3IETB

Crystal structure of 237mab with antigen
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
210
Chain Sequence
QVQLQQSGGGLVQPGGSMKIFCAASGFTFSDAWMDWVRQSPEKGLEWVAEIRNKANNHETYYAESVKGRFTITRDDSKSRMSLQMNSLRAEDTGIYYCSGGKVRNAYWGQGTTVTVSSKTTTAPSVYPLAPVSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Immunoglobulin light chain (IgG2a)
publication title Antibody recognition of a unique tumor-specific glycopeptide antigen.
pubmed doi rcsb
source organism Mus musculus
total genus 47
structure length 210
sequence length 217
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ietB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ietB01
1KTDB 2D2OA 3KYNA 1QFWI 1EPFA 2X89D 2P49B 3OPZH 5IVXF 4LLMB 3DETC 1TLKA 5ERWA 5FUOH 3FL7A 5FK9B 4PJEB 3GSXA 5D7LA 4NRZB 4NC1C 1A6TB 3ARTA 4NN6C 1B0WA 3KPNB 5GSRB 5JHDD 1TZGL 4NQED 3C9NB 3IJYB 4ZD3L 3E6FB 3IFNH 2IBZX 2FHBA 4ZFGH 2I60H 1YMMD 4JFZH 4LCCA 4PRDB 4ZS6D 5FO9B 3LRHA 4FQ2L 2WM0A 3J7HA 3P3YA 3VW3L 4X6DF 3LIZH 2CIIB 5TJWK 3CPLB 3BP7A 3ARSA 4Z0XA 1SY6A 3DSFH 1NUFA 3VGHA 2YMXL 3ZTNL 1MI5E 4M62L 4PJ5A 5TPWH 4LEXH 4P5MB 4QRRA 2XKNA 4F57L 3MA7A 3LS4L 2DBLL 2HFGL 5GGUB 4MJID 4C57C 5KJRH 2ADGA 2HAZA 1EDQA 2NW3B 3ZKNC 3H0TB 1KLGA 4LARL 1KCSL 1CXEA 2KBGA 4HLZH 2H9GA 2DQGL 3MOAH 4P2RB 3N06B 1TVHB 5EO1A 2CR6A 5EZJB 1I7UB 4GKZB 3X11B 1INQA 4NCC1 5GXBB 1K5NB 2H8PA 2E7HA 4HS8L 3LV3B 4MXQD 2V5MA 3L5WB 4QRUB 4CN6A 1W8NA 4FQJL 3L3HA 1WCBB 1YEKL 3QA3A 3VFUB 5CCKH 5IEHB 3RZCA 1HYSC 2CKNA 1IAMA 3MA9L 2A6JB 3C5JB 3G9VA 4JFEB 2O26U 3GRWH 3CK0H 5F96H 5DD1H 2BOCB 4G5ZL 2P44B 4WFGD 4G6KH 4JFYB 4DKEH 1EO5A 1RUPL 4P2QD 3TZVC 4NKOA 2J12B 1F6AA 3O2DL 4Y16D 3PQYD 1BEYH 1IC7H 2PN5A 4EI6A 4JY4A 4JFDB 3GJFA 5IMOA 4S2SB 3UBXA 1NAKH 1MSPA 1U8MA 4ZOBA 2OX5A 1HOCB 1IBGH 4NSKA 3HE7C 2YWYA 5IIEB 1J1XH 1QZ1A 1QPXA 2YPVH 3EKCA 4QTIH 3T1FB 5EUOB 3QJHB 3QNZB 4NC0B 2NY5C 3X3FH 5C8JA 3QUXD 1IC4L 4OZ4A 4QRPE 3ILQD 3UTSA 3OZ9H 1TVBB 4ODUB 3L7EA 2WWKO 3VRJB 5F7HA 1JPFA 4AEIL 1RZGA 1KCRL 2Y6SD 4LCUB 1P4BL 3WSQL 2D03L 5EOQL 4HEME 4HKXB 1L6XA 3FB7B 1DLFL 4XWGH 2UVEA 2GK2A 5HHPB 3TJEL 3VXUD 4DZ8A 4K23H 4LAQH 4LRIA 5EOCL 1RVFH 4NUGH 5DQ9A 4ETYA 2AJYL 1CD8A 5HYFA 3RBGA 4RRPG 1G7LB 1QBBA 4X7SH 4DFIA 4HLJA 4RGMC 4PRAB 4PV9A 2IWGA 1UYWL 5HDBF 3RDTC 1R5VB 5I8OL 5DMYA 5TE4L 4OCNC 4XNMB 2ITCA 5BQ7B 1CLOL 1D5MB 5EU3B 4RAHA 5HSFA 4X9BA 2XYCA 1NUGA 3BQUD 2Y36L 3PHQA 2V5TA 4AEHL 5IB2A 5CKGA 1FGVL 1TZHB 4U1NA 1DJSA 2ENYA 3UXFA 1LDSA 4RAVB 3T2NL 3UTQA 5ANMA 1YN7A 3FQTA 2NW2B 5FA3A 3C60B 3U46A 1P7KA 4M9OA 1NC2A 3QIWD 4NM8H 4XC3L 4XPFL 4R4FL 2NY6B 4NNPL 2VABA 4M8VA 4RQQB 5LWYL 4EN3C 1XEDA 3RAJH 2H3NA 2OTWA 5HHOD 2CDEB 4YXHL 2PXYC 1JWMA 3EFFB 3QO0A 2P1YA 1KB5B 5A2KH 1NGWB 3HAEB 2I9LA 4RCAA 4M5YL 4LLVB 3MV8E 4QHNB 1V7NL 3ALXA 4LGRB 2F58L 3DUSB 4HPOH 4QRSA 1OY3B 4ZPVA 3EOTL 3D18A 3VXSB 1VFMA 3HPLA 4HMEA 4UILH 1WAAF 3VWJA 5AUMA 1CI5A 1T1YA 2O5YH 4JY5L 4X0KA 5D70H 4X8XA 1FVDB 4GRWB 1HSBB 3MQIA 4KMQA 4JRXA 4Z7QE 3SPVA 2CXGA 1EVTC 2R56L 2G5BB 3EO9L 3A6BH 5AZEL 3U83A 2ZOKA 2EDWA 4LL9A 1RFDH 4LCIH 1I1AA 4PS4L 4D2NA 5C6WH 4FG6D 2EEBA 4ONFH 5DMIH 1XCQA 1NCBH 1NMCB 2KDGA 2YA0A 4OFVA 4LFHG 1J8HE 4IMKA 4UB0H 5L2JA 3GJFH 5C7XL 5ID1A 4ZNCD 1U8PB 5J12C 5FHBH 4MB5A 4YDIL 1S9YA 3EAKA 4PJ7E 1AHWC 3M07A 1FV1A 3TO2B 5F89B 3DVNB 1O5DT 2P5EB 2BOBA 5DC0A 3UO1H 4HGKC 2FGWL 4XBGA 3LQZA 1IAII 3HLAB 5J57B 5CD5C 5DEFB 4MNGE 3BH8A 2YHGA 3ZLQC 1MCOL 3UJTL 5ADPL 3FTGB 3G5XA 4YBQC 1CICA 2WP3T 1P84K 2O5XH 4QHKJ 1R3LB 2XTJD 5CHNB 5KW9L 2YA1A 5DEGA 3SKUD 4LGPB 3DSNA 4U4BA 1H3PL 1DBBH 4HK0B 5DF0A 3O8XA 3RIAK 1T1ZB 1BZ9A 3LH2H 4TULH 4WW2B 4D9LH 3MLPA 1BVLA 3RBSA 5HI4D 4XH2A 3ULSA 1MCSA 2W38A 1YPZB 5DK0B 1LP9F 1C5CL 1UT9A 4PJDF 5HGGS 4NJAL 3VGAB 3D39A 4YC2C 4L8CB 1QQDB 5JHDB 4KROD 4NQEB 3MLWH 5I8KH 1J0IA 1YMMB 5SV4A 4OCXL 1JF1B 2CKBL 5BVJA 1LO0H 1KF9B 2XN9E 5I1AA 1NCDH 2ADFH 2R1WA 2VH5L 1OP9A 3HMWH 4G8FB 4GOSA 4AIXA 4M1GL 4D94A 4Y5VA 4MDJB 1JZ3A 2NLJA 3BOVA 4CMHC 1Q9OA 4MJIB 1X5AA 1N4XH 1U93B 4LLYA 5GIRB 4W4NA 2DQIH 1XT5A 4PJIE 4I4WB 2GW5A 5F1IB 1QR4A 5CS7A 5C07E 5I2IB 3NZHH 2R1YA 5DD5H 1GGYA 5FCUH 4HZAA 4KI5F 3U4BH 4DVRL 3N1QC 4XCNA 3V6BR 3W9EB 4ZFFB 4RMUA 3C5SB 3QXWA 3QPQD 4YFLF 1RUMH 1O7VA 4JDZB 1OSZB 3PP4L 4KKAC 4WIQA 3ARGD 4G9FA 1NAMB 4CUCA 4LHUA 4JHAH 2OP4L 3OB8A 4P9HL 5AYQA 2IFGA 3EYSH 4GW4B 4O2FA 3MFGB 1MCJA 5A2FA 1RZ7L 2VDOL 1K4CB 2APBA 5C0AD 1MCPL 4WI7A 5B39B 3QXAB 2IPKB 1BECA 3DHMA 4Z7NE 4Y1AE 5CLWA 3V9FA 3MRFA 3QEHB 3EYVB 2I24N 4FP8L 1TCRB 4WW2F 3X12A 4GKNB 4TVPH 1C1EH 4JM2C 4GS7C 1YPZF 4OTXL 5E9DE 4L4VD 3VGEA 4LKXA 1JYNA 3U9UB 5GZND 4L4TD 1X44A 5JORB 1HHIA 5EA0H 15C8H 2X4QB 4UNUA 2E27L 4P2QB 4OF8A 5ACMA 1PG7X 3IU4H 4AH2A 4X99B 2AJZA 3GKWH 1CZ8L 4Y16B 2X4OA 7FABH 1QTYT 4J6RH 1A5FH 1XGYL 5C3TA 3JSSA 1HSAA 4S0TD 1XR9B 5DS8A 2DMKA 4N5UA 5D2LB 3W5NA 4NWTL 4JKMA 2DQDL 1MLBA 1ZT7B 4KDWA 4KGLA 1ZGLP 4U6HB 1GAFH 3QUXB 2V9TA 1X4XA 5J1AA 4PJ5E 1PKQE 3L3DA 5DT1H 3KJ4C 2J5LC 2PO6A 3F62A 4QCIB 3MLSL 2Q6WB 3GMLB 1MFDL 1OAXH 4HZLA 3GBNH 5HD8C 1HQRA 5EC1B 3SBWC 2IBZY 2IMMA 4LSDA 2VXTH 4NQSA 2CRMA 4RWYL 