3UGEA

Silver metallated pseudomonas aeruginosa azurin at 1.70 a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Silver Metallation of Pseudomonas aeruginosa Azurin
rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ugeA00
4YSQA 1JZHA 1AR1B 1E67A 2UXFA 1RCYA 3CDZB 2AZUA 1I53A 3RYMA 4FA7B 1BXAA 2YXWA 4BWUA 1BQKA 3CVCA 4E9WA 2IAAC 4RH4A 1JZFA 1FA4A 2GBAA 4N8UA 2XWZA 3N2JA 2W88A 1ETJA 3KW8A 4W9ZA 2CALA 2UXGA 1V55B 1ASQA 2FQFA 3X1GA 5I5IA 5PCYA 3AW5A 3NP3A 2VN3A 2ZONA 3X2QB 1KBVA 3QJRB 1PZCA 3CG8A 2Y1AA 1KYAA 2JKWA 4DP8X 2AZAA 6PAZA 1A4CA 1GSKA 1AANA 3WI9A 1ZIAA 2CBPA 1EZLA 4G70B 3IE9A 2XV3A 1AS7A 4DPBX 3QPKA 2IWFA 3S3DB 4L0PB 3AG3B 3FSZA 1AZUA 3NJGA 4JKNA 4BXSV 1OE1A 3NSYA 2UX6A 3MBWB 3NSFA 1JERA 2BW4A 4G7QB 1CC3A 1L9QA 1OE2A 3C75A 5I6MA 1E5YA 4YSDA 3TBBA 2VM4A 4E9QA 2CUAA 2QPDB 4AKPA 4E9TA 4E9VA 1A65A 2GIMA 2UXVA 1T5KA 4WTQA 2PCFA 4YSTA 1KDIA 1AZCA 5TK4A 3NJHA 3OQRA 2GB2A 4E9XA 1A8ZA 3SQRA 1W6WA 1IKOP 1OCZB 2ZOOA 3NYKA 2JXMA 4PAZA 4JHVA 4E9SA 4GP4B 2RACA 5AZUA 2XV0A 1ZIBA 4Q89A 1NIBA 2PP9A 2YAMA 3ABGA 1X9RA 3S3BB 5D4JA 4NERA 1BXVA 1JOIA 2FQGA 8PAZA 1CUOA 2IH9A 2GI0A 1BXUA 1PZAA 2YAEA 4DP6X 1N70A 2BW5A 1A4BA 2XV2A 4YSUA 1V10A 2W8CA 1NINA 3KW7A 3FSWA 1QHQA 5F7BA 3FT0A 1IBYA 1RZPA 3H4HA 1SF3A 5I6NA 3FQYA 2PCYA 2J56A 4KNUA 1L9TA 5ANHA 2CAKA 2QPEB 1QLEB 1SDDB 3FU9A 3PAZA 3FU7B 4X4KA 5B1JA 2J5WA 3PAVA 2FNWA 2YAPA 4HIPA 1SFHA 1MDAA 3FPYA 1UATA 2ZWNA 4KOBA 4P5SA 3ZDWA 2IDSA 4NAJA 1SNRA 4GP8B 2HLEB 4G7SB 2A3TA 3FYIB 2LLNA 2B08A 1AZRA 2VSKB 1RKRA 2PPFA 3T6WA 2I85A 2XX1A 5I6KA 1OCOB 2XXFA 2YXVA 1SF5A 2B3IA 3PCYA 1JZIA 1AQ8A 1GS7A 5EHFA 4BDVA 1M56B 2J57A 2XYBA 1CURA 2FTAA 2BP8A 3NJMA 1N68A 5I5JA 4GY4A 3WG7B 2R7EB 1J9TA 5B7MA 3ABKB 3U25A 2BO0A 3ABLB 2Q5BA 2ZXWB 4YVUA 1FFTB 2PPEA 2IDUA 4FAAB 7PAZA 2N0MA 2PPCA 3CDZA 3EH3B 3X1FA 3PPSA 3UGEA 3DKHA 1URIA 3QJQB 1KCWA 1SHXA 4YSOA 1GS8A 1E65A 1DZ0A 2Y69B 1GR7A 3HB3B 4KO5A 1NPJA 1J9SA 1WAEA 1AS8A 1KBWA 1TKWA 4YVNA 1OV8A 2YAQA 1KCBA 3UAEA 1J9RA 3TA4D 2FT7A 1ET5A 4BXVA 1NIDA 3WNJA 5I5MA 1MZYA 3V9CA 5B1KA 3WIAA 1GY2A 2H3XC 1KGYE 2PLTA 1GS6X 1SFDA 2GHZA 1E5ZA 3JT2A 3GYRA 3GXUB 3OD3A 4P5RA 3PAUA 5I6LA 3WKQA 5B7EA 1MZZA 1TEGA 3NJIA 4HHWA 4E9YA 4UANA 3AG2B 3OMIB 5I6OA 5LDUA 2JFCA 2HX8A 4AZUA 4HCIA 2XVBA 2I7OA 1JZJA 3NSDA 1J5CA 2EINB 4DP5X 1AG6A 1F56A 1PCSA 2H47C 4A2EA 2OJ1A 2WSDA 2BHFA 1OCRB 4CSZA 5D4IA 3ZBMA 1M9WA 1BYOA 4YL4A 4HAKA 2BP0B 1TEFA 2FT6A 2Q9OA 3IEAA 3S8GB 4BK5C 4N4YB 4A2GA 4QLWA 3QJUB 2AANA 2YAOA 1WS7A 4CSPA 2E86A 1ID2A 1GY1A 1RZQA 3BVDB 3PLYA 3SBPA 4HZ1A 4A2HA 1E30A 1AS6A 1TU2A 4A67A 5B3SB 1ET8A 1IBZA 2VW7A 1PNDA 1OOWA 4A2FA 3MX0B 2P80A 5B1BB 2UX7A 1SHWA 1GW0A 1W8EA 2TSBA 4YSPA 1BQ5A 3FS9A 4JHUA 3FU8A 2VM3A 3CVDA 4E9RA 2EIMB 3JTBA 1VLXA 4KNSA 4AI7A 4HHGA 3NSCA 1ASPA 5I28A 1FWXA 2QDWA 5AFAA 1ZV2A 1MG2C 1ZDQA 2HX7A 5FC9A 3UAAA 1ZPUA 3T71A 2NRDA 4PCYA 2GC4C 3FQ1A 1ET7A 1OCCB 2DY2A 3X1BA 3OMAB 4AKQA 1SDDA 5I26A 3T6XA 2PP8A 3FU7A 4UAHA 4YSEA 5AKRA 3S8FB 3OM3B 3QJSB 1CYWA 3FPXA 2OCCB 2WO2B 2HXAA 1JZGA 2DYRB 2VSMB 1WS8A 1JXFA 1PLAA 1HAUA 3L45A 2FJSA 4G7RB 4F7KA 2P80D 3TASA 1PY0A 3QQXA 3OMNB 1IUZA 4A68A 1L9OA 1CYXA 2OV0A 1HFUA 3PXLA 4K9JA 4TXVB 2XXGA 4DP1X 4DPCX 4DPAX 2IH8A 2DV6A 4YSRA 3T9WA 3CZUB 3X1EA 5TK2A 1W6LA 1ILSA 3T6VA 2YAHA 2GSMB 4GP5B 3ZX1A 2XUWA 1NIAA 1SJMA 2BWDA 4KO6A 3ZIYA 2R7EA 2BZCA 2TSAA 2HRGA 4F2FA 2EIKB 3EF4A 1AIZA 1L9SA 1NWOA 4KO9A 4A2DA 4DP9X 2VMJA 3NJNA 1AAJA 3EH4B 3EH5B 3ERXA 3AG1B 4YSSA 1KDJA 3UACA 1MG3C 1WA2X 3SBQA 4W1TA 9PCYA 2I7SA 3V9EA 4KNTA 2MRYA 2XX0A 2FQEA 1GYCA 1JZEA 2MTAA 4M4RB 1JVOA 3ASNB 2UXTA 3WKPA 1PNCA 1AOZA 4DP4X 2VW4A 4HALA 1PMYA 1OF0A 7PCYA 1BEXA 2PP7A 5B1AB 1XB3A 3NJLA 2XLLA 2H5UA 2IDTA 2IWEA 4BWTA 1ILUA 2YARA 1OE3A 4DP7X 1AZNA 3UABA 3HEIB 3DIVA 3NJFA 5B7FA 4F2EA 3S3CB 5A7EA 5IY5B 4KOCA 2EIJB 1J5DA 4G72B 2FT8A 3AY2A 2HRHA 3NJKA 1BYPA 1AG0A 3T6ZA 1YLBB 1M57B 1XMEB 6PCYA 2CCWA 3X1NA 3FYEB 1AACA 2J55A 2FQDA 1NIEA 3CVBA 2QT6A 3GDCA 1X9UA 1PLBA 1KV7A 1BAWA 4ZK8A 2YAFA 1HAWA 4EF3A 4G71B 1NDTA 1NPNA 5PAZA 1NTDA 1JXDA 1NWPA 2BP0A 1L9RA 4GYBA 5I6PA 1PF3A 4DP0X 1AZBA 1NIFA 2DWSA 4NB7A 1V54B 1ASOA 4MFHA 1PLCA 3G5WA 1PZBA 3FSVA 4HCGA 3FQ2A 3H56A 3BQVA 3NT0A 4YSAA 3ABMB 3AZUA 1BQRA 3WNIA 4DP2X 3NJJA 4HCFA 1XB8A 2IDFA 1NICA 2VW6A 2AVFA 4AX3A 4ENZA 2CJ3A 2XU9A 5B1JC 1NZRA 2IWKA 3DTUB 1IC0A 1R1CA 1A3ZA 5F7AA 3IN2A 3N55A 3TBCA 3H4FA 2IDQA 3ASOB 4M3HA 1QNIA 2BWIA 2X87A 1JVLA 2EILB 3UADA 3IN0A 3TU6A 1XB6A 1B3IA 2HX9A 4AKOA 3IBOA 1EHKB 2FWLB 1A4AA 4KO7A 3QJVB 2YQBA 4UF7C 2PPDA 4GXFA 4WKXA 1J9QA 2QDVA 1ZDSA 1WA1X 2DWTA 5D4HA 3NP4A 1PAZA 4BWWA 3D12B 2PPAA 5E9NA 2GC7C 1DYZA 3FSAA 2HZHA 1L9PA 4BDVB 2BP8B 1JXGA 2BZ7A 3QJTB 4YSCA 3SBRA 3EHBB 1WA0X 2X88A 2DYSB 4A66A 2AFNA 3AG4B 1ADWA 4QKTA 2WO3B 4Q8BA
chains in the Genus database with same CATH superfamily
