3UGEA

Silver metallated pseudomonas aeruginosa azurin at 1.70 a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
molecule tags Electron transport
source organism Pseudomonas aeruginosa
publication title Silver Metallation of Pseudomonas aeruginosa Azurin
rcsb
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ugeA00
1JERA 2EIKB 3ZDWA 4A2GA 1DYZA 1M56B 2BP0A 1SDDB 2JKWA 1ET5A 4CSPA 1AIZA 3QJRB 1ZIBA 2GC7C 1R1CA 2UX6A 4KO6A 1XMEB 5I6NA 1SNRA 2BZCA 5AFAA 2WO2B 4ZK8A 5I6LA 2Q9OA 2HXAA 1BAWA 4M4RB 1NIFA 3NSCA 3UACA 5B7FA 1JXDA 4W9ZA 3X2QB 1GSKA 2FT7A 3QJQB 2JFCA 2Y1AA 4F7KA 4YSOA 3X1NA 5IY5B 1V54B 4QKTA 1IUZA 4BWUA 1CUOA 3EF4A 4GP5B 2HRHA 1A4AA 2A3TA 2I7SA 1A65A 1RZPA 1B3IA 2DV6A 4G70B 4YSUA 1JZJA 5I6PA 1V10A 2XWZA 3FQYA 2J56A 3IEAA 2BP8B 3V9CA 4E9WA 1W6WA 4A2EA 1NIDA 3TBBA 1E5ZA 4G7QB 1TKWA 3V9EA 3T71A 1NDTA 1AG6A 1JVOA 1L9QA 3N2JA 3BQVA 1FA4A 2GB2A 2XUWA 1SF3A 3ZBMA 3JT2A 3L45A 1J9RA 3AG3B 1J5CA 4HHWA 2QPDB 3N55A 3S8FB 2FT8A 1ZV2A 2EILB 2XVBA 3PAUA 3SBPA 1L9OA 2ZONA 3ABGA 2IWFA 5B7EA 4UF7C 1W6LA 2ZOOA 3FT0A 4KO5A 1JXFA 3AZUA 2TSBA 3IBOA 4WTQA 4DP5X 3UAEA 2VSMB 1EZLA 1SHWA 1AANA 2VW6A 4YSPA 3QJSB 2YXWA 1ET7A 3PLYA 5D4HA 3X1GA 3NYKA 4A2FA 2PP8A 3ERXA 4AKQA 1NTDA 1IC0A 1SFHA 1ZPUA 3T6VA 4BWWA 1PF3A 2E86A 1X9UA 5B1JA 1WA1X 4DP6X 1OCCB 4HZ1A 1NIAA 3IN2A 1ASPA 1XB6A 2OCCB 3NJMA 4HHGA 3IE9A 2XU9A 2IH8A 3CVCA 1MG3C 2UX7A 5I6MA 2VM4A 2FJSA 2QT6A 2ZWNA 3NP3A 3RYMA 2IDUA 3SBQA 4YSEA 1JXGA 3NSYA 4BK5C 1HAUA 1IKOP 2PPCA 1OCZB 3X1FA 1PZBA 3CVDA 4MFHA 1QHQA 4N8UA 4A2DA 4E9YA 3FS9A 3H4HA 1CYXA 4AX3A 1NICA 3NT0A 1ZDQA 2HX7A 2YXVA 4KOBA 1GS6X 3T6ZA 4E9VA 1BXUA 2VSKB 5TK4A 4E9RA 3TBCA 2XXGA 4NB7A 3TASA 2XX0A 1KYAA 2PPAA 3ZX1A 1SHXA 3FSVA 4GYBA 4BXSV 2AZUA 4DP2X 3DKHA 1KBWA 5PCYA 3OD3A 2CJ3A 3UADA 1OCRB 2YAQA 1NIEA 3WKQA 4N4YB 1RZQA 2MRYA 1JZFA 1A8ZA 3OQRA 2BW5A 3SBRA 1M57B 1AZNA 1CC3A 1BQ5A 4YSQA 3NSDA 1MG2C 1SF5A 4HCFA 2X87A 3OMIB 1MZZA 4YSAA 4KOCA 2FTAA 4ENZA 1ZDSA 1URIA 3AG1B 3T9WA 4UANA 3ABMB 4AKOA 5TK2A 2HX8A 1KDIA 1W8EA 1WS7A 1GR7A 1GYCA 1PLBA 1TU2A 2OV0A 2CALA 2B08A 1KGYE 3QPKA 1AS8A 1PCSA 2GBAA 1XB3A 2VM3A 4YSCA 1QNIA 1KCBA 2PP7A 3SQRA 1AZCA 3JTBA 4DPBX 1AR1B 5D4JA 2HRGA 1WAEA 2W88A 1PY0A 4A66A 2CUAA 2PP9A 2XX1A 2BP0B 2X88A 2YARA 3WNJA 2XV0A 4JHUA 3PAZA 4E9XA 4AKPA 1SFDA 4RH4A 2UXFA 2PCYA 2HX9A 2BO0A 4GP4B 3CDZA 4NAJA 2XYBA 3CG8A 3CVBA 3T6XA 3G5WA 3NJKA 5B1JC 4UAHA 4G72B 1FWXA 2FWLB 2FT6A 1OCOB 5AKRA 3PXLA 3AW5A 1ASQA 1T5KA 4EF3A 2BZ7A 3S3CB 3FYEB 2GIMA 3TA4D 5AZUA 2J5WA 1MZYA 3FU9A 1NPNA 4YVNA 4DP4X 4BWTA 1WA0X 4QLWA 3NJHA 2BWIA 4AI7A 4K9JA 4DP1X 4G7RB 4WKXA 3NJFA 1BQRA 2EIMB 2IDTA 1PNDA 1L9TA 1PZAA 4DPCX 1HAWA 1HFUA 1A4BA 3DTUB 3EH5B 3FSZA 3NP4A 4BXVA 5I6OA 1JZEA 4DP9X 1I53A 3S8GB 1MDAA 3FPYA 5I28A 3GYRA 1GS7A 4HCIA 1A4CA 1PMYA 5B7MA 3WIAA 1ET8A 1A3ZA 1XB8A 3S3DB 4A68A 4PAZA 2CCWA 5I5JA 1J5DA 3UABA 2FQDA 3FQ1A 3TU6A 3CDZB 2JXMA 1WA2X 2B3IA 3OMAB 3NJJA 5FC9A 3WG7B 3ASOB 4KNUA 4KO9A 4BDVA 1GS8A 1JVLA 2PLTA 1OF0A 2EIJB 3FU7B 2H3XC 4TXVB 7PAZA 3FSWA 1JZHA 1AZBA 1BEXA 5F7BA 4M3HA 1GW0A 2GSMB 2WSDA 2HZHA 6PAZA 1J9QA 1RKRA 1ADWA 7PCYA 3EH3B 4YL4A 1EHKB 2ZXWB 4CSZA 2DWTA 4GXFA 2P80A 5I26A 5B3SB 2UXGA 3HB3B 2AZAA 2BHFA 1PZCA 3MBWB 3NJLA 5B1KA 2LLNA 2VN3A 4DP8X 2YAMA 3FSAA 3PAVA 2AANA 1E65A 3WI9A 4YSSA 1F56A 2P80D 6PCYA 3FYIB 3KW8A 1ETJA 1AZUA 4DPAX 1BXVA 1N70A 4F2EA 1KDJA 2MTAA 1BYOA 1V55B 2DY2A 2R7EA 3BVDB 9PCYA 3AY2A 4HCGA 1OE2A 2PPEA 3X1BA 1AZRA 3QJVB 8PAZA 1M9WA 4DP7X 3WNIA 1BQKA 1NWOA 2AVFA 2J55A 4PCYA 2R7EB 2I85A 2QDVA 2PPFA 1L9RA 2CBPA 5I6KA 4X4KA 4E9TA 4HAKA 3C75A 2CAKA 2DYSB 1VLXA 2FQEA 2XLLA 1OV8A 2IDQA 2PCFA 1AOZA 3OMNB 3H4FA 1BYPA 2WO3B 4GY4A 2YAOA 4W1TA 2OJ1A 2W8CA 3HEIB 3NSFA 5I5IA 1QLEB 2FNWA 2IH9A 3ASNB 4NERA 3WKPA 4A67A 1N68A 2EINB 3D12B 4E9SA 3EH4B 3GXUB 2VW4A 4E9QA 1AQ8A 1ZIAA 3GDCA 1OE1A 3U25A 1KCWA 2XV3A 4P5RA 4HALA 5E9NA 1TEFA 3ABKB 1PLCA 2XV2A 4JHVA 3T6WA 1J9TA 1UATA 3EHBB 5EHFA 4BDVB 1X9RA 1PAZA 3PCYA 3DIVA 1NIBA 3NJIA 4JKNA 2GC4C 1L9PA 1L9SA 2XXFA 2IWKA 2QPEB 3FPXA 3UGEA 4KNTA 5D4IA 2DYRB 4DP0X 1WS8A 5B1AB 3KW7A 1JOIA 4FAAB 5F7AA 3NJGA 3FQ2A 3QJUB 5B1BB 2NRDA 3S3BB 1AS6A 3ZIYA 2QDWA 2TSAA 4G71B 1AS7A 1ASOA 2YAFA 3FU8A 4G7SB 5LDUA 1TEGA 3AG2B 1PLAA 2FQGA 2RACA 2BP8A 2YAHA 2UXTA 3QJTB 4L0PB 1AAJA 1RCYA 2VW7A 2H47C 5ANHA 4A2HA 2IWEA 1JZIA 1YLBB 3ABLB 1KV7A 1GY2A 1SDDA 1CURA 1NINA 1NPJA 2I7OA 3AG4B 2VMJA 1BXAA 2H5UA 4HIPA 3IN0A 3CZUB 1CYWA 1ILSA 2BW4A 2PPDA 3MX0B 4F2FA 4YVUA 2IDSA 1DZ0A 1JZGA 5A7EA 2GHZA 4FA7B 3NJNA 2YQBA 1OE3A 2YAPA 3OM3B 4YSRA 1KBVA 1AACA 2GI0A 3H56A 2DWSA 2Q5BA 1IBZA 2BWDA 3PPSA 2HLEB 3FU7A 4KO7A 2FQFA 4AZUA 1E5YA 2N0MA 1ID2A 2J57A 5I5MA 5PAZA 4Q89A 1GY1A 2IDFA 1IBYA 2Y69B 1FFTB 3UAAA 2AFNA 1NWPA 1PNCA 1SJMA 1NZRA 4YSTA 1OOWA 1ILUA 3X1EA 4YSDA 1E30A 4Q8BA 2UXVA 4GP8B 1J9SA 3QQXA 1E67A 2YAEA 4P5SA 4KNSA 1AG0A 2IAAC
chains in the Genus database with same CATH superfamily
