2KLRA

Solid-state nmr structure of the alpha-crystallin domain in alphab-crystallin oligomers
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
82
structure length
82
Chain Sequence
b'RLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-crystallin B chain
publication title Solid-state NMR and SAXS studies provide a structural basis for the activation of alphaB-crystallin oligomers.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 13
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
A PF00525 Crystallin Alpha crystallin A chain, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2klrA00
4I88A 2XCMC 2JKIS 2K8QA 3IGFA 1SHSA 2WJ5A 3L1FA 4JUSA 2CR0A 4RZKA 1X5MA 2CG9X 4YDZA 4YLBA 3GUFA 2Y1ZA 1WGVA 2KMWA 3Q9PA 3AABA 1WH0A 2N3JA 3EUDA 4ELDA 2KLRA 3L1GA 5LUMA 2O30A 3GT6A 4YE0A 4PBDA 2MNWA 2Y22A 3W1ZA 4JUTA 5DS2A 2BOLA 3QORC 4ZJ9A 2RH0A 4FEIA 4PCKA 3Q9QA 3VQMA 3J07A 2WJ7A 3GLAA 1RL1A 3AACA 4M5SA 4YLCA 1EJFA 2Y1YA 3N3EA 4M5TA 1GMEA 2N0KA 3QORA 4MJHA 1WFIA 3VQLA 3QORB 3L1EA 5DS1A 4YL9A 3QORD
chains in the Genus database with same CATH superfamily
1A22B 2XSKA 5SWZA 1MHCB 2EICA 2GBAA 3AXIA 1I9JH 3BSGA 4YSOA 4RRPA 4U6XA 2RFXB 1LK3L 2VQ1B 4XPTL 4UM9A 1BAFH 3H2QA 4KH9A 3HMXA 4S2SA 3EYSH 1WFMA 3QI9A 3N55A 1IV8A 3U1SL 5DGRA 1QSEA 2WCPA 2O30A 3E9UA 2JJVA 2OMTA 2QTEA 4TUJA 4OF0A 5DRXA 3S6CA 3STBA 1I3VA 2X88A 4BSWA 5JPMC 1UUNA 4XPHH 4HFUH 2UZXB 4ACPA 4NKDA 4BFBD 1MFAH 4D7PA 3OKKA 4G9FA 5IW6B 5MHSE 4YFEA 1ZTXL 3LKRA 1HL5A 3N06B 5EUKA 4BZ1L 4EI6A 1YYLH 5HVGB 3QQDB 3VXUB 1LE5B 1R24A 1HWGB 3NIDE 2IANE 2EIBA 2UZYA 2L04A 2B3RA 1EJOL 3ARQA 1M9WA 1QI4A 1NFIB 5E9AA 4D9LH 3OMIB 4Z7OB 2Z31B 3SE4C 4GXFA 4YSUA 2VSCA 1CD8A 2VXQL 4WWKD 2OA9A 5EU4A 3HC4H 1S7VB 1AQMA 1JHKL 1MI5B 1SBBA 4X8XA 3TF4A 1KTBA 4GSRA 3PWPD 2EC9U 2AV7B 3MRHA 1ZJAA 1HI6B 5CSZA 2FX7L 3T3ME 4QEGA 4NUGH 4E42A 2Y6SD 1XIWA 1BFOA 2GTZA 4BK5A 3V7AE 1XQ4A 4GI9A 1WYJA 4RAUB 2YBRA 3ORJA 4JPVH 1ML0A 2WLNA 3WHXA 1ZMYA 4U1IA 4PJDF 2ESVB 3SKNA 3E3QE 1MFCH 4J28A 2H0EA 1URLA 1RUMH 1OAYH 1VPOH 4UTAA 4FNQA 4EI5D 1Z6JT 1DBBL 4TRPH 3Q1EA 4OH2A 3H8NA 4YBQD 3T0EA 1XF2B 2FJUB 5BJTB 3PQYB 4KKAC 4RFEA 1QHOA 4GUPB 5J7CC 1NCOA 3FB8A 1A9BB 3GS4A 2P5ED 3CBKB 4ZAKD 4JFFD 3IETB 2EKSB 2WLJA 4GRMB 1CTNA 1G87A 4J1UB 2F8XC 2NW3B 2EEDA 2FHCA 1GZPB 5K1JA 3UZEC 3DX3A 2AEPL 3CDGB 2HTKC 4U1LA 5CINL 1KXHA 3DX0A 1VENA 5I23A 3P9LA 5EN2B 5FUOL 2J44A 4ISVB 4XPGH 1SXNA 3VFUA 1DQQB 2MNWA 3BXNB 1RZJH 1Z9LA 3DK0A 3FHAA 4NQSB 4YZWA 1XGUB 2E6PA 1FVDB 1YECL 2AQ3A 3EYOB 1R3JA 4MAYC 4PGBA 3WMPA 3NJJA 2X6VA 1WS7A 1Z7JA 3N3EA 4J4PC 2ITCA 2XACC 2GY5A 4UV7L 5AOLA 1HYSD 1NMCC 1AAJA 2CZNA 4KY2A 4LVEA 4WFEE 2WWOA 3VQ2C 2VLJD 5D7LD 3C5ZA 4HXAL 1M57B 2O5XL 4KDTA 4M7JL 4WO0A 4ZFOB 3BZ4A 3C8KA 3ARRA 3VXSD 4DJMA 1T1XA 1M7IA 4XMKH 4D7BA 2R8SH 1V3MA 3RU8L 2CIIB 2K4AA 4HISA 3WXVL 4BQ9A 1E3FA 3ISYA 1E4KA 4M6OH 1G94A 2BWIA 5EBWB 1UOKA 3CDYA 4HX1B 4KKPA 4QMEA 4F9PA 4I18A 4KI5D 4YFLF 3EDJA 3I9GL 1O9VA 3E6HB 2WBJB 3K3QA 1KBBA 4N8VB 5AYQA 1VRSA 2XZQL 1HXYA 1GC1C 1NC2D 3GXIA 5INCB 4OBSA 1ES0A 3KGTA 2NR6D 2YO3A 4FNPA 4K5OA 4NZUH 4WNJA 1SLXA 5AW0B 4R4BA 3DV6A 3FDWA 4JREC 2NNRA 4KKBC 3SOTA 2YAPA 3ARSA 1I9IH 2OAAA 5F9JA 3CHQA 3RDTC 4FEMA 1FGNL 3HLAB 4PJ7A 5DZNA 3IDJB 2W5PA 5LN8A 2YD2A 2CUAA 5EU3A 4A6YB 2H6PA 3ELAT 5CJBA 3BP4A 2Q8AL 1PY9A 3NK4A 5LNDA 2CRZA 3OKDA 1KIQB 1GMEA 4XN2A 3B2VL 2R29L 5IT2H 2PF6A 2YAMA 5F9OH 2FL5A 3BUYB 3G5XB 4GRWF 4XX1G 3CLEH 1BGXH 3KHOA 1UZ8B 1A7QH 1GXEA 3BW9B 1CLVA 4JFXA 1UFUA 3QAQA 3ULUL 5I18L 4G6FD 2VLRD 5IQ9A 1KGWA 5HHOD 1KBPA 4GW1B 2OZ4A 1WO2A 3TO2B 1OY3B 1UT9A 6PCYA 1UATA 2BLFA 2QPUA 1I7ZB 4UT9H 4F20A 4ZMZA 1L4IA 4WO4C 5HYJD 3D4GA 3IDNA 1A4CA 2C1PB 4JFEA 1PD0A 5IFJA 1F0LA 2N4IA 4O2EA 4NWUH 4Z76B 5E24E 3DO7A 5C09A 4JR9H 2MCMA 2DWDB 5TE7L 3WS6C 4L48A 5AAPA 3AM8C 2ZWKA 2BDNL 5FO9A 4O2FA 4ZYKA 1JNLH 3QJHB 3V0JA 4E2OA 1W72H 3HC0A 1UFGA 4R5XA 2PYFB 3SYQA 4M3KB 1S7TB 3FB7A 2YXFA 3I74A 3KBPA 5EU7C 1SYSB 4PJIE 2ZSVA 4NBZB 5FF6A 1S2EA 1MJJA 2BZCA 4PJBE 1NDMB 4LVHC 3TO4B 3FN0H 5EF1A 5F88B 1RURH 2YK1H 4F91B 1NINA 4U33A 5SWQB 3LCYA 3SDXA 4DW2L 4GRWB 2Q3ZA 2YAQA 2KLTA 3HEIB 4Z0BH 5C0CE 5T1KA 5C97A 5CGYC 3NVQA 2MPAL 4RLDA 1KYAA 2JVUA 2R1YB 1BLNA 2NNXA 3OKOA 3DMMD 3QRLA 1W8OA 1AGCB 3VACA 1BOGB 1NL0L 3G6DH 1Y6KR 4XMLH 3Q8EA 4EOWL 1KSRA 4WRLA 4KJWD 3O0RL 1PZBA 4BQBA 4IBQA 3PG2A 3FBKA 4FX5A 4XBPB 3BJ91 5DD0L 4JDVA 4OCWH 1CGTA 1ECYA 1MAKA 2BVPA 5F96H 3CK0H 3T4YB 1BZQK 3F85A 4F58L 1MCWW 1XF5A 3HC2A 1QUNB 3LEVL 3IDUA 5I6OA 4D8PA 2AEIT 1C1EH 1QBBA 3MGOB 1GS6X 1AQKH 1L0XA 1UXSA 2H6OA 3K72B 4XMPH 4BQ8A 3V0DA 4LLMB 3CD4A 1ZT4A 1G7MB 1IL1A 4DP6X 5IB2A 4LCVA 5KANG 4M6ML 4X9HA 3KPSE 4UUJA 2DQFB 1RIHH 1ETZB 4DPRA 3DVIA 1RMFH 4YDIH 4MCYB 2D7TL 3CFKB 3E0GA 4U0QB 5B7EA 1NIEA 3F58H 4K4KA 1HESA 4FMVA 3KYKL 1HE8A 4NRYA 3X3FH 4YHIA 3MLUH 1INQA 3PHOA 3QNZA 4M61B 2VDRB 4F1ZA 5TQ0H 4FG4A 5JXEA 4AH2A 2HJKA 1QHPA 5KYUB 3BWUC 4L3CA 1TU2A 4UANA 2APVA 1SFDA 3NRQA 2E0PA 4KNTA 1NM4A 5TF1L 4DN4H 3F62A 5ISZD 1PGRB 2FT7A 4BEIA 1M7DA 1WSST 1DSFH 2G75B 3CQQA 1B4JL 5I8KH 3OAYK 2DQTH 