2KLRA

Solid-state nmr structure of the alpha-crystallin domain in alphab-crystallin oligomers
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
82
structure length
82
Chain Sequence
b'RLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-crystallin B chain
molecule tags Chaperone
source organism Homo sapiens
publication title Solid-state NMR and SAXS studies provide a structural basis for the activation of alphaB-crystallin oligomers.
pubmed doi rcsb
total genus 13
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
A PF00525 Crystallin Alpha crystallin A chain, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2klrA00
2Y22A 3QORC 3QORD 1WFIA 2BOLA 3EUDA 2KMWA 4YLCA 3AACA 1EJFA 4I88A 3Q9PA 2MNWA 4FEIA 5LUMA 1WGVA 3W1ZA 2WJ7A 5DS2A 2KLRA 4JUSA 4ELDA 3GUFA 4RZKA 3IGFA 3QORB 1SHSA 2N3JA 2RH0A 4JUTA 4YDZA 1X5MA 2K8QA 4YLBA 3Q9QA 2CR0A 3L1FA 1RL1A 5DS1A 4MJHA 4ZJ9A 4PCKA 3VQMA 3GT6A 3N3EA 3GLAA 4M5SA 2O30A 1GMEA 3VQLA 3J07A 4YE0A 1WH0A 2JKIS 2Y1YA 4PBDA 2WJ5A 2Y1ZA 3L1EA 4YL9A 3L1GA 4M5TA 3QORA 2XCMC 2CG9X 2N0KA 3AABA
chains in the Genus database with same CATH superfamily
4P3DA 1VEPA 4HOZA 2WZ5A 1BSIA 4EEEA 2ZCKH 2WZPA 3N1QC 3ZKND 5L9DH 5KSUA 3BP5A 4XR8C 5IB4B 5DJ2A 5JIMA 4YDLB 2WXRA 3DHUA 1AZCA 2FJFA 1FNSH 4NUPA 3IPFA 3QS2A 2HH0L 2D7TH 4LFHG 5E08L 2XUWA 3L5XH 4OI8A 3DI2B 1OAKH 3PP3H 2EO7A 2NDGA 3SYQA 5ISZA 3CD4A 1KYUA 2RHEA 5E6YA 4LB8A 5IEHB 3ZL2A 1OAUL 2YEZA 4X80H 1HH9B 1NGPL 5C2BH 2ICES 5EZJB 3FQNB 4IRJC 3V4VB 4FTVA 3MCKB 3N85H 2YD7A 4PJBE 4AVHA 3L2NA 3LPOA 4M3KB 3SPJA 1F90L 3K5SA 2VQTA 5JO5B 4R0LC 5JHDD 1WZMA 1IARB 3IB4A 4EIUA 1HOCB 2NXYC 1W72B 1E8XA 1OY3B 3PGCB 1I9RL 1YHPA 2FEDC 1OARL 1WVZA 4YXHL 4IJTA 2JKIS 4E9TA 4KTEL 4DWHA 4S1SH 1LO2L 1S9YA 1Y6KR 3ZDZB 2HB0A 2DQIL 3P2TA 4XHQA 1T0NA 3T2LA 5I1EL 3UYRL 2B2XH 2HRPH 2WKOF 2X28A 3CZNA 1JV2A 3WO3B 5FHBL 1CFTA 2Y25A 4Y4FC 5LG1A 2VSMB 3BAIA 1I7TB 5LGJA 3MSPA 1HEZA 4NWUL 4HWEH 3RY5A 1GPOH 4UOZA 1CR9L 1DP0A 3AXHA 2YA1A 4MCYB 4AJ0A 1YUHA 3TBBA 3WTSA 1P4LA 1UD6A 2I25N 4RA0C 3TYFB 3MR9A 2QHRL 1RSFA 4NZFA 1XIWD 4G43A 2NW3A 3BO8B 5JW5A 1YMHA 4M6NH 2Z8VC 3HI1B 2J5LC 1CFSB 5B4MC 3G5ZB 4X6FB 5FC9A 3WKYA 3ZZ1A 1RZKC 3EF4A 5HHNA 1KFAH 1I1RA 4WSKA 5CGTA 1TTRA 3OAYK 4YMPA 2VLKB 2QADB 1NMBH 2X4UA 2Y1YA 4I0KA 4OI9A 3V95A 4G8GD 3GXUB 1JGEB 5DRXB 1ADQA 3OJDA 4G6FD 4M43L 3ZHNA 4DGWC 4ZZKA 4PRHA 1I8KB 2IPUG 4YFDB 1OGAB 3K2UH 2YSSA 1XF3B 1T6WA 2G3NA 5CEZL 4JFWA 3LQMA 4KTDL 4MQXD 4NGHL 2EDLA 1RCYA 4XX1E 1U8NA 3ZN6A 4W9IC 4I18C 4L2YA 1DDTA 4NUGL 3UCRA 1K9TA 4Q6YA 3CVDA 4ZUUB 5JIKA 1QZ1A 2WWNA 4LLQB 2BC4B 4GAFB 4HUWA 4JPWH 3CN2A 2XIIA 1Q9KB 3I75B 3U6RA 3UGXA 2WLHA 4JFUA 1NBYA 4Z78B 4KKLD 3ZHDA 1N8OE 1OARH 1FO0B 1KTCA 1S7TA 3Q2WA 2IAMD 1P6WA 1CICD 4HLEA 2B08A 5F7DA 4MS8C 4JUSA 1U6AH 1O6SB 1NQBA 4H0GA 2PTUA 4UTBH 5JIDA 4KX7A 3JXAA 1F8TH 3VXSD 1IGMH 2X1XR 4R4ND 1IT9H 2HSIA 4CN4A 4U0RB 3AMLA 1WO2A 2QV4A 4PRIE 1YY9D 1IC7L 3V52H 1CK0L 3EFFB 5CCGE 1ZLEA 4OV5A 2EEXA 3AGVA 3MUUA 5JXAH 1S7RA 1AY1L 3EJZC 3LKSA 1FG2B 1JRHL 1EZLA 2W0PA 1T1ZA 2OS7A 4AQOA 4PR5A 4NIKB 2Z31B 4P5MA 3FC8A 1BJ1H 1ZAGA 2GW5A 1A4JB 4TLUA 2G2NA 4MJIB 1QEXA 2BP8A 2FRGP 4MVBC 4ZW8A 3WIFB 4Z6AT 3O6KH 2OXGA 4JFEE 4QTHB 4XZ4A 5F1OB 4HC1H 3IMBA 3BISA 3C2SA 4KK6C 1U2YA 3S5ZA 4N2GA 4BFKA 3IGLA 3SKUD 1Z0NA 4Q97A 5AVRB 2EUXA 5DYOA 3O2DH 1REIA 1TJGL 2I60L 3T6XA 1O9VA 4OF7A 3QIBB 4KPHL 1NLBL 3HCVA 3U0PA 1V8HA 4MSWA 4O02B 1FHGA 4QD2E 4ZRGA 5FYJU 3UTQA 5I1LB 4KZDH 1CF1A 2R4RH 1J1OL 1T3FB 3GDCA 5DHXB 4PGEA 3TH2T 2VMEA 3DVNB 3NZHL 4MNGB 1FC1A 3OBAA 3TGXA 5EOQH 3QUZC 2BP5M 1KELH 1CDYA 1OHZA 4ZPTA 4G8GE 1BVZA 4NO3A 4F8QA 4PTTB 3GRWL 1KEGL 3DVGB 3ETBJ 4AVKA 1IGFL 5MP6L 3CZKA 4WFEE 4ZX3A 4PY7A 1ITBB 2OR9H 3CAFA 4YDKH 4MNGA 5F7LB 3SCMC 3LRSA 4HU2A 2JI1A 3I9GH 2X4PA 3UACA 1KB5A 2W5PA 4NQCA 4MX7B 2OZ4H 1F58H 2ZUTA 3I50L 1SM3H 3FTYA 5L2KA 1NPJA 3RI5K 2H5UA 1RIUH 3HZ3A 5IB5B 1UHVA 4FEMA 3WJMB 4H8QA 5EFIB 3RIKA 1TLKA 3TBYA 1JIBA 3EJUA 2DWEA 2YXFA 3NTCH 1J0JA 4HXAL 4FFYA 1ADWA 4Y9FA 1A4JA 4OZIE 1H6UA 2GY7B 4N5UA 5HDBF 2IO5A 4QLRA 1NCDH 2CD0A 4LLMB 2ED6A 2CIKB 1LTXA 2NY4B 1FH5L 3G08A 5KANG 3RX5A 3VFPA 4AH2B 3V0EA 5JZ7D 3WFHB 3WNOA 4A2LA 5ANMA 3LYRA 4H0LC 4PTUB 4BSJA 2ZOLB 1MHEB 1OAJA 4MMXA 5F9JB 1OE2A 4JZOB 4YSOA 3GNMH 2VR7A 1ESOA 1YZZA 2QFRA 4G6FB 3TWCH 2Z64C 1HWWA 1NGZA 1XGYH 5DDHA 4DKDC 1MZYA 2R29A 3ECBB 5ITFB 1F86A 3L5IA 4L18A 3VD2A 1HHIA 3WKML 2I9TA 2OMWB 4OVVA 5EEYA 1N4XL 2EE3A 5C9KA 5LB1A 5AOMA 3WU1A 2Z34A 5CN2A 3SIKA 5BMFH 5AVZB 1BOGB 1QBLL 3SGJC 1W6LA 5K9QI 1HYSC 1FL6B 5F89B 2P7TB 1HL5A 5JPMA 2YO3A 5HVHC 1H6TA 4J3XA 1O0VA 2CO3A 2HKAA 1YJDL 3DJ9A 5E8OB 1ZE3H 1O75A 2R29L 1SDAB 3ARWA 4GKLA 4LLWB 2GTQA 5IQ9B 2IGLA 3VFMA 2E9BA 3UJIL 3ZJAA 5FECB 4ODWA 4JPIB 5AAWA 4HD9A 3MGOB 2AP2A 4B41A 2GPZA 1ZT1B 3O4LE 5AB9A 3L7FA 2WD0A 3DIDA 3CX5K 4O00A 3UTSA 4BFJA 5DHVB 2GAZB 1QLRA 2XWBA 3BUPA 1K8IB 3FYEB 1TJIH 1OSPH 2MSPA 1J88A 3MGOA 3H0TA 4F57L 2UX6A 5FM8A 1INEH 2VH5L 3V6ZB 4F1SA 3DHMA 3IBOA 2NOYA 3HPLB 4M4RB 2QLVB 1RHHA 5GHWH 2PR9A 1HJBC 3ASOB 3QFDB 3PIQB 5AAMA 5F89A 1YMHB 3QNXA 