3VXUB 1I8LC 2D7TH 1GRWA 2JCCB 5I0ZA 3FRPG 4FQLL 2J6EH 5C0EA 3RNQA 2KH2B 4G3YH 4F7CA 5IT2H 4HCRH 2AKRA 3MLYH 3PWLA 4XXDA 1A6AA 4UAOB 2VL5A 3PL6C 4KRNA 4YX2H 1NGYB 3DRTA 4YH6A 2Q7NA 4MXVF 3EFDL 3HG1D 2VISB 4UIMB 3BH9A 5EORL 4KPHL 3WO4C 2BSSA 1VCAA 4K71B 3QHTC 2IAMC 3S88L 2J8UA 3AREA 4EUPH 1ORSA 3GSVB 3B3IA 1QUNA 4CN1A 4DQOL 5IBLD 1LO5A 3QIWB 1F4WH 2WBWB 5BV7B 2X4RB 3VGDA 1MI5D 2YC1A 3KG5A 3OAYK 1RJYB 3MODL 3VI4F 1JZ4A 3H9ZA 3FQNB 5I30H 5D2LF 1HHGA 2NTFB 4LLAA 3SKMB 2R2HB 1U6AL 4ZUWA 5L7XH 3IVKA 3IDYC 5H94A 3OAZK 2E9BA 5FUZL 4M00A 35C8H 4LU5L 4J1UA 2R29H 2D4FA 5B38A 4RNRB 4UDUB 5C0BA 5B21A 2Q8AH 3B2UC 4ZDHB 4L9LA 4GG6B 3B6SB 3FN3A 3O2DA 1OP5K 2BZDA 1QSZA 2VJXA 4U6YB 5T1LD 1IE5A 4H26A 3S3PA 5L9DH 4TSAL 1JI2A 2D7NA 2HFFB 3N1PC 2XWTA 4LSUH 2JCCF 4B50A 2OR9L 3U2SB 2GJ6E 2F8XC 4PLJD 2VDKL 3FONB 4MA8H 1NC4A 1CLYL 5IB4A 5FO8B 2X1OA 1FO0A 2DYPD 1PG7L 2I07A 1NJ9B 1SMOA 2J1KA 2BNQE 4N0RA 1BWMA 3EDDA 4JVWA 2V2WA 1QSFA 1A7PH 2GHWB 4Z8FH 2X41A 3N50A 4XP6L 5HJ3A 3HZYB 2X4PB 4CDHA 4MQ7A 3PGDB 4UDTA 2PTUA 1I4FB 1DN0A 3RRQA 4JFZL 3DGGB 1IGFL 4WFEE 1WJ3A 3K80A 4YWGL 4EI5A 1U8OA 3LMJH 4P3DB 5EFIB 2XTJB 4XCCH 1CFNA 3DSFL 3O4OC 3OKNA 4FTVD 4DUVA 5F7UA 4G8GE 3BKMH 3DX7B 4QRPD 1UVQB 3W9DA 3FQXB 3UTPE 1WWCA 3X14A 5TPWL 4LEXL 1ZHBB 5EU6D 5E5MA 1U3HD 4HJJH 4PRPE 5BO1L 2GEEA 2OSLA 1JZ8A 3HI1A 4Q6IB 2WINA 5CD3B 3D0LA 1I7TB 1WBYA 2UV3A 1IGJB 5A3IC 1SBSH 3S34H 2FD6H 4JRYA 1OAKH 1B9ZA 1D3CA 1KUMA 3GK8L 1OM3H 4GG6F 4YQXH 1C5DB 43C9B 1M7XA 3RL1B 3INUH 3OHXA 2P24B 4NFBA 1NEZG 4JRXE 4OCRH 4NYLB 3BESR 1PEZA 4BSWB 3RJDA 3N9GL 3P73B 4P4RB 4M4PA 1G7HB 2BMKA 4TSBL 1PY4A 3QBTB 3SDCC 5IEKB 4LKCB 5E03A 4L29A 3SOBH 4H5SB 4R7DA 3T8XA 4LSQH 2BC4B 4Z9KB 1D6EA 5F7NC 3VFRB 3MLVL 1RUKH 2HVKA 4E41A 1DEEA 4BZ2H 1QVOB 2W92A 4ORGB 2N7AA 1EAPA 3ARGB 5EWIH 3V5HA 3WYRA 5E2VL 4WEUD 4LPVA 2A73A 4PTUB 4QHLB 2RAMA 4I0PC 4LNVA 4B41A 3KYOA 4IIQB 1MCHA 4NKIL 3PNWA 2Y1VA 5C0AB 3MBEB 4JQVA 1EUUA 1Y6MR 1EAJA 1FBIH 4NBXB 3F12B 3QRFM 2MOVA 3BEVA 4JGMA 4XMPH 4YHOL 4GUPA 1MEXL 2VC2H 3OR7A 4QTIL 3QIUD 5E8NA 1F3DH 2GJZA 2AV1B 3WNOA 5MEOA 4L4VB 2FJGB 3X3FL 1GOHA 3PHOB 1A6VH 4OZIB 4H0IA 2VNCA 4FQPA 2W60A 5LGJB 5EBLA 3LCYA 3HMXH 1S7RB 2HH0H 3UAJD 4I48A 4CADB 3O2WH 5CIPB 1H3GA 4LSPH 4QXGL 4D0CA 3PGCB 1A4JA 1GJIA 5D1QA 3MLZH 4X4MA 4XWGL 3IDIA 5EIIB 3BN3B 4PB9L 4L8SB 1XF2A 3N0PB 3EZ8A 1F00I 5SWZA 1RVFL 2XZQH 4U3HA 3QNYB 2W07A 3PJSA 1LD9B 4U7MA 1T2JA 1FG2A 3VFSB 3DMMA 1S9WA 3TBSA 3WNNA 1UH2A 1UKQA 4H20H 2PYFA 2X4TB 4Y2DD 1T5XA 4UTBL 4D0BA 4PGCB 1NFIB 5E8EB 1ED3A 5EN2A 2CR3A 3HE6A 1L0YA 3W11C 1NGPH 2PYED 4K94L 3O4LE 3RIFF 4NM8L 3QRGH 4XAWH 4KY1H 2GSGB 5KANI 3JVGC 1CN4A 1H3VA 3CFBA 4K2UH 3VFNB 2WUBL 3U30B 4M8QB 5DTFB 1BQSA 3QNXA 5E8DL 2PF6A 4ELMA 1IAKB 3NIDF 4NQDE 4XPTL 1KGCD 2F74B 5J56B 2NPLX 3BP5A 3DJ9A 3PG2A 1D5ZA 1D5XA 1IQWH 1FRGL 4KJYB 4HIHB 5HYSB 3ABZA 1MHEB 1MQKH 1HDMA 3BPCA 1VEOA 4OD3L 2BK8A 1WBZA 4X5WB 4PB0H 4N0YH 1F8TL 3OJVC 5I9QC 1KB9J 1MI5B 2DIAA 2ZKHH 1J88A 2C1PB 1TMCB 2COQA 5SWSD 3RPIB 5F93C 1QFHA 2GT9B 4ZXBD 2FJHA 3ARDC 1DQLH 4NQCD 5ACZB 4LCIL 2HJLA 1QHOA 2CD0A 4WUUE 3KYMB 5DJ2B 4ZQKB 3ARFA 1H3UA 3LQAL 5KVEL 3B2VH 4ONHA 1T1WA 5ALBL 2HT3D 1M6OB 4Q58C 5JPMB 2R2EB 2QLVB 2C4FU 5AYUH 1REIA 4K8RH 4AG4H 3CCHA 2WUCH 1H8SA 3CC5B 3KLHC 2CDFA 3RTQA 4PJHE 5T1LB 5H2BB 3T0AA 4Z5RB 4UZGA 1MOEA 4E42A 4AM0A 3IDUA 3T0XA 4JFFA 1QLFA 2HJFA 4Z7VA 2WK2A 3L3JB 2X4UB 3MLUH 5T3XD 1AQKL 3BP6B 5FGBC 2IPTL 1F4AA 1G9NC 4P9ML 1FNSL 4WW1B 5EULV 1ZT1A 2DWDA 4I18C 1E4KA 3QDMD 1A02N 2FYYB 1IFHL 1PLGH 5GS0C 1AO7A 4D9LL 5JR1H 5D2NE 4MAYD 4U0QB 1ZTXL 2IPUK 5SX4H 2D3VA 4CN4A 3GIZL 2X5PA 4ZTPL 3MO1A 3VU2A 1MFBH 1FPTH 3NZ8B 1AGFA 4OCMC 4OKVA 5EZIL 2GCYB 3CUPA 3PWNB 1I8MA 4HT1H 4PJFB 1JV5B 3VXRD 1HHKA 4W4OA 1J5OL 5E94A 1KOAA 3QZWA 5KN5B 3ESVF 1ZE3C 1VESA 1NCDL 2VKWA 4FTVB 1G7QA 4QRPB 2FGZA 2EYSB 3K2UH 3S35H 3LN4B 2A0LD 3QFJE 1U3HB 2HLAB 1OB1A 3EZJB 4X7CC 3MJ7A 4OSUL 4XHJD 1N4XL 1XGUA 4U33A 1TETL 1CE6A 3CX5K 2MQCA 5ABDE 4JZOA 1T4KB 2AJXL 5IFJA 2BSTB 5DD5L 3BO8A 5FCUL 4AEFA 3BPNC 1KTRL 4N0FA 4WEMB 4J4PD 1P1ZA 3K4ZA 2PW1B 4YHYB 1DTUA 4R6UA 1NDMA 1PY9A 4TQEH 1WIOA 3IDXH 4I2XE 3MTRA 4G6JH 5C0NC 5ID0B 5CBEA 3WLBA 2I26N 3RVWD 2XZCH 4YBLC 3DXAE 1U95A 4P3WA 1ZS8B 5F1OB 2R9HC 4EXKA 1AY1H 3RWIB 1PKOA 1UB6A 4Y5YB 3KLSA 2FATL 1ADQL 5E6IC 4GRLA 1A7NH 4UUJB 3KLAB 4APQA 1BQUA 3OG6B 4IM8A 4TVPL 5IBTH 3TA3A 5CZXD 3G6AA 4BH7B 3WUWG 1R3JA 5EA0L 1N64L 5GGQH 4XVTL 5TE7L 4JFHE 3BJLA 3PABB 1JZ7A 4IOFD 2IANA 1MAKA 1QFUL 2UUDH 4DCQB 4PJFF 2DD8H 3MV8B 4P5TA 4TTDD 3NTCH 2FWOA 1FFRA 3P9MA 1T0PB 3KVQA 1XH3A 1BM3L 1MRDL 4R97B 1GC1H 3GGWB 1KEMH 1IEAB 1G0DA 5I1IH 1HCVA 1T7WA 1KT2B 1PDKA 2C4XA 4RSVA 5JOEA 2P8MA 2NX5E 3QIUB 4LCCC 5INDA 5FA4B 2Z0BA 4M6OL 3U7WL 3REWB 5FYKD 4C56E 3U4EB 3I3EA 1FP5A 3B43A 3ZDXF 1NBZB 4OZGA 1XGTB 3OB0H 3NACH 4JPVH 3F7YB 3ULUC 2AK4D 3O45B 5DT1L 2YXMA 3TN0D 4K7PX 3ZE2E 3RWGA 4CU7A 1KBGL 2MPAH 1M7IA 2AXGA 4I9WD 5HGBB 3E8UH 1J18A 2BDNH 2Z8VC 4IBLT 1BD2A 4LDLB 3I6GB 4NO0A 3BP4A 3C08H 1A3QA 4ZAKA 4AZ8A 3D25B 1S5HB 2APXA 4D9RE 1NUDA 4EDWH 2VLRE 2D7TL 1JGLH 4K3DL 