2WLZA 1AD9A 2C3HA 1ZVHA 5JR1H 3MA9H 2KERA 2JKWA 1N9PA 3TIEB 4LKCA 4JRYD 1U8MB 5L0QC 4YX2L 2A73B 3TV3L 4PRPA 4AE0A 4DQOL 2IMNA 2J5LC 3FHEA 3I75A 1WCBB 1ZVSA 2ZKYA 4P06A 5DD0H 4JN2B 3LKQB 1ADQA 2QTEA 1WUZA 2NX5D 2NY4D 4YSOA 1V54B 4QKTA 5D71H 4KK9D 5KS9F 3LTVA 4FXKA 4HIXH 4UIKH 3VA6A 4P49A 3H3KA 2EADA 2YGNA 3ZSTA 3I6GA 5JDSA 2X9WA 4K2UH 2ZWKA 2H0PA 3O2WH 4IRSA 5JQ6L 4WI9A 1T21B 4I87A 3V4LA 2WN3A 2PYEA 4K3JL 4ZODA 4Y2LA 5JHDA 3L2LA 4HMEA 4PTTB 1F1GA 3V5DA 2EXWC 2WBJC 1FGVL 3U0WH 2GBTA 1L9QA 2UZIL 3BXNB 2X6UA 3NDYE 4XVUD 4GSUA 3FCTB 4OF5A 5AZEL 2LU5A 4KXBA 1J9RA 5ILTH 1D5ZA 3AG3B 1PD6A 3K0YA 1UKTA 3L9RB 1MCOL 4PJFB 4XT1C 1P7KB 4GIPD 4OQTH 2F68X 3T08A 3KBHE 3DVGA 4QJ3B 4OGYL 1IGIL 4BFNA 4X7SH 4NJ9L 3D52A 5JHLL 2W91A 1UJ3A 2Z91B 1IGJB 1Q1JH 4NO2A 1T2XA 4YWGL 3Q06A 3IDNA 4L4VE 1PKOA 3QORA 1LO4H 4XN5A 1WEJH 4TLSA 4TSAH 4GAYB 2CO4A 2W0KA 2IAMC 3HC4L 5C07B 2AXFB 2V2WA 3I9GL 1WWBX 5E7BA 1HXKA 1XMWA 4JG1L 1DJSA 4YSPA 4QJ5B 1F4WL 2FECL 3IVKB 2DH3A 1UOVA 4PCSA 4OIIH 1X5IA 4A2FA 1EAPB 2JTDA 1AGFB 3ZE2F 4BSJA 4MJ5B 2QSCH 3IDUA 2BNRD 2HCZX 5F1IB 2CK0L 3OGOE 1ROWA 1J05B 2XN9A 3EBAA 2WTOA 4ONFL 4PJEE 4DO6A 4CSSA 1ASPA 2OCCB 4HG4J 4HHGA 2PYFB 2YUVA 4NEHB 4Y5VC 3IU3B 2YKKA 2ZXCA 1G7QA 5GXBB 2WOYA 5T1MA 3Q6FB 4ZO9A 1M4KA 2EE3A 2W0FA 1KULA 2WGXA 1GH7A 1EXUB 3JT0A 4G8IB 1S46A 1MCPL 5LGYA 3M6DA 4WWKA 3FONB 3QYMA 3CSPA 5BUPA 1TO5A 4BA8A 1B4JH 4AC2A 4QRQB 4UBDD 4HCRL 3UH8A 2C4FT 2AQRA 1DVQA 1ITBB 2F5AL 2ID5A 4KOBA 1JPST 1GGCL 2VSKB 3PQYD 3APFA 4XN8A 3U0TA 5ISZB 2Y7QB 1DBAL 2XXGA 3OJDA 4MXWL 1C8PA 1G7MA 4ZX5A 4OLZL 2ROYA 5C8JA 1F6AB 2D7PA 4LFHG 2P8LA 4JB9H 2P45B 3OG6B 5JTWA 5LG6A 4PB9L 1O0VA 2VXQH 3NACH 1T1WA 5PCYA 2CJ3A 2QQLL 1OCRB 3KR3H 3N85H 4Z76B 4HEME 4LPXA 4MLIA 1PPIA 4W70A 5AW8B 4QT5A 3VGBA 4OJAA 4P23A 1S3RA 3EYQC 4MNQB 1M57B 1JHLL 4KRNA 2VLJB 1IBFA 1HNYA 3SQOL 3RWHA 3DVNA 3BKJH 4FFZL 3W1ZA 3D07A 4KFMA 4M03A 3SO3B 2L7EA 3GZKA 1KGIA 1URIA 1HXMB 4UANA 1BMZA 4N8CL 5KAQF 3KBFA 4W9FC 5D6CB 1E5UI 2CO1A 5JA8B 3MFFA 2MQ3A 1FE8L 4GMTL 2FBRA 2VQUA 4K94L 5G4MA 1GR7A 1RURH 3QG6A 3L3DB 1TVHB 1OTUD 3U6XS 1VEPA 1BGXL 3ULUE 1BOYA 4ZBJA 3D0AA 3MO1A 4Y0GA 4I77L 4XVSH 1VJSA 1AR1B 1ORSB 4JQIH 3NQKA 5F3HA 4CU8A 1U3HA 2JCWA 4LVHB 1C16A 4PJ5B 2CWRA 2J72A 3CMGA 3HN8A 3O8XA 1A6ZA 5AVUB 1F58L 4HFUH 2OW7A 4LFHD 4Z0BL 1KY6A 1U9KA 4RH4A 5KVGH 1OT1A 4FMVA 3SKMA 3O6FD 2BOCB 3O2DH 3CDZA 3SD5A 1LMKA 3FTVA 3ZE1B 1G7JA 2CK0H 3SDXA 4GI8A 1NCTA 4BFKA 4N5UA 2FT6A 4FRWA 2AVGA 5E6ZA 4W9LC 1CLZH 3X3GH 4KI5F 4Y1AB 3QG6B 2R1YB 2IPUG 4KJQD 1QQDB 2E27L 5IEKB 1CCZA 1XCQB 1KIUB 3FN0H 1PFCA 1Q9LB 5DRNA 2F53E 3BVVA 4DAGL 1LP9E 3TYFA 3LH2L 4MDJB 3ET9F 4BV1A 8FABB 3DGCR 5KZCD 5DD1H 1KEGL 1AJ7H 5AENA 4MASA 4DCQB 2W07B 1C8QA 4NYLA 4DPCX 5E70A 4POUB 1JZ6A 3H3BC 3W5NA 3ALPA 4OLVL 3HHSB 3TN0B 1JN6A 1WF5A 4XO8A 4PLNC 2DMCA 3S8GB 4ORGB 4Q6IA 4XE0A 5FYLE 3PG2A 1VESA 1UXSA 3PWNA 4HXBH 5HDRA 2AEQL 3SGJC 5KBKA 4UQ3A 3AWEA 2BSSB 5J0BA 2CCWA 1BD2B 1K6QH 1C5CH 3WL9B 3MV9D 1HCVA 2Y1ZA 3I84A 3MJ7A 5JOEA 3ASOB 4J3UA 5GGTL 5I71C 4PJ8A 1LDPL 3FCSB 4S2SA 3ZL2A 1MJUH 3GMRA 4TS6A 1OF0A 4HC1A 2EDYA 3HE7B 3QSKB 1TDQA 3H53A 4HF5H 2CKBL 3IVKA 1CL7L 1B6UA 1QTPA 1YEHH 3F85A 4NC1C 3VRIB 5C92A 4BFJA 5LWYH 1A1OB 4D94A 1FORL 2A2QT 1KNOB 3IDMA 5DQJB 4ZFOA 5KS9A 5TH2A 2VISB 1QBBA 4CU7A 2DWTA 1NPUA 4PRDA 4W9GC 5BJTB 3BT2H 2WBWB 1JK8B 5BCAA 4DTGL 1PKQE 3V0VA 4M5SA 4ZMXA 4NUGH 3A24A 2PYFA 4LCWB 1OB0A 1F56A 1C08A 2IIJA 1OGAD 4WW2F 3VXSB 1O7SA 1ED3A 1LQSR 4LPCA 4EIBA 1CYGA 2ESVD 2HWZL 4FNPA 2FWUA 3E2HC 5D7KD 5E4IA 1IGMH 3SDCC 4C83A 1KBKA 2UY6B 2Y7NA 2Q10A 3FO0L 4EVNB 4MNQA 4U1NB 4X5WA 2H9GB 4X9FA 4NNXA 1NWOA 2B16A 2EKSA 2ORBH 2J1KA 3KD4A 3PHQB 1XF3B 2R9HC 2WUCH 3FTGA 2R7EB 2BMKB 3P77B 3ULUL 3ARFB 2CJUH 3NIFB 1NBYB 4Z7WA 3VDBA 1NGQH 4ODTL 4W4NA 3C75A 4JFFE 3VE0B 4GQRA 4ZYKA 3EGXA 5H35A 1LO0H 4TQHA 1IQDB 2CJTA 2M2DA 3H9SD 1NCAH 3Q5YA 3MRDB 3DO4A 4U1LA 3X3GL 1FAIH 1VRSA 1M42A 2Q7YA 3WNOA 3TJHD 1P4IH 1P7KA 4IBUA 4LCWE 4X9GA 3KLAB 4JHWL 4M56A 5HHVL 4C56A 5KJ4A 2I32A 1N68A 1GOGA 2RTTA 1DUYA 4RRPA 4E9SA 3J27A 3EO1B 4Y16D 3U79A 5IHZA 4XZUA 4QXUL 1OE1A 5FOBA 4P5RA 1JF6A 3TEWA 4HALA 4S1QL 1HHKA 3BH4A 4Y2DD 3PAYA 3UTPE 2UUDH 5TDPB 1XF1A 3HZVB 2AXHA 3PCYA 4HAGA 3DIVA 3GXTA 1NIBA 5DRWB 2OR9H 3QJFA 2BZDA 1LQBC 1UD6A 1KYOK 1X5AA 3JQOB 1AMYA 2RIKA 43CAA 1RJYA 3UGEA 5BOZG 1J8RA 5EEWA 2IXQB 3ZKSD 1MF2H 4GB9A 1HEHC 4L1BA 2B9AA 2YD0A 3T8XA 2HVJA 4QRRD 2YO3A 3FN3A 3BPCB 4MYWB 4KI1A 1KWGA 1J8SA 3RWDB 3VVWA 5IFAL 5CLYA 4AYFA 2QPSA 3TS8A 3L95B 2F6AA 3VH8G 4YBQD 4O4YH 1NGZB 3IMTA 3K1DA 3BGMA 4ZO6A 4BH7B 2NXYB 2G0KA 2MSPA 3CC5A 4FA6A 3KPSD 5GSVA 3FZUD 2B14A 4EI5D 3I6KB 2OYKA 2HPTA 1NPJA 3VMOA 1TENA 1MHPL 1C5DB 3TJHC 1B0GA 3ZDZF 3QIWA 3KJ4C 4JZJA 1F8TH 1NCUA 2XC8A 1P4LB 1JCKA 5IQOA 4P9HL 4AEHL 5JW4M 1R3KB 1SYSB 5ENWA 3BFWA 3B1TA 3BZFA 5TF0A 1RK7A 1AGEB 3P0GB 3JV0A 3WFEL 1KCSH 5I0VA 2D2OA 3BP5A 3EGSB 1ZA3A 4PRHB 1CN4A 1WFNA 3DURA 3RU8L 4F3FB 2UWEE 1XGYH 3BFQG 4ZTOL 2HLEB 4KO7A 2BSED 1FAKT 2MCAA 3L3IA 3V4VL 5I75B 4KKQA 3RZCB 2Y69B 4NENA 1BF2A 4OCMC 1CZ8L 1NWPA 3WS3A 1OPGL 3I6GB 3GM0A 4M3KB 2ZXGA 3V0DA 4BBWA 2YA1A 1OM9A 2NXZC 3IGFA 4TM9A 5IVZA 3VCLA 