4QWWC 4R0LB 1EFXB 1S7XA 1EJ6A 5FGBC 2AJZA 3P30L 5AENA 1AQHA 1TCMA 3A4FA 5D8JL 5ITBL 3A3YB 4QHNB 4X7SH 5IESH 1QWHA 2Z31D 3QUXB 3KEHA 1I7TB 1Y7VA 1R6VA 1MI5D 3WD5L 1RUQH 5BS0B 4FYSA 4LF3A 1Q9LB 2Y7OA 5GS3A 1UH2A 3CDCA 3IXTA 3J2PA 2YQGA 4HWBL 3EH3B 3MNZB 3BKML 2W59A 1HH9B 3C5XA 3CC5B 4NQDB 3OSVA 4NQEB 4OLWL 2B1HL 3CZFB 3HC3H 3PJSB 2WJ5A 4ORZC 5KVDL 5KANI 4QYOB 2X87A 1ADWA 5F6IC 3JWOC 1IGFL 1DN0B 3FO9B 4PGCB 4Y1AB 3TBYA 3BVTA 2YIHA 3VW3H 3CXHK 3MRFB 2FGWH 2ZKMX 3FB6B 2Y3AA 4UYPA 5HHPB 1JZ2A 4NWTH 3S8GB 3ZJAA 2MKWA 2X4TA 4GEJA 4HKZA 5L8JB 3V5HA 3KE0A 3FU0A 4LQFH 5IF0A 2ILLA 4H8PA 4NYLB 5SX4I 2WN3A 1CCZA 4M7ZC 2X7LA 3U0TB 3QYMA 3TLRA 3RWIB 4F8PA 4NN6B 1DLFH 1NZRA 1FL6A 3REWB 2QHRL 3JV4A 3SCMB 4LSUH 5L7XL 1F3JB 2FLMA 3U25A 5JTWA 5KW9H 3EFOB 2ADFH 3JV5A 2HFEA 1HHKB 4BRJA 3I6LD 1QSFE 4NZJA 1M7XA 4FNLL 1JFQH 5F97E 4X4YB 1HINH 1N59A 4XP1L 5T3XH 3GBML 2E7BA 5D2LE 3T6WA 2J6WA 1U95A 3K8MA 4NSKA 2YUXA 2PCXA 5C0ND 1HH6B 3CPLA 1BXVA 4X6DA 4R9HA 3HNSL 4K8RC 3KL3A 4NQVA 1KENH 4DCQA 3C60B 3RVUD 3UO1H 4U1KB 1E4HA 4P46B 2EDLA 2WIIB 2B4CL 3AMLA 1GGYA 3WIHH 4KUZH 2VLMD 1JF1B 1X5LA 5FDWB 1DE4B 3VFGL 4LNRB 4J3VA 4K9EC 4QJ4B 4B3VA 2YPLB 3B2UD 4HBCH 1ZS8B 4NGHL 3JWDC 1MY7A 4PWGA 1FHGA 1IFRA 1OWWA 5C0EB 4MNQA 1EANA 2H3NA 3MACL 5FAAA 5I74B 3QFJE 1C08A 4Q7DA 3WN6A 1MAML 1I7RB 1Y6NR 2WBJD 5A16B 3ZDYE 4HIHA 5TFSL 3GMOB 2OSLA 3BYTA 4YAQB 2EDEA 3ILQD 5J13B 4JFDD 2DM3A 4P2QE 3SBWA 4XRCB 1G7HA 2XYCA 1QW9A 2DM2A 4X4XB 1BG9A 1T5WB 5CZRA 4BFFA 2F1BA 1LMKA 1GH7A 2PUQT 3U2IA 2DY2A 4JMXA 5JOFB 1UA3A 3QZNA 2PWHA 3FH8A 5GJTL 1JGIA 4XO5A 3NA9L 4PJXF 1AD0A 1CBVL 3O2WL 2ZKXA 3NQIA 3PUCA 2MSPA 4BWUA 1EO8L 1SJEB 4KVNL 1U2CA 5HHVL 1U3ZA 5CEZE 2J1YA 1AD9A 1G6RA 1AOHA 3G6JF 1MCOH 2Y1VA 2C8NA 2XZZA 3E2HB 4ANXA 4Y5XA 1TVDA 2DDQL 3PDGA 1QFOA 5FYKL 4MD4B 3U7WH 1SF5A 4NQCA 4N8PA 3FULA 4I0PB 4KO6A 2CDFB 2X6AA 2GJ6A 4JY5L 2XG4A 4TQIA 1BVKA 2K9FB 3FPXA 4NFCA 4J8QA 4ETQA 4ZMLA 1KZQA 4HHAB 4JZNA 1HYSC 2DYPA 2QGEA 3FHEA 4WSJA 1RZGB 1KN4L 2QQLL 1B90A 4OZHF 1EEQA 5GZNA 2OQJB 3AREC 3L3OC 5JHBA 2OW6A 1FUNA 3O6FB 3CJJA 4HJGB 1XGYH 1M1XA 1A7PL 5DTFA 3O3DA 4DT2A 4TVPD 3MCLL 1NLDL 3U4EB 1N5YH 5DJCA 1LEIB 1OF0A 2ZKHH 2R51A 4AQ8A 5JPNC 1UCBH 4QHKJ 2HX7A 4XPAH 5GGSY 4FJYA 4KI5C 4XGZB 3MN8A 4DVRH 1MWAA 4NLHA 5IJDC 5MEQA 1XCQA 2EH8L 1TUPA 4AXWA 3NZ8A 4PJXB 3RWJA 5JNYB 5EORL 4CSSA 1CIDA 1JV5A 3MR9B 5L0QB 3FB5B 1MCIA 3GMNB 3VI3B 2WV3A 5EUOE 3G6JB 3WKML 5I66B 2Y69B 4I7ZC 4QI3A 3SGKA 2MOVA 1THAA 2CG9X 1B4TA 1LK2B 5C0BE 4XAWL 2X4NB 3GIZL 1DFBH 1F02I 3UC0L 3GI8H 2AXFB 3LRSB 3GINA 4BV1A 5F7UA 1KYOJ 2X42A 4LCCA 4YGAB 4IBSA 2EDQA 4MJIA 4TF4A 4XP6H 2BY0A 5I8CA 3STZA 4EDWL 5E56A 1JNHA 2G2RA 3PHQB 4WFGD 5IJKC 3FUHA 4PRIB 1P4BH 1QG3A 5G55A 4JZOB 1F3DJ 5TJWK 1I1YB 1RAMA 2UX7A 3Q3GB 2VIRA 4W81A 4JDEB 4Y9FA 1H15A 3N0AA 4DZ8B 2XG5B 3KPNA 4JAMA 5T1JA 5ECGA 3BGMB 2DQJH 3LZFH 2HX9A 1F4HA 2GUOA 5E5RB 5IEKB 4PCYA 2WXPA 3ZYOA 4GP8B 4JQIA 1KJVA 3SPGA 1KMGA 4NAMA 5IOKA 1X44A 3FFDA 4OD1H 3JWNG 3EO1B 3L5XH 4F9LC 4FQJH 5AOIA 1USQA 2FO8A 4RMTA 4NENA 2HG0A 1CB4A 1UD4A 4MA1C 1NOAA 1H19A 4GMTL 4EF3A 3DGGB 3HKZA 5DVNA 2PXYB 2GAZA 3RDJA 3VQ1C 1E28A 2JH2A 4ANVA 2BJMH 4A55A 1P4LB 3FT4A 2VUYA 3DOIA 5D1XE 1OF2A 4M62L 5AVZB 4IU3A 1DLHA 1FYHB 4Q74A 1TQBC 1A1MA 2COVD 4YGVA 4ZX6A 1JK9B 2JV6A 1PKQB 1MJ8H 2AERT 3A6CH 3L8QA 3MA7B 2XQYA 3N42F 3DHMA 4G1EA 2EO9A 4NCDA 3EHBC 3ARDC 1A7OH 1SLUA 3HG0A 1RERA 3EBHA 2D2CC 5LGHH 4HWBA 1MRCL 1TZGL 2IPKA 3GSOA 3GRWH 4HVBA 1EFXD 3MU3A 3HRZA 3NSDA 4LCYB 4NUJA 3RL2A 1CYGA 3BPOB 2OTUB 5TH2A 4FQLH 1ZVSB 2W60A 3Q5YA 4J7RA 2R9HD 1N3NB 2IALA 2NRDA 3IGAA 5DEGA 3TIEB 1RSFA 2J8HA 3QUXD 3OJMB 4R8WL 1S6NA 5T1MB 1XL6A 4V2BA 2F5BH 1N8ZA 5E6IC 4TQPA 5MI0C 2XFXA 1X9UA 4BSVB 5BS0D 1JXJA 3B9KC 3HJ0A 3CTTA 1FFTB 4MXQD 4R26L 4CGUB 1XZ0A 2F5AL 5FCUH 3UMNA 2F1EA 4XXDA 3D0AA 3APDA 4KV5F 2VQ4A 4XOAA 4N8UA 3HS0C 4GG8B 4NQDD 3BAYA 4FOMA 2ED6A 2FLBT 3DX9B 1CL7I 3D4ZA 3HCVA 4FTVE 3QDJA 4Y4KA 2EDOA 4N6RA 3PFUA 4YHYC 1E6JL 3HE6B 1JPTH 1JVLA 1SFHA 4IRZL 4Y1AD 1ADQL 4M1DH 3RX8A 43CAA 5BO1H 2Y2WA 4JMNA 5K59F 3NFNB 2WNXA 2QQQA 2ZX7A 2V5SA 4JCLA 4LKCB 2Y1YA 3DOSA 3P11H 2V7NA 4QRRB 3VFVA 4MZ2A 3N42B 4ZS6C 5IHUL 1J0JA 3D51A 4OTXH 5TK4A 4C4UA 4I3SH 4C83A 1K4CA 2LW3A 2BP0B 1BYOA 2P80D 5E9NA 1AR1B 3OHXC 3SCMD 3ZGIA 3BZ5A 2AQ2A 3MLTB 3TA3A 1G7LA 1VFOA 2VKWA 4WHCA 4JB9L 1YY9C 5JHMA 1CFQA 1SJHB 1AQ8A 1LO0H 3O3AA 1URIA 5GJSL 3DARA 1GTNA 4ZPVB 1AVAA 4Z7WA 5I75B 3WSQH 2DIEA 5F1IB 3GTTA 3EIFA 3WG7B 4PMEA 3NA4A 3BT2L 1BQ5A 4RAVB 3MCKA 4H88L 4LLYA 1Y1DA 3NUKA 4OZ4B 5K9JL 4JPKL 5KG9A 1KB5L 5CEXA 4Y9EA 2XN9B 3CMOL 4AQAA 3G04A 4ZOCA 3MLVH 3BKYL 4HQQH 4JVUA 4P46D 4QKXB 5ILTH 2MHAA 2OTWB 3PGCA 3JTSB 3DDFA 2J43A 5EBLB 5F21B 4OD2B 3FUJA 1W16A 3VXMA 1S7SA 5DJ6A 2HLEB 2IAMB 3A24A 2FSEA 3MODL 4IMLB 5HI5D 3NZHL 3BQUB 3FXIC 1MCCA 3C12A 5HGAB 4TNVK 1RXLA 3QEUA 4JCMA 3NIFF 3KCWA 5BZDA 2AI0L 5BZXA 3VFSA 4P59H 4Z78B 4XOBA 1SNRA 4LLWA 4JGMA 4Y2DA 1EH9A 5EIIB 5EC2A 2DF3A 1LMIA 1JN6A 4RMUA 4ENED 4ODVL 3TS8A 2W88A 5HGDA 1YAIA 4QOKB 4WI2A 2G5RA 1X5GA 2W1NA 5BVPH 1DTUA 5I1AB 1D9KC 3AUVA 