4HG4K 1NEUA 5IG7A 5TDOB 3GBLA 4U2ZA 1A0QL 4JZJA 2J6EL 1OGAD 2WIIA 3NBNA 3CXHJ 3VXMD 3ZHLA 4HCRL 4XX1E 4PJ7B 4KKNA 2EXWC 2V7NB 3GSUA 1NGQH 3CMGA 4MJ5A 3DI3B 4YR6A 4DEPC 1A1MB 1BFSA 4HDIB 1X6NA 3QCVH 5DRWA 2Z8SA 4GKSA 4PG9B 5I1JH 3VXTA 4AIZA 4MNHB 1WZLA 4ZUSB 2Y25A 4WCYH 4R0LC 2OXHA 3AS0A 5JQ6L 2PYEB 2DOCA 5KS9E 5I73B 3D3VE 3ILPB 1OAZH 2QTEA 2VOTA 2E6QA 1JHTA 2YS4A 3H9SE 2JTDA 3WKNA 3CAFA 2RGSA 4GMSH 1VPOL 3BXNA 1TIUA 1J0KA 1OL0A 3BKJH 5AD0A 3QWOA 5FECA 5I30L 1LE9A 4X6FB 1UXWA 2H41A 4W81A 2BVQA 4YNYA 5HY9B 4OGYL 5L7XL 3QHZL 1AD9A 1XGRA 2LQRA 35C8L 2BFVH 2R29L 4G7YL 1WV7T 1S7TA 2Y7QB 1LILA 4FZ8L 4TRPL 3V5DB 1HZHL 4LF3A 3P4MA 5IB1A 5CP7B 4QNPF 1JHLL 2Q8AL 4HIIA 5IB3A 4NNYA 2ZOLA 1NAMH 4ZMAT 3JWOL 3O6FA 5SWSB 4I5BB 5DA4A 5I1CL 5L0QC 2ERJC 4NQCB 2Y06L 3O0RH 1OP3K 3K46A 1UCBH 2NY2C 3UPRA 1HNGA 2ATKA 4Z7UF 5E8OA 3TC9A 3LKPB 3MV01 1ZHNB 1ZV5A 4J2XA 4QHMA 3HR6A 1CGTA 1R24A 1CR9H 3VWKA 3OKYA 4Z8FL 1AKJA 3Q3GB 2AV7B 3LQMA 2WMPA 4LRIC 4W68A 5EZOH 1ZHLA 3NABH 1TQBB 3R0MA 1YEGH 3PV7A 1HILA 2KZ1B 2XRAL 1ORQB 3GB7B 1EMTL 3MJ8A 4FZEL 4PD4J 5MI0B 3EJJX 2X4NA 3L6FA 1AGCA 1UZ8A 5MEND 1TNNA 3HPJB 4YZFE 1NCAH 3H3PL 2F19L 3FO1A 5BS0D 1JGDB 3HNVH 4XCCL 1H0DA 5ICXA 4KVCL 3I2CH 4DZBB 4PJCA 3QDMB 2O61A 5CINH 5C9KA 1GOFA 2CDGA 5FYLD 4KV5F 3KDMB 4HJJL 4ZOCA 4JY6A 4MAYB 3GUTB 3ZE0F 3IGAA 4OZFH 3QEQE 4WDIA 1W0WB 1YJDH 1SBSL 2FD6L 4I3SH 2ESVD 1FCCA 2VRAA 1Z9MA 1OM3L 5J1TC 4X5LA 4RGNE 4R2GD 3L3OB 4U1KA 3STZA 3VXRB 3ZYOA 1PVHA 1IQDA 5LAXB 5I76A 3ZSTA 1P4LA 4P49A 4R4NC 2DB8A 3P9LA 5JPNB 2DF3A 1OT2A 1ACYL 3SE4C 3IRZA 3QUMH 1TXKA 3O3BB 4QWWD 3RDTD 1JUFB 1LGVA 4OCRL 3FN0L 3TV3L 3S5LB 2VSDA 3QDGE 5JOFB 1LDPL 2HVJA 3VD9A 3IDNB 4Y4FB 2CO6B 3NIFE 1KPUA 3AUVA 1F2QA 4JO3L 1Q9WB 3BZEB 4U6VL 4PJ9C 4XNYH 1I9IH 2OYPA 1WTGT 3ZO0A 5BV7H 3CVIH 5DJ8B 3WFHB 1B90A 2NCMA 1DE4A 1JYVA 1TJGH 3NIGF 4IRZH 4IMKC 5IF0B 1MIEL 4ELKA 1C5BL 1WFOA 3O41B 4MA3A 2Z93B 5DEZA 3SEPA 4LLUB 3SKJL 3O6ML 4Y0GA 1A7QH 2ATPA 4IRJA 4LRNH 4HH9B 4XMPL 3QI9D 3VJ6A 3RI5K 4N8CL 1JGVL 2UYLA 2CK0L 3VFMB 3GMRB 1DUYA 2ARJB 2VQ1A 2OMBA 4LVNC 4G6AD 1KJMB 3G9AB 4NKMA 5ILTH 1MAJA 2YEZA 3CGTA 2WBJC 4X4XB 3O11A 4PRID 1X5LA 2AJ3B 4XPAL 1OAUH 1TTFA 5HVHB 2HH0L 3BGFC 4HIEB 1QOKA 3O8XC 1A6UH 3CDGB 3N1GC 4U1MB 5DHVA 1PSKL 4A6YL 4HS6A 4LSPL 4MNQD 2B8OT 2AI0H 3HZVB 3MV9A 4G7VH 1E6JH 1UZ6F 2ZUQB 4OJFL 3RGVC 5IB5B 1YYLH 4I3RH 1B4RA 3L5XH 2E8YA 5F7FA 3IXTB 4OIBA 2XNAB 5MERB 1RK0A 4DTGL 5F3BA 4I8DA 2X4SA 4M7JH 5EO0A 1KIPB 4P23A 5DJCB 1FZOB 3CH1A 3WLWC 1JHKH 3P9WB 4YO0B 2AK4B 3TN0B 1MCIA 4H20L 2VTFA 4LAJH 2H45A 4DN4L 3MV7E 2PETA 5GGTL 5JDSA 3CSGA 3DX6B 5CD5D 2F53E 1NGPL 1RIHH 2NXYC 4WY7L 1YYML 2DQCL 3KPSA 4J12A 4MJ6A 3PWVA 3TIEB 2B5IB 4K9EC 2A83B 2AABH 4X80H 4JG1H 1OGAB 3G6JA 4YDKH 4DKFL 3L7FB 3PWUA 3VXMB 3L3GA 1OP3H 1R5WB 1KJ3L 3QJFA 2PTTA 5D96C 1FJ1A 3SE9L 3IYLW 4LP4A 3PP3H 1KPRA 1IQWL 4UQ3B 3IDJA 2VZVA 1HCFX 1VHPA 3S37L 4PTTA 5DJZA 1P4IL 4LPWA 4OGXH 4XMLL 2EKSA 3GJEB 3GSRB 3KXFD 1M1SA 3CVHH 1XGQA 3TNNA 1G7PA 4NHCH 2FO4B 12E8L 4G8GB 1IGML 3K74B 3LKOB 5F8RC 4NRXB 4OLWH 2IH3A 2BX5A 2QEJA 1CL7L 5CEXA 4Z0BH 2B1AL 2WWMC 2F54A 4PJGA 5MHSE 4J23A 3ULVD 1YY9D 5DZNA 1MLCB 4LCWD 5KSUB 2A1WH 4JQXA 4NFDA 1CFQB 3WS3A 1T83C 3MR9B 5D7JA 5J8OA 1RIUH 4D8PA 4H1LH 4BFBD 1J1OH 2BVYA 2P47B 1P5VA 1P6AB 4N8VB 1QA9A 4YBHA 4U0RC 4KKAD 3VCLB 3MXVL 4CMMA 1SEBA 1EEQA 1LO3H 1T66D 3DXAD 2VAJA 3MROB 4V1DA 3RWDA 4M1CC 3MRBB 1ZVHA 3EHBC 1GZPA 4LPYA 4XXCA 5F7EL 4R3SB 1DDHB 1Q9KA 4X83A 2IH1B 1BD2E 3PWPD 1LO4H 2P8LA 5JXEC 5KSBA 4JPIB 3NAAL 5ENWB 3O3AA 3GMNB 5D6DA 1I1RA 2AJSH 3NCMA 1KPVB 5BMFH 5JR1L 2ARWA 5DDHB 3JTTA 4Y19D 4KTEH 4GJTB 4GKOA 3BN9C 1MFEL 5HHNA 1CLZH 4K7PY 4XBEH 1A64A 4FQHB 5J4MA 4X6CA 4U1IB 1XGPB 3RWCA 1MFBL 2E7MA 1QKZL 2Z4QA 3UTZB 1SHMA 5MENB 3QT2A 5F1KC 4Z7WA 3DWTA 5BS0B 2NX5D 4FXKA 1ZVSA 5LVEA 1IKNA 2GFBA 1W72A 1I85A 3FFDA 1HI6B 1NSNL 4ZYKA 1FQ9C 1YQ2A 5HDOA 2WV3A 5D1XA 3D85D 4NKDA 1LK2B 3ZKMC 4RRPA 5E0QA 1A6WH 2EH8L 4GMTL 1UJ3A 2ESVB 2AERT 2FH6A 2W9EL 3S3JA 4OZHA 5D9SB 4F7MB 4N5EC 1CXKA 4R2GB 3WDHA 4I77H 4N9GB 4YK4C 4S1QL 4U1JB 5KAQF 1FGNH 3A6OA 3LKNB 4U7SA 4ZPTB 3QFDA 3MCLL 3VFVB 1AY1L 1A9EB 1KB5L 1B2WL 2HTLD 3B9EA 1UM6H 5BJTB 4WRLA 1Q1JH 3DV6B 4G6FD 2R0WH 1IM3B 3A67L 1U92B 4NZUH 4LPXA 2FH8A 3CFDA 3SGJA 2YPLD 5IW6B 5ISZE 3IF1B 4M6NH 2DIBA 2BVEA 4K3JL 3G04B 1ZVYA 5CWSB 4KK8D 3VE0A 4MA7L 3SKNB 1E4XH 1KJ2B 4KK6C 2JIXB 4K7FB 3L5HA 4A2LA 4RZCA 1WFUA 2LTQC 3CFEA 5J9PB 3I6KB 1F2XK 5K9QI 3QI9B 4F7TA 3VA2C 4PJBA 4WHTA 1TNMA 3ECBB 1XF4A 2ZWLT 4ODVL 2OTUA 5KSAC 1PYWA 5EO9A 1WZMA 1AGDB 1K8DB 4PRNB 1MJ7H 4PJCE 5CSZB 4EXPX 5EOTA 3HI6L 3NACL 3NCJH 4WWKA 3QCTL 4PRIB 4BFEA 4ZS7H 2M2DA 1ONQB 1Z5LA 1U3JA 5HTSA 5I15L 5I75C 1JFQH 1BFOA 4XCFL 1NFDB 5IHUL 1OW0C 2DTML 4MNQB 5H35A 5EU5A 2H32B 3QUKB 4WUUB 5CGYC 2FIKA 5F3HB 5I18H 4DGIH 1LVEA 4UTAH 3MRJA 3FJTA 5DUBA 5IOPA 2HT4C 4XP1H 5E2TL 1RULL 2L7JA 1IGCH 4V2CB 2QSCL 1IZJA 2P5WA 4NWUL 5HHQB 3KPRD 4JFQA 2CH8A 4RAUA 2VLJA 4FQIL 4FQQB 4YHIB 4JKPL 5DI8A 3HUJB 4KKLC 3MRDB 5I1JL 1BOGB 1FFOA 1MHHB 1ZT4A 1A47A 1FLTX 3BI9X 5D7KE 3ARQA 2GSIB 