3O6FC 4C83A 2NT0A 5DZPA 4YLBA 4J6RH 4N9OB 4JFDD 4Z7UA 1IBYA 4DNLA 4U3SA 4MS6A 1IC4L 3VD7A 3QDME 3MR9B 3P77B 2QKSA 2Y07H 1U8CB 2QHRH 4L3CB 3HPJA 1U21A 3WHXA 2VDOL 2HWZL 4B96A 1KCVL 1G7LB 4WW1B 1EVTC 5T3XE 3W57A 2C1OA 3DOHA 3WLBB 3QI9A 4K2UH 5DURD 3VFOA 2IFFH 4U4BA 3V5DB 2J1YA 1QFPA 1NCIA 1CLYL 1UOKA 4FXKC 2JELH 3HZYB 5KJRL 5JIQA 5LGJB 3RTQB 2AJXH 3WFHA 5BVPH 3G6AA 5HI5C 3FPXA 4MCNA 3H9HA 4N6QA 4F7EB 2HVJB 1HZHH 4WEMB 4I9WD 3BH8A 4MAYB 1FZMA 1T20B 3RYMA 3QEGH 3GINA 3V0AC 1IGJA 4QCIA 4Z76B 4JO2H 4WI4A 2P5ED 4PGZA 4E9XA 2PPCA 2P45B 4M7KH 4X4XB 3ZTCC 4BELD 4W68A 1J0KA 5A6MA 3GI9H 1NCAL 2E59A 2DAVA 3EYUL 4U1SA 4OZIA 2APWA 4H7VA 3VI4A 1KIPA 3BCFA 1Z6JT 4ATTA 3KD4A 1DJSA 5BZXA 2NR6A 4O9HH 4WI9A 5BQ7B 5T1JA 3HG4A 1GGYA 3EG9B 4FG6D 3P40A 4NFBA 4LSQL 1F42A 4YR6B 5DZAA 1SBBA 5EZJA 3D0LB 2CMRL 2WLLA 4PY8J 5JQHC 1N0LB 3LXCA 3RWIA 2XA3A 3EUUA 4MA3A 1KACB 3VG9B 2YWYA 1WBZB 3QVAA 2YD0A 3FQWA 1KIUB 3HCVB 1T1XB 4IIZA 1BLNB 2QGCA 5I0XA 1BVKA 4PV8A 1RFDL 5H35A 1OD9A 4YSSA 3H53A 1PU0A 5F7HA 4LLAA 4XBPA 1AE6H 3AB0C 4XNXH 5GIRB 3V4VL 4AC2A 4CILA 1SQMA 2Y7QA 2DQUL 5D93C 4QWWC 4J3UA 4EN2A 1J11A 3ES6A 4A2DA 1P7KA 4ZDHB 1BF2A 4WNQA 4U6HA 1MOEA 2JIXA 3VCLA 4P4KA 4W9HC 5IMKB 3JBG7 3WNPA 4TULL 3SDXF 3VB9A 4GEIA 5PAZA 2A9BA 2ZUUA 3DKHA 2GBUA 1CLYH 1CDGA 4PGBB 1IE5A 4G80A 5DQDH 4HV8A 4YDLC 4BFRA 1NAMB 2GJRA 4P0DA 4J3OF 4K2UL 5CGYD 2B77A 3H1ZA 3IDUA 3CZFA 3QYCA 4X7DC 4KZEH 1G6VK 4S0SD 3SJVB 3UMTA 1YEKL 4GRMB 3X1FA 2X6UA 4JPKL 3ULVL 5I75C 4IW4C 2D03H 3C5ZD 3IU3A 4HIXL 3SQOL 1I3GL 3IDNA 3J8F7 2WB1A 1A7PH 1MF2L 5L2JA 3B7YA 2VDLL 4QRRD 2AEPH 2E7LA 5HGHA 1T0PB 2DLHA 1NBYB 2QLYA 4D9LH 1JFQH 4LPVA 1KJ2H 1WAAE 3TJHD 4ALAL 3R8BB 2CCVA 1W72L 5F3BA 5C3IA 4YFLI 4XC1H 1CZ8L 2NNFA 2DPKA 2KHAA 2AJVL 4IBVA 1VRSA 2DEWX 3BVUA 2B9BA 5F9OL 3ZW3A 2BINA 1EO8L 1XGQB 3IJSA 5E8DH 3MN8A 4ZNCD 1XF3A 1SHXA 5E5MA 5T5NG 2OP4H 1TUPA 1WITA 2DMHA 3FKUS 4UWQB 3HG0A 3CLEH 5E1IA 2C9RA 3GMQB 1XMWA 1QPXA 4JL1A 1MCLA 4TVPD 5EMYA 4JJHA 3JTBA 3FUNA 3TWYA 4CVXA 2NY0D 1OB0A 5CZRA 3QEQE 4Y4FB 4AJYV 4OCMC 2O72A 4NRYB 4JHAH 2WWMC 1T4WA 3MOAH 1RZKL 3C08L 4B9ZA 5CIPA 4FFWD 1ORQA 4FYSA 2G0LA 4E36A 2X4QA 2I7OA 3NSFA 1CU4L 3FO2A 5FYKD 2WZAA 3MJ9L 4UTAL 2ADIA 4CU8A 5IM7B 4YLCA 2FVNA 4Z9KB 1A7QL 4AV0A 2XG4A 2J43A 2XIDA 4N1EA 4YDNA 5JQ6L 3RWHB 4LBEB 2KL6A 4Z7AA 1ZANH 4PWJA 4Z7NF 2F61A 1OM3H 1EHAA 3GJEB 4YFLF 3SGEI 4XH2B 4P04A 1DBKH 2VYRE 2BIQA 2WIIA 2J5LB 2XTLA 3S5LA 1M6OA 2JB5H 1EEQA 5E95B 4ENEC 5LNDA 1IM9B 2ATKA 3U9UB 5HHPB 3BPCA 2CA3A 2VW4A 1BDYA 1T83C 3FU7B 1B4JH 2PR4L 4QRQB 2IDFA 2V2TA 5IBLD 5I8EB 1J8HD 2BERA 5E4OA 3SDDA 1AO7D 2DD8L 2VKWA 4I2XB 4U1MB 3ULVH 1I8MB 4MLIA 1KIQA 4JPQA 2E6JA 5E8PB 4U1KB 3SN6N 2BNRD 3O41B 3GEWB 3OKDA 2AVGA 1CLZL 1FJ1A 3UPRA 2AEPL 1P7QA 1JZ5A 4MJ5B 1BIIB 2J2ZA 4U6XA 3U7YH 4U31A 3UFIA 3QHTC 4WEEA 5D7SH 1LO0L 4QXTB 5BUGA 2PTTB 4H8PA 3VM7A 4X5WA 1TU2B 4F5CA 1AXTL 1UXSA 3BLPX 5DO8A 5K1NA 1YAZA 1I1AC 3PV7A 1P4UA 3MCKA 2HZHA 4KFZC 4M6AA 1JYWA 1QLFA 4ZOBA 1JNHA 2A9NH 5AOLA 4L9LC 4EN3C 5J1AA 1NEZA 3SCMD 2JQZA 5BVJB 4H13C 1W0VA 4MXVF 2NY1C 4XP6H 5E5UB 5BXFB 2IQ9L 3VXQA 4DQOH 1FQ9C 1AE6L 4HMDA 3CZGA 5C6WH 3MOAL 1G1OA 2WQVA 4E42A 1I1YB 2E7DA 4XMVA 4WW1A 1P69B 1ORSA 1NTDA 2Y7OA 4Y19A 1U9KA 5C92A 2VM3A 3NSDA 5AW6B 1F58L 5MENE 3LKRB 1Q72H 1X5HA 2XKNB 3HC0B 5L7XH 1L9TA 2JJTA 2WSKA 2DMGA 3Q5YA 1NEUA 4NI6A 5LJYH 4LPYA 1XF4A 1FFPB 4I3SL 3IN2A 3QFDA 1RHHB 2X44D 3TT3H 1NCWH 7FABL 1R5VA 4MMZA 3WIHL 5IOKA 1J8KA 1FHNA 1IC7H 2VAAA 2UY7A 3QCVH 3AG4B 3OKYA 2WJ7A 1RHFA 1BZ9A 4QHNB 3ZE1E 4CW1B 4KK8D 2EH8H 2N3JA 4HOMA 1QLRB 1KJMB 1EK3A 2WCSA 2Y7NA 2O5XH 4BWUA 4NO5A 1QVOA 2BW4A 3BFWA 1V7NH 2ZKWA 3E0GA 2WLYA 2JCCB 3FW6A 2GIMA 4UNTA 1EFXB 3B8SA 4LRNL 5E1QA 2FEJA 2FJGA 4EZMA 3L3KA 1XF2B 4U49A 4UQ3B 4N2FA 2DWDA 1YEKH 1UYWL 1I8LA 3QPQD 1I8IA 4J4PC 1CE6A 4LEOB 1DN0B 1L9OA 2B14A 3BP7B 3BWZA 3MRBA 3BQUA 1GXEA 3Q43A 1IGFH 5MP6H 2LLNA 3DI3B 5C0GB 15C8L 3DGCR 5ICZB 3DV6B 2GABA 4K5MA 4LCCB 5K39B 3L08A 1WFUA 1EA9C 3D30A 3VI3F 1RZFL 3BGFB 3LDBC 5HYJD 4CMHB 1FL5B 2DLFH 4H0HB 4HS3A 1E9OB 3UCQA 2XWTB 3ILDA 3JYBA 1DL7H 5DHEA 2G2PA 4WI0A 1A6ZB 4YEEA 3S2CA 4HFUL 1F02I 2D3JA 5JR1H 4F9PA 5AYTA 3ECBA 4P2YA 5D55A 1UKSA 1ZLVH 2NY4C 1MFDH 4QXVA 5F8RC 1P6AB 4TN9A 3S88L 1EUUA 1OAZH 3FU5A 2ZOLA 3OVUB 4P3WA 4RZKA 5I1GH 2ALWA 4P23C 1ES0A 4F20A 4Q9RH 4MJ6B 5EOCJ 1OP3K 1NSNL 4JO3H 4PI2A 4AIEA 1L7IH 4ILDA 5HYJB 4S1QH 2JJVA 3RVUD 1MAML 4F57H 5CJXA 5JXAL 1HCVA 2BZDA 3MCG1 1Q1JL 4ZOEA 3BZEB 2R0KH 2OKMA 4Z3EA 5F1IB 4HGWA 5IVOA 1QRND 3E9UA 2FIKB 3FZUD 4JFQA 5E4IA 1ILSA 1OAYL 2H41A 3CGTA 2Q10A 4L3EE 2JCCF 1AD0B 5DD6B 3EHBD 5D70H 5I1HL 5KOVC 3MTXA 1T89C 3QZOA 4PJ7A 3LRSB 4NZUL 4G9DA 4PG9B 3CZJA 2Z8SA 35C8L 5C3LD 3QJTB 3MBED 5DS1A 4X5LA 4KO9A 5FPIA 4PCKA 3Q44A 3MUZ1 4H4NA 4JY6B 1JGLL 2CHWA 2G5UA 4HIPA 2P24A 2XIBA 3QG7H 1W2KT 1DBML 1PF3A 1E28B 1QFHA 3MNZB 1OF2A 3RL1A 3RQ3A 4DP4X 4X2UA 2XQYA 2DQDH 1JXFA 1JHTA 3MRPA 4FXLA 1WC7B 1HZHL 1QUNB 3T2NL 1WBYB 1DHKA 4M7JL 2P24B 3AM8A 3LX9A 2CALA 4K7PH 2CO2A 3MLXL 4OLYH 5D6DC 4RIRB 3MODH 3ATEA 3NQKA 1SJHA 4XMTA 3O6FD 3N3EA 4HXAH 