3UGEA

Silver metallated pseudomonas aeruginosa azurin at 1.70 a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Azurin
publication title Silver Metallation of Pseudomonas aeruginosa Azurin
rcsb
source organism Pseudomonas aeruginosa
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ugeA00
1AG0A 1L9RA 2XLLA 3ERXA 4KO6A 2BO0A 4BWWA 2VW6A 4DP8X 2OCCB 2IWFA 4AI7A 3S3CB 1ET5A 1TEFA 3L45A 2FNWA 5B3SB 2IWEA 3IEAA 1WA0X 2DWTA 1T5KA 5I5IA 1V10A 4ENZA 4G72B 4YSPA 2DV6A 1WS7A 4CSPA 2JKWA 4JHVA 1GS8A 2I85A 2UX6A 1RZPA 5I6NA 2AZUA 1J9SA 1ILUA 4KNUA 3FU7A 1SFHA 1A4BA 1M56B 4PAZA 3NYKA 1NPJA 3TA4D 3WG7B 1X9RA 2XWZA 3MX0B 1R1CA 2YARA 3QJVB 4E9YA 4KO5A 2Y69B 3NJGA 4BXSV 3X1EA 3BVDB 1JXDA 3TBBA 4QKTA 3QJSB 5B1KA 1F56A 3N2JA 4DP4X 3C75A 2QDWA 2VSKB 4GP5B 2W88A 3HB3B 1ASQA 1QLEB 3ASOB 1CYXA 2R7EB 1DYZA 5I6KA 4NERA 2AZAA 4HHGA 3T6VA 3NSDA 4P5SA 3T6WA 1KV7A 3CDZA 3NJMA 1URIA 4YSAA 4L0PB 6PAZA 4A66A 1IC0A 4PCYA 3HEIB 1AS8A 2P80A 1SDDA 2PPCA 3H4HA 4Q8BA 3WI9A 2B08A 1NINA 2HX8A 1AIZA 1NIBA 2VN3A 4QLWA 2GC7C 3FYIB 1PCSA 1SF5A 1RCYA 2XXFA 5LDUA 2BZ7A 2XX1A 1MG3C 1ILSA 1CUOA 1NICA 1JZIA 4YL4A 4BWTA 3NJNA 3BQVA 1BQ5A 2W8CA 9PCYA 5IY5B 1OCRB 2WO2B 3NJIA 4DP7X 2EIJB 5EHFA 1MZZA 4JKNA 1KGYE 4GP4B 4E9XA 1JOIA 4A2HA 1AZBA 2YAMA 4DP1X 5I6MA 4NAJA 3CG8A 1IBYA 2PPEA 2GC4C 5PAZA 4WKXA 4N8UA 1E30A 2UXTA 3X2QB 1NIDA 4UAHA 2H5UA 3JT2A 1A65A 3FU8A 5FC9A 3UACA 1ID2A 2I7OA 2UXVA 4HHWA 1BXUA 2IH9A 3NP4A 2J56A 2VMJA 3G5WA 3QJTB 1FFTB 3ABKB 3WKPA 3IE9A 2YAPA 2CBPA 1J9QA 1J9RA 2YXVA 3CDZB 4CSZA 2BP8A 1JZJA 5D4JA 2FTAA 3QJUB 4YSDA 3ZIYA 4EF3A 4YSEA 1GS7A 2XXGA 2QPDB 2YAFA 3H56A 4P5RA 1N68A 5AKRA 1EHKB 2BZCA 1JVLA 3S3BB 1SNRA 2Q9OA 2PP9A 2ZWNA 1PMYA 1GY2A 1PLBA 3FSZA 2WSDA 5B1JA 2PCFA 1OCZB 3U25A 2AANA 5D4IA 3ABMB 3NT0A 5B7EA 1HAUA 2CUAA 4DP5X 4KOBA 4HALA 3DTUB 1JVOA 2FWLB 4DPCX 3GXUB 5B7MA 2FT8A 1OE3A 2E86A 3V9EA 2BW4A 1GR7A 3AY2A 2MRYA 3V9CA 5I28A 2QT6A 1B3IA 3AZUA 1M9WA 2AVFA 2GBAA 2IDSA 2VM4A 5AFAA 5D4HA 3UADA 4BXVA 2PLTA 1FA4A 1GS6X 3FPYA 3AG4B 4KNTA 4RH4A 4BWUA 5I5JA 1FWXA 1M57B 4DP2X 1OOWA 2WO3B 2BP0B 1A4AA 2XX0A 3QQXA 4GYBA 1PZBA 2EINB 1BYPA 2GHZA 1ET7A 1XMEB 1N70A 3FSWA 1ZIBA 4G70B 4BK5C 1OCOB 3ABGA 1KDIA 1NWOA 4E9SA 1L9PA 3NJFA 3QJRB 3UABA 1BQRA 3T9WA 1CURA 3CVDA 1IUZA 3IN2A 3ZX1A 2FQGA 2XVBA 2XV3A 2IWKA 2BWDA 5I26A 4HIPA 3EF4A 4X4KA 2DYSB 3QJQB 3NSCA 2N0MA 5PCYA 2MTAA 1OCCB 4HCGA 4TXVB 2NRDA 1AZUA 1BAWA 4YSTA 1W8EA 2B3IA 3FU9A 1JZGA 1BYOA 1IBZA 2PPAA 4E9WA 1WA1X 1ASPA 3OMIB 4HCIA 1TEGA 3NJHA 1JERA 5ANHA 3UAEA 2HX7A 1I53A 2XV2A 1XB8A 4DP6X 4E9RA 1PY0A 1A4CA 3X1FA 1L9OA 1V55B 1NPNA 5I5MA 1EZLA 1AAJA 2FQFA 1YLBB 2XV0A 4FAAB 2EILB 1HAWA 3ZDWA 1OF0A 4E9QA 1NWPA 3GDCA 3FU7B 4A2DA 1NTDA 1E5ZA 2PP8A 1JZHA 4UANA 1PAZA 1ZV2A 1PF3A 3H4FA 8PAZA 2XYBA 3AW5A 1AZRA 2HRHA 1RKRA 3T6XA 3TBCA 1NIFA 4DP0X 4HAKA 1E65A 1AZCA 2XUWA 3NSFA 1NDTA 1KYAA 2HLEB 2YAQA 5B1AB 2ZONA 4A68A 3S8FB 5I6LA 4KO7A 1NIEA 2BHFA 2FT6A 3OMNB 3QPKA 3ABLB 3WNIA 2OV0A 7PAZA 2Q5BA 2FT7A 1KCBA 2QPEB 3DKHA 3OMAB 1PZAA 3NJKA 2IDFA 1OV8A 7PCYA 1KDJA 1SDDB 3AG1B 4YSSA 4G7SB 1J5CA 4E9VA 3D12B 1SHXA 3OM3B 4E9TA 2VM3A 3FT0A 2J55A 2DY2A 2OJ1A 5A7EA 2BW5A 1HFUA 2PCYA 3PPSA 5B1JC 4MFHA 1AOZA 4YSCA 1GYCA 2UXGA 1ZDSA 2IAAC 4N4YB 1DZ0A 2ZOOA 4BDVA 4YSQA 3PLYA 4AKOA 1RZQA 4GY4A 3FPXA 1AZNA 2YAEA 3X1GA 3AG2B 5TK4A 1SFDA 2HRGA 1W6WA 1MZYA 4YVNA 2H47C 2ZXWB 4K9JA 1VLXA 1ZDQA 4W9ZA 1TU2A 3OQRA 1NZRA 3CZUB 1SF3A 2FQDA 1V54B 2YQBA 4AKPA 4M3HA 2PPDA 4KO9A 3CVBA 2FJSA 3NP3A 4NB7A 2P80D 1MDAA 2EIMB 3S8GB 1KBVA 1IKOP 3IBOA 3UGEA 1BXVA 2UX7A 2IH8A 4FA7B 1KBWA 1TKWA 2GIMA 2JXMA 2LLNA 3TU6A 4JHUA 1E5YA 2EIKB 3EH5B 2A3TA 2RACA 3GYRA 2BP8B 1AS6A 3N55A 2VW7A 3ASNB 1A3ZA 2IDQA 3PCYA 4G7QB 5B1BB 2VW4A 4WTQA 3PAVA 4ZK8A 4A2GA 3PAUA 1AG6A 3PXLA 3KW8A 1JZEA 4Q89A 4A67A 1KCWA 2TSBA 6PCYA 3JTBA 1X9UA 3EHBB 3FS9A 1UATA 3NJJA 4HZ1A 5TK2A 4AZUA 1PLCA 2VSMB 2QDVA 3KW7A 4YSUA 4BDVB 4DPBX 3RYMA 3WKQA 1QHQA 1BXAA 1BEXA 1J9TA 1A8ZA 1GSKA 1PZCA 1OE2A 2Y1AA 1AACA 4F2EA 1XB3A 2I7SA 2YXWA 3OD3A 1WAEA 4KOCA 3FSAA 2TSAA 4YSOA 1AR1B 4F7KA 1OE1A 2HXAA 2JFCA 3SBRA 4HCFA 2HZHA 5E9NA 3DIVA 1J5DA 2J5WA 3AG3B 1XB6A 1BQKA 1GW0A 2GSMB 2PP7A 1QNIA 3TASA 1WS8A 2BWIA 1L9QA 5F7BA 1ZIAA 1PLAA 1ET8A 3FQ2A 1L9SA 4M4RB 1AANA 2IDUA 2DYRB 1ETJA 3X1NA 3ZBMA 3IN0A 4YSRA 1E67A 1L9TA 3NJLA 3WIAA 4GXFA 2YAOA 4DP9X 4A2FA 1AS7A 1WA2X 2XU9A 2FQEA 3T6ZA 3FQ1A 2HX9A 3MBWB 4A2EA 4AKQA 2X87A 1W6LA 4KNSA 3PAZA 2AFNA 2CALA 4W1TA 3S3DB 2PPFA 1ASOA 3SQRA 3SBPA 5F7AA 1ADWA 4GP8B 2CJ3A 4YVUA 1CC3A 3EH4B 4AX3A 2GB2A 1NIAA 2BP0A 3T71A 1MG2C 3FSVA 3CVCA 3NSYA 1GY1A 2CCWA 1JZFA 3WNJA 2J57A 5I6OA 1PNCA 1CYWA 1JXFA 3SBQA 4F2FA 1ZPUA 1SJMA 1JXGA 2H3XC 3X1BA 5AZUA 2GI0A 2UXFA 4G7RB 2R7EA 1AQ8A 2CAKA 3EH3B 4DPAX 2IDTA 4G71B 3FQYA 2DWSA 2X88A 2YAHA 1PNDA 3FYEB 3UAAA 5I6PA 5B7FA 1SHWA 4UF7C
chains in the Genus database with same CATH superfamily