2VDMH 3MMEB 4GBXC 4JEGB 3BIKA 1N5AA 3NH7H 5FF6B 4CVXB 5C2BH 1DUZA 3QWRD 5EU4B 1P9MA 4CU6A 3TYFB 3ME0A 1AXTH 1EFXD 4JAMA 5D2NB 1WFNA 1T0NA 3BKJL 2VMFA 4CNIB 4JKWA 3GNML 4X5XA 3LDBB 5TDNB 3BYTA 5IVXA 3HCVA 4L3EA 1MUJA 2G2RB 5B4MD 1FLRH 4GSDL 4HBCH 1N6QH 2BFVL 1UB5B 4KKCD 3H3BC 3ES6A 3KS0J 4TNWF 1CT8A 3KXFB 1UENA 3MRPA 1BX2A 2DJ4A 1F58L 1BLNA 5DRZA 2V17H 1B4JH 4PR5B 1NFDF 3V7MA 3HKFA 1NAML 3OKLB 4XVUC 1I3RA 4PV8A 4O5LH 5F1NA 3EO0B 2MQ0A 4IMLB 2ZUXA 3IJHB 1A1NA 3QDGD 1UCBL 1TZIB 3V5KB 1G0XA 1UGNA 2AAVA 2HFTA 3G5VB 5IBUB 4LCWB 3V4UH 1B0GB 2VLLB 4P46C 4DGYH 5FHAH 1JL8A 2AEQL 4EEEA 5IROC 2HKHH 4U6XA 4PLKC 3VGGA 3BKYL 5ESVB 4LSRL 3I6LE 5BRZA 4HULB 1CF8H 3HUJF 4I2XB 2K1MA 4DUXA 4NHUB 3TPUA 5EZOL 2BNRA 3QIBC 5BOZG 3DXAB 3O3EA 3BHBB 4OLZH 2VWEE 4I0PD 4A6YA 1JN6B 4XNZB 5BZDA 4QRTA 4XAKE 3GMQA 1S7UB 5J3HC 2C7UB 1F90H 3RA7H 4PLOB 4YDJB 5T33L 1ZANH 2OZ4A 1WFTA 3ZL4H 2Z31A 4JDVA 3I2CL 3JV6B 1P7QA 3PWJB 5L6YL 1QLRB 1YEJL 3VD3A 4LLMA 1DQDH 4FXLA 3G6JE 4LDEB 4OQ1A 2CSPA 4JO4L 3OV6A 4Y19B 2VSCA 4K7PH 4PJEA 2LU7A 3BRDA 4NRZA 1CL7I 3R1GH 3DYMA 5GGTA 3O81A 4N1HB 3KPNA 2QHRH 4L8DB 3QG7H 5D6CB 5GSRA 2DI8A 3C9NA 1FYTD 3IJYA 5F6IC 4I3SL 5C08D 4J8RA 4PRDA 5C6TH 1OTUC 1UADC 3THMH 4BUGA 1PAMA 4NO5B 1OSPH 2ADJB 2W9DL 2NX5B 3CPLA 2FBJH 4XNXH 3ULVF 4QY8B 2I5YL 1H15B 4JHBA 2NTSP 5CJOL 3MYZA 4RWHA 3FCTA 3MRGA 4OCSL 1K2DA 5GJTH 2VXSH 1RZJL 2R0LH 3LN9A 4P9HC 4OT1H 5CEYB 5D7IF 3D85B 1CWVA 5HYJD 4M6MH 3H8NA 2YD9A 4HUMB 2VLKA 4JREB 4F33B 2EDNA 1NUNB 3TIDB 5FYJH 4BKLB 3W11D 2DDQL 1Q0YL 1I3GH 1TVHA 4TVPE 5JXAH 5EZJA 4DVBA 1RMFH 3RKPA 1K5NA 1I9IL 4XNYL 3ARFC 3SDAD 1EEZB 4WTZG 5BV7L 5C0JB 3FO9A 2HG5B 3L5WA 3MJ9L 1GH7A 3MRRB 3GI8H 1JGEA 5SX4I 5IKCA 3F8UB 4LCYB 3PHSA 3MREB 1ES0A 4CBPA 3GSOB 5JW5B 1WCBA 3HR5A 5T5FL 5L2KE 2XTLA 3MRMB 4FFZL 3V0VB 4G6FB 1OLZA 5CEZD 3D0VB 4PJXA 5DJ6B 4JFEA 1GGUA 4MD4B 3LN5A 2M1KA 3C5ZC 3ZE1E 2BOCA 4BYHA 2YPLB 2YXFA 4JFYA 1CGWA 5ITBH 5GQBA 2V2TB 5TF1H 5CBAB 4NZTH 5D5MB 2R69L 3G08B 4NT6A 2J88L 1E6JL 3DV4A 2W0FB 1LK3H 1FZJA 1SJEB 3GMPB 4FHBD 4KJPC 4PG2A 5DRXA 3L5XL 4L8BB 4ODHH 5EIQA 1MY5A 5C0DB 5T1KA 4WFHE 3LRGA 2FB4H 1HKLH 4M7JL 3MYJB 5EUOA 2VDNL 2BVPB 1MCBA 5F7MC 3SDDD 5J06A 2EE6A 5GHWH 5TQ2H 4MMXC 4ODUA 2HLFC 4JKKA 1DSFL 5CP3H 4LCUA 3MJ6A 5HHXL 5DSCA 5HYQB 4HKXA 3RL2B 4GXUN 4M1DL 5JNYB 3O9WA 1J05A 3VMNA 1NGXB 3L9RA 4FOMA 4TUJB 2V9QA 4UT6H 2NY3D 1S7VB 4MA1B 2AABL 4X80L 2M26A 4YLQT 5GRWA 3FO0H 2DL2A 5C9JA 3K1KC 5DQJB 2D7OA 3WXVL 4WJ5B 4HK3N 3IETB 4PRAA 3VA6A 1SEQH 5ETUB 1CU4L 1H3XA 3KPRB 5IW1B 5BQ7A 5EU3A 5JZ7D 3JZ7A 3DBXB 4KJWD 4XPBH 4IEFB 3T0EA 4OGXL 1LHZA 2VN4A 5BXFA 5E99L 4HKJA 1JNLH 3FAWA 1C7SA 2NW2A 3FHAA 3Q6GL 4Q9RL 2YA2A 4NHCL 5D5MF 3GI9L 4I3GA 1T03H 4KTDH 4APQC 3FB8B 4HWZB 3TA3C 5K9JH 3OF6D 3WNPA 2Q20A 3EFFA 2VZ3A 3ZDYE 1IT9H 1F11B 2X40A 3BZFA 3HAEA 3QXTA 2FDBP 5LGHH 5JLZB 4QHNA 3H7BB 4LVEA 4YFLI 1FVCB 5I1DA 1ZA3B 1RIUL 4QT5B 3VXSA 4RGNB 2ZCKH 1AI1L 3TWCL 1NEZA 3IFPB 5KVMC 4YHPB 1QSED 4IRSD 4XTRD 1JZ5A 1SYSA 1HHJB 4Z7OE 2XA3A 4M7ZC 2D0FA 1LO3L 1FVDA 4M48L 1HSBA 1MAMH 3IFLH 4NZDA 3IFOB 1JBJA 1BJ8A 2YD5A 2G5BA 2QJDA 3QDGB 3IDMB 4WHCA 4JFXB 3EYQC 2B4CH 5LCVH 1GPOL 2W0PA 3HZKB 2PR4L 5E6ID 5F9JA 1MHCB 2HMID 1WC7A 2JB5H 2ICES 4V2BA 4YHKH 3VXPB 2H6PB 5K59E 4ZAKC 3W82A 1U8PA 3P11H 4PP1D 3EJYC 3W39A 4CDGC 1S7WB 1A7OH 1JWUB 4CL7A 1U0QA 4JZJC 1R3KB 4S1DC 1GHFH 1QD0A 3DUHA 5F89A 2NY4C 2P5EA 3EYOA 4UV7L 2HWZL 3WXWH 5DLML 3TBTA 5C0FA 5HI5D 1Q0XH 3HLAA 5D7LD 2G75B 3ELAT 4QXWA 5DEFA 4FXGB 3FTGA 1KJVB 2OL3B 3RZWA 3MRQB 3MLXL 1OF2A 5F21B 3TZVA 3LKRA 1DQJA 3OKOB 4HK0A 4WVRA 4ZSOE 2VZSA 5I17B 5FYKH 3TT3H 3DPBA 1U8KA 2BHUA 2CO7B 2GITB 5MP6L 5C0CE 4NO3B 1A6WL 2A74B 4QRRD 3ROLB 3V52L 3HE7A 1FYTB 5IVXE 5C08B 4L3EE 4XRCB 1WQVT 2VXVH 1R3IL 1YNKH 4ZUVB 3QCUH 3QDJA 3FRUA 1JF1A 5DUML 1RHHB 5AAWA 4RISH 1FGNL 1Q9LA 3CMOL 4HXAL 5IFHH 4F7PA 3SJVE 1U8LB 5I1LB 5EOCJ 3ARWA 1HN1A 3KPMB 1CIDA 4X6DE 4MJIA 2YUXA 1JF5A 1U93A 2GY5A 4EOWH 5D93B 1Q1JL 3PIQA 5I2IA 2F53B 4QOKA 1B6DA 1PZUB 3M8OH 3FFCA 4M43L 4ZFFA 3W9EA 1CDHA 3HNTL 4QEGA 1DFBH 3HB3D 5HGDB 3RZCD 4M6NL 3SDAB 4JFPB 3PGFH 4UU9B 5IMKB 3IU3A 2NY1C 3QPXH 4GW4A 1OT1A 3FQRB 1QRNE 1E4XL 4J3OC 1K4CA 4FQXC 4JG0H 4IOIB 2XXCB 1W0YT 5HHVH 3QXAA 2IPKA 5B38G 1UKTA 4XVSH 2W0LA 3QEHA 4HIJB 3T77A 4EN3A 5HI3C 1WGOA 3I84A 4GKNA 3WCYA 2DQJL 4F8QA 3K81A 3UX9B 2EXYC 2PXYA 4KUZL 3WDJA 5I8EA 1SBBA 4FFWC 3STLB 3U9UA 3SDXB 5JORA 3RVTC 4EVNA 3B9KD 5I9QB 2X4QA 2JELL 3NCJL 3EJZC 4Q9QH 5J6GB 4ZS7L 4P2QA 3L3IB 1G7JB 1KB9K 4N1CA 1GVIA 3V8OA 2HFEB 1M7DA 4PJEE 1OARL 1RJZB 3UTSD 1LEIB 4DKDC 1YEEL 4HKBB 5GGSY 1BGXH 1IAOB 2NY2D 1ZGLB 5J6HB 2AGJL 1AXIB 5E95B 1UG9A 1KN4H 3UTTA 3IJSB 1IGTB 5IVZB 4K94C 4JVPA 3V6FB 3TBWB 3RQ3A 4U6HA 3TLRA 3MLTB 3SDDB 3QUXA 1J1PH 3MXWH 2JKXA 2OI9B 2IQAB 4WFFD 3RY6C 2MJWA 3P4NB 3SCMC 3JV0A 2BRRH 4N0UB 3I9GL 4RGOH 1UACH 2P42B 4Y4KC 5C0RL 2E7BA 2F5AH 2P7TB 1C8PA 1U8HB 2ZUWA 3DHJA 1UA6L 3DVGA 4P2RE 2IFFL 5EDXA 2NY3B 1GGBH 2X44D 1ZEAH 3W81A 1SJHB 5DQDL 1NC2D 1WZKA 2W91A 2EC9U 5I6XB 4QTHA 2NY5H 5ESQB 3WBDA 4RFNC 3A6CL 5GJSH 4LSTL 3UC0H 5FYLH 4Z18A 