCVA 3AS0A 3I75B 5EU3A 4LBAA 3TEUA 2B16A 1PZCA 3QE5A 1TVHA 4JHWL 4LPUA 4NN5B 1T2QL 4XP5L 3R19A 3UC2A 5GZOC 3EOYG 2YXWA 1QSFE 3VCLA 3L1OL 3FT1A 4QKXB 5J1AA 1PTZA 1P7QA 1PY9A 1MDAA 3VU1A 1EZLA 4HEPA 2PW1A 2QDWA 4D2NA 1P5UC 1JMXA 3B3BA 4JAMA 1Y6MR 4IGBB 5DZOA 3WEBA 2CBMA 1G4RA 4XAWL 2DQDH 3ECVA 4ONFL 3KS0H 3TBWB 1EK3A 3DX2A 3BDYL 1XL4A 1NSNL 2EDTA 4OJDH 4WEBH 5EEXA 4HIJA 4MA7L 2EE6A 2J8HA 1MEXH 1SGKA 1EWHA 5C08B 1VERA 4DKFH 4GS7B 1DQMH 4EVNB 1ECYA 4DPAX 4XODA 3FUHA 3ATEA 3V0JA 3UBXB 3BGAA 4NDMA 5FGCE 1E6OH 4UQDA 4TUOB 3HB3D 2A4CA 2YMXH 3B7YA 2BFVL 4HHWA 1CGUA 4PJDA 4EZKA 2DJ4A 1E42A 4XVTL 4AQEA 3F04A 3OXRB 1OTTD 3O9WB 4Y2DD 5EEUA 2Z7UA 4S1QL 1YG9A 4WFED 5IFHL 1NGYA 3PUCA 5D6CA 1A3LH 1OAYH 4O02B 1J8RA 5I1CH 1DQLH 1TF4A 1UYWL 4NRZB 5CBEB 5DVLA 5GGSY 4Z7VF 3BGFB 3GXUB 1BZEA 1PLAA 4MNQE 4YGAB 1O6TA 5AW2B 1X9LA 1UOWA 3BUPA 1X4YA 3LZPA 2BP8A 1NDGB 2DPKA 3BAIA 4W9JC 4GLRH 4NQXB 4HXAH 4UTBH 5TD4A 4NQCA 4XO5A 1B4LA 1VF5C 3HZMA 1FO0L 3ESNA 1F56A 3DXAA 4M9PA 4R3SA 3GMLB 2J88L 2WQXA 4NRYA 1PQZB 5BXFB 2OXHA 3CH1A 2OMNA 3TFKD 1E28B 2RIKA 3HUJB 5I1LA 5BV7H 4FQXB 2G5BB 3PJNA 2IH1A 1EEYB 3QDJB 1KDJA 4H2AA 4U1NB 5DZ9A 1SN5A 2HA1A 3LS5L 1O6SA 4OIIL 2X6CA 1BQHG 4LIQE 3ARPA 4OH2A 2TSAA 2VDRB 3WO4C 2FLMA 2YA2A 3NG5A 5E9DE 3I50H 3F7PC 4G42A 4LEXH 3WIHL 5JPNC 3PAYA 3AM8C 2P7TA 2ZCKH 2FEDC 1PW3A 3QNFA 2BOCA 3DJTA 2ERJC 4N2LA 2A6JA 2OJZH 2Z34A 4P3CH 5CLXA 5E8PA 4GW4B 1TEFA 1MFVA 2OZNA 2D0FA 3EGXB 4DP4X 5BZDB 1HE8A 1WE5A 2L7EA 1NCBH 2XT1B 4LAQL 3STLA 1SJXA 1CYGA 1ZMYA 2UX7A 1AXTH 4A38A 1CLOL 2CJ3A 3GMMA 1YAIA 2IDSA 2XPGA 1D6VL 4OJEH 2CA4A 1MELA 4LLQA 5AW8B 3T3PB 3KGSA 1HQ4A 1ZRUA 3MGAA 1U8NB 4J3TA 1G7MB 4OQ1A 2W88A 3QA3B 3AMLA 2OM5A 4EI5D 4ENEC 4JFPA 4N68A 4J39A 2CXKA 3DJSA 5T3ZE 2XQBL 4JFFD 4TN9A 1YDPA 5DTFB 4MJ4A 4AEIL 5GGQL 2EUXA 3RTQB 3KBPA 3EH2A 3HFFA 2Y36H 3OG6B 2Q0ZX 4XBPA 2AEWA 4BSWB 1EMTH 3A4AA 4PS7A 4QXGH 2ZOLA 2AEIT 4LIQH 1C5CL 3CFBA 2V37A 3K81A 4P2QD 4D9RD 3VG0H 4JVPA 2XVLA 3J07A 1HU8A 1H19A 3O8XA 4GO9A 3ZTCC 3TIDB 3ULVL 2HN7B 3K72A 4LHUA 1T5WA 1NUDA 1VFOA 3BWSA 4EO5A 1NC2D 3CFEA 3H0TB 4S1DC 3V7AE 2OYKA 2AXGA 4JRXA 3U36B 1AG0A 1YNLL 4GI8A 1XDTT 1EO8H 1NBYA 1AS6A 2OMVA 3BJ91 5F93C 1WHOA 5A6MA 4DTGL 1ZK9A 2JFCA 3LB6D 4JJ5A 4OZGB 1KNOA 2CK0L 1YPZF 1FFTB 3VRJB 3FN0H 2FO4B 1AKJB 2YXMA 4Y19B 4AC4A 2PPDA 3QZWG 4Y5YB 1TOXA 4DKTA 2HXAA 4FC3E 3BI9X 3QEGL 4N5UA 4XPBH 1RIUL 3CC5B 4OZHA 5D71L 2NR6C 3VI4B 5F6HJ 1GJUA 3T1FB 1U92A 2B14A 3H9HB 1BG1A 4PJXA 4NUGL 1OZTG 2L0DA 1F6FB 3IM1A 3L95A 3VFRB 3H4HA 5L8JB 2WQAA 5C0AE 5E08L 3COOA 4LVNC 5T3ZH 1UA3A 3BVNA 4DN3L 4J8RB 3QUHA 3S37L 1ZTXH 3BAXA 4L9LA 5L0QB 2H8PB 1ZANH 4UOW1 4KVCL 4LSPH 3TCLA 4X4ZA 3SDYH 5AVYB 3K1KC 1VA9A 2VC2H 3G3LA 4PGZA 3K0YA 1W72L 2TSBA 2ETWA 4R4FL 2GVYA 4HT1H 1I7UB 4U6XB 3KWTA 3Q44A 3LY6A 1A1OA 4BKSC 4ELKB 2WB7A 4FLHA 3QIBD 5F1KC 3MN8A 4TSAH 1H8OA 1L3WA 3T9WA 5T33H 1F90L 2F19H 5D7IF 1BX2A 3WMPA 2NT1A 1X5AA 3DX1A 3WJLA 1ORSB 4PJDE 1S8DA 2IGFH 1IBFA 3UDWC 2G75B 1BXXA 5EF0A 2P5WE 1RZQA 1DO5A 1INDH 3QS2A 2Q76B 2ITDA 3OB0H 4HPYH 5F70A 1KBBA 5DUJA 5HJ3B 4LNVA 1IZKA 5FO7B 3INOA 1C08A 4KJQD 4QRPB 2ARJA 3B2MA 5EDSA 3V0IA 3S97C 4Q9CA 4Z7WB 5EU6E 3EO0B 2XTSA 3NABL 2P9RA 4NQCE 5ABZA 5J5EA 1D5IL 2JMRA 3MA9L 4U1GC 4PB9L 4DGYH 4ZX6A 2OZ4L 5CEXB 1MKFA 4XZUA 4QTHB 2C4XA 1U0QA 4I2XA 3WIFA 3IEAA 4OZFG 4X5QA 2NY3C 5IQ7L 2BVOA 4WHTB 2J6EH 4TSBH 5E6RB 2CWRA 3EF4A 1F2QA 4YBQC 3FSAA 2DTSA 4PHXA 1DN0B 1HSBA 2D2OA 2ZCLH 4L37B 1T7ZA 1TZGH 3NRFA 3MJWA 2F8XC 1LWHA 1I8KA 4V11A 2X1OA 1FPTH 2QADC 1JZ3A 1K4DA 4HUXA 1MCPL 1J1PL 3KLAB 3UO8B 2QVIA 3PDOB 4JQIH 2PW2A 5CCJA 1FSKC 2X05A 3EYQC 3QWRA 4HIXH 4R26H 1W16A 4E5XB 3EYUH 1AR1B 1P84K 2ICWJ 5T1DL 1C1EH 1U8JB 2F74A 3LNDA 2XN2A 5EZOL 5T5FA 3KCPA 4X9BA 3IMVA 4PH8A 4UANA 1Q0XH 4J3WA 4D3CL 1SDDA 1IBZA 2GITA 2UWEB 1FFOB 3PHQA 3RBGA 4TKWA 4X83A 5LAXA 3N40P 3QJZA 2X4OA 1OP5K 3K6IA 3RZCB 4JPQA 3OZKA 3BH9B 1AE6L 2VDOH 1BAFH 1M7IA 2XN9B 4OU3A 4AVIA 3KDMA 4AXWA 3JUYA 1QYGL 4XP9H 5GIRA 3FOLA 3W11D 4PP2B 3HE6A 2IV9A 3WU1A 2FL5A 4MS6A 4BFRA 2ICCA 3OR6A 3GS0A 4PJCB 1FZMB 5KS9B 1R34A 4HKBB 5HVGB 5DMJB 2VLRA 1CT8A 4XPTH 4DN4L 1C16B 3QJXA 3D34A 5HYSA 4K3EL 1U93A 1ZLSH 5JIPA 3BPLC 1YEKL 5LGJA 2AQPA 1JWMB 4XBGB 4GP4B 4HJ0D 3WLBA 2GBAA 1FL3A 5BOZG 1NZRA 4DVRH 3RIAK 3LZNA 1YQVH 3D25A 4WJKB 1EXUB 1IX2A 5B1JC 3HB3C 4NC1E 5HDLA 1B0IA 2YGVA 3FB7B 