1VFMA 1INDH 4MMZA 1MNNA 1UD5A 3HG1E 1FIEA 3QORB 3QRGL 3FSAA 5L6YL 1BLIA 3V5KA 3Q1SL 4FXKB 1LWRA 4P05A 2OS7A 3FAXA 4ETYA 1J5HA 2VLLA 5HP5A 2W9LA 2X0VA 4HCIA 2FATL 3FO1A 3KVDD 1E9OA 1TPXB 1VFAB 1LO2H 2GIMA 3ERXA 3UP6A 4O02A 4BH8A 2PTTB 1A47A 4KXAA 3HG3A 3NJKA 5ADPL 3WGUB 1NGYB 2D03L 3R4RA 1RIUL 1EBPA 2UZIH 5J12B 3EGXA 3ZO0A 4H5SB 2DQMA 2AC0A 3KDPB 1GTFA 4GJTB 2ZKWA 4LSRH 2HH0H 2YWZA 4TLKA 3O6FD 1OGPA 4WLCA 5D96B 3KNBA 4F1SA 3TYFA 4EKJA 2OI9B 3H3KA 1FYTE 3LNEA 1QX1A 1KCRL 4O2CA 4PP2B 4C4KO 2R0ZH 1NUFA 3BIKB 3ESOA 4BUHA 1IAIH 3NZSA 4CN1A 1WUZA 2A77H 4KU1A 1JE6A 1QYGH 4H25B 4PFEA 4PJ9D 3KYMA 1JWSA 4R4ND 5TE4H 3UTQA 3ZE1F 4B9IA 1M6OB 1XCTB 3LD8C 3PL6B 1HEZA 2P8MA 3PHSA 3FCTB 3QNXA 1IM3A 4D0DA 1MREH 1MCBA 4L9LA 1TZHB 5L2JB 2HP4A 4M8QA 3AS3A 3UXFA 4FQ1L 3WJJA 1T5XB 3ABKB 4XN8A 3ROLB 3ULVE 2DD8H 1MHEA 1G4RA 3SKMA 4DO5A 5D7IA 1BAWA 1LDSA 1V54B 3HI6H 5KVGE 3WE6A 2WXLA 5DEFB 4PJHA 5KYYB 4EIBA 3QR2A 4KQ0A 1NBZB 1ZHNA 4IKIA 4ZFZA 4FXTA 3UAJC 3N9GH 2F74B 4JN1L 4MBRA 1FJ1A 1U93B 3C6SB 2WSPA 4BCZA 5I8OL 2X6MA 4MD5A 3MRBB 2ADGB 3O3BA 4MKMA 5HHNB 1MXGA 1URZA 1RK1B 2FWSA 4ACTA 4WIQA 3CDZB 4PLJD 2OV0A 1IU1A 3FQ2A 5TE6L 3VXRA 3GSXA 3PXLA 3QIUA 1UB6A 3BZEB 4AIZA 3ZL4H 4OF3A 4WCYL 2ZIDA 3Q8FA 2EAEA 1AZCA 1CI5A 3KCPA 2B8OT 4G42B 1CU4H 3BCFA 1FL5B 4ZUSA 3EZJB 2OYPA 4OUUB 4CMHB 1ZHBB 3BVNA 4WW1B 3MRKB 3ZE1B 2FRGP 3GMQA 4JM2A 1AO7E 3CQPA 1KCVL 1S9XA 4KPHL 4WFFD 4JKMA 3W11D 4ERSL 5HYQA 3IGLA 3LV3B 1O7DC 4F37K 1OSYA 1YSOA 3MJ8B 4CW1A 3VSTA 4GIAA 4M9PA 2CPUA 3QCUH 1A5FH 3AGWA 5EV7A 4HZLA 5J6HA 1BVZA 1T66C 4OQTH 4Z3JA 3WIIL 1NMAH 3B2XA 2ODHA 3CFTA 1AHKA 3PJNA 4JCWA 3RTQB 1A3LL 2ODIA 1UWFA 4JRYB 2PXYD 4DP2X 3P69A 3FSZA 5LDSA 1ZLEA 4EBQL 3GYRA 4MYPA 5A6IA 1ZPLA 2Q6WB 2BOLA 4AUJA 4N3TA 3TO4C 3S3PA 4GW5B 1OWRM 2IFFH 5D70L 4OIBA 1QHQA 1W0WB 4I77L 3GBNL 4X6CA 1H3GA 4GAYB 5ECJE 1RLWA 1OPGL 3QHFH 3V6FA 5FB8B 3DNKA 4KMTL 1PQZA 5I1HL 5KVEE 1NLBL 2K9UA 3D69B 2WO2B 2VSMB 4N68A 2FJSA 1LO3L 1E6OH 3HN8A 5L2KE 1OANA 3VRJA 5HHQA 2B1OA 4OLXH 1CR9H 3VRIB 5INDA 5KTEH 3FT2B 4KKLC 4TVUA 4WKXA 4MA7L 5FGSA 4E0RB 2H2SC 1ZAGA 2A7BA 1OARL 4CVZA 1PF3A 3FS9A 5C07B 3ZE0F 2WHVA 1ONQB 1BQHG 2PYEA 5DUPL 3PDDA 3X1EA 3B56A 5IMLB 1CK0L 3IFNH 4AKOA 1ZLVK 4AGMA 2UZPA 4M7LL 1MCRA 2J72A 4Y4FB 4MA8L 4AL8C 5FHAL 2HG5B 3HE6D 5IROA 2UY7A 4AMKL 3CPUA 2X2YA 1IQWH 1R3HA 1XSIA 4XNZB 4AEEA 4UMSA 2JELL 5DT1H 1KCSL 5AAMC 1Q9KA 3BSZA 5EO0A 5ADOH 4X9GA 3T9WA 3R0NA 3L7FA 4IS6A 4G6MH 1W80A 1NANH 2F7IA 2BHZA 5DHYB 2OMUA 4HWEH 4NNXA 4V11A 1WS8A 1EVTC 3ARUA 5IB4A 4BZYA 4F8NA 2F68X 3INOA 4QRRD 3H55A 1B0IA 1UZ6E 4KX7A 4NJ9H 4P5MB 5F0JB 5GGQL 1SXBA 3PJLA 4K94L 1UEMA 2D3LA 3NSXA 3O2DH 4JGUA 2BS9A 1LP9E 4L8SA 1AR1D 5ALBL 4L4JA 5KS9E 3VD2A 3ZYJA 1N5AA 1KB5A 3OJ2C 3NJHA 4OZGE 2Z35A 2GK0A 1J48A 3RX7A 3ZTJH 5TD4A 1FZKB 5C3LD 2Q87A 1WGOA 2JK5A 2Z91B 5FYLL 2IDSA 4CKVX 1A1OB 2QPDB 1YMMA 5EO9A 3CN2A 3MOBH 1EJFA 4U1HA 3NDZE 1KXVC 3QR0A 3KLSA 4L3EA 4UOW0 4YHNA 4RQQB 1J0ZA 1IKFH 4DAGL 5A43C 1N8OE 5D4QA 3ZE0B 1G9MC 1S9YA 3V6OC 4MMYB 2WYZA 2XN9D 1AZRA 2R9HC 3VGHA 1MIML 1I85A 1TEGA 4Q2ZB 5H35A 1TZIA 3QUXC 3I2CL 4KQ3L 4BQ6A 1HS6A 3FONA 3TT3H 1NA8A 4G8GB 5KSBE 4H8QA 4HKXB 3HN5A 4JO3L 3NCJL 2AJ3B 1CYWA 2IAMD 4FQQB 1A4JA 4HH9A 2E27H 5C6TL 3BQUD 3OZLA 5BOPA 3SDDA 3UGUA 1RV6X 2OZNA 5AOKA 4JM4H 2IV8A 4X80L 3OG4B 5IK3B 1YN7A 1P9MC 3MRRA 3B9VA 3ZE2F 2UXGA 4YDVA 4L4TE 5GRVK 3GUTB 2OMYA 3ZKNC 4QOKD 3FTSA 2OSXA 4FJ6A 3CFCH 3V4UL 1AY1H 5CNHA 1CDYA 3U36A 3Q8AA 3ZKXC 3VM5A 2OJZH 5EUOA 3SCMC 5C3TA 2Y36L 3IDYC 1ASQA 2MFNA 2YHGA 3BUTA 3RA7H 4FQ2H 3CH1A 5EEZA 2Z0UA 3QORD 4P57B 2JB6B 3ECQA 5EOQL 1NTDA 2C34A 4QRQB 1JP5A 2OJEA 2E56A 4KX8A 4CUCA 3MRDB 2YSSB 3D39B 3HZ3A 3CXDH 3W0WA 5FPIA 3ULAB 2DEXX 1CFNB 4OZFH 1OAXH 1P1ZB 5CZKA 1I9JL 4BWTA 4KK5C 1RZ7H 1HOEA 1X5KA 4QF1A 4XN5A 1OTUC 2X89D 4RMVA 3VX0A 1J18A 2OMNA 5IFHH 3EYSL 3C60C 5T3ZL 4HGWB 1YUHB 5AB0A 2PW2A 5DS1A 2WKGA 2E3VA 3D18A 1PSKH 4OQ1A 4TQEH 4XPHL 4HFUL 2WLLB 4WAFA 4YE4H 1IE5A 1MFAL 4Y8AA 4PRAA 4TVSa 2WQUA 3LXBA 3MCG1 4QXTA 1XH2A 1YYLL 3WEAA 5I74C 1YNTA 3WDHA 3ESPA 1AI1H 4LFHD 3VXNB 3PWPE 4K3DH 4G7VH 4OV5A 4EMZA 4W1TA 2VMDA 1FG9C 4D9LL 1H8LA 1YEHH 3N0PB 5FW8A 4PR5A 5IHLB 1JRHI 1MWOA 3OX8B 4NO3B 2FYYA 3Q6GH 3IJSB 1U3JA 5DUBA 3HC4L 2IH1B 2EO7A 3GMMB 4L8BA 1XGRA 2X28A 4J6RH 2MMXA 4KQ4H 3VWJA 5IM7A 4NUGL 2FVNA 5BV7B 3ETTA 2G9KA 3PV6A 2VH5H 2WOBA 4JPVL 4Q0XH 5I73B 5GGTH 3ES6B 3BE1H 1MFCL 1QUPA 2BERA 1E4XI 2DIBA 4KO7A 1FNGB 3L54A 1U8NB 2P5EE 1AXSA 1RUML 1OAYL 1REIA 1VPOL 2IO5A 1UM5H 1SYVA 1I1AC 1S3KH 2BNRB 4JFFE 4LGSB 3QP3A 4TRPL 4PS4H 4BRVA 1LQBC 3HR6A 2V5TA 3BHBA 4K7FB 4BHUI 1GS7A 3RYMA 4I0PC 3V0GA 4PI2A 1G7IA 3NQKA 3T0AA 2VLKA 5I0ZA 1BBDH 4WI7A 4GQPH 4ALAC 2XRAH 3FQUA 4LSSH 5CZVH 5FGRA 3AGVA 5IG7B 1XXDC 4LKXA 2OSWA 1IEHA 1NBYB 4PWEA 3DI2B 2GC4C 2V7HA 2BIPA 3IE9A 1JXGA 1GGIH 3VD9A 4HLEA 1IGTB 2OMXA 4FFWD 2GEQA 1HNYA 2EVIA 2GABA 1DVXA 4H8VA 5F44A 1T0MB 3FO2A 4XPGL 4QXGH 3G9AB 2WANA 5D7LE 2G5UA 1RZJL 1N6VA 4RFNB 3L4TA 1DVFD 1JVKA 2O93L 1Z9MA 2FQDA 1S7QA 3RTQD 3MRLA 1OSZA 3HI1A 4JRYD 3QUMA 2B0SH 1Z0MA 1CPUA 2B3IA 3EDDA 