1NGYA 3U1SL 2VISA 2XACC 5T1MA 4UIMA 3BPOB 3SDXF 4XX1G 5JDJA 1N6QL 3HC3L 3IB4A 3GSVA 5C0IA 3UMTA 5HDBE 8FABA 1MJ8H 4FRWA 4POUB 4RIRB 5CSBA 3QIWA 1MVUB 4JLRA 3ZTJH 2XWBB 3LQAC 1EBAA 2X4RA 4JFEE 3TM6A 2WZPD 2Y4SA 2LE9A 5CUSL 3UDWC 3VWJD 3IKCB 3MJ9A 1ERNA 3EYFB 1RJYA 5HDLA 1J0HA 1JJUA 3CSYB 3MCKA 1FVEB 1WZ1H 3NPSC 4HJ0C 4Q97A 3FQNA 1TQCC 1U8IB 3NFSL 3SKMA 5L88H 3E2HB 1EHLH 2V7HA 3UYRL 3V4UL 4P3CH 4M93C 4DGYL 1FNHA 4JFDE 1N6VA 3ZMRA 2HKHL 4F37K 6FABL 3BW9B 4MD0B 1BP3B 1I1AD 4DW2L 4IRSB 1CF8L 1RZFH 4ENED 5FCSH 2WQ8A 1JPGB 3VRLF 2G60H 2JJSC 4OLZL 4PY7B 4HS3A 4U6YA 1WAAE 5C09A 4P23C 1JNNL 2F5BL 5AZ2L 2VWEC 4HUXA 2HFFA 3U2SA 1ZLVK 3IDGB 2XXMB 5F7KC 3VXOB 5FO7B 1ITBB 2VDPH 5F9OL 3FONA 4HWUA 4R9HA 1T3FB 5I1GL 1BIIB 2H2SC 4JZNA 1W2KT 2Q3AA 1NJ9A 5HYIA 4E9LA 2YD1A 2X1QA 2NNAB 5ISZB 1NKOA 4XPGH 1CICD 5DZLA 5GGSA 1FN4B 4K07A 3T2QA 3E1F1 3KPLA 4LQFH 2LFGA 5BZWA 5E7BA 1EJOH 4OQTH 3RVXC 4MHHI 4HX1A 2QQLL 3R1GL 4IJ3B 3KYNB 3HZYA 4UBDC 3DYPA 5DMGD 2FIRT 1WEJH 3LKSA 5D7LB 4JM2A 1CG9A 2H32H 1OSPL 1N6UA 4D3CH 1FNFA 4YE4L 4P3DA 1MH5B 3QUZC 5EFIA 5A1AA 4XNXL 4BQ8A 1IGYA 5FM5M 1KELH 3FQXA 2GK0A 1OQOA 3BP7B 3T65A 1MHPL 4Z0XB 3GO1H 3RWFA 5GS1B 4Q6IA 3ARBC 4PRHA 1I7TA 1IGIL 3OJ2C 2XKNB 1IGJA 2LVEA 1KFAL 3OKDB 3MA7B 1T2QH 2OXGA 2R15A 3I50H 3ZKQD 2ADGB 1RAMA 4JQXC 3FQUB 1LP9E 5GPRA 2OK0H 4PJDE 1O7SA 5JW3H 1KLGB 43C9A 3P77A 2MTPA 2H9GB 4R8WH 5JW4N 2P24A 4OD1H 5EO1B 1UWGL 4Q2ZB 1E28A 3BIAX 3GI8L 1GGCL 3KR3H 4C54A 3CXHK 1EGJH 4G9FD 4LHUD 4Z78A 2H8PB 4NYLA 5GRJH 4TNVF 2IG2H 5IESL 2HRPL 1E4WH 5A43C 3P73A 4P4RA 1I8LA 4F9LC 2WSKA 1BBJA 4XXCC 5IEKA 3QA3B 4H5SA 2DLTA 2OJEB 5GSVB 4U1LA 3EYUL 4X4ZA 3VFRA 1QVOA 3RZCB 2Q8BH 1UWEL 2H1PL 2IEPA 4MLIA 2EZ0C 3PL6A 3QG6A 4MD5A 5ITBL 2XA8H 4P48A 2K9UA 4NZTL 4KI5E 4QHLA 1NBYB 2IADB 5KANG 2OR8A 1ZLSH 3G6DH 4ODTL 4FQCH 3ULVH 3OAUL 5C0AA 4NKOB 3MBEA 1E27B 3U0TB 2VL4A 4CKVX 3GBML 1XIWC 2H26B 4TUOA 4ODHL 2FX8L 3VGFA 3V4PH 4KTYA 1KENH 4MQSB 5ALCH 4JY4B 5ADOL 3GJFB 4XP5H 2IGFH 5IMOB 3ULUF 2IC2A 2QADB 3UBXB 1F3JA 1U8MB 1CDYA 1OD9A 1YY8A 3PHOA 3P4OB 4Y4HB 4NSKB 4OZIA 4ZOAA 2O5ZL 2A6IA 3B9KB 4XMKL 1ULVA 5LGJA 1TJIH 1YPZE 5C8JB 1PZ5A 4CADA 5CIPA 1WSST 4OZ4B 4YJZL 5IP4A 1A9BB 4GW5A 4LDOB 3UTSB 2X10A 3PGCA 2ZCHH 5IJVA 5D1XC 5JHDE 4ZO7A 2PO6D 1RUQH 4NQEE 1RZGB 3TO4D 1S9KC 1VFUA 4RMVA 1CVRA 3U48A 3JUZA 2AEWA 4BQCA 1YMME 5T3XL 4NDMB 1VA9A 1A3RH 1G6VK 4LGSB 1G1CA 2C1OB 3D69A 1NCCL 5DR5L 1PG7W 4R96A 1RU9H 1F4YL 5DQ9B 2E3VA 2X05A 1XFPA 2X4TA 1A22B 1OTSD 3QZWG 4MJIE 1E4XI 4GXVH 5E8EA 1AC6A 4HWBH 1VFAA 5EUKA 1JNLL 5D8JH 2ITCB 2N4IA 1LNUA 3LB6D 5H37G 4BZ1H 4KQ4H 4KTDL 2X7LB 3QUYB 3ARED 1LWRA 4U1NB 2DWEB 3UTQB 1CTOA 5I71B 1F4XL 5ANMB 1KCVL 1YN7B 5FA3B 2AEPH 3CSBA 5C70A 1V7ML 3SGJC 4M8QA 2VABB 5C0CD 2RR3A 1J0ZA 2PUQT 2MCG1 3JWOC 3SGKC 4KC3B 4MQXC 2IBBA 2XWJB 1LE5A 4P2OC 3OBAA 2FCBA 4JPWH 5ECJE 2C3GA 2ZCKL 1MHEA 2FX7H 2V9RA 3T08A 3GHBH 1MWAH 3ZYIA 4TOYH 4WU7A 1NL0L 4QRSB 4GO6B 1QFWL 4MXVE 3AS1A 4ZPVB 1V3JA 5DYOA 1MI5A 4GAFB 3VI3F 1DANU 2C1PA 3VWJB 4P2QE 5C0BD 4X0KB 1KCKA 2XY1A 1Q8MA 3CFCH 1YC7A 5LCVL 4NM4L 1AGEB 3I75A 1AD0B 3PQYE 1WITA 2EIZA 3AB0B 3F6LA 3ARUA 2A77L 2LU4A 3TBYB 3KYMA 4AYFA 4L1DA 3VI4E 4Y5XB 4O00A 4M7LT 4LVHC 2ZOKB 1FFQA 5D2LE 1I1AB 5C0GB 2R2EA 1NC4D 3P11L 1HH6A 2BVOB 1A7OL 1XCQB 3VRIA 1YQVH 1MF2H 5L2JB 3B9AA 1R3HA 3W0WD 4XHQA 1U9KA 4LBEB 1G9EA 2P46B 2YOCA 1WVZA 3WJLC 2L4OA 1BQHG 2OMNA 4M61A 3NGBB 1FV1B 2HRLA 3L3JA 2X4UA 3LRSA 3SE8L 1SJXA 5LXGH 2BOBB 2DLEA 3C6SA 1AR1D 4KKBD 4U1GC 2B2XH 5DVNA 3VXUE 3VG0L 2JCCE 1BFTA 1CICB 4J3TA 1EERB 4EI5D 1FDLL 3H3KA 3HC4H 4JR9H 3VFPA 5MEPA 1MRFH 5M94B 1AGBB 5GZOD 3W5MA 2BJML 4FN0A 3S36X 5IW3A 2YRPA 4JFOB 3R06A 1BVLB 3NZ8A 3ULSB 1DL7L 5JUEL 3TVMD 1DVFC 2MWCA 5CGYD 4I13B 1JV5A 1AE6H 3RVUC 2Y23A 2HYMA 5KN5A 3WIHA 4RISL 4JRYD 4PP2A 1QLEH 1T6WA 2APVA 2P48B 4QRPA 3LN4A 5EU7E 3DRQA 4IOSD 5HHOE 2FEDD 4Y88A 3E6HA 3WFCH 2EECA 3R0NA 3WN5C 5I1AB 3JWNC 3MRKA 1K8IA 2R1WB 2ICWB 5KVFH 3S9DB 4UQ2A 4KVNH 2BSTA 3EDEA 4Y5VB 1JI1A 1NCTA 3M8OL 4NOBA 1H5BC 1Q9OB 4S11A 4LLYB 4NP4H 5E00B 1XCTA 4C4KT 5KG9A 2R1YB 1RJLB 1RZ8B 4XP4H 3K1DA 4XCNB 4KU1A 3DIFB 4S10A 3BMWA 3QAZC 4E41D 3QEUA 4GG6E 3FT4B 4UOW1 1ZS8A 4G9FB 4FS0A 2BY2A 3OKKA 4LHUB 4MCZA 1VKXA 1YEIL 5KSVB 2XFXA 1MCDA 3DLQR 1UEYA 2CRYA 3P40A 2D31B 1YEHH 3AMLA 2B1HH 1FNGB 4UUJA 3KLAA 2DIJA 1EHNA 2FJFB 3H7LA 4UINH 1NPUA 4N8PA 1IC5H 2BSRA 3PDOA 4K8RD 4OUOA 2Z31C 3X12B 3PABA 4LPCA 2R0KH 2Q87A 2RJMA 5ICZB 1ZLUK 5B22A 1F13A 5IQ9A 4LKXB 4PY8I 3WEXA 4DCQA 3T3MF 4Y89A 4F58L 1HHIB 4OM0H 4DOHB 3MV8A 1BGXL 1X5HA 4AH2B 4WTXA 2AJZB 5EPMA 4PUBL 2FX9L 2ZG2A 1I1YB 1VSCA 4PLKD 5D1QD 5FA4A 2XTJE 1HSAB 3REWA 1S9XA 1X5ZA 1X5YA 2CMRL 3QWQB 3U4EA 5E5UB 5DS8B 1FC2D 5LBSH 3PXHA 4YUEL 3ARDA 3GMOA 3F7YA 3VG9B 5IHZB 1RIVL 2DQUL 4ZUUA 4YHNB 3D87B 3GDBA 4PREA 5HGBA 2EO9A 2XICA 2YUWA 3DMMD 1S7XA 3SQOH 5J1AB 3I6GA 5J3HD 3L3DB 1DQQA 2PO6B 3WKMH 3D9AH 3TO4B 3D25A 4OF0A 4DWHA 5TDOA 1J8HA 3HE6D 2OL3H 3RWEA 3TESA 4OB5L 1KN2L 2UWEB 4PJ7A 2V7NA 5FYLL 2J2ZA 5C0EB 3DNKA 1A1MA 4HDIA 1FSKB 1OTTC 1XF5A 4KDVA 1Z3GL 1MIMH 4F7CB 