4ZSOE 2A7BA 2V2WA 2XLLA 4RBPH 5J6HB 1O75A 4OZHF 4HPYH 2JI2A 3GO1H 1TEFA 4ALAC 3DHPA 1LE5B 1TYRA 4ZOBA 2FDBP 3ROOB 3PIQA 1NMCC 3Q1SH 3NA9H 1TETH 5C2BL 3EO1A 1R5WB 3OF6D 1KPVA 3RPBA 5LQBL 2HFGL 3PQYB 2VXVH 3KLHD 3IDJB 2W60B 2YMTA 4XMLH 5FDWB 3MKGA 2OQJB 3T8VA 5B4MC 4AQ1C 4MJ2A 3V7AG 4EKJA 4QTHB 1XCQB 3BAKA 3KR3L 1MCIA 2DM3A 3KPMB 3P3RA 4U1JA 1AHWC 5C0AB 1A4BA 3DX7A 3OXRA 4PAZA 1HJBC 5B8CC 3E9UA 1B0RB 5FA4A 2RA1A 1MVUB 4YQXH 2JCCB 5JDSA 4GSXA 3KCPA 2YARA 4P23A 3HKFA 4R6UA 2WIIB 4FQJL 1E4XH 3ZDYF 2X6VA 2JJTA 1U8QB 3ECWA 3QW9A 1HXMB 3FUKA 5FA3B 3VGDA 2ZOUA 4FXKA 5F93C 3BH9A 3LKPA 1WBZA 5KYWB 1SYVA 1FQ9C 5DZ9A 3G3LA 3HR5A 3TM6A 1QLEB 5T3XE 3QUHA 3WS3B 1LNUA 2YD9A 4E68A 1CFVH 4HS8H 5IQ9B 3IMVA 3LVTA 3BAIA 2YMXH 4K7PX 1SBSL 4QTFA 5CAYB 2AJ3A 4PJ8D 1MFCL 1RHHB 2ROYA 4YIQA 1Y18A 3IDXH 5AL0A 2OPCA 4H8UA 5FUZL 2GSGA 4N0CD 2W38A 1GGIL 4QLWA 4Y1SA 1IAKB 1RXLA 2WUBH 5IB2B 2V7NA 5GGVL 4FHKA 3RWHB 3VD5A 4EXPX 5C0CA 3F04A 1FO0A 4QRSA 1JMXA 4L48A 2YLKA 3BD3A 4CDHA 1R3HA 5A43C 4DP7X 3ZZLA 4GMTH 1JNNH 3QQDB 5AOIA 4YPGA 2EDNA 1R0AH 4KH9A 4JM2F 4OLWH 4QOKB 4HKXA 3WJMB 2FRGP 5GRUL 5JOFB 4JZNB 1JF1B 4LPXA 2FWOA 1IC1A 1MEXH 1UVQA 4JPWH 5KS9A 5MEQB 2V6HA 4DO5A 1AKJB 1TJIL 2WY3B 3EYOB 4H8WC 4UAHA 3VSTA 3VWJD 3ZIMA 3GINA 5FC9A 3V4PB 1MHHA 4FFZA 1M7DA 3QXAA 4Y5YB 9CGTA 2DTML 5F1OB 3SSGA 2AJZA 4RRPA 1GIGL 1TZIB 2VMJA 3OJ2C 2VLRE 4U1NB 1G43A 1C8QA 2EEFA 3KGSA 4QAMB 3ZTNH 1T1ZA 1TUPA 3UCRA 1YJDC 3B2PA 4O4YL 4Q2ZA 3FTGA 4N3UA 2XDHA 4YO0A 1KB9K 1T7WA 3IPBA 4JR9H 4KQ4H 3ELQA 1KB5L 5I19L 2YD5A 3ZRCC 1YEJH 3ZL1A 3S4SA 4D3CL 1SEQH 3T3MF 2CWRA 4JJHA 4PJ5E 1MIEL 2BZCA 2CBTA 3MV8D 5DVPA 2ZKMX 5F3HA 2BVYA 3QFJA 3ZYJA 4YWGL 4MYWB 3QB7C 2NW3A 2WNWA 1QUPA 3HS0B 1QRNA 4QCIA 1RPUA 2MMXA 2ZD0A 3MOBL 1NBZB 3BO8A 3EYFB 4HIXL 2B59B 5D4IA 4BSWB 1UZ8A 4LK4A 4E2OA 1A9BA 3LS4L 4Z7VA 5CSZA 1I31A 1HZHH 1MVFA 1C16B 4ZFQA 4A7GF 2FGWH 1XF1A 5J12C 5C09D 4JFZL 4L3FA 3WBDA 4FNUA 4L8BA 4HK3N 5KVEL 1NFDA 4LCCA 2XY2A 4JFEA 1EFQA 4FQXD 4MA1C 4NWUL 5EOQH 3C5ZC 2AXFB 4UQAA 3V4VH 4I9WD 2A0LD 3NPZB 1YYLL 5EPMB 4C54A 3D7PA 4MBRA 5IVNA 1NLDH 5E8OB 1SQ2N 3FOMA 4RH4A 3U7AA 4MJIA 3PNRB 4WIQA 1J87A 3V6FA 5EN2A 4GYBA 3K80A 4ZUSA 4EO5A 5BZDB 2WBJD 2UWEE 3NJXA 4RWYL 3UTQB 3FZUC 5DC2A 1JS4A 4N9GB 4NQEA 3HE7C 3L1EA 4JKKA 3PJSB 3FB6A 3HOGA 2QZ5A 2NCEA 3K72A 3HLAA 1I3RA 3GXDA 4DEPC 4OKVA 4DKFL 2NY5L 2O6PA 5D7IE 1ZVHA 1IVTA 3QDJA 3OPZH 3UJJL 5AVRB 2IQAB 3S8WA 4PRAB 5AAWA 2C9AA 3FFOA 4M5YH 2IWKA 4UZSA 3K2IA 4KK8C 4HXBL 5HYJE 3F7KA 1Z7JA 1CL7H 3FXIC 4KUZH 2ZT9C 5DEJA 2VLMD 3APCA 1RUQH 4OD3H 4HLEA 1WE5A 4JDTH 3ETSA 1CYGA 3MGTB 1UD8A 2EIBA 3O2VH 5FUOH 2X6BA 3L5IA 2ZG3A 3L16A 4LPVA 1S5HA 2PPAA 4JO2L 4M9OA 2DQGL 5EO1A 2DWXA 3DUSA 5DMYA 5ANHA 3RVUD 3SZKC 3RAJL 2BSTB 4XP4H 2H0JA 1S7RB 4IU2B 5CGTA 2EILB 4YHYC 4NJ9H 5E6ID 2VRKA 2QQLL 1NWPA 3FT3B 1E5ZA 3HI5H 1JZHA 3ZKND 2NY5C 2WXNA 2KI6A 4BFKA 3MTRA 1MI5B 2ZOKA 4FL4C 1CN4A 4M93C 4NIYE 4DP0X 5HHMD 3EZ8A 3GUFA 3SHSA 4O9HL 4FFWD 4YHKH 3SPJA 4EZKA 5K1JA 1IKFH 1DFBL 1RPKA 3K0YA 4AYFA 3L08A 4KO7A 4G43B 3UXFA 3GEWB 4TQ8A 4U6YB 3SYCA 4FQQB 3D3VA 5E03A 5L4JA 4KVNH 7PAZA 5INDB 4UTBL 5E8NA 1KCBA 3FN0L 2ED6A 3BWZA 2OM5A 4M7LT 4ODWA 3S6CA 4LASH 3LXCA 2OL3B 2I32A 3TZVA 2R2BB 1KDJA 1CDUA 1ZA3B 3D50A 4KJYB 4X7EC 4F1SA 4PUBH 4Z95H 4E9TA 4M5SA 2DQDL 5DLLA 2XOTA 1RZJH 1UXLA 5HYQB 2EDWA 4LB8A 1T5XA 3AU0A 2FJUB 3QI9C 2OSXA 4U0QB 1YVLA 3A3YB 4HS6A 4X6CB 4ANVA 4LDOB 2OZ4A 4RMBA 3KPLB 1EJOL 1RMFH 3QWOB 1AOHA 2G5UA 4YBLC 4WHYH 2D03H 3KPSA 2QLYA 3QUYA 4HEPG 4MAYC 3CUPB 4NCC1 5CEZH 1PIGA 2P5WD 2ZF9A 3NZHH 2K9UA 2VDKL 1YQVL 1QZ1A 1NANH 1TU2A 3CZKA 3BWAB 5K93A 4JGMA 3RIFF 1WWAX 2ZCLL 1D5XA 2LU7A 4OZGE 3VXPA 5AW7B 3KDMA 1E3FA 3DYPA 4OUOA 1WICA 2FJSA 5F9DC 1ORSA 2ZXDA 4J8RA 3C60C 1JK9A 2QSVA 4IRJA 2CDGB 2P80D 1CTNA 2YRPA 3DPBB 5SX5K 1AP2B 3IBOA 3RQ3A 1PKQB 1LQBC 4X8CA 3UGEA 1LEKB 3RTQC 5E8PA 5EBWB 4B7IA 1XGTB 4FA7B 1JP5A 2CK0H 4N2AA 4WSJA 4KXAA 3Q5YA 3RWIB 3GJFB 5A2CA 5TE7L 3SO3B 4EE2A 1LWHA 2NYYC 4WHTB 3SD5A 3ESNA 4PJDF 4RFNC 5C07E 4HPOH 1WFIA 1UJ3C 3B7RL 2DH3A 2JQAA 3SE3A 5JA9A 4FP8L 4HIIA 1BGXH 4Y7MA 3C2AH 3S35L 1MQKL 3MLRL 1CFSB 6PCYA 1BX2A 1TIUA 4RZCA 3T0WA 1DJZA 4HUNB 4MCZA 1T22B 4Z78A 3VXRB 3ARWA 3KW7A 4BDVB 3FU0A 3KYMB 5TH2A 2MQ3A 3CCHB 3T3PF 4F2MA 4JFFA 2DMKA 1XB3A 4FI8A 3S36L 4GRLA 4Z7OE 4E5XA 1BZQK 4HSAC 3H85A 3BSZH 1RIVL 3FCGA 5GGRA 2V8LA 2DBJA 5D1ZC 3ARBD 3AMKA 4N2KA 1S7WA 1WZLA 3F6LA 2HJKB 2V9RA 1RIUH 1DVXA 1XL6A 3RI5K 3WFCL 1TSRA 5KW9H 1DEEA 1P69B 5F2FA 5HYFA 1HWHB 2OI9C 1BV8A 1RUAL 2OTWB 1PX3A 3QCUH 1ADQL 3QUKA 4R3SA 3RGVD 1ZLWK 1EMTL 1A6VH 1BIIB 3O8XD 5LCVA 4CNIA 1ACYL 2EDKA 1Q9LA 4AL8H 2Y7SA 1QNIA 1XR9A 4EIGB 3CHXA 3LZPA 5T1MB 4WENB 2GBVA 3MRJB 2EJ1A 1Y6NR 5D70H 1DFXA 4PJHE 3MRGA 3AROA 2X0VA 3ZBMA 4N2BA 1F02I 4HJUA 4L4VA 1PY9A 3O0RH 4MJ6A 5CUSH 5F89A 1WISA 5KAQF 3ULVF 3T5WA 3WIHH 1KTDA 3ZR5A 1KXHA 4AT6A 3WIAA 2FX7H 4NHCL 2Z91B 5FGCE 1FNGA 1Q8MA 2P46B 2V17L 5MERB 3JV6A 1BAFH 3WEXB 5B38B 3US0A 2ITDA 1U8HB 4U7SA 4JFHE 3TWYA 1JPGB 3Q6FB 5EZLB 4JQXA 1BDYA 2N01B 4K23L 4X9FA 3WTUA 5ID0B 2YD3A 1QACA 3L3JB 3VFNB 3QRGH 5AAMC 3WUWG 2WOBA 1IBGH 1HINH 3EH4B 1FZOB 4HIJA 2AEWA 5EIIG 4PJCE 5EUKB 4M1GH 