4TVPL 2G60L 5ICXA 2P5EB 1E67A 2JI1A 3K74B 1IQDA 3U0WH 1I53A 3BYYA 1WV7T 1DEEB 2R69L 4XC3H 4EXPX 5HVHC 2DKMA 2CIIA 1UA7A 3VXME 1DTUA 3KBEA 2NUTA 1GYVA 2K6ZA 5AOIA 4D3CH 1NBZB 1LO0L 2R4RH 2VDMB 3AROA 3HG1E 4JRYD 4PWJA 1R24B 5ABZA 5CKAA 3RWCB 2X6CA 4W9ZA 1MREL 4QR7A 3DK2A 4PJAB 4WK2B 1LGVA 3L4XA 4YO0A 1TJIL 3BKYL 3NP3A 3E6FA 5K69A 1OGPA 2FE0A 4WV1B 1UKSA 3UG4A 2B15A 4EXKA 5I18L 5AKSA 3SPHA 1E9PA 1OF2B 4S1SH 4KY2A 3V5KA 3GIZH 5AAWC 3IJYB 5HBBA 1RZGA 1R5WA 4YHOL 5ITBH 2GQHA 1GSKA 3ZTEA 4YBLC 5E1HB 4LPTA 4JPQA 4JO2L 1PIFA 5JDSA 3ILPB 4UI2A 1GA2A 1I4FA 1QBAA 2ADFL 4XNQA 1NCCH 3N85L 5CZXC 4RQQA 1JV5A 5HGBB 5C07A 1AQDA 3FQUB 3GTVA 1KY7A 1VZHA 4R83A 3CN2A 1BWMA 2NYYD 1FP5A 3OGCB 4WCYL 2O93L 1FO0B 1IKFL 5E2VL 5IVZB 3CZKA 2NQCA 4LL4A 3PXHA 5EZLB 1RJYA 1BBJA 4U1LA 2AXJA 4KK6D 3NJHA 4C4KO 4G5ZH 2IALA 2WAHA 2CBQA 4WGKA 4TULL 5FS5A 5ICYA 2EH8L 3HAEB 1R5IB 3WTUA 2AK4B 5HDWA 5IFJB 4HD9A 4XWGL 1MFBL 3QDMB 3B56A 1KLFB 3SKOA 2C34A 5I76B 3P3RA 4Y1AA 4IIQC 4TS6A 1T4KA 4N1EA 2BLFA 3WE1A 5D70L 4ZOBA 4TUKH 3PP4L 2YIHA 1BFOA 4ZS7L 4ZAKA 3UZEC 4M8VA 3B9KB 2VC2L 4JRWA 2L3BA 2XXCB 2H41A 3W9EA 7CGTA 5HYJD 1JOIA 1VPOH 4OFVA 1FYTA 1MELA 3DUUB 4WFEE 2XYCA 3E3QE 3S37H 2YPLB 2DW5A 3SPVB 3BRDA 1DVQA 4BFBD 2BXZA 2DEWX 4OD3H 1PYWA 1FGNH 1NCJA 1W72B 3ESUF 2OS7A 4PJIF 1IKNC 5DCCA 3MGAA 1PQZB 5EEYA 4MMZB 3WIHA 1RZKC 1S7XB 4OVVA 1KMGA 5D2NE 3KPLB 3NSJA 3R7RA 1ZPLA 1ZSDA 5CN1A 4DETA 5INCB 1OTSC 1BMZA 3WFEH 1AO7B 2P3YA 1BFVH 4PG9B 1OGAA 3M1CA 4PP1C 5T1LA 2NY7H 1NAKH 1CFSA 2CD0A 4R8WL 4X6DF 3S9DB 1Q9KB 4L9DA 5I75C 3GSVA 4WFHD 5FO2A 4G8GB 3ZDWA 4PJEB 4NAJA 5C3IA 3W5MA 2G9HB 5I19H 3MODL 1FNGB 3V0VB 2C9UA 3BW9B 4J3XA 3BWUF 3V6BR 1P5UB 1O9ZA 2B14A 1Z5HA 3NRPA 3SGJA 4XPBH 1KJ2A 2FYYB 3N43B 1JZIA 2NNXA 4XPTH 4ZUWA 5I0XA 3SEPA 3L7FB 3T0WA 3GHEL 1E5AA 3OPUA 5FUZL 4MSWB 2G5UA 2FUQA 3BN9D 3DTXB 3EYVA 3MUGB 3V5HA 3OAUH 5C0BB 4L4TE 4QYOA 3U25A 5B7MA 2D2OA 3FONA 2HPTA 4G9FA 3IMWA 3ECUA 1IGIL 3HB3C 4AV5A 1E4JA 1H3PH 2OPCA 4JM0A 3GS0A 3TPKA 3V52H 1KCWA 3ETTA 2JJWA 3P4LA 4MNHA 4WUUE 2DMKA 5DTFB 4ADIA 2VXVL 3L1EA 3LN5A 3MRKB 3X14B 3QUXA 3QXAB 4O5LL 1XEDA 4AEIH 2VR7A 1ES0B 2JVUA 4F20A 3TJHD 1LO3L 1NC2A 3HW7A 3DIDA 2X6VA 4H8HA 1R5VB 5IBUG 4XXDB 4LOUC 5C0AB 1BF5A 2R2EB 4AYEC 2R1YA 3FFCB 3V9CA 4ODHH 1NKRA 2FJGA 1UZ8A 3CCHB 1NCIA 2LE9A 4OZFH 2Y7MA 5K1JA 3QQ9D 1SFDA 4TTDC 1SXCA 2I9TB 2AI0L 3MKGA 3S96B 1I3RA 5MEOA 1E6JH 3NCFB 3KNBA 3MRHA 1C1EH 2KZBA 3IKCA 5LBVA 3JWNC 3DX0A 3MO1A 4HOXA 1WAPA 3OMIB 1VKXA 3WLBA 1KSRA 1T3FB 2ZKHL 5EIVA 4HPHA 1HS6A 5F3HA 4XH2A 3KPQB 4Y4FD 1AG6A 1PCSA 2Y25A 3ZBMA 1JK8A 3NK4A 4C8XA 4XP1L 4UQ2A 1BYOA 4P48A 1OSZA 4JNXA 4HAKA 3OC8A 2ZUTA 2FRGP 2R39A 3G7TA 3OZ9H 1T6BX 4GW5B 3ULUD 2R0LL 1K5NB 1IGJA 1K6QL 1EO8H 3WYRA 3FCTA 4KUZL 1HNYA 4UBDD 1CYGA 3AWGA 3HRPA 2PO6D 3LS4L 4FQXA 3MAWA 4LHJB 5DFTA 3ZO9A 4PJBE 5C0DA 5IQ7L 5AVTB 2CKBH 3ZE1B 4Z5RB 3N9GL 1DCEA 4FRWA 1E3ZA 4HWBA 4XO9A 3S5ZA 1J8SA 3KDMA 4B0MB 2YEQA 3BJ91 1NC4A 2EH7H 3APDA 3U4AA 5F21B 4NKIL 4TVSa 3G5YB 5KAQF 4AGQA 2HLFD 4RDQF 5GJSL 4D94A 1GGTA 1XHHA 1D5ZB 4R7VA 2YD3A 4JRXB 5FYKU 2CK0L 5LO7A 3D8MA 3DO3A 3IU4H 4MCYB 2Z1PA 5BZDB 2Z31A 4ZO9A 5AVVB 3DHJA 4BUQA 5I28A 1YNTA 2XA8L 2Q7YB 4JE0A 1A0QL 2LU7A 4NP4H 3NGBC 4RISL 1OAXL 3FDWA 3BUIA 2QLYA 2E6QA 3SE9L 1TVHA 2PYEE 3P0YH 2BOLA 2NRDA 1HXYB 3UBXG 2P43B 2AERT 4KKCC 5ACZB 3L3OC 4NKDB 1QBML 3E2HC 3KWVA 3NIDE 3V8CA 1MFEH 1NOFA 4YFLF 2ZG2A 1E4HA 3FPXA 2H6UA 3GMRB 3MVSA 5I82A 4BE6A 4HUWB 2G2NA 3TIEA 4X6EB 2DIJA 1NCWH 2WLJA 4DN4H 4ODTH 4GI8A 3BP6A 1YN6B 3LVEA 1OTTD 2V9QA 4TVPD 4O2CA 1A7OH 5IROD 3VXMA 3VYNA 5IJDC 2NY5C 4DP1X 4K9JA 3CWGA 4Y7OC 4PJXE 5HYIA 1GYUA 3NFPA 4UB0L 3X1EA 1EHLH 2MJWA 1U8OB 3PWNB 4WWNA 1PZ5B 1MRFH 1H8OA 4NN6B 1UVQA 5CLTA 1P7KB 1K4DB 1MIMH 2W07A 4EN2A 3WIHL 2XG5B 2W1NA 4UQCA 1MJUL 1KDJA 2BSCA 3UACA 1NGPL 1NA8A 3C08L 2MKWA 4W1TA 1WUZA 5KJ7E 3PL6A 4WO4C 5E9DA 2A99A 2OJEB 3EG9B 1GYCA 5KYYB 1E90A 3NN8A 3X17A 3FTYA 4ALAL 1Q1PA 1X5KA 1P5VA 2XBTA 4L4VB 4DP4X 1INEL 5TPWL 3IDMA 2WNGA 4G1MB 3OKEA 4XBPA 5AZEL 1OF0A 4FTVB 3HI6L 2E6PA 2HT2C 4NPYA 4PH8A 3TCTA 1Z3GH 5T1MA 1U8KB 4R7DA 4I48B 4MWFA 2H8PA 5LGYA 1P2CB 4BWTA 1NFIA 2YARA 1QUNB 3CK0L 3ZKSD 5I1DB 2DPKA 5F71A 1OSPH 3QRLA 1W0WA 2UZPA 1L3WA 4WUKL 1KJ2L 2WANA 3UAJC 5KAQG 4EZMA 3DTDA 2ENQA 4U1MB 3VQLA 1XF2B 5DWUH 1NM4A 4WSJA 2EUWA 4Q14A 1KGWA 3MV9B 1OZTG 1KCSH 2FT8A 1H3XA 2H0PA 4HIEA 4N0YL 5D1QD 2J2ZB 3UOAB 1AG0A 3OBAA 2H3KA 2QADC 5KBKA 4PHXA 5T1JA 4MA1B 1T21A 2WYIA 2NYZA 4JUTA 4KMTL 5F70A 3C8KA 2J55A 1U58B 2QJDA 3GMQA 1MNUL 1ZT7B 1BAWA 2L0DA 3AAZA 1F18A 4DAGL 1DVUA 2IGFL 3I3EA 4ELMA 3WS6A 3VGDA 4ZFGL 1XAUA 1I85C 2W94A 1A1MB 2KPWA 1IEAA 1HZHH 4F9PA 1V54B 5SV3A 3OKKA 2JCCE 4F9LC 3FQRB 2CO6A 3ARDC 1CXEA 5GGSA 4KTGA 3LKSB 5A7BA 2OSLA 4YR6A 3ZE0E 4OCLC 5E56A 3WJLC 3GMPA 2AEPL 3W37A 3WOVA 2Z4QA 4TPRH 1NICA 1IIKA 4OD1H 2X1XR 5TJWK 3O9WB 4H26A 2FX9L 1A3ZA 1X9QA 1O9WA 4NC1E 2ENYA 2J7LA 4JL1A 4KU1A 4R26L 4QEGA 5IJKA 1E4XH 4UTBH 3VNYA 3NACL 3ASOB 2H0EA 3KPSB 1TO5A 1SOXA 3DVNA 4WAFA 3LTVA 1MCDA 5IKCB 2OKMA 3IBOA 2MEJB 3GZPA 5I0DA 2WP3O 1DJYA 2NXYC 3AY4A 3LIZA 5L88L 2EUXA 4GUOA 2ZX8A 3P54A 3CIQA 4YX2H 1RZFH 5EDXA 4NQCB 3RGBA 1HXMA 5AB0A 4FFTA 3MCLH 5CKGA 4GXVL 2ZCHL 1R6VA 4LEEA 4Q6IA 1T22B 