5FGBA 4XXDB 3H42H 4MNGA 1A6AB 3RWJB 2VL5B 3UZVB 2AS5M 1FL3A 1MCRA 1JYXA 1RI8A 2NYYC 3DRTB 1OTUD 1RURH 5GGVL 3HN3A 2AW2A 3MPCA 4L5FL 1U58B 2BSSB 1FORL 5DXWA 3LEYL 2J8UB 3AREB 3PE9A 3B3IB 4NUJA 5HPOA 3CNKA 2RQ8A 5TE6H 4ODBD 1LO5B 1WZ1L 4P59H 5C0CB 4TYUA 1HXYA 2YC1B 2CLVA 1IL1B 1IAIL 4UOJA 4WGVB 1KXTB 2NZ9D 3AC0A 2NR6D 5C0AE 1M71B 4IDJH 1HHGB 4N0CC 2QV2A 1U36A 3NA9H 1HK6A 2Y7QA 3NIDE 1RZFL 3GSNA 3IXAA 4PG2C 3V5DA 2ITDB 5CP7A 3BAEH 1S5IL 4L4VE 5DD3L 3GMMA 4JO1L 4KMTL 4L4TE 1AXSA 1NLDL 4J1UB 2QQKH 4HC1H 4L1HA 2JK5B 2L7UA 4U3XA 4I5BA 4NN5B 5B38B 5C0BB 1NMBH 1I9RL 3LPFA 1KTKE 3WMSA 2X09A 4PJIA 1URLA 4L9LB 1KJ2L 5C07A 4AEEA 1N2RB 3RTQD 4H26B 3LKPA 5DVLA 1ZHNA 4ACPA 1A21A 3RKDC 2UWEF 2Q76A 1U8JB 5DURD 1X7QB 3HC0B 4JFFD 2CLRB 2EO1A 3RU8H 1CD9B 1FAIH 4XPGL 1DBJL 5CZKA 1NC4B 3NCCB 3Q3GA 1KEGH 5IB4B 1FO0B 4JB9L 3DVIA 1C12A 1S3KL 4WUKH 4OUUB 3GB7A 4PGDB 2V2WB 1AO7D 3W0WB 4HMDA 4LSSL 4JHWH 5K9KB 3BIBX 1E6OL 2XZAH 4Y1AA 2Q7YA 5HJ3B 2J8UF 5A16B 3HPJA 3SO5A 4MQ7B 1A6PA 3WIFA 3C2AH 1JGDA 5E9DA 1G6RA 1TVDA 1DN0B 4OF7A 2DM4A 3F58L 1KELL 3C60C 2RCSH 3WFDH 1VGEH 3ZHDA 3A0OA 4EI5B 2WLZA 2NY6C 1U8OB 1ACZA 2WW8A 2ORBL 3GUTA 1HQ4A 5GISH 5BVPH 1L7IH 4R26H 5CJ5A 3W9DB 1VENA 1ZWIB 3X14B 4XNUL 1A3LL 5E5MB 4Q0XL 5E2UH 4O02H 3HG1E 3TVMB 5IVNA 3HI1B 4OLXH 1N5YL 3D0LB 5CZVH 1OAYH 1WBYB 3BDYH 4MS8D 4R8WL 4JRYB 5CMAA 1G9NH 4M7KL 5I74B 1CGUA 2VZ1A 4EIZC 2AJVH 1KIQB 3MUY1 3JWDL 1ZSDA 3LEXB 1NANH 1PKQA 2YN3A 4PBXA 1EGJL 5GS0H 1JUFA 5GRJL 1JMXA 3OHXB 2ZNWA 1JYWA 5A2LH 1F3RB 5CJQH 3P4LA 5HGHB 1TJHL 4OCYH 5F6HI 4C4KO 3ZDZF 5K9OA 3IDNA 4Y4FA 3K4AA 4TTGA 4H0HB 4MVBD 3CFJA 1MCWW 4QXTA 1JGUH 2ICWJ 5DVKA 4GRLD 1KNOB 4U1SA 4APQD 1NCNA 5I1HH 1NMCC 3TA3D 4RMQA 4R7DB 1P53A 3T8XB 1D6EB 2HVKB 2DI7A 3O41A 5D72L 3CJJA 1NMAH 4KI5C 4CJ1A 3V5HB 1PQZB 2EIEA 3BT2L 4R0LA 4OAWA 2A73B 2IAND 5DO2C 4GT7A 4M5ZH 5DA0B 2ADIB 4HH9A 5E5RB 2ZPKL 5JOPD 4P5TD 3PNWB 1KXQE 3GMRA 2ARJA 2CQVA 5FDWB 4OLVH 1UXSB 4PJAB 1KJMA 3BEVB 5DFVC 1S9VB 3ARZA 4GUPB 3AM8C 4NC2B 1XR8B 3CSPA 4X4XA 1KYOJ 3OR7B 4WHYG 3C6LB 3OGOE 2Y5EA 1M4KA 1ITCA 4KHTH 5IQ7H 4YGAB 3OQ3B 4HF5H 3EGSA 5IWLC 1BFVL 4DUWA 1G7IB 3MUGB 2W60B 2CK2A 1OGTA 3VGAC 3MZTA 5D4QA 3VFWB 5JMRA 4I48B 2XQBH 3IXTA 5FDYA 4Z95L 4PJFE 4MGXA 1A4JB 2HKFL 4NO0D 5HDQH 3T1WA 5D1QB 5TQ0L 1I8KB 4ZS6C 4OCWL 4C83A 3WIIH 3MNWA 4YHMH 3DTXA 4LIQL 5DJCA 2B7DT 2OQJB 4FTVE 3B9DA 1BREA 1UQSB 3SE3A 1CD1B 4YO0A 3PJSB 5EU6E 3TN0A 3DUUA 4HQQH 2JJTC 4MAUL 4F80A 2GJ6A 4UT7H 1FG2B 1WWWX 4HWBL 25C8L 4JVUA 3W2DL 3DMMB 2X70B 3ZDXE 4RFEB 3X13B 1CK0H 1T89A 2BHYA 4XZUB 3C2SA 4D0BB 1VEMA 2LAGB 4U7KA 2BNQA 3TIEA 1ED3B 4I1NB 4FQ1L 3HE6B 2A83A 3WD5L 4PJ8D 4GAYA 1WTLA 4EUPG 3L7FA 3VXMA 2Z8WC 1R5WA 2BY3A 1L7TH 1U3YA 3CFBB 3O6KH 2K7PA 3ULUH 1SY6H 4NGHH 4GRMA 1MFAH 4MXQC 4UQ3A 4K3EH 2HJKA 4PJAF 3U6RB 5ITFB 5F6IB 3QNXB 4F15B 4ELMB 3GJEA 4WI4A 2FX7L 2AXJA 3GSRA 3BP5B 1D5ZB 1D5XB 4YDLB 1KLFA 1W8OA 3FT3A 4Z6AT 4G8GA 3HI5L 5DMKB 2E7CA 2EH7H 3LKOA 1HDMB 3BPCB 3SGDH 3RHWF 1A14H 1D5IH 1HNFA 1GIGH 5CILH 4LHQB 1WBZB 1KC5H 4NQUA 4PRPA 3LEVL 4POYA 3TFKD 1UM5L 3LOWA 3V6OE 1G9ML 2UY6A 5KSUA 4WTZA 3O6FD 3L1OH 4OLYL 4AK1A 4Y16C 2FJHB 3CZFB 5DJXB 4J3WA 1LP9B 4PJDB 4X6BB 1F4HA 2ZUTA 3OXSB 2HJLB 1K6QH 4KAQL 3CDYA 3PF2A 4N8VA 3SE4A 1T0MA 2Y07L 4RMSA 1MF2L 2BSED 5LQBL 1T1WB 2NY1D 3VWKD 2N1KA 1AKJD 3QUXC 2AXFB 1R5IA 4I0KA 3ILQC 4HWNA 3BPLB 4QNPE 1DDHA 4MYWB 1CE1H 1OVZA 4MXWL 3RTQB 1MCEA 2Y6SC 4KJQD 4JPIA 4PJ9A 3MBXH 2B2XL 1HWGB 3RX8A 5DURB 4AM0B 4JFFB 1D9KB 2HJFB 4Z7VB 4PRBA 4UIKL 3CD4A 3F7PC 4FFWD 4ONOA 1KPVA 1PBYA 4Z7UE 3UJIH 1DBML 4JDTH 3JBG7 1ZT1B 2DWDB 4ELMF 1F3DJ 1N7MH 2YD3A 4FQHA 1RZIA 1AO7B 1RZJC 4U1IA 1JCKA 4L9DA 1N0XL 4UAOC 5FB8B 4JN1H 1A2YA 4GW1B 5K93A 2DM2A 1BQLL 3MO1B 4GQPH 2FHCA 2IQ9H 4UI2A 1T21A 3AU1A 2PYEE 2WBJA 2F9BT 1AGFB 1QLEL 4BSVA 1JPTH 2APTA 2XT1B 4DN3H 1I8MB 5CGTA 3O3DB 5K9QG 1HI6A 3WFBH 4DGVL 3QIWC 1HHKB 5BV7C 1X9QA 5F1SA 2QL1A 3FT2B 2QR0B 3QXDA 4YPGA 1LK2A 5EU7C 3RGVA 1G7QB 1YEFL 5KVFL 2LV4A 4LVOB 4HJGA 1KGCE 4HH8A 2Q86B 4KV5E 3KS0H 1CE6B 2YD4A 4TN9A 1AJ7H 5D9SA 4F7MA 3ZE0E 5IFJB 5LJYH 4XP4L 2VITA 4N9GA 3KPOA 5ESAB 3AAZB 4X7EC 3T0DA 1P1ZB 3LKNA 4TUKH 1NDMB 2I9TB 3VFVA 4NCC2 5SWSE 5C86A 1A7RL 3QO1A 4NQCE 4G9DA 5DJ0A 3WLBB 2BY0A 4Z7VF 1YEHL 4YPJA 3DV6A 3QQ4A 4UINL 3O4LA 4AENA 5IM7A 1UB6B 3CFIC 1IC5L 3EOYG 4IRJD 4FG6C 4GRLB 2ZJSL 3V0WH 4OI9A 3O2VH 5F9WB 5GRUL 1V8HA 2ICEB 2YD6A 3G6AB 3MNZA 1JMZA 1R6VA 3G04A 3K7UA 4QYOB 2OJZL 1NLBH 1R3JB 4NQDA 1UM4L 4XP9H 1KJ2A 1WCQA 2JIXA 4K7FA 1YZZA 1YEDB 1DBKL 4B0MM 2J4WL 4RMRA 4ZO6A 2EC9T 3I6KA 4J3VA 4P4KD 4OKDA 3NIGE 4P5TB 3P9MB 1KV3A 4E5XA 1XH3B 3GM0A 3BFOA 5T3XE 4POZD 3MV9D 3CFKA 4KQ3H 4MJ4A 2R4RH 2DM7A 5FV2A 1K8DA 1I8IA 3QDME 3VFGH 2XTJC 3S4SB 2DKMA 3MX0A 4WO4D 1T83A 3SDYH 4OZGB 3V6ZA 1BJ1J 4HAFA 3PQYB 5HI4C 4MNQA 5DUPH 3DX8B 4WUUA 4Q6IC 4RBPK 4B5EA 1M7IB 3DO7A 5F3HA 1YNLL 4ERSL 1T6VN 2G5RA 4IHOA 4BM7A 2H2SD 2OL3L 4Y2OA 3VXRE 4NO0B 2VXUH 4KRPD 3OMZA 4MWFB 5E4IA 3ZT5A 1UZ6E 3KPSD 4GAJH 1DBAL 4JM4H 5B3NA 3U0PB 3HFML 4NBZB 1OAQH 4DK6A 4PJHA 4OZFB 1I9JL 4OFYA 2WIIB 4QXUH 