4H1LB 3L4WA 1IAKB 5ESAB 3ZZ1A 4KI5E 4RGMB 1PZ5A 4HFWB 2R8SL 1XB3A 4XMKL 3GGWA 5E03A 4FXGA 3EJPA 2A9MH 3DROB 1XZWA 1BEYH 4EQ2A 4S0HA 1XBRA 5FKPB 4M6OL 4NQXA 4DKAA 1KJ2B 3OBAA 2RGSA 3ECBA 2DAVA 3G5ZB 1AOZA 2BSEA 5GRJH 2L7JA 1A7BA 3OF6D 5DVPA 2BFGA 2DWTA 1F4AA 1BF2A 1P7QA 1QBLH 1MIEH 3R8QA 2E6QA 2I25N 4NZUL 3VTAA 3U0WH 4JFQA 2WB7A 4U1NB 1I9IL 4PLJC 4X6EA 4YDLC 5EOTA 2TAAA 2VGLM 1G9EA 2CXKA 4LSPH 2R2CA 2XV6B 4E41E 1NBCA 1FZMA 3KYAA 3L4VA 4FQHA 1FCCA 4EVNA 2HCZX 1Z1WA 1MFUA 3DXAB 1G7PB 3JQOB 2NNFA 3BKJH 1BVLA 2VLRE 4Y4FD 5DC0A 4AVIA 5J1AA 4DFIA 5IT2L 5IQOA 4EZMA 5F9OL 4RWHA 3F04A 4NP9A 3FNKA 1GC1H 2VXUH 5HHOE 2FTAA 5IBUG 3RVWC 3CLEL 3MUHL 1A7QL 3SJVD 4OGYH 4AZUA 4CJ1A 2ZOOA 5E4OA 5HYJE 1MSPA 4ZMXA 2P46B 1ZV2A 3KPPA 3H9HA 5SWZB 5DD1H 5JA9A 1ACXA 2CJ3A 4U6XB 2F15A 3MUGA 4UT9L 2ZWSA 4UM9B 5FM4A 4C55A 1T0NA 4S2SB 4NQUA 3QI9B 1GHFH 3UPRA 3ML8A 4PREA 5AVQB 4TUJB 2OMTB 4WY7H 5DRXB 3V6BR 4BSWB 4NWUL 4BD4A 3ALXA 4P3CH 4TUOA 4JR9L 4NKDB 4MJ5A 2DQ6A 3MV7E 3OKKB 1SY6A 1A21A 1AS6A 1B0RA 1T1WA 2FWOA 3IFOA 4NT6A 1BVNP 4P5RA 3T6ZA 1JNLL 4CVXA 4ENZA 3LKRB 1W72L 2XHNA 4LRIC 1MVFA 3F05A 5EUKB 4EI6B 5IWLA 2YARA 1KLFA 5I5MA 4GB9A 1R24B 2PWFA 2IMMA 1B6UA 2YD1A 4CDHA 3BPOC 3O6MH 5F7LB 4JRWA 1FPTH 4LLUA 2YN5A 3FN0L 4LE8A 1EHAA 3MLYH 4LESA 4K5MA 5CM1A 3QYNA 1RURL 5ANMB 2YK1L 3U4AA 3GNMH 2OX5A 4H26A 4GKSA 2VWEE 4G8GD 3MQIA 5EU4B 5I5RA 3A5VA 1JAEA 4IQHA 4Z0BL 1JERA 2ZG2A 1Q94A 5E6RB 4HCGA 5CSZB 5JW4N 4PTUA 2VQUA 2YRLA 1TJXA 1WITA 5GS1A 1AHMA 4E42B 1XIWB 1BFOB 3APNA 2GTZB 3E9TA 5J0BA 2YBRB 3EJYC 4GSDH 2FBJH 3WLWC 3G6DL 1CO1A 2CLRA 3SKNB 3LKPA 2YPVH 4XMLL 1W15A 2E8YA 4X4ZA 5DWPA 3EUDA 2HPTA 2BRRH 2I26N 3ZRSA 5E51A 3T0EB 4OCWL 4KZDH 2O6DA 1U8JA 3VXOA 4MBOA 2HPOA 5F96L 1KPUA 3CK0L 4H0GA 5I16A 4RFEB 5MEND 3HW7A 1EBAA 3FB8B 4AC2A 4GKZA 3WTUA 4FFYH 4Y16A 3GSQB 4D2NA 1L0QA 1UCTA 2AW2A 1C1EL 2Y7MA 1KYUA 4HG4J 1QLEB 4YBLB 3RBGA 3UYRH 1KBVA 5DHMC 4U1LB 1OP5K 1B88A 4ODTH 2VMJA 5I75C 1AQKL 1VAHA 2DQEH 4ZW3A 4XMPL 1CGWA 4PJ7F 3P9LB 3BYYA 1J1XH 2W07B 3DJTA 3N1PC 4NP4H 1RIHL 5D5MA 2PW1A 1FH5H 1R3JB 1GA2A 4N6QA 1QFWH 1RMFL 4YDIL 5HDOA 2XWTA 4XTRD 4LPVA 4JFPA 2P5WA 3VXUE 4N5EC 1XL4A 3NGBC 3WCYA 5EN3A 3X3FL 2YGQA 2Z7WA 3C5ZB 3T6XA 3MREA 3MLUL 2Y23A 3BZ4B 2CUIA 3C8KB 3INUH 4IRJC 4MXVF 5TQ0L 1IAOA 1M7IB 1T1XB 2GTQA 1WA0X 2NXZB 3P4MB 3S36H 1F4YH 4Z7OE 3JV0A 4AMXA 5EDSA 4DN4L 1CYXA 1DVTA 1MQ8A 1BQSA 2K6ZA 4QRTA 4YIQA 1MI5E 5IVZA 1DSFL 3ULSA 2C3VA 5I8KL 2DQTL 4I18B 1F86A 5F8QC 4BJLA 3AACA 3P4OA 1RIVL 4LP4A 3MJ7A 4JRFA 4X7SL 5IESL 2NTFA 4YFLI 5GGUA 3TBVA 4AJVA 1ES0B 1RKRA 4HH8A 4R4BB 2ESVE 1RUQL 5DURB 3RJQB 3S5YA 4S1RH 2CLVA 3UFIA 4YVNA 1IZKA 3BVDB 3OAZK 5AZ2H 5B8CC 5F9JB 4GLRI 2BY2A 2YD9A 5DK2A 3V0IA 4RGOH 1DP0A 4IEFA 4PJ7B 4RESB 3HC3L 4N8CH 3NZUA 4JRXB 5B1JC 3ESVF 5EU3B 2H6PB 3OHMB 3BP4B 5ACZA 4P5TC 4HA1A 5DHVA 3VW3L 2F7RA 3PQYE 1IGIH 4JKNA 2FGWL 3OKDB 4YH6A 4NWTL 1VLXA 3FCGA 3Q5OA 5AKRA 5FGCB 3GTVA 4A1RA 1HDMA 2AQRA 2FL5B 1RP9A 2PR9A 3SDXF 4DP7X 4FG2A 1Y1UA 4LQFL 1F18A 4JFXB 3TPUA 5B4MD 2ICWA 3GSNA 3ZZSA 2Z34A 1DLFL 2YD6A 2V2WA 5IQ9B 4QGYA 2IPUG 4NZTH 1CF8H 1YEDA 3K7UA 4EN2A 2R4RH 2QKSA 4LSUL 3DYPA 2JKSA 2XA8H 5KW9L 2DJSA 3JWOH 2ADFL 1BQKA 3CFBA 4DEUA 4OIIH 1OALA 5IQNA 1JFQL 4JFEB 5IFJB 4JVPA 1HINL 5T3XL 4OFPA 4F7KA 2YBGA 4N0UA 5C09B 2APXA 3POCA 1TCRA 2VLME 2CO7A 5FO9B 2KI6A 3MPCA 4O2FB 4ZYKB 2ITFA 5CEYA 1AXIB 3PL6C 1DCLA 1X5IA 4KZCA 1OAZH 1KENL 2DB8A 3BPLB 5DC4B 2QV2A 4O51A 4TMPA 3UO1L 4HAKA 5IREA 3HE7A 2Y7SA 3FB7B 3LEYH 3WIHL 2Z0BA 3C9NA 3ECVA 2ZSVB 2VJ8A 3QDHA 4KUZL 5FF6B 4ZQTA 1MJJB 2O5YH 1KIPB 4G72B 3U0PA 4HBCL 1KT2A 4NRZA 5GPRA 5J06A 2X12A 3W39A 1VCBC 5GHWH 3QO1A 3SDXB 1BQUA 2PABA 4WZ9A 4GRLB 5T1KB 1UTDA 3U30B 3FCSA 1CE1H 2JQZA 3EBAA 4BFOA 4L18A 4K8RH 2NZIA 2UY6A 4MA3A 3L4CA 1BLNB 3FUFA 3OKOB 4ZOEA 5GRWA 4DEWA 4XO9A 2P47B 4KFZC 4KKQA 3ZT6A 4DVBA 1M4KA 5E8DH 4K9EH 3EJTA 5DEJA 5EEYA 3JWDH 4OCSH 4U1JA 2DQUH 4TOYH 1EHXA 2F18A 2DQHH 3WIFA 4HPYH 3DXAD 1UKQA 1T2XA 4IHBA 1HIMH 2N01B 1MCOL 2CUHA 2Q86A 5KSBA 4DK5A 4UT9A 3MLRH 5DUJA 1DN2A 4D8PB 1ZVHA 2G4GA 4LPWA 1P7KB 2R69H 4KX9A 4IU2A 1TYRA 1C5DA 1CJYA 3U7WL 5J6GA 3BMVA 1R5WA 1UD6A 1Q72L 3NFSH 4LSTH 1UXSB 1HOCA 4L8CA 4HOXA 3RTQC 2ZCKH 3OMNB 5IB2B 1SJVA 2R4SH 4TVPE 3GDBA 1H8OA 1HZLA 5SWZD 2CGZA 4CGTA 3QRFM 3KW8A 1O7DE 1CICD 4YNYA 3MV9B 4X7DC 4UM9D 2Q3AA 4CMMA 2Y5EA 2IQ9H 1XGYL 2EILB 2ZOKA 3QI9D 2IG2H 3Q7JA 1WFNA 5E2UH 4OU3A 4NRYB 5FO7A 4BINA 1N5YL 2ZKHL 4YHIB 4DEPB 3CFUA 1CDJA 1INQB 3PHOB 3QNZB 4HJ0D 4XPAL 4AH2B 4U7SA 4Y9CA 4DVRL 3TEZA 1W6LA 1PNCA 4L3CB 4U3SA 4M5ZH 1TU2B 3U7YH 4P2CG 4G71B 4ANKA 2DOCA 1ZCRA 1M7DB 2WWMD 2X9WA 4GRWE 3OTTA 4OI9A 4ONGH 4L2LA 2IGTA 1S7XB 4WHDA 1OP5H 4YQXH 2AJZB 3T8MA 3LXCA 4DGVH 3IMBA 1KEMH 1MJUH 5H8DA 5K39A 4OFKA 2BIOA 2KZKA 4WFGE 2CCVA 1QFPA 1DFBL 4HJJH 1FSKB 1YEFH 3GI8L 4LF3B 3I6KA 5DJZA 3VRLF 3IXTB 1BM3H 1XIWD 4XP6L 4HUNB 4XB8A 3HLKA 3C6EA 2AQPA 3FQXB 2WAQA 1KB9K 1MCDA 1O5DT 1ZE3C 3OXRA 4Q4IA 3UL4A 5DQJA 4FQCH 3F7YA 4A7QA 3NJVA 1P4BL 1JL8A 3ILPA 4XNZC 3TBYB 3SQOL 1DJWA 4CU6A 1YEKH 4KXZH 4C57C 4MCZA 4TL5A 4K71B 