3HI5L 1BV8A 3QYNA 4W93A 2YD2A 1GKEA 3DX9B 4U4BA 3GBML 3VG9C 3ULUH 5K39B 2ICWA 2BY0A 1LILA 2DQCH 5KVDH 4HWBL 1WT5C 5F93C 4RX4A 2DYSB 4RCAA 3B83A 1MHCA 3BFWA 4HXBL 2MQ3A 3SPIA 2EDMA 5L6YL 2WSPA 3I6KB 1FVEB 4NBXB 2NNAB 2DLFL 4HIHB 3H9SD 2H45A 5AAPA 1UM4L 2XHNA 4HMCA 4PJHE 4QRRD 2LW3A 3CHSA 3HG5A 1M9SA 4W70A 4M8RA 3EJJX 4G6AC 1D5IL 3KXFE 1MFDL 5DUBB 2IXQA 3MJ7B 1GHFH 2J73A 2ZOTA 2FO4B 5C0CA 3PHQA 3A6OA 4ONHA 4MXVF 4OJDH 1M2VB 4WQOA 3WAKA 1CDJA 1U8JA 2I5YL 2X5PA 3H8NA 4BQ8A 3D5OF 43C9A 5E08H 1QI5A 4MJJA 1N64H 3MROB 5E8NB 5DI8A 2VN3A 5DHVA 3K3QA 3WJMB 1ZV9A 2IAMA 2NT1A 3RKDC 1C8QA 1QLEL 2CO7B 3OKOB 1IAKA 5GISH 1UJTA 4U05A 5G4MA 5L7XL 3BGMA 2JKIS 2BVOA 4TN9A 2WN2A 3D3VE 2A6KA 5D1XE 3BUTA 1JYVA 1T1YB 3LN9A 3EJYD 4KKRA 4O9HH 5L2KD 2XV3A 4WHTB 3CSTA 4DPBX 4KJPC 4GBXD 1DBKL 5AVSB 2ITCA 2KYIA 2K6YA 1XR9A 1ZEAH 3INUH 1QKZL 4NM8H 5LAPA 4Z7UF 1I1AA 1BBDH 1F4XH 1R0AH 3EDJA 1BX2A 2ATKA 2Y36L 4G80A 3Q3GA 4AKPA 5F8RC 1DVXA 2BVQB 3OGOE 1U8LA 4PJBA 2WAQA 3EUDA 2I9LA 3OAYH 4IU2B 3P4NB 4TVPH 2G60H 4GUPB 1YEGL 4Z7NE 1P53A 5B4MD 1W6WA 1DE4B 5SX5H 4EDXA 2E9IA 5AAMC 4ZMWA 3TS8A 5KYXB 2FSEB 4MRBA 3V4VH 5I66A 4JFXB 5DUML 4NUPA 3QJHB 4RGOL 1OPOA 4N1CA 4YDLC 4MX7B 4N2KA 1IL1B 4BKSC 3MREB 1WO2A 3N41B 3OWRA 1DBBL 1A25A 1TJIH 3D1MC 4HUCA 2J88H 2CM5A 4IOSA 3BKYH 4M6OL 4OZGE 2IH9A 1SZNA 4P23B 3SDDB 2G0KA 4UILL 3ZXAC 5CSBA 3VFWA 3FUEA 3BC9A 3PJSB 5T1KB 5JW4N 2ITDB 4PLKD 4YHOH 3KW7A 3BFOA 4IEFA 1E8ZA 5A2AA 3AS2A 4ODWB 3I6GB 5C07D 1XGQA 2O5YH 4FG4A 4KDWA 4N2NA 4FZ8H 4PV9A 1P84J 3WTVA 3GLAA 4LOVA 3QNZA 2N7BA 4D7PA 2ADFH 3H9HB 4JZJB 3ROLB 1FPTH 3UP6A 2E74C 3N85H 3HG2A 4GQRA 4PG2C 4IJTA 1MNNA 2VNCA 1NCBL 4MYPA 3ZMRA 4ZMQA 3CQPA 3VWKA 3NDYE 1H5BC 3QR0A 1NL0L 3KYMA 2QV4A 3U1PA 1NAMA 4AT6A 2ZX7A 4HAGA 4WCYH 1F97A 2VSKB 3GTTA 4YPGB 2A9DA 1A7QH 2YGNA 1IKFH 5E2VH 1BZ9A 3ARBB 1N4XH 4Y1AD 4F3FA 1BM3H 3TBTA 3WEMA 1CDIA 4ZAKD 1IARB 1NMAL 1X9LA 3BVVA 2EO1A 2EH8H 4U3SA 1S7SA 4LBEA 3TOPA 2XPGB 1OANA 2Z91B 4AL8L 1QO3A 5E6IC 2ZNXA 2A6IB 3PYCA 3SZKC 3WG7B 1UZ6F 4EZLA 3MRFB 5CCGE 4ZFOA 2OI9C 5AEAA 1JNHB 1KN2L 1MLCA 1BD2B 2VC2H 4JFPB 3CE1A 3V7AG 5TE4H 1WBZA 2F9BT 3LV3A 4Z7VA 2D7QA 2B5IC 2MPAL 2C3VA 5HGAB 3HC3L 3VXUE 1NCOA 2HT4C 4CC4C 3B8YA 3Q48A 5T1LD 1OGAD 3R06A 1RVFH 3RUGF 4F8PA 4L1SA 1U4EA 2APXA 2V2WB 1TKWA 3OKMB 4JFQB 4KH9A 1UHVA 2D03L 5HGDB 4UINL 4XNDA 3LIZL 3QEHB 3OAZK 3FH8A 3I75A 1Z1WA 3CZEA 3U9WA 5KSVB 4R8WH 4HUKB 2UV3A 1V8HA 1KGYE 2PLTA 2G3MA 3MR9B 4U1NA 4YPJA 3DX4A 2ADIB 3CFTA 4HPYH 1E4KC 3R4DA 3BPCB 3A6BL 3MODH 3WL9A 3ULVC 2XVGA 1X5IA 2UUDK 2FBJL 3BHBA 4H13C 1KCUH 3ZQXA 3QZOA 1C7SA 4W9GC 5E8OA 1A9BB 2QKIC 2ZUQC 3APFA 3RJQB 4FQQB 5ES4B 5CJ5A 1J5CA 1MCJA 2BDNL 5J4MA 1N2RB 1YY8B 3O2VL 1OCRB 3D30A 4J3SA 4G9FD 1TUPA 1AR1D 1I1FB 1HL4A 2H32H 3EXJA 1T0MB 2OQJB 2JCCA 3FUFA 2VN6A 4RMUA 2OW7A 2G5RA 5DYOB 2HH0H 3ZUNC 4O4YH 1Y0LA 2JKRM 2E86A 1UG9A 3QUXD 3PLYA 1E27A 4BQ9A 2DWEA 4GFTB 1RP8A 2R2BB 4QTIL 3PDGA 3L6FA 2DQGL 4JDVA 4IS6A 5F6HJ 1NCUA 2XKNB 1NC2D 2N59A 5B3SB 3SKNA 3SGDI 3ESOA 1OGTB 2AKRA 2EXWD 2BSDA 2NR6C 4IIQB 5KYWA 2VSDA 4A2FA 5KBLA 4K94H 5I16B 5B1BB 2G2RB 4O5LH 5A40E 2GJJA 4L2YA 2SODB 3AM8A 4RGNE 2J1ZA 1B2WL 4N2HA 3O6FD 1LO3H 4JFVA 2FSDA 4QT5A 4JQIA 3NSCA 4F27A 5ITFB 4Q0XH 4KTDL 2Y1YA 3WMSA 4MVBD 3KPRA 5AFAA 1G43A 3K2IA 2Y3AA 1RFDL 5M7QA 3DJTA 2UY6A 3C09B 1B0RA 1MG2C 2H7WA 1BMWA 3BPNB 2VZOA 4FG6D 4R4BA 3A23A 3S35L 4BCXA 1N9PA 3QG6A 2K9FB 6FABL 2GI7A 3FQ1A 4PRHE 4UDUB 3V4PB 4XCEA 2KL6A 4X8JA 1SDDA 3JTTB 2X0VA 1LEKB 4UNIA 2DOCA 1TSHA 4FC3E 1B88A 2OMXB 4HEPG 4I3RL 5HHXH 4K3GA 2OCCB 3X12B 4N87A 4NUJB 3HR5A 3QUGA 1IT9L 4XP1H 3VYPA 4Y16C 1WICA 3RVWC 4OAWA 2ZICA 3TO4B 4F93B 2FJSA 3MYJB 5L8JB 1MIEL 1AQMA 4P3CL 4ENEC 4F7KA 3ARGB 4JPSA 3QAZC 1K6QH 3FH5A 3WNLA 4PJHA 3U4KA 4KUZH 3HI1A 1NC4D 4DH2A 2XN1A 1UH4A 2GAZB 3LS4H 3QAQA 2OV0A 4YHLL 3IJ7A 2DWDB 4KWUA 3VFVA 5IQ7H 2DBLH 1I8LA 3N9GH 1Q0EA 4N28A 3LH8A 3PXJA 1TITA 3WFHA 4PJ5B 2Z31D 3GD1C 1RIHL 3LPGA 3MCG1 3NAAL 3ZE2B 3MOAH 2ODHA 4FL4B 4OLWL 1TG8A 4NKIH 2BSRA 2D73A 4PW3A 3C12A 3MPCA 5GJSH 4JS7A 4J7RA 4N25A 1S9YB 4F2FA 2ATPB 1L9SA 4M7JL 4EBQL 2EDBA 1RUML 1UD2A 2CK0H 1AAJA 3Q2VA 1TZHB 3VJ6B 2EVFA 2C9XA 5D1XA 4ZW7A 1U30A 3IDIA 1ANUA 5DGRA 3V9EA 2XA8H 3QEQE 4L3CB 4ELDA 3D0AA 1A0QH 2XACC 2EDJA 2P5EE 2FQEA 3MV8B 4NWTL 4RISH 1OAXH 4PTTB 4YGVB 3C2AH 3DX7A 3FN0L 1M05B 4NBYB 3SE9H 4TL4A 3WUWB 5EBWB 3U2IA 1NAML 3CPLB 4TNEA 3Q1SL 4KK9C 1VENA 1G1CA 1QBMH 4L1LA 5LLIC 4LRNL 3P9MB 1MAML 2OR8A 4NOBA 5DQJA 1U8CA 4HIQA 4NENA 3RL1A 5E2TH 4PFEA 4HBQA 1KNOB 4HBCL 3VXMD 3RHWF 1WCQA 2DMBA 1WWBX 1G0XA 1DVSA 1BZQK 2O6CA 3HE7A 3HG1D 5IBLC 1VCAA 3LB6D 4RWYH 3TONA 1NGZB 5DC2A 1ZS8B 2LR4A 4AE1A 2IPTH 1K4CA 1HQRA 2CGYA 4ZFOL 3QRBA 5FV1L 3IXAA 4Z3TA 1E28A 3IDJB 3REVA 2FK9A 3IJSB 4ZW5A 5TH2B 1Z5YD 5FOBB 4UB0H 3K2UL 3RB5A 3SDXE 4UQBA 2KQNA 2ICEB 3C5JA 3P9LB 3PL6D 5E9DD 3TF4A 4OZGA 3OMZA 1O6VA 4S1QL 1NIFA 2D0HA 3M07A 3NA4A 1IM3A 4KKBD 2XTLA 5C09B 1J8HB 3G5WA 3P3TA 4Z1PA 5EBGA 2BSEA 3FQ2A 3FQWB 4KMQA 4D7BA 3VFUB 3C08H 1IC7L 4YBHA 2BHYA 2UZIL 