1MJJB 4YHIA 1SVZA 5DK2A 1FE8H 3MRDA 1BOGA 1MHHA 2KQMA 5JXEA 2PNDA 1MJUH 5F7YC 3GSUB 3KPPA 2Z91B 4AMKH 2GSIA 4TSCH 3BE1H 3MMEA 5DVMA 5D1ZD 4J7RA 3U7YH 1IKFL 4M9PA 1L4IA 5FF6A 4CVXA 5J11B 2A9NH 3VXTB 4AIZB 1KG0A 1RZKL 4JQIH 1GOGA 3VH8B 4PJ8B 4QF1A 4OCLC 3TYFA 3QUMB 3MACH 3QPQC 5D2NA 3U9PL 5GRXG 3DOSA 2KPNA 4LASL 3ARGC 1HINH 2OBGA 1NBVH 2AJUH 4WI2A 3OR6B 1MCKA 3BXNB 4NZRL 2ID5A 3BQUB 2F54D 5AD0B 4OIIL 4IDJL 2DJSA 1JZ2A 1LE9B 4IIQC 3JXAA 3ARVA 4DAGH 1UXWB 1EH9A 4UV4H 2BVQB 3F6IA 3MBEC 1JTPA 2DLIA 1FH5H 5D7JD 4BUHA 1J10A 1OPGH 1XGRB 4OZGF 3OKLA 3VD5A 4K9EH 4H8WL 4ZNEE 2QQKL 5HHOB 1S7TB 3QFJA 4ODSH 2BP3A 4HXBL 5TF0A 5GZNC 1NMBL 3P4MB 5IB1B 4XPHH 3GHEH 3IJHA 4HIIB 5IB3B 4NNYB 1B0GA 4V1DD 3O6FB 2A6KB 4IS6B 3S96B 2GTWA 1JPSH 1QBLH 3MRNA 3TJHD 3RU8L 1FAIL 3UPRB 4NN7B 2W65B 2ATKB 5ESVA 5CEZL 1QO3A 5E8OB 2A9ML 4L8SC 1KEGL 4I2XA 1ZGLM 2YBRA 5FYKE 3DXAA 4M02A 2NY1B 3BHBA 3VWKB 32C2A 1RSFA 2AK4E 4ALAL 1AKJB 2P4AB 4KZDL 1TPXB 3LHPH 1D6VL 1G7MA 1TTUA 1ZHLB 5JHLL 4JANB 4I9WE 5CGMA 5IFAL 1DQMH 4YDJA 2F15A 3MJ8B 5B8CB 4HGWA 4M7LL 3QEGH 5F7DA 3L6FB 1UZ8B 1LO2H 4ODWB 1OQXA 2OS7A 3BWAA 1QLRA 3OPZL 1HXMA 1TITA 5J7CC 3FO1B 1OGAE 2C3VA 3HZMB 5FUOL 2R8SH 1H0DB 3VXME 5TH2B 2O61B 1X5KA 5D6CA 3U30C 2CDGB 3IFNL 4JY6B 2E9IA 4ZFGL 5D1XD 2I60L 2WP3O 5KZCD 3S7GA 5CZVL 4HUUA 4NO5A 4JJ5A 5KSAA 4U49A 1TZGH 2ADJA 3LIZL 2NX5A 1JTTA 4C56A 4Q7DA 2R1XB 4U1KB 1K3ZA 3VW3H 1VFBA 4X9HA 5F71A 1IQDB 2YPKA 5I76B 2FZ3A 2HN7B 1OW0A 2YK1H 1P4LB 5KJRL 1KIRA 3D85A 2YMXH 3ZTNH 4M62H 4WV1B 1VGKA 3E0GA 4KROB 4BKLA 4F57H 2DBLH 2HFGH 3CVHB 5FOBB 2Z35A 1DCLA 1U42A 1Y6KR 1F02I 2VLRA 5EZLB 3MOAL 1WLHA 5FYKU 1RK1A 3HAEG 2V2XA 4M3JA 4LARH 1KCSH 1BF2A 4XCEA 4JCLA 2DQGH 1KPUB 2BCKA 2HG5A 4X8JB 3MRRA 3H6JA 5E8PB 1NMAL 3L95A 4ZODA 4HS8H 4U6TA 4GBXA 5CCKL 3MRMA 4MA3B 4MCYB 3V0VA 4H1LB 3DURB 3BSZH 3D0VA 4KH2A 5KS9A 3D3VA 2ATPB 4MD4A 3GRWL 3CK0L 4PJCF 5F96L 4IRJB 5HVGB 3H9SA 5DD1L 3VJ6B 1NGZA 4G6KL 4DKEL 2UYLB 5D7SH 5DWUH 3MA9H 5IQ7L 3F7VA 4G5ZH 1BEYL 1IC7L 4XWOD 3ZYJA 3UP1A 4WWKD 3HRPA 1RUPH 5EIVA 3N1MC 2W0FA 1VACB 4UT9H 3GMPA 3FOMA 1NAKL 3FB5B 3C09C 4P4KB 3O2DH 4LFHD 4Q6YA 5DHVB 1IBGL 3IAPA 5MENE 1T22B 4HS6B 5IVOA 1J1XL 2CIKB 5C0DA 3STBA 5HDQL 2YPVL 3MV9B 5BS0E 4KHXH 2ZSWB 3GKZA 3MYJA 5T3ZD 1Y6NR 4O2EA 2ZUSA 4BFIA 1UWXK 4L4TB 1L0QA 4WENB 3OJDA 4BH8A 1Y0LB 3D48R 3OZ9L 1FO0H 5FYLE 4LPUA 4P46A 1CGYA 4WO4B 5TFSH 2NY0D 4PPTA 1IC4H 1FL5A 4F7EB 1U3HC 5IROA 1DANT 2P5WD 2EDJA 2EE2A 2JE8A 1MCQA 3HRZA 3RL2A 3L5JA 1WWAX 2VLJD 2R23A 5JNYA 4AEIH 2ENSA 1KCLA 2C5DC 3RJQB 2ESVE 1ZLWK 1ND0A 2ZUYA 4TUJA 1P4BH 4K23L 3WSQH 4LAQL 2D03H 4NUGL 5EOQH 1J87A 3QIBA 2HT2D 3OAYH 2VO5A 2Z92A 4KRPB 1DLFH 3TH4T 4YHYC 4X7SL 5FGCB 5IMLA 4WJ5A 3KPSB 3TJEH 4MJ6B 3IETA 4QHUA 3ZHKA 3CLEH 2AJYH 2DAVA 5K33A 5IW1A 1YMHA 5FYJD 3PWUB 3MGTA 4K3EL 4X7TB 4KWUA 5E1AA 3OAZH 3L3GB 2C9AA 3QJFB 3RX7A 1RPQA 1P2CB 1FJ1B 1S78D 5I8OH 4Y5YC 1CLOH 5D1ZB 1KPRB 3IDJB 2CKBA 4PTTB 5DJZB 4AEHH 1TCMA 4HUWB 2EH7L 1JWSB 3RAJL 3QWRA 3T2NH 1OP5H 1D5IL 1GIGL 1XGQB 1KC5L 1G7PB 4XPFH 1F11A 4R4FH 3IT8D 4NNPH 1OWRM 5DJDA 3K3QA 3QEQA 2IH3B 5JLZA 3H7BA 4YXHH 1FVCA 2AVGA 5CEXB 4HPOL 1EEUA 2YD8A 3HG1B 1ZA3A 4QLRA 4X9IA 2F54B 4QT5A 3FAXA 4UILL 4R97C 4M5YH 4AL8H 3T0BA 5LGKA 2CLZB 1V7NH 3WS3B 1XZ0A 5D7JB 3B5HA 3CU7A 2O5YL 4HAGA 3VXNB 1KIUA 1HHJA 3EOTH 4LP5A 4D8PB 5B39G 5D70L 3QIUC 5BRZD 5FEBA 1R0AH 1QA9B 3DX9B 4PRIE 4CMMB 1SEBB 2BNRD 5LKNA 3A6BL 3QDGA 5MEQA 4JFXA 5E08H 1CE1L 1IZKA 1RFDL 5E70A 4XNQB 1NFDE 3QQ9D 4V1DB 3RWDB 4MNQE 2UVFA 3MUZ1 3SO3B 3UAJC 3KNBB 4ONFL 5DMIL 4IDLA 1NCBL 2R56H 3EO9H 1WWBX 5AZEH 3PV6B 2CRZA 2ZG1A 4O4YH 3VXPA 4UB0L 3D5OF 2NXZD 3G6JF 3RI5F 1FFNB 1BF8A 4YFEA 1X5GA 2P8PB 2EE3A 2P8LB 2Z31D 3UJIL 1CLCA 5I1KH 5FHBL 5KSBB 5I66B 1JWUA 2DQHH 4XCYB 3TBVA 3O3AB 4P57A 1JTOA 1P7QD 5C7XH 3RVVD 5CJBA 3UO1L 4O2CA 3NFNA 3JTTB 4YDIH 3HUJE 5HHNB 2G75A 3UJJH 4FXGA 4X6CB 3FOLB 1KJVA 3C5ZA 2O5XL 5CJXC 2FGWH 4XVJH 2FLBT 1UKSA 1X5JA 2DYPB 1DBBL 3EIFA 4ZFOB 3RGHA 4Z7WB 1BWWA 1MCOH 3FO2A 5DD0H 3UJTH 5ADPH 3WL9B 3LH2L 4TULL 5I17A 5I73C 4DKAA 4FXKB 4PJGF 5KTEH 2GFBB 4AT6A 1H3PH 1CFTA 1W72B 3FFDB 2VIRB 4NO3A 2A74A 4ZYKB 1I3VA 2ED7A 3MLWL 4R90H 5I8KL 5C08A 4DK3A 5SX5K 5KZCB 4NKDB 3ALWA 1C5CH 3TNMA 4NJAH 5KOMC 4UOW0 4BQ6A 2VLKD 2EYTA 3KXFE 1LO0L 1UJ3B 2ADFL 4G43A 4TUKL 3HMWL 4OZHB 3QULB 1U8LA 4OCXH 5EU6B 5I1LA 5DGQA 4AQOA 2LU3A 3KPMA 4NRYB 5DZOA 2WNGA 3MV7A 3VFOA 2DQIL 3ULVE 3U36A 3B9VA 2VH5H 1M05A 1L0XA 4M1GH 2F53A 1A1OB 3NZHL 4LCWE 4PFEA 2JJWA 5KSBF 3U4BL 3OXRB 3T4AB 2FHFA 2D0HA 2VZOA 2ZUVA 5D7IE 1RUML 5HGDA 5FXCH 4KXZI 5JW4M 4JFPA 4JHAL 1KLUA 5IMKA 3MRIA 1KACB 3EYSL 3OSKA 2HT3C 3WHXB 3CFDB 3FQRA 2BVUA 4X6CF 1D5BB 3PP4H 1FL6A 3JV5A 1TQBC 3VD7A 5JW4Q 2OP4H 4P9HH 5SWQA 4Z7WF 1WT5A 5MI0C 3VE0B 1RZ7H 4YEFA 2VDOH 4M6AA 1C1EL 4RZCB 1MCPH 3PWPE 1YUHB 2VAAB 4LPTA 3STLA 5F44A 4F7TB 15C8L 4LIQE 5T1KD 5J6GA 4E0RA 4PJBB 1G7JA 3IU4L 4WHTB 4G42A 1XF4B 2GUOA 4Y19E 3GKWL 4HMCA 5JO5A 1PYWB 5EO9B 2IALA 4JHZA 7FABL 1LEIA 3DECA 2XKSA 4MAYC 4J6RL 4WWKB 1SQ2N 1A5FL 2E27H 1IAOA 4YHZH 3BGMA 1RV6X 1V3KA 3VGBA 1MCLA 