1K4DA 3FO1B 1IM3A 3HN5A 4HOMA 4S1DC 1EEZA 4LIQL 4BELD 3GEFA 2DS4A 4QRSA 1T89C 3BRDA 3MDJA 3N40P 4PGZA 3QIBD 3WJMA 4FJ6A 4A2GA 5I18L 1A6ZB 3GBEA 1P6AB 3S6CA 1IAOA 3O6FB 3C2AH 3S96B 5E1HB 1ZGLA 1KN4H 1WHOA 3GTTA 4P05A 4XC1L 4LOUD 1DQKA 1PY9A 2NY7L 4TRPL 3S96A 3AUWB 3T4AA 1UA7A 1ZY9A 3H1ZA 1TO4A 3MSPA 3P30L 4HKJB 5F93C 1CDYA 3NSCA 4AEEA 2B4CL 4DGVH 1UTDA 3D33A 3SBWC 4ETQB 3NCJH 1GAFH 4OJYA 5I1CL 3H2PA 2WQVA 2Z7UA 3FRUB 1YUHA 1XGRB 1MCPH 3WENA 1TQUA 3RZWA 4ZS7L 1RUPH 3EJRA 3LKRA 2YS4A 3DVFA 4HEPA 4IDJL 1U30A 3C8DA 3C87A 4FLQA 2FX9H 1JZJA 4YDZA 3QUZD 2BY1A 2VR7A 3N41F 3IEAA 1NGZA 1HT6A 1FNGA 2YA2A 2MQ0A 3G5ZA 4WY7L 3ZZSA 1YSOA 2R8SL 1EA9C 1BAFH 3BAXA 5F9AC 4GSRA 3SKNA 1TKWA 3B2VH 1FL5B 4B95C 1T20B 1DSWA 4YO0B 1I1AD 3T8XB 4ZMZA 4OI8A 4PWIA 4OLEA 3DETC 4XVUC 2Y3NA 4B9KC 2RCSL 1AQDA 2V2XA 4LCIH 2VXUL 1ZLDA 4ZAKC 3BZEB 4L4TA 2JKXA 3Q2LA 1Q90A 4I0PC 3LKPA 1GYAA 2NY6B 2XFXB 2EEFA 3EYVA 2G2RB 3HB3D 2NSXA 4HA1A 3S34L 1G4MA 4NM4L 1P84J 2G9HB 3KPRA 3W11C 1Q72H 1OP3H 3HNSL 2F7QA 1E8YA 4FYTA 5FA4B 3STLA 1UWXK 4HIEA 4MS6A 5I9QB 3ZRSA 3MLYL 3F7KA 5JOFB 3ATDA 5E8OB 3CHQA 5KBDA 1SEQH 1PVHA 1YYMH 4NN5C 3OB0H 2A74A 5BO0D 4IHOB 4DESA 2JMRA 2WUBL 3LMJH 4F8LA 4PGBA 3X12B 4L9LB 5AYTA 3MNZB 1DBMH 1MFEL 4DNLA 3JWNE 5K9OB 3FCSA 3RIAF 3VSUA 3OVUB 4OFIA 1NKRA 3DX9A 4YK4B 4NO5A 4OCSH 3IU3A 2CIIA 4PJAA 4XNQA 2M83A 1KGUA 2YD5A 1KMGA 4K5PA 5DFTA 1OCCB 4BD4A 1EWHA 1IFHH 2Y06L 3ARVA 4PJBF 4XP9L 4BUGA 3U9UA 3NCCB 5I9QC 3W3BA 4M6OH 3LZNA 3TFKD 2G9HA 4N2DA 4OLYL 4F2MA 3NDZE 3UJTH 3QS3A 3NPSB 4FQXD 1WZAA 2NY1B 1T7WA 2VGLM 1ZS8B 5SV3A 5D1QC 2D0GA 4F57H 3K81A 4FQXC 1IC4L 3APDA 3QZMA 3GI9L 2WNWA 3NFSL 5FM8A 3M17A 1GVIA 1HILA 1FZOA 3KMDA 4Z1PA 4AW7A 3OHXA 4ZI8A 4KTEH 4YO0A 3OR6A 1OAUL 1DQVA 1TCMA 3HZYA 5CCHE 2XPYA 4QHNA 5GGTH 4IU3A 2HG5A 3ZDYE 4YIQA 5D8JH 1GTNA 4E9VA 1DSYA 4JRLA 3UO1H 5CBAB 1U8CA 3DXAD 1XD0A 1HTYA 4JDZB 4Y4KA 5EF0A 4M7ZB 3WNMA 3TBYB 3HFML 1XV8A 1TEYA 3T4YB 3F12A 2DBLL 3QG7L 3CDGB 4M48H 3NRFA 5FIEA 3V4PB 3NBNA 2F15A 3KBPA 3GXPA 1RJLB 2MRYA 3KYNB 3WHXB 1JHTA 2FDBP 4X5WB 4X9YA 3G08B 1AZNA 3QEQE 5TFSL 1P84K 1NMBH 2HKAA 3DSFH 4JO5A 4N20A 3UTQA 3J07A 5EBMB 1H8LA 2X87A 4L0ZA 3F5WA 3V4VB 3ARDC 1CDHA 2VERA 1OP3K 2MHAB 1OAQL 1BVNT 5GS3A 3ARDD 3VJ6B 3S37L 3POHA 5T33L 5I0ZA 3KLLA 5TK2A 4D7PA 1I1FB 2E6PA 1MUJA 1AXIB 4ZX4A 3HZKA 3H9ZA 1ES0B 2GG1A 5JHLH 4CC4C 5IFJB 1KXVC 1EEZB 2FATL 5GIRB 1IM3B 3FZUC 3FB8B 4B3EA 1KGYE 3FT4A 2ZKWA 3S2CA 1MOEA 1CDCA 2ADFH 3IB4A 4QOKB 1GPOL 5I74C 3SYQA 5JMOC 4JKLA 4HDIA 4CVWA 5ABZA 4KY1H 3CZNA 3D30A 1HH6A 1A7QL 3OR7A 4WFFD 5BMFL 3CIAA 1TQCC 3MGTB 1Z0NA 4PVMA 2DPKA 4E9XA 1GC1L 2IPTH 4FQIL 2X7LA 4AKPA 2IBZY 1RMFH 3IETB 1UWYA 5EU6B 2JV6A 2H41A 1ONQB 4JL1A 4PS8A 4X2UA 1H8SA 1QRNB 4KPHH 2ICEB 2WVUA 3APCA 4KXCA 4OZFG 3UYRL 4QXUH 3LY6A 3PNRB 4G72B 5IBTL 3SY6A 3TJEL 5L6YL 5FW6A 5GSRB 2R4RH 2CLVA 4WCYL 1LD9A 4LOUC 4YK4C 1K8IA 5HI3D 3SDAB 4D3CL 2CKBH 3QDMA 3VFTB 1NAKL 3ARYA 4NP4L 2WLLA 4YHIA 2QV2A 3KPQA 1KEMH 2YWYA 5KBPA 3HS8A 3GSQB 1VFUA 1IC1A 2WTRB 3CVIL 4AYDC 4LKXA 2C9VA 3TBVA 1P6WA 1ECZA 1D5MB 1KLFB 3OR7B 4DUVA 1FFPB 3NFSH 2P5WA 3NJFA 3UTSE 3GJFB 4FQ2L 5LNEA 3SOBH 1PNDA 4L05A 1FYTA 2EDMA 4LDLB 5IB4A 2CLRA 3UJJH 2I5YL 4AMWA 3MRJA 3T0XA 4UT9A 2AV1A 3GRWL 3DTUB 3MUGB 3EH5B 3ZLQC 2V2TB 2FD6L 4G8FA 1J8HB 3Q43A 4NI6A 4ENEC 2ED7A 2IH1B 3F6IA 4G1EA 3EOTH 3QXVA 3S88L 1U8IA 1EJ6A 1NUNB 1V05A 1YPZA 2VDPB 3ATAA 1UM4H 5C2BL 3E80A 1M05A 2PR4H 2YRPA 3ESPA 1G7PA 1WA2X 4HWZB 3ZQ9A 3TV8A 5IB2B 2FYYB 3TIDA 3O6ML 5FA3B 2MJWA 3BUTA 5EIIG 4KUCF 4NO3B 4GRWH 3BN3B 5BQDA 1KYFA 1LL1A 3EO0B 4MA1B 3VXNA 1JVLA 5JOPD 1A3QA 1HQ4B 2JKSA 1F86A 3IMUA 1S7RB 2F7PA 7PAZA 1HHKB 1CLCA 3GSVB 5TFSH 3OV6A 1RJLA 3OC5A 5F7DB 4BUHA 4X80L 5IMMA 5MEQB 1JWSA 4QRTA 5I8CB 4PJBB 2ZXAA 5CWSA 5L2JB 1SYVA 5HY9A 1J9QA 1RKRA 4IMLB 1HHIB 3TNNB 1LE9B 5DUMH 4C4KO 1SY6H 3QUZB 1YO4A 2EZ0C 1CR9L 4G8EA 3D69A 4QRUB 1H9VA 2A4CA 5SWQA 4JMNA 4ZMLA 3GS7A 3HUJF 1PZCA 4FZEL 3K2UL 4JQXC 3FTXA 2HPOA 2W9LA 4YLQT 1I1AB 1N6UA 4ES9A 5HHPB 1O7DE 1U2HA 1UVQA 1VHPA 4PLJD 1CDBA 2P42B 1HVXA 3PHOB 3PWPB 3COOA 1YY8B 4AXWB 4D9LH 3M17B 4OY9A 4PD4J 3GBNH 2UZIH 2VR6A 1NOAA 4UDUB 4LGSB 4MVBC 4OFQA 4AT6A 1RUQH 1W15A 4JPVH 4LHQB 5I1EL 3M1BB 1EEYA 4MMXA 1WUNT 2X4UA 4M1DH 3L7EB 4NIKB 1TCRB 2CZNA 1N0XH 2CBPA 5DWUH 2KZWA 4NHCH 3K5RA 3MRBA 2PXYA 4KKAD 4FX5A 2H32B 3HC2A 3TA3B 3U7WL 3KWTA 3U1SL 4MJIA 4L8BA 4AYBA 2OSYA 2ED8A 4I5BB 1WTGT 3RVUD 4HBQA 2W8CA 1NGYA 4X5QA 2NR6C 3HS0B 4PHXA 3KJ6H 3KPRD 1CPUA 3ARBC 3GSRA 3A4DA 2EINB 2IFGA 3N85L 1G6RH 5IB4B 1DSFL 3EH4B 2O6DA 5E1QA 4HUNB 1AQ8A 1RUPL 4IDJH 3N42F 1YN6B 2EDXA 2KYIA 3FH8A 3NIGE 1H3TA 4PIBA 2NQDA 2Y72A 4PH8A 1TEFA 2C9SA 5FF6B 4J39A 2XV2A 4JDEA 5IB5A 4PJAF 5HYIA 1J9TA 2CMRH 4ZS6C 5EN2B 3FU5A 3GSWA 4KJQC 1JS4A 4APQB 5JW5B 4JZNA 3RY4A 4OZGA 1NFIB 5DCCA 1RAMA 1J9CT 5AW3B 1X5GA 1QEWA 5IG7A 4WNJA 4X4XA 5FHAL 1T2JA 1F6FB 4AQEB 4DN3H 3DA0A 2H32A 2IV9A 4L8SB 5CIPA 3IFOA 4OCRH 1GMEA 2BX5A 3M07A 5DJ0A 2OYPA 3DDFA 1LNUA 2IWGA 7CGTA 1TZ8A 4C4UA 5AB1A 3S2AA 1TZHB 2EDQA 4KHXL 2YEZA 