4CMMA 1BQRA 4Y5YA 2LT9A 2V5YA 1JWUB 4NZTL 4R4ND 1PX4A 1KLUB 3X11B 4NI3A 2Z92A 2XQBL 3GZKA 3CHOA 4QRUB 5TPWH 1EGJH 2CLRB 4RLDA 2XN9B 5AZEH 2SEBA 3VFNA 2LHAA 3HI6H 1A6AA 3QDME 4Z3EA 2O61B 35C8L 3GSRB 4UQ9A 3KEDA 4YHYB 2X87A 2FBRA 3NGBB 4XMWA 3CK0H 3NJXA 1R17A 3HHSA 4XODA 3BIAX 3IDYC 1Z9MA 4B95C 3B9DA 4UYPA 3CZGA 4IHBA 4WUKH 1KJ2H 4IRJC 2OMNA 1EBAA 2NY6D 2YPLE 2NY2D 1LEGB 3PY9A 2F5AH 5DFWH 5DZAA 2PPDA 5IHLB 4NQEE 1J0KA 1WK0A 3E2HB 1Z5LA 2OMYB 3SKMA 2N56A 2WVVA 1S9XB 2Q2LA 5DVLA 4Q97A 4HZLA 1OPGH 1R3LA 4XBGA 4BWWA 3A6CL 4WFED 3N06B 3H3PH 4H4NA 4YC2C 4DTGL 1KXTA 1QFHA 4UOJA 3K6IA 2IANE 3R7QA 2EXYC 1F6AB 1AO7E 3TXAA 3CXDL 4ZFGH 3SPCA 3EHBB 1V3MA 4EI5A 3DARA 5CJOH 2V6HA 3FOMB 1A3RL 3KPPB 2PETA 5JO5B 1DJSA 4GFXA 4PJEE 3V0FA 3DVGA 1ZTMA 3GK8L 2OYPA 3U9PL 4AY0A 4AW4A 4TLKA 2Y9RT 1M7UA 5E6ZA 3F7QA 2DH3A 5F3FA 4Y5XC 1XCWA 2AEPH 1FHNA 3FB5B 4JQIL 2GITB 1FF5A 3LH2L 3G5VB 4J6RL 4PY8J 2XWZA 2PWHA 1HEHC 1P4BL 5AVQB 1I3VA 3KW8A 3RRQA 2FX9H 4YFLI 1L0YA 4R26H 5EIIG 3NFNB 2AQTA 1XH2A 5EOQL 2EDTA 3NACH 1QSVA 2F8XC 3CLEH 4APQB 3OX8A 5C0BE 3MRJA 1CFQA 1A4JB 3QJRB 5DD3L 1JWMA 4ZW6A 1E8YA 2YRBA 3KAAA 3QUMA 4GKLA 1A4CA 1PSKL 4MDIA 4JAMB 5FECB 4KY1H 1GZQA 5IQLA 3BOVA 1L0XA 2B16A 1FV1B 5K9QG 1DQJB 5TFSH 1D5MA 4O02B 1SMDA 1SXZA 1PBYA 3AG3B 3QIUA 1A5FL 4RX4D 4LMQE 5CSZB 5DF0A 5DUJA 5EO0A 5G4OA 5L4FA 4GXVH 2ZCHH 1C9SA 2DQMA 2GHWB 4WUUD 1JERA 4P4KA 3HI5H 4TLTA 4G7QB 3DRQA 5BNXD 1F0LA 3O41B 2YEZB 4PREA 1ZHNA 1G9NC 1OE2A 2QADB 3BAYA 3FFCE 3GBMH 4PJ6A 1CE1H 4HWBH 3IF1A 2AF2A 5A2IH 5IREA 1TEYA 1X5ZA 2WXRA 1QR1A 2EO9A 4M93C 3ZDYB 1F11A 3BPOB 4EQ2A 4BSJA 5JLZA 3TN0A 3BLBA 3GSNH 4PTUA 3C60A 5L6YH 1PKQB 4NQUA 3F04A 1KDIA 1AIFA 2DLFH 4N0CD 4W68A 5DJ8A 4L8DB 5C0CD 3NYKA 4JY4B 3MRRB 4NDMB 4KXBA 4G11A 2BS71 2V7NB 3KLLA 2X9WA 1XGZA 1D5IH 3TT1L 5BV7L 2XV0A 1N5AA 2IAMD 1NIBA 5ERWA 3OHXC 2CUIA 3ARDB 1QAWA 1FHGA 1CG9A 4UUJB 3T0EC 3TA3C 4GLRH 2I5YH 2WQRA 4X0KA 4X7TA 5AB1A 2P8PB 3GMOB 4O2EA 4ZUVA 3WXVL 1TNNA 2HKAA 4X5WA 4GRMB 1EAPB 4PQXA 4X80H 1N70A 1KIRA 1QLEH 5D7IF 4XCNB 1T03H 4FFZH 1GYWA 2XDHA 4IIZA 4PRHA 5F7BA 4IRSA 1UCBL 1MWAA 2WZ0A 3ZE1E 2COQA 4PWKA 4ZQTA 1NEZA 1RZPA 3I3BA 3LX9A 4ERSH 4KNUA 4LVHC 4XGZB 1DBKH 2EICA 2TRHA 1E7VA 3NSXA 3VCLA 2OL3A 1MW0A 4PVLA 3GB7B 3VYOA 1PG7W 2CDFB 5D7EA 1SFHA 4H1LG 2NXYB 1AXSA 3FQTA 3U2SB 3LXUX 2F7PA 3JV6B 4JUSA 1MJ7H 2H1PL 1CF1A 2A3TA 2E7BA 2Y36H 3SOBH 4FJZA 4B9GA 1RKRA 2HJKA 1EAJA 3U6XS 2N01B 3GSQB 4AK2A 1YEGH 3NIFE 3PGFH 5HHQB 4N0UB 3ZR6A 2WZ6A 5B38A 4GRWH 4PD4K 3QDGB 4IOSD 1ZA6A 2B20A 2HKFH 4U7SA 4PGEA 2WW8A 5JHDB 4RFOL 3F6IA 3LKPA 4YHMH 5DUMH 1WZAA 4RGOH 3O8XB 1I7ZA 1OAJA 2PYED 1DQMH 4L8SA 4DIXA 4Y4HC 1J9TA 3O6ML 4GEIA 3P02A 3D08A 2VDNL 3U1SL 1VACB 4IGBC 1IB5A 3ILQC 2IDUA 5F1OB 5KSBB 1PW3A 2PXYB 3UGEA 4B5ZA 4UILH 2WBJC 5TQ2L 1DEEA 2R29A 1TCMA 5FF6A 3PIQB 2CMRL 2VDLL 5SWQB 1OALA 2CPCA 1NBZA 1AS8A 4QRTB 1JP5A 1R24A 4LARL 3RWCA 4CVUA 2RCSL 3WD5L 4PJAA 3L13A 4X4ME 5JIMA 4WV1A 1S3KL 4R2GD 1OK8A 2ARJB 1L6ZA 1XH0A 1OF2A 3FTGB 3LPFA 4F58H 3IJYA 1NBCA 3NG5A 1NL0H 1YJDH 1D7DA 4LSQL 4PR5B 1P6FA 3QDJB 5LBSA 4R4FH 4HD5A 2ZSVB 2AQNA 4OF8A 4Z7WF 1R9FA 4WO0A 1HCZA 5I6OA 3ILPA 1PX3A 2FH8A 4D0DB 4FNUA 4Z7QB 5GS0C 1NMAH 4R96B 4FTVE 4HU2A 5C0FB 4NJAH 3D4CA 2VDKL 1XV8A 5HGBA 1OP9A 1WIUA 3FQUA 4AL8H 4DPRA 1OOAA 3QXUA 2EQDA 3MV7A 3PWJB 4BK5C 4QLWA 4LSUH 3T1WA 1IGYB 3OGCA 4AVHA 4OM1L 5A6MA 1KN2H 1FO0A 3ATAA 1RZJL 5IVZA 5EZLA 2MMXA 2EJ1A 4BZ2A 1SRDA 4Q6YA 4QWWC 4F37K 2OK0L 3QUZD 3HAEA 3OXSB 1R5IA 4BQBA 2AK4A 1G1KA 5IFJA 5A6LA 4KVCH 1KUMA 5CFHA 3ZTJH 2DLGA 1CD8A 3QDMA 1KLFA 2B1OA 2VMFA 2GBTA 4P2YA 3U4EB 5I76A 4NLHA 3QUML 1C8PA 3G6DH 2D03H 4UINH 4YXHL 5MENB 1R19A 2CHNA 1DJXA 4NIKB 3H55A 2YD4A 4ES8A 4AI7A 4QJ4B 1T2XA 4R97B 4PW4A 3UJTL 3DUUA 4KXZI 5IBUB 2YPLA 4TLSA 4JG0L 3SPVA 2E9GA 3F7PC 1W72A 1TJHL 5FLUA 1CD9B 4BHUI 2RJMA 5DFVC 1PQZA 1I1YB 4MMZA 1S7XA 3A6BH 4BKLB 1E40A 2BJML 5D6DC 2BVYA 5HHMB 4QAMB 3LNEA 3SJVE 2ZOUA 5CJXA 1M53A 4NZRH 5INCA 3JUYA 1AO7A 4PG9A 3GXDA 2NCEA 3WTXA 2BDNH 3TT3L 4R5VA 1XF4A 3JYCA 3O2VH 1Q9KA 2OSWA 3ZHKA 4G8GA 4MAYB 4TM9A 3GEWB 4PJIB 1JXFA 1AD9B 5AD0B 2G9HA 4KC3B 4WK4B 3KS0H 2X1QA 5FHBL 1NMBH 4X4YB 1FNGA 3V0VA 3QQXA 3BW9A 4HWEL 3OMNB 4U0QB 1P5UA 4QTIH 4NZJA 1E2ZA 1TPXB 1YN7B 1TZ8A 4NQCE 4KK8C 2FYYA 4ACTA 2R56L 1YNLH 3BSHA 4LOEA 4CL7A 1T7YA 2OI9B 2EDDA 5DHVH 5TK2A 3L7FA 1FLRL 4QI3A 4F80A 4MSWA 4LCWE 2J6WA 3VXSB 3KPRD 4CAGA 4GO8A 3DTXA 5DLML 3MUGA 4KKNA 4UNTA 2NX5E 2VR9A 5C0BA 4F1SA 1NBVH 3IJ9A 4M3KB 3JV0A 1MWAL 1II4E 3EH4B 3EH5B 3O81A 4BH7B 4I1PA 3V79C 1ZLSL 2WPGA 2NY1D 1N19A 4KTDH 5CLXA 1FFOB 1AKPA 2OL3L 3HNVL 4OUUA 5C3TA 5DTFA 5T3XE 4Y1TA 3MRKA 3L5IA 3X14A 3QXAA 3IGLA 1M71B 2XQYK 4IBWA 3UDWA 2E4TA 2ICWJ 1OP4A 3S35H 1ES0A 2FJHB 1PFCA 1JGIA 4N6RB 1KLGB 3SKJL 6FABH 3QA3B 2HJLB 1R5VA 4XXDA 5C0AA 1FL3B 1QA9B 3R0NA 1P9MA 1OT4A 2IDTA 2R2EA 4RFEB 5CZRA 4G5AA 2PWFA 3B37A 5EWIL 5FM8A 3FFCA 4L0ZA 3CCHA 5HD8D 2ARWA 2ZXGA 3KS0J 1V27A 3Q7JA 4J3WA 3QS2A 3PUUA 1IT9H 3KXFD 3S3CB 2AJXH 2I9TA 2XTJD 3O2WL 1XH3B 3S96A 2GJPA 