1CZ8H 5DJAA 4OZHF 1BFOB 1K4DA 1WK0A 1B6UA 3IJSA 1IGTA 4O9HH 4HV8B 5H35B 5EU5B 5IVZA 1XGYH 4OV5B 3O9WD 1BQHA 2FIKB 1GAFL 3AXLA 3SDDA 3BUYB 5FGRA 3RP1A 4NWTH 1ETZB 3MRJB 2R39A 3C8KB 5DUBB 4N0UA 2DLGA 5IOPB 4HEPG 3SQBA 5KVDH 4JJHA 2NY0B 4UMGA 1OAXL 3GBNL 1CYGA 1MJUL 2P5WB 1U8HA 3B5TA 4JFQB 4AMKL 4RAUB 2VXTL 3BE1L 2VLJB 3TP4A 5DI8B 4HW6A 3MLSH 4OGAC 3T0ED 2A9NL 2JB6B 4HUVA 5CKAA 4U1GB 5FUCE 2DQEH 2E6PA 5TDPB 4Y4FC 4J4PC 2XQYG 1SJHA 4Z7UB 4JN2B 4G3YL 5FKAA 4RWYH 3BIKB 5IT2L 1N5AB 3DETD 4KUCD 5ESQA 3MLYL 5HHMD 1DUZB 4FQLH 4YX2L 4TVSa 3LS5H 1AQDA 4JAMB 4Y2DB 3RVWC 1T0NB 1FIGH 4X5XB 4W6YB 2OTPA 5INCB 3M17A 1ZA6B 1IM9A 3HCVB 4PJBF 3EFDH 1HH9A 1F4WL 5DC4B 2XWBA 1OPGL 4PYGA 5EORH 3VXSD 3Q5OA 4KPHH 5I1EH 5J13B 3S88H 3ES6B 4F3FB 3IKCA 4OLUH 2YPLE 2QSTA 4ODSL 3AS3A 3MRPB 5CZXC 1BX2B 4DQOH 4LNRA 2V5RA 1BLNB 4FFVC 5DRZB 1FVEA 3BVNA 3ALPA 5D5ME 3MRCB 1U8IA 1H3WM 4G80A 1GL4B 4X7FC 4IOFC 3KLDA 1I3RB 5HVHC 3WS6C 4JGUA 3ZKND 4YFDB 3MODH 3T09A 4TTDC 1A1NB 3BW9A 3GRWA 2ZUQC 4MD0A 1U6AH 1CDJA 4IRSA 3REVB 2F8VA 5HPMB 3GIVB 5E4EB 1JPGA 5FUZH 4MZ3A 4U6XB 3KPQB 4LU5H 3HTLX 5BRZB 1T04B 2FSEA 5L9DL 4ZXBB 3LHPL 3TPUB 4RX4D 4W6XB 4RA0C 4LSUL 3WFEH 3SE3C 3VXOA 3O3EB 4MLSA 3TN0C 1DQML 2P5ED 3ZKXB 4MA8L 5BZDB 1HYSD 1C08A 3RNKB 3C8DA 3GMQB 2OR9H 2VDRH 5E7FA 3Q6FA 1T89C 5ISZA 2NXZB 2QKIA 1ZKAA 1A7PL 2VDKH 1N59A 5DFVD 4X4YB 4KK9C 1CLYH 3SGDI 2B5IC 4JDVB 2EDYA 4FQXA 1PG7H 3TZVD 1P7QB 4BSJA 2JLLA 1MNUH 4R4BA 4NO2A 4G8IA 3KPRE 1AP2A 5DVOA 5I8CA 2YRZA 4MZ2A 1BBDH 4XP6H 1GXEA 4Y8DC 1PW3A 1CFSB 2GI7A 3IS0X 2GAZA 1A4KA 3LMJL 3HE7D 1MH5A 2FL5A 2VDQH 4J8RB 1BOYA 2N56A 2VR5A 5EC2A 4ZFZA 1CDCA 3BKML 4OBSA 1IGFH 3QDJD 4YWGH 2YK1L 4ZO8A 1NKRA 5GS1A 4P2YA 4QRQB 4KK5C 4TPRH 4ZUTB 3FCTB 3MRGB 3T3PF 1K2DB 3GJFK 3T2OA 3OKDA 5J1SC 3S34L 5FKPB 2R2CA 1OAKL 5BO1H 2MQ3A 3FQUA 2JF1A 2VLKB 4YQXL 5A2JH 4QOKD 1FFPB 3RWHB 3S37X 3INUL 3LSOA 3FFCD 1U2HA 1WUNT 2XPGA 3RY6A 3SCMA 3GK8H 4HGMA 1JIBA 4Q2ZA 3UBXI 4JO2H 1F97A 4DVBB 4Y4KA 5HYSG 3VXQA 4N68A 4JE4B 4XGZA 3FO9B 1Q94B 1JGEB 3X3GH 5IKCB 1WICA 1T20A 3UYOD 3VFTB 3BSZL 3QSKB 1ES0B 3GSWA 3CX2A 3SOBL 3HR5B 2OJEA 5GSVA 1YDPA 1HHHB 4LSQL 4X6EB 3CLFH 1RUKL 3N9GH 4BZ2L 3I3BA 4TSBH 3QDAA 3V7AE 5EWIL 4EN3D 5D7SL 5DWUL 4CU8A 4PJXB 3WDIA 4PJEF 2PXYD 1NBYA 2IADA 43CAA 4BFGA 2X9XA 3LN5B 1GCFA 3MLVH 3MOBH 4D0DB 5DJYA 2AK1H 3G5ZA 5E2VH 4UT9L 1E27A 3U0TA 4Z76B 1FBIL 1JK8A 3MCG1 3MRHA 2H26A 5JA9A 4NT6B 3DARA 2VC2L 1TTGA 4NKIH 1FG9C 4KHXL 3UDWA 3DV4B 4R7NA 3RUGB 1FZJB 5DRXB 5B3JF 4Y4HA 3P4OA 1A6VL 4YHOH 3UTTD 1FZMA 3B9KA 1MEXH 5DFTA 5T1KB 3NOIA 3OGCA 2PTVA 1FO0L 2EC8A 3HMXL 5TFSL 3AVEA 3O2WL 3BRFA 1A9BA 1G0YR 5FM4A 1FCGA 1E4JA 3MLZL 2W59A 2ZSVB 1Z0NA 1FYTE 2MMXA 5C08E 4U1HB 1X4YA 5DSCB 4X7DC 4NDMA 5TGBB 2XZQL 2CUHA 4MMZC 4QXGH 2RFXB 4Q9BA 1H8OA 1OLLA 2C1OA 2JJSA 3O9WB 4GAGH 1J05B 3L9RB 5L8JB 4PB9H 4R2GC 1P6FA 3UEZA 2FLRT 3KJ6H 3CLEL 5F88A 1X3DA 5C9JB 2DBJA 3S35X 5HYJE 1INDH 4QWWC 2DQTH 1YNTA 4H0GA 4HHAA 3OX8A 4MX7B 4PJXF 1VERA 3QRGL 2FBOJ 4UTBH 4YBQD 4XAWL 2R4SH 4KY1L 3T0EB 2Y72A 2X7LA 3EDKA 3QUYA 5BXFB 4HKJB 2DWEA 5ICYB 4K2UL 4K94H 4PBVC 4LEOA 4WI8A 5HHMB 4LLWA 4WI9A 2XWJA 4KZEH 4NN6B 2NZIA 2WUBH 5DRNB 3RUGF 4PY8J 1RD6A 5L8KB 5E8DH 3BZFB 3QUZA 1MQKL 2EDLA 4AL8L 1YECH 2EYRA 4XPTH 1SYVB 5EUOF 5I1DB 4PB0L 5I16A 4N0YL 2PCPB 5CEZE 3QI9C 1FAKT 1I1FA 3V0AC 3ARRA 1FRGH 2ZKHL 3BX7C 3SDXE 1NEZB 4CW1A 4OD3H 3ARBA 1R0AL 3I85A 4G6AC 4OD2B 1SYSB 2C3HA 1DQLL 1F8TH 3WJJA 4CVZA 2ZCLH 2KUTA 3S3SA 5E08L 2VE6A 3U4AA 1AGEA 1AD0A 3CZJA 1ADQA 3GM8A 5C09D 3TBYA 3VDCA 4Y5XA 4O4YL 3B2VL 1MQ8A 4YDVB 5C0GA 1XF3A 5F9JB 2BVOA 5I1KL 1WC7B 1BMGA 4YEEA 2DQHL 4RDQG 3ISWA 3DO3A 4LOUC 3LQAH 4K8RL 1I7ZA 3D2UA 5AYUL 3UROR 4AG4L 5KVEH 2WUCL 4G6MH 5ALBH 4F9LA 2YRLA 4LBEA 3W39B 4N0UE 5L2KA 3LY6A 3UJJL 3VRLE 1T5WB 4MQTB 1WBXB 3MLUL 2ICWI 4Z77A 1JNHA 3EYOB 2GTZB 4XVJL 4KUCF 3TBTB 5C0FB 5DHVH 4JM2D 3NFPB 3ROOA 1FZKA 5DD0L 1PLGL 1AQKH 2IPTH 3BZDA 4EDXB 2UZIH 4P9MH 5KTEL 1FNSH 5C1MB 1OF2B 1B88A 3TZVB 3LKRB 4C58B 1AGBA 1DQJB 3JWDC 4ZO9A 1KYOK 1KXVC 5D2NC 1IFHH 3E3QE 4JFOA 1XIWA 4OFDA 4R90L 1FPTL 2DQFA 3EO1B 4YGVA 1U8KB 1ZTXH 3LDBC 2ZG3A 2DTSA 4HT1L 2MSPA 4PRHD 3GIZH 2EIDA 1NFKA 4ZTPH 2VLMD 3UTOA 2R2BA 3HE7B 2J6EA 5EZIH 3K2MC 1Y18A 3S35L 3K2UL 4HCRA 4GRWF 4WU5A 1V05A 3QDJB 3FRUB 1DLHA 5IV2A 1J5OH 1H9VA 3KWWA 2D7QA 1N8ZB 1Q9LB 2ICWA 4F7PB 1BJMA 1MREH 4EUPA 3P30H 3ULVC 5HD8D 3AMKA 1YY9C 4OSUH 1FC1A 3OJMB 1TETH 3K4DA 3NN8A 5E00A 3WV0A 1NH6A 2AJXH 2DKSA 3PIQB 4TQEL 4QOKB 1RJLA 2UY7A 1RZ8A 5FGSA 1QSEE 3IDXL 4M4RA 5D71H 1QFOA 3FFCB 4G6JL 3DIFA 4J3UA 4O58H 1U8QA 2XZCL 4P5KB 3GSQA 4RGMB 3BUTA 3LKQB 2MNUA 3FT4A 1T1XB 2IF7A 3PL6D 3RDTB 1T66C 5DC9B 3IU3B 5KSVA 1F45A 2D31A 2A6DB 2XG5A 4NQVB 4XNZC 1FNGA 4LK4A 1A7NL 2FJFA 2IAMD 1ROWA 5IBTL 1Z9SA 1BVKB 3MBED 2FATH 1ADQH 1CCZA 5GGQL 5AWNH 3T77B 4EN3B 3DROA 3SGKA 5ICZA 2IMNA 4P2OA 4EZMA 2PXYB 4KRLB 5I8EB 3NA4A 2DD8L 1N64H 4EVNB 3NTCL 4XVTH 1CDGA 5TE7H 2UZXB 2ZP0T 1GC1L 4YHZL 5JMOC 1KEML 5I1IL 1QNZH 2XI9A 1M7DB 1QFUH 2YD2A 5D7LE 4HFWB 5GGRY 4EIGB 1I1YA 4O9HL 1BM3H 1MRDH 2MFNA 4WHYH <