4XHQA 1T7VA 1CFSA 2KQMA 5EZJB 3P2TA 4ES8A 2QGEA 2VR4A 2APTA 4RGMC 3SE3C 1NSNL 1DQJB 3VD7A 4R8WH 4LLQA 5HYFA 3QEQB 3CFBB 4HIQA 1GGBL 3ABLB 3QIUC 4J7RA 4S1SL 4TUUA 4N2GA 4NZUL 2MCPL 1JF1B 5HYJE 1SDDA 3C6SB 4WUKL 3SGEH 1FL6A 3SZ6A 2WYZA 3FL7A 1JV5A 1GGIL 1L0XA 4PJGE 2DM2A 1DJHA 3CZUB 3E3QC 1FFNA 1MVUB 4FE9A 3TCLB 1S6NA 2BFVH 5J06A 2OSWA 3SZKC 4U6YA 5D5MA 1ZSDA 4IQHA 3FQUB 5D2NB 3HC0A 4XNMB 1F3DH 1J1PL 2F54D 4AH2B 3N44F 3ULVH 3F7YB 2IH3A 1UWGH 1EO7A 2WLNA 4XVTH 4YZFE 2B77A 5DXWA 4M8UA 1JNJA 4MHHG 4L3ED 1LP9A 4P4RA 1NC4B 4AJWA 1IAIM 2XHNA 4AZUA 4X6DF 3MRIA 2J8UE 4M7KH 2NUTA 5I5MA 5ACLA 2ZYSA 3JV6A 3HMWH 3HG1A 1DBJL 5AL8A 5JORB 4WO4C 1CXEA 3QNZB 1NZRA 4MS8D 5ANMB 1D6EA 4RDQG 4CMMB 3CN0A 1YECH 1V7MH 4Q8BA 4TKWA 1XTMA 3QHZH 5E6RB 1INQB 2EDRA 4BGDA 1T1XA 3WUZA 2PO6A 3IJ9A 3LNGA 4TVPD 3V6OC 3ZT5A 4CDHA 3P0VH 4R7NA 3IGUA 3QXDA 1J10A 4FCHA 2D3NA 1JERA 2V9TA 1Q9WB 1BVNP 4ONHA 3EJCA 2VZ3A 3CD4A 5AVZB 5D7LA 3QUXC 43C9A 3CH8A 4ZK8A 4R3SB 2WSKA 4BZ2H 1U3YA 2BY0A 3JZ7A 1CG9A 2A4ZA 3RY6C 2NNFA 4I2XA 1H8NA 2OK0H 1L6XA 4KTYA 2NSQA 4LBEA 1J1XH 2W59A 5IMOB 4PJHB 3ZDXF 1FZJA 5IQ9A 4AEIH 4JUTA 2NXZB 4XRCA 1PZ3A 5CEXA 3KS0H 1KFAH 1WAAE 2BNQB 1AP2B 3ZE0F 4NWTL 3WD5H 4XPHL 3DHJA 1YEWA 5BZDA 3QYNA 5DQ9A 2XBZA 3V6FA 4PBDA 2ITCB 2WXIA 1B3IA 1S7WB 4UI2A 1UOKA 1XO8A 4ZQKB 5L4MA 1IQWH 3HJ0A 1JNHA 4JJ5A 4QRRE 3WUWB 1ZLWH 4RA0C 1D5XB 3U82B 3GBDA 4HX1B 3HG1E 5ETUB 1UASA 2F8IA 4M7LH 1JVOA 3ZE2B 1GC1C 4UTAA 1FA4A 4PRPD 2IXQA 1A6AA 4NQDE 1U3NA 3IKCA 3L45A 3R0MA 3INOA 3LIUA 4WEEA 1MHPH 5IW3A 4L3EA 4F57L 1X5JA 2XG5A 3UZEA 3EYFA 3VX0A 2F2HA 2GYSA 1GKEA 2H0JA 2DN7A 4JPIB 5D1QA 4XNXL 3EYVB 3RPIB 5JMRA 4MJIB 2J7LA 1MFAL 2ZXDA 1FJ1B 3DX2A 3PWUA 4B9IA 5GRYA 2BNUB 1NFDE 4OZIA 4HMDA 1DVFB 1A1NB 2WINA 4JDVB 4KK6D 1NCCL 2JWYA 3P9MA 4WTQA 4HF5L 4MAYD 4PJAB 3Q6GH 4XNQB 1SHWA 1SZNA 4Z3FA 3RVVC 3Q0HA 1OAZL 1QATA 5AZ2H 2ETWA 2CDGB 1JWMB 3T2OA 1QSEB 4JCMA 1CE1H 1J48A 2X4QA 1IGFL 2DBLH 3QG7H 5B1CA 1U92A 2XQYG 5D7IF 4F9PA 4ZXBB 2EH7L 5CMAB 3T4YA 3UROR 3BKCH 4XZ4A 1NIAA 2EUVA 1UJ3B 4XMKL 1AP2A 4H0LC 1HSAB 5JW4N 4F9LA 1A7PH 5DMIH 1EO5A 1UADC 2PTUA 2XU9A 4RX4D 3DTXA 1K5NA 4QF1A 5FECB 3U0PA 3OKLB 4P2OD 1WFIA 3QFDB 3DSNA 5EIQA 4LEXH 4MJ2A 2HG5B 5L4JA 4AZ8B 3BLPX 3K2MC 3LQAL 4HPHA 1MWAB 1HAUA 2O26U 4F8TA 5CWSB 4HV8B 4ZPVB 3SGKC 2EUXA 3DI2B 1FZKB 1HILB 4FNTA 1SRDA 1XGQA 2XZAL 3L5WB 4V1DB 3ZZLA 1N6QL 3HLKA 5MP6H 4A2DA 4GO9A 5F6HJ 2YQGA 4K3JH 4M8QB 4JVWA 1YNLL 1XZ0B 4PS4L 2ADFL 1IJNA 2E9WA 4YDKL 1R19A 4OLVH 3PDOA 1TVBA 3KWXA 3EFOA 1MCSA 5EEZA 1KYAA 1FV1B 2NY2D 1CB4A 4X4YB 2FUQA 2YWZA 1ZE3H 2EVGA 1DFBL 5GGUA 4A6YL 1D7CA 3I9PA 4A7SA 5DFVC 4BRJA 4FULA 5J13B 4N4YB 3KVDD 1C12A 3QEGH 5DD0L 2GAZB 5DUBB 4H40A 1TF4A 3V6OA 2E7DA 4HPOH 4GAGH 3G3LA 5AVVB 3IF1B 2R29H 3B6SA 4F80A 3D6GA 2BXZA 3I75B 4P4RB 1LP9B 4QRRA 3F83A 1RH8A 1H5BC 2OMBA 2DWEB 5CJOH 2FEDC 4M7LL 5T8IA 3JZYA 2PF6A 2HVBA 2XG4B 3QUXA 4HJTA 1WZMA 4X5PA 3HA0A 3RLSA 4WWKD 5A2BA 3FOMB 1JPFA 5DJXB 4I48A 3D34A 1KDIA 4H26B 4ODUA 5F9DC 3RY6A 4F27A 4X8CA 3BAEH 2XKNA 3I2CH 3K6IA 4YX2H 2ICES 2B08A 1VFAA 3RIKA 2P7TB 4I48B 4LU5L 1Q9OB 3QPKA 3SOBL 3X17A 4HXAL 1VFMA 1HHHB 4DCQA 1YQ2A 2X70B 4OVUA 5L7XH 1YMMB 3BH9B 3GIVA 4C4KT 1NDGB 4Z7OE 2WZAA 1ONQA 3FUFA 3MLUH 2OSXA 4LLQB 3WY4A 1RHFA 1ZHLA 3K2IA 3IBEA 4JANA 1J0IA 3S4SA 5ERWA 4F91B 3SDAD 1AD0B 4J1UB 3B6SB 3CZJA 5DRZA 4BKLB 3A6BL 5A43C 1KPVB 1E5CA 1BFOB 2YEZB 4P5TC 3EJZD 1S9VB 2BVYA 3D05A 4IOFC 4FJZA 4JFHD 4YGVA 5C0JA 5JIDA 4CMMA 2DQCH 4MNHA 2FWLB 2UVFA 3WS6C 4QYAA 1FV1A 3DJRA 5HDQH 4KKLC 3VI3E 3GI8L 3GK8H 3WTUA 3DJZA 3SKMB 5AAWA 1C5DA 4GO6B 3BDYL 4WGVB 1IEBB 4ZO8A 5B22A 1XSIA 1IB5A 4HUWA 3HI6H 2EIZB 4PU2A 5IOKA 4DP1X 3TTSA 4Q14A 5IVOA 2CXKA 4HP5A 1A8JH 2XWDA 1NGWA 1L9TA 2EIZA 5EC2B 4S1QH 1HFUA 5FK9A 1QR1B 2EIBA 3LRSA 1J8HE 4XNZC 4AEFA 5F3BA 1OP4A 2NY6C 3VXSE 4F8QA 2PO6B 4OFYD 4AITA 2B39A 4P4KD 1OP5K 3GYRA 4G8GA 1PD1A 4NFDA 5JQIB 3DX0A 5GGUB 3MBEA 4GSDH 2GITB 2XJKA 1BF8A 2J8UA 4ZW3A 4Z7UF 1A3ZA 3MXVL 1ZD6A 1RUKL 5D72H 1FN4B 4JG0L 3US9A 3J8F7 5IW6A 1TVBB 3MUJA 4DVBB 3NCEB 3WG7B 2PWEA 5KSBF 1RURL 2ZKXA 1NANI 1CFSB 1G0DA 2ZKHL 3NFNB 2CQVA 3ZHFA 3ZL1A 1SEQL 3N43F 5DFAA 3CGTA 4FFYH 5BZWB 3EFFB 2KBGA 4LLYA 1GCFA 1DBAH 5CHNB 2YXFA 4M4PA 4NRZA 4ZPVA 3K4ZA 3S37H 3RFZB 4J3VA 1N10A 5KVDL 5ID0B 1LEGA 3H3PH 5E6IB 3CFMA 1YEIH 5GRVK 2ARJA 3NIFF 2A77L 1WH0A 4AQEA 3TZVC 3KLAA 5B3SB 3MJGX 2WB1A 5JQHC 3QIWB 4HFWA 1TU2B 3RWJB 2LLNA 3RVVD 5BUGA 1O6SB 1YC8A 3TZVD 4CRPA 2COVD 1HSAA 3IMVA 2AQPA 1JGEB 1MNNA 1NBZA 1J5OL 3FYIB 2VISA 4POZD 1E50A 3D50A 3T0AA 1EEQA 1OAXL 5JXAL 1T4KA 2IBZX 1V7ML 1UGKA 2ENYA 3I6LD 3IFLL 4UAOC 4Z7WB 5EU5B 2HVKA 4PB0L 4F58H 4Z7VB 3FUHA 4N85A 5E2UL 1KTCA 1AZRA 1EHLH 1GOHA 4KDTC 3K72B 3KWWA 4UDTA 4DP7X 2RBLA 4FQHB 2A77H 2ADJA 3B7UX 3ETTA 3B34A 3I6LE 4PJ7A 1AO7B 1INDL 5DEGA 1W9XA 5KSUB 2J55A 3SGDI 1UM5H 1BYNA 4X6CE 1N12A 4XCCL 4N2CA 3U30B 5DJ0B 4HAKA 1HEZA 1E4XH 4P2QA 1UWGL 2KZ1B 4Y4HB 2EDTA 3DIFB 4WFGE 3TPUA 5H2BB 1BLNA 1Z2KA 1SXNA 1JPEA 4LARH 5I76A 3QAZB 2NX5E 3P9WB 4KKPA 2EO9A 3IWVA 1LP9F 