3LZNA 4MJ5B 4N2LA 4P3CH 4LP5A 1DN2A 4OLUL 6PCYA 3JWOC 4GKNB 2CE6A 4QOKB 3X1NA 4JCLA 1T3FA 1XX9C 3FYEB 1VADA 4GIOA 1AACA 1T7WA 3W3BA 3KPQA 4UV7H 1B9ZA 1QFWL 3NEEA 3D3VD 1RIHH 4GAGL 1NTDA 3NAAH 5D1XD 4GYBA 3F85A 2R29L 1F3JB 3KLQA 4OLWH 2AC0A 2X6AA 5A2BA 4GW5A 4NB7A 4OBRA 1K5NA 4M7JH 4EBQH 4MFHA 1JGDB 3HBQA 4NJ9L 2FVNA 2HFGH 4NO5B 3LZRA 1W16A 2C4FU 5GS2D 1ORQA 1DBJH 3NJJA 1I3UA 2HAZA 1EVTC 3WXVH 1OQOA 1P0SE 3T8MA 4Z23A 2OZ4H 2XQYA 3VWJC 3ZJAA 1EA9C 4BK8A 2FATL 3G5YA 2Y5EA 1GSMA 1NAMH 1D5ZA 3INOA 1EHAA 3Q1SH 4JRXA 4N0FB 3PFUA 2K78A 2VXTL 3EAKA 3HE7D 5LBSL 3MJ8B 3OAWA 4LRNH 4MCYA 1GJUA 1MAMH 2ALWA 1XF5B 2H1XA 5BZDA 3ARPA 5HJDA 1QRNE 3UADA 3OZKA 1B3IA 2Q7YA 4UQIM 3GI9L 3PDOB 2DIBA 2MHAB 4HBCH 4KKPA 2VXQA 3IJHB 1YMME 3EJRA 3QXWA 4DF9A 1AGBB 1XGTA 2F53E 3NCEB 5FYLE 2Q3ZA 5C08B 4E41B 3MRBB 1HXYA 1I8IB 3TFKC 4G6JL 5ACZA 4NKDA 2YS4A 1RJLB 1GGYA 3QG7L 5CN2A 4XOEA 5IWLC 1FO0L 3PV7A 1IM3D 4HH8A 4MHHG 4G6FB 1PG7X 3RGHA 4BZ2L 3D9AL 3GMRA 3K2UH 2BSED 2V5TA 2CXGA 4HUWA 4CSTA 4X6EA 5IESL 1OHQA 3RY6C 3VTMA 1QBBA 5DD0L 3MLRL 5E8EB 1JZHA 1YN6A 1IAIH 1SUJA 2NZ9D 5TDNB 3VFPB 2UXFA 4DK5A 3KR3H 5ANMA 1J1XL 2J5LC 1EHNA 1EEQA 5DR5L 1VFOA 1RZ7L 1IC7H 4UIMB 4FA7B 2UZIH 5JDJA 4YDIL 1XTMA 2C7UB 1DL7L 4Y4KC 3WY1A 2NY4B 3FB6B 5TE6L 3BH4A 4NZTH 3PWNA 1U8OA 4GH7B 1XL4A 1PZ5A 3HVDA 4DWHA 4WW2C 4N8CH 5ILTL 3G08B 5KVGE 1W72L 3SQBB 2UXGA 2NY3C 1P7KA 1K4DA 3MRQB 4G7YL 5I8OL 5CJBA 4C83B 5KOVC 2XG5A 3II3A 1E8XA 5D7JB 2NYKA 3O0RL 4J3VA 3CBRA 35C8H 3ZMNA 4DOHB 4BFOA 1YMHA 4PJBF 2OJEA 3EG9A 2VJ0A 5DRXB 2COVD 4NHCL 4X2UA 1DSYA 5KYYA 3JWDC 3HA0A 4OIIL 1NFKA 2NXZD 1CN4A 2ROXA 1JAEA 3D2UA 4L4VA 2PR4L 2NSQA 4NNXB 2W95A 4G1MA 4MJIB 4E5XG 3MI6A 3V0WL 1EDYA 4ZX4A 1J8KA 4IYKA 1U8KA 3A6CH 2MKLC 4I48A 1P2CA 3NSYA 4DTGH 5GZNA 1QUNA 3PJNA 4BBWA 3CN0A 5I1DA 1ZVSB 2NZIA 1CC3A 3DA0A 4FKEA 3D2TA 2F0CA 2IOOA 3CFQA 1A6UL 3FN9A 1XF2A 4U1MA 4Y5VB 2UZXB 1T04B 3D51A 2K4WA 3AGWA 1BQUA 3MV9A 4RNRB 2J2ZA 3WFCL 3GK8H 3U9PH 2FGWL 4XXCA 5HI4D 1CXHA 1MXDA 1TU2B 3TBWB 3ECVA 3ZRFC 1U58A 2BFVL 3OAZH 1ZT7A 2LAGB 3NIDF 2YPKB 4LT7A 4M1GL 4Z7IA 2CHZA 4J6RH 3NPSC 1SJXA 2ZXCA 1JZ3A 3BWZA 4EI6B 3VGGA 4GI6A 4W81A 2PP9A 3FAWA 1JIBA 2XWJB 3DXAB 1A1MA 3JUZA 4LCIL 4F8LA 4TQPA 5HJBA 5EOQH 2ESVB 2X7LB 2IOIA 3FQRA 3W39B 3DX8B 2UUDH 3AGVA 2BNQE 1RZIB 4APXB 4RMSA 2IC2A 2RIKA 1T66D 3LKSA 5E5LA 4AQEA 4DP6X 5DD3H 1OSYA 3ZKNC 3ETBJ 3QIUD 1V10A 4OSUH 4PJXF 1PSKH 2L7UA 4L48A 3JVGA 4S0HA 3O9WA 3FTSA 4P4KD 4KUCD 2ZG1A 4MQ7B 3UG5A 3WHE1 2D7TL 4JRYB 5J0BA 3GF8A 3S7GA 1FVDB 3W11C 3E1F1 3FU7B 3ARFC 1EDHA 2CA3A 3KPSA 2WOYA 4JM2C 4JX0A 1FNSH 4J1UB 2J4WH 3WO4C 4OF6A 1KBPA 5I1EL 5IKCA 4TUUA 3C6LB 3EYFA 4XVOA 5K9QI 1G7QB 1UM6L 1BVKB 1EZUA 4RGND 5AB9A 2R4SL 5J9PB 1T2JA 1WTGT 4K9EH 4EZJA 5I15L 4YC2B 2O6PA 3L3HB 2K4AA 3QZMA 3VQMA 1V05A 3BXNB 1X6LA 4N6QA 1E2WA 5L4JA 1HZLA 1M56B 1T22A 2J57A 1CURA 2CJSA 5JW3L 3TT1H 4ZJ9A 2JB6B 1R3JB 3D0VB 3DX9A 5BV7H 5CWSA 2I07B 3WSQL 1JMZA 5K39A 2P45B 2R1WB 1VAHA 2UY7B 4OF3A 5JOPE 1BF8A 4PRHD 4N24A 1FIEA 1PPIA 2LAAA 1FFTB 4IRSD 1JXKA 1TTCA 3EFOB 3I6KA 1FVEA 2VL4A 3GXPA 5DJDB 2NNAA 3K72B 3C9NB 2PPCA 4HIHA 1DR9A 1CIDA 4RMBA 3KLDA 4N3UA 4ZXBB 5KJ4A 1ND0B 2ZKXA 2AXFB 4QGTA 5DUBA 2YHGA 4K23L 1UCBH 3MJ7A 2FO4A 2VXQL 2G3XA 1YDPB 4MAUL 4K73A 1M2VA 4PJ5E 3TA4D 3VD5A 1YYLL 2C4XA 3EDDA 3WN5B 4NM4L 3MROA 4PWEA 5C6PB 2JCCF 1FG2B 1N8OE 1ZANL 2Z93B 3TZVD 3WJMA 1XVSA 2FEJA 2HLAB 2CO7A 3OKOA 3SDAC 3NZUA 3ZE0F 2DI7A 3IGKA 1SQ2N 1N0LB 4PJFE 4FMVA 2H1PH 3ET9F 4WRLA 3QFJB 3COOA 3UAFA 1T1YA 3N44F 3TEZA 4NS0A 1SN0A 2CO2A 3MV8E 1HKFA 3KWXA 4WHTA 3BRFA 5LDUA 4IBQA 2VO5A 1YVLA 4NXKA 5D1ZC 5JHMA 1HWWA 3CX2A 3HMWH 4FFWD 1WF5A 4IQHA 4YE0A 1IC4L 2CG9X 3AREC 3TP4A 3P2BA 5FCUL 4F7EB 4OZ4B 1KYDA 4IBZA 2P5ED 1KTLB 2ZXDA 4OGYL 3QH3B 4FP8L 1YYML 4YL4A 4M93B 4M5TA 3EDKA 2BVQA 3BUDA 2AANA 1JK9B 3AWEA 3O6MH 1GY1A 3BVDB 3K4AA 3SBPA 4IU2A 3JWNE 3P4NA 4EUPH 3NESA 5FDYA 4GUPA 3VQ1C 4JHZA 4AGNA 4Y0GA 1RERA 1E30A 1E9OB 1KXVC 3VD1A 3HN5A 3HZKB 3RVXC 1DE4A 2WLKA 3W2DH 5J11C 1LO5B 1AYRA 2B39A 4L3EE 4AIEA 4P06A 2FSEA 1FUNA 2ZXBA 1QFUL 2VDLH 5ICUA 5IJVB 1GOHA 4GRLB 4M4PA 1KIUB 3EBGA 4JFXA 4LCVA 3DI3B 3QJHA 1KBBA 5CGYD 3TA3B 4UT9A 4MX7A 1IL1A 1UA6L 3MREA 4YDJB 1TTRA 1B2YA 3HG0A 3DPDA 5BO0D 4W9DC 3WD5H 5B8CB 4HHGA 5F9JB 3UJIL 2H0JA 1EJ6A 4AENB 4P23A 1S3KH 3SDDA 4ABVA 3ZZLA 5C09E 4ZTEA 4POZC 1JRHI 3II1A 3PJSA 3AVEA 5T1KA 3IT8D 2ITEA 2ITDA 4PJHF 4LSQH 5F7EL 4QJ5B 1CIUA 2NUPB 2E6JA 2OR9H 3I6GA 4ODWA 5E5RB 4FNQA 4K5MA 5EBMB 3WTWA 5GGRB 2I60L 1OCCB 3X1BA 3F7YB 4OZFG 3H9HA 1OXYA 4HUUB 2CBOA 1XF1A 4AIXA 4JZJA 3LNIA 3ROLA 4ECNA 1U3YA 2A9NL 5E6SB 1IZJA 2WO2B 2VDKH 5FM5M 2IF7A 3LPOA 3QO1B 1FL6B 4M5ZL 5E6RB 4QXTA 3BZ5A 3RA7L 1PKOA 1TCRB 4OM1H 4YPGA 2EYSB 1RZJH 1CO1A 5E0QA 3QDMD 3ARBA 3MLWL 4KZDL 4I77H 5F9AC 5KVEL 3VRJA 2CLVB 4P07A 3B9KD 1CBJA 4YSRA 2LOEA 5KUKA 2XPGA 4TTGA 4YZWA 4DFHA 2K7PA 2FHCA 2Z91A 4JFZL 4Y4HB 3FULA 2A6IA 3FHAA 1JWSA 2YPLD 5HVGB 2NDFA 3MRFA 4IGBB 4RSVA 3CXFA 3QUMH 4XN5A 3U48A 1VEMA 1JNHA 5ABDE 5LXGH 4YXHH 5FDWB 