1S7VB 2FIKB 3CN2A 4P46A 2OXGB 4TPRH 3MX0A 1BIHA 3RJDA 4TV3A 2FATL 2PO6A 3EYUL 1R24A 3ML8A 3H9SE 4I0PC 4UOQA 5MP6L 3OMZA 4GO8A 3K8LA 4X8XA 2UYLB 5LGHH 2Y5TA 3AC0A 1I7ZA 1IBBA 4OLXH 4DCQA 4AE1A 5I8CA 3BKCH 3N0PB 1E5CA 2A5UA 1OTTD 3P54A 4L3AA 2ADJB 5GSVA 1I1YA 3NFPA 2CXGA 2P1YA 4Z7UA 3RWGA 4X6BA 4OZIA 4H0GA 4ONHB 4MXQD 4AXWB 4OCXL 5LLIC 5HVHB 5BRZA 1IAIL 2LR4A 3CFDA 1NGYA 3GXFA 1FPTH 3H9HA 4DVRH 3IE4A 3JTTB 5I6PA 5B7FA 4CJ0A 4GUQA 3QZMA 2IQ9L 1V3MA 3WIFA 4XHQA 5C9JA 3UTZA 1YPZB 3B9VA 3FB8A 4GO9A 3U2IA 4NBXB 4UU9A 4PJIA 4I3SL 3ESPA 2DLEA 4ZFZB 3OKNB 3SDDD 1KPRA 1ZANH 4DVBB 3RFZB 3EJZC 3FQUB 2R1YA 1QBMH 1NFIA 4Y5XC 4G72B 5DD6B 3LMJH 4ZUTB 1J8HB 4G9FD 2J6EA 4JN2B 3OKKB 4Y4HA 2JKWA 3TWCL 3P4OA 2D73A 4N0YL 3NPSC 4AGMA 5CM1A 1KEGL 2F15A 1AD0B 1RJZA 5A2LH 4MDRA 3KJ6H 3FU7A 3OPUA 4YHZL 2EXWD 1QTYT 4DKEL 3W9DB 3LEYL 4IBYA 3OR7A 3BAJA 4N22A 3SY0B 3DVFA 2H6PB 1VFBA 4HJ1A 3FCSA 4KK6D 2BC4A 4D9RE 3GXIA 3EJRA 3VG0L 1FYTD 1KGCD 1VJSA 3BVDB 3IB4A 3QIUC 3SY6A 5H2BA 3C75A 1HKLH 3QEGH 1P4LB 3QWQB 4MKMA 3QHFH 4U6HA 2APVA 4QRQA 5EU3A 4X9BA 3H53A 2IPTH 2LAGB 3MMEA 4UM8A 1E2WA 3MREA 2YS4A 25C8L 3BWUC 2CBMA 3IETB 2VC2H 4YSAA 1QPXA 4ZQTA 1FZMB 2B1OA 5FX3A 3D0AA 1T66D 4MJ4A 1HHIB 5E9DD 3WI9A 3NGBB 1KCSL 1SOKA 2MCPH 2FX9H 4XH2A 5CJQH 3QNXA 2V3FA 1KYFA 4MNQD 1KGWA 2XX1A 2MCG1 2BP5M 4FFVC 1S7SB 3EO9H 1YEEH 3DX3A 4GG8B 3LN4A 4TSAL 1MCEA 3QQNA 2Y25A 2YUZA 3E3QC 4WCYH 1AGFB 2PF6A 2X5PA 4LESA 4Z1PA 2XA3A 1G5AA 2NY6C 5CWSB 3VCLA 3NG5A 3CG8A 4TM9A 3VTMA 3AU1B 3GSXB 4JANB 3ZE1F 4IRSC 5HYSB 4TQEL 4ODUA 5E00B 1DTUA 5K5YA 3UMTA 1D7BA 3ZE2F 5GGUB 4KKAD 4I88A 4IRZH 5ACMA 4P2AA 4WO0A 1UADC 2ATKA 2OMUB 3UL4A 3WSQH 1BXUA 2NY1D 4IW4C 2ZX9A 1KXVC 4MASA 3UH8A 3K4AA 5TDPB 1NC2D 5CJOH 4Z77B 2MQGA 4P2RE 3SPIA 2ZUQB 3IPEA 4NUMA 3ZTDC 5L8LB 4LCVA 4QLRA 2FO4A 4HX1A 4CN4A 3CDZB 4IEFB 2NT1A 1DQTA 3AQZA 4PG9B 4RMQA 3VGAB 2NDGA 3GDBA 3JZYA 4P4RA 3UDWA 2VLRA 4G9DB 3DYOA 15C8H 43CAA 1BJ8A 1ITCA 4PR5B 5EIIB 4HWBA 1KFAH 4U1GB 3OVUB 1VGEH 3CIQA 1JDDA 4QRRD 3CFEB 4Z0XA 1FRGL 3FSZA 5T3ZL 1GZHA 3BXNA 3WEAA 3N41F 3OJDB 4K3JL 3N9GL 1EEYA 3BVNB 1UWEL 3DPDA 3FQXA 4LAQL 4BSJA 4RNRA 4APXA 4LIQL 3CZSA 4IBQA 3CZJA 3DXAE 1TITA 4DN4L 2GTWB 3QXDA 1E28A 1UB6A 5I23A 1YNKH 3HE6C 4DPCX 2OSLA 2HMID 1JNHA 3MRMB 2R8SH 4NQTA 4DFIA 3CVIL 4PGCB 1MY7A 3UROR 3F8UB 3PDOA 4YDJA 1RJYA 1CU4L 1CFNB 2B5IC 2YR3A 1JD9A 3DETD 4J3OD 2FH6A 1IM3D 1WIOA 1RQ5A 5CEZD 4ZAKD 5K59E 1A66A 1U8JB 4F58L 3CFCH 3FPYA 1R5IA 4OCSL 1M3IA 3D1MC 3L3GA 4L8CB 3V0HA 3EJSA 5EOTB 1PD0A 3SZ6A 4ONGH 1S8DB 2VLJD 1N70A 4HKBA 5DTFA 1NCCH 4G70B 5KVEE 1XSIA 3N44B 5DD5L 5IFHL 2V7HB 1XGYH 3VJ6B 3TURA 3WFDL 3O4LB 3MNMA 1GMIA 3NABL 5CD3B 3ETBJ 1S9XA 4NO0A 3TLRA 1ZHKB 2WBWB 3OGCA 1BXXA 4PRHD 2E7CA 1G7MB 1S9VA 2WWMC 3U79A 2PCFB 2UWEA 3D4ZA 4HHAB 4NENA 3RB7A 3NSCA 2E7BA 3TNMA 3QT2A 3ETTA 4XXWC 5I75C 1D5IL 1DQIA 3FF7A 1JFQL 4TSCH 3US9A 5C3LD 1QWHA 5D7IA 4X4YA 4U6XA 3MFFB 4P4KC 3WFHB 3IXAB 2VDPL 3PHQB 1WA1X 1OP5H 1CI3M 5DLMH 1W72L 2J6WA 5EUOA 3WLWC 2JTDA 3VWKA 3TCLB 4PJAB 5FO7A 3WFEH 4BRJA 4QRPB 2ICEA 1MW1A 3X1FA 3JVGC 1BD2B 5CLTA 5DJ2B 1DVFB 4LPUA 5HGBA 4FNTA 4E9LA 4UQBA 1XIWB 2VXUL 3G5VA 3LQMA 3KWUA 4CGTA 2Z93A 1DLFH 2K4AA 4IBTA 4LNRB 4QHUA 3SO5A 5DZOA 5HP5A 3NRFA 2VOTA 3S97C 4IYKA 4WJ5A 2NR6D 2X4SB 4Q9QH 1FF5A 5EOCL 3HI1B 1GMEA 1TCRB 1RKRA 2Z4QB 4JRYD 3WHXA 2ZUYA 1UA3A 2FBJL 5C9KA 3IU4L 1YEDB 1UM4H 4TUKH 5KVGL 1N5YL 3CVHA 4BSVA 3GRBA 3AUWB 3U46B 1F4XH 1HHGB 4JZOA 4QF1A 5BPPA 4BZ2H 3U36B 3GMMA 5MENE 4WTZG 3HG1D 4Y4FB 4LU5L 3KBEA 1B2WL 5J56B 1G6RL 3DKHA 4N2IA 4WW1B 1X5GA 2XCMC 1FHGA 3ARGC 5AZEH 3A67L 3MJ8B 4QKXB 4OQTA 2CLRA 3CD4A 5DYOA 4U3XA 2GPZA 1CF8L 1E7UA 3FT0A 4J3WA 4U1LB 2GJ6B 4U1MA 3P3UA 4N5ED 4WUUD 5DVKA 1E5BA 1TQCC 2DY2A 5TQ2H 4F80A 1EHLH 3DX6B 4GFXA 2WWOA 4QT5B 4WWNA 1O7DE 4JO8A 4UDUA 1PZ5A 2ZOOA 3GBNH 4HFUH 4HAGA 5DUBA 4AJWA 4LVOB 4TVUA 3BLKA 2W9DL 4K94L 3QFGA 2AQ1A 2HRGA 4PJEE 5D1QD 4RDQF 3HCVB 1AR1C 2GK0B 1DBAL 1GSMA 2KS0A 3CZUB 3UAFA 2FQDA 2WJ7A 1UM5L 1NL0H 4PGEA 4NP4H 4N2GA 1Q9KB 2OR8A 1GH7A 1OB0A 4PBXA 4XVSL 1YC8A 2WLJA 1J1PL 2ZUSA 4A63A 4U49A 2ADYA 3B83A 3OWEA 5CS7A 2A9NL 1RZ7H 1KBWA 2ZQKA 5C6TH 4CADA 4OI8A 1DBJH 3TVMC 1CS6A 3ES6A 3UO1H 3WKML 3BIKB 3UJTL 4OZGA 1U95A 3D08A 3MUUA 4EN3A 1HSAB 1JPSL 1TZOA 4G3YL 4K07A 3SGDI 3HBGA 4L1DA 4M4RA 4XCNA 2H26A 3VQMA 1QLFA 5J0BA 3BQUA 4XI5C 4NQSB 1RZGA 4K94C 3FT4B 3PWVB 1QG3A 3MO1A 1FL5B 4ACTA 3PJNA 3TA3C 4Z3HA 1JZEA 3VD3A 1RU9H 2NSMA 2EDTA 3JV0A 2I07A 3EHBB 1NAMA 1UATA 1L4IA 2F74B 2IG2H 5DQJA 3TT3L 2FX8L 4C8XA 3SKMA 4RRPM 1NSNH 5C07A 4APQA 4KZEL 1J9TA 4EKXA 4M5TA 4GQ9H 1AGBB 4AENA 3PWPE 1U8KA 4XNXL 2E7LA 5D7JA 1NBVL 2ZPKH 3OAZK 3LHAA 4PS7A 4ICWA 5FK9B 4Z7NF 4YLBA 3KEDA 4WEMB 3G6JF 1VACA 3B9KA 5DD1L 5FO9B 3KPQB 1F6FB 1HQRA 1FGNH 1IC7H 4JL1A 5C7XL 4NYLA 1WYJA 2XZCH 2CIIB 3KPPB 2JF1A 4H44C 2ZX8A 4JPIB 4RX4D 5SWSB 2N1TE 3VXME 4YBQC 3KLHC 1FVEA 1ZHLB 4N2FA 1PX4A 2I25N 5DMJB 4N2HA 1ZHBB 2OW6A 4XR8C 1J5DA 4HAFA 1CG9B 1II4E 2XQBL 2NY4D 1U8IA 3WAJA 1S5IH 4I0KA 1CFMA 4WWKB 4D7PA 4M3JA 1NGZB 3EO0A 