2RCSH 4HKZB 1YPZA 3V5HB 4GQQA 1A0QH 1OK0A 3S9DB 3T0ED 2ED8A 2DQJL 3M7OA 4P0DA 4R97C 5IF0B 5CXPA 3VE0B 1JHTB 2JTDA 1NUDA 1FFOA 3GPEA 2X7LB 4GS7B 3DDGA 4OD1L 1JGDA 1FL6B 1XSOA 2HRGA 3CN4A 3HHSA 4FMKA 4L3FA 4EI5A 3WY1A 3RWGA 2DV6A 3L5XL 1EIBA 2I60H 4LPUA 2HFEB 4BBWA 1CLCA 3X11A 3X1BA 2FJHA 3OAUH 4GKLA 2IDFA 1DZBA 3ULUF 2CM6A 4HWNA 1N59B 3VFMA 2DBLL 4ZAKA 2CO4A 3ASNB 1U95B 3LB6D 4NSKB 4AX3A 2BJML 4MVBD 5JZ7D 1BQHA 3WMQA 3CPLB 4X6DB 3F84A 1TO5A 4UMGA 2EUZA 2YEVB 3DIFA 3OQ3B 2XWXA 4JG0H 4NQVB 3VMPA 1RJCA 1E27B 3BH9A 5AW4B 3WFDH 4DCQB 1P0SE 2GPZA 2QPEB 1MJ8L 3A6CL 1PMYA 1FG2A 2FDBP 2EZ0C 5FWRA 2EYRB 2NXZD 3QUKA 1A7OL 2X2UA 5DHEA 4ODXA 4E5XG 5DEZA 5KSUA 4JE0A 4PS7A 2XZCH 3MCYA 3RVVD 4LBEA 5LGHL 2ZSWA 3N91A 1SEBA 3QSKB 1AP2A 1O7VA 1ZVYA 1F5WA 3WUZA 4ZMYA 1CGXA 2H3NB 2AJVH 5BS0E 3GRWL 1C08B 2IPTH 1HAUA 2VLJA 5D7LA 4DGYH 5A40E 4WEBH 4YHPA 3BWAB 4FQLL 4HIHB 4HPHA 2OSLB 1U8CA 4NQDE 4NQEE 4IGBA 2WVTA 1EAJA 3NT0A 1BD2E 4WU5A 3VXSA 1JZ5A 3VI4A 2F9BT 2F5BL 2J3SA 4LEOA 4ODUA 5DURD 1OK8A 1G7HB 4Y1AE 5DF0A 1ZLUH 3DX7A 4Z7QB 1HWHB 3E80A 4XHJC 5FCUL 3OLEA 4P2RE 2BS71 2ZYIA 3FF7A 3EOBA 4KKCC 1AD0B 1SLWA 2D0GA 4GFXA 4ICXA 1KJMB 4JRXD 3DV4A 2Y24A 1R5IA 1E5CA 3OKEA 3KLQA 2H5UA 1JPTL 1AD9B 1G6RB 2ICCA 2NT0A 2QZQA 4MS8D 3ZRCC 3CVHL 4FE9A 4M1DL 5BO1L 3UTPD 3U82B 1BA9A 1J8SA 1UD3A 2I32A 3KWWB 3J27A 3QJXA 5JLZA 3P11L 3FUDA 4HYTB 1DBAH 2IOIA 1UT2A 3ARFA 4LSQH 3QWRA 1KNOA 2GJ6B 4I3SL 2XG4B 4OTXL 5LG1A 1V3KA 3FQ1A 1BVKB 4RZCA 2RIKA 1PJ9A 2HFGH 4JZNB 4BE5A 2IWKA 2DYPB 1PPIA 4FG6D 1PS3A 5F6HI 2N1KA 3B3IA 3CFIC 1B2WH 3DX8A 3NIDF 3S37H 4QTFA 2AITA 3LNFA 1LO0L 4DKTA 3DBXA 1M1XB 3FUEA 5DTFB 3WIHA 3O3DB 3WSQL 4JFED 4E9TA 3ARWA 4EN3B 4AQ1A 4XB7A 3ZXAC 5C09D 1C5CH 1WZLA 4JFYA 3CDFA 1DEEA 1HCZA 2N3JA 3TX4A 5HY9A 1MWAB 1KIUA 1XCQB 1KDIA 3TVMC 2YPLE 4PP1C 4AXWB 4P9HC 3NZ8B 3MLVL 4URKA 4HQQL 4XXCA 4PWJA 1JV5B 1NAKH 2E75C 3A22A 4G8EA 5ILTL 2C9VA 4P5KB 2PMZA 3OLGA 1EZSA 5JR1H 1U91A 5T1DH 3QWOA 4R5VA 1DDHA 3F7LA 3AUWB 1X5XA 1ACYH 2ITEA 5EA0H 5I73C 2Y25A 2IFGA 3D33A 5CR1A 5DRNA 4Z3IA 5C9KA 5FOBA 2L8AA 4GRLD 3L5JA 5T1KD 4LCCB 4A38A 2ICEC 2QVTA 4RX4A 4MJIB 3CUPA 1BCIA 4S11A 4KROC 1XX9C 2WB1A 3QWQB 4AQZA 4P59L 4K2UH 3STZB 1JNHB 2ZWLT 2G5BA 4BHUA 2J21A 1ZA3A 4K5LA 3TBSA 2HFFA 1PW3A 3CZJA 4N87A 1RHHA 5FDYA 1IZJA 2AV1B 2VIRB 4YK4B 2A74A 1RUPH 4WHYH 3ZIMA 1H15B 1XH1A 1YDPA 3KPNB 5BVPL 4JAMB 1INDL 4Y5VC 2ZXDA 5CO1A 3CHXA 5I1CH 1NBVH 2VL5A 2ZP8A 5D7JB 1FFRA 1E5AA 2LE9A 1E8YA 1KJVB 2ARJB 1PD6A 3BDXA 3IU4H 3KYOA 8PAZA 4G6JH 2YKLH 5IIEA 1UD8A 2FEEI 3OMAB 4H4NA 1U33A 4RRPM 3UTOA 4RFNC 2DH2A 2K3HA 3TIDA 1LO2L 1T1YB 2BZDA 3KPQA 4NENB 3U4BH 3CZNA 3CX2A 4MHHG 2BFVH 2N7SA 1CD9B 1FLRH 5F93C 2EEXA 1CFVH 3DIVA 2X6UA 1XGTA 3TBCA 1E28B 1EWHA 2J7LA 4LNVA 5ID1B 3MUJA 3POHA 4OKVA 3MV9D 4RGMC 4LSRL 3FT4B 2HH0L 5AVSB 2WVSA 1OF2B 3V0HA 4IU3B 1A1MB 4P2YA 4PJXE 4YGVB 3IAPA 5L8LB 2R0ZL 3LNGA 1C12A 1CZ8H 5FLVA 3RIKA 2LLNA 4G1EB 5JXED 1I8IA 1IAIL 3VI3E 4ZBJA 3G6JE 4ZZFA 5TE4L 1QYGL 4ZTOH 4AVHA 2IQAB 5DC2A 2WNGA 4ZUWA 2YD0A 4ZTPH 2IPKB 2X38A 3GMRA 4EQ3A 1XCWA 3GSOB 1J8HA 3LY6A 1CGYA 3HRZB 3LNHA 5D1QC 3TZVA 4N1HB 4N9OB 3WNLA 1XGPA 5TH2B 2UZXA 4BFIA 3TBBA 1KCKA 2DD8L 4P04A 2W60B 4Z7WF 3VFWA 3IGAB 2NDGA 4UV4H 3HI6L 5DEGB 5IW6A 2XA3A 5E9DA 4OCMC 2XV3A 1BWMA 4PRIE 1N8ZB 5ICXA 4JHZA 5ISZA 1ND0A 2TSBA 2XFXB 3IM1A 1DO6A 1WFIA 4PG9A 4AOFA 2KDGA 4OZHE 4KITB 1XZ0B 2CU9A 3N9GL 4HJUA 4XXDB 1EO5A 2AQSA 1S5HA 3VXPB 4MHHI 3D4CA 4LPCA 3HCVB 1NFIA 4IW4C 3VFPA 4F7MB 4Z23A 3O4OC 2GFBB 4XZUA 2A6IA 3GLZA 2K8MA 2JCCA 2OR8A 2WXHA 1NUGA 4PSRA 3IMUA 3AQDA 1KELH 43CAB 2ZXQA 2WYHA 4HOMA 4CJ0A 4Y2OA 4KMQA 1KPRA 4WFFE 3ZL4L 3FT1A 4Y1TA 3CZSA 2N0KA 4A6YH 2V7NB 3MZGB 5BNXD 4GAGH 3QG7H 4XNYH 3RFZB 1CU4L 1OP3K 1F4XL 5E5UB 3WTWA 1GSKA 1K4CB 1ZV5A 2IJ0C 2VZOA 5EEWA 1NIFA 4TNWK 2V37A 3KAAA 4S1DD 2J8UA 2H0FA 2OW7A 3TA3B 1OTTD 4YPGB 4LCIH 1G7LB 2H3XC 3EYUH 1Y0LA 1CFQB 3HMWH 4MB1A 1YEJH 3QCUL 3O3AB 1A5FL 5JORA 2EE9A 4G6AD 4LFHG 4OQTL 1NMAL 3NCYS 3S34H 2WCSA 4Z7WB 4GUPA 3RHWK 1A9BA 1JMZA 1PKQE 1TLMA 2IAAC 1KTKE 3LQAC 3IETA 5SWSA 3MCKB 3PWJA 2H4EA 4X0NA 1Q90A 3GRWA 5KG9B 1U3HC 8FABA 4K3JL 5CEXB 2IFFL 2YRBA 5GRYA 4AQAB 4G82A 3G04B 3ZKQD 4WUKH 4I0CC 1A2YB 4S1SH 3BP6A 5HD8D 1JZDC 2MHAB 3OAWA 3QHFL 2Q2EB 1W2KT 3PGCB 4TYUA 1WIPA 3WN5A 3KS0H 1A3QA 4PRDA 1E6OL 1XIWC 5AW1B 2DQCH 2KDYA 3VXMB 2P4AB 3HPLA 5DJ6B 5CGBA 3O6KH 4JHAH 4FLQA 1WZKA 1PVHA 2FSEB 3EFFA 4TXVB 4OLXL 4ZSOA 1CR9L 5HGBA 1JDAA 3RZCA 4RDQG 1VEOA 4X0KB 5KTEL 3OWEA 4PYGA 5DJ8A 1IILE 3VFSB 3VYPA 5EU6A 4OCYH 1OM9A 2PWDA 1OAUH 4LLWB 4Y2DB 5EC2B 4I9WD 3V0EA 1JN6B 2WAHA 4JJ5A 2VUKA 5EZOH 4ZTEA 5DI8A 5HGDB 4B9PA 4YSDA 4GRWH 2WPGA 1T21A 4OGQC 1PBYA 2O72A 3IYLW 4OT1H 3BUPA 3KLAA 4U1GB 3IFNL 5G2NA 5IUSA 3ULUD 3UTSA 1JFHA 4QRRE 1G84A 4BDVB 4JY4A 4ZW5A 2WLZA 1AJ7H 3V5KB 3F7RA 1IQWL 3DSFH 4JFDA 2D2OA 2QDWA 5DT1L 3NN8A 5D7IF 2A73B 2HVJA 3GZPA 5ADOL 3L4XA 4PJHF 2VLLB 4G6ML 1NGQH 2VDNH 4HWEL 3MDJA 3UEQA 4QKTA 3UZVA 4JO8A 3MBEA 3W9EA 2P8LA 2LAGB 2JMRA 2QVFB 4NJ9L 4MZRA 4O02B 4BH8B 4BZ2H 2GJ6D 2OFQA 2QT6A 4GKNA 3O2DL 2GTWB 