3GMNB 3MDJA 4DKEL 5KAQF 3MLXH 4OLYL 2OXGB 4AIXA 3TFKD 1F1DA 1G6RA 2AC0A 5DD6A 1A3ZA 5I73C 3EBAA 1NIAA 4KH2A 3DK2A 1DQKA 1B0GB 1IX2A 4B7IA 4WJ5A 3GXFA 2WUCL 2I24N 3X12B 1N3NB 5F1IA 4ZTOL 2DQCL 3TBSA 1S7RB 2XSKA 3QJFB 2G9KA 5FGCB 1ZE3C 3IGAA 1TJMA 2EZ0D 4X4YA 3RTQC 1CT8A 4ELKA 5F96L 5GRWA 5KYWA 1DDHB 3JQOB 4PJHF 3DMMC 2W60B 1DQML 4OZGE 4XMLH 4M1GL 4DN3L 3GS7A 4G6MH 1JV5A 2P1YA 3D85D 2NZ9C 1FE8H 1A1OA 4Y2LA 1UWXH 4KDWA 1F90H 3OHMB 1VFOA 2VDRB 2YIHA 4QRPB 3VWJC 5GS1B 5DEGA 2E7CA 2VSCA 5HYIA 3NAAL 1A4KA 4PRIB 2DKMA 1A14H 3CPLA 4WWKD 4RMTA 1AS8A 1THCA 2I32A 3VXMA 1T5XB 5E0FA 4HJ1A 1X6LA 4QOKB 3ZKXC 2GBVA 2JKNA 4HS8H 4ZMZA 1GL4B 1T0MB 1IV8A 2K8MA 5I8KL 3N6YA 5C6TH 4AEHH 4QY8A 2GTWA 3N1FC 3RKPA 1VPOH 2Q86A 4HKZB 3RURA 2BNUB 1VFBB 2IH3B 2OMVB 3MNDA 4LE8A 4P5TB 3T8XA 1ZGLB 4PRHB 3X1BA 3PV6A 4OLXL 2BOCB 2XFGB 1I8IB 5D7IA 1MI5D 3SE3A 3U82B 5I28A 3GXPA 3BZDA 1P2CA 5HP5A 2FJGB 2VE6A 3BDXA 3KWUA 4RISL 1H3PH 1UWFA 2VLKA 3G6DL 3LB6C 5JOFA 2KZWA 3G6JB 5HGBB 4KKNA 1LWRA 3JZ7A 1H3PL 4X6FA 3V5KB 1CFSA 3AT8A 3LH2H 2YUZA 4IBYA 2MFNA 2FE0A 3BUQA 4NAMA 3IMWA 2DI7A 2HTKD 3RBGA 2ADFH 1T7YA 5GRZA 2WAQA 3SKJH 4HYTB 4MFHA 4QRTA 5KYXA 1UXMA 3AB0B 3UC0H 1R5IA 5JA9A 3LVTA 1XD1A 1OAKL 3TIEA 2CGRL 4LCWA 3C8DA 1WPCA 3D12B 3QDJE 1WJ3A 2D7PA 1J05A 2JK5A 3CMGA 3QZBA 5B38G 2VQ1A 2YC1A 2OJ1A 2FJSA 2WLJA 1DVFC 1EBPA 1FFPA 4AM0B 2ZP0T 5DGQA 3Q2CA 3IETA 5L2KD 4HLZG 1LO4H 2VR4A 3M7OA 4I89A 3ARYA 4WJG3 3OPUA 3AQXA 1YSOA 2QQLL 2AITA 3TZVB 2QVMA 3T4YB 2RFXA 1D2OA 3IFPA 1I1YA 3W2DH 4PJCE 2ATPB 3AY4A 2IGFL 2ZUWA 2QGEA 5HDBE 4ANXA 3AACA 2AXFB 2A6JB 3LXUX 2VLRE 2XHNA 4E9YA 2BPBA 3LS4L 1ZSHA 3QJZA 1S9YB 5FUOH 4FA8A 3HMWH 5E4EB 1XSIA 2C9PA 1EXUB 2JKJA 4Z3JA 1LVEA 5LBSA 4P46D 2WYTA 3MLYH 4H1LB 2R2HB 3BIKB 4P9HC 2K4WA 2RA1A 4K3GA 3NRFA 4OLZL 2PXYA 1XXDC 3Q6GH 1QLFB 4JHBA 4EBQH 2IV9A 4NJAL 4I2XE 4KO6A 3NPSB 4JY5L 3DPDA 3A5VA 3EJZD 3LQAL 2BCKB 1UXSB 1KGIA 4IBZA 1A3LL 3QXVA 5LKNA 1KYFA 1MFMA 4P2OD 5FFOA 2YMXH 3D6GA 3ULSA 1ET5A 1TQCB 4WI8A 5D7LA 1L9PA 1QHOA 2YFOA 2LU5A 3CPUA 3RNQA 2FLMA 3EIFA 3TEZA 1BEYH 3RFRA 3BAKA 4U1KA 3WL9A 2NX5A 1KIQB 1WSST 2JJSA 4ISVB 5DJ2B 3WYRA 1R9FA 2WKGA 5I6XB 4ZBJA 2F5AH 2JQAA 1WP6A 2V6HA 3P1VA 4Z3TA 4N9GA 2PO6D 1RJZA 4D8PB 1TVBA 1GYCA 3LEYH 1AXIB 2WMPB 5C08D 3TZVA 4I5BB 3U9UA 5HDRA 4NXKA 5ISZE 1SJVA 3PABB 3Q7JA 5DLML 1F18A 2EO1A 3KCWA 1NFDB 3O9WC 4PJ5D 2DQ6A 3KBHE 1K5NA 2Z4QB 1R3IL 4YXKH 3SKMA 1A9VA 1MJ8H 5I76B 2B8OT 2VQ1B 1S7VA 2O6DA 2YC1B 3GSUA 5FAAA 1J05B 5EEWA 3V5HA 3MV7B 1ASOA 4X4ZA 1A65A 3RNKA 3P3UA 4Z7NE 5EOTB 1MW3A 1OCCB 2DQHH 1CD9B 1A5FH 4JFXA 4NJAH 3QSKB 4AIZB 4ONFL 3OJVC 2EVFA 4DHLA 3NK3A 4I0PA 3EDFA 5DJCA 2PR4H 3UBXB 5KYXB 5IMMB 1ORQB 4CC4A 4A2HA 1NM9A 3WFEH 3HS9A 2D2CC 3P4NA 4HHGA 4W9KC 2R15A 4D0DB 4GFXA 2EDHA 1CXFA 1BX2A 1L7IL 3STZB 3PHQA 2HPTA 3S3CB 2CUMA 1GGTA 5C0FB 4F7CB 2FIRT 1N2RA 1ROCA 1CGTA 3ZY7A 4M43H 2Z1KA 4IRSA 3GMQA 1CZ8H 4WI2A 1MCHA 4XN7A 43CAB 3S88H 3X3GH 1XQ4A 5E6UB 1KENH 2OSLA 4KHXH 2GITB 3O11B 1SDYA 3DX9A 4LCIH 5M7QA 5J11C 3AT0A 4PB9H 5I0ZA 1PZ5A 4Z0XB 3VYOA 2BNQE 3QUYA 2WCPA 3D2UA 1J8RA 4QKXB 1HHKB 3QUYB 3M86A 3RE0A 4PMEA 4MAYD 3K72A 1X9RA 3AMKA 4ZX4A 1G0YR 4JRYA 4JDVA 2OSLB 1MH5A 2E74C 43CAA 1YY8A 3AWEA 4AOFA 2BSSB 3TN0B 1RZFH 2F53B 5AZ2L 3E6FB 1G4RA 4UQEA 5AEAA 1Q0YL 2XT1B 4MNHA 3PGFH 2QMJA 4CGUB 5CS7A 1IFGA 5JXEC 2E7MA 5F8QC 4FP8L 1MLBB 1C7TA 1SLXA 2JI3A 1KB5H 4JY4B 1X5MA 3QUML 2FEDD 1YG9A 4X50A 1HI6B 2CQVA 1RZ7L 3L16A 2LAAA 4HG4J 5F72S 3V4UL 5EG6C 4BEIA 3QUHA 3EYQC 4WWID 5DHYA 2J6WA 2Y1AA 1S7VB 4PRHE 4R90L 3PPEA 3ZE0F 5I76A 2SEBA 8PAZA 2DLTA 2FO4A 1P4IH 3B5HA 3DSNB 3IS0X 3GMOA 2Q2LA 4RAHA 1RULH 4NQEE 2KT6A 2Y7QB 1IMHC 4LQFH 3ELAT 5ADOH 2J4WL 3C60C 1MY7A 5D7JD 5FA4A 1C5BH 4NO2B 3JVGA 2VR3A 4UQDA 2QPFA 2OL3L 1BFVH 4X99A 3FB8A 5FO2A 4JFEA 3LNHA 4HGKC 4S1RL 3ARZA 1A6AA 4YHZH 1ACCA 1JZFA 3D4GA 4PJXE 5BJTB 2X1WL 3SKOA 1MLCB 3FQ4A 4KHTL 1P4BH 3MRPB 2XNAA 3DSFL 5GQBA 5DJZB 3X13B 3QB7C 2XXGA 2ISDA 1IKNA 3SO3C 1B3IA 2F7OA 4V1DA 3K1KC 1ND0B 1OF2B 1CI3M 2A77H 3GM8A 3J2PA 4JM4H 3V7AE 4PJAF 4G8GA 2OZ4A 1QW9A 1DQJB 1QOKA 1NCCH 3LDBB 3L9YA 4ZQTA 1X5AA 2YBRA 4MJJA 4CMHC 5CP7B 2BCMA 4Z7WA 3NJLA 4JFPB 5HDBB 1FFNB 3BPOB 2YXVA 4H5SA 1UH2A 1KV7A 3QULA 2HLAB 2HMIC 5GRYA 4IHOA 1DFBL 4R3SA 4U1SB 4B3VA 2J6EL 1GH7A 2BFGA 3OGCA 1FBIH 5E7FA 3HEIB 3E3QC 1AGCA 4YFEA 2ZIDA 1YJDC 1VENA 4FQXC 3K7UA 3AU0A 3RVTD 3TEUA 3DBSA 1D9KB 1NOAA 5F7FA 1IM3D 4X6BB 4IMKC 1MIEH 5C0ND 3I3EA 4OJFH 2FUTA 2BSBA 3WTWA 4LSQH 1CURA 2V9TA 1U8KA 5KVEH 4MAYA 4Z18A 2ICWB 3IFPB 2DB8A 5IJKC 1H8NA 3ZRCC 1QBAA 5EOCH 4UDTB 5GS2D 2OCCB 1G9ML 3US9A 1OQXA 4XP5H 1B6UA 2RTTA 5EBLB 1KPUA 1K5WA 2KZBA 1WAEA 3ENEA 5E9DE 3GZQA 4RAUA 3ARQA 1RUMH 1KYAA 2VRAA 4JJ5A 4KAQH 2BMKA 3ZGIA 1W8NA 5KSVB 3GTNA 2ICWJ 3FU0A 3FT3A 4Z7VE 3OXRA 4AQ1A 1SOQA 3TP4A 3P77A 3HUJB 1P84K 4P59H 4JB9L 3IKKA 1DLHB 1R5IB 4P2RA 2B39A 5B8CC 4LF3A 2YPVL 4LCUA 3VJ6A 3BH9A 3KPQA 1B2WH 1INDH 2X0UA 4I3RL 4Y1TA 4X8CA 3SB3A 3TOPA 3QFJD 4NZTL 5L4FA 3MNMA 3FONB 2Y1VA 3F62A 2CM6A 3W2DL 3LRKA 4ZSOE 4HF5L 4YBQC 2QQKH 1E5CA 3U6XS 1CE6B 4NIYE 3PDOB 1BQHB 