3JTBA 3MV7D 3NSDA 4BQBA 2ZCHL 5TF1H 1DJHA 5KYWA 4U1LB 3CXFA 2IJ0C 1XX9C 2EVJA 4UDTB 5EU7C 3A24A 1OTTC 2QGCA 4Y2DC 5HHNA 4XNQB 1HH6B 3KYNA 1K3ZA 3GSNA 4IIZA 5EWIL 1TQUA 3TBSB 5DGRA 4HU8A 2YBRA 2YK1L 3MRCA 1HHIA 4U31A 3TU6A 1ZEAH 3STZB 4X98A 4XZ4A 5H2BB 2HMID 4P07A 1QBML 1HI6A 2VH5L 3KLKA 4YNYA 4OZHE 3D12B 1PMYA 4OJYA 4ERSH 5CAYB 4P9HC 3RB7A 4ODBD 3GSRA 4L3CA 1WD8A 1AC0A 2YEZB 5DQDH 2B4CL 3MRFB 4PJXE 5C1MB 4U1HA 4MMZC 1L9NA 4JR9H 2QPEB 4QHKJ 2QKIC 5AB0A 3RVXD 4X6CB 1YVLA 2Z0BA 5AD0A 2WXKA 2WD0A 3U30B 2FH6A 1EGJH 4XAKE 3DHMA 1E7UA 2F0CA 1FLRL 2CR3A 2NNAB 1W0VB 2BIIA 4E42B 1KLFB 4K94H 2CJUL 3GRBA 1QUPA 3QDAA 4FEIA 4N2DA 1LEKA 5C86A 2R29H 3VXUB 1HTYA 3CFCL 2XWJA 3QC5X 1J0JA 1EO7A 4E41B 1BREA 4PJAF 2X4TA 3LNEA 4ZUUA 3QORD 4PJGA 2VE6B 1IAIL 2XNAB 2EO9A 3E8VA 2IWEA 4UAOB 4M7ZB 3NIFB 2F1BA 2ZPKL 3IDGA 4POUB 5LGHH 3U6XA 4U1JB 3D1MC 3I75A 1MUJB 1UM6L 1FN4B 1JPFB 5AAPA 3DUHA 2NY2C 5KSBF 4MD4B 3ZDYB 1U6AL 2Z8WC 4G83A 3D85D 3GO1L 3GLDA 2X5PA 4G6KH 3EJUA 2RCSL 1RZFH 3VWJC 1U3YA 5ITFB 1CDBA 2JTDA 3X14B 4TQ8A 4GI6A 1P53A 3UAAA 2RHEA 5KJ7E 1CGSL 2FHBA 3EFFB 2QSVA 2J25A 4EVNA 1UEMA 5JTWA 5MI0B 2B9AA 4M4PA 4L1HA 5DHMC 3UBXA 1GIGL 4B50A 1LILA 4X9IA 1LE5A 3HNSH 2NXYB 4TUOA 2OTUB 3H2QA 1GCYA 4BZ2H 3W56A 1BP3B 5D5MB 1I53A 2LHAA 5LXVA 4JM2F 1KULA 1F4AA 3BESR 3OXRA 1PJWA 3O9WA 5FUCE 4AK2A 1KY6A 2TRYA 3HE7D 1KEML 1MF2L 3E3QE 3ESPA 4O02A 3LQMA 5JXAH 1MJUH 3G9AB 4UNIA 1I1AB 5I1KH 3QEQB 4NRZA 4KRPD 3WKML 1X5MA 3LB6C 3B9KB 4J3XA 4KH9A 5EIIB 2F54D 2EDBA 2DICA 4OTXL 3FT9A 1NDGA 4XCYB 4Q9RH 1O9WA 4AQAB 6FABH 1URIA 4JHAL 4NQXA 5DR5H 5IBUB 3RGVD 1IEAB 4KDTA 4NGHL 3K4AA 4LSQL 4U7MA 3GMLA 1PQZA 4U3XA 4Y5XC 4IOFD 3QYMA 1E28A 3HUJA 2L4OA 2G5BA 3QDJA 4FQXA 1EEYA 4N3TA 4U1NA 1L0PA 3GKWH 5DWUH 3ZHNA 3BC9A 5KAQG 4A7QA 3PABB 4NO2B 4BFIB 3LKRB 4NQUA 2X09A 5I28A 1QNZL 4IRSB 3NCBB 2DMCA 2QSQA 2O6CA 3QISA 1HZHH 3QB7C 3DARA 4ANWA 5IMKB 3N85H 4NZUL 2ATPB 3O6FD 3DX4A 1CPUA 4GW4A 1CDHA 5AZ2H 3EGXA 1OSZB 2C9RA 1AJ7L 1FNGB 4FQCL 5BZDA 1GXEA 1FG9C 4MJID 2DEYX 3GK8H 1FH5L 4GO8A 2GJRA 2XUWA 1L9PA 3QIBC 1A7RH 2J5LC 3LX9A 4YFLF 3RJOA 2IPTH 4I13B 3FO0H 3I9GH 2EVIA 1E5CA 2H0EA 1U8NA 2ZAGA 5ITBL 1G7MA 3VRIB 1J5CA 4F1ZA 1N0XL 1XF5B 1H15A 1ZVYA 3P0VH 1J05B 3QCVH 4ZUVA 5CXPA 2H1XA 4H8WC 3BQVA 3W39B 2ZX6A 2JLPA 3LMJL 4IYKA 5AYTA 5T5FH 1N6QH 3OMZA 2CDFB 3EDFA 5L88L 3B1TA 2BIOA 5DTFA 2AF2A 4KJQC 3F01A 1EEQA 4BSWA 4W9IC 3OQRA 3AG2B 4I4WB 2ICES 1DJYA 1Q9LB 3F12A 4Y7OC 3MBXL 3UTTD 2ZYIA 4U1IB 5CJQL 1HCYA 2WLHA 4RBPK 4UBDD 5GSVB 5HYQB 2AJUH 3U0PB 4WHYG 3WN5C 4HWEL 1RCYA 3PLYA 4ZAKB 4W68A 4KMTH 3TIDA 2HN7A 3T2QA 1EJFA 3BT2H 3H0TA 2K9FB 1IM9B 3U36A 2NCEA 3FFOA 3S5LB 4DP8X 2VR7A 3QZMA 2JJTA 4W1TA 2VKWA 1AI1H 2PPAA 4M5ZH 2Q3XA 4FHBD 4OZGA 4R4ND 5AB9A 3FHAA 3VRJA 2EDDA 2FO4A 4HJTA 1AKJA 4Y19A 5JR1H 2UZPA 2JK5B 4Y5YA 5E2UL 5D8JL 4L4TB 1GOHA 2B3IA 5I6PA 1UADC 1K6QH 4DIXA 4PJGE 1UM4H 1H9VA 1BEYH 4FLRA 3LXUX 5F3BB 1ZV2A 3VI4A 2YD9A 4A39A 1MRFL 3T3MF 3T1FA 1AY1H 3H9HA 4PD4K 2NSQA 3QZNA 5C2BL 1CL7H 4PI0A 3FTVA 4PJ8B 1JD9A 4GAGL 2VWEC 4FF9A 1F00I 4N8UA 4NQDD 4J8RA 3ARQA 3WXVL 4ZT1A 1SY6L 2H8PA 2WWMD 3RY4A 5JPMB 1NUGA 3GLEA 3S3JA 1X3DA 1I9IH 1XB6A 1FFRA 2YD8A 3GUFA 3W11C 1T83C 4NSKA 4PRHE 2FECL 1H3TA 2CM6A 1KGXA 1UUNA 4YSUA 3U9UB 2KZKA 3TS8A 4RGOH 4X6DB 2KDGA 4F8PA 3QDMB 1EHLH 2NNCA 3UJIL 4GP8B 3N42B 4F1SA 5CLZA 3BKML 2YZ8A 3LN9A 1I7UA 4U6XA 3AACA 3HS0C 1ADQA 3M07A 3GZQA 4RZCB 3T65B 4AE0A 1LMIA 1ZGLB 4FQHB 4ELKA 4HJ0C 3GS7A 4N26A 3MKGA 4K7PH 3KGTA 2UY7B 3MRHB 4NCC2 4PS4H 3RIFF 4Q58C 5HHOD 1CE1H 3V5DA 5AB2A 1MPAL 4XCEB 3TA3B 3P0YH 1ACYL 4XCNB 1ORSA 4OZFH 1H5BB 5HDBB 2G75A 3QDGB 2J8UF 1T66D 4IBZA 2NNXA 3VD1A 2VOTA 3TP4A 3GHEL 5CZXD 2GI0A 5HJ3A 4K5PA 2WPGA 1CZ8L 5BCAA 3QPQD 4QYOA 5FO7A 3V6FB 3ZE2B 3EDDA 1I1YB 3RI5K 3U1SH 2K3HA 3VNYA 1IILE 4Z7WA 2HMIC 3L13A 3PHAA 3EO0A 4Z7NF 4PJEB 1KFGA 2VB5A 2AK1L 1JXGA 2YN3A 5I5JA 3IMSA 1MQKH 1IE4A 4ETYA 3QG7L 3U6XS 3CXDL 1OB1B 3FFCD 3DMMB 3W37A 3LN5B 5CEXA 4NN6B 3UTSA 3HUJE 4QTHA 1R3HB 1FNSL 4HEMA 1LP9F 2EDRA 3C6SB 4N0FB 4OCRL 5DJZB 5KZCB 3QQXA 2EEDA 1Q1JL 4DPCX 2IXQB 3RVXC 2CJSA 4K3JH 1UXLA 4WHTA 5B3NA 4JVUA 1RP8A 2Y1ZA 1DN0A 4L37A 3KXFE 4U7KA 1XCWA 4L8SB 2XXCB 3K6OA 4WNJA 4I3RH 3ECWA 4DK3A 3MUJA 3PDOA 5I8KH 1E4HA 2A3TA 2P8MA 4MS8D 5F7KC 3OAYK 4YX2H 5I6XC 3NJJA 1E2WA 2VL5A 2CUHA 1DBAH 3V0WL 2X42A 2N4IA 3NIDB 1Q9OA 4P5KB 