4KRPB 4HXBL 4X4ME 5KJRH 1A6PA 2ZG1A 2OTWA 4YHNB 4U0RB 3HMWL 3IDMB 5DQJA 4BSVB 4HWUA 2B59B 3UTSD 1MVYA 2D3VA 4NN7C 1SUJA 1T4WA 4ESKA 2JK5A 4OCWL 1PKQA 5E4OA 1XZWA 4MDIA 2EYRB 4QHUA 5LNDA 2JJSA 5FFGA 3OKMA 4B9GA 5JUEH 3SDXE 3KS0J 3EFDL 3L7FA 1KCKA 4I13B 4Z95H 1A6TB 3OAYH 3MACL 3ZDZB 3VQMA 5CF3A 1DP0A 2FJGB 3FH5A 4AQ1B 4EOWL 1ERNA 3MV8E 3SE9L 3DOHA 3ZQWA 3CFKB 4QCIA 3D2TA 4TULH 3HIZA 5DYOB 1CQYA 3ZZ1A 4JEGB 4CBZA 1E42A 1E4KC 2HN7A 1JGVH 3TN0A 4GPVA 4AJ0A 1P7QB 4GW4B 4NNXB 4P9ML 3SCMB 2BSTA 3KGSA 2W9EL 1KYDA 2IV8A 3MRMB 1MWAL 1ETB1 3ORJA 2A6JA 2YAHA 5CGYD 2UXTA 1MDTA 5F2FA 2JI3A 1AAJA 2B4CC 2ZNXA 4FFYL 2APVA 4QRBA 4WFFE 5E56A 4A2HA 4OZIF 3JWDC 3HHMA 1V7NH 2IPKB 1IEAB 5JDSB 1MFMA 4B60A 4WIQA 3FB7B 1SM3L 4OQTL 5DO8A 5A1AA 4UTBA 1KZYA 1I1AC 2IH1A 2IG2L 5KSAD 5LVEA 5KG9B 1MREH 1SBSL 2K4AA 2XG5B 1MJUL 2NYKA 4MD0A 1ILSA 5KSVB 4DFIA 3O11A 4F2FA 3ELQA 4PUBL 2J2ZB 2NXYC 3HNSH 3DV6B 3KVPA 1PZDA 4PJBA 5L2JA 3QUMA 2YQBA 4DOHB 2AJXH 1PIGA 2GI0A 1AACA 3IS0X 5J1AA 2RD0A 3BP6B 3OX8B 5FKAB 3RWHB 1S7RA 3WBDA 2EXWD 2WBJD 3DX1A 3GM8A 5BO1H 4LCYB 4NZFA 3WD5L 4DETA 1A21A 3GPSA 2DQEL 4IOSD 2VR8A 3REWB 1SM3H 3LX9A 3RDTD 4HC1H 5I24A 3WTWA 1K6QL 5SWSA 1J8KA 4BA0A 4NQEA 2WZ0A 3ILEA 2VNCA 3AMLA 4C55A 5K1NA 3CUPA 1RZKL 4PJCB 4KVPA 5IV2B 1A3RH 2WTPA 2IFFL 4WUUE 4MB4A 4KK9C 4Y7OC 1AH1A 2JLPA 4OSUH 4KC3B 4IBLT 1J86A 3X13A 1TITA 1B4RA 4J1UA 2ZOWA 2P5EE 4EDXA 4MCMA 4GAJH 1YYCA 1JI2A 2BIPA 3TFBA 5CKGA 1U58A 5JIKA 1RMFL 3ZY7A 3ABZA 3K4DA 2VITA 2A9MH 3L3KA 1U2CA 1T03L 4LSPH 1CIDA 1CLYL 2QQKH 3P73A 3UAJC 3ZOAA 1DUZA 4U1GC 3RPBA 1OALA 4PRIA 5K5YA 3RNKA 4OZHB 5ACMA 2ZQKA 3SE4C 3AMKA 4PJXF 3SDAC 1JFQL 4PJDE 3PWLA 5FYKH 3DMMB 3VFPA 4I8DA 2FGWL 4WFHE 1KTBA 4HUVA 2WP3T 4XWOD 4NJ9H 1NUDA 2CH8A 4RWYL 1NCIA 3FQYA 1Q1JL 1MFDH 1XH0A 2WXJA 3MMEA 2WXRA 1Y0LA 5CSZB 4APQA 4C59B 3UTQB 4EN3B 2DQTH 5JW5A 2GPZA 4P9MH 1KJ3L 1TJHH 4CJ1A 4Y5YC 1JG9A 1MCWW 1AFVL 4WFHD 3T71A 1JDDA 3DO3A 1BG9A 2GTWB 3BWAA 5ESAB 3V0WL 5IFHL 3BQVA 2Y6SD 3FSOA 5AVXB 5BPPA 4ZW7A 2IALA 5FOJA 5BVPL 4PP2A 1J5CA 4KK8C 2E8ZA 4PP1C 5EDSA 5AD0A 4N2IA 5I1GL 5C0AA 1O6SA 2R69H 2N3JA 3IRPX 4R97B 3OKMB 4NQVA 2NZ1A 4EUPB 3L2NA 3SBPA 4X6CB 4ODBD 4RWYH 2QVTA 5IHUL 1IM9A 5A2AA 3RL2B 5E2TH 3WY1A 3HZYB 1MLCA 4UF7C 3MRPB 4KO5A 4YQXH 3EJPA 2D8KA 4QRTB 3PWVB 1JV2A 2V17L 5HGAA 1AANA 3ZN6A 2OTWB 2BRRH 3AITA 1D9KD 1U33A 5HYQA 5C6TH 2EVJA 3HRZA 1ET7A 3QUYA 3PLYA 1DTUA 4JPWH 2BVQB 5CJBA 2V0AA 3AFLA 1XGPB 1IE5A 5CU5A 4K5LA 1KIPA 1OGSA 4OD2B 3KPLB 3ZKND 4GQQA 3SYCA 5EF3A 5GJTL 3ROOA 1X9UA 4FZEH 4HVBA 1FN4A 1LM8V 1IBHA 3QORB 3IFOB 5I66B 1NCDH 3P4OA 4IIQA 3RGBA 5IFAH 1GGCH 3FFCE 1BX2A 3VNZA 2CIIB 3CN4A 5E6UB 2OXHA 3CVCA 1MG3C 2WCSA 3PABB 5K1JA 2CUMA 5J6GA 2WLKA 4WFED 4CDGC 1OGAE 2H26B 4D9LL 1OAYH 3RI5F 4YDVA 5C08B 2AEWA 1OP5H 3U1PA 3VU1A 4XHJC 5BRZB 6CGTA 4J12A 1RUKH 3ARBA 1PZBA 3BHBA 5E9DA 2JE8A 5IMMB 5MEQA 1HCYA 4KJPC 3QVAA 4NM8L 1I85A 1QWUA 2O5ZH 2RHEA 5C07D 4AX3A 5B8CC 5FYKD 4R8WL 3ZYOA 2W9DH 4FMKA 4JQIA 3RP1A 4APQD 4R0LC 3VWKC 5D1QB 4E41E 1JZ8A 5KTEL 2MIZA 2CRIA 4FXKC 5TK4A 4FQCH 3GS4A 3ESOA 3TBCA 2Q86B 2F53A 1CGUA 4GYBA 5KVDH 3MRBB 3PJSA 5A7BA 4UV4L 5D1XB 5J6HB 5EOCL 5MEND 3GSXB 2QVFB 2AITA 3BQUD 3QNYA 5AALA 4OZHA 5TGBB 3DHUA 4JR9H 1TR7A 4OBSA 1DANT 3IMWA 4G6FB 4HAFA 5DC0A 1H15B 4AMKH 3ULVL 1VKXA 4G42B 4IBVA 1BQ5A 4X98A 2XTJE 1AQKL 4NXKA 3L4XA 4D0DA 3JUZA 1DLHB 1VFBB 3MRHB 3RE0A 1S7VA 2ITCA 2A6DA 4J3BA 3UAFA 3VXMB 3AG1B 4XH2A 4UTCA 4HIEB 4J8QA 1XR9A 3T3PF 4K7PY 3RWEB 2EDEA 4FEIA 5DUML 3QWOB 3S36H 3L13A 5K9KA 4JHZA 2QFRA 4L1DA 3Q44A 5IMOA 1UYWL 2BSRA 1TU2A 3RWJA 1IKNA 1WTLA 4CN6A 4UOZA 5M7QA 2GUOA 4L5FH 4TNGA 5GSVB 1MNUH 3C6EA 1WAPA 5DJ8B 2WBKA 1IGML 4GRWB 1ZA6A 3FN0L 3IGAA 4PWJA 1JZ4A 2A1WH 2AEOA 5DS2A 1DJZA 2XX1A 4PBWD 2AQTA 2CCVA 2BP0B 5AB9A 2Y22A 5KSAB 1KXQE 3FT2B 3WNJA 3RA7H 5CEZH 1BPLB 2B2XH 1Y1DA 3DGDA 1HH9B 3GT6A 1MHHB 4HJEA 4QY8A 3F7PC 2QVMA 2Y5TA 4XMLL 1UJTA 2WWKO 2X6CA 3A22A 3CG8A 1PG7H 4KVNH 3T6XA 4CNIB 4J8RA 1EXGA 1MCKA 5DQDL 3LQAC 1JUFA 4K7PH 4N90E 5HHOA 2CNYA 4PREA 3I85A 1ODUA 3HCVA 4JW3A 1KGCD 2AKRA 1CGVA 4JN2A 4JFDA 2B7DT 2ZD0A 2YRBA 4NO0D 3KJ6L 3V6ZB 3IJEA 4N6QA 4NCC2 2YOCA 1HCFX 5FWRA 1UXWA 2QKIB 4TF4A 2Z31C 1U21A 3N9GH 4IMKC 1UB6A 4LAQL 4OV6F 5C3LD 4CGTA 4HH9A 1G84A 5DD3H 2Z0UA 2A38A 4KUZH 1SXAA 2LQRA 3VUAA 1HC1A 3UL4A 3WJMB 5C2UB 1WE5A 4NS0A 3D9AH 2Q7YB 2XKNB 3U9WA 4DEUA 1K8IB 2UVEA 4RGNC 2EAEA 3MJ9A 2X4NA 1K4DB 4KMTH 1A4CA 1KGJA 4LP8A 4PI0A 1YA5A 4X5XA 3RIFF 4JG9A 1AXTH 3BIKB 3SDDD 4AQ1A 4DGWC 5C97A 2RB8A 2BSDA 4GO8A 1FF5A 2EYTB 2B3IA 2XJLA 4KY2A 3MV8B 1OK0A 3JXAA 1R5WA 3QEUB 4ICXA 4RRPM 2CU9A 5DZPA 1MREL 5EUOE 4AUJA 4KO9A 4BKLA 1E90A 1NCCH 3I3BA 5DRZB 4YHMH 2WLIB 1JFHA 3B2PA 5HHQB 5F9WC 5KYXB 4U1IB 1H8OA 2CA4A 2ZUSA 5I2IB 2R0KH 3SGEI 4D0BB 5EZPA 2GSMB 3ZRCC 1LGVA 1FFOB 4XBPB 4EUPH 5HVHC 1KCVL 3OZLA 3STLB 1CE1L 3NH7L 1JPSL 1A7OH 1DVXA 2B1HL 3IM1A 3PDOB 2I9LA 5F7MC 5T3ZH 3UZEC 2APSA 4N3TA 4PJ5E 1L5GA 1ZK5A 4EI5C 2XG4A 1KDJA 4ZMNA 1BYOA 4YAQA 1V7NL 3LPWA 3BAKA 4Y5XC 4JQIL 4K55A 3X1BA 4DZ8A 