3A6OA 4YDZA 1K8IA 2V8LA 2HWZH 5KG9B 1EFXA 3BSHA 3N40F 3OX8B 3RHWK 3II3A 4WUUD 1ETZA 1WZLA 3TURA 3KBPA 3P4OA 4B3EA 1RUKL 1JZ7A 1YPZA 3WIIH 3OHXC 5E08H 1ZVYA 2UVEA 3KPRD 4OGAC 4UQ9A 2G4EA 4PLJD 2OTPA 4WIQA 1ZLSH 3L3JA 4M61B 5HDWA 2BP0A 3VXUB 1T5XA 1XR8B 4BFBD 3VXMB 4OUUA 4PJEE 3CH8A 3HUJA 3SKJL 3QR0A 5I73B 3D4YA 4J3OC 5AW0B 4AQ1B 3ULVC 4PSPA 2R2BB 4G9FD 1KYDA 2IAND 5FFLA 3QPXH 5DEGB 1NBZA 2P7TA 2WQXA 3W0WD 4XHJD 5KSBE 2DY2A 3QXAB 1CD0A 3EO1B 3ZSSA 3KS0J 4TUKH 3S97C 1UZ6E 1QFWM 2CAKA 4XCCL 2HJLA 1JV5B 5TFSH 3A6CH 1TT6A 2BVUA 2W65B 4TRPH 4XOBA 5C0IB 3RWCA 3HFMH 4MTMA 2Z8WC 4Y19B 5D7JA 1YEIL 3ZE2B 3EGDA 2AI0L 5B1AB 1J5DA 3SQOH 5HYFA 3NFSL 1XO8A 4OCYL 4TOYH 2PO6C 1M3IA 5HDQL 4J3OH 5AB0A 4TVPH 1KBVA 3QJFA 3BKML 1ZVNA 1XSOA 4CKQA 3HG3A 2C9AA 5ANMB 2D8KA 4Z7WE 1J12A 4NCDA 3VFPB 1NIDA 1A7RL 1MVFA 5FYKE 1UWGL 1OTSD 3L5JA 5HHXL 4XP4L 3EJQA 2OYLA 4LAQL 5F9AC 3T0XA 4C56E 1MQKH 1JPTL 1P7HL 1OXYA 4P2OC 3OL2A 4U7KA 3UC2A 4AMWA 4QXGH 2HT3C 4ZD3H 3TPKA 4HP5A 3ZKXB 4QHLA 5CP7A 5EFIA 2VLJA 2FWLB 2YD3A 1RVFH 1DQTA 5CFAA 5IF0A 2B4CH 5A2IH 4M1GH 4DPAX 4UQAA 5EWIH 5JLZA 2D7QA 3QK0A 1WICA 1R24B 5JDSB 2AFNA 4X5WB 3FB7B 3P54A 2G3XA 5AVXB 4DCQA 5IJVB 2PYEA 4J4PA 3VMPA 4KKCC 5L6YL 3IU4L 5E2TH 2JIXD 2J5WA 4LEXH 4PY7B 1T03H 1BIIA 3RL1B 1PZUB 1P7QB 1DLFH 4P46C 1FJ1B 3HNSL 5FDYA 3UPRB 1TQWA 3WKPA 4ZPTB 3GMPB 1X5JA 3MV8D 1ROWA 3SDDB 1RZKH 4UTCA 5I8EA 1KN4L 2WN2A 3FB8B 4U4IA 5DUJA 2VABB 3UOAB 1T04B 3IFLH 2WLNA 4PJ9C 4AITA 2DTMH 1T6VN 3BEWA 4M4PA 1PZCA 5KSAA 4M7ZB 3HBGA 4NRZA 4NBYB 3LKPB 1A7OL 1AYOA 2FYYA 1TXKA 4CVZA 2FIKA 3BQUD 1WDAA 1BFTA 1T0OA 5DJDA 3SKNB 1UOLA 1ZHKA 4QTHA 1ZS2A 3OPZL 4JM0A 5JPNC 4E2OA 4HKBB 3UG3A 5HVFB 1OAXL 2L7EA 3BPLB 5E9NA 4AVIA 3VDAA 5CJ8A 2RBLA 3FCTA 2UZIL 2ZZUT 3TZVC 4DUWA 2FGZA 5C8JB 2NUPA 2BRRL 1NCNA 2VIRB 3PJSB 3LPFA 4M1DH 4WO4D 4O4YL 2ENJA 4GMTL 1FG2A 3WKQA 1T2XA 4WDIA 3M8OL 5LCVA 1SEQL 4FG4A 6PAZA 5E1GA 1G7PA 2XG5A 3FPYA 4J28A 5AOKA 4EI6A 4FLQA 1PLGH 4B50A 1P53A 2CRMA 2Z93A 4MNHB 1DVSA 2DQEL 4Z0BL 5EHFA 3U9PL 3MUGA 3WE1A 4MD0A 3L9RB 2OMTA 5GGRB 2VRKA 1J86A 4FQXD 4HLJA 4JPSA 2VWEC 1KF9B 4L9LA 5ADPL 3ABKB 1C08B 1PFOA 2XA8L 4A1RA 4AGPA 4JG9A 4R26H 3DTUB 1HKLL 3I02A 4JRYB 5DD5H 4BSWA 3IDXH 4YUEL 2MTPA 4PJEA 4TXVB 4RDQF 2GJ6D 1JRHH 4NNPL 2JB5L 1DJGA 4XPTL 3CC1A 1NGWA 4MYPA 1FNFA 3WS3B 3KNBB 5A2CA 4TUKL 5EUOF 3PWPD 3SDAC 1WAAA 4QRSB 3EH5B 4LP5A 4P2AA 4ZT1A 2R59A 2EDJA 8CGTA 2H3KA 1KIRB 1TQCC 5F93C 1BAWA 4BK5A 5HGHB 3D39A 1N9PA 5TH2B 3L5WB 4P5RA 4M8RA 2GB2A 1QSEE 2CNZA 1OB1B 4GIAA 5LGHH 1BX2B 4FCAA 1WBXA 1JK9A 5I6XC 4L8SB 5E70A 3OJDB 4FL4C 5AKSA 1G7JB 3WLWC 4IM8A 1FL3B 4XPAH 4R7DB 1QABA 2WVVA 3TH4T 3TT1H 5D1ZA 4PLKD 4EDWL 4RRPG 5EIIG 4F7TB 1T7WA 2P3YA 4PW4A 4OCRL 4HKXA 3PP4L 4FQPA 4EAEA 3BKYL 3ULUD 4ZDHA 3L4VA 3CVHA 3FOLB 4NP9A 1XT5A 2IANB 2WYHA 3HC0A 2CUAA 3FHQA 2ZSWB 3EYOB 5G5DB 4EI5D 3NCFB 1SDDA 3F85A 5GRVK 5MI0B 4MHHI 4XNUL 1MN4A 4GAGH 5GIRA 1UASA 1GHFL 1QBLH 4N9GB 3SDYL 1WLHA 4GMSL 2JLPA 3D4ZA 1MCPL 3AY2A 1OCRB 2V2WB 5EO0A 1BMWA 3NIGE 3QWOB 1UWGH 3WFBH 2FX8H 1I7TA 5T1MB 4F92B 4GBXB 2HN7B 3UDWC 1OK0A 3P0YL 4HGMA 4TLTA 1WHPA 2KH2B 2NYYC 1AANA 3AG3B 5E5LA 3EFDH 3KZ8A 2JKLA 4WUUB 3R7RA 2XBZA 4IGBD 1W15A 1I3GH 3FJTA 5IW3A 2FYVA 2EUWA 2A74A 5HDQH 2YRPA 5HGDA 3C87A 5AKTA 5GS0H 4ZUWA 2J7LA 5B21A 3D69A 2BZCA 4JFED 3L4XA 2OI9C 4X6EB 3MREA 4XNQB 1N7MH 1KB3A 1KTLA 2R0ZH 2FH8A 4L8CB 1W8OA 1DEDA 1UCTA 2COVD 1NCBH 2H47C 5AW9B 1IL1B 1UH3A 5J12B 3NZ8A 4NBZB 2X6MA 2Q76B 5E2UL 1KCVH 3CUPB 5DWPA 1ZANL 3DX3A 2EIBA 3U36B 2I85A 1UADC 2J55A 4OCSH 4FF9A 1CTOA 2CWRA 1WYJA 3TN0C 1V3KA 4NQED 3OWRA 1TPXC 3EBGA 2DM3A 4U1MA 1I8MA 1BEXA 2R51A 3QUYD 3QO1B 1GGCH 3APCA 4ZQKB 4YNYB 5JIIA 3N41B 1RUPL 2ZAIA 3JWDL 1G7MB 2E46A 3HAEB 4RRPA 3FU7A 3IF1A 3VE0B 3WJLC 5B39A 3P9LB 4OM1H 4OZ4A 5JA8B 2NZIA 2XN9D 4X42A 4NUJB 2FJFB 3E8UL 2VERA 1YMME 3M7FB 3WY3A 2CO6B 4YSQA 4DOHE 3QIUB 2Q8AL 3S35X 4WSJA 4UNIA 3V5DA 4R26L 4WHCA 4EI5B 3V6OA 1D9KD 1GCYA 3CU7A 3VGEA 3FFCB 5IEKA 5B1KA 4FADA 3KHOA 1WUZA 2Y69B 1G7LA 4OFYA 2UYLB 4CUCA 1MQKL 3OKNB 5G4MA 1ERNA 1W8EA 3QRGH 4LCWB 4XXDB 3CSGA 5IM7A 3C60B 1QBML 3MRNA 1U8OB 4LKXA 1I7ZB 3E6HA 4X8JA 3T6WA 2XI9A 4ZXBC 4DGIL 1BBDH 4MNQB 4Y0GA 4HG4K 2DQMA 1OALA 2NY6D 3L54A 2ZF8A 4FOMA 3DRTA 2PLTA 1P5VA 1X5IA 3HFFA 4Q9RL 1T5KA 5DUML 3TPUA 3BC9A 2A5UA 3WFDL 1DJZA 1M57B 2QPEB 1DQLL 3P3RA 1SLVA 4NP4L 4TNFA 4OZFG 3IDGB 1MFDL 5C86A 3JV6A 1KXTB 3QPQC 1LEGB 2ESVE 3CSBA 4PLKC 2OMBA 1F97A 1VFBA 1G7IA 3RL2A 1AMXA 1T7XA 2DQTH 1ML0A 5BVPL 2ZKMX 5T3ZD 1PZBA 2V2XA 4X8XA 3STBA 1KBBA 4UTAH 4F37K 4XXCA 4XMPH 4OGXL 1M2VA 1Q0YH 1S7QA 1NINA 4ZO9A 3S3JA 2FX9L 4XAWL 5E8OA 3GFUA 1UFGA 4XCEB 1NEPA 2EXWC 3KPSE 4ZMOA 4FQXB 3GI8L 1F56A 4JKLA 2GK0B 2DS4A 2YFNA 2ZX9A 5SX5H 5DVOA 1DEEB 2GEQA 3GLAA 1FZKA 5CJXC 4JS7A 1O7DC 4HJIA 3KEDA 2Q6WA 5IFAL 1RSYA 3BSGA 3CSTA 1WWBX 2CKBA 4JQIA 5ITFA 1JF5A 1R1CA 2CLRB 1QLEH 5DJXB 5EEVA 4X4YB 4NKIH 1QBBA 4WHTA 2OTWA 3AS1A 5EF2A 5CSZB 4PJHB 1MHEA 3FAWA 3LQZA 2W80C 5DMYA 1WZAA 3WNKA 3Q2NA 1WQVT 3LN5A 3GRWH 4EQ2A 5M94B 5IT2H 3PJNA 3EZJB 4BZYA 4FFYH 3K0YA 3NN8B 