3BISA 3T0EE 1ZHBB 1EFQA 1U8JA 3QORC 2WSKA 2AK4B 3VJ6B 4L4VD 5BRZD 3JWNG 1XB3A 1YRKA 1IQWH 5I1IL 3ERXA 2UWEA 5KYYB 1FFOA 2DQGH 4C47A 1DBML 1AHMA 1WGVA 5SWSB 5HDQL 2VDQH 3HOGA 1UA7A 2HLEB 3M46A 4TNVF 3BH9A 3FO2B 3TO4C 2LLGA 1H3PL 3WV0A 2DQMA 3FUIA 2PNDA 1TEGA 3I6GB 4JPWH 2Y2WA 3PL6B 3VFVA 4XN5A 2VAAB 4PP2A 4QXWA 1E8WA 3K91A 1RLBA 3ZL2A 3BP5B 1FZMA 1BVNT 3CMOL 5I15H 5KS9A 3KM1A 2WUBH 4HKBA 1X5FA 3ABLB 1EHNA 3U4AA 4IW4C 4KI5F 2DWEB 2Q8AH 1SQ2N 3PGFL 5GRYA 2GIMA 1JWMA 4XBGA 3RHWK 4I0PC 1MCDA 3UERA 1XXDC 1B9KA 3PRZA 4NN7C 5KVMC 4IKIA 3MLZL 2XZCH 1EXUA 3D06A 3VFOB 2H6UA 3EYVB 3FB7A 4D0BB 1YJDH 4XPAH 2ILLA 2XSKA 2AJVH 2QZQA 4U1LA 4ZFQA 5FR3A 4PJIE 4UDTA 2VLJE 4XNQA 5KYXB 1HH6A 4IK6A 3TBSA 5DHDA 3HE7C 3UH8A 3TEZA 2KLTA 2EYRB 1RHFA 1AZCA 3CZLA 4KC3B 4KRPC 2VW7A 4CAGA 4KROB 2AGJH 3VD5A 4L05A 4MYWB 5H2BA 1TJMA 1RZJC 3WY2A 4WU7B 1J18A 5G4OA 4B9IA 2WXPA 1FFNB 1F11B 3RGVC 4QCIB 3VI4E 2QV2A 5LXGL 4QXUL 2YEZA 3MRFA 4ODUB 2I9TB 2TRHA 1N0LB 4IOFC 4YDLB 2P49B 2EUWA 2I5YH 4X6CA 5D70H 3VX1A 3BMVA 4RVBA 1BQKA 4U3CA 3LJ3A 4OCXH 4V1DE 2ZWZA 4EN3B 4IBLT 3IJ8A 2K78A 1ITBB 1OGSA 3BYYA 4F2EA 2Z4QA 1ZGLM 4E42A 2NNAA 1W0VA 5ADPH 4YHLH 1KLFA 2JKSA 4TRPH 4AZUA 4XNAA 4ORGB 2ICWI 2C26A 4FFZA 4EMZA 3PWPB 5AOLA 3VXUA 5HBBA 4LEBA 3HC4H 1U3JA 1MFNA 2F7QA 4EOWH 4YLCA 9PCYA 4E41A 3M1OA 3O6FC 4A63A 2VE6A 1Q38A 2XNAA 3F7YB 3HTLX 1UQSB 2O5ZL 5H8DA 2FDBP 2OMWB 3MV8D 4JFTA 4I1PA 3ZDZE 4NM4L 2HYMA 5H4ZA 1YAZA 4U1JA 1MUJA 1FN4A 1AGCB 1JPFA 2WCGA 2KYIA 3KZ8A 5AZEH 1XGRB 4ATWA 3FN3A 4MD4A 2OMYB 3LS4H 2DKMA 2R0ZH 1F97A 2DIEA 4MXVE 3FAXA 5AQ0A 3D4CA 5A40E 1U2CA 4FZ8H 1E2ZA 1UC6A 5ITFA 1T2JA 3CQQA 3X14A 4RMSA 3V0GA 2E27L 3ARDD 1UJ3B 5KVDL 4D9QE 5JW5B 3VXRB 4FADA 3MACL 3QQNA 4P2RD 1HCVA 2X6VA 5DEJA 4KUZH 1TYRA 2M26A 3OAZK 3QHFL 1DDHB 4JG1H 1F4XH 2OTUA 3NDYE 4QHNB 4A1RA 4UBDC 1KELL 2GABA 4Z7OE 3UTSE 1J11A 5D5MA 4HEME 2W0KA 5M94B 1T0PB 1WITA 3UJTL 3AROA 4X7SH 1ED3B 1T7WA 2EDYA 4HOWA 5DF0A 3WIIH 1HC1A 2IAMD 1WAPA 2BVQB 3I3EA 4E9TA 1I1AA 3QEQA 3HI1A 4DSYA 2F5BL 3MJ9H 4RSVA 2H3KA 5ES4B 3OTTA 4FQLL 4R4NC 5EIIA 1RXLA 1B2WL 1U3HD 4MA1B 4AQAA 3KPLB 3QFJB 2HH0H 4QHKI 2C3WA 1KLUB 3BZEB 1OGAA 1JRHI 1XIWD 1MWAL 5BUGA 1E5YA 5EOQH 1YZZA 3Q7JA 3PWJA 3GRWH 3A0OA 3UAFA 4JG5A 3MGOA 1S3KH 4DQOL 3P30H 5EOCL 2X4RB 4FLQA 2YRZA 3PABA 1N7ML 1KBGH 4NO2A 5KOVC 2H7WA 3LKRA 3ZKXB 4BFIA 1DBBH 4C59B 3MODL 2CRYA 4IRSA 2WWMC 2AEQH 3TWCL 2V9QA 3ZOAA 1NMAH 2DJMA 4J6RH 3SDAD 5KS9E 2PTVA 1LWRA 5IMKA 2V9UA 1MCCA 5GGVY 1OSZA 1FNGA 4NZJA 1WH0A 1NCCH 1MXDA 4GRLC 5L9DH 1AAJA 1QW8A 2P24B 1FGVH 3QCUL 3QJTB 4IRZH 4QR7A 5IROA 3TWYA 3SGEI 2K4WA 2H32B 4PVLA 1SJVA 1NFKA 4U4IA 1M9WA 5DZLA 1H8SA 5K59E 1RUQL 3VRIA 2X70B 1XF5A 2OXGB 4CSSA 2FX8L 1J05A 1T66C 1GYUA 4Y4KB 5TE7L 4OLZH 4EN2A 2V5RA 3W39A 3T5WA 2O5XL 5CZXC 5DA0B 1MNUL 1DJWA 2CDFA 2Y0SA 3PP4L 2GJ6B 3QPQC 4JFYB 3NCJH 2HLAB 4YDMA 3VXMD 2NY0B 4PRIB 2YUXA 2YAOA 1ZOXA 1E0OB 3WNMA 4I4WA 4OKDA 4TULH 1AYRA 1Q9LA 4A2HA 1IT9H 5ALCL 4OW6A 3KEHA 2Z7WA 4LESA 3VYNA 1TTUA 3JV6B 1P6FA 2NZIA 1QHQA 2WXNA 5GSVA 3WXWH 5HYQA 3BO8A 3U0PA 1JFHA 4V2BA 4ZAKA 5KEZA 2DWYA 4X6CE 2YAQA 4DVBB 3H42L 1IM9A 1V05A 4G3YL 5AALA 3HMWL 2EH8H 3S5LA 4ES9A 1XGUB 3AU0A 3ELQA 1NIDA 3ZTDC 4RZKA 4DPRA 4AQZA 1DYZA 1KSRA 1FRGH 1NLBL 4W6WB 3MDJA 1H6EA 1Q72H 2CALA 1PIFA 3VXUE 4AENB 1MJ8L 2F8IA 5LWYH 2JK5A 4MS8C 2D7TH 4L4TA 4NBXB 3U1QA 3IFNL 4I7ZC 5F3BA 1YLBB 1UD8A 1KYUA 3TT3H 3H8NA 3Q06A 1WK0A 2X4QB 3H9ZA 1U8QA 4Q8BA 4U6VL 5D1QB 3FOMB 4PJ8A 1IGCL 4X9GA 3W9DB 3PQYE 4JY5L 2AAAA 2D0HA 2Y7QB 3A6BL 4RX4A 4HGKC 4AUJA 5D2LB 3L1GA 4PJ7F 3TH3T 2DB8A 1QWHA 2CO1A 4AYEC 5JPMA 1UM5L 1L0YA 3QXAB 4U3HA 1OHQA 3DUUB 3NEEA 4LOUD 3NN8B 3U9UA 2DYRB 5DQ9B 3IVKB 4X6DA 3BAEH 1VZGA 3L5HA 2VXQL 3QDMA 4M61B 3HZ3A 1MREH 3SPCA 5DD0H 4NWTH 4LVOC 4RZCA 2ODHA 3T65A 4GAJL 4R4BB 4FQHA 1JCKA 3VD3A 2G0KA 3VXSB 3MRHA 3SPIA 4BZ1H 2DDQL 3AB0B 2NXZD 4MCZB 1S5IL 2CK2A 4CMHC 2EC9U 35C8H 4GAYA 4YXLH 3SQBA 1G9EA 3SE3A 4XCEA 3CIAA 1FC1A 1OIOA 4LP5A 4XCNA 5D5ME 3TA3A 3AGVA 1H5BA 5JW4R 3AS2A 4TUKH 4NWUH 5SWZE 4AM0Q 5J9PB 3QDGA 3PXJA 2EVGA 4LRIC 5DMYA 3AW5A 1BWWA 6CGTA 4JFEE 4JMXA 3WJJC 1JTTA 1PY0A 1UACL 3FB6B 3V6FA 4FNLL 3NUKA 1TENA 1I1YA 5CCGE 2WMPB 1FYTB 4K73A 3A67H 1E65A 3V0AC 4ODTL 3UOAB 1RIVH 1ZHLB 3L3OC 4JFZH 1E3ZA 1J5OL 4XXWA 1NCJA 2B0SL 2AJ3B 4PJEA 4GG6B 2XKUA 1OGAE 3I74A 3Q43A 1EUTA 4Z3EA 4RNRB 4CVXB 