1AI1H 1BVOA 4IOSD 5IQNA 3PWUB 3BUIA 3Q8AA 4P2CG 3T1FA 3F6JA 1ID5I 3TXAA 2HRPH 3F5WA 5GZNA 3D39D 1L7TH 2HA1A 2A38A 2NXYD 4QAWA 4KPHL 2CHZA 1RUMH 5DEGA 2PWEA 1L9TA 5E6YA 3AY4A 3ZU8A 1YN7A 4FNLH 4ZXBD 4GXFA 2HKFL 3ATEA 1YNLL 3V52L 3AXIA 2I9TB 4ISVA 2XVGA 4GNKB 4ZPTB 4BEIA 4LZKA 5GS0C 3VA2C 4PYHA 2D3VA 2HKHH 2G3ZA 5E95B 3CHPA 3OJVC 4TNWK 1TVDA 4PJ8C 5HYJD 2CALA 3ZK0A 2KH2B 3AAZA 2X2JA 4PJHA 4JQIA 1FC1A 2LLLA 5ID1A 5ISZD 1I1FB 3E1F1 4MQ7B 2WK2A 4N0CC 3D85A 3IMBA 1E2ZA 3HZYA 1JHLL 2IH3A 5IOPB 2IF7A 1B4JH 3VU2A 3BEWB 3WLBA 1EAQA 3F83A 3QZNA 4EI6B 4D94A 1V8HA 3E2HC 1HHJB 2AQTA 4Q7DA 1H3VA 5D6DA 2XN0A 1I8IB 4X5XB 2IXQB 2X4TA 4PJGF 5BV7H 4R4FL 1HHKA 4JPSA 1WFOA 4Y7OC 2IMMA 1ZTMA 4L3CB 1WG3A 3QQ3B 3QZPA 1KN2H 3GQFA 4DEWA 3Q06A 4BH8A 4PJCA 2OMWB 1JGVH 4F7EA 2IANB 3F00A 4KTEL 4LEXL 4NX0A 1P4BH 1RULH 2D2OA 2EDQA 3VWJC 3PXJA 1RZKL 1K8IA 2L7QA 4NQDD 3H9SA 3U9PH 4NZFA 3WIIH 3V7MA 2OMVB 3QUXA 3RZCA 1NAKL 1COBA 4PRPD 4KDVA 3KPRE 4PJFB 4YUEL 1GTFA 2PTUA 3VXUB 4R7XA 4JY5H 5AG8A 3RUGE 1FP5A 5B1CA 3RKPA 1SJVA 4OIBA 4MWFA 1XXFC 4RAUB 3RY6C 1A14L 1QBAA 3IEAA 1XGPB 5DHVB 5KSAD 2VUKA 5I1IL 2FUQA 5IESH 2IV9A 5LG6A 4MRCA 1UEYA 5HGAB 3U4BL 4X8GA 2MPAH 4YSPA 2HFTA 1PJ9A 3BUPA 1XH1A 3WS6C 4WTWA 4XXDB 2XG5B 2TAAA 3GT6A 2VMCA 5E2WH 1A7RH 4AQ1A 4OGYH 2R2HB 4HJJH 4B53A 5TE6H 2ZKXA 1EXUA 2E46A 4C55A 2PNDA 4Z8FH 2DL2A 5HGDB 2J8UF 1KLUB 2E0PA 2BVQA 4DW2L 3PHAA 5AYTA 4ZX5A 3NFSH 2MNJB 4QO1B 4UDTA 4NNYB 4OI7A 1JXDA 1PYWB 2AK4B 1NC4B 5DT1H 1OB1B 1BJ1H 4LLQA 4BELD 5I1KL 1QWNA 2N7BA 5DHYA 4GP5B 3STZB 4WU5B 3RL1B 3QPXL 1CYXA 2R7EB 1IC5L 2KLSA 3VFWA 2XN9A 2HVKA 3JQOB 4FMVA 4S0TD 1D3CA 1OAUL 4OLEA 5D7KE 3RNQB 3SPGA 1N8ZB 2GSIA 2F1EA 2PXYA 2Z65C 4FQXC 1LO0L 5ECGA 4FQ1L 2A0LC 2ZTBA 2H32B 4XTRC 1AS8A 1MFDL 5DRXB 4WEBL 1OM3L 4AYDC 1A9EB 3H4HA 4Q8BA 4R7LA 1KN4H 1P5UB 4KH2A 4PRID 1ZKAA 1G6VK 2CKBL 2OULB 2F1BA 5LDUA 2XXFA 3MV01 1OT2A 2WBJC 1KTJA 3O9WB 4YL4A 4OB5H 4XBMA 2W8CA 4LLUA 3G5XB 4PI2A 1F4WL 4I77L 5KSBE 1KB5B 4H40A 2VXSH 1OCWL 4JJOA 4UOJA 4DP1X 4PGDA 4JAMA 3V5HA 5I16B 1FFPA 3MUJA 4HKZA 5DMGD 4D9LH 5JOPD 5GRVL 1NDMA 3D9AH 4Y4KD 1R75A 1JPST 1JSYA 2Z0BA 4NSKB 3R18A 3CDFA 4XWGH 5D5MF 2OZNA 5AVWB 1XF2B 1BWWA 1E43A 1A6AA 3V4VA 2J25A 2NX5B 3A6CH 2J21A 2JLLA 3HE7B 3I6KA 4XC3L 3KYOB 3TPUA 1BA9A 2JKNA 3K2KA 1V3KA 2X7LB 4C57C 3BAEH 4JFYB 3EFOA 5DJ8B 3BP6A 5CR8A 2EVIA 4PJ9C 3V0IA 4K9EC 2ADGB 2NXZB 2B16A 2CBPA 1J48A 4G8GD 3I9GL 4GAYB 2A83B 3QCTH 2BP8A 1UFUA 3LQAH 2A77H 2VDML 3ZIYA 3OAYH 4B9CA 5K1NA 2V2XB 2GABA 1JGDA 4LLMA 4M7KH 5E6IC 1Q38A 3T65A 5LG1A 3QCVH 4GO6B 4P2RA 3ARFB 3GBMH 2FEEI 1DDHA 2N59A 2XXMB 1HWGB 4AJVA 5FM5O 2AEQH 1GY2A 2H6UA 2C9UA 2XPGB 2YFOA 2D3JA 1KBGL 1VDGA 3RURA 4PBWD 3F7VB 4QRAA 2EIZA 4QY8A 4FFWC 2ZXBA 2AEPH 4O2FA 1DVUA 4GS7C 4V1DE 3LZFL 5IHBA 1MRFL 1YN6A 3D25A 3HG5A 3QJZA 4FXGC 5CCKL 5FGBA 5HGHA 4B9ZA 3IDYC 4Y16A 3TO4C 4XNQA 4OTXL 2BW4A 3ZDZB 3V9CA 3QORC 4R90H 1OGAE 1DQMH 4WSGA 3VB8A 4HLJA 5JYMA 1OGTB 5JMOC 5T3ZE 4Z7AA 4IMLA 5I8EA 4V2CB 2CRYA 3FO1A 4JE4B 1ETZA 1GXEA 4L29B 3DXAA 3C5ZA 4TNFA 3H9YA 1EO5A 4OCRH 2G9HB 3JWOL 5ALCH 3OB0K 3ULSB 2N56A 5E1AA 2YRZA 4UNVA 2JJUA 1J1OH 3BUYB 1GA2A 4ES8A 1KIUA 1Q9OA 3P11H 4K9EH 1BFVL 4O02H 1U2CA 5TQ0H 1OCOB 5GRVK 5DR5H 3P77B 4KWUA 4Y19D 1BEYH 1CICD 5JHBA 2O5ZH 3LDBC 4FD0A 3L17A 4PY7A 2GBUA 5KJRL 4PGJA 1KC5H 1MJ8H 3OSKA 3OLEA 4XMWA 3SKNB 5KOVC 3INUH 4F33B 1WIUA 3REVA 4YHOH 4KY2A 2YGPA 1NLBH 5DRWB 3W39A 2ICCA 4R2GB 4BJLA 3TPKA 3HHSA 5TGBA 2YXFA 4MA8H 2ZKHH 3JWOC 2A1WL 4YXHL 4W9KC 1F4YL 3FO2B 3L5XH 3RWFA 3U1SH 4KKCD 4E42B 1ZT1B 1DUZA 3V0VB 4GT0A 2VR6A 1NH6A 3FO0L 1PY0A 3FBQA 4WHDA 2R9HD 5I5MA 4DGUA 4F8QA 1H0DA 4DO4A 3MLUH 3QXTA 5FYLD 1HAWA 1MHCB 1EERB 3IGAB 3C60B 5C0EA 4GAJH 2AJUL 5HDWA 1ULVA 4HBCH 4U1JB 1CFVL 1ONQB 3OXSB 2R56H 1TQUA 3RTQB 4CMHB 1F6LL 2C9PA 5FA4B 5DS8A 4FADA 4Y9BA 2X05A 2WLLB 4P2QD 1ZVYA 5JIQA 8CGTA 1CFTB 2HRHA 3TBCA 4WO4A 2DEWX 3LJ3A 2VGLM 4XNAA 3T0ED 1E65A 3P9LB 3I84A 1C7SA 3QEQD 5DVNA 4WFED 3QH3A 4PD4K 1DO5A 1KYAA 3ZGHA 2WUBL 1FL3B 2IC2A 3HR5B 4K4KA 3G08B 1F90L 3QPKA 3WNIA 1JK8A 1LNUB 1VF5C 4UB0L 3BT0A 3ARBC 1D2PA 5EZJB 2J1YA 1NKOA 1N6VA 5I1JL 5TDNB 4UUJB 1DJYA 1KENL 4O5LL 3WTSA 1X7QA 2Z31D 4KROD 1WBYB 3O8XC 1OF2A 2ESVE 4YR6B 1QKZH 3GS7A 1T6WA 5KVGE 4X9YA 4N85A 3L4TA 4RBPK 4PP1C 1MEXL 4JPWL 3D69A 5G55A 1MCLA 3VW3L 5MENA 4ZFGL 5I1EL 1PW3A 4FS0A 4OY9A 3QI9A 5IVZA 1F42A 2DQJH 3I02A 3G6DH 5TFSH 5D1ZB 1ROWA 5IROD 2DI9A 2LTQB 3FPXA 1UXWA 3NACH 4MAYA 2QADD 2WQAA 4HKXB 1RK1B 3LRMA 3WJJC 2NNXA 1DUYB 1ZDQA 1YNTB 4GI8A 1UVQB 5IFAL 4S0SD 4KQ4L 3CFIC 2QHRL 4IKKA 1NQBA 5HI4D 1MCNA 4F37K 5A1AA 5FIEA 5C86A 4FMKA 1U8CA 4XNDA 5INCB 5HBBA 2FWSA 1N7MH 3ABZA 4N90E 4PJEA 4X6DF 1E6OH 4L4JA 2C8NA 2HLAB 3GZQA 3X14B 3R1GH 1QR1B 3TEXA 3NQIA 2ADIB 1LVEA 2F19H 3MV9E 5IVXB 4YO0B 3RWEA 3FBKA 4JFXA 1AO7E 1U8PA 1DQLH 3TFKC 2ZYIA 4KRNA 3U30C 3ASNB 4WNQA 3CFQA 1H3GA 3NCFB 3S4SB 1N19A 4OLVL 1T1YA 1SJEB 2X4NB 2ZXAA 3PAVA 1UJ3A 2NW2A 3NCJH 4MS8C 1OTTC 1CDHA 3IU3A 3UAJC 4QXVA 1KGUA 3KW8A 3UPRA 4YJZL 2AC0A 5AUMA 2CBOA 1WCBA 