1GIGL 2EIKB 2FNBA 1BD2A 3L1OH 4JFPA 4L8BB 3VH8G 4DP9X 1AGDB 3VAEA 4P5TB 3C2SA 4EDWL 1ED3B 4Z78A 2K8QA 1WA2X 3RDTC 5HY9B 1IGML 3UJTH 5DZJA 4MMYA 4JG0H 4Z7NF 2IAND 2XX0A 1ICTA 1AO7D 4ZMVA 1TJHH 4OJAA 1JVOA 1M3JA 2W9EH 3I9AA 2G4GA 3GT6A 4HGWB 4RMTA 5EFIB 3S36X 4BQCA 2V2WA 4HSAC 5TQ0L 3OKMA 1OT1A 2JELL 2BJMH 5HGDA 3MRLB 1A6PA 4AEHL 1S4IA 3QEHA 4UNUA 2RTTA 2XLLA 4FXTA 3R0MA 1NCAL 1U6AL 4H2CA 4BFJA 2NCMA 1AKJB 1IM9B 1KGUA 2RA1A 3WIIL 5KSVA 3TT3H 3UABA 4OZGF 3ATEA 2AEQH 2CUHA 4F2EA 5BO1L 5BMFL 2OMUB 4MNQE 3RUGB 2EIJB 3L08A 5F1IB 5EH1A 3BPCA 1ZRUA 5FHBH 2H0FA 1MOEA 3P77B 1T0PB 1Y1DA 4HWEH 3PF2A 5GGSY 1TT6A 2RQ8A 3K2MC 1A9BA 1QQDB 5CJ8A 1PAMA 1NUNB 4WY7L 1BYNA 1XWVA 2XZAH 5C0BD 1ZHKB 3UTSB 4U4IA 1AMYA 1JF1B 1KV7A 1N2RA 1YY8A 4KJWC 2R56H 5T3XL 4RA3A 3VTAA 1I1FA 4L23A 4EF3A 4JPVL 1FLRH 1T0MA 2B0SH 2OQJA 3OHMB 4JVPA 3W0WE 5I6PA 4QD2E 5DYOA 4H8WC 3T2PA 2DWSA 4CUCA 5E24E 2E4FA 4HKBB 4UM9B 3R1GH 1MWAH 3JTSA 2R2BA 1ZVNA 1ZLSH 5JYLA 4GIPD 3BQVA 2XKNA 2WKOA 2RAMA 1UQSB 3ABMB 2RFXB 2OL3H 1OGTA 3HNVH 4IIQA 2GG1A 2Z35B 1Q1JL 4HCFA 5C0AD 3ZO0A 2HFEB 4PGJA 5I16A 2ZF9A 2AVFA 2WSKA 4HS8L 2A9MH 2G2RA 5DJZB 1BF2A 3FFCD 4TOYL 3WFZA 3SKJH 4GAJL 3ZOAA 3D52A 4UQEA 5HGHA 5KANG 1QPXA 2X6BA 2ZKMX 5JMRA 2BWIA 5EWIH 1E42A 1MFCL 1QZNA 4JRLA 2ENJA 1XB6A 3MLTB 2EVIA 1P69B 3ZT7A 2WUCL 4GJTB 1IIIA 1KELH 4GI9A 5EBLB 3WTYA 3O2WH 1DCLA 5BRPA 3P30L 2AXWA 2NQ3A 3BVUA 4PRAA 3HE6D 3MBEC 4UDUA 3V4PA 4PLJC 1J8RA 4C55A 1N7ML 4M9PA 4B3VA 5I1HH 3JTTA 2GC7C 1LEKA 5L0QC 1C12B 2V0AA 3OJ2C 1LL1A 2OMXA 4XZUB 4HIJB 3X12A 3MLVL 3THMH 4GAGH 2R29H 1ESOA 3LQMA 3TO4A 1WA0X 2YOCA 4RESB 2HKHH 3L4WA 2H4EA 3MYJA 4M7LT 5HVFB 3ARGA 5B3JE 1ROWA 2AS5M 1S5HB 3SDCD 4UT9L 4CC1A 2VLKE 4NJ9H 1RHHA 2GAZA 3D09A 4JKKA 3VGAC 4JRXD 3QQNA 3L95B 1MHEB 2F5BL 1N6VA 2Y1VA 2EE9A 3WIFB 4PJ5A 2GBUA 1AGCB 3LRSA 2PNDA 3MKKA 1UWXK 1XCTB 4N0UE 3BX7C 1MRCL 4FXGB 1DVYA 4BZYA 3QDGE 4JFSA 4WGVB 1GGUA 4ZTPL 1S9YA 2ATPA 2JKTM 3ME0B 5JHDE 5LBSH 5T3ZE 2VXTH 5PCYA 5I5IA 4MB1A 5LN8A 4KUCF 1TZHA 2A6JB 2WP3T 3VJ6A 4LLDB 3ZLQC 3UZVB 3GSXB 1PZCA 1DUYB 1F8TH 1J48A 4L3CA 1GGBL 3S3PA 3VRIB 4LXFA 3VGBA 1U21A 1UURA 3MV8A 4WWKC 4DEPC 6PAZA 3T5WA 4YGVA 4PTTA 1QR4A 2EAEA 2BMKB 1M05A 3WDJA 4OVUA 3TVMB 1YG9A 2WBWB 3N91A 1RU9L 3WUWA 4PCKA 5EBWA 5F7NC 3FTUA 1I3GL 1ZGLM 2J6EA 3CPLA 4G6JH 3CFNA 3ATDA 4GG6B 3P9MA 3VXTA 1FO0H 1NANI 4M02A 4ZO7A 4J3OD 1BQSA 3DX3A 4RA0C 4BZ2H 2P49B 4H5SB 4YDKL 1U8IA 1KNOA 4LSSH 1CK0L 5DMYA 3C75A 2Z7YA 2JXMB 1PDKB 2CUAA 3IB4A 1YEKH 1TF4A 5GGVL 4M48L 5IESH 3NK3A 2OMTB 5IR1B 1YUHB 2A4EA 5J56B 4YBQD 1NGZA 4M8UA 1ZS8A 4WTQA 5DD0H 3MLRH 1A47A 5IW6B 4E9XA 1J1XH 2XZQL 3SQRA 5DR5H 3IDJA 4B60A 4F57L 5EF1A 3KHQA 4ZBJA 4PGDA 1MH5B 4PAZA 4YDIH 5TH2A 1DL7H 3NRFA 4UOZA 4W4OC 5EEZA 3F2LA 5FOBA 1CCZA 3FCUB 4FE9A 1EXGA 2RACA 2ICEA 4N2EA 4Z7QE 5ILTH 2F1AA 3P9LA 2AQ2A 4AGLA 1W72H 1QYGL 1CDHA 1X9RA 2VZ1A 5I8OH 4DN3H 1W0YT 5C09A 1FI8C 2IEPA 1WH0A 1J8HA 3O0RH 2FQGA 2J25A 5EIIB 1ETZB 3FQWA 4FTDA 3FO0L 4M5YL 3VFUA 3GBNL 3KPNB 3CVHB 3L2NA 1I7TB 4FTVD 2I25N 5D93C 2FECI 5JIHA 2BS9A 3AS0A 2N1TE 4PD4J 2YUXA 1JWUA 1TYRA 3Q13A 3VWJB 3T0XA 1NINA 2QQNL 4NHCH 4OIIH 1KLUA 3ORJA 5GZND 3X11A 4XWOC 1W8NA 3L2LA 3BAWA 3L2MA 1N0XH 2PR4H 1KXQE 2CLRA 3CSBA 2XN9A 2QGBA 3FQYA 2QQLL 4YEEA 3KGTA 2QLVB 3V0WH 2O61A 3FU9A 3PAZA 1WBXB 4O2FA 1G7PA 3GSRA 3PAVA 3SPGA 2W0LA 4Y2DC 5MENE 2FX8H 3LRLA 5CCKL 1THCA 1KBKA 5DU7A 3CFBB 1A6UH 1RULL 2X05A 2VXSL 2XWTB 3RNQB 3E6HB 2B08A 2AJYL 1LEGA 2J8HA 2N7AA 3B2MA 4CBZA 2OMYA 3WFCH 4MDRA 3WV0A 1JCVA 3GRGA 1S9XA 3KLHC 3RGVC 3ELQA 2C8NA 2X89A 1KXHA 4GBXB 2YXVA 3RWGB 3C6SB 4M00A 2BFVH 4WJG3 5HHME 4U1SB 4P5KB 3KHOA 2B59B 2JI2A 1F6AA 2RB8A 3QHTC 4UMGA 5DRNB 5I5JA 4I88A 1HH9B 3DIFB 4PRPB 3LH9A 4OGAD 2WIIB 3FOMA 3KPPA 5IMMB 4LCIH 5JO5A 4TNWK 2F58L 2Q5BA 3ZQWA 3FFDB 2K3TA 2WJ5A 1DJZA 3VFOB 3O9WD 2APFA 2WM0A 1TYJA 1W0VB 4BFNA 4Z95L 4RGMB 2BOCB 3FB5A 3NVQA 5D71H 4U6YB 3G5VA 3O3UN 1GR7A 2NY3B 5FYKL 1BZDA 2BOBB 2BK8A 2BIMA 4PJ8B 5DHYB 1KB3A 3PHSA 3SDXF 5E5UB 1WJ3A 3FT9A 2WZAA 4JZNB 1KCBA 4PUBL 4WI0B 1CI3M 3EH1A 3LNGA 2D7TH 3NFNA 5GS1B 1MY7A 4Q58C 4NN5B 4DO5A 2HRPH 2X10A 4ZRGA 3VXSE 1MZYA 5I0WA 3V4PL 4APQA 1IZKA 4RZCB 4NQCD 3VX1A 1A4JA 3ZKXB 1BVZA 5AUMB 5I1EH 2GHZA 1O6SB 1SLUA 4RZKA 3BEWB 4OCMC 4AIZB 5AVYB 3IDUA 4JAMA 4EN3C 5FECA 4WSGA 5JYMA 5EU7C 3LZFL 3GJFB 1FV1A 5I15H 3BUBA 5F97E 3SQOL 4U1GB 4O02A 3QCVL 5IFAL 4LRIC 1ACXA 4OJFL 5CSZA 3S97C 4I9XA 5FUCC 1M9WA 1Z9NA 4KH2A 5T3XD 2ZUWA 1QTSA 1JTOA 5JW3H 1H6TA 3IEAA 2D7MA 3WSQH 2VLRB 4Y1SA 1WIPA 2DKSA 4V1DB 4RETB 3ZZQA 2Z65C 3ULVE 4DKFH 4XBMA 3D07A 1YUKB 1TNMA 1PKQA 3Q2CA 4L8DA 1HE8A 3NPSB 1AHWC 4JY4A 3MRRA 4LP4A 4NDMA 4EQ3A 1PNDA 2X0UA 3F8UB 4WU7B 1F1GA 1B9KA 2V7NA 4TF4A 2YUZA 4A37A 4K23H 4MQTB 3HLAB 2WLLB 2VM3A 3T4AB 3PQYB 3JTBA 4UUJA 1A6VH 2CDGA 1JGLL 2CR6A 2XVKA 4KNSA 4MD0A 2KHAA 3QO0B 2P8PA 4NM4H 2AEWA 4PJEF 3TL5A 1MF2L 2J6EL 1HHJB 3JXAA 2X4QB 1ZANH 4GRMA 3ARRA 1EAPA 1JFQL 2QDWA 1J05B 1TETL 4XCNA 1QD0A 4HJ0D 4NQDB 3IFPA 5AYUL 1SYSB 4K71C 1OIOA 3X3FL 1U3HB 2XIBA 