1K72A 1OB1A 3D3VB 3DMMA 3KLDA 3L2NA 3OKLB 4DCQB 3CQFA 3DV6B 4N0FA 5IUCA 2XTJE 3C6SA 4PLJD 1XMWA 2J57A 2IXQA 4OI8A 4NO0B 4GT7A 4CU6A 2BHZA 3SQRA 3A23A 3VM7A 1LO5B 4YN3A 1I85A 2GC4C 4K5NA 3UC0L 1CU4H 4L8SA 4DOHB 2ZX8A 4JDEA 2AITA 5IGXL 1EJOH 3OKMB 43CAB 4OM1H 1KWGA 3KPQB 4YFEA 1R9FA 4JCLA 4X5PA 5DZAA 4N2MA 4X2UA 3K80A 2FIKA 3G6JB 4P5KA 1ZHBA 4M56A 4FOMA 3VJ6A 5JA8B 3H85A 3I9IA 3PP3K 4MAUH 4ABUA 1A6AB 4EBQL 4CU8A 4FI8A 5KYYA 2Z93A 1FE8H 5SWSA 2XWRA 5D1XC 1GR7A 4LFHG 5AVRB 3FO2A 5J13B 4OD1L 4UT9A 3I6GA 2BHUA 3P11H 3PL6A 5FYJL 5JIKA 2VAAA 2LFGA 5IW1B 3BQUB 4MTMA 5I5MA 3D69B 1JZ4A 2E76C 1AZVA 1IU1A 2GIXA 4A7GA 3INUH 1T0NB 1XH1A 2DWEA 1AQ8A 3B7TA 1S9YB 1S3RA 1W8EA 3ARDC 2WKOA 3QNYB 1XF3A 1AO7B 2HFGH 4LPXA 4RRPA 1QUNB 1YJDC 3WNKA 3ZKMD 3FQXB 2DBJA 3VFOA 1ZA6B 4KK9D 4D0BA 1FO0B 4LKCA 5DYOB 5IJBC 4XWGL 4Y4HB 4W9EC 3IMRA 3WFCH 2H3NB 1YEJH 1VFBB 3OLEA 4UIKH 4JFQA 3HI5L 3NJLA 3IDIB 4JG0H 1ZJAA 4LLYB 2IAMC 3T2LA 2VMEA 4DESA 3TN0D 1NCIA 1ES0B 3WFDH 2EYRA 3BZFB 3PIQB 1UXMA 1X44A 4ZMOA 4OJFH 1OT4A 4GW5B 2ATAA 2OK0L 2E74C 4K15A 4JQVC 3OMNB 3HBPA 4WU7A 5GS0H 1F4HA 1U3HC 3WUWG 1INEL 1I75A 3QI9D 1FFNA 1F11A 5MEND 1QP1A 4QCIA 1LDPH 3SCMD 4L5FL 4DQAA 1LTXA 5DT1H 4NC0B 4ODUA 2I9TA 1I8LA 4TS6A 4Q89A 4JRYB 1N0LA 1HVXA 3WELA 5EUOE 3DHPA 3OHXC 1CGWA 4ACPA 5A2FA 3VD0A 1AACA 3X11B 3J2PA 4EN3A 3F65A 4OT1H 2P8PB 1DP0A 4G6AD 3RWFB 2UZIL 2K4AA 9CGTA 3VGEA 1QOKA 4ZFZB 1YNTA 3QO1A 1MVFA 3S5YA 3WMSA 3B2VH 4NZ8A 4ORGA 2C1PB 3PWPA 5GJTL 2YC1B 3RX7A 3I2CL 3C08L 2EE2A 3AG3B 3SDAC 2XN1A 4XPGL 4X6DE 4ZS6D 1E4KC 5HI4C 3QDME 4UTAA 4OLXL 1XQ4A 5KVGH 4FXGC 4P9HL 5JDSA 2CKBL 3TO2A 3F7YA 3GI8L 3CVIL 3AZUA 1J8SA 1AXSA 2AEPL 5ISZA 2OMWA 4JGMA 2A2QT 1HYRC 4NPYB 3Q1EA 3WENA 1URLA 3EJRA 1I8AA 3O2VH 3X17A 1AGCA 3EYFB 4MCNA 1P4BH 2OYMA 3E2HB 5L7XH 1BJ1H 1XGRA 5J11B 3EF7A 3MLUL 5HDBE 3ARVA 5LGKA 3NACL 4FTVB 4AW4A 2DWDB 2WO2B 4YVUA 4Y8AA 1KPUB 1LHZA 2I26N 4DK6A 3W9EB 1R3IL 2J73A 3IPBA 4H44C 1B4JH 1B3IA 2Y24A 3WTXA 2A6DB 3AGWA 1F1AA 3C09C 4A6YL 3BDBA 4MHHI 3VGAB 1UJ3A 5DUML 3FCGA 4KKCD 1NFDB 5JW5A 1BZDA 3CSGA 3VXRA 2QL1A 2E7LC 1QI3A 4PJEE 1DANT 1DDHA 5FHBL 1PYWB 1SJEB 3HN3A 3UTPD 1KTLB 2AJXH 4G5ZH 5D7LD 1BZ9B 3G08B 4QHNA 4OBSA 1AG6A 2L3BA 2FBJH 5FA3B 4BSJA 1ZLDA 1BV8A 4OQTA 5C07A 3NFSL 2RALA 1YY9D 3RU8H 2HT3D 4GQRA 1ED3A 4GBXD 4XR8C 4WEBL 3SGJA 4LCUB 3DJ9A 1XMEB 4BGLA 1CF1A 2RQ8A 1MEXL 2BVQA 3NJHA 3A4DA 4PHZA 3B2PA 1KXVA 4BE6A 3TYFB 4DKFL 1TTCA 3PS6A 4KH2A 1BLIA 4U3SB 2O30A 3S3DB 3GXPA 4PGEB 2NY7H 3PU7A 2YMXL 3V4PH 5FFLA 3KPLA 3QFJA 1KLUA 3BZEA 3K7UA 2JKTM 4HJ1A 1BMGA 1I1CA 4DZBB 5I9QC 3EH4B 1MCKA 1P0SE 3H54A 5IMOB 4NI3A 3S88L 1W72B 1OAYL 1R0AH 1JBJA 4PG2C 1NPJA 3U6RB 1DQLL 3HC0B 2X4RA 5E6YA 4GKZA 4DGWC 3G5WA 5DVOA 3TVMD 4HXAL 4UTBL 3LZRA 3ZTNH 1Z7JA 2DWSA 3FUKA 3HBZA 3QIWB 3IKKA 1USQA 3HR5B 1U8MB 5EC1B 5M7QA 1URZA 4LOUC 4HCFA 4HC1A 5EOCJ 5BV7L 1NCOA 2ED9A 3IDMB 1ZE3H 2ZXQA 1TPXB 2LE9A 5C6PB 4H2CA 4ZQKB 4PR5B 2AEOA 2APTA 3I50L 1IAII 4LEXL 1MFBH 4R90H 3PUUA 3STBA 4J3OD 1L5GB 4LPCA 1NAML 2ZCKL 3ECBB 4L2YA 4WGKA 4XOEA 2H32A 3O3UN 3AADB 4CC1A 3GI9H 4P46B 2OJZL 2X70A 3MTRA 4R7DB 5HYJD 2OXGA 4P3CL 2VDMH 4JHUA 4FTDA 4Y4KA 4PJHE 2CLVB 2JVUA 1D5RA 4TQIA 5D1ZD 5B39G 2GJ6A 4JFYA 3T8XB 2HLAA 3QUXB 5E7BA 1E5BA 2B59B 4PRIA 2CNZA 2Z65C 4F20A 1AXTL 1DQDH 3BZ4A 5FWRA 2HRGA 5AKSA 3L5IA 2YKLH 1I4FB 3TTSA 2Z8SA 3EH1A 3H56A 1OVZA 3O41B 1U91A 2JE8A 3JV6A 4NQVB 5C0BA 2CCLA 4AGPA 4E68A 4NNXB 4P05A 3DSFL 2WQRA 1UTDA 4XNUH 5F7WC 1DFBH 1TJHL 1QAWA 5I19L 4F7CB 3LV3B 2KS0A 1YUKB 2I69A 2VXVH 4PLJC 4B53A 2X9ZA 4DVBA 5HGHB 2YQ3A 5B7FA 1XGUA 2HKAA 1E27B 2Y36L 3O4LE 1RZ7L 1EMTL 3NFPB 1H3VA 3DOSB 4QXGL 4LIQL 1J9CT 4G7QB 4WW1B 1IUZA 3VWJD 2EE9A 4ZMAT 3VG0L 1KUMA 1RFDH 4NFCA 4AENA 1UGNA 5EOTB 5GZNC 5C9JA 4Z9KB 2CO2A 4AYID 3VSUA 4N24A 5JQIB 4Z7VB 4O5LL 1AD0B 2CHXA 4J3SA 4CA4A 3ZMNA 2C3VA 3MI6A 5ISZE 5D1QA 1ZCRA 1ZV9A 4G5AA 3FOMA 2AERT 4WW2F 3W9DA 3LNIA 4OZHF 3HBQA 3OD3A 2Y7QA 4LSTH 2FEEL 2QFRA 3FN0L 4PJXF 3QSKB 5I23A 3TNNB 1G6VK 3HW7A 3RIFK 1DEEB 1MRCH 1KGJA 4D7PA 2ZSVB 1F2XK 4FFWD 3QXAA 2KT6A 3RB5A 4F9LC 1UG9A 1FGNH 4XPBL 3QWOB 4JFDB 1MSPA 1XSJA 4PFEA 2YO3A 3DUUA 3TJHD 1MLCB 4N90D 3NN8A 3TJPA 1GY2A 2X9WA 1CR9H 5DQ9A 3IVKA 2QPUA 5I75B 1JXFA 4HQQH 5IOPB 3WNOA 2X4UB 4M61A 3QAQA 1A2YB 3IN0A 5T3ZL 1HL5A 2QJDA 3CFMA 4AW7A 2B39A 4PWIA 4R4BA 4UV7H 4YSAA 3ZW3A 1ZTXL 5LCVA 