2OYMA 3A6OA 1BQHA 1A3LL 4G6MH 3NJJA 4LFHD 2KMWA 1QRKA 2W9EH 2YQGA 1A3RH 3QDGB 4YHPB 3SDAC 2BOBB 5LXGH 1VEMA 4HGWA 3RIAF 4HFWB 3O4OB 1BEXA 3QJXA 4AMKL 1IBFA 4H0HB 4MYPA 1SEBA 5L0QC 1JYXA 3EDJA 1SRDA 1UH4A 1I1AB 3K6SA 1HL5A 1J9CT 3SDDC 4HCRL 4HH8A 2VLKB 4LCCB 3ML9A 2DTSA 3MBEB 3C09C 3P1VA 4I1NB 1HH9A 1Y1DA 1Z9SA 2ZNWA 5KZCD 2CR3A 3MLPA 1CR9L 3IFNL 1T3FA 1ED3A 3TJEH 1WC7B 5FM8A 3N0AA 1AJ7L 3FOMB 3OPZL 3CFUA 3NAAL 4NLAA 2DWEA 1NBCA 5E8DH 2X6MA 1JCKA 3F7YA 3IAPA 4KK6C 1K5NB 1KCKA 2BK8A 3VXMA 1EGJA 5DO2D 4D8PA 5DJZA 1Z9OA 5E8EB 2WSPA 2JCCF 3DHJA 3GSNH 4JRXB 1K4DB 5MHSD 1RY7B 2BIOA 3NPSB 2EUVA 4OH2A 1YO4A 2XU9A 3VXSB 4B5ZA 2HX9A 2NY3B 4NUGL 5J6GB 1Z0NA 3DX0A 2F53D 2YZ8A 1PFCA 5DK2A 2ZZUT 1M71A 3CSBA 2PR9A 1P9MC 4FKEA 4KK5D 1S9YB 3EUDA 2N7AA 4MXWL 2APBA 1D6EB 2AQRA 1JGUH 2GJZB 1W15A 3Q9QA 2DF3A 1CC3A 2LE9A 2KLRA 1ADQA 4AX3A 3CXDL 2NLJB 1KLFA 2P5ED 3BP4B 4XMUA 3V95A 1E9OA 1RZ8A 3IGUA 5AWNH 4AIZA 3DWTA 4ORGA 3DUSB 4ZMNA 3L4VA 2N0KA 4JFPB 3GS4A 4L4TB 4LEEA 1G4RA 1R3LB 4I0PA 1BFOB 1P0SE 4URKA 1IKFL 4EBQH 5ADPL 1MH5B 2VZ3A 4IIQC 4F2FA 1E4WH 1X4YA 5AZUA 2O93L 1R3JB 4KVNL 4H1LH 2VO5A 2X9ZA 4AM0B 3NIDB 1F2XK 4KKAC 3D2UA 2ODIA 1SDAB 4LASL 3JZ7A 3VX0A 3L6FB 1U3ZA 2VABA 2NY1C 1HH6A 5C0BE 4PUBL 4Z95L 1TQSA 5KYYA 5DZPA 4FZEL 5LAXA 1FORH 1GKOA 1NGXA 3LD8C 3QG7L 2IH1A 2NTSP 5CMAA 4AI7A 4AYFB 5JYLA 3S3CB 4B9KC 2IFGA 4GBXD 1QSEB 2ODHA 3D3VB 5MEPB 3DROA 1E50A 4IRSB 4OZHE 3SQOL 1RMFL 2NOYA 4M6OL 5E8NB 3SJVE 3UTTB 3KBFA 4DH2A 2D03L 2PYEB 3DMMA 5LXVA 3LKNB 5JR1H 2ATPA 4UCFA 4NQQA 1J86A 5CEZL 4ZW8A 3NZHL 4XP6L 2J43A 4W4OC 3KPRA 1OARH 2AZUA 2NTFB 2BSRA 1J9SA 4JKPH 4XZ4A 3RUGA 4KDTC 4KNUA 3HLKA 4YOKA 4KMQA 2VYRE 4PREB 3ULVH 3E8UL 4MNHB 3FN9A 5ABZA 4WW2C 4HS6B 2B2XH 1Y0LA 4FYRA 2A73A 1N0XL 2AABH 3NK3A 3HUJE 4Q4EA 5DJDA 2Z92B 2EIEA 4JX0A 3QUYB 3T6QC 1QLRB 1PQZB 5JHDB 5FECA 3ZDYE 2DQUL 2VMDA 1XH0A 2W88A 3SDCB 1HL9A 4GQZA 2I27N 3MTXA 1Q94A 1TU2B 1A6UH 1EZVX 3CLFL 3QIBD 4HPOL 1FJ1B 3UO8B 4J3OC 1LO2H 2BIMA 3E1ZA 1W0WA 2UY6B 4LKXA 4OCMC 5IWLC 3PQYD 4J8RB 4CMMB 1AQHA 4ZAKC 5D93C 3C2AL 3MYJB 2XT1B 3O3BA 2PPCA 1QVOB 1Q0EA 3U0WH 4JZJB 1IQDB 3JUZA 1XAKA 3QZWA 2DYPD 2Y23A 2NPLX 4OFKA 4XBEH 2FB4L 2L8AA 5GGTA 1KLGB 2BY3A 5DUMH 4X8JB 3OKDB 3LH8A 3TCTA 2O6FA 1KGIA 1VFMA 5T1KB 4BK4A 3BSZL 1AZBA 1THAA 1TVHB 2WMPA 3RL2A 4NAJA 4Z7QB 2HH0H 4FFYL 1WITA 4LCIH 2W5PA 1CE6A 3QNYB 5DK3A 2UXTA 4I4WA 1P7BA 3VDCA 3TH4T 4WI6A 5KW9L 5JZ7D 3I6GA 4JFFB 4DGYL 5KSBA 1A6VL 4HH9B 3EBHA 1KXVA 4AL8L 5ERWA 2APSA 1N10A 1OHZA 5F8QC 3JXAA 1LE9A 2XZQL 2HRLA 1ZTXE 5FOJA 5GGRB 1H3WM 1ZJAA 3P0VH 1KACB 5CINH 4HEME 5D70L 3NIGB 2Y24A 5E7BA 2VDNL 1YCSA 4EF3A 3WIHL 2A74B 2P49B 4P5TA 4M8RA 2FX7L 1TJXA 4HOXA 1BQLH 3D48R 4QOKD 1JVLA 2Z64C 3RVXD 4F24A 3K71B 1I8LC 3FF8A 1A7OH 1Q9LB 4RWHA 3HG0A 3ARTA 4X4XB 1JHKH 1Y07A 1ZXQA 2NR6C 2ZWNA 3O6KL 4RGOH 3PV7A 1XT5A 3MRDA 1P1VA 2A99A 2DI7A 4XN1A 3T3ME 5IQ7L 4GKSA 4UYQA 3DO7A 1N12A 2B15A 5CN1A 1I7RB 1O7SA 2AANA 1U3HA 1JTTA 5FCUL 3RWJA 1KEML 4LE8A 4KX7A 2VLLA 1HINL 5AOKA 2RB8A 1XV8A 4TPRL 1I8KB 3HE6A 7TAAA 3AY2A 4QRTA 3SPVB 2JKSA 2JJSC 4OFPA 3T4YA 5I28A 4POYA 2J2ZB 1UB5A 1OANA 2P7TA 1TJMA 3L13A 2MOGA 4H88H 4LCUA 1HNYA 2BY0A 1RURL 3CWGA 1IGIH 4AWJC 2A6DB 3BP5A 4S1RH 4ODSH 2VDLH 2CR6A 3FTWA 1AMXA 4MHHG 3FQ4A 4N5EC 5H35A 4W9EC 4BWUA 5KYXB 1TPXC 4YAQA 5EU6B 1A4AA 2CHDA 2NY7H 3ASWA 3TF7C 4P46B 1HJCA 1FPTL 4DVRL 4U6TA 1OGAA 1I3GL 4CDGC 2IOMA 2PO6B 1CT8B 1ZHNB 4WSKA 1G9EA 4KRPB 3FSWA 2R69H 2O72A 1G7QA 1W72B 5C0RH 5I8CB 1FVDB 2EO7A 3NJFA 5D1QC 4AQEA 5F3BB 2GFBB 4Y0GA 2JVUA 4X6CF 3CVDA 1OLZA 3WAKA 1I1YB 3DJ9A 2YPVH 3E6HA 4JRFA 5IBUB 4X6BB 1DJGA 4BZ2A 2O6CA 2BIHA 1TQCB 2DIBA 1LO4L 3V5DA 1MCDA 1PFOA 2YPKB 5I26A 1PSKH 2QV2A 4FLHA 4IKIA 4M5ZL 5J89A 1CXKA 1BOYA 2XQYK 3MLYL 4ECNA 4OAWA 3VFVA 5C9JB 2N0MA 1Z5LA 3KJ6L 3JV4B 1IGJB 5IMOA 4GH7B 4Y9FA 3CXFA 1RP8A 1JZ4A 4M1CD 3EGXB 1JWSB 4NEHB 4JEGB 1EQWA 3U7YH 3ILPB 1H8SA 1KPRB 1U42A 1TEYA 4P4KA 4B41A 4ZYKA 4HQQL 1JERA 2FEJA 3NFNB 2JCWA 2RFXA 3K6NA 3HRZA 4MCNA 4LT7A 2E27L 3I75B 3JVGA 4FAAB 5JUEL 1IM9B 1S7QA 4RAVB 1THCA 3FFCE 3QHFL 3WTVA 3FU7B 4U4IA 3VFRA 3BPLC 1YEFH 3GHEH 5FYJH 2LVEA 4ZW6A 5A2JH 3O3AB 3RDTD 3CX5K 2DOCA 5KANG 1VFBB 5H37H 2QFPA 4J8QA 3DO3A 3QUGA 1XH2A 3EAKA 3M8OL 2H6OA 1AD9B 2PW2B 2DB8A 1FN4A 1UD4A 1VADB 5DHDA 1PIFA 4YDIH 5LGYA 1KB3A 2YAQA 2ZONA 3QWRD 3UGXA 3DX8A 2FT6A 4J7RA 4X5QA 3C6LC 4QRUB 1ZS8A 4M62L 4NN5B 4QRQB 4QXTA 4U05A 5EU3B 3TA3B 4WVRA 4UM8B 3K3QA 3LYRA 4FG6D 4FKKA 4KAQL 2FT7A 2F54B 1U8LB 1IGFL 5IHZA 1CE1L 1RP9A 1PZAA 1QD0A 3T77A 4LVNC 4XVTL 4YSSA 4G7SB 2DM2A 2NY4C 3Q2CA 32C2B 4WV1C 4XH2B 5FKAA 4AEFA 2ZYSA 1MCKA 5CKGA 5HSFA 3L3IA 4NCC2 3MCYA 5FFLA 2XFXB 4DKTA 1GYCA 4IRZL 4O51B 2BFGA 4XGZB 3HZVA 3T4AB 2BVEA 1DZ0A 4XPBL 3LN4B 3PLYA 1T7VA 1E90A 4HJ0D 1D9KC 2NXYC 2AJVH 4G5ZH 2IGFH 3KS0H 3OQ3B 1MREL 4FX5A 4UNUA 1VFAB 3M7OA 2ESVA 4JFQA 5F1IB 2CU9A 2X9XA 4N6RB 4ZXBC 4JY4B 5I9QB 2Y3AA 2ZP8A 3Q2LA 3LXUX 3VFMB 3BJ91 1C9SA 2VE6A 1RZFH 4ODUB 1J8SA 3FH8A 1O6VA 4C83A 4IBWA 2ZXQA 1G9NC 2OP4L 5F7DA 2PPDA 3H2WA 