1X4YA 1EBPA 5DD1L 1KT2B 5IB5B 3ARFB 4IRZA 3L1FA 3BRGC 2EC8A 3GWJA 3N43F 4XGZA 3WO4B 1EJOL 2V2XB 4J3OH 3CDGB 4ACPA 2QKSA 3GB7A 4X5LA 4F5CA 1IC4H 3D50A 4ADJA 2CDFA 4P9ML 4M1DL 5D7IB 3U2SA 2AJSL 4KITB 4FP8H 1YYMH 3JV6A 1EXUB 1RPQA 1HAUA 4PGCB 3L45A 5A2FA 4N90E 1QG3A 3BVWA 3CN4A 3EYOB 3FU0A 4JDTL 4U1KB 3RL2B 5SV4A 3TBVB 4HEME 2OA9A 3GSQA 1WQVT 4B96A 5TE7L 1ERNA 3K7UA 5EO1B 5E1QA 5HHQA 1A3LL 4KK6C 4LQ1A 1QRND 4PLOB 1CGVA 4N0UA 5C08E 3UTTB 4E41E 4D9QE 3OSKA 2AMGA 3FN3A 5CXPA 5IUCA 4HJGB 3QDGA 1ACYL 1QFUH 3CZNA 2YXFA 3T6VA 2G5BB 1YMMD 4P23D 1UM5L 3I9GL 2HVKB 1CDYA 2J8UB 1YEDB 4HGKC 4OF0A 4PY7B 4X6CE 5DJAB 2FL5B 3SDDD 2DM2A 2F53D 2GY5A 3O8XA 1I9EA 5T1KD 1UA6H 2ZPKL 1VACA 3UJIH 1R46A 1YNKH 2W9LA 3IJEB 1GRWA 5KSBA 2PXYA 2IH3B 1NGWB 3F01A 3I6LE 2GJ6E 3Q9PA 4XNZB 4KNTA 2WTOA 1BQHB 3PIQA 3DGGB 1TMCB 2MTAA 3O4LA 5SWQA 4YMPA 4NFBA 5I8KL 4N8VG 5F7EH 3B4NA 3CV5A 1GVIA 2IMNA 1NCHA 1BJ1H 2JE8A 3EBIA 4PWIA 4QRTA 5CD3B 3UPCA 1IGTB 5CINH 5HI5D 1EFQA 4OT1H 3MLXH 3LKRB 5CU9A 3O6FB 1G1YA 2AABL 4X9HA 5IQ9B 3SDAB 4LOFA 1E5BA 2AGJL 3QWNA 2ARJA 1UEMA 2XJLA 3DIVA 3VUAA 4AV0A 3PGDB 2P48B 3FTGA 5B7FA 2EIEA 4DOHE 3HNSL 4ONOA 4M5ZH 4PR5A 3QDJA 1FH2A 5LGJB 3RA7H 5K5YA 1MCFA 3F65A 3NJKA 2ZSVA 5IVXE 3ZE1F 1M57B 1XMEB 4XVTL 3MLWH 4XTRD 5TGBB 4KZDH 4QY8B 4D0DA 5KVEH 3CVBA 3GDCA 4U2ZA 2IPUG 1AXTL 1X9UA 4MJIE 4R96A 5C0FA 2VUKA 4BIKA 4JFZH 2UYLB 1WGVA 1WAAE 4K2UL 5FW8A 1FG9C 4JKLA 4AQOA 3PWJA 3KWUA 5KSAC 3BKCH 1IGYA 4Z7WB 3L4CA 1CMOA 4NHUB 3ZHNA 3SDYH 5J11B 2KDYA 3GS4A 3BAKA 3RTQC 3ULSA 3H56A 1WZ1L 3PWPB 3NIFF 2FIKB 4D2NA 5KG9A 3OXSA 4L3FA 4HK0B 1XB8A 3L5XH 1BJ1J 3SZ6A 4FOMA 1T83A 4P2QB 4QUOA 4JO1L 5B1JC 2YLHA 3U4EA 3D39E 3O45B 4XX1G 1T7VA 4OCRL 4QRBA 5TQ0H 5BOPA 3N55A 4AIOA 4P2OA 5MENA 1FE8L 4NUMA 4HUVB 1FNEB 2B4CL 1J7VR 3QXVA 3TURA 3FRUB 3SE4C 1NCAH 1U6AH 5J89A 3WIIH 4ZO6A 2F74B 4O02L 2HCZX 4LL9A 1DANU 5CZXD 1CQKA 2ESVE 5IHUH 2W9DL 3CFDB 4PVBA 5BO1H 2A9CA 4JFEE 1USZA 4XR8C 1I1YA 2CRZA 4AH2B 4BKLA 1D6EB 4QAWA 4PG2A 1BG1A 2E8ZA 1MW2A 5D6CB 2BNQD 4WY7H 2EDWA 1HNFA 3FSAA 4F15C 4K3DL 4BDVB 4Y4FC 3LKQB 4AQZA 3LPWA 4JPVH 4MAYA 4YSCA 3MJGX 4PJIA 4TRPH 3BH8B 5LHDA 1AD9A 5JA9A 2X88A 2EIZB 1SVZA 2MPVA 1HINL 4X4YA 2APTA 5KBDA 3HG1B 4HFUH 4JFHE 5GJTL 3ULUC 1VZIA 4KK5C 5HYQB 5I6XC 3BD4A 3CDZB 2N1KA 2ZAHA 3FUDA 2BIQA 3DMMC 4UBDC 4YNYB 1I1CA 1JYNA 1BAFL 3MXWL 1YN7A 4WW1B 1CR9L 1UT9A 2DKUA 1Q1JH 2LABA 2GBAA 1MCLA 1QBLL 4HS8H 5HYSG 2W88A 3VI4E 4TOYH 3VXSA 1T7XA 2BHUA 4DO4A 4UTAA 5FO8B 2HLFC 3ESPA 5AOZA 3RWJB 1IJ9A 3GSWB 2FLRT 3WELA 4BH7A 2IO5A 4DKDC 1XFPA 4IRZL 4M6AA 5CGMA 4JJ5B 1EEUA 2BSTA 4KKAD 3X2QB 1MFCH 2W5PA 4PP1D 1XDTT 1FFOA 3PHOB 4KDTC 4GNKB 3WI9A 4FMKA 4IBTA 5KANI 1M71A 1QEXA 2FJHA 4N6RA 5JOPD 1D9KB 1KLGA 1P1VA 4EOWL 3QA3A 2HJLA 3TO4D 3RZCC 3UYRL 1FL3A 1QA9A 4WLCA 1N7MH 4XNBA 4RFEA 4HOZA 3SE8H 1JGVH 3MLVH 4UAOB 4YQXL 3UYPB 5I6MA 1E5YA 1ITBB 1XH3A 1OTUC 3VG0L 4P46C 5JIIA 1XIWB 1G6RH 4JFYB 4MJ5A 2H6PB 4PJ5D 4OTXL 3H7BB 3RWFB 4FN0A 3V6OC 3HRZC 4I2XB 4M3JA 3CQQA 3OQRA 3QFJE 4GKNA 1OTTC 3NZHL 4LLWB 4QOKA 5IROC 1NEPA 1OCZB 2X2UA 3V0AC 3QI9C 1QWHA 5BOJA 4XB3A 4HW6A 2F54E 2O5XH 3CAFA 4L9LC 4HDIB 4YEFA 3OQ3B 5J1AB 1A9EB 1J12A 3DYPA 1F3JA 4ZSOE 3VO0A 1MRCH 2W60B 2K8MA 3ABGA 25C8L 1U8HB 2CRYA 2ADYA 3MV8D 3OKNB 4P4RB 3UTOA 4ZTPH 4Z7OE 1BPVA 1LDPL 3L4ZA 5D2NB 3RJOA 1JGDA 3PE9A 2NW2B 1U8QB 4NO5A 5C0RL 2GI0A 3IMSA 5F7YC 1R3IL 3FRPG 3ZSTA 1GGBH 2RBLA 2L7JA 4RAVB 1JNLL 4EIUA 4YSUA 5L4MA 3CLFL 3I02B 1V3KA 2YQ2A 4CN4A 1IJNA 1J5HA 3GMLB 4XO8A 1IBYA 3FUNA 1JZ7A 2EDFA 3MCYA 4IMLB 5JPMB 1JSYA 4A38A 2R9HC 2J56A 2HFFB 3ZPDA 3AU0A 4N0FA 4NO0B 3QNYB 3T0EE 5CBEB 3D05A 3IS1X 3ELAT 3MJ8A 3QISA 5JHAA 3IVKB 1XF5A 4E5XB 4QLRA 5ID0B 3DHPA 5A1AA 1T6VN 4YDMA 1ECZA 3FPYA 3T0VA 5KBPA 2Z6FA 1DQTA 1O5DT 4YDKH 3PDOA 3HKZA 1SNRA 5AW2B 2MHAA 3K6FA 1CK0H 3IJHA 4JBSA 2Y72A 1S9KC 3MBEB 4PWFA 1AGBA 3NBNA 5GGVH 3GGWB 1ECYA 4RFNB 4TQEH 5C08A 4E41A 3MRBA 1I8IA 3MLZL 5D1QC 1KCRL 4NQVB 3LS5L 1RJLA 4L4TB 3LQAL 4N85A 1QI3A 4OCWL 2DIAA 2FB4L 4U1JB 2XZQH 3CDFA 4AYDC 1LVEA 3GNML 5T33L 2YA2A 3G5ZB 5C09D 2XIIA 2EZ0C 1J8HD 4S1RL 1KB5B 3MBXH 2P4AB 3B43A 5DLLA 3WJJC 3KLSA 3QCUL 4H0LC 2WZPA 1OM3L 5I1CL 2W0FA 5ETUB 1H9VA 2BVUA 3J7HA 1UJ3B 1F13A 2Z34A 5E8EA 2DQIL 3VGAB 2OJZL 5D7HA 7TAAA 1KYOK 5TDNA 1E5CA 2O6DA 2IBZX 3VFPA 1S7WB 3EH3B 4M5YH 1W80A 3OG6B 4OIBA 5ICZB 3GBNH 2PTTB 3F58L 4UIMA 1URIA 4PJ9A 1UB5B 3QARA 2C7UA 4EE2A 3FB6A 3MZTA 4KRPC 5I1AB 2QQNH 2VAAB 1T4WA 1BVNP 1VEPA 4N9OB 5FB8B 3G08A 2VE6B 4CU7A 1BZOA 2YAQA 3SQBA 2ED9A 3REWB 4F8OA 1ZLVK 3MRQA 2P7TB 2Q86B 2QQLH 4C56E 4J4PC 5D7JA 4KKCD 2E7DA 2ORBL 4WI8A 1DQQB 3BSZA 3SCMC 2MCG1 2QL1A 3JT2A 1MI5E 2X89D 5DRXA 3HTLX 4P5RA 2DI9A 2WTRB 3PNRB 5DZOA 1RSFA 2ZXQA 5HI3C 1RULH 2VXSH 3IFOB 2AJYH 3LNFA 4POYA 4HHWA 1T2QL 4NNXA 1N26A 5JNYB 4MJIA 4AZUA 1B0IA 1LMIA 3TBYB 3EHBD 4XMUA 1T0OA 5FUOL 4KZEL 4WFGE 5DJ2B 1JZJA 3LJ3A 2EXSA 4HKXA 5C0ND 1GXEA 2QVMA 3O2DA 3RDJA 4A2EA 3GLDA 3RX9A 1ZVSA 1BSIA 3ALXA 4QHKI 4R9HA 1A64A 2FWOB 3N41F 4ZMYA 1HXKA 1KYUA 5DRWB 4Y5VA 3TYFB 