1N8OE 4HIIA 2N3JA 3VXSA 3PV6B 2IOMA 1XV8A 2P4AB 4FP8H 3US1A 3P9LB 1VPOH 1ZANL 4MCZA 4TXVB 1DVFB 1HEHC 1AMYA 3ZKMC 1ZS8A 4LSPL 4CGUB 4JM4H 2EVHA 1T4KB 1W0YT 3SDYL 1OV8A 5C07E 4Q0XL 4KK9C 5FFGA 5J9PA 5D7KE 3MSPA 4KQ0A 2E6JA 3QZBA 3QIUD 1NOLA 3OB8A 5AG9A 4HT1L 4MKTA 3FB6A 4L0ZA 2CHWA 4P23D 4YSRA 3TN0C 2B15A 4CADB 5IQMA 2WMPA 1FYTA 3ZGHA 2WKGA 3QC6X 4MMXC 4YSPA 3K8MA 4TSAL 4WWOA 5T33L 2F19L 1ZHLA 3JWNC 3KYMB 2LGNA 3SD2A 4GG6A 5AUMB 5JW3H 3QI9C 4G6MH 5E4IA 4RNRA 4CVXA 5JO5A 3SCMC 3D3VA 4DCQA 3OKLA 2HG5B 1INDL 4HPYL 1CLCA 4YPJA 3DV6A 2L8AA 3C60B 4HIQA 4G7RB 4UCFA 2OI9B 4IIQB 4NO0A 4X0KB 4AE1A 5IMLA 1LO5A 3B9VA 4G6AC 4S1RH 4FMFA 1W0WB 2BJMH 5F9WC 4TNVK 2IAAC 4QI3A 3MQIA 5GXBB 1ZVHA 4DGYL 3OKMA 4ZOEA 43CAA 2QELA 1WUZA 3KPQA 1TVBB 3ES6B 1OP5H 4ZS6C 4N0YH 5F88A 3F58H 2OP4H 3G6JA 4P57B 2Y6TE 5C92A 1YPZB 1AGEB 1CFMA 5D93C 4TSBL 1A6AA 2YD0A 2Q20A 3IXAB 2ZCLL 1MAMH 5TDPB 4BQCA 1GAFH 2IQAB 2OMUB 4PEEA 1TZGL 5E99H 1U30A 2QQQA 1FPTL 3F7VB 2E8ZA 2XQYG 5F8QC 4OUOA 2X4NB 4GJTB 4PV9B 1FVEB 3S5ZA 3MZTA 1VFAB 1P7QD 3NZ8A 4PBWD 5AOZA 4R26L 4WI2A 3EJYD 3VB9A 5IW1A 2WM0A 3BQUA 1C1EL 2K1MA 2OLDA 4G6FB 3D69A 2YR3A 5DFAA 5AVVB 2BXYA 4HUVB 3ESVF 1IJ9A 1T0NA 1U3ZA 4PRIE 2FECI 3IPEA 4ZRGA 1DLFH 1S9YA 1QFOA 3QNYA 4KKCC 5D2NC 4LDOB 4WFHE 2XG5B 2VDOL 1BAFL 3HZYB 1OANA 1QUNA 5C0BE 2YPLE 1FQ9C 1G9ML 3HZVB 3EJCA 3FQXA 4XP9L 1CE6B 1ZA6A 5FA4B 5DYOA 3V0EA 4GSRA 3AC0A 2OSLB 2Y06H 3TIEB 2EILB 4Y4HA 2ID5A 1IJNA 2HX7A 3MJ7B 1YY9C 1JI2A 2H3NA 2HT3C 1VFBA 3T2NH 1NM9A 1OT1A 2FGWL 2WXQA 4GBXC 2OA9A 3IDIA 5D7IB 5DRNB 5JHLA 4LLYA 1GVIA 3SO3C 1PGRB 1QFWL 2CG9X 3ZL4H 4XI5D 2LFEA 3BZFA 4DVRL 3PIQA 5FYLE 1B90A 4GW5A 1G94A 4XXDB 4XH2B 5DC2A 1E2VA 4HV8A 3UXFA 2G60H 2CUMA 5JQ6L 4HKJB 5TF1L 3GM8A 2D3NA 5JZ7C 4WK4B 2JNZA 4Z5RB 4TVSa 5AFAA 4LFHD 1WIOA 3DXAD 1OM9A 1JFQH 3KL3A 3L3DB 3POCA 4M93B 2WNKA 1NWPA 5D1QE 3AVEA 4JRYA 4TSCL 3EG9B 4JO1H 2HKHH 1W9XA 3DTUB 3DVIA 3MRDA 4QIRA 2YFNA 5CGBA 3X11A 4HK0B 1DVYA 1ZEAL 2P8PA 3RWFA 2V33A 2QTEA 1L7IH 3CIQA 3FO1A 2PXYB 4ZFZA 2AQSA 3GBNH 1Z5LA 4KXZI 3QEHB 4G9FD 3O3BB 5L6YH 2RBLA 5FC9A 5JHBA 5FYKE 2C1PA 4WWKC 2YC1A 4ERSL 1MI5E 2X4SB 1JPGB 2N7AA 4XVSL 4AJYV 4KV5E 4R0LB 2FZ3A 4JR9L 1RUAH 1SYSB 6PAZA 1PEWA 1U8PB 1I8IB 1T4WA 5IVOA 2DLTA 1B2YA 3ARXA 1EGJL 2Y25A 3BPNC 3VXSE 4Y1AB 4IKLA 1QI5A 4NPYA 1L0XA 4PJGF 3DV4B 4K94L 2EEBA 2GBUA 3EYFA 4N0UB 4BJLA 4J3OC 5HGDB 4WUUB 5FYLH 1RZIB 2R29L 4PYGA 2OR7A 3TA4D 1JGIA 4ELME 3IDYB 2Z4TA 3K4DA 3VTTA 2AZUA 1ND0B 5F21B 2DWDA 1CLZH 4ACTA 4Z3IA 2HKFH 1KPUA 3SKUD 1M9SA 2X38A 2I60H 3W9EA 4W4OC 1TCRB 3VFMB 1IAIM 1X5YA 1FYTE 5D1ZC 3FF7A 2A6DA 3GIZH 3TCXA 2WN3A 1MIMH 2BSCA 5JMOC 5I73C 1NFDA 3BWUF 2BW5A 3UGEA 4AMKH 1N19A 1K9TA 5L4MA 5JDJA 1PYWA 1SJEA 1HESA 4J12A 1KTLA 2BZ7A 3G08A 5AW4B 3D3VE 3O8XD 5FYKH 3ULUE 4PIRF 4DJMA 1M7XA 2AI0H 1CIUA 3QUGA 1G9NC 4LHUD 2I85A 1KJMB 5AW1B 5A2IH 1KJ3H 2BSBA 2Q5BA 4LCUA 4JRXD 5E6ZA 2W0PA 1G5GA 1MW1A 4U0RB 1EVUA 1XSOA 3D05A 4UB0H 3TYFA 4PWFA 4LVHC 3C6LB 4U3SA 1WZMA 1GGIH 5CIPA 4XCFH 3HNSL 4PGEA 3T8VA 1XF4B 4BZ2L 1RK7A 2D73A 2A38A 2FWSA 2JJVA 3KS0J 3KWVA 1TFHA 4ZYKB 3UAJA 1MFMA 3WY3A 3G6JE 2YMTA 3MUHL 4MJHA 4MXWH 2DQHH 2HVJB 4ZNEE 4LDEB 1FBIH 1WAEA 3ZE1E 3BJLA 4MNGB 1MCEA 5IMOA 1WS8A 2ZXAA 3ESMA 5I66B 2ISDA 1PZAA 4DP9X 5JXAL 1MJUL 5I1KL 3C9NB 2H0JA 4KTYA 1O7SA 3HC0A 2CRMA 1RJLA 1NKRA 2V9RA 3M7FB 1EV2E 1MFUA 4XAKD 4FNRA 3HUJF 4YFLI 3LKQB 3QPXH 1MCSA 3QR0A 3W0WB 4E9YA 5DR5L 1QSEE 4FFWC 5H37G 4LSUL 4LGSB 4UM9B 2XLLA 1MW3A 1GGBH 3HR5A 1U8MA 3ASNB 3DECA 3DK0A 2QQKH 5EC1A 1ZE3C 3TJHC 2IDCA 3ULUH 2MFNA 1JN6B 3AXIA 1SYVB 1CD1B 1WBYA 2BIQA 3GKWL 5DWUL 3HAEG 1T04B 3IDMA 3IGFA 3OSKA 4PYHA 1MG3C 4OCYH 2IMMA 2IANE 2H41A 4XP1H 4PR5A 1T7XA 4PJAB 4AVKA 2FB4H 4E5XG 2Y5EA 4X7TB 5DHVB 1N59B 3ILDA 5DURD 1A3QA 1L5GA 3ECBA 2R9HD 5A2JH 4P46A 2P5PA 4R7DA 1N12A 3HNVH 3N85L 2OZ4A 3CFJA 2ZICA 4EXKA 4GXUN 3NESA 3SDDD 3VDAA 3QIUC 3TJEH 1WCQA 2V3DA 2Q87A 2IDQA 1QLFB 3N40F 5I0VA 1G7IA 3RDTB 1ZVSB 3T8XA 4P23C 3QUXA 1ADWA 3GK8L 2B59A 1M7DB 2WIIB 3BOVA 4GQPH 4MAZA 1PZSA 4XOCA 3G5YB 1I4FA 1FVDB 3FO0L 1F1DA 3IMUA 3I9GL 5H94A 4H1LB 5JW4Q 2EUZA 1OK0A 4NNXA 3P0VL 2BIHA 1ZXKA 3QCVL 4GG8A 3HLAB 4KO5A 1AHWA 4JRYE 2E3VA 5T5FL 1N6QL 4WTXA 4CBZA 4GP5B 1WVZA 2N7SA 3LV3A 2J55A 1JXJA 5CU5A 3IWVA 4F7CA 2DEXX 1E27A 2AMGA 2EIEA 3BLPX 3DKHA 1TG8A 3CH8A 3NFPA 4FXLA 1KY7A 3DOSA 3HIZA 