1NOLA 3MRIA 1TTAA 2X6CA 4PD4J 1G6RA 1W0VA 1XFPA 15C8L 4BUGA 2MHAB 3GKZA 4HULB 2CMRL 5DUPH 2UX7A 3U4EB 4D0DA 3MCLH 1YDPA 3VD9A 3OKOB 5DWUL 1AQKH 2FO4B 3OZ9H 3FQNA 1YQ2A 5FO2A 3TVMA 1E5YA 4X6FA 2DICA 3QR2A 5GRWA 1LK2B 4PJ8B 2WZ6A 2AQNA 2NZ9D 2X3CA 3B2MA 5JQHC 1ZK9A 2K7QA 1BOGA 2D2CC 5DS1A 2IAMD 3SDXE 4LSTH 5J11B 2R8SL 4TUOB 4PJDE 4OZFH 2MJWA 4X6EA 2IOOA 5TK2A 1AO7A 2ZE0A 1SMOA 2EKJA 3BSHA 1EEYB 3SB3A 4KHXL 3FQXB 4RNRB 2Z7UA 1DQDL 3LPFA 1QAWA 3F84A 1J7VR 3QO0A 4UQ2B 1A6TB 1AACA 2Y0SA 4L1LA 3P4MA 4I18B 2BNRE 4DK5A 3BIBX 5GGRY 1WAEA 2WNXA 2XKNB 1C1EH 2A6JA 1O6TA 5K69A 2X4PB 2O61B 3PDOB 5KYNA 3IJYB 4NOBA 1MRDH 1NCCL 1YPZF 3L9YA 2E76C 2JFCA 2B1HH 2H9GB 1CJYA 3LNIA 1FYTE 3LRHA 1O7VA 2MKWA 3MRFA 2F8OA 2OMTB 3U6RB 2OJZH 4TLUA 1KELH 1RUPL 3I50L 3MZTA 3VXRD 4JGUA 5IQMA 2WXHA 3JWNH 4LXFA 1KYDA 1J11A 4MDIA 3S37L 3G04A 3X1NA 4BFIA 4JO3L 3MV7D 3F58L 5FM5M 3W37A 5EIQA 3HPJB 5E9DE 2EVJA 2WINA 5BS0D 4NO0B 3VYPA 3VVWA 1UD2A 3OHXA 3MV8B 4F9LC 5E08H 2JH2A 1ZAGA 4MNQE 1OP4A 2D7QA 4NIKB 2X87A 1RFDH 2V5SA 4HIQA 3TYFA 4LSSL 4R5VA 5A6IA 4E0RA 3S3DB 1YMME 1MHEA 2WVVA 3IF1B 4DGIH 4KVCH 4XP1H 3S3JA 1DLFL 1B0GB 1BPLB 4ANKA 1OLLA 4TVPE 3NIFB 4RGND 3HZKA 4OQ1A 3TEWA 1KJ2L 2Y4SA 2DAVA 4MDJB 4Q9QL 5IJKA 3DIFB 4FJ6A 5D7EA 1JPTL 3LKRA 4NPJA 1SVCP 1EX0A 3E38A 3MBXH 4UM9A 5EUOB 5C09B 1H6TA 2GT9A 1HCYA 1HX0A 1OKEA 3D4YA 5FO7B 3R06A 2WQ8A 4AJ0A 1UOKA 2BY1A 2Y06L 1Y6KR 4RETB 1JXFA 3PFUA 4ZZFA 5BQ7A 3D09A 4HWZA 1CGWA 3G5VB 1OP3K 5CEXB 3ULAB 3H3PH 2QQNH 3VACA 3EZJB 1HCZA 1IFHH 5DMGC 5ESAA 1XEDA 1J1XL 1A4JA 3RRQA 3CN4A 1LXMA 4M43H 2LGNA 3EH3B 4N2EA 4XMKH 4YGVB 4H2AA 1P1ZB 2IPUK 3QYCA 1T1XB 1IGCH 2X88A 3D30A 2EC9U 4LRIA 3MRPB 2CG9X 2X4RB 2RHEA 4X98A 5EU4A 3QHTC 2BJMH 2VZOA 1X5YA 4XP5H 3P73B 4POUB 3SE8L 5TQ2L 4OLYL 4BSVB 5D9SB 4CAGA 5IMLA 1DVZA 1BG9A 1VAHA 2BVUA 1CD9B 4X7TA 5ITBH 3VRIA 1P2CA 4PWGA 1J12A 4HC1H 5EFIB 4OFVA 3GMMB 3CK0H 1WP6A 3GBNL 2ARJB 4HFUL 3RY6A 1RJLA 4CRPA 5I73C 3PV6B 1F58H 1TYEB 4P3DB 4UOW1 2Y36H 4DESA 1GRWA 2HTLD 2VITA 5C0BA 3PGDA 4MJJA 3K74B 1JGLL 2RCSH 5DYOB 3WS6A 5KSVA 3B2UC 5F71A 3NCMA 4YDLB 1J8RA 4KI5F 1L7IL 1ZEAH 4NP4L 4OZHA 2CKBB 3DJZA 3SJVA 4UDUB 3ARDA 3CIAA 1R3IH 2KPNA 2CDFA 1OO2A 2RJMA 4JFDD 1M05B 3NJGA 4EN2A 4XZUA 3HFMH 1KSRA 1N4XH 4HKJA 4PTTB 4X7SL 3N2JA 1W91A 4L5FE 5AALA 5E6IB 4PCSA 2QDWA 4K3DH 4LLWB 5I15L 1BYNA 3M17B 1WRFA 1JIBA 1HHHB 1CFQB 4IS6A 4PB9H 4NUJA 1U2YA 4PRNA 4J4PC 4M03A 3REWA 2UY7B 4L0PB 2ZAHA 1A3QA 4CC4A 3FCTB 1DQQA 4FQ2L 3EOTH 5HHMB 4FG4A 1RU9L 4Z0BL 3NMEA 2ZP0T 4P06A 3CLEL 5IMMB 1OTUD 3GMQA 2DWDA 5HDQL 3ALWA 1JXJA 2MOQA 3ES6B 4JL2A 2W0PA 5HDBB 3GIVA 4P59H 3GZPA 4GQ9L 3CTTA 2DD8H 5FYLL 3LIZH 3BQUB 4PWIA 4CBPA 4LCWD 4JKNA 4ZMAT 4HZLA 1CICC 2VDMB 2X4QB 4U1HA 1PDKB 2IOIA 2A9DA 1IC7L 3GPSA 2I07B 3QARA 1B0IA 3G9AB 1PLGL 4YHLH 2Q76A 1NIDA 4OJEH 1NGWA 4L3EE 1UM6H 2C3VA 1AYRA 5EC1A 5J1TC 1JWMA 4ODXB 3CE1A 2GUYA 4A6YA 5DSCB 3ZE1E 1MDTA 1MN4A 4UTAL 5EU5B 2NSXA 1E0OB 2Q8BL 3ZE2E 1S5IL 1RVFL 2PYFB 1EO8H 4C56E 2R83A 4QR7A 2P5WB 1S7UA 2W0KA 4AE0A 4MNGE 3ABKB 1AI1L 4G7VH 5FYJD 3VGGA 4ZO8A 1CZ8H 3Q2WA 5T5FL 1CXFA 2HRPL 2AITA 3PABA 2EC9T 4R4BA 4PJ9A 4JM2A 3MNDA 2Y07H 5F0JB 4O02A 2XNAB 3WHE0 2R1WA 1JZJA 1WUZA 2YXMA 1BFTA 3B43A 3QJUB 5T1LA 4BGLA 5AEAA 1M53A 4K5LA 4OFDA 3IDIB 2CH8A 3S7GA 4FNLL 3G5ZA 4O2EA 1N68A 4IKLA 4YHML 4JLRA 5JLZA 2CM5A 4PJAF 1EK3A 1EHAA 3S3BB 2ZJSH 4MMYB 3MJGX 4HEMA 1BMWA 1QI4A 1INQB 1T80A 5EZIL 5A2IH 5EZOL 1K5WA 4FNPA 4ELKA 1UXSA 4J2XA 1MFAL 2LLGA 1B4JL 1S7XB 2F18A 2YEQA 5HYEA 1E4KC 2UZYB 4UMSA 1JVOA 4HIEA 1I8MA 4WUUE 3TO4A 5AVQB 3KWTA 1GJIA 4F8NA 2VL4A 2EE6A 3DHMA 3QORA 3KPOA 3U9UB 3L9RB 3BAYA 1IL1A 2GBAA 1IGYA 3MRKA 4NDMB 4KI5D 2Z31C 1I9RL 1HT6A 3D0VA 3AS3A 1U92B 2VRQA 1QO3A 1VPOH 5KVDL 3BPOB 1FUNA 3D85B 1FLRH 1JGVL 5EEXA 4JFUA 1GS6X 5D1QE 2R59A 4HUXA 1T5WB 4JN1L 3N91A 1OOWA 4FFTA 1TZ8A 5IBTL 2CO7A 3BPCB 1SDYA 2OK0L 2X4TB 2BIQA 2C1OB 2X41A 3CMOL 3KXFA 3O6FC 5I1GH 5KAQG 4LARL 4WI9A 4A7GA 4AYEC 2WXPA 4ZMLA 5ILTH 3K1DA 4JY5L 1IC4L 2QADC 3CSYB 3FMGH 3TV3H 1OQXA 3QUZD 4N1HB 4AIOA 1QSFA 1HOCB 3RGVB 3ZL2A 4JVWA 3O45B 3O8XB 3L9EA 3IN2A 4F7EB 1SM3H 3W3BA 2LFEA 3KGRA 5BZWB 3BKJL 1T2XA 3MRRA 2XV3A 4LQ1A 2DYSB 1JUFB 1GYVA 4PY8J 3QUXB 4KXDA 4Y2OB 4IBLT 2W81C 2QVFB 3MOAH 3N85H 4HCGA 1TQVA 4OGYL 4PCTA 4XN4A 3RBGA 2A2QT 5D1XD 3CFBB 5TE6L 1GYAA 2HJLA 5AB9A 3FU9A 4XBPA 5E23A 4Z8FL 1AXIB 2G5RA 1Q9WB 3LKQB 4GXVH 1AGEA 1MJ7L 3NFSL 1FNEA 3M1OA 2WB1A 4FQLH 3MLVH 3HC0A 4LSRH 1CIDA 4DP6X 1M7XA 2X4UA 5DT1L 3QDAA 5HHPA 1V55B 4KXBA 4FG2A 1YLBB 3O2DH 4RLDA 5GGSA 2A9ML 4TNEA 3SPCA 4ONOA 3ZDWA 4Y1AB 1N6QH 2YZ1A 3ELAT 4YX2H 1V3JA 5FKPB 2EP6A 1QFUL 1C5DB 4W9GC 3GUTA 1GYUA 1QWUA 5AOLA 5ETUA 2AV1B 2BVQB 4X5PA 5HPOA 2BVPB 1LO5A 3T6XA 1NIFA 5IHHA 3QUML 1KTLB 1W9XA 1X6LA 3U2JA 2H3KA 3U30B 5ADOH 3S9DB 1UT2A 3FFCA 4MX7A 5FYKD 3LEVH 2QR0A 1JN6A 2K6YA 5HHOD 1NGQH 3QR0A 4OB5L 1LL1A 2XN9B 2WBXA 3O41B 1GJUA 1TZHB 2F58L 1BSIA 4DUVA 1NEZG 5FF6A 4XPAH 2FYYA 4B60A 1EV2E 2GSIB 2PXYB 4HWEL 3OMAB 3D39E 1GGYA 4WHYG 1EUUA 4ZFFB 1YY8A 4J3OG 5K9OB 