1A14H 1NSNH 3C5ZC 4KDTC 1H3XA 2B08A 2CCLA 1K4DB 4PCSA 2WZPD 3KNBB 2FX8H 1UZ8A 1SDYA 2RALA 4EXKA 2X0WA 3BW9A 3TYFB 2XN9E 4KV5E 4N9GB 5A2AA 2JB5H 1IBHA 3MOBL 4LDLB 1E4KC 4EN3D 4O2CB 4JX0A 2BSDA 3ZDXF 4R2GB 1MCFA 1IKFL 3FU8A 4GW1A 2C7FA 3TO2A 5DA4A 2NZ1A 3AAZB 4AE0A 3IPFA 1U4EA 1JWSB 1PIFA 3UTQB 1NCJA 4JM2F 1W8NA 2JJSA 1HEZB 2P8MB 3QNXB 5K59E 1IM3B 3U48A 1H8SA 4D0DB 4L9LB 5IQMA 4M8QB 3VDAA 3L2LA 1CQKA 3QARA 3TT3L 2FWLB 2VDRH 2PPEA 4Z76A 5D6DA 3Q48A 2DWDA 1MHEB 3SKMB 4AEHH 5D7IB 3V4VH 5FYJH 3QJHA 5IB5A 1XR8A 2E27L 4ZFZB 1ZHNB 4QOKE 4FAAB 3OKNA 2XWRA 4MJID 2CD0A 2FD6H 5I17B 1FJ1B 2O26U 1G9MH 2VXSH 4X6CF 5I6XC 1NDMA 4MD5B 3O3BB 5GZOC 1OT1A 3ZBMA 4P07A 5F88A 1GIGH 3EG9A 2ZXCA 3LKQA 3LKSA 1DQVA 1JF6A 3FL7A 5DVOA 3I9PA 3TT1H 4I2XA 2VRAA 3CFCL 1PLAA 4XOEA 3VXRB 1XXFC 3GSXB 3QIUB 1UB6B 4QLWA 2OJZL 5J3HC 4AIZB 4FG6C 4AV0A 3KBHE 3L5WB 3RA7L 2EVHA 2R1YA 4FQ2L 2XIDA 5D7JD 5D2LF 3ZDXB 2VE6A 2NYZA 4ZUSB 4HXBH 1EVUA 3ZQXA 3BVNB 1N6QH 3DETD 3L13A 3GMQB 4JM2B 4XX5A 4I1PA 2VR5A 1S9XB 5HYQB 3BI9X 3CXDL 4AYSA 4CW1B 3IVKA 1GGTA 1OAXL 1T7XA 3N1GC 1BPLB 2FR4B 3D8MA 4HZLB 5J6HB 4U4IA 3ZQ9A 1RZ7L 3T4YA 1J5IA 3Q2WA 2OL3A 5F1OB 3BPLC 5IFHL 1V27A 5EFIA 1F42A 5AW8B 3VMNA 4KKRA 2EKJA 3M86A 1EPFA 2BSCA 1PSKL 2XTJB 1AGFA 4TQEL 4YE4L 5DMGC 5K9OA 1P1VA 3VSVA 3GQFA 4WWOA 1PIGA 3LHAA 1RZFH 1G7MA 3MXWH 3OKLB 3V6FB 3Q2CA 4FNRA 1AI1L 1UGKA 2FH6A 4K3DL 3D06A 2Q7YA 3NJXA 4G7VL 1YECH 4WNSA 4EAEA 3FCUB 3ZL2A 1JTTA 1TQCC 3VRJB 4X4MA 3C2SA 1YEHL 3D08A 4XB3A 1MPAH 5HHQB 2NY5C 1YA5A 4FI7A 1WQVT 3Q6GL 4JQVA 2BVEA 1DUZA 3GS7A 4UAOB 5INDB 2V4LA 1P2CA 2G60H 4J6RL 1O9ZA 3QJTB 4KQ4L 2ATAA 5HYFA 3SDAC 5C2BH 4PRBA 3QO0A 3ARPA 2VH5L 4Q0XL 1HCFX 5TPWH 5GGTL 4HIPA 3B37A 2DBJA 2PYEB 2B7DT 1G1OA 2G75A 3DTXA 5E00B 2V9RA 3K74B 3NH7H 2PO6A 3W81A 5FUZH 4P4KD 2EP6A 4IBZA 4PIBA 2YZ8A 1UM5L 1T2QH 2K6WA 1S3KL 3WO4C 2OK0L 4PS4L 1BFTA 4XAKE 3QIWA 2UY7B 3IBOA 1R3HB 1CXHA 2R1XB 1GY1A 1Q9KB 5EO0B 2APFA 3DYOA 1BBDL 3X14A 1Q9LA 4A7GA 1R5VA 4XT1C 3PAZA 4IS6B 2XRAL 1UG9A 4LSSL 2YQ3A 1CLYH 3VYNA 4YHKH 1LJMA 3ZE1E 4D94A 5CZVL 2OMUB 4NNXB 1UKSA 5IB4B 3CN0A 4OQTA 3VDCA 5GXBB 3IAQA 1I3RA 4M1CC 2VSDA 1GGIL 3FO9A 3AS2A 4PGCA 4B9GA 4CC1A 2B20A 4L8SB 2ARWA 4PQXA 3SPCA 4HHWA 5EB9A 1N5AB 3QQ9C 4M93C 3OJDA 1VACA 3JUZA 1KB5B 3T0XA 4QXGL 4IDJH 3TA3D 5EBGA 2Z35B 5HYSA 1CDIA 2GK0B 3UACA 4W70A 1YEIH 2JK5B 4AM0A 3H9YA 4Y1SA 4TULH 5CCKH 5EUOF 2C4XA 1YMMB 5EO9B 3SBRA 4ALAH 4U1HB 4FQPA 5E0FA 5BVJA 2B0SL 5CLTA 1UHVA 3QEHB 4L3EB 4YS4A 1NH6A 4XVTH 4WW2C 4YHNB 5HHMB 5FHBH 4EO5A 4YSSA 4Z7VA 1T0PB 3VFTA 4Z3GA 3EFOA 2WXIA 4DP9X 2BP5M 1HHKA 2A9ML 4P23A 2ZUQC 4DUXA 5H35B 1TZIB 1GJUA 4DH2A 1BEYL 1RZPA 3FONB 3MLWH 1WK0A 5LGJA 3GMLA 1OO2A 4CA4A 1GJIA 1MZZA 3OGOE 3AY4A 5CF3A 3C5JA 1S9KC 3VXMD 3KM2A 1Z5LA 4RMSA 3X12A 5C07E 3VWKA 1SLVA 1A4JB 1QBLL 3GM8A 4HH9B 4LEXH 3U0WL 2LU4A 4KAQH 4FABH 3SDDB 4P46A 1UENA 4GIOA 3FUMA 2J5LC 3OPUA 3MUUA 1YN7B 4LSPL 3VD7A 4LNRA 3TF7C 3ZQWA 3MRRB 1YNTF 3PU7A 2R0LH 3OMZA 1ZS8A 4QO1A 4Z6AT 2ZXAA 2VM3A 3G5YA 2OMYB 5DK0A 3HHMA 5FYKD 3CC1A 4GS7C 2R2BA 3T2NH 3LHPH 1PY0A 3U36B 1I7RA 3BKJL 2CM5A 2VXTH 3NIGF 1L9SA 3GMOA 3IAGC 1TTUA 3O2DA 1GC1L 2VXUL 3BESR 4AJYV 1UWYA 3L5HA 3DJRA 1OGAA 4XRCA 1FAIL 1NL0H 2WSKA 2ZAGA 4HEPA 4OGYL 2BSBA 2OJEB 5FM8A 4GFTB 1BF8A 3C87A 1TTBA 1SN2A 1G1YA 3W0WB 1RFDH 5DD1L 4XCEA 2ZXGA 1U30A 3EJQA 4JDZB 3NABH 3AQZA 3PCYA 4H1LG 1FO0H 1KCBA 1JK8B 2EINB 4QF1B 4MX7A 4MMXA 3FKUS 3ARZA 3HR5A 5FFGA 1GHFL 2ZUXA 4NQQA 4GUQA 4JPWH 5FEBA 2PW2B 1LD9A 3PWLA 4WY7L 3D18B 3DVNA 1LM8V 1OAKH 4P3CL 3ZE0E 2VN3A 1X9LA 3OKMB 1E3ZA 5KBLA 1FWXA 3KDMA 4PRAB 2NNCA 4J3OC 2CDFA 4NC1C 5IHHA 3K6OA 3M17B 4OKDA 3HAEG 5F7MC 1OE2A 4HHAA 1YNTB 2NLJA 4R2GD 2Q3XA 3IWUA 4LEBA 1QBAA 2X2JA 4X5PA 1G5GA 2WYTA 3U9PH 4X2UA 2VSKB 4GINA 3O6ML 2ZX5A 4W6WB 4OV5B 1FPTL 2HAZA 4JFHD 2VZ1A 4OVUA 3ETBJ 2EJ1A 3MLYL 1IM3D 3NCYP 5CJQL 1PU0A 4PR5B 1EAOA 3SBWC 3NFPA 3NIGB 2FYYB 2WZ0A 3GNML 3UDWA 2EEAA 3DPDA 5DUBB 3SIKA 4L8BB 1XGRB 4NB7A 1NEZG 5IM7B 4XGZA 3VWJB 5I0YA 2H9GA 4PJ9A 3QT2A 1ZTMA 4RIRA 4GSDL 3MOAH 3K46A 5CBAB 2FBJL 5CP3H 2W9DH 5D2NA 1KV7A 1OQOA 2YPVL 3TTSA 2XVKA 4HALA 1NPUA 4OJYA 1AGDA 4Y5XC 3UTTB 3VI3A 4QYAA 2VJXA 5JUEH 4B9CA 2FQFA 4YXKH 2BRRL 1GZQB 3RVTC 1T22A 1LQSR 5K1NA 3BHBB 2B1AH 4MLIA 4X7EC 5ABAA 4KZDL 3EJRA 2HSIA 1G7IB 5PAZA 2AXFA 2VLKB 3VXRD 4E5XA 4OZFA 2Z9TA 3FQUB 1F11A 1L9TA 4FFYL 4LKXB 3V0WH 3D39E 3MVSA 4TN9A 1QR1A 2I9LA 5E0QA 3RURA 4APQC 5GZNC 2KYIA 3VD0A 1I75A 3UYRL 3B34A 2YEZB 2OMXB 4LO9A 4ODTL 3EFDL 2NY7H 4WI3A 1LNUB 2DQEL 1ETA1 1E43A 1MOEA 2O6CA 4JM2D 4CSZA 1A6PA 1J1XL 2XNAA 1EEYA 3FO2B 4AQ8C 1U8KA 1JPSH 2K8QA 5HPOA 4NP4L 3BGMA 4UNUA 2XXFA 3U1QA 1KXQE 1FH5L 3JVGA 1QFWL 2OYKA 2B39A 2UWEA 3F8UB 3KL0A 3S3CB 3NCXA 3MRLB 2QSVA 4XWGH 1OSZB 3HI1B 4XXWC 1H6TA 1RZ8A 3QUMB 3O8XC 1QP1A 3B7SA 2QSCH 3OR7B 2XTJD 4Z7UA 3EO1A 2NY2D 3INUL 1A6AA 5CFHA 2DM4A 1PZ5B 4NC2B 3LZPA 3MNWB 5DO2D 3S36L 3GGWB 4PJEA 1NICA 5CBEB 4FXGB 4Y4HC 3SGKC 1KGUA 5C0AA 1F4YL 4FNLH 5TK2A 3L4ZA 2W9EH 4NQXB 3DGGA 3GSVA 3L48A 4WSGA 4P3DA 1KYOK 3ECBB 4PD4J 2QGCA 3K6DA 1HHHA 1P4LA 