1MCHA 1OE3A 4AKQA 4R6UA 4PJIF 1NCAH 2HLFD 5CEZE 3RX9A 5EOTA 4UQ9A 4RDQF 3GZPA 32C2B 3NCWA 4ANUA 4RFNB 4KBPA 3QWRD 4KMTL 5AW3B 3OKNB 4Z7VA 4BIKA 1AD0A 5CP3A 3FUEA 4M9OA 3FT0A 3ME0B 1OE1A 2GSIB 1AI1L 3N1MC 4OFKA 1QLRB 2CDEB 5CU9A 3UABA 3EIFA 3FRPB 4XN7A 4QXTB 1PL3A 4HFUH 2W91A 3KH4A 3NJXA 4R5XA 2JTYA 5JR1L 1BECA 4YXHL 1DEEA 3V0DA 3CD4A 1VACB 3GSVB 1BXAA 2ZSVA 3RWCB 3CDZB 4PS8A 1K6QL 3FU7B 3HE6D 1UM4L 3M17B 5EBLB 5F2FA 3QWOA 1BEYL 4JFDA 3F7RA 4JPKH 4AG4H 1XWVA 1AY1L 3MO1B 4X42A 2D7MA 2X89A 2XYCA 3GJEB 4LPTA 4XB7A 1CL7L 4MQXD 5IOPA 2C9VA 2VLRD 5E2TL 5DZPA 2EICA 1A2YA 3H6AA 2YAFA 1NFDE 3WEAA 3L3HB 4DETA 4P59L 5KAQF 3QYCA 1X9QA 2CDGB 4ELDA 3PV6A 3P9LA 2BW4A 5EF3A 1DVFA 2B1AL 1I9IL 3KBHE 1Z0NA 1T4KA 1JNLH 1M1XB 2MPAL 4CVZB 3JV0A 4YHOH 5CEZH 5F7EH 1IZJA 2XRAH 4DPBX 3ZDZF 4KPHH 2PCYA 3L8QA 4RGOL 1NC4B 1PG7X 3IB4A 5AZUA 5DK2B 3LIZA 1NCWH 5ALBH 1EHLL 2Y23A 2BOLA 2W0FB 3QK0A 2UXTA 4M48H 4HPHA 1UA6H 1NEPA 4CADA 2R56H 4PP1D 1WT5C 4K7PL 3CGTA 4UQ2B 4XI5C 4PS4L 1X5IA 5B7MA 4MXVF 4BFGA 2AFNA 1CE1L 3KYMA 4UM8B 3P0YL 3MC0A 1MFCH 5AUMA 4TUUA 1HK6A 4H40A 1TCMA 1EPFA 1NBVH 1BYPA 2HG5A 2CXGA 4U33A 3U7YH 1EJ8A 2FD6H 3C60A 3D6GA 4LCWB 2VN6A 1D7CA 3T0VA 1HHJB 5J12C 4IIQA 3OAYH 4Z78B 1MLBB 3U1SL 2GSGB 2F7IA 4Z7OF 1IBBA 4BK5C 4KZDH 1L6XA 2FT6A 1WTGT 1I3GH 3D4ZA 3EHBD 12E8L 5IW6B 1AC6A 3LDBB 1MQKL 2GY5A 2ZUQB 2XYBA 4ZMXA 1DL7H 1TVBA 5BQ7B 1RZPA 3ES6A 4F33B 3AQYA 4P57A 4WGVB 1AGEA 3G5ZB 5HY9B 1UT2A 2CBQA 2X0VA 3V6OA 1G9HA 3EKCA 5TDPA 2UUDH 2IQAA 2OMUA 1PDKB 4K71C 1E5ZA 5C0CE 4A2FA 2HVBA 3F7VA 4MAYA 5CIPH 3T3MB 3ARFC 1XAKA 2KLSA 5JIIA 2X4NA 5I8KL 4PV9A 1X7QB 1FVEA 4YX2L 2NZ1A 1VFAA 4XRCB 3TOPA 4M8VA 2AABH 5CILH 1DBAL 4B0MB 5CGTA 4N3UA 5GS1C 1CVRA 4IGBD 4K3HA 3ARGB 2JIXA 4HUVA 5CMAA 4OFYA 5TGBB 4QT5B 3AQXA 1IQWL 2ROYA 2H0PA 1Z9PA 3QHTC 1S78D 4ZD3H 4QOKB 5C97A 4XGZB 4YZFF 3BWZA 3MUGB 5DUBB 4YSSA 1WWCA 2VDQL 1NTDA 5C08D 5KS9F 1LMKA 3OAUH 2XG5A 3HZYA 4UOW0 1T6BX 2EQDA 1OKEA 2QZ5A 3HZVA 3L4VA 2NW2B 3LEVH 2JF1A 1UKTA 3DDFA 3B37A 4JPWL 1CE6A 4JKWA 2R0WH 1J88A 3PXHA 3O8XC 5FA4A 1X7TA 4ZG1A 4ZW8A 3UPRB 2RJMA 4OJCA 1MWAB 2OSLA 4M03A 3TIEA 3VH8B 5I15L 3B6SA 4C4BA 2WUBL 4L8CB 3MJ7A 1OLLA 2VDNH 3O9WD 3V6BR 4AGLA 2RGSA 3ZZQA 3NPSC 2Q8AL 2A9NH 5D7IA 5DRNA 5FHAL 3SPHA 2KKQA 4F3FB 4M62H 4HK3J 5K59F 2QLVB 1ETZB 4MQSB 4U6HB 5D6DC 1TLKA 1XGQB 2J8UB 1P4LB 2XZCL 5F0PB 4XH2A 2CGYA 4POZD 3ZZ1A 4XP6H 2H26A 2G4GA 3LKOB 3V5HA 3M1CA 3SKJL 4XPAL 4A04A 4H7VA 4HKJA 2AJVL 4W9DC 3GXNA 4Z5RA 4WDIB 2WTRB 2XWCA 3LYRA 4G7YL 4PREB 4RWHA 2VQTA 4GW1B 2FJFB 3E9TA 4MZ2A 2GW5A 5DWPA 5DHYB 3EG9A 4Z7NB 4FQXD 3QDJD 2NZ9D 2V4LA 5HD8D 5C0RH 4NP9A 4HK0A 4JB9H 2AGJL 2VDKB 2PXYA 2Z91B 5F44A 1R5VB 4YHKH 1GGYA 4NXKA 1LP9B 4X6CF 2WYHA 3QEHA 3O3BA 4L9LC 2HZHA 3BSZH 3S96B 5HVWA 4JFDE 2X4SA 1JPGA 1MW2A 3S5LG 5DMIL 2FBOJ 3ARTA 2NY4B 4Z3GA 4R0LA 5BOJA 1CF8L 1SYSA 2I5YL 1I8IA 4S2SB 5D70L 5DEZA 2A5UA 3AY4A 2EDLA 2L7QA 4G1MB 5J0BA 3CZEA 4OLUH 1SOSA 5JIQA 2DV6A 4JPSA 3AQDA 1D5MA 2QQNH 2DQTH 4YHLL 5ADPL 1BM3H 3DV4A 2DKSA 2WZ0A 4N0UA 3SHSA 2X1WL 3L4TA 5HGDA 4WUUA 3EBGA 2R9HC 3HC4L 3T2OA 3WJLC 3P73B 3VXTB 4OV5B 5HGBB 1ND0A 4JL1A 1PF3A 3KWUA 3ZRSA 1ULVA 5E4EC 3WYRA 4NHCH 3OAZH 3LRGA 3SDDC 3K46A 5EBGA 1TCRA 1EAJA 3SKMB 5K9QG 2AQ1A 3D08A 1MCRA 3DRQA 2OYPA 2GBVA 1S6NA 3SE4A 3BIBX 3RTQD 4QGYA 3BFOA 4JN1H 2DIBA 2WLYA 1YEDB 3L3KB 5AZEL 1N8ZB 4YEFA 1R6VA 3U2SB 3MBEB 1J8HB 5I8CB 1JSYA 2R0ZL 4HUCA 3BXNB 1Y6NR 5HYEA 2ENSA 4QRRB 1FZOA 1NFIB 2JXMB 4KMLB 4KNSA 4FZ8L 2BZCA 4L8DB 3RRQA 4YLQT 5TDOB 3MRMB 4H8QA 4RMVA 4XPHH 2HFFA 2NOYA 3QUMA 4PWHA 5HHXH 1DBKH 3ESOA 1EEZA 1OSPH 2BNUB 3QPKA 1A7QH 5H37H 5I0DA 3CPLB 3FUJA 1NCNA 1SY6A 4KK5D 1UCTA 2WVSA 4JO8A 4Y19D 5ANHA 4PW4A 3WFZA 3ZL1A 1V5JA 4ZYKA 4OLWH 3M8OH 3UIYA 1OXYA 2F58L 3HAEH 2WBJB 2HVJA 3OC8A 4X7SL 1KGCE 1BF2A 3V6OE 2QSTA 3LIZH 4AL8C 4MNGA 4KNQA 4EZJA 1CXHA 3NK4A 5I66A 2BNRE 1DLHB 2MIZA 2B20A 5I2IA 4HWUA 1CK0H 3C9NA 4WI9A 4NENB 3MJ9L 2VR3A 2DD8H 3RPIB 2H6OA 3ARBD 3HR6A 4LO9A 3VWKB 1NPUA 3LKQA 4WFGE 2CKNA 5ILTH 2HPTA 3W0WA 4BRVA 2VXUH 2HH0L 1IBDA 5K1NA 1X5ZA 1X5JA 3RVTD 4ANXA 1CC3A 3SBWA 1M7UA 3DX6B 4UM9A 3ZKSD 4LLUB 1K2DB 5EOQL 3H7LA 1JJUA 2X2YA 3GRWL 4AM0B 1WP6A 1JMZA 5E1IA 1RUKH 4MQXC 3H9SA 1SYVA 1T5XB 1CD1A 4ZUTB 3S3SA 1T04A 1QTPA 1Y6KR 4NKQB 3P30L 5CJ8A 3BKCL 1JK8B 1JXDA 3VYPA 1KBGL 3US0A 1DBBL 4PJAA 4ODWB 5DHVA 1QWNA 2NY6B 