4KKLC 1QBLL 1TENA 3IFOA 3D9AL 3C9NA 3TBTA 4ZBJA 4GKNB 2A4CA 3SGDH 3W9EA 3KNBB 2CNZA 1A22B 3SDDB 4JM4H 4XPHL 3Q13A 4MMXA 4WY7L 1AZVA 2ZNXA 4WFGD 3AACA 1J05B 1IEAB 4G9FB 4YDVB 1VKXB 2R23A 1EVUA 5ISZE 2Q3ZA 5LN4A 4G8IB 2YC1A 4L1TA 4RFEA 1ZE3H 2ZKWA 3MVSA 3RPIA 3V5HB 4F8PA 3DURB 4NXKA 2ZXWB 4QI3A 3WJJA 5CP3H 1NDMB 1OT1A 3OB8A 3QCTL 1MCPH 2O5XL 5D96B 5H94A 5FHBH 3EUUA 2COQA 3ULUD 3GJEA 2IADA 4M02A 3ATBA 5C08A 1S9WA 5HI5D 4KK5C 1WAAE 3SD2A 1U6AH 5KBDA 3EOAA 3GBML 1LK3L 3V4VB 5J9PB 3WTXA 3BZFB 1KBVA 1CMOA 1IJNA 1IVLA 3KYKH 3O3DB 4NCDA 2AEQL 4JG0L 5AB2A 4IOIB 4RFOL 5AG9A 2GIMA 3TU6A 3FQTB 3DOSB 3E9TA 5AVSB 1LWJA 3ILEA 3FH7A 4O00A 4OFYA 3T2NH 2BP8B 4JPKL 1CLZH 1TFPA 2VW7A 4NQDE 5CD5D 1GZQB 1JGDB 4WTQA 1BZOA 4X99A 1MNUL 4PVNA 2XIDA 1C5BH 1CTMA 2K6WA 5F72S 5D1ZI 4PB0L 1AMYA 4FULA 3UAJA 2B0SH 3TBSB 3DHUA 1DQML 2XWJA 1ZV9A 2H4EA 4G1EA 4OIAA 4R97B 3SGEI 4HZ1A 4JVUA 3M7FB 2FL5A 2WUCH 5IW6A 1MLBB 1FNLA 2DLHA 1MAMH 2EIZB 3GSWA 2EXYD 5GGQH 3MROA 3SDAA 1I9IL 4BCYA 1N0LB 2BOCB 2WZPD 5GRJL 3IS1X 4Y16B 4PJDA 3V4UH 1XXDC 2G60H 3LZLA 3NZ8A 3RNKB 5IFJA 5A3ID 5HTSA 2HXAA 5CR1A 1VEOA 2XQYG 4PJFF 5DJAA 1UURA 5AYUH 1N64L 4XC1L 4K3EH 3K0WA 1ROCA 3NZSA 4NT6A 2A6KB 5E7FA 3WE6B 3VFUB 4Z7NE 1BEYL 1ETZB 1WHPA 3G6JE 1U8NA 2O5ZL 2CRIA 2UUDH 3FUNA 3GS0A 5DJXA 3UTPE 3IDGA 2Z8WC 2BNRA 1NC2B 2FD6H 2J5WA 3PWLA 5E70A 4OJAA 3INUL 1GW0A 3FRPA 3EHBD 3HI6H 4IJTA 5GS3A 5IW1A 4AV4A 5F88A 3LS5L 4YHOL 4NHUB 5FV1L 1T89C 4P9HH 4HUUA 2Y7MA 3QEUB 4U3SB 5BO1H 2ITFA 3ZPDA 2DLIA 3FQ2A 4MA8L 2KYIA 4BE5A 1FYTA 4Y5VB 2ZKHL 1Q0YL 5IV2A 3CV5A 3VXNB 3BKMH 3C2SA 4I8DA 4XAKE 5EC2A 2FQEA 4QRRB 3UG3A 3QIBC 4N28A 4AKQA 1BECA 3KH4A 5JXED 3GSRB 3IFLH 4IDJL 4MS6A 3M1BA 1WTGT 3IKCA 5C0JA 5TGBB 1P9MA 2ZOLA 4PM1A 3VG9B 3U6XA 2H41A 2LVCA 4YN3A 1IV8A 5KG9B 4WWKD 1IILE 1A7PH 4JGJA 1KPUA 3V8CA 5K9KB 3ORJA 4GJTB 4ANWA 4OV6F 2Y1YA 3TO2B 1YMMA 4XCFL 3F12A 4Y88A 3N43B 1IM3B 2P8MB 4TULL 4L9LC 2F68X 4PJGE 1IBDA 5E99H 2AMGA 3KGUA 4ZPVA 5SWZE 4GAAA 2PWGA 3C8DA 1AQ8A 4K5NA 4AK1A 3ZHLA 4ETYA 1G9MH 5CU5A 4IK7A 2VLJB 3VFTA 3HJ0A 3ECBA 3N40P 4UF7C 5CZXC 3POHA 3CZLA 4K7PH 2L0DA 4ZNEA 2YEZB 3QJHB 2FJHB 4QHNB 4DAGH 4JO4H 5JQIB 4GW4A 1IAII 1C5CH 1P7QA 4NM4H 1KGJA 4PU2A 3KLSA 2ADFH 2KZKA 2CNYA 3NDYE 4AYID 1WBXB 3A0OA 1BZ7A 3L45A 3L5WB 4F57H 5KJ4A 2E4TA 5K39A 2DQJL 4PRHB 1C12A 3G6DL 2JE8A 4R26H 4AC4A 3KWVA 2JI1A 5K59F 1U8OB 1WDAA 3QA3A 4FG0A 4G6KH 4I85A 3WL9A 3NACL 4YK4B 3SYQA 2K0RA 1OAKL 4JHVA 2GQHA 2X2YA 1RZPA 3CDGB 4W4OA 2OX5B 3RVXC 1ILUA 3I2CL 1DBBL 4NM8H 2IAND 5E1IA 4OD1L 5HHNB 3WKNA 1E27B 3HHMA 2HT2D 4HMCA 2BNQE 3WCYA 1JNLL 4E9YA 1HIMH 3M45A 4Y5YC 2OMZA 1N7ML 4AV5A 4AUYA 4XAWL 1JAEA 1IGMH 2E6QA 4PFEA 4PH8A 4AEHL 1PY4A 1E6OL 3W81A 1V7NH 3I6LE 4JQVA 1QEXA 2J8UE 3R1GL 3VXUD 3BE1H 3WY3A 2H1XA 4RIRB 2F19L 5IM7B 1ASQA 1MLCB 2GITB 1DQKA 5GS2D 2EH7L 5GJTH 4L1HA 5ACZA 4Q6IB 5C1MB 3T6VA 3FAWA 3GMRA 2X1WL 1OSYA 4XPFL 5CJ8A 1SY6H 2ENYA 4GAGH 4YC2C 3WXWL 3BC9A 4J12A 4JRYB 4M6NL 4N26A 3HEIB 5IWLA 4OVVA 1KCVH 4IOFD 4HK0B 4ZAKA 3ZDZF 3WTYA 4PWHA 2IVFC 2W59A 3U6XS 2B08A 4WU7A 1NCBH 4W9HC 3GHBH 4J1UB 1XH3A 2X6AA 1A3RL 3J8F7 3RA7H 3HS0C 1ILSA 4JFXB 4UILL 5LXGL 1E9QB 3HG1B 3PAYA 5D7LE 4AIEA 4WFFD 3H6AA 1BBDH 2WO2B 3MUGA 1NA8A 4N2LA 3CBRA 5LBSH 4GW5B 4U1SB 1QNZH 2AK4D 2RALA 5CXPA 4GP4B 4MTMA 1P6FA 3IGFA 2OMXB 2DS4A 4JDEA 5CLXA 3RILA 3X3FH 2UVFA 4MD0A 2OBGA 2SODB 1O6SA 1EEZB 5ALBL 4AOFA 1INEL 1FH2A 3DV4A 1S78D 3V4PH 2VCOA 4HGWB 4HA1A 3O11A 3HZ3A 3TJEL 3X17A 5J1SC 1P5VB 2OYLA 2F5AH 3EG9A 6FABL 2I5YL 3BHBA 5FYLE 3OC5A 1E9PA 1EEUA 3QJTB 3II2A 4CBZA 5IQOA 3I85A 4M1CC 3VI4B 3APFA 2VUYA 4WK4B 3UGUA 4L3EA 4GUCA 1UWGH 3MLZH 4P2QE 3I3BA 3QHZH 2EEBA 2OJEA 4CSZA 4L8SB 1RERA 4LHUA 2R69A 4BFNA 2YSSB 3GSNL 2J8OA 2XXGA 4B9FA 2AF2A 5EA0H 5GIRA 4U7KA 4C56A 3QEQE 1TTBA 4I1RA 5AW9B 2DWEB 4JHAH 4IGBA 4ZODA 4N20A 4IBVA 1I8LA 1X9LA 4FFYA 4WEEA 1UUNA 1CBVL 4OBSA 2C7FA 1FZKB 2NR6A 5AZ2L 5EEZA 4NQVA 1XWVA 3ABMB 3CSFA 1KJVA 4GW1B 4DP5X 4ZQKB 3AQYA 4DZ8A 1ZVSB 3R7QA 5HHXH 3M88A 5IKCB 1LMIA 2GUOA 1EFXA 5B7MA 4LQFH 5LJYH 2IPUG 3MNVB 4NO2A 3W11D 1J18A 4FG6C 2V37A 2XRAL 1XBRA 1VCBC 2Z9TA 3RVVD 3AZUA 1AFVL 3I9AA 2HFEA 4HWUA 4LKCA 3D6GA 2OL3L 4YFDB 2J7LA 1DO6A 3IFPA 1GAFL 1E4WL 1H19A 2ZCHH 4N8CH 3TYGL 1H3PH 2CGRL 2EQDA 3QDMD 4HD5A 4WUUA 1H15A 4ZFOL 1OSZA 4WHCA 2ARWA 3DGCR 3OKLA 1E9OB 1UQSA 1IAMA 2D8KA 2WYIA 2EVFA 1JPFA 3IAQA 4N0UB 3HC2A 2CRZA 2EYTB 3DLQR 3GB7A 3U1PA 2WVTA 5H37A 3W0WE 3CFJA 4NQXB 2C9SA 1Q4NX 4LOEA 4JDZB 3MGOB 4NKMA 2VL5B 4UINL 5H8DA 3H0TA 5D1QA 3BGFB 1F6AB 4LVNB 3VMNA 3BEVB 1E42A 3AITA 1MIML 4NJAL 4WV1B 3V79C 1A7NH 2ORBH 5D72L 4FQPA 5F1NB 1UACH 3V6OC 2EE3A 4AYMC 3IMUA 3U0TB 2VC2B 2OZ4H 3QC6X 4KJPD 4AUUA 4OFQA 3BMVA 1R6VA 5KVFL 2Z8VC 3UP6A 1YNTF 4JKPL 5DO8A 2AW2A 4Q58C 2AGJL 2WHVA 2HFFB 5CMAB 1TVBB 2HSIA 2X42A 4ERSH 3HC3H 2HVJA 5BUGA 4S1DD 3CZFB 4R9HA 4BH7A 3DMMB 4OR1A 3SE9H 1YEKH 3L4WA 4QEGA 5G5DB 4F93B 4MD4B 5HYJB 2NZ9C 5IHUL 2JB5L 4RMUA 3KHQA 2ZUTA 1L0QA 3QO1B 4LDLB 5IVXF 5I18H 2BLFA 2BSRB 3L3HA 4XNZC 5DEFA 1DJIA 2PP8A 2H3NB 4JFOA 