1JNNL 2VDRH 4AQ8C 3ROLA 3ES6B 4PBVC 4A6YH 1C16B 4PP1D 3U2JA 3WY4A 1DVFD 1KPVB 2FLRT 3VTAA 5FWRA 1WEJH 1NFDE 1I9IH 3U6XA 2EE2A 4ODTH 5FS5A 3RG1C 1A7PL 3VSUA 4KKBC 4GIOA 2XN9A 1MG3C 5E8NA 5CEXB 1SJHB 4TKWA 1WFJA 3HN8A 1Q9LA 3UROR 2DEXX 5HHXH 4TM9A 5L2KB 2FX7L 2HTKC 4HPYL 2XTJD 5A16A 4N0FA 3ZDYE 1L3NA 3B2VL 1FLRL 4GUCA 5I1DA 2EC8A 3BQUC 4LASL 4N8PA 3A21A 3UJTH 4XWOD 1YEDA 5JW4Q 1MCPH 2DQFA 4LLYA 1LQBC 1N7ML 5FYJD 4EKXA 2L8AA 4ZS7H 3OZKA 3DVGA 5IB1A 2P5EE 1FA4A 2ERJC 4AXWB 1QA9A 1AG0A 4MVBD 1CYWA 5A6IA 2FR4A 1JZHA 1H3TA 4DW2L 4RBPH 1UWYA 4UOW1 4B9PA 5F88B 5GZNA 2D0GA 4PGEB 3MTRA 4RDQG 2XV6B 4Z7UF 3O0RH 3ME0B 3ZRSA 5IHZA 4NT6B 5FF6B 1AD0A 4X7TA 1A02N 2O26U 3S37L 4AQ1C 4PJDE 4GG6B 4PLNC 3MV7D 5AW2B 3ECQA 2J20A 3OB0H 4NQXA 3SGJA 4Q6IA 5GRXG 5FGBA 4P99A 1I9IL 5MHSE 5DGRA 3BUYA 3D2UD 2X4OB 3D34A 5EO1A 3EDKA 3UTSE 2YXMA 1DCLA 1XZ0A 1GIGL 4UDUA 1KCUH 2F1EA 4GSRA 2G5BB 5ICXB 1YC8A 4BFGA 1NFKA 2BOBB 2VDQL 3QEHB 3CFCL 2P5WB 3L3HB 4JDEB 4NI3A 3UBFA 3R1GL 1SHSA 2V3DA 3OC5A 4OFDA 2PO6B 3CJJA 3DMMD 4EI0A 4ONHB 2CUHA 3VX1A 3HVDA 3ZDWA 3OMAB 5BRZE 3PFUA 2BNRA 3BFQG 2E0PA 2OR9L 4PYGA 2H2SC 2O30A 3K4ZA 5DI8A 3SBRA 5IP4A 4JRFA 4ZMNA 3D85B 5GS3A 2ZX5A 1XGZA 2L7QA 1B3JA 3C6EA 2J1ZA 3BUDA 4P2OB 1I9EA 2DI8A 4U3SB 5DHMC 3PXJA 1GRWA 4S1DC 3MZGB 3FSWA 2NY5C 1E4WH 5EN2B 3K71B 3QQXA 3PHOB 3NJXA 2NPLX 1IQWL 1SJEB 2VQUA 3PIQA 2QQLH 2QSTA 4AT6B 1R5WB 3BWUF 3V4UH 2QR0B 3MRGB 2IPUK 4MXWH 4FNLL 3V6ZA 1DL7L 2ZXWB 4DOHB 1OSYA 5I74C 1X5YA 2ZOOA 3ORJA 1JCVA 4YZFE 4LEOA 4NNPH 3QQNA 5I8OL 2EDKA 1LO3H 2MWCA 4U3CA 5I18H 3M8OH 4UCFA 5B4MD 1MCKA 3MUJA 4PVLA 3C5SB 1PDKA 2ZOKA 4GS7B 3F83A 4NO5B 7PCYA 5DT1H 4JE4B 4UAOC 5KYUA 4ZUTB 5HJBA 4PLJC 4PUBL 4QF1B 1LO3L 2WXHA 3V4PB 4MDIB 4ACTA 4QHNA 2NY7H 1RIHL 3QFJB 1VZHA 4Z0BH 2F1BA 3U9PH 4PJ9B 3RGVD 1RL1A 2PKDA 1NCCL 5DZ9A 3ZUCA 3REVB 2E8YA 2GT9B 4IEFB 1UZGA 2BS8A 3NSCA 4ALAH 2BNQD 4HD5A 3I6GB 4NN6C 3TS8A 3TF4A 2LW3A 3LZNA 5JPMB 4B9CA 4B5ZA 4HJ0D 1NGYB 1UKTA 2ITCB 4O2FB 1XEDA 2NW3B 2GYSA 5JW5B 1D5MA 5JPNB 4PCYA 4XO8A 3R06B 3UZQA 3HE7A 5KBKA 4EBQL 2PXYD 4TVPE 5F7YC 3NGBB 4KJQD 3EGXB 4BZ2A 1YUHB 1ETB1 1XH0A 4QO1B 3EOAB 1MNNA 3MLZL 4A38A 3I85A 1UURA 2VXSL 3DPBA 3ET9F 3H6JA 3O8XA 3FTUA 4MD4B 4OQTH 4S2SB 3EOTH 2PW2A 1MVUB 1TETL 4FFZA 5FUZL 2AQ1A 4TMPA 2X89A 2P26A 2UXVA 3U48A 4MB4A 4K71B 3AAZA 4U1GC 5DEFA 3UJIH 1B0IA 2VN7A 4NQDA 4W81A 2LLGA 4A6YB 3HB3B 4NWTL 1FNEB 1HFUA 4X0KA 2HCZX 2GY5A 1S5HA 3H3KA 5FCSH 5L4IA 3O2WL 5IW6A 1J0IA 2I07B 5E0QA 4PRHD 1O7DE 5A2BA 4MB5A 4NZ8A 4TL4A 4X6CE 5C0AA 1DJXA 1BW8A 4XCNA 4BDVA 4ADIA 3NJIA 4FYQA 2J88L 2AK4E 3CFEA 4D3CL 2H1PH 5FGRA 4ESKA 1U2HA 4Q4IA 4HUVA 3K1DA 4WI6A 5LBVA 3SDAB 5JO5A 1IFHH 3MRIB 5T1LA 3TEXA 1NGXA 4UIKH 5ENWA 2E7LC 2HLFC 1YO4A 5I66A 1PCSA 1SVCP 1QQDA 3S37X 4QI3A 1E27A 2VC2B 4LK4A 5AW5B 2PABA 1EGJA 1I1CA 4BUHA 3MNWA 5DTFB 1C5DB 4KO5A 2HVKA 2BIOA 4G42A 1BF5A 4M8QA 5C09E 1AIFB 2WBWB 5C0BA 2ROXA 4BZ1H 5DMKB 3T0BA 4PSRA 1AKJB 5CZVL 2ATKB 4PJCA 1MI5A 3QJOA 3MV9A 2Y22A 5I16A 5KSUB 1JK8A 2HLFD 4XH2A 3PJLA 1G1KA 5DUPH 1NCAH 4IRJB 4NPYA 4KDVA 5DMJB 1CDUA 3CV5A 4HEPG 4GXVL 4AGMA 1E8WA 5DWUL 1WIUA 2KBGA 2FL5A 4WV1A 5MI0C 4EDXA 4P5MB 1VJSA 2ENSA 1VHPA 2BWIA 1EANA 3JZYA 2JNZA 4K23H 2FQDA 4MMYB 4Y88A 5CWSA 3UAAA 4B9KC 4OZFH 1U8JB 1LNUB 3EO9H 2HP4A 1IU1A 5ERWA 4P07A 2VR5A 4WO4C 3AWFA 4GBXC 3OKLB 4NPKA 4I0CC 4PREB 3MC0A 2R4RL 2Y5QA 3MLWL 5FO7B 4U3XA 3BHBA 1YYLL 2OAAA 4LHJB 5F7DB 3F6IA 1M05A 2F5BL 1E0OB 2WNXA 3CFUA 3F64A 1NUFA 3HI6H 3NIDE 3OQRA 5E5RB 1R33A 3B4NA 3F5WA 1UM5H 3OKLA 1XGQA 3IJSB 1J8SA 4P57B 1NC4A 5FV1L 3QPKA 2GSGB 3HZMA 1KXQE 5FDWB 3HR5B 4GIPD 4MMYA 2GJJA 4OH2A 2PXYC 1JUFB 3KLKA 3LSOA 4OF3A 5GHWL 5TF0A 5AVQB 5AZEH 3RJOA 2BC4A 1E4KC 4LLQA 5KTEL 2ESVA 3WEAA 1AVAA 1COBA 1GZQB 4OCSL 5IMOA 2G4GA 5J3HD 3NMEA 1CMOA 2VW7A 2BNQA 5EEUA 4ELMA 5L2JB 1XTMA 1AR2A 5EORL 1TPXB 4IRJA 1BREA 1HYSD 3IU3B 4P49A 1CFQA 1OGAA 3TFBA 1U3HD 1DQQA 3BGMA 2DMBA 3OV6A 1U6AL 2VN3A 2AQRA 3TCLA 4BZ2L 1BEYL 2XBTA 5B3SB 5CIPH 2CIIA 1Q94B 4N1HB 1IRAY 4JFOA 5ACZB 1RUML 4HIXH 1AIFA 3UEQA 4HV8B 2B2XL 4PGBA 4P9HH 2RD0A 1NFIB 2AQNA 2Y06L 3ZIMA 2BLFA 5HYJE 1T66C 5F7KC 2JIXB 5IMKA 3VCLB 4G43B 3DDFA 2XZAH 1MHCA 4YHKL 3SY0A 5E94A 4DK5A 3RWFB 5T1LB 2VDNH 1E4KA 5EU7E 4BSVA 4HVBA 1THAA 2C5DC 5BRZA 1NPUA 4OLZH 4K7FB 2PWHA 3EJYD 5ETUA 5ITBH 4PGDB 1IM9D 5FW8A 3DUUB 4PCSA 1IAKA 3HMXA 4QHPA 2A9AA 4ZXBB 3FQXB 2CCWA 5L8JB 3VD0A 3CIAA 4Y4HB 5C09A 3SDCB 3DXAA 3RUGF 3R4DA 2ZICA 5ACMA 2YPVA 3S3DB 1CLOL 1UTDA 1K85A 1KFAL 2AAAA 1D6EB 4NHUB 3KDMA 3A67L 1N0LA 2H2SD 4A6YA 3P3TA 1FIGH 3FL7A 5L7XL 4JO3L 4F33B 4XHJC 3RWEA 1OPOA 3VRIB 5AALA 1YMMD 5EU6B 1FVEA 4H1LG 2QQNL 4UOQA 3BT2H 3INUH 5T8IA 5BQ7A 1KLFB 3GLDA 1UKQA 5E51A 2AGJH 2P8LB 3CG8A 3GF8A 4PJAA 5AAWC 5HPOA 4L9DA 1LMKA 2G9HA 2UXGA 3C6SA 4YLQT 4XNBA 2LU4A 1J1PH 1YN7A 3DURB 2K8QA 5FKPB 12E8L 1X3DA 3NEEA 1B6DA 1RVFL 1FGNH 2FNWA 3KS0H 4TVUA 4U1NA 1UFUA 5C0DA 4BHUA 2YD6A 2C9XA 1QR4A 3VRJA 1QW8A 3QARA 3K6DA 2AMUA 1X5ZA 2FGWH 3VXTA 1Q1PA 2B4CL 5I19L 3BAXA 3QIBC 4IEFA 4J1UB 4WI7A 2BIIA 3GD1C 3APFA 4IOSA 3PGFL 4OIAA 1GGIH 5B38A 