4PWHA 1XX9C 5F9WB 5E9AA 3H85A 2P9RA 1D5RA 4Z7QF 2I07B 5KANI 2AVFA 4WO4A 1HWWA 4UTAL 4JFYA 4KRPD 1QO3B 1H3XA 3UBXB 4BKTC 3VWJA 2WIIB 2JB5L 4EKJA 3Q5TA 1BM3H 3DBXB 1OV8A 1MW1A 2HTKD 4H0GA 5C09D 3UJJL 2PCFA 2PYEE 4Z7WE 4K7FA 4LSRL 2NUPA 1HXYA 1M3IA 3DSFL 4YHPB 1OAKL 3KH4A 5FM5O 2WO3B 3M1BA 4Q6YA 3OKDA 3MZTA 5IKCA 4RGNB 3FO2B 2E4FA 1XEDA 2FEEI 1B0IA 2DQEH 1D5IH 3D3VD 4NSKB 2Q6WA 4E41A 3NGBC 4ZUWA 4NKOA 1LEKA 3V8OA 1QLEH 4GS7B 2AJYH 3Q3GB 2VLKE 5E6YA 5JPNA 4ZFGL 4PW4A 3MV7D 1YDPA 5F8QC 5IHLB 1A2YA 4IRZA 1O7DC 4V33A 1K5NB 4R96A 3WV0A 3M86A 5FECA 1T21A 4YZWA 3O4OC 4B9FA 1L9SA 2R1YA 2IBGA 2VN6A 3KGRA 4PRDB 5TQ0L 3UCRA 3MXVH 1CBVH 1TMQA 4W93A 4P5MA 1F3JB 2AJVH 2ZAIA 1SQ2N 2KDYA 2DH2A 3LDBC 32C2B 5AYQA 3DRTA 3IJYA 3LIZL 4QHMA 4DHLA 5DSCA 5E99H 1RU9L 4MXQC 4UUJA 5GS2D 4H5SA 4H8WL 4OGYH 3X12A 2VKXA 4MZRA 1JGLH 1YEKH 3AG2B 1QNZH 3UTTA 2VSDA 5KSBA 4YQXL 5IQ7L 2NY0C 1G7PB 1Z9SB 2JXMB 3DV4B 4Y5XB 2FX7L 2EDBA 1WFJA 1YLBB 2D7OA 3CMOL 3FT3A 4LKCB 5D7LE 3V0IA 5CCGE 4ZMAT 3MO1B 2OMUB 4K4KA 4ZO7A 1P4LA 4IJTA 2WP3O 2H5UA 2J21A 1U8JB 3GZOA 4J4PC 1A7OL 4ZUUA 3IN0A 4DZBA 2ODHA 1Z0MA 3SHSA 3EJYC 4MA7L 3C6SA 5AQ0A 1EH9A 5IR1B 1XDTT 2F53D 3RHWK 4QTFA 5I1DB 4H1LH 4QPEA 1KBVA 3AXLA 2ADGA 2X5PA 3GMNB 2DWSA 4WEBH 1F11A 4Y4FD 4G11A 2ZCHH 4PRHD 2BWDA 2X4PB 3BIAX 4WJ5A 4TN9A 1OT4A 4QYOA 3B83A 4GRLA 3MJ9L 2HJFB 3AXHA 3FTWA 4WDIB 1QQDA 1ZA3B 2B15A 1IBYA 3BQUC 3KHOA 1IGIH 3MLTB 3HR6A 3EG9A 3SDAA 1K3ZA 5JHDE 3G04A 4MD5A 3V5HB 4R83A 1I8KB 4GFTB 2PCPA 3VI4B 3GSXA 1TQBB 3O6MH 3HRPA 2QR0B 3ULUH 4DGVL 1G7LA 4YPGB 4TSAL 4QRPE 2L3BA 2X4NB 1DVSA 2O61B 43CAB 1KIQB 4BCYA 3DJSA 1ZGLP 4APQC 4XVJH 2YAEA 4BEIA 5JHDD 4WW1B 2A4EA 2N01B 4HGKC 3G6AA 3D85A 4MCYA 3KXFE 2FX8L 5DJ2A 3ULVC 1AI1H 1R1CA 1DBBH 1UXWB 3DMMD 4N26A 5GGSA 3VH8B 5E9DB 1SNRA 2W5PA 4GKSA 4P04A 4A6YA 3QZPA 5HYJB 3DPDA 4K5OA 3U1SH 2JI2A 3FU0A 4H20L 5I6XC 2CR6A 2FB4L 2CHZA 4R5TA 1TVHA 5FW7A 2WK2A 3ILDA 4F7KA 3ZKMC 1ES0A 3C2SA 1EJFA 3ECBB 4JM0A 1SVCP 5E0QA 1BX2B 2OR9L 4B5ZA 4ZFFA 1ULVA 3FW6A 3VQ1C 1BIIB 3V55A 4JG1H 4XOCA 2HRHA 1A4AA 1XF5B 2YGOA 1YY9D 2VDNH 2ZSVA 4FTVB 1YVLA 4IKLA 4L0YA 4NM4H 4DGIH 1EHXA 2N1KA 3WEOA 2LV4A 1CIUA 3GMQA 3BYTA 3B3IB 3HAEB 4OTXL 3V4VA 4EN2A 3QZOA 1DBBL 2CMRL 4XPGH 4BFGA 1EDQA 4AUYA 2I60H 1E27A 3QZNA 1NIDA 4K23L 5FM4A 1UUNA 1E6JH 3BJLA 3A47A 5I17A 4FL4C 2JKJA 3IDXH 3V8CA 4M5TA 1EPFA 4OCRL 3CFKA 3HMXA 4QCIB 5CJOL 5DTFA 2K4WA 1ED3B 4NT6A 1ZSDB 5F9OH 2Q87A 1I1AA 3NIGB 4UQIM 2IG2H 2L0DA 2QPDB 2FBOJ 2P5ED 3OXRA 4Y4FA 3T4AC 3HB3C 4M6MH 1RQ5A 3PABA 2O5NA 4EIUA 4F8NA 2MQCA 4KQ0A 2FT8A 3FTSA 4LCCB 2QJDA 1SLXA 2NUPB 2EE2A 4JREC 5FYLD 4N2NA 5CP7B 4MMZC 2ZONA 4XPAL 4L23A 4M6OL 2XKSA 3LXBA 3SDDA 3IBOA 3FRPB 1E4WH 3G5YA 3RWCB 2ZE0A 1DLHA 1E6OH 4O5LL 4L8CB 1CGTA 5EA0L 1GZQA 1UCBH 3CE1A 3EJSA 4G43B 1JZ2A 1GGIH 3PXJA 4LHUD 1X4ZA 2GJ6A 2ROXA 1PF3A 4P3CL 1OZTG 3CLFL 1QMUA 5AVTB 3K1KC 1T7ZA 1BD2A 5D1XA 2VRQA 5J6HA 3OG4B 3CWGA 3DMMA 4PJAE 5CR1A 2UWEF 3TO4A 4G9FB 2DLIA 3BWUC 1BIIA 3BWZA 3LKNA 1WVZA 2IAND 4UIMB 5E95B 4P23D 1S7QB 3BMVA 3RWIA 4Y19A 2N4IA 5D1QD 2BHUA 3OAUH 3QEHB 3MNZA 4YSEA 3SBQA 3LV3A 5IB5B 1U3HD 3NSYA 2Y07H 1Z5LA 4GUCA 5F1NB 4ODSH 1Z32X 5KS9E 5EU5A 5DJZA 1A66A 5EG6C 1R3JA 4E9YA 1U3ZA 3H2WA 3R1GL 3CSYB 2DYPA 4RQQB 5DUJA 3D85B 3KPRE 4MCYB 1KCRL 4HW6A 1A22B 5FA4A 2HX7A 2ICWJ 4KDTA 5LUMA 1M7DA 3D25B 3IDIB 3NCXA 4MXQD 2CDEA 4Y4KC 2XFXA 3OB8A 3ZR6A 1Y6MR 3LH8A 3WDHA 4Z7UA 4OH2A 3B9KD 2AJSH 4Y5VB 2GT9A 5AL0A 1GYVA 5JO5B 2EC8A 4HS3B 1CICA 3HVDA 4M7JH 3DKHA 1CDIA 4LLMB 5HPMA 2LLGA 5G5DB 1UFGA 5CEZL 2W65A 1LILA 5AOLA 4FQQB 5EU3B 3BAJA 1UQSA 1ECYA 3CFEA 3SCMD 4U1NA 3K6NA 4Z3IA 3N0PB 4F92B 4ODHL 3FO9A 1MG2C 5IQLA 4HCFA 3S35X 5T1LA 2L8AA 3V0FA 2AABL 2OJZH 2Z8RA 2DQHH 1MFVA 2VIRB 1RPUA 4UOJA 4JY4A 5I74B 5L2KE 4XCEB 3L9EA 5E1AB 4YEEA 3ZUNC 2IVFC 3WLWD 1HKLL 4AKOA 1MY5A 4MYPA 4BZ2A 5F21B 3FB8A 5GGVL 1FNEB 2ZYHA 4ZG1A 4XNUH 4AM0A 1A7BA 1B3JA 4P5KA 1TNNA 3I3EA 4ORZC 3F8UB 3QHTC 3C5SA 2CALA 3NMEA 5IBTH 4WK2B 5E2TL 1I1FA 3TWCL 4LAQH 3MRJB 3T0EC 1S5HA 1Z5YD 1A3RL 3TESA 2DTSA 5EC2A 3OKNB 1KNOA 4IBTA 1W80A 3BPLB 4AGNA 3JTBA 3GKWH 5ITFA 4EQ2A 4KH2A 4GQPH 4HD5A 5F1OB 5IF0B 4TL5A 5D5MF 3GLEA 1VERA 3JV6B 4GUQA 2DWYA 2CUAA 1E4WL 2PP9A 3LRHA 2XZCH 3LCYA 4HJJL 3FO9B 3OXSB 1P4IL 3W82A 4AMXA 2ERJB 4J3OD 4KNQA 2FWOA 1IT9L 5D7SL 1IGTA 3HG4A 4M3JA 2FUTA 5TPWH 4M1DL 2PCYA 2FNBA 4PJGB 5DJAB 4X7TA 4D9RE 4F37K 1KB5A 2CGZA 3MRQB 3H42H 1EZVY 1ZT4A 3WIHA 1ZV9A 2WBJA 3NTCL 3OZ9H 5J12C 1QTSA 3L4CA 2NY2C 3TXAA 2BSSA 3VG9C 5A2IH 2FSDA 3LDBB 2D9QB 4HS6B 5SX5K 4ZFFB 4Z7UB 2XKUA 3B2XA 3DMMC 5T3ZD 5I8KH 2OMVB 1T83A 4G6KL 5I1HL 4YFDB 3ULVE 5GS1B 5KG9A 1XTLA 4KUCD 1MLBA 3BSZH 2W81C 4JM4H 3U6RB 3ZK0A 4F7TA 3B5GA 2VITB 3L4WA 3DUHA 1R3HB 5E23A 4EBQL 3GSOA 2FJHA 4AI7A 4LF3A 4XN4A 3T1FB 5CJXC 2Z31D 3O4LD 1MRFH 3KAAA 3UG5A 3M8OL 3BW9A 4L1SA 3TBVB 3CLEL 2CBTA 4CSTA 3GHEH 1EUTA 3HNTL 4PJ9B 2ZP9A 1I7TA 1LYQA 5ICZB 5IEKA 3AGWA 2V4LA 1HEJC 5F88B 4H4NA 1JZEA 3VFTA 1FVDA 5DVOA 1KTDB 5I76B 1RERA 1DO6A 2CIKB 3U4EB 2R59A 1MDAA 1MUJB 1T1WB 3VTMA 