1EUTA 4Q97A 5ENWA 3PWNA 1ZV2A 3BCFA 2CA3A 5IF0B 2F2HA 4FNSA 1F45A 4H8PA 1Z32X 2XYBA 3ZT7A 3JYCA 2DIEA 5DJDB 5D8JH 3UBHA 4G6JH 4KKZA 5F9JA 2H45A 4X4ZA 1A6ZB 2VR8A 2BHZA 4XBEL 2ZXGA 3AXLA 1M1XB 1Q94B 4H8HA 4PHXA 4A38A 4LOVA 3B37A 2D4FA 3C6LA 3OR6A 4OCLC 5DUML 3RU8H 3L2LA 3MLWL 1UH2A 4H0LC 1M7UA 2EUWA 3GSVB 3IVKA 1FNSL 1HEHC 4EOWL 3E6FA 4ZUUA 1AQDA 4G8AC 1XGQB 2FSEB 2ZYRA 4D2NA 3QGVA 4L2LA 4PRPB 1D6VL 3AG1B 1A2YB 4UT9H 3T08A 4E9VA 2VM3A 4FYTA 3UC0H 2BNUB 3FUFA 2COVD 3MLXH 5A7EA 4OZFA 4M61B 4ZD3H 3KMDA 4YSCA 2UXGA 4P23D 3AB0B 4RVBA 5KSAB 1AE6H 2F53E 2XICA 3R4RA 2R0KL 4FGMA 4NZTH 1P7HL 1LMKA 2BXYA 3EYQD 4M8VA 1D9KA 4JO1L 2XBDA 1X4ZA 4HSQA 3DSNB 1FYHB 2CQVA 2X10A 3TTSA 1IEBB 1JXKA 2WMPB 3MACH 3NK4A 5GRXG 5LCVH 5I1CL 3NEEA 1UA6H 2P5EE 3D18A 1XGRB 4EUPA 1WSST 4LLVA 4TOYL 1A9VA 2H0EA 3QEHB 3VSUA 3WO4B 3W5NA 2DZEA 3NP3A 4MA3B 2H2SD 2KT6A 3G5YA 1B3JA 3EJQA 5ISZA 3EDKA 3WNLA 1D5MB 4CC0A 2YUWA 4F7CB 1EBPA 1JHKL 3B1UA 1OAYL 4KQ3L 1A1NA 1ZT4B 4ENED 3ZO9A 3H7BB 2FZ3B 1TKWA 1SJHA 5IB4B 1R5VA 3GJFH 4AG4H 5B39G 3KEHA 1KCUL 4X6DE 4ZX3A 4KHTH 1XHHA 1PD6A 3EFDH 4UT7L 3LB6D 4A2MA 5C8JA 2FO1A 4HIHA 1MW2A 5CP7B 3PCYA 3Q8BA 3HZMB 4N86A 4OGAC 2X4OA 2VAAB 3DOIA 4P5TB 4PJXB 5E2JA 3GHPA 1EHNA 3I74A 2QSCH 2VIRB 3MN8A 2MTPA 5JIPA 3THMH 4H13C 4PRIB 4XO3A 1LLAA 2DQTL 43C9B 3QXVA 4LL4A 2G75A 4ILDA 4ACPA 3DX9A 5FB8B 3FHEA 2AJXL 1IGIL 1PLCA 4XB7A 1A6WH 4S1RL 3DGDA 1ZGLA 1CGSL 2XZAL 2EH8L 1HNGA 3RYMA 5DC0A 3GKWH 1BXAA 4YZFE 3ESVF 3D0LA 4L0YA 4X50A 2F8VA 4DQAA 4QRBA 4DOHB 5FOBB 1ZA6A 5LO7A 3QAQA 3EKCA 4KOCA 5LNEA 5IB3A 3WGUB 3FB7A 4WJKB 5CJ5A 3A22A 2AQ3A 3HFFA 4LEOA 4F7KA 3K81A 3T4YB 4Z7WB 5I8KH 3N04A 1Z3GL 2X44D 3BFWA 4Y4KB 4LCUB 1ZSDB 4ZUVB 5C0RL 1ACZA 5DMKB 5JW5B 3BP5B 4HCFA 3O6LL 4WGVB 1HNFA 1WPCA 2YD1A 1MWAL 2YPVL 4JDVB 5E9AA 3VI3B 3KVQA 3GTNA 5HJ3A 2YBRB 4LLDA 3GSUA 3QFJD 1CFBA 3Q2NA 2CA4A 2R0WH 5HVHC 2JXMB 1MAJA 1YUHA 2C1PA 3GMOB 3QYNA 1QRND 2AQ2A 3CSGA 3LH9A 1GZPB 2I26N 3PL6A 4G8GB 1EDHA 1G7QB 2Y9RT 1NCOA 3D52A 4HMEA 4I5BA 1FG2B 1X5KA 3G6JA 1QFWL 3TBYA 2VXTH 2CLVA 3PQYE 4U0RB 1MJUL 2N7SA 1FAIL 4JUTA 3Q1EA 4I3RL 2EDFA 4JGNA 5CBAB 5D71L 2NUPB 3LHPL 4LF3B 2B39A 1MF2L 3U4KA 4LGSB 2WAQA 3U7YL 1I1AD 3TONA 4ZTOL 4BRVA 2MQCA 3T6ZA 1T6BX 5C0AE 3RFZC 2XSKA 1E8ZA 2JCCE 4DUWA 1T20B 4H2CA 2X1QA 1OK0A 5JO5A 4JFED 4JG1H 1LD9A 4FZ8L 2VJ8A 2BCKA 4W81A 3S96B 1Z5LB 1Z5YD 4OGXL 4FE9A 3GHEL 5FYJL 5DQDL 4MJID 2AXHA 1CO1A 3T71A 2Y7OA 2A4ZA 3L7FB 1KXQE 1WZMA 4KTDH 4TTDD 4XX1G 5E5LA 3P2TA 1G7LA 2WYZA 1XSJA 1RUKL 4M1DL 4NQED 3SKJL 3W5MA 4J6RH 5GZOA 1I7TA 1HKFA 1T2JA 4A7TA 4AQAA 2BWQA 4JRXD 3VFPB 1FIGH 2H3XC 3A4FA 1BREA 5F97E 3ISWA 5T3XH 3UX9B 1ZK5A 3VRJA 3Q44A 5HHVH 2NY3D 4V11A 2A9AA 2YD2A 5I0DA 1ZV5A 4LFHG 4Z7QF 4YGAB 1SHWA 4PJBB 3UBXG 5DDHB 1L9RA 5IB5B 4P04A 5KANI 3V8OA 4N68A 1FN4B 3NGBC 4PJGA 4LRNL 2EYRB 4XNMA 4FTDA 4Y19B 5SWZA 1CICB 4QOKE 1ZCRA 1DSWA 3WNKA 5A2KH 3QIWA 1ZWIA 1ZS8B 2BOLA 2FNWA 1KJ2A 3HS8A 3HS9A 3ESUF 3AS1A 4OF7A 1EZSA 3O3EA 4N8VG 1SXNA 4EI5A 3FTUA 4BZ1L 4G5ZL 2IGFL 4MAZA 5IHZB 2ZCZA 3T77B 1NCWL 1GS8A 2RGSA 2UX6A 4NRYA 2D7TH 5FKAB 1QEWB 5IG7A 1T4WA 3UTSB 3NIGF 4N1CA 3IWUA 1OAQL 1UWXH 2ENSA 1ZLDA 3K4ZA 5B39B 1MUJA 3HZVB 4OSUH 4P3CH 3QJVB 2KC0A 2DM4A 3EYSL 4E41A 1JF6A 3JWDC 4WK2B 2D31B 3HNSL 5DUPL 4BK5A 4JFQB 1FFOB 1VGKA 2VMFA 2VXQL 3SOBH 2ZUQC 1JV2B 4KKNA 2I9LA 4U6VL 1TTRA 1AQKL 4HWBH 5A40E 3RJQB 1DJXA 3WFBL 5AAPA 4GMSH 2BVOA 5BS0B 1QSED 3D3VD 4CVZB 4CA4A 1Z66A 1I4FA 2BNQA 3NSDA 4J4PA 2G9KA 4FYQA 4LSQH 4KI5C 2IPKA 3FU3A 1R17A 3UZVB 3VGAC 4YXLL 1OWRM 1DANU 3T0EB 3UZEA 5I24A 3EBGA 2QQKH 3T0VA 3TZVD 5IZ7A 1BBJB 1A5FH 2GAZB 2UZIH 2J8UA 1UT1A 1I9JH 2YK1H 3EGDA 3H9ZA 2UZXA 5EU7C 2BS9A 2GC7C 3GRWH 2RTTA 5H4ZA 2HT3D 5CILH 3FQNB 1EZVY 1F11B 3CU7A 4X6FB 3SGKC 2EXTA 4Q0XL 3MRQB 5MEOA 2N1KA 4XO5A 5ABAA 4YXKL 3KPSD 4R4ND 1V7MH 1X5AA 1AY1L 3QUYD 3BPNB 4KROB 1BOGB 4P5MB 3A21A 5ECJE 4MA7H 1IBYA 2DQFA 1MRDL 1WFUA 2B1HL 1SHSA 4MZ3A 4F9PA 5D7LA 1J0JA 3L5JA 4U33A 1INDH 1G7JB 4HISA 1SBBA 4XWOD 3OBAA 5L4FA 4CGUB 1P6WA 4IRJD 3WO3B 5FYKL 3Q9PA 2HVBA 4JK0D 2GCYA 1AYOA 1WWBX 3AM8C 3TS8A 5FHAH 4YEFA 4NS0A 4QXUL 2H0FA 3BGAA 2J88L 1J9QA 1J9RA 5BV7B 5AVUB 1TOXA 4S1SH 3GMLA 2E7MA 4PJ7B 2H2PD 1K4CA 2WWKT 3BN9C 3MJ9L 3O6ML 3A5VA 3MRFB 5AKRA 3MXVH 1EHKB 3FCBA 3EJPA 2OR9H 3EYVA 5D5MA 1KZQA 2W65B 2WXLA 4WUKH 2A6IA 4B3EA 3GM8A 5DD3H 4KVCL 2AJYL 3BZ4B 5CJBA 3WXVL 4TSBL 4AVHA 4AV0A 4ZOEA 3TT1H 4JFFD 3MGAA 5FGRA 4PLOB 2NY0D 3QEQA 3KYNA 5J3HD 4UTAA 1VHPA 4GRLD 2AI0L 4LSVH 4MB1A 1BFSA 1E4KA 3GSQB 3DVIA 3L7EB 2HN7B 2GTZB 3Q6GH 4I0CC 3ZZSA 3DC0A 3ZKXB 5T5FA 3SOTA 4BINA 3ULUL 3OX8A 3TYFB 3UZQB 4TUJB 3UBXB 1MI5E 1EH9A 1KIQA 1A6PA 4OLZH 3IK2A 4P9MH 2CO6B 5AFAA 1DVFC 2QMKA 4WF7A 5L2KA 2ICWB 3UADA 3W2DH 4BXVA 3H3PL 1RK0A 3PWJA 1XR8A 2WTPA 5E4EB 1I75A 1JD7A 2VKWA 3CVHH 1FA4A 3HZKB 3TEUA 2IALB 1TSHA 4UT6H 5CCJA 3PGCA 5F7NC 3MRLA 1HI6B 3BYTA 1IGCL 4Y2DD 3F62A 4N8VB 3B4NA 4XNUH 2M8XA 4JRWA 2BJML 4UBDD 3CN0A 5DA0B 4M9PA 3V6OE 1DANT 2OTUA 4I48A 3O6FA 2R4SH 4XBGA 4LL1A 1AQMA 5BQ7B 4HWZB 4L4VD