4AM0Q 5KANI 3GSOB 4N8UA 3G6DH 4XT1C 1EEYA 5C6TL 4NDMB 3H9HB 2WLIA 1WAPA 3G6AB 1S9VB 1AHKA 1WD8A 4NAJA 3V4PA 3QUZB 3BXNA 3U4BH 3OR7B 4OLXH 3RAJL 1JWSB 4YPGB 5GJSL 1ZLWH 3QI9B 1CI5A 3IJHB 1DVYA 3ZGHA 1PDKB 3QRGL 4OF8A 1OKEA 1OSZA 5I1HH 5KJ4A 1G7QB 2I5YH 2DBLL 5B1JA 4X5QA 3G5XB 3RAJH 4W93A 1U8CA 4L3CA 4JVUA 5C0EA 3FF7A 5C70A 4LXFA 1BAFH 1KC5L 1BPLB 4L37A 1ZT4A 1IGTA 3CH1B 2MCMA 1AS6A 4UU9A 2XETA 3HMXL 3Q8FA 4LLUB 4JMXA 4EE2A 3OKOB 4C83B 3MRGA 1EFQA 1MFEH 1BGXH 2X9XA 4LDEB 1NANH 1ZSDA 3LCYA 2DIAA 3PHOA 5EZPA 1ZHLB 3TJEH 4UB0H 3ISWA 4UIMB 5SWZA 4L37B 3OAUH 4P2OA 4NRXB 4IGBB 4LOVA 1LDPH 1DQDH 4ZTOH 1XF5A 1ZPUA 1QSFE 2WQ8A 3L4WA 3L5HA 5L9DL 2AQTA 1U95A 1OSZB 1DQMH 4PRBB 2AJUH 6TAAA 3MROA 3WS6C 5LHDA 2MJWA 2ERJB 2BNRB 5CF3A 1JTPA 2H3NB 2ZCLH 1XSKA 3L4CA 3UIZA 4M7LT 4IU3A 3EYVB 4BINA 2WCGA 2FHCA 2Z4TA 1BBJB 2K6WA 2AV1A 4AZ8B 3D08A 3GSOA 1LJMA 1Y7VA 5B38B 4M1CC 3K4DA 2OYPA 5AD0A 1GKOA 1LGVA 4PS4H 2XWZA 1CGWA 2ZG1A 3ABGA 3KPTA 3D39D 3AZUA 1UACL 3W39A 2EXWD 1XCQA 3ATDA 4M7LL 1D7CA 3FN0L 4OZHA 1OE3A 3HI5H 1YNTB 1HX0A 1BOGA 1LWJA 1S2EA 1BAFL 1KC5H 2Z35B 3FN9A 4QYOB 1A5FL 5CR8A 4U1NB 3TO2A 4JB9H 5GGVH 2YRZA 3VACA 4LEEA 5DWUH 1I4FB 3AXIA 4O5LL 5E8DL 2XTJE 3L95B 2J8UB 4LARL 4MJ4A 3QFJE 2WM0A 2IDUA 5IV2A 4R7NB 4JDZB 4NKDA 3AITA 1OPGH 2MPAH 1UUSA 2WK2A 4WWKC 2CM5A 4LSSH 4MNQD 1N8ZB 2Z0UA 1OF0A 4IJ3C 5D2LA 3WO4C 3JWNG 3BVTA 5IVXB 4Z7NB 1DBMH 1IGIL 3Q2LA 1ICTA 2BW5A 3KJ6L 4WKZA 4WUUE 4XB7A 1BJ1J 2NZ9D 2NY2C 3P2BA 5I6LA 3IK2A 2HFFB 2YOAA 5K5YA 3WGUB 4YL4A 5I6PA 4K9EC 5DUBB 3SGEH 5JORA 3LN4A 4PJ6A 3Q3GA 5CR1A 4Y5YA 4EDWH 3POHA 1SZNA 3QZWG 3O3EB 1VZIA 5DJ0A 3PAYA 4GSUA 5ESVB 3TH3T 4TUJA 3CFBA 4WWOA 3ESNA 3N5AA 2W92A 3O6FB 3VXNB 5FEBA 1D5ZB 1I1FB 4I9XA 4BKLB 4C56A 3L1GA 5JORB 5HPMA 3U7WL 2YGVA 5E1AB 4H0IA 3UADA 2O93L 4YDIH 1PPIA 2A1WH 2J88H 4NQVB 4E41A 4S11A 4P4KD 4ABWA 4YSDA 1QAWA 4RNRA 4LGSB 1RD6A 4QRRB 1LDPL 1DUYA 4NKOB 4CBZA 2YZ1A 3GS4A 3MRFA 3T0AA 4AQAB 5J9PB 1N0XL 2CKNA 4PJIA 1RIHH 1RUKH 1SY6L 3NJKA 3PWUA 4HAFA 5C7XH 5F1NA 1E5ZA 4NKDB 4YL9A 1ZTXE 1QFWL 3L45A 4MAYC 3MRKA 2VT0A 4MSWB 4O02A 1SXCA 2D4DA 1G6RH 3F84A 4Y16C 3GBLA 3KPOA 3T3PF 1S3KL 5DK2A 4I9WE 4ZUVA 2AZUA 2YBGA 3QNZA 2Z35A 3TO2B 3V55A 5JPMC 2GK0A 2JF1A 4ZD3L 3DRQB 4FQXA 4J3WA 3T8MA 4JO5A 5IVZB 2XV0A 4RFOH 4UV4H 5IK3A 1N5YH 4JKKA 4IOSD 1RZGB 2FSDA 1G94A 1TTUA 1Q9OB 1YEEL 4LSPL 3W11D 4N87A 5GZNC 1BBJA 4HC1L 2WYIA 4N8CL 3RHWF 2GSGA 1MZZA 2O4EA 3ZZSA 5DSCA 2QTVA 2FEEI 4FKHA 4GP5B 4MJIE 1N70A 4Y2DD 4MRBA 5FYLH 4AUUA 3HB3C 1LEGA 4FNPA 3H4FA 1KXTA 1SN0A 4EN3A 3TM6A 3OKMA 3G5VA 2OMYA 1QPPA 5FO7A 1ZEAL 4DEWA 4YHOH 5CN1A 1P5VB 2BM3A 1ZSDB 4QIRA 5E99L 3QQ9D 3FH8A 5F3HB 3H55A 1CL7I 4PJBA 2GUYA 5C0AE 4R7VA 5K9JH 5DC9B 1CUOA 3E6HB 1QFUH 1U8OA 4LKXB 3ZE2F 3D51A 2YPLA 3CCHA 4F2EA 2WSPA 4HIEA 3VTTA 2NT1A 2O6FA 4NQCD 3ECVA 3CN4A 2A6DB 3TBWA 1G7QA 3UTPD 3F7RA 3T08A 2PYFA 4NYLA 3P11H 4BA8A 3VXRA 1JFHA 4ERSL 3FT4B 3T0EE 3JTTA 4TTDD 3FU9A 3LZPA 2H7WA 4Q0XH 2KLTA 2PW1A 5I16B 3MV9B 3QUMA 4FULA 4YIQA 3QQDA 1JGEA 4H88H 5A2LH 2W9DL 2NNAA 3LEVL 1FFQA 3AS2A 5INDB 5HHVH 4NOFA 5H37G 2A77L 4AE1A 3ZYIA 1OGTB 2BVEA 4HKJA 4JL2A 2X3AA 5EU5B 2V4LA 5ALBH 5TDOA 3ZX1A 5I75B 3WNIA 2AVFA 3WE6B 4U1JB 3CC5B 5B7EA 3KYKL 2XWJA 3N41F 4FDWA 4MZIA 4Q2ZA 2AJZA 3EFOA 4KHTH 3QE5A 1F00I 1NCBL 3ETBF 4P59L 4BK5C 5I23A 5FYLE 4ODXB 4Q14A 1F13A 1RLBA 3UZEC 1VGEL 1T5WA 3PXHA 1FGVL 1QFWI 3HG1A 3O4OC 3SYAA 3C6SB 3NVQA 1AXTH 2VLRA 2Y06H 4N28A 3U2SB 3SBWC 1NICA 2IDTA 4XXWA 3CDZA 3FSAA 3QCUL 1XGUB 2HG5A 2Q2EB 1PEWA 2F9BT 1FVEB 4L29A 1Y6NR 4WO4B 3QNFA 5CZVH 4CU7A 1MCNA 2EXSA 3ARDD 1KMGA 3HNVH 1NKRA 3D7PA 3JWOH 4AKOA 4Q9CA 2AJSL 1SN5A 4OFQA 3VDCA 4GT0A 1S5HB 4CC1A 5HGDB 3PL6A 4CADB 4XWOC 5DMGC 4MJID 4Y89A 4CADA 1HWGB 2K4AA 4NQDB 1MELA 4FI7A 5EU3B 3MRJB 1JMXA 4M7JH 4ZYKB 4B0MB 2XTJC 2GQHA 2VDPH 5A40E 4WO4A 1KB5L 4N0CD 3G5YA 3M1BB 4NKIL 1CQYA 4JHZA 1XGYL 3IJYB 3D5OF 3REWB 5HYQB 2JELL 2EDDA 4TNVF 4HJTA 1T1YB 1BIHA 2NXZC 1IFHL 4JKMA 3KDPB 2H8PB 4OFPA 4CNIB 3MRDA 4GW1A 1BHGA 1FC2D 2XBDA 3T65B 4WGKA 5ABAA 2UWEE 2BWQA 3DGDA 4M56A 3ETTA 3UZQB 5KVFE 2WXQA 2VMCA 2BIPA 5I82A 3TX4A 1L7TH 2X70B 5PCYA 2HJKA 3LTVA 4A2MA 1YYLH 5CD5C 2YR3A 1KEMH 4C47A 1F2QA 2OMXB 1G4MA 1Z1WA 2AK1L 3UGEA 2ZP9A 5CBAB 3MFFB 1IQWH 2FB4H 2OP4L 4JKWA 4ZMTA 4ZI8A 4KGJA 4OCWL 3S0PA 1CLVA 1MJ7L 3D06A 2WQSA 5J5EA 2FWOB 4I3RH 4YIQB 1KLGB 3S6CA 1MAMH 1W16A 4ZUTA 2WWOA 1V3JA 4W9EC 1ZEAH 1CFQB 2JJSC 4JO1L 1OB1A 3DYOA 1DN2A 2F1AA 3D07A 4FE9A 3TBVB 3KAAA 4NYLB 3NCEB 2VLLA 4PRPE 1OGAD 4Y2DA 1NLDH 3W5MA 2D7NA 1T80A 4JRYE 1K6QH 4JR9H 3PFQA 4HIEB 2VZOA 2J8UF 1HKLH 5DD5L 5T33L 3I2CH 3ROOB 2QELA 1UT9A 2NYKA 2ZT9C 3ECWA 4FQJL 4HIQA 5DRWB 4Y8DC 4A7GF 3RBSA 2P8PA 2MQCA 4P2RE 1I1AB 2IEPA 4FS0A 4WGVB 2DJ4A 4Y4HC 3RILA 3SDCC 1F4HA 2AF2A 4G1EB 3O2DL 4JN2B 1IAIH 4Q8BA 2Z92B 3I6KB 5JHLA 2F8XC 1GCFA 4L9LB 4EN3B 4MCZA 1IKFH 3UG4A 1CG9A 5FOJA 1XBRA 3JTSB 4PRNB 1H6FA 4BXSV 4YHNB 3K5RA 2MOQA 5D5ME 4M1DL 4AQZA 1WFTA 1RUQL 2Z93B 2ZYRA 3VG0L 3W3BA 4G9FB 3ZE0B 5CLWA 4HH8A 1W80A 2I9LA 1RZ8B 2NR6C 4L8DB 2ATAA 2RJMA 5CJBA 5G2NA 1R0AH 3BVNA 