2UZXA 1T04A 3T2QA 4LPVA 4PYHA 3HFML 4RNRA 1CLOL 1NGQH 4UV4H 3H3BC 1A02N 4UTAL 1TU2A 4A67A 3TBWA 3BAXA 2YD9A 3H53A 5F0LB 4Z95H 3M1BB 1OOWA 2YPKA 3G5XA 2P80A 3HZMB 4HMEA 4F1ZA 4MNQD 1KBGL 3CZSA 5FYKH 4O58L 5T1DL 4APQD 4K94C 3UTSE 3W38A 4XPGL 2XWJA 3DXAA 3TTSA 3CSGA 3UPRB 5J3HC 4JK0D 4PUBH 4HWNA 2PYEB 2AV1B 2ESVA 2X7LA 3K1DA 5D93B 3TH2T 3W39A 4CVXB 2XN0A 2HT2D 3DX8A 1N10A 1SY6A 4W9LC 1ASPA 1RZIA 1YQVL 3V10A 4APXA 1JPFB 4JQVC 3ZZ1A 3NIDB 2VM9A 1HCYA 2WCSA 3W0WD 1BA9A 3TNNB 1N8ZB 3RKPA 3QUKB 2YLKA 3I2CL 4BRVA 3QS3A 1JPGB 3C5ZC 1HEJC 4I0CC 1E3XA 5A43C 1PGRB 4MQ7A 1RUAL 2DY2A 3FO2B 4JRYA 4L8CA 4Y2DB 2QADD 3SQOH 3BAIA 5IFAH 1FVDA 4CN1A 2MCAA 3FU7A 3TV3L 3EGXB 2EVGA 4OJFH 2H2PC 1ZMYA 4J1UA 3CVIL 4M7KH 3ZGHA 2E27L 2ZZUT 4OIAA 2HXAA 4LGSB 4R2GB 1RK1B 1IAIM 3BO8B 3MRCB 3C6LA 4KGJA 4PJXB 4WHCA 5IK3B 1G7QA 1VFBB 1BVKA 3QIWB 3F5WB 1IUZA 1J1PH 4KBPA 3KVPA 4LVNC 5D8JL 2OYLA 3L3HA 4DJMA 4I18B 3ARDD 5TF0A 4BA8A 4LCYB 4YFEA 5BRZB 3BXNA 5B4MC 2WLNA 2XQ0A 3OZLA 2GSMB 3U30C 4DT2A 1QLFB 2JB6A 1R3JA 5E9AA 3TYGH 3NDZE 4C54A 2I07A 2P44B 4ODBD 1H0DB 2F1EA 4Q9BA 2BZCA 2R1WA 4PJDE 5FYJE 2UY7A 4N3TA 4ANUA 4A2DA 1A6WL 3L1GA 5CFAA 3EFOA 5DJDA 3AG1B 5F88B 1WIOA 3B3BA 5FGRA 1MF2H 2BRRH 3C9NA 2I7SA 4GQPH 4MAZA 1Z9LA 3SODB 1JFQH 3IYLW 1TETH 1R3KB 4ZXBA 1NBQA 1JZEA 1ND0A 3BMVA 3QUZB 2AXFA 4UT7H 1IVTA 4FLRA 2DN7A 2EE2A 4PLKC 4W9IC 3X3FH 4OLYL 2NXYD 3ZL2A 4H25B 5DD1H 1YDPA 4C58B 4XNXH 3RJDA 1SPDA 4FJ6A 1BEXA 3BFQG 4AMKL 4CGTA 2I27N 2VLKD 3WN5A 4MXQC 1IQWL 4Y2OB 3WENA 1PLGL 5HDQL 4XN2A 3AB0C 2DQJH 3ISYA 2AQ3A 4M1DH 2FD6L 4P9MH 2HLAA 2AJSH 4PRNB 1PZ2A 4LDOB 5IY5B 1P7HL 3DJ9A 1J5DA 3Q1EA 2C9RA 3CSPA 1QTPA 3QFJA 4IBYA 1OCWH 3AY2A 1MFVA 2HRHA 3QDGD 4NKOB 4JDTH 5KS9E 4HIXH 1UWXH 1EAQA 3SIKA 5T3ZD 4CJ1A 5JHDD 4UQAA 3O8XD 1A3LH 3A4FA 2PMZA 3K5SA 4F7EA 2O30A 3MLUL 3V2AR 4FADA 4OZ4A 2XWEA 4GG6E 1ACYH 2P5WE 5CEZE 1KTLA 4G71B 2IVFC 2ZF8A 3ZE0B 4G83A 3QH3A 3ZTNL 1UM5H 2KQMA 3I9GH 4KVNH 4Z9KB 2X2IA 4G6AD 5EA0H 1TVBB 4GXUN 1JK9A 3ZQ9A 1PZBA 1AHWB 4RSYA 5ECJE 4KX7A 5EC1B 2ZUYA 3LQZB 4ZX6A 5ALBL 1E9OA 2HRLA 1SDAB 5EOCL 2BNRB 4ZS6C 4DP2X 1LO5A 2EIBA 4XAWL 3WAJA 2IDFA 2QGDA 3BSZL 5IJVA 4IOIB 4GRLA 3HZYB 4LE8A 3SGKA 1KIUA 3RIFF 3D85B 5FO7B 2K1MA 1ZE3H 3GRWH 4YDJA 3RE0A 3KYKL 3PABB 4B9CA 1EJ8A 3GO1L 1C5DB 4H8VA 3P3UA 5F9JA 4ABUA 5B8CA 1KG0B 1FL5B 2AABH 4KJYA 4BHUA 3NEOA 5JW5B 1RIVL 3ARXA 4AENA 4WI2A 4XMVA 2AGJH 3SD2A 3LXCA 3TU6A 2MOVA 4LCCA 5D5ME 3QFGA 4XMTA 3QT2A 3FW6A 3O2DL 1MW3A 4DEWA 3TESA 1N59B 2GW5A 3HNSH 1G7IB 3FB8A 2W81C 3ATFA 3GS7A 2APWA 1KTDB 2NUPA 2Y2WA 3WLWD 4OU3A 4BD4A 1VRSA 4UDTA 4ES9A 5EBMA 3N1QC 1WA1X 4XVTH 5GGRA 3NP4A 3QZWG 3IFLL 3F7YA 4HOWA 1UACH 4HUUA 4C59B 1AXTH 4GSUA 4U0RC 1RK0B 3TWYA 1RV6X 5C3LD 3VXNB 4P5MA 1TQTA 3QJTB 4K2UH 1Z9SB 3QO1A 1FL6A 1FVCB 4PJFF 3KXFB 1ADWA 3CFJB 2KZ1B 2VWEC 2EYSA 3SO5A 5KVFE 2AJVH 4ETYA 4EKXA 1BIIB 5GZOA 4LEOB 5MEND 2CLVA 4ORGB 1LMKA 1SY6L 5I1IL 4MKTA 1K2DA 4N8UA 2EYRA 2EXWC 2F6AA 1KF9B 4Y4HA 4JO1H 2X09A 3ETBF 4A6YH 1D3CA 4JDZB 4S1DC 2G3ZA 3D3VB 4IGBA 3L7EB 3SSGA 1JPSL 1V55B 1FE8H 4NQSB 5FDWA 2DD8L 4L8BA 5T8IA 1P1ZB 2B4CH 1AGDA 2K0RA 3BQUC 4ZPTB 4P5TA 1H3UA 2X2YA 1CTMA 3LEYH 1ED3A 2NNFA 1ZHBB 1P7QB 5HY9A 4B53A 3F7VB 5HHMD 1WFTA 3IRZA 2TRYA 2PO6A 4AQ1C 4BFEA 2O5NA 3L17A 1JI2A 1F2XK 3DHUA 2OYMA 2DWXA 5D96B 5EFIA 4M61A 4A39A 2PWEA 2WXGA 4FG6C 3VD0A 3MRLA 4MAYD 2HN7B 3GKWL 4L0PB 3QQ4A 1TDQA 1KC5L 2EP6A 5SWZB 3RFZB 1AKJA 1IM9A 4OLVL 3B2VL 3HPLB 2J8OA 4FG2A 3VRLE 4K3DH 1KN4H 2OMUA 4HEPA 4FS0A 3RUGA 4FQXC 3VFSB 4ZW3A 4E9QA 3GFUA 1G0YR 5J1SC 1FAIL 5F1IA 4CJ0A 2DQFB 1NDGB 3P77A 2JTYA 1RMFL 4IBLT 1A66A 3MBWA 1G9ML 1QQDA 3RWHB 3VXSD 4DKEH 2ZWYA 3F6JA 1IKOP 1TFHA 1SM3H 1ZHKA 3MXWH 1SOSA 5KSAB 1JF1A 3QFDB 1OKEA 2HT4D 3OG4B 1OP5K 2FLMA 4OW6A 4HXAH 1HKLL 2QFPA 3RB7A 5IT2L 2VJ8A 3V0JA 4HKBA 4UM9A 4NCDA 3IU3B 4Z3GA 2ZCZA 3BKML 5C86A 1QP1A 3PUCA 4IRZH 4XN1A 4XN7A 4HWUA 4V1DE 1NOAA 2FEDC 1UQSA 2RFXA 1A7PL 5A2KH 2CO4A 2Z35A 3IPFA 3QIBB 4FXKB 3AUWB 2HFEA 4G3YL 5DJZA 1RP9A 2ZUXA 4P05A 3IE4A 2I32A 2YPVA 3UTZB 1NCGA 4QHUB 3RLSA 4EOWH 2PCYA 3ULVD 5T5FA 3MLPA 4LQFL 2CAKA 3MNWB 3SYQA 3TNMB 3BUYB 1XGYL 1ZTXH 4XO3A 2WOBA 1RH8A 3JSSA 3NABL 4B9KC 4HIPA 1MDAA 3AU1B 4JN1L 2DWYA 4OFQA 3KPMB 5E4IA 3MLTA 2WVTA 2QV2A 1MRDL 4MBOA 2WWKT 3MJWA 1CTOA 4GP8B 1J5OL 2HLEB 5CMAB 2QQQA 5EBLA 4GG8A 2X53A 1AXIB 1CL7I 4XMPL 2HA1A 3NCXA 5EU3B 2XX1A 5CR1A 3LB6C 4OV6F 1F4WL 2NXZB 2EE3A 4OTXH 4QRFA 4LIQE 4F15B 3CUPB 4GT7A 1FQ9C 3NZHH 1WLHA 2C9QA 1PIGA 1EMTH 3RI5F 1G7HB 4AJ0A 3ILEA 3TWCL 1QVOA 2EYTB 1C12A 2OTWB 1GS7A 4HIJA 4XZUA 4F33B 1AY1L 1YC8A 3VXUB 3CC1A 2VH5H 1HNGA 1UCTA 1G6VK 2R0ZH 3AACA 5I6XB 1S6NA 3S5LG 5M95B 5J12C 3C6EA 2YN3A 5CLYA 4JKMA 1LDPH 1L7TH 2QTVA 5DZLA 1AJ7L 1S3RA 1DDHB 5AW6B 4JMXA 1S5HA 4PV1C 4PBXA 5C0RH 1Y6NR 4Z0BL 2KI6A 2D7NA 3UJJL 1R3IH 4I0PC 3VFGL 2DQTH 3MV11 2ZWKA 3L95A 1MHEA 1JNLH 4B9FA 5E6UB 4KRNA 4TNVF 2D3VA 3WIFA 4OF7A 1EDQA 4KO5A 1LD9B 2OM5A 4F7PB 1QACA 3P4OA 1GAFL 1ORSB 1OV8A 4N90D 4PJ7B 4PS4H 2VRKA 2A5UA 4R4NC 4FXGA 4PRBB 4HK3N