1HINH 1N59A 2AEQL 3LTVA 4KKNA 4UT7H 1NMAL 4IOSA 1MCBA 4WV1C 3P0GB 4J6RL 3ZKNC 3DBXB 3ZYJA 3EH5B 1TFPA 3QQ9D 4JO4H 5KBDA 2KLRA 1I7TA 4WCYH 4EKJA 1RL1A 4LHJB 3E7JA 5D7IE 4AYDC 4KWUA 2EKSB 2BY1A 3F7LA 3DJRA 1QLFA 3KPSB 4ZMZA 3RDTA 5CLYA 3D48R 4K5OA 4TNFA 4HCGA 1RI8A 4QRPD 4PP1C 1M7DA 5EMYA 2WIIA 3U0TB 2HTLD 4QHUB 1SPDA 5FGBA 5L9DL 4IRZL 1FGVL 1A6WH 4DP2X 4H25B 3G5YA 1FVDA 5BVPH 5A43C 4N2NA 1QPPA 1NA8A 4H1LA 3GMOB 3EZ8A 5HHMB 4N2GA 4UV4L 3UO1H 3IF1B 1UJTA 4OLZL 4PRPE 1TKWB 4FNTA 4F8NA 1BQSA 3ZYZA 2PKDA 1A6VH 2ZXGA 3NCJL 5TFSL 4YHMH 4QD2E 2G3XA 3GJFK 4KXCA 2H5UA 2DLFL 1H8LA 4F24A 2WZ6A 4RGNB 4JBSA 4MXQD 4PBXA 4TULL 2Y4SA 1AR2A 4JG9A 1IT9L 4NO3B 4JJHA 5MHSE 4M8QB 3LXAA 3QUZA 3ATDA 5GJSH 3W5MA 5EA0H 2QADB 2EDOA 5EEZA 5DJ6B 3QGVA 3WXWL 4WUKH 4AI7A 4B3VA 32C2A 3AWGA 3KPRB 4FQ1H 5I74C 4HJIA 3TEWA 2EP6A 5EU4B 4MZIA 3OKNA 1AR1D 2AZAA 3DROB 1V27A 3GD1C 4ADIA 4HJEA 3SYQA 5LKNA 3DIFB 2EH8L 3ME0A 5KUKA 2GSIA 1KPVA 1ZK5A 3F62A 4BFJA 4ALAL 1QLRA 1A02N 2CDEA 4N2AA 1JV2B 1YEWA 1X6LA 3FRPA 4ZBJA 4QXTA 1XGZA 3R7QA 3RZCD 4WUUE 1Q72L 4MA8H 4QRFA 1A5FH 4NN5C 1NGQH 5KOMC 5LWYL 1GS7A 5EUOF 2XN9D 2AVFA 2IVFC 3QRGH 1VACA 3IDXH 2D7TL 1OO2A 3GSVA 3SE9H 3RWCA 3CDZA 2RFXB 3FU7A 4I1RA 4ODVH 3M17A 5EBLA 5C09D 4E9XA 4JHVA 1N4XH 3TT3L 2RACA 3VFPB 4AMXA 4P5TB 4IGBC 3ETSA 3MO1A 3GJEA 4DP0X 1Y1DA 4AQ1B 3ZDXE 1S78C 5TJWK 3U0WH 3L3HA 5D7HA 3QNXB 3ET9F 4OCSH 1A14H 5IIEB 3QRLA 4ABVA 3Q2LA 4P0DA 2CDGA 3QZLA 5GRJH 4KITB 1YC8A 2EIZB 2XXMB 2EE0A 4XN2A 5CFHA 1IARB 4BDVB 5MP6H 1D6EB 1Y18B 1M1XA 5DMGD 1PD6A 2BSDA 4ZSOE 1N5AB 1BMWA 1C8PA 1HNFA 1NC4A 3BAEL 3IE4A 4ICWA 5F9OH 1YY8B 5DK2A 4BFFA 5E00B 4J23A 1MREL 1SHXA 2W0FA 4HUKB 4JUSA 4KTEH 4S1SH 4Y2DB 5HDBF 4UMSA 4NWTL 5DD0L 4BM7A 2AXFB 5EIVA 4UQ2A 1D9KC 4BZ1L 2BOBB 3MR9B 1ZT7B 3L6FB 35C8L 4WEMB 3B9EA 4UM8A 4POZC 5T3XD 2RD0A 5FCUH 1EQWA 4TUKL 1ESOA 1ZS2A 4NWUL 3DO4A 4OLVH 4DUWA 3M86A 1QPKA 1ET7A 2G4EA 3BP4B 3HG1E 3VFNB 2WVTA 4PJEF 2CKBB 2WK2A 1J1XH 3R8BB 4LCWA 4ILDA 4QHMA 4W81A 3SOTA 1BLNB 4F15B 2OBGA 2G2RB 1HHJA 1CTMA 4FQXC 4Z78A 2QKIB 1MLBA 2NZ9C 3KPOB 2GSGA 2J56A 1M05B 1SM3H 2JCCE 1RIVL 2VLKB 4JFZL 4Y8DC 1IGTB 1F86A 1MHHB 1U33A 1ZJBA 1TTFA 4HKXB 3EBHA 3L5JA 5IW6A 3BAYA 1VEOA 5FECB 1XGPA 4Y5VB 5AL8A 5BQ7A 1CD0A 4E41D 2A7BA 3H9SE 1JUFB 2M8XA 3G5ZA 4K2UH 5HY9A 1O5DT 3NJMA 4PJ5B 3SYAA 4JY6B 3OV6A 1C7TA 2BNQB 4A6YB 2R23B 1ZPUA 2DM4A 1PDKA 1O7VA 1CU4L 1OAXH 1YMHB 2D9QB 2Y1VA 4J1UB 2ZG1A 2DTMH 3G5VB 1T7VA 5BUAA 2ZUYA 5J4MA 4MRCA 2J43A 3SDCB 3VB8A 1EJOL 1JHKL 1FVCB 1LK3L 3BEVB 3LAFA 1X7QA 4IDLA 1KT2A 4I18C 5JYMA 5IQ9B 2NY2B 5AOJA 2GG1A 4XRCA 5IHLB 1QRKA 3FC8A 5JXEC 2FEEI 4NNPH 4UNVA 4JCMA 1JZ7A 3MLSH 1E90A 1PLBA 3ARGA 3I6LD 3Q0HA 1A4KB 3NCYS 1ECZA 5TGBA 4MAUL 4QT5A 1DUZB 4OAWB 1MCNA 4MQTB 5FO9B 2ADFH 4IMLA 3H2WA 3VWJB 2BZDA 1FIEA 2Z64C 4QOKA 4XGZA 2WLNA 3MUGA 4WNQB 5DUBA 4KY1L 3HHRB 4YHIB 3V4VH 3IJSB 4JFFB 4NZDA 1BVKA 3RTQC 5F1NB 1QHOA 4JPVH 3UJJL 4A7GF 3SQOH 1OCZB 4GUCA 5HJBA 4L3EB 1I1FB 2VJ0A 1HILB 2NW2A 3P11L 2NXYD 4OIBA 1CDGA 2Q7YB 1RZ8B 5I1GL 3V8CA 5A6LA 3UPRA 4PVMA 1MWAA 3H55A 1QWUA 2VLME 3VH8A 4F57H 2GI7A 2OJEB 4L8CA 3INUL 3N44F 3RA7H 1JYNA 1T0MA 2A9DA 2W9EH 3B2XA 4ONGH 1EZVX 3OLIA 4OCMC 3WOVA 3IRCA 3ZU8A 1I1AD 2HFGL 1ETZA 3QEQD 1E4XL 4U6HA 3US9A 2J8UA 1XGQA 1LL1A 1DQJA 2YOCA 3B9KD 4YUEH 4PV8B 4PSRA 3SIKA 4PJHF 2IBZX 4N20A 1QSFB 3LKOA 5AKVA 5SX5H 4FE9A 2VSDA 2WQVA 3PXLA 4C58B 3WFCL 4WDIA 2WTRA 1YEJL 3JWOH 4PREA 5CINH 1HT6A 1AANA 4MD5B 5BV7B 1NL0H 2W81C 2FJFA 4GW1A 5F6IB 4JG0L 5DHYA 1HE7A 3WFDL 5L4FA 1X4XA 2MQ0A 1TTAA 2NX5D 4OJFL 1W8NA 3NRPA 2Z91A 3IMBA 2X2IA 3ARBC 4I0CC 1R5VA 4N0CD 5GS0L 1AGBB 1LP9A 2VN7A 3BAKA 1TZOA 5L0QC 2WQWA 4IRSD 1YN6B 2DBLH 3T0WA 2BP0B 3S96A 1SDYA 3UYRH 3UACA 4Y4FB 1JGEB 1YEFH 1LDPL 4FKEA 1D5XB 3RVTC 1YNTF 5DT1L 4KQ4H 4Z3HA 3VW3H 5IKCA 2O26U 4AJ0A 3MMEB 2I27N 4S2SA 2IGTA 2NW3B 3CDGB 2R2EB 3NA9L 4X6EA 4G1MA 4FD0A 4XVJH 4OT1L 4Q9QH 2FNWA 1ICTA 4X6BB 1WCBB 1OCRB 4AYFB 1REIA 1CTOA 2DI8A 5KYUB 4MNQB 3B2VL 2ZD0A 4UT6H 2XJKA 3GXDA 3RWGB 1FIGH 1QW9A 3WN6A 1XBDA 4R7VA 3QJHB 1AVAA 1J9TA 4I0KA 1BBDH 3WCYA 1LO2H 5IFAH 2NY5H 2NYZA 3QQDB 3QQ9C 3P73A 5C8JB 4OV5A 5HGBA 2NUTB 4TUJA 3VXOB 2BS8A 1M3IA 1U58B 1RPQA 1WA0X 2W95A 3ZQXA 1HZKA 5FLVA 2X4PB 2LAGB 2Z0UA 3SKMA 4NZRH 3OZLA 3LRMA 3NBNA 5LDSA 2NYYD 2B5IC 1S5HA 2OMXB 5DD6B 2NTSP 2R8SH 3BP6B 3O2VL 1KOAA 1YEDA 2A4EA 