1XCTA 3T09A 4GKNB 3VXUD 4R0LA 2BOBA 3FT2B 3NCMA 3O3DB 12E8H 3NP4A 3QXTA 3J07A 4EKJA 3RI5F 1F4AA 3TNNA 3LKOB 1FYTD 2MOVA 1EERB 1S4IA 1S9WB 1HHJB 4DTGL 4WFHD 3J27A 4HOXA 4LCYB 3QUKB 3QA3A 1DJWA 3U2IA 1N6QL 2D31A 3UBXI 1JK8B 2C9UA 4GG6A 2FECI 1AYRA 2VM4A 3DSFH 1CXEA 3N0PB 2IAMA 1YEGL 3C09B 4L4VE 2YA2A 3T2QA 4G9FE 2IFGA 2ZUYA 1AKJA 2R1XA 3VW3L 1M7IB 4JM2D 3CTTA 1BAGA 5JHDB 1DLFL 3GKWL 3Q13A 4A67A 5BZDB 2D7MA 1DBJL 3LKQA 3KPMB 3ARPA 4RQQB 1K4CB 3G6JE 3BOVA 3AWGA 3FQ2A 3OXSA 3QI9C 5LXGL 3D3VB 4BIKA 4HZAA 4NO0A 3US1A 5FUOL 4DUXA 1TYJA 3LS4H 1U36A 2UZYA 4MQ7A 4G6JL 4AYSA 4HAKA 4W9JC 2VWEE 3MI6A 1IGIH 4NQVA 2CRZA 2PYEB 2Q7YA 3U1SH 5ILTL 2WXOA 2R4SL 4U1HB 4XVOA 3RPKA 3SDAA 3VFTB 1OHQA 2W88A 4C56B 4JG0H 1JSYA 3VXNA 2NZ1A 3VRLE 3BZ4B 2X89D 4HK3N 2WQRA 2HT2D 2I60H 2O61A 2XJLA 3WFCL 4E9WA 4LARH 4PYHA 4ZMAT 3AGWA 5IW6B 3TIDB 4FG0A 3JSSA 3RZCB 3V0JA 5IKCB 2D7OA 2FZ3B 5E2VL 4KJYA 3LEXA 4MDRA 4QWWD 4Z1PA 5IQ7L 2J12B 2JKTM 4P9MH 3KLDA 3ROLB 1HK6A 1MRCH 3AAZB 3VWJA 2RGSA 3B9EA 3HG2A 4NERA 3WFZA 1HHGA 5IVXA 3LQZB 4LSVH 4UUJA 1AP2B 1JAEA 1JERA 5EPMA 5BCAA 2PW2B 1AXSB 5CD3B 2WPGA 4P23B 3SPVB 5E2VH 2EUZA 5CNHA 1XDTT 2BSED 3CVHL 1LK3L 4J6RL 5BNXD 3UPAA 4PGJA 5I5MA 1KGWA 4K7PL 4QO1A 1A2YA 5SWZD 3EGXA 2XWCA 2J8UA 1MWAH 4I4WA 4OFIA 3ARFC 4WY7L 3ULUF 5HHOE 4UQ2A 4N68A 1D5MB 5JPNA 3ATAA 4OU3A 4FRWA 4G82A 2FSEB 3RY6C 3QXAA 1CU4H 1VPOL 3DA0A 5FKAB 2R4SH 4XCEA 3FQRB 3C08H 3CFJA 2IANE 4FG6C 4M5YH 2HMID 1F4YL 4YDKL 1BZ7A 1GA2A 2ZKHL 5AFAA 2IDSA 5DA0B 2IPKB 1WA0X 1QBMH 2HT2C 1AZUA 3QFJA 4N90E 3WLWD 3HMWL 5D1QB 3EYVA 2NSQA 4RAVB 2ZUVA 4B60A 4IBUA 1AGDB 4UM9A 4O02H 4XBGB 2WZPD 4M6ML 1HESA 3II2A 1YPZB 3FTWA 1BQUA 3GKWH 4HK0A 3U1PA 3KYOA 2ZKHH 5KVDE 4P46A 5FYJE 1ETJA 3BAEH 3FQUB 1MFCL 2BXZA 3K2UL 3PWLB 4H8VA 4FN0A 4DERA 2I7SA 1PCXA 4RMBA 2NY2B 1BQHA 4NRXA 3IDGA 3D18A 5DRNA 3MZTA 2V9UA 1PD1A 5DLMH 2EXYD 4D9LL 3T1FA 5J7CC 1URZA 4GG6E 2IF7A 3TVMA 3VXPA 3EJRA 3O0RL 1MEXH 3DOSB 3NJVA 3GMRB 3UAJA 1MXDA 1OAQL 5IFJB 4C57C 3NDYE 1QR1A 3MRNB 4CKVX 4GSDH 1DVUA 4XO9A 3RWDA 1PNDA 3Q1SL 3C60A 2P49B 1QR1B 2WXIA 5C0EB 4X8GA 1OE1A 1ED3B 1ZS8A 4WGWB 4X6DB 3JYCA 4QT5A 1TVHB 1JPSH 2WO3B 1BG1A 3MYJA 3SDXA 2OTUB 2FH6A 3T1FB 1PX3A 3UTOA 2HA1A 1U91B 2FEEL 3GJFK 1YEJL 4JG1H 4L05A 3CLWA 1KNOA 2DJUA 1KBGH 3CHRA 5I0VA 3S5YA 2F53D 3SQBB 4F5CE 2AQQA 3FOMB 4KRMB 2ITDB 3TONA 1I75A 3BKCH 2X10A 1JDAA 4UYPA 1KN2L 2IGTA 2X42A 3PWLA 5B39B 4S1DD 3VE0A 2YQBA 2EIZB 15C8H 1QASA 4Y16B 2DQUH 3BUYB 5EO1B 5TDNB 3APNA 1AGDA 2C4XA 5HD8C 3S9DB 1DYZA 4LLVA 5AW8B 2GC4C 2PF6A 1KBPA 4XB8A 1PKQB 3NFNA 5GS1C 3MRMA 4WFED 3FSOA 4DAGL 5I8CB 4Z77A 4XN8A 3MJ9A 1MY5A 1U8PB 1YN7B 2OW6A 2G60L 2HFGL 3ZZQA 5FF6A 5IHZB 1WA1X 2EEBA 2V3EA 2VLJD 5FCUH 1M7DB 4L1HA 4L0PB 3IJ9A 1JZDC 3IJ8A 3FQ1A 1II4E 4UQBA 1JS4A 3WIHH 2WV3A 1PJ9A 1BJ8A 4LPCA 3T3MF 3EO0B 4M9OA 5FW6A 2H9GA 3BN9D 4Q0XL 4YHZL 1I9JL 2DYPB 2EVHA 1I8LC 2R8SH 4KKCD 3HG1D 4NN7B 2WLKA 4OQTL 4GUPA 1S7UB 3X13A 5EUOB 4P2QB 5C6PB 2DQGL 4DQOL 4UUJB 4KKAC 3O6KL 1OK8A 4NJ9H 4AG4H 2CLVA 3WXVL 1IEAA 3QWOA 2WINA 5D1XE 4F2ME 3HE6B 5E1HB 2BVOA 3ZE1B 3ARDA 2VXVH 4PGDA 1R0AL 1LEKA 1AQDA 2H6PB 4MAUL 1X7SA 5FA3A 3NCXA 2VMFA 3D3VE 4YOKA 4HFUH 2ZX6A 4I18A 5EORH 1LEIB 1UZ6F 5F0JB 3ZYZA 2FQFA 1TTCA 2A3TA 4B9YA 2XY1A 3NN8A 1AHWC 1IT9L 3BD4A 4M93B 3IDIA 2X4TA 1Z3RA 5EO9B 5MERA 1BVLA 1CICA 4R96B 5DD0L 9CGTA 4BFIA 2DYSB 4MKTA 3RLSA 3BRDA 4O51A 3JWOL 1JZGA 5C2UB 2CKBB 4HHAB 2BO0A 1N12A 4GQ9L 2ICCA 2FX8L 4JY4A 2A38A 1EHLH 2E9IA 3QDGA 2B1HH 4L3EA 4F91B 5I2IB 3C5JA 4WFFD 2BJML 4UT7L 4RQQA 1VLXA 1DEEA 1PEZA 4JQVC 1R3HA 3BVVA 5E4EC 1QP1A 2N4IA 1NMAH 4UINL 1JVKA 2IMNA 3EXLA 3A24A 5JHDA 4WW2F 3NAAH 1M7IA 4DZBB 1V3LA 3VDBA 1NUDA 1OAYH 1YY8B 4EPSA 2VXQL 3GB7A 1DANU 4HJJH 3U0WH 1T7ZA 3PAUA 3KPLA 4DEPC 2GTZA 2WY3B 2P5WE 2Q7NA 3MRQA 1UM6L 4FQQB 1B4JL 3QH3A 4IHBA 5KYYB 4GW5B 2BVPA 1RMFL 1S9WA 1NLDL 3VYNA 2L3BA 3E3QE 3LKOA 2DLGA 4OZFA 5KS9A 2QPDB 3MMEB 1PZ5B 4CRPA 4K73A 2D9QB 4HK3J 3I02B 2MRYA 4BSWB 5IHUL 3FT2A 3O3DA 4M62H 5CGYC 4KKQA 3HRPA 1GGCL 3ALPA 1C08A 4FHJA 2AXGB 1YYMH 1SLWA 3K81A 3P02A 4FX5A 3FQTA 2R23A 3CBKB 3VXSB 2OMTB 5GGRA 5D4IA 3CFCH 3IRZA 1FCCA 4RMQA 5JTWA 3GI8H 2B5IB 4IS6B 4O2CB 3STZA 4XP5L 3Q06A 1VACA 1LE9A 1SOKA 5LUMA 4D9QD 4R8WL 4OZGB 1U3JA 4K8RL 4MA7H 3UAJD 3L3IA 3RDTD 3FQTB 1LK3H 3EBHA 3S36X 1GJUA 2H26B 1M2OA 5DJCB 3MO1B 5BZWA 4U0QB 3I6KA 4KXZI 5HDOA 5FGCE 1RK7A 1Y07A 1E3XA 4KTYA 1E8ZA 2DLFL 4JZJC 1N64L 2FL5B 3RNKB 2C7FA 4ZFOB 4RRPM 2AJVH 4NZRL 2V5TA 4UTBA 4M03A 1SPDA 2YPVH 4WU5B 2MQGA 5LBSH 1K2DB 3NEXA 4XO5A 4DKFL 2EEFA 5GGTL 5IQ7H 3VFUA 2Z4QA 5J06A 1NJ9A 4EXPX 2DWYA 3BSZH 2BH0A 1S8DA 3QQ4B 4WI3A 2OMZB 1MI5B 4JQIL 1LO2H 1WV7T 1NFDF 3V7MA 1JZJA 5JNYB 3FU6A 1DQLH 3NEOA 3P2DA 3KPSD 4YXHH 1EDYA 1SY6A 4HCRL 1YEGH 1RJZB 1CN4A 3UYRH 4GRWH 4GMSH 4ELME 2VDML 5TPWH 1CXLA 4XMXA 3GIZL 3VXME 3SE4A 4NXSA 1AGBA 1OGAE 1J7VR 4ONGH 1E27B 2RIKA 2UWEB 4EIGB 2AABH 4JNXA 1QQDB 1TITA 3BUBA 4XVSH 4JCLA 3BH4A 2EVJA 4LL4A 4NLHA 3GPSA 4C59B 4PRID 5IG7B 2R7EA 3BEVA 4HFWB 1NCWL 7FABH 1PFCA 2IJ0C 4PJGA 1HCYA 1MCOL 3FUEA 2YD2A 5E56A 4YGAB 