1B2WH 2DIEA 1D5IL 5HPMB 4EZLA 2ZYRA 3KLHD 1NBQA 2V37A 2RR3A 1UD4A 3QDHA 2FHBA 2MHAA 1G9NL 3HI1A 3CDZB 2JXMA 4C4BA 2XQBL 5J57B 3OMAB 5EU6A 3GLAA 4FTVE 1BZQK 4UQDA 3KZ8A 4WU7A 1NKOA 4MNQD 1VGKB 2H2PD 4ZUSA 1GS8A 3M7OA 1OD7A 1EQWA 1T22B 1BDYA 5IMLB 2OS7A 4MBOA 3B8YA 2A83B 2R29A 3CC1A 2J1XA 3EH2A 5IJCC 3O0RH 1QWHA 4U1KA 5MEPA 1AKJD 1ORSA 3CPLA 5AW4B 3QQ9C 4GW5A 4JPQA 5E8DH 5F71A 3EH3B 4LT7A 3LHAA 5E9DE 3UPCA 1DFBH 4WV1B 1EXUA 4MBRA 4N0YH 4P3WA 5CBEB 5HDWA 3D06A 5FYKL 4EXPX 3F01A 3LIZH 3VWKB 4YBLC 3STBA 1RZIB 3LKNB 2DKMA 3LHPH 5C0ND 1ZLUK 1Z3RA 1D5BB 1EJOL 3A4FA 1LE5B 1IL1B 1IGYB 2J6EH 5FLUA 5C0AD 3SGKA 1N70A 4M1GL 1FI8C 4XZUB 2V3EA 1MJ7H 3S8WA 3GI8H 1XGPA 5EO0B 1AKPA 5KN5A 4FKEA 4NLHA 3KYAA 4PTTA 3WMSA 4NQCD 5ACZA 1FNGB 1BF5A 2PCXA 4JRYE 2AP2A 4N0YL 4Y9FA 5FUOL 2AJUL 3MUY1 3OSKA 2VL4A 3GIZH 5FUCC 4IJ3B 1E9QB 4JRFA 2ZPKL 1MLCB 4M5YH 2DYSB 2F5AH 3NTCH 3OZ9L 3QHZL 2KHAA 4HJGA 1U8HA 4NQCE 3VGGA 3Q01A 1RZKH 2PXYC 4JO8A 3UTZB 4LHUG 3V4PL 4RSVA 1EVTC 2E7LA 3SDYL 1H9DA 2ENQA 5EV7A 1PZ2A 3AB0C 1QBLH 5HJ3B 4NP4H 1G1KA 3LZFL 1JHKL 4YIQB 3DPBA 1HL8A 1YDPB 3QE5A 4PJHF 4TQEH 2AF2A 4P46A 3ZTCC 3BUPA 4QXTB 1J7VR 3P4LA 4E9QA 4F7PA 3HE6C 3S9DB 3QR0A 5GGSB 4LCVA 4MJIE 2HLFC 2DMGA 1G6VK 1RUMH 4FQ2H 1OWRM 3LNIA 1KELL 4L3AA 5E5RB 5FDWA 2YSSA 2YK1H 4BDVB 4GMSL 1UM6L 2WBXA 1DLFH 2ZKHH 3CAFA 1NC2A 2C1PA 3HR5B 5H2BA 3VWKA 1HIML 4HWBL 4PJDF 2QPEB 4ABQA 2J4WL 1X7QB 4PV9B 4ZMYA 1SXCA 3JTTB 4FYRA 1M2OA 3VFPB 5A2KH 1WS8A 1XF5A 1BD2D 3E6HA 4UQ9A 1NL0L 2D7MA 2FEDD 3F6LA 1DJIA 4JFSA 4UOQA 1HZKA 4HK3N 1L6PA 5E1GA 4KJYA 1UZGA 4HZLB 3MUHL 4NUJB 4KI5D 1QPPA 1JSYA 1A47A 5CILH 1QZNA 4L9LC 2NY3D 5K9JL 1HL4A 2TSAA 4F1SA 5CGTA 3RIFK 2WLMA 2QV4A 1ROCA 1TTFA 2Z93B 4B5EA 1AGCB 4CMHC 4O58L 4EI6A 1C5BL 4JFVA 5EC1A 4XXWC 5HP5A 5TDNB 2H47C 1EFXB 3ISWA 3UTOA 4WNSA 2P24A 1F18A 4Z7NF 2MOVA 1QVOA 1R3KA 4U1MB 1P5UB 3P4MB 2I7OA 4G8GE 1TZGL 3VMNA 1DBML 5D7JB 1WC7B 5F88A 5BRZE 3ZMRA 2WYTA 1B0RB 3K8KA 3MX0B 5EWIH 1N19A 3TVMA 4I1NB 1UWFA 2OMXB 4KK8D 4PP1D 3ZGHA 2NYYC 3IJSB 1WEJL 1CICD 2V7HA 4MKMA 3ZT7A 3T0WA 5I17B 5BZWA 3ARGA 3AREC 5C0BA 2WLIA 3S3PA 1AGCA 1AYOA 1ICTA 1MI5E 5GRWA 5JHDB 1OOAA 3L5HA 5EZIH 3EF7A 5DD1L 5IIEA 5KWYC 2Q76A 4OIIL 4YDMA 5J1SC 3MBEC 3OKEA 5D72L 4PGCB 2J88H 1NDGA 1A4JA 5ECJE 2AFNA 2J8HA 4OZHF 1SJMA 1XGRA 1ZOXA 5E9DD 4OCLC 1J1XL 3O0LA 4ABWA 4JFQA 2Q2EB 2BOCA 4L5FL 4PJ6A 4Z5RA 4AIOA 4HOWA 2UY7A 3W2DL 3FFDA 5H37A 4LEXL 3HZKB 3L3IB 4OIFA 5F1SA 1S7UB 3ZDWA 3U48A 1IMHC 1FE8H 4GMTH 1ZIBA 2IPKA 5DVPA 3WXWH 3RVTD 1J88A 1UD8A 5LCVL 4NOFA 3WJLC 3PGFL 4MA3A 5F7KC 2BNQE 3ULSA 3MRFA 1G9MC 2FBJL 2YC1A 1H6UA 2QVKA 5C0GA 4K3HA 3AQYA 2Y1AA 5FV1L 4LLVB 5TQ2L 3C08L 3MJ6A 2VMCA 5JPMA 2GBVA 4ILDA 1XL6A 3PRZA 1WWWX 3PFQA 1VCAA 1AXSB 3DGGB 4NZRH 1KLUB 1MQKL 2VDRL 4WU5B 2KPNA 1RZPA 1M53A 3IFNH 5EA0H 4JFWA 2G5BB 5BXFA 3KPMA 5IUCA 5DJYB 2UZPA 4J5VA 1TIUA 1XF3A 5IESL 1ZVNA 3RUGA 5DZJA 2PO6C 4U0QB 1FGNH 3SYAA 1IARB 4QYOB 4Z77B 4A2EA 3VSQA 3RGVD 4OZHE 1QD0A 2D9CA 4Q7DA 2N1TE 5IBLD 1AG6A 1LO3H 3QIUA 4Z76A 1UZ6E 4P46C 4QXGL 4WGWB 5F0JB 4EZJA 5HVWA 1SF3A 5T1DH 2Z31A 4IMKA 5CIPB 3FB6A 1CGSL 3BAEL 2WKOF 3QJFB 2BHYA 3MLSH 3SDCD 4C8XA 5A40E 1X6LA 1GW6A 4HJ0D 5DHDA 2HUEA 1NEZB 3ABGA 1UUSA 2R2EB 4Q2ZA 4ZUVA 3MRRB 4ELKA 4JFFA 2OKMA 2HKFH 3TVMC 1RZ8A 3B2MA 3VACA 3AM8A 1T3FB 2GHWB 1EZLA 3HC3L 1D7BA 4WF7A 3QNXA 5CZXC 4JHWH 4P46B 5HHVH 2E8YA 3CXDH 2F1AA 2YXWA 2BVUA 5CP3A 5D4HA 1RULL 2YMXH 2ZSWA 5J6GB 5C7XH 5T1JA 1ZPUA 4UIMA 1M9SA 4POYA 3QNYB 3WL9A 4M9OA 2ITDB 5E8OA 4YHZL 4OT1L 4HZ1A 5EEXA 1CL7H 4MTMA 5F7FA 2NMSA 3HNTH 2ZZUT 3W38A 3LEYH 2JTYA 1IKFL 1NDMB 3KPLA 2VABA 3BSHA 2I9LB 3HS9A 3JWDL 2IH8A 1JK9A 4PWKA 3AT0A 5IBUB 3W2DH 5C09A 3HAEG 1OAQH 1ZT7B 5AG8A 5KN5B 2YPLB 1NAMA 4YXLL 1FBIL 1A3LL 3VXTB 4DK3A 1JRHI 2EP6A 1J0KA 1ZHKB 4R2GC 1NANH 1OHZA 5IB1B 5F89A 1MWAA 1GZHA 3HNVL 3FS9A 5IR1A 2F9BT 3JVGC 5C08A 4KKNA 3T09A 1C08B 3O3AB 4PLKC 1GS6X 2ADIA 4Y5YB 1IC5L 1GPOH 4JZJC 3KEHA 1TZIA 3H9SE 2Y3AA 5IQNA 4LSTL 3BE1L 1BWWA 2AKRB 1R24A 3I50L 3PP4H 4H7VA 4P2RE 3E3QE 2OMVA 5IW6B 2G5BA 1CFNA 3SY0A 3QIUD 3QDMD 4OZ4B 3RQ3A 2X53A 4JUSA 2AQ3A 3D0VA 1E9QA 3FN9A 4HGWB 1FZJB 5IQ9B 5JPMB 3BWAB 2P52A 1NIEA 1MCOH 3QNFA 5FUCE 1RZQA 3IXTB 2PW1B 3LSOB 2EYSA 3OQRA 3QS2A 5HHOE 2QEJA 4LCYA 1RZ7L 3MNVA 5BQ7B 3RL1B 1T89A 3TH4T 1HWGB 3AT9A 3KWUA 3EJJX 4MQSB 1CXKA 1UH3A 3KPPA 4WCYH 2H3NA 3SDXF 4JY5H 1MCQA 4ZMOA 1M3JA 4WK0B 2VZOA 1IL1A 3T9WA 4ZDHB 1IM9B 4HUWB 2PR4L 4X6DE 5TQ0H 3RAJL 1JYXA 1NQBA 5CN1A 2EDJA 4JFDB 4JO3H 4OAWB 3ZR5A 5AYUH 1XFPA 2WKLA 3V0AC 4XNZB 1O5DT 3ECBA 3RWFB 2ARJQ 3VB8A 3MV7B 5FYJH 4J4PA 2D7TH 3WSQH 4F7MA 6FABL 3MUGA 2V2TA 4BFIB 1AS8A 1PCSA 5I0WA 1XR9B 35C8L 2EC9T 1MFAH 4HSQA 4PG9B 3KLKA 5CJ5A 4GT7A 1EVUA 4CVZA 2PKDA 5D4JA 1WAEA 3VH8A 3GDBA 4HHAB 2Q3AA 4JRXB 5DS8A 5AZEH 4IRJB 3DETD 1XBDA 4WHTB 1RZFL 2A6JB 2VDOH 3STZA 1OWWA 3FUIA 4AIZB 3QP3A 4WUUA 4HU2A 1DE4B 5AOMA 2YD6A 5F7LB 4BUQA 2FJFB 5C2BH 4YH6A 4TRPH 1BZ7A 4B0MM 4GQ9L 4FFZA 4H25B 3TBSA 1WICA 3QR2A 4GSQA 2AS5M 1CICB 4XN9A 1HHHA 2JB5H 5JO5A 1QABA 3TVMB 