1II4E 3IDIA 1IBBA 3FF8A 3OGCB 4WGKA 1ZA6A 5TTRA 2OBGA 4BCXA 3BGAA 2JKXA 4FZEH 4QD2E 5CR8A 1SXAA 3TBTA 1A6TA 1P7QB 3JYBA 2NZ9C 5GS2D 1JK9A 3B4NA 4PJGA 3UG3A 5AD0B 1QEWA 2K7PA 4S1RL 4X6EB 5EOTB 5AZ2L 3SE4A 3D9AH 1CUOA 1MXDA 2BNRE 4RGOL 1FBIH 1NAMH 2LU3A 2XKNB 5L6YH 3ELQA 4PYHA 1DVSA 1KJ3H 2H32A 3TFKC 4X8CA 1FZMB 4FQHB 1OM3H 4F8OA 4EVNB 1KGCD 2JNZA 1IGIL 3JTBA 4PLOB 3RPIA 3ATEA 4N3UA 1GS8A 2OTUA 3FQNB 1BVLB 4K7PY 5J1AB 1ZVSA 2ADIB 3AG2B 4UOW1 4Y2LA 1A66A 4M00A 4N1EA 1V7MH 4B41A 1RPKA 4TM9A 3BFOA 5BRZA 3WAJA 2ZCHH 4UINH 1EGJA 3E3QC 1KYFA 5KUKA 2D31A 3KPPB 3H9HB 4NZTL 1CF8L 2R4RL 3WI9A 3O2WH 4HSCX 4W4NA 1I7UB 3VFNA 2XA8L 5LAXA 4NKOA 4NFBA 3JWOL 1Q1JH 3HE6A 3UBXB 3MUGB 4V33A 1T7WA 1NC4B 1T0NB 1UM4H 4OIIL 2ENJA 4AE1A 3AMKA 4KK6C 3V4PH 2VDQH 2X40A 4Q89A 4PREB 1N10A 5IGXH 3WV0A 1THCA 5E1AA 2W0KA 3D34A 2VN6A 1N0LA 4QT5A 1YYMH 4MJ5B 4FADA 2FWOB 1T1WB 4CVXB 3IFOB 4NT6B 3SPVB 5DJYA 1ASOA 1YMMD 3NJIA 5AVWB 2VR7A 1OAZL 3UEZA 2YOAA 1KLFB 2VZUA 3B2MA 5BW7A 1RPUA 4L3ED 4Z5RB 2G30A 3HRZC 5HHMD 3DIDA 4JM0A 3LEYL 1ZOXA 3VTTA 4OF5A 3LX9A 4BKSC 4LLUB 4QRPE 5KN5B 1KLUB 2ZONA 1A7PH 5JQHC 2ZUWA 2OX5B 4H26B 4GKSB 4OZIA 5D5MF 5GHWL 1BFSA 3QDAA 2F54B 4J3BA 1Q94B 3ABZA 1CE1L 4PTUB 5GS1B 3CSFA 4K8RL 4OCLC 1BP3B 4PGJA 3TEWA 3DGCR 4H44C 4ZI8A 3BAIA 4Y4KC 3TEYA 4YBHA 5IVXA 1CURA 3ZDWA 1TF4A 2G9HA 3SDDD 2W65A 3DXAE 3LKPB 4OCRH 4Q9BA 1AIFB 2G2NA 5E8DL 2WY3B 4LZKA 3V52H 4K9EL 3E8UH 3GMPA 4LEEA 3JWDL 4OCSL 2WNWA 4OAWA 2DQUL 4TOYL 2A4CA 3UC0H 2DQHL 4E9QA 3VXOB 4HPYL 3BFWA 1SOQA 3D3VD 1HIML 1KPUB 1XGQA 3BQUA 3QR1A 3B8YA 4YFDB 3ZK0A 5I16B 3ZKMD 1H8NA 3LH9A 2BOBA 4GKZB 2B9AA 4Y16B 2JSFA 2XWEA 3MLRL 2XCMC 4XWOC 4YSPA 5SWZE 4IBVA 4EDWH 2R69L 4OJFH 2ETWA 2GBUA 1KIRA 3BH8A 4W6YB 3P3TA 4PJ6A 4XO8A 1TVBA 2QV4A 3NFSL 2CLZA 4HC1A 4LSTL 4QOKA 4LXFA 3WO3B 5J5EA 2ZCKL 3EBIA 1L9NA 2Q10A 4NIYE 2R4SL 3WENA 5I1AA 5GSRA 3ZO9A 4PCKA 3LOWA 3RWHB 2PN5A 5D5MB 1G7JA 3HKFA 1MCPH 2PCFB 4NM4L 4KJYB 2CK0H 2XWTB 2IQ9L 4FXKA 1ILUA 43C9A 4JFPB 2P5WB 1I31A 2E47A 1AG0A 2IDUA 2IG2L 3T77A 5E2UL 3TJEH 1EDHA 3M46A 5E1GA 3MREB 2J25A 5AKTA 3P9MB 2H8PB 3L9YA 1VFAA 1IAOB 1WWWX 3F6JA 4KJPC 4RSYA 2I69A 2ED7A 4M5ZL 5LO7A 3U7YL 1Q9WA 2AEQL 5ANME 4OFIA 2OMWA 2X89A 3NP3A 2YR3A 3DC0A 4QRTB 4YIQB 5IVZB 3D0LA 2C3VB 4ONGL 3T3PB 3NJMA 4WVRA 1HWWA 1D5ZA 3EUUA 2PR4H 3P4OB 4YQXL 4S1QH 2P7TA 3MJ7B 2P8PA 4DGVL 1KEML 1MJUL 4Y2DC 1PTZA 2NTFB 1RZIB 3NAAH 3V9FA 5GGUB 3TBVB 3CFEA 4EE2A 1UH4A 2NQDA 2NSQA 1MEXH 1UWGH 4HJJL 1YEFL 4PP2A 4MD0A 3BPNB 1ITCA 3HHRB 1BM3L 2CRIA 3VWJD 2BX5A 5DK2B 1J9SA 2DMHA 5I1LB 1XMEB 4MMZC 5A2CA 4FQCL 2ZF9A 3SO3C 1E3XA 4FI6A 3T0EE 3BAWA 4GUOA 3FCTA 5ACZB 1TZGH 1IGYA 2J55A 4QXWA 3QNFA 1YEKL 1HILA 2ENSA 3UTTD 1SUHA 2VW4A 3H56A 1TITA 2RCSL 2V8LA 4AWJC 4XBMA 2IGFH 1A0QL 3T4AC 2CO2A 2XPZA 4RZKA 5KS9F 1K72A 3P77A 3KPOA 1XSKA 2HB0A 2YAOA 2VLKD 3TPUB 1NBZA 2HT2C 1W6WA 2XWCA 2ICWB 1WICA 2F74A 3PAYA 2V2WB 5A7EA 3VG0H 4PGDA 5C0IA 4ESKA 1ZE3H 3CHOA 5T33H 3BH4A 3MRBA 1OPOA 4MQXC 2LGNA 4LOVA 5C70A 3QK0A 2I60L 3CFBB 4IRZH 1JI1A 4MJHA 2KQNA 3OAUL 1MNUH 4HJIA 2FEJA 3NRFA 1CXIA 2WYIA 1CFTA 3PS6A 2EABA 4MDIA 4N0UB 1TCRB 2NXYC 2CO7B 5KSBF 2MNJB 5IHUH 5CEYB 4WFHD 4HS6A 4JG0L 4FFVD 3WFDL 3T0VA 2XJLA 1UQSA 2I5YH 2RB8A 3G5WA 1BMGA 3DURB 3MRKA 3QWNA 4O51B 4WW1A 1V10A 2HMIC 2XDHA 4WV1C 3JXAA 1WBYA 1B9KA 2HLAA 2ZOUA 1T7ZA 3C9NB 4NQTA 3WJJC 4F8LA 5FYKU 3WTYA 2GSMB 1PYWB 4ZUVA 1DVFA 1NDTA 1QABA 3U0PB 2EADA 3ECWA 3UBFA 2XZCL 3M1BA 1KT2B 1SHSA 4NRZB 3W39B 1SOKA 3G08A 1SQ2N 1C7SA 1Q8MA 2AJVL 4JRYA 4AVJA 3FU7B 4JZJB 1HC1A 2IPTL 4XZ4A 4LVOB 5CP7B 3FQWB 4DGYL 1MFBH 5LWYH 3FCSB 4WEBL 2GIYA 5TDNA 5F0MB 2CBMA 3HB3C 3F7KA 4PJ7E 4GW5A 5C08B 3T0WA 1P7QD 4F15B 2Z8SA 3KVQA 1GMIA 5D7KD 4LPYA 5KUMA 5JXAH 5IBTH 4ADGA 3BIAX 1R0AH 1DVQA 3D69A 3QIUC 2JWYA 3UTPE 5FGCE 1PNDA 2WXQA 4B60A 4DVBB 4EIGB 3ZHKA 4ZNCD 3EYQD 5DFVD 4H40A 2VXVH 1FCGA 3P73A 3TWYA 5FK9A 3TCTA 3AQYA 3IMVA 3WIFB 4F7CA 4TPRH 4WQOA 4MXVE 1M7UA 4UCFA 1QASA 2Q86B 4QXVA 5CS7A 5BQ7A 1MLBA 4OJDH 4JM2C 1GGBH 1T04A 3FZUD 5JIHA 4QHUA 4FA7B 2ZP9A 2OMZA 4IU2B 1C5DB 3AWEA 2QZ5A 1VSCA 1R5WB 1DBAL 3HZMA 3QJFB 4KWUA 4LSQL 4NUQA 3KGUA 1HOCB 4L8CB 3FFCA 2HFGL 4JFEE 5FUCE 3EJJX 3L3JA 4IK6A 5IMLA 3KXFA 5FYLD 2VR3A 4ZO8A 3R18A 1QACA 4QGTA 5C09E 1FV1A 3S2CA 2XTJC 1B2WL 2NY1C 3RX5A 4YNYB 3S37L 2DIJA 4YEEA 4CMMB 1P5VA 4ODSH 4Q6YA 1NFDA 1R3LA 1JF5A 1NC4D 5DO2C 3U4KA 3WKNA 1YPZF 1PL3A 2ZOKB 3SJVA 4KHTH 3FQRA 1GYVA 4JFZH 1ITBB 4PB9H 2YMOA 2BY3A 5FO7B 2DMGA 1JCKA 2VR4A 2DICA 2M26A 3DSNA 2Y9RT 3QJOA 4P5MA 2WQRA 3ARTA 4U3SB 3ESMA 3K0YA 4QHLA 2D3VA 2XWZA 3MJ9H 4KC3B 1D5XA 3SDXE 2N59A 1HNFA 1NAKL 1AE6L 4UQCA 1XR9A 2NX5A 1F56A 3QXWA 1PZSA 4XVJH 5J11B 1TR7A 2BS8A 4J6IA 5JR1L 4HU2A 4XNAA 5T1DL 2F61A 4A2GA 2DRUA 2Z91A 5K39B 4NBYB 5EA0L 1ACYL 3QQ4A 4PH8A 3WFEH 2BVOA 1X3DA 3I6KB 2F54D 4L1DA 5DJZB 3K2IA 3P3YA 3TTYA 3S36X 2ZJSH 1A3RH 2D9CA 4GO9A 4MMYA 4UNIA 4GXVH 5DLLA 3RB7A 5GS0H 5DQJB 4P9HH 3F7YB 4OM0H 2WUBH 5IROC 2BSTA 1HAWA 4BELD 3ILPB 4PRPB 4FNTA 3QDGD 3QEGH 2MOGA 2R69A 4FLSA 2KL6A 4G8GA 1RUPL 2EDYA 2ITDA 1FNFA 1UXLA 3BZFA 