1TQVA 3MLUH 5JW3L 2Q76A 4RFOL 4UV4L 4R97B 4DH2A 5IB2B 4X83A 4PIRF 3W9DB 5A6LA 2XPYA 4LSTH 3CFEB 5J11B 5H8DA 4F7PB 5EU4B 2QSQA 2GUOA 2GBAA 1QZNA 3P73A 2LU7A 3FB5B 4JHWH 4FERA 5FOBA 2VLJB 3QUYC 1GYAA 1NDMB 1X5LA 4OD2A 4PW9A 1ONQA 2O5ZH 3MU3A 2PCFA 4L5FE 4EOWH 1INQB 3FRUA 5IR1A 1SEBB 4UM8A 5D2LE 4ZUWB 1TFHA 2F8OA 3MRDB 4AUYA 5G55A 3VQ2C 2FD6L 4APQB 5B3JE 5JQ6H 1JXGA 2EKSB 3ZTJH 1JTOA 4WUUA 3BW9B 2OSXA 2YAPA 3M1BA 1Z66A 3D25A 3HHSB 5SX5K 3HHSA 5IFAH 4PWKA 2CGYA 3PDGA 5FWQA 4G6JH 3MBXH 5DQJA 4JANA 4K3HA 3PS6A 4APQA 1H8LA 3DX1A 4FZEH 4U6TA 3SZ6A 3DMMA 3EXJA 2OFQA 4OLUL 4ANUA 2EIKB 5MENB 1ONQB 3BVWA 5DURB 2EIDA 2IWEA 3D3VD 2K6YA 1X4XA 4HIIA 3ZKMC 4LLDA 5KS9E 4JFFA 2LABA 3O0LA 4P4KC 1NGYA 4HLZH 2FQGA 4KMTL 2FT6A 5IB3B 1JTTA 2F7QA 2V8MA 2ZXEB 3GSNB 4PS3A 2JCWA 1OCWH 9PCYA 3SEPA 2VISB 1FPTH 1G9NC 3BEVB 1UT2A 4OUUB 1PQZA 1Y18A 1DVQA 4ODXA 5CILH 1N6QH 4BGLA 1T22B 2BP0B 1PKQA 3QDGD 2XJKA 4PG2A 4R9HA 4MDIA 3M88A 3QEQA 3RPIB 2CNYA 4G3YH 1HCZA 4U1JA 5MHSD 5TPWL 2MEJB 5D6DA 1C5CH 3CXDL 1M3JA 3Q8AA 3ZTDC 4ADGA 4U6VH 4XNUH 4HULB 1RY7B 1MCSA 2FCBA 3PGDA 1WHOA 3CQPA 4FLSA 1L4IA 1ODAA 3IDMA 3SO3B 3VFWA 3PAVA 4DFHA 1SHWA 1QRNB 5TF1L 1ACZA 3H7BA 2X0VA 4HKZA 3T8XB 4FI6A 4WK4B 1CGXA 2PYFB 2DOCA 2KC0A 3NUKA 3QJUB 4ZS6D 1KWKA 4X6DA 1ED3A 4CGTA 2K45A 3BPOC 4P5KA 3D09A 3UG5A 2DQHL 3ULVE 4IOFD 3MUHL 4P2RB 2YPLB 3CCHB 1FVDB 2JTDA 3L7EB 3FZUC 1IIKA 1OZTG 5ESAB 3RZCC 5IFJA 2IOIA 3GMRA 3IT8D 4AJVA 2YD4A 4XPGH 4BRJA 3FT3B 4KVCL 3B7SA 4XO3A 5F3HA 4ETQB 2OL3B 5I6NA 4QHKI 4QRPA 4JW3A 3EGSB 3AUVA 1MCEA 5GGQH 4XN2A 5CAYB 4PJDF 4RAUB 2GKIA 3V9EA 1UD4A 5EBLA 5I6KA 4PJGE 2WXPA 3S36L 3SOTA 3V6FB 3UTTB 5ID0B 5LVEA 2NUPB 2VIRA 1OP9A 2YPLD 2X3BA 3L8QA 2ICWA 5F71A 3O6LL 2KQNA 1CT8B 3ARBD 4NQSA 1W0YT 3ARFB 2V9QA 1P1ZA 2B15A 3BZ5A 5EH1A 4HKBA 3GO1L 1JXJA 2JWYA 1HH6B 3GZPA 3ISYA 4YUEH 1SHMA 2VR8A 5IOPA 1NIBA 4NQXB 5D1QA 1LO0H 3L3GB 1N3NA 5DO2D 3IWUA 5SWSE 4OFYD 4OLWL 3LRHA 4XP4H 3N2JA 2CPUA 3HG5A 3VH8B 1VEMA 1HSAB 3O81A 3GWJA 43C9A 3EH3B 3FTXA 3N1PC 2OW7A 5D72L 3TV3L 3DNKA 2WSDA 5B8CB 1ID5I 1ZIBA 3GMNA 5D7HA 5ADOL 5IROA 4CN6A 4DPRA 2HT4D 2DLEA 1SEQH 3S8FB 2DQIH 3KPOB 4AXWA 4ELDA 4XVTH 4GQ9H 1PBYA 2NY0B 3QDGB 5I2IA 2V9RA 1FWXA 4KVCH 3UAEA 2FQEA 4BCZA 5AOZA 3B8YA 4PS8A 5AW4B 4J8RA 5HI4C 2BIMA 4KK5D 4PV9B 3PWNB 1EMTH 1HL4A 3P3SA 1CDIA 4PRAA 3T6VA 3C8KB 5A16B 4TQ8A 5E6IA 3NA4A 4JFDE 2GJZB 4C4BA 4YDMA 2MQ0A 1S5IL 5EN3A 1B2YA 3RZCA 4XP9L 2DRUA 3NJGA 4OCXH 8FABB 4EQ3A 3GRWA 4K94C 3OZ9L 4QHUB 1CF8L 1KPVA 3E1ZA 3E80A 5CZKA 3ARDB 2XPGB 4JGUA 2GJZA 1EIBA 3NSXA 2FJUB 1IEAB 4PJXB 1W9XA 1UJ3A 3LN5B 1DQDL 1TMCB 1AIZA 3FBQA 4PJBF 5KN5B 2X41A 4OGXH 5KJ7E 1QRKA 3BMWA 5I1JH 1S7UA 4PVMA 2EC9T 5DJXA 1G9HA 4FFVC 1XEUA 3N85L 1SXSA 1EAPB 1BYPA 1F45A 2Y36H 2YS4A 3KYKH 4CC0A 2H6UA 1SLUA 4P3CL 4KKLC 3CK0H 4KMTH 2WVTA 2UXFA 1EXGA 5E9DD 1QLEB 4MJHA 2WNKA 3LS5H 4G70B 2QVTA 4RX4A 5F0LB 2JXMB 3TBCA 1S7SB 5EBMA 3BWUC 4R7NA 1KY7A 1I7UA 4YQXL 2KI6A 3PLYA 3VFRB 4OLUH 32C2A 4EVNB 1IE4A 3K4AA 3NCJH 4Z77B 1M2VB 5EU7C 2EXTA 4YBLB 1BCIA 4JAMA 2P5WD 4AJWA 4GB9A 4Y5XB 5GRVL 4L3ED 4UZSA 1IGCL 4LLVB 1EX0A 4LCYA 3UYPB 3QQ9C 1J8HB 1HHKA 4XX5A 4DP5X 2EH7L 3EJYC 3D2UB 5FX3A 1KGUA 1P1ZB 2A2QT 5K39A 4LCCA 3EJTA 1FPTL 1YEEH 2LAGB 3QBTB 3UP6A 1BFOA 2FBRA 2YXWA 2H1LM 3VI3B 3GHPA 2O5XL 1ODUA 1KTJA 2J8OA 3ZT5A 2QEJA 5GZOD 1IKNC 2AJXL 3FAXA 1DR9A 4XPHH 1ZJBA 2W9EH 1PZSA 1T66D 3JV6B 3L3KB 1XF2A 4YDJA 4JX0A 2WUBL 3D05A 4PGCA 5DVKA 1LK2A 1MFNA 2H0FA 4AGNA 4PJIF 3HZVA 1JWUA 1ZA6A 2BVTA 2Z3FA 4O58H 1U2CA 4PRBA 4Y1AB 5DA4A 3SDDC 3HE6C 2P52A 1BZDA 3JTSA 3OMIB 4LSTL 4PRNA 4QRAA 4AI7A 4MCZB 3W11C 2V5SA 5HJDA 4AL8C 4FLRA 4NO0D 4IKKA 4JFXB 2BHUA 1ILUA 1WIPA 2JVUA 1Q72L 3DDGA 1QTYT 1HL9A 2P8PB 5E6IC 3F7QA 2P5EB 3VRLF 4D8OA 2IADB 3BLBA 4JN1H 2Y3NA 4N2LA 4CN1A 3O3BB 4XCYB 1IGTB 3BDBA 3CH1A 1KTRL 3V0VB 2MNWA 3K2KA 1U92B 4XN5A 3BPLC 3G3LA 4K5NA 4X6CB 1G1YA 3ASWA 3NA9H 4UDTA 3ULUH 3G5XA 4JQXC 4AYDC 1NA8A 5IQMA 1TOXA 2BHZA 3RTQD 3TBVA 5DS8A 1JI2A 2N7SA 3PWVA 1YLBB 5J8OA 3T2NH 4N2NA 4RAVA 2IH1B 4AKPA 3VM5A 3A6BL 1EPFA 1USQA 2CLZA 5BXFA 1AGCB 2X6VA 4KOBA 5JQIB 1PQZB 1Y18B 3LIZH 3ZSTA 4Z3HA 1EBAA 3U36A 1P4IL 5LBGA 1VADA 3TFKC 3FUMA 2F6AA 4R90H 4DEPB 3KPNB 4RDBA 4LSUH 3O3UN 5FKAA 5JDJA 1UT1A 4F15C 1JGIA 1J87A 4LP8A 1N4XH 3EOBB 2DBJA 4JFFB 4H25B 4OQTA 4HIIB 3GBNL 3P0VH 4RFNB 3D69B 4TLSA 1AD9A 4IIQA 3U7WH 1UA6L 2HFEA 2RB8A 2VW6A 3QGVA 3T2OA 1KGCD 3QS3A 5FLVA 4P4RB 3K3QA 2QVFB 4OCYH 2YQ2A 1F5WA 4D7BA 4B27A 3C5ZC 4JO4H 4QHMB 4POZD 4L8BA 4RWYH 3IVKA 2B5IC 3NOIA 5E6ID 4L4TD 4FXGC 5KVDH 4BZ2H 5T1MA 4ZYKA 2D73A 2IBZY 2GVYA 4XI5D 3MV8E 3BW9A 3GMLA 1JGUL 4K7PX 4C54A 2A6JA 1TTGA 3LHPL 4CC4C 1UM6H 1PD6A 3LEXB 4W9DC 4KV5F 1NIFA 4G6AC 3KJ6H 5AOJA 5TE4L 1IAIM 1SEBA 1QNZL 5FA4B 1SDDB 3QFGA 4JZJB 5L88L 2ZSWA 3FH5A 1CVSC 1LP9F 3Q6FA 4KY1H 4NN5C 2ETWA 1ZWIB 5FOBB 1LMIA 1GOFA 4A7SA 3P73B 2ZQKA 4NM4H 2GUOB 4FNQA 4W70A 4ES8A 4HKXB 3TTSA 2XY2A 1SJMA 5GJTL 5ETUB 4RSYA 4P2QD 3CN1A 1EHXA 2YN5A 3M46A 2VNCA 3HG1B 1EHLL 4HS8L 5HHMB 2UZYB 4H2AA 2X2JA 4GW4B 4LNRB 2EDTA 3FO2B 5D1QE 4P23D 4I48B 5CGM