1XCTA 4RETB 3LN4B 1X5HA 2P49B 2A9NH 1DEDA 2GIMA 1LK2B 1P53A 1AZZC 2C9QA 1N6VA 2B1OA 1I9RL 2BDNH 4MRCA 5EOTB 3BGAA 5AUMB 4TL4A 4DEPC 4NYLB 3FQTA 4GQZA 4DN3L 2G0LA 4LAJH 3G5XB 3WXVH 5J1AB 1JBJA 1X6NA 1NL0H 2A6KB 2E56A 4FG4A 5DK3A 5CM1A 1CXLA 1N0XL 5DWUL 1G1OA 1PFOA 2AQ2A 4HIHB 2KL6A 2R8SH 3N91A 1PZAA 1JRHL 5HYJD 5I1JL 3WYRA 1KIUA 2BNRA 4M43L 5DRXA 4R97C 4TNVK 4WK4B 2GTZB 1OGTA 1SVZA 5HHXL 4ADGA 2O4EA 2DIJA 2YRLA 4JO4H 4AYID 3EOAA 4CVXB 3BLBA 3RU8H 1AHMA 5LXVA 3LZFH 3RBSA 4S0HA 4X8XA 2F19H 4DVRH 4XMXA 3OF6A 1KGXA 1WK0A 1YZZA 5FB8A 5KANG 3C8KB 2R4SL 4A68A 5CJQH 4IGBC 1CE6B 2UWEA 5ICUA 4G6AD 4L3CB 3H7BA 4CKQA 2YBGA 4P4KA 5JDJA 1JE6A 5FC9A 5I19H 4HCRH 3O4LE 2PLTA 4UDUA 5DHXB 1W72L 1AHWA 1XBRA 4EKXA 4PJ5A 3IFPA 3NRPA 3VRJB 2OR7A 4X6EB 2D03H 4NN7B 4LVOB 4EZMA 5K39A 3VD4A 4G9DB 4LLMA 4KITB 1QFOA 1PS3A 1M1SA 4MA8L 6PAZA 1KJ2B 1EHKB 1IGJA 3ES6A 2WNGA 4YE4H 2P5EB 3RA7L 4JZOA 4JO3L 1TXKA 4QNPF 2YFNA 4Z0BH 5B1KA 3ZDYB 2MKLC 4RAHA 4LNRA 4XODA 4BCZA 4BE5A 3FFCA 2VDQL 1DDTA 3S37X 1WISA 4PLJC 5I82A 3SQOH 1AQKH 4QO1A 1PJ9A 5I19L 5JPNB 5SV4A 1SYVB 5HY9B 4KDWA 4ZXBA 2R7EA 3NIDE 4NRZB 3DOIA 3U30C 1XSJA 1F6LL 1NAMB 1PEWA 2UV3A 4WUKH 2JQAA 3JWOL 2FZ3A 3MGOA 1M9WA 4OLZH 1UKSA 4QHKI 3FBKA 4DKTA 4HOXA 1PZ5B 4IBSA 4MMYA 1OSPL 2BS8A 5L4FA 4QXVA 1UVQB 3OB0K 1AJ7L 3AU1A 5EBWB 2GT9B 3PWLB 2RFXA 3GBMH 4TQPA 2F8VA 3MBEB 2XDHA 4UM9D 5K93A 4BFFA 1QO3A 3BKJL 4W1TA 1F0LA 4PRAA 2IDCA 2K6WA 1YQVL 3JVFC 2IC2A 3D69B 4H1LB 3K6SA 4XXWA 2H45A 2BCKA 4H0IA 1KYUA 1EAQA 3TZVB 4JRYB 4JX0A 3JUYA 4F8OA 3M1CA 3ATBA 3MYJB 1ZIAA 2A74B 2EEDA 3FRPA 1DO5A 1XH2A 3KL5A 3CLEH 3EGDB 4HKBA 3INUH 4K94H 4X6FB 3V7AG 4M61A 1F4XL 4PJEF 3IDNB 4TUOA 3KNBA 1HQ4A 1JRHH 2F1BA 1NGYB 3E6FB 2K8QA 2LFGA 3IDGA 3RWIB 5KYUB 1ZHNB 2BM3A 2AW2A 3AXIA 2W1NA 2WUBH 3LMJL 2DB8A 3BUYA 4L3CA 4N28A 3K4AA 3KCWA 3P0YH 2PABA 3ZTJG 1YJDC 2NCEA 2JB6B 1YMHA 2R4SH 2M26A 2X4UB 3FQ2A 4UNTA 1U91A 5I2IA 3G5VB 3S3BB 1AO7A 1E7VA 2DQTL 2DQ6A 3AGVA 1NGPH 3ZIYA 4LBEB 3ZDZE 1S9WB 4IKJA 3U1QA 1ASOA 1WG3A 2VLME 4XPGL 1F4YH 2IANB 3KCPA 1E28B 4RNRA 4L8CA 2RACA 3V95A 1BAFL 1DBKL 1XAUA 4K9EL 4K7PL 3L3OA 2VW7A 1N8ZB 3PWPA 4JO1H 2VZTA 2NCMA 4NWTH 1U36A 3DARA 2YR3A 5D96B 1R34A 3VI4F 2QQNL 5FEBA 1I3GH 1CXIA 3P0YL 3ARUA 1BXAA 3ULUF 1FVEB 5B38B 5IVXA 2CPCA 4WQOA 2ATKB 5E00B 3WXWL 1L0PA 3L9RA 4KU1A 4XCYB 2HSIA 1XCTB 2P43B 4FXTA 3DX7B 1EXHA 1NCBL 3OGCB 5E5MA 3TJPA 3HZMA 2EDLA 2DDQL 2FBJH 1ZHBB 1UB6B 4QAWA 4HWBA 2J1ZA 3MLYH 4N5ED 3OKOA 2ESVE 5CHNA 5J12B 3TLRA 3KPPB 4XPBL 5D7IA 1IBZA 1IGTB 2G3ZA 4WNQB 3GRGA 3Q13A 5CCJA 4ZFQA 1GCYA 3TEXA 5ISZD 1I8MB 1WZKA 1U93A 3MLSL 3HBPA 2YOAA 1F3RB 4WW1A 3BP6A 2XACC 3OX8A 1LWJA 3IFNL 2OP4L 5KYYA 3M8OH 4HWZA 5SWZD 4GBXB 3UIYA 2IH3B 32C2A 3F7YA 4MMXC 3ZTJH 2ENPA 2PN5A 1R5VA 2GVYA 2VQ1B 1H3VA 5IT2L 4Y4KD 3DC0A 2ATKA 3MLTA 5E00A 3HN3A 3GKZA 4DF9A 4PJDA 1OAZH 3PHAA 4G8FB 2LU4A 3VM5A 4QHUB 1A6VL 3PWJB 4YUEL 3O3AA 3HMXH 4M8QA 5F7NC 3FXIC 3O2WL 5ECGA 3QA3A 4WJ5B 1TFPA 3QUZC 4MMZA 1ZA6B 1BEYL 5FYKU 3VAEA 3VXTA 2PWFA 2BZCA 1P7QD 3GMOB 2ZICA 5E94A 1QPXA 3MKKA 4NCC1 1K8DB 4ANKA 2WTRA 1CFQB 2IGFL 4J6RH 5DI8B 4GKZA 5DMYA 3P02A 3R06B 4XP5H 3RFRA 4W9ZA 3DSNB 1NCAL 5DWPA 2CGYA 3SCMA 4RZKA 25C8L 1EZVX 3HTLX 2JFCA 2PW1A 2WMPA 3LSOA 3GHBH 5IWLA 3E9UA 3SIKA 1KTRL 3CFCH 3FF7A 5BVPH 1YMHB 1K5WA 4WTZA 3CMOH 2Z3FA 1A65A 1AOHA 3S5ZA 1E4KA 1T1YB 3UYPB 3HFMH 4BSWA 2DD8H 2UYLB 2CDFB 4YSUA 1TMCB 3RJQB 2E6JA 4N22A 2HTLD 3QQNA 1IAIH 4OZGE 4HPYL 2HJFA 1E3FA 3EYUL 3KL3A 1NGPL 4NQEE 3SDCB 1IC5H 5GISL 4OT1H 1EZUA 2BIIA 5FKAA 1MJ7L 1R3LA 4BK8A 4RRPG 2DWDB 1AY1L 2OZ4L 5LGKA 2Y36L 1X7TA 4UM8A 1KCUL 4IIQC 4PJHE 4AUUA 5KOVC 4PG9A 4X7CC 4OLWH 4ZUVB 2BNUA 4ELKB 5I0DA 3SKJL 3SPCA 1XF4A 3QUHA 4W9HC 1FDLH 1Y07A 1JK9B 5EZLA 5AAMA 2D31A 2L04A 4Q4EA 1M2VA 2FL5B 5JNYA 1A6AB 3Q3GA 2DLFH 3T3MF 1ZCRA 1GZHC 3CCHA 2VSMB 2JJWA 4J3WA 4Y2OA 4GI6A 2H0EA 3KYMA 2RMNA 3VXRB 3FRPG 1SEBA 1YJDH 2E59A 3G08A 1CFTA 3MJ8A 4MSWA 5B3JF 1BA9A 4XI5D 1SHSA 1SBBA 1E4HA 5KSAC 2J88L 1NTDA 2KQNA 4JJ5B 3WUWA 4F33A 3G5YB 3RWCA 2N59A 4U3SA 1A9BB 4NDMA 3CDGA 3D4CA 4JJOA 1QTYT 4PRBB 3GJEB 2EDNA 5F0MB 3VXUB 2SEBB 1AXSA 1XL4A 3BIKA 3W57A 3S7GA 4EIZC 5HYSG 5CP7A 2VUOA 1XB6A 4YFLI 5IB3A 3FTUA 3NJMA 2N7AA 4O4YL 2AMGA 5CGMA 4XGZA 1UB5B 2I07A 4NHUB 3CN1A 2QT6A 3R4DA 3HRZB 3II3A 3QUYB 5FK9B 3VTTA 4AV0A 1G4RA 3MOAL 5F70A 3WUWG 1LE9A 2F8XC 3NIDF 4DQAA 3B37A 3OAZH 5JW3L 5IMKB 3FUMA 2FR4B 4ISVA 1WO2A 2IQAB 2W60A 2AJUH 1A1NA 1PG7W 2GUYA 3QA3B 3IWUA 4OLUH 1FHNA 1A6UH 2AXWA 3NZ8B 4R0LA 4L18A 3FJTA 2V5MA 3ZDXE 2HKHH 1T6VN 4OCNC 4ZOAA 4DVBA 3B3IA 1D3CA 2MCPH 4NZUH 4ZMVA 4LPVA 4Y89A 3WEXA 4C58B 4YNYA 4L8DA 2YQ2A 1WQVT 3IKCB 2ZUVA 5D1XD 1BVKA 1AMXA 1K2DB 4MAYC 2V5TA 4NENB 3OD3A 3QORD 1T0NB 4P2QE 5KYXA 2VLKD 5L9DL 1N5YH 1R3LB 3WY3A 2NY3B 4AGLA 1BJ1J 3HPLA 3LVTA 4G6FD 1CK0L 4DO5A 4XI5C 4YSQA 1OPGH 1EUUA 1M71A 2WKOA 3NCFB 1J5OH 3NZHH 1A6UL 3K80A 1HHGB 4O02A 3DDGA 1FFPA 3PJNA 4PRPB 1TZAA 1D9KB 2K6ZA 4A37A 3T3PB 2K6YA 5C0EA 3MJWA 1G6RL 2ZAGA 5FGCB 4YXHH 5DMGC 2A6IA 3GZQA 4PJHA 4OD1L 2HT4D 1GYCA