1LQSR 3L3KA 2IIJA 5E9DB 5L7XL 1GZHC 1N8ZA 3N9GH 3CHXA 5I1JH 3KPPB 3U25A 1J8HA 4LL1A 5I8CA 1A8ZA 1KB9J 3BXNA 4WRLA 4QNPE 4QRRA 1NFIA 2JXMA 5JNYA 4FG4A 4ZAKD 4O9HH 4NZTH 1B4JL 3E0GA 4L8DA 4ZZKA 1JYXA 3ILQD 1A21A 4F37F 4HSCX 5TDOA 3MRMA 3TGXA 1IM9D 2QKSA 3HC3H 3MA7B 2OL3H 4X4MA 5EBMB 3CVBA 3FH5A 4XNBA 2BNUA 4JFVA 1PZUB 2HT2D 2Y3NA 4MXQC 3CPLA 1RPKA 2AJXL 2JJSC 1I1RA 4E9LA 5K9JL 1HWGB 1QFWI 3QBTB 4HIEB 2W65B 2DKUA 1MY5A 3N1GC 2VJXA 4L4TD 4CKQA 5IB2B 5IT2H 1FL5B 2WBJA 3RU8L 3RVWD 3PAVA 5E6UB 2EDNA 1AR1C 2ADJB 1GOFA 4YXKL 1NBZB 3NQIA 1FC2D 5KVDE 4XMPH 4NUQA 1DLHA 1SBSH 4PJ8D 4NQEB 4IMKC 2COVD 2ZCZA 2GHZA 3NTCL 1AIZA 2WQ8A 4ORZC 1YC7A 3AT0A 1P9MC 2APSA 2X9XA 4RX4D 3RPIA 3T3ME 3RZCC 3VWKA 4BWUA 2D3LA 2NY7L 3V4PL 5ESAB 2F1AA 5E6SB 4DGIL 2MSPA 2VC2B 4W6YB 4Q97A 3DX6A 4MB4A 4LLUA 1QRNA 1K2DA 4ODSH 2OW7A 3F85A 4AM0A 3FTGB 1R0AL 4QOKE 1OSEA 1T5XA 4LARH 4ZUTA 5KTEH 1S9KC 2HSIA 3ATFA 3CTTA 1JK8A 1FNHA 1MH5B 3ALPA 3KNBB 4M6OH 1WBXB 5I30H 3HS0B 3N1PC 5CLTA 4ODWA 4HX1B 2OJ1A 3ZTNL 5I71B 3TA3D 5DMGC 4Y7MA 4M6NH 3L1EA 2X3AA 5DRXB 3QDGD 3MV7B 1RLWA 3CFIC 5IMMB 4G6JH 2EKSA 3CFNA 3TT1H 3JWDH 3KPSA 4F2MB 4FG6D 5T1KB 3RWEA 5C0AB 5J6HB 3CVDA 1U8KB 3MV9E 4HBCH 1XD0A 4M7JH 3U0TA 4QHUA 3U46B 4R90L 4GKLA 4H25A 1BM7A 1BOGB 2DQUH 4YBLC 5I16B 2OR8A 3GI9L 2WSPA 4YIQB 2ENQA 4MLIA 1SF5A 4EZMA 1MIEH 1RUPH 2B2XH 3NJFA 3CVHH 2VDML 4HCRH 5D4QA 3DMMD 3IF1A 3M7OA 1IV8A 3C12A 1TKWA 5KZCD 3FU6A 4FYQA 1VCAA 3U30C 5CUSL 3N91A 1A7NH 2WGXA 4LE8A 1DQDL 3MJ6A 1X7SA 4D94A 1MFAH 2DQEH 2YKLL 4NO3A 4GO6B 4M8QA 2EDJA 2VUKA 3V4UH 3MNDA 1DVSA 2IV8A 5D7SH 5DJ6A 1M6UA 1ZIAA 3HBGA 3ZSTA 4XNUL 3PDDA 1Z0MA 2APFA 4BSVB 1IFHL 2JKRM 1ASPA 2P5WB 2VXVL 1B0GB 4R8WH 5DD3H 2AK4D 3DIFA 4XE0A 5KSAB 2R1XB 2VT0A 2C3XA 4PW3A 3OSVA 2P8LB 1KGUA 2APVA 4PJFB 1DJZA 4QHPA 3U7WH 3VVVA 5SWSD 1JV2A 4ZTOL 4NS0A 2VDOB 2BP8B 2IWKA 1RFDL 2BERA 5MEOB 3TO4B 5EU6B 4OUUB 4OCWL 3WE1A 3ELAT 4G8IB 4NQCB 3PL6D 3F6IA 4JO3H 4P5MB 3K2UH 1Z32X 2RFXA 4PV1C 1X5GA 3HMXH 3VFPA 4P5TA 2E8YA 3WNNA 2IG2H 1U2YA 1MG2C 1IKFH 3OF6A 4AQ1A 1RJYB 2H1PH 5DRWB 4LSTL 2WXHA 4K8RL 5IIEA 4HXBH 3P40A 4G42B 4N8VB 2EIZA 4YBHA 4I0PB 1RD6A 2VZUA 1AS7A 2P7TB 4BDVA 1HHKB 1Z3GH 1M6OB 2NXYC 1KJVB 2NYKA 2H6PA 4I77L 4YQXL 2Y7MA 1BA9A 5A2BA 5B1JA 1N5AA 1PKQB 2DJSA 5FDYA 1CR9L 4X9FA 1YY8A 4QDGA 5BW7C 2BHFA 5E00A 4X4ME 4KJPD 2ZXWB 4M6ML 4Y2DA 3GNMH 4ELMF 1P4UA 4UV7L 1U95B 1ACCA 1BF8A 2AXFA 3IS0X 1I1AC 4FP8L 1B6DA 2BOBA 3GMMB 3MR9A 4BFOA 1VPOL 4KROD 2FX9H 1ZT7A 3B9KC 4MJ6B 3N50A 1A4BA 1DQVA 1YN7B 1F6LL 1YYMH 4GXVL 4CUCA 4Z1PA 1NCDH 4AIXA 5GGTH 2IQ9H 1JGVH 3UBGA 3BP4A 5HPOA 3VFNA 5LO7A 3RGVB 4UTAL 3LD8B 4WQOA 2Z35B 5LQBL 2CKBA 5LNEA 1E5UI 3TBBA 2DS4A 1BLNA 1ROWA 2WO3B 4NHUA 1BQLL 2G2RA 4HWBA 2QKIA 1JZGA 3KPOA 4XBPB 4EN3D 4M8UA 5CZVH 1TEYA 4KGLA 1M05A 3ULUF 4LSRH 2ZNXA 3PAZA 2YQBA 3VGBA 2VLKA 4N9OB 1IGTA 1NCUA 1PD1A 5B1BB 2F68X 4HUMB 5KJ4A 4WI3A 3O2DH 2WWNA 4HKXA 3PWPD 4IRSC 3V0VB 5FECA 2D3VA 1BPVA 1QRNE 4FS0A 4Y5VA 5JOPE 1HOEA 3C5JB 3DA0A 2QFPA 1T5WB 4PBVC 1JUFA 2XWEA 1JZ8A 2QQLH 2DMBA 1OCWH 4CN6A 2QGBA 2FYYB 4PJ5A 2LLLA 3BUYB 2VRAA 4JY6A 2BNQA 4A6YA 5C0JB 3B4NA 3VXNB 4J1UA 4S1RL 1Q4NX 1YMHA 4RAHA 2EYSB 4G8GE 4MJIB 2FWOB 3OR7B 4X5WB 3SDCA 3ZE1F 4L9DA 1FVCA 3OMAB 4N2OA 3BEVA 2YD2A 4CMMA 2PLTA 4WW2B 1O7DC 5D9SB 4OZHB 2WBKA 3SEPA 2OP4L 5DO8A 1LE9B 1SXAA 3GHBH 3V52H 4XO4A 1TZAA 1A4KA 3WTTA 2E9JA 4OAWA 5FO9A 3MROB 1MAML 1GAFL 3VWJA 3D9AH 5E99L 2NYYC 4WNQA 4TVPD 4YHIA 4HG4J 4JFFA 4MQ7A 3VRLE 5F1NA 5BOPA 3VXRD 1CL7I 2W9LA 3GSUB 2XV0A 5LAXB 3VQ2C 4H20H 3MLXL 3IJEB 4L3EA 1I1FA 5E1GA 4FABH 1HILA 5HHME 2Q7YA 5CN2A 1RZ8A 4UQ3B 4M7LT 3KLSA 1BQHB 5TPWH 2OJEA 4YK4B 3ILQC 3LRSB 5EZLB 1DLFL 2O93L 4GH7B 4W93A 2F53E 1NC2A 1A1OB 2YWZA 1J86A 1DDTA 4BBWA 2HT2C 5IVXF 4PV8A 1TQBC 3SZ6A 4XNXL 4UTBA 1QSFA 3VFSB 1NKOA 5EDXA 1BD2E 1FJ1B 3QFJD 4K9EH 1TO5A 3UROR 2Y06L 3VTMA 1T3FB 3IRZA 3OPUA 5L2KE 3RVWC 3T2NL 4MD5A 3RZWA 3OMIB 4AT6A 4ANKA 4PWEA 2DH2A 2GKIA 2KH2B 2K8MA 3IDJB 4PJ8C 3VMPA 2WVUA 3ZL4L 3PHOB 1QFWM 3MXVL 3IAQA 4ZI8A 1AGBA 3H3PH 3N43F 1FZJB 5J8OA 1YN6A 2BP0A 2ZJSH 4JO2H 3RUGE 4Y4FA 1JGEA 5IW3A 2WNWA 1D5XA 1JFQL 2XIBA 2J8OA 3UMTA 3WIFB 3APFA 2PF6A 3LZQA 3MMEA 4D0DB 1UWGH 4JO1L 4W9FC 2QPDB 2HKHL 2NW3A 5EN3A 3CDGA 2FEJA 2LR4A 2R2EA 4QY8B 5FX3A 2A74C 1YYLH 1SFHA 4X6BA 1OAKH 1WCBA 3QW9A 4AYFA 2FNBA 3GBNL 1DJGA 2F15A 4L23A 2V8LA