1MFMA 1YPZB 3CIQA 3CVDA 4NLAA 4DKEH 2ZKYA 3CHRA 3ZMRA 5CLYA 1N7MH 1NBVL 1QI5A 3K8KA 1Q0YH 2VR9A 2VDPH 3HUJA 2GEEA 1FFOB 4I48A 3IU4L 1R17A 1JMXA 3DK2A 2M8XA 4Y16D 3VI4F 1JGDB 2EEBA 2YKLL 4JHVA 2KKQA 4UIKH 2LU7A 5HDLA 4ZRGA 5IK3A 3ZHLA 2CDGA 4EI5B 1QQDA 3RWGB 1EEZA 2KMWA 4NO0A 4XO4A 1OL0A 4I8DA 3X11B 3GUTA 3I3DA 4X7FC 2FJHB 3EYFA 2CKBA 1XCXA 4GEIA 2CJUH 3ALPA 4LAJH 2BFVL 4PWFA 1B4RA 5TE6H 5HVHB 5MENA 3UZQB 1FLRL 3KPRA 1CFVL 3M7FB 1PZ2A 3CU7A 1IVLA 4ELMA 4LLAA 5LKNA 2E46A 4OJAA 3I3BA 5JIDA 3SBPA 4A2MA 3N41F 2CHDA 5D72H 5DK3A 5AVUB 1I85C 1XH0A 3DIFB 2P5WD 1JSYA 3BH9B 3GLDA 1ETJA 1N6UA 1JNNH 4KBPA 3NCBB 3MRDA 1CZ8L 2NY6B 5DHXB 5IMMA 4FQXC 4X5RA 2HLFC 3QUKB 3R7QA 4ODXB 2OJ1A 4ZTOL 5KSUB 2XICA 4LBEB 4NZ8A 1GKEA 2ZSWB 3KS0J 4X8GA 1SEBB 4UQEA 1AP2B 3GLAA 4ZTPL 3C6LC 2Z8WC 2YD4A 5H4YA 3SDDC 4J3UA 2JFCA 1W91A 5DCCA 4N2NA 4XNUH 3BP5A 4YHPB 2GJPA 1U8CB 4LAQH 3WBDA 1MW1A 4IGBB 4UV4L 2YLHA 2WXGA 4W9CC 4WU5B 4XNMA 1D6VH 5I19H 2N7BA 4ODUB 1B3IA 1KJ2H 2L7QA 2FK9A 4BYHA 2WP3T 2QPFA 1IGCH 3KLLA 4XP4H 5J9PB 1LO3H 1QTYT 3EOBB 1HQ4A 5K9QG 3G6AA 3MO1A 3O3EB 3BUIA 4X5WB 3SDCD 1R5IB 1NM9A 3OKEB 4N90D 3HZVA 2E7CA 1WD9A 4FKEA 4TTDC 1UOLA 5FOJA 1HXKA 4IBUA 2IH1A 1KELL 2V5RA 5CZXD 3SGEH 1OD9A 1XB8A 3N41B 2EVFA 1E8ZA 4N0CC 1U8MA 3U9UA 1RZKC 5LBSH 3NPSC 4JGNA 4ZO9A 4A6YL 4JS7A 3ARBC 3QG7L 4XNYL 3LH8A 3ARFB 4FLRA 4TQ8A 1KNOB 5IBLC 1R33A 2HYMA 4J23A 3S4SA 1JZFA 2C9AA 4RZCB 5IW1A 1CK0H 5JIQA 3IGKA 3US9A 3QULA 1FNGA 4QNPF 1G1KA 3B3IB 4AUUA 4LCIL 3EYUL 5GQBA 3DX8B 4X6DE 4AMKH 3HMWL 3LKOB 1YEJL 2PWEA 2W0PA 3N5AA 3VRLE 3DBXB 2JELH 3DWTA 3WTSA 4F9LA 5ELIA 3S34L 4YDZA 2G3XA 2F7PA 3F7VA 3MYJA 3HJEA 4AQ1B 3IWVA 4A68A 2ZE0A 1MFDH 3KYNB 4JFYB 1DEEB 4QRSA 1MQKH 1SEQH 5HY9B 2WLMA 4NC1E 3VH8G 5K9QI 4XVUC 3WU1A 4MNQE 4WUKL 4J8RA 4Z7NB 4S1SL 2XQBH 4G8EB 1Z5HA 1CC3A 7PCYA 2P44B 1L5GA 3SDYH 3V7MA 1U21A 1P5UB 2FEDC 3BRGC 1U91B 3PV7A 2DQCL 3QWOB 3WY4A 4M4PA 4M43H 3ARDA 3D7PA 1LDPH 3VVVA 4ZG1A 3O6KL 3SQBA 2DIAA 2YZ1A 4JHAL 4QUOA 3L95B 4RFOH 4Z3TA 3HN3A 2J12B 3K4ZA 4PTTA 5CAYB 4UF7C 4Z7QE 3LQAH 2VQTA 3RKDD 3LVTA 1G7QB 5EEVA 3RIAK 3CUPB 4L2YA 1KTLA 3GSWA 5I1GH 3OM3B 4G59C 3ZMNA 4OCYL 5C08D 4AY0A 3ULUE 4TLSA 2GK2A 3QPQD 1OAUL 2G5BB 2I7SA 1ZA3B 1S7WB 3TBSB 4EUPH 5EZOL 2HFFB 4WI4A 5FKPA 4U1SA 1RHHB 4QCIA 2XETA 3FRUA 5SV4A 2A74B 4OT1L 5E6IA 3QHTC 2QSQA 1YDPB 2K3TA 3B9KA 4YZFE 3HAEA 3K5SA 3MV8A 3TNNA 3AJ7A 4NQCE 5E2WH 2VW7A 4A7UA 1AJ7L 4U2YA 5E7BA 1NOLA 3DSFL 2GJ6E 3UX9B 3KYOB 4YHZH 4UTAH 5IIEB 3DRTB 1NGQL 2VDNL 1XSJA 4X80H 1H6EA 4ZMPA 2YWYA 5BUAA 1DBKH 3TIDB 5IR1A 3KPQB 4BZ2L 1O9WA 1NEZA 1YEWA 1H3UA 2G4EA 1FIGH 2AKRA 3DXAA 1L9RA 3PGFH 4FFVC 3LS4H 1R34A 1A14L 2PTUA 2YGPA 2JCCF 1NSNL 3UO8B 1XGTB 2NY3C 4AL8L 4S0TD 1KOAA 2HT4D 4OKVB 2CHWA 2FHFA 1IC7H 3OHXA 5DDHA 3AXLA 2APBA 3DPBA 2FX8L 4FXGC 5DJXB 3WJMA 5D1ZB 2JB5L 3EF7A 3BD5A 3D05A 2BW4A 3EDFA 3TN0D 1C12B 1S78C 2WLYA 3LQZA 3V6ZA 1I8IB 3QUYB 4ICWA 5J1TC 1GSMA 1OIOA 1PFCA 3KJ4B 2HKAA 1CICA 1M71A 3D25A 1BX2A 2J8UF 4OJCA 2DKSA 5LJYH 4ZUWB 1O6TA 5D9SA 3GMRB 5T3ZH 1J8HB 3IU3B 3TZVB 4IOSA 2VDRL 1XGPB 4X9IA 1G43A 3FTGA 1HVXA 1QLFA 1SDDA 4MJIE 4BFIB 4Q8BA 4AEHL 3VFWB 3K0WA 2B9BA 3MAWA 2CHXA 5E9DB 1PEWA 1USZA 4ZUUA 5CSGA 4XC3H 5FYJL 3V4VL 5ICXB 4TSBH 5ISZB 1ND0B 2AF2A 4PG9B 2E7LA 1IRAY 1LEGB 3KG5A 5CJ8A 4BH7A 2XXMB 2X4UA 2CGYA 9CGTA 2FD6L 3PXJA 4ZUTA 1G9ML 1S5HB 2QLVB 2VXSL 3PFQA 4Z8FH 3FZUC 1CDCA 3VFPB 1RLBA 4HS3A 4XZUB 5EZJA 2A6IB 1OCOB 2JCCB 1GIGL 5ANMA 4PRPD 3KR3H 5I1EH 5CGTA 2Z1KA 1WDAA 2OMBA 4UTBH 2GVYA 3TT1L 5HBBA 4TUUA 2PTVA 1T0OA 4YDKH 4Y2OB 1J05A 3X3GL 5ABZA 2N7AA 2Q2LA 3QJUB 1KPRB 3WNIA 1DQLH 1N0XH 4ELKA 4TLUA 1NKGA 2C7UA 3LN5A 3LXUX 3Q2LA 1D9KA 1YQVH 1ZDQA 4OBRA 2A0LC 4YL4A 1SXSA 4HXBL 4PJ8A 1JV2A 4JKLA 4N1CA 1N6QL 1IBGH 2MCAA 3RRQA 4XC1H 2J8UB 2V17H 3JUYA 2DN7A 2XV2A 1Y0LB 3WYRA 3ZDZF 3WXWH 3PNRB 4HLZG 1MFVA 4MWFA 7CGTA 5JORB 1M1SA 4LQ1A 5IWLC 2MQ3A 3GSQA 5DGQA 3ZU8A 2OZ4H 3DO4A 5SWSB 3P0VH 3PWJB 4MSWA 5JMOC 3ASOB 3V10A 4WGVB 1Y18A 2AS5M 1JXDA 8FABB 1A64A 5BRQA 2DYSB 2WLKA 3JWNC 4GQRA 4AV4A 3BGFB 5F8RC 5IBUB 1RZFL 3BP6B 1MFNA 2NY6D 3QIBC 3MXWL 3ESUF 2W07A 1JIBA 2PLTA 1R3KB 5ALCH 5AW6B 4DPBX 3WN5B 1E2WA 3S37X 2EIKB 4PRDB 2XFGB 2J8OA 3MGTB 1U3NA 2D3JA 1HKFA 3BLPX 2D7PA 4KMLB 3X17A 3HPLB 5IJBC 2HN7A 1MPAL 1CG9A 4M5TA 3BZDA 3ISWA 3EFFB 4ZSOB 5HGBB 2QL1A 1DJIA 3RZCB 2G60L 5DJ8B 3ROOA 2X10A 2CUMA 3APFA 4IGBD 2OYMA 5EU6B 3DVGA 5PCYA 3P4MA 3QDJE 1AFVH 5C2BL 4WUUA 1GGCH 4JJ5B 4IOFC 4OW6A 5TPWL 3T09A 5DI8B 3BN9D 4EEEA 4Q9RH 1T21B 2D7OA 2FJGA 3B9DA 3ZDZB 3KLAB 3NH7L 1RI8A 5FUZL 2NY0B 5KBMA 3ULVC 3KMDA 1T2QL 4NO5B 1XEUA 4L5FH 3UTSB 4HG4K 1CDHA 1I53A 1ZK5A 2NY5H 4KDWA 5F6HJ 4DNLA 4OF6A 4JY4B 1YCSA 2VDMH 2X1PA 4JFDB 4FC3E 1UJ3A 2YD7A 5EF2A 3B83A 3NN8B 1SOXA 5C0DA 2HVJB 1J0HA 2GCYB 4WK4B 3GXMA 1CLYL 4YHKL 2W38A 2B5IC 2X44D 3NCCB 3RGVD 3QCTH 1H3WM 4JQXA 3MBEB 3UZVB 3W9EB 2P8LB 4DTGH 3SGJA 4JRXA 5T3XD 2BW5A 2KH2B 3ARFD 3QWRD 4GKNB 4KRPC 3EJZC 4Z7WE 2ZYSA 5SX5H 3RVXD 4IHOA 3IJEB 1DSWA 1JZ4A 4RNRA 4IDJL 4FDWA 3MC0A 5IOPA 2EE2A 4BFJA 4JEGB 3MKGA 1YEIL 1ZY9A 2WW8A 1AAC