3IETB

Crystal structure of 237mab with antigen
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
210
Chain Sequence
QVQLQQSGGGLVQPGGSMKIFCAASGFTFSDAWMDWVRQSPEKGLEWVAEIRNKANNHETYYAESVKGRFTITRDDSKSRMSLQMNSLRAEDTGIYYCSGGKVRNAYWGQGTTVTVSSKTTTAPSVYPLAPVSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin light chain (IgG2a)
publication title Antibody recognition of a unique tumor-specific glycopeptide antigen.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 47
structure length 210
sequence length 217
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ietB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ietB01
3W0WD 3DURB 4HS8H 3BJLA 1CT8B 3F58L 5JXEA 1A6UH 4P2CG 4L8CB 1HXYB 2JB5L 3UEZA 2HAZA 1TCMA 3WS3B 3MZGB 3OKEB 4GQPH 5H2BB 3ULVD 2IANE 4YXHL 3WFBL 5I1DA 3KR3H 1CVRA 4HWBH 3LS4L 2P5WE 1FIGL 1QUNA 1IGTA 4JHWL 1KB5L 1NBYA 4LGRB 1U8QA 5LGKA 3QH3A 5LBSH 3IRPX 5ICZB 3MRGA 5DC9B 2MQ3A 5ENWA 2MKLC 3RPIA 4TN9A 5IT2L 3SGDI 2BXZA 4ONFL 1JCKA 5GGVY 1U8NB 2NY5H 2P7TB 3S37X 1EGJL 1K3ZA 1NGYA 4JRYE 4NQVB 5JOEA 4GUPB 5JO5B 4F7PB 3TJEH 1XF3B 2LQRA 3P4OB 2X70A 1LO0L 1JUFA 3GHBH 3VE0B 4JQIH 1JI1A 3IDUA 2V7HB 1YUHB 5C09E 1PX3A 3CFCH 3UTTD 5GS0C 1J8HD 1A0QL 4UV4L 4WV1A 1UENA 1VACB 5HHXL 1X3DA 3QI9A 4X8JB 1SVZA 4ZXBD 4DK6A 4NQEE 5KVGL 5FUZH 1KJ2L 4OQ1A 5DK3A 2D7MA 4FN0A 5GGVH 2V2WB 5KVDH 3T0EA 2YN5A 1LO4L 3VGDA 3OKLA 3VDCA 4ENED 1U91A 4J3SA 2Q7YA 4M3KB 4H88H 4GAYA 3GUTA 1OTUD 1RUPH 2P44B 3IDJA 4DAGH 4UBDC 2FB4L 5J1AA 2UVFA 1Z5LA 2XWTB 1FCGA 5EOTA 5MI0B 3WXWL 3EGSB 3A67H 1MCNA 1RFDL 4XBPA 2L4OA 3NCMA 4Z7WF 1K5NB 5IW1B 5CILH 3C6LD 2X6MA 5GGRY 1A64A 5T5FH 1EEZA 2YMXH 5GRJH 1HK6A 5D2NE 1F4XH 3ALWA 5BS0B 5I15L 4UT9H 4WCYL 4H8WL 4JPKH 1XCTB 3RIFF 3VRIB 4N9GA 1S9KC 3MRQB 2XG5A 4PJEB 3D18B 2CLZB 3GI9L 4JN2B 5KW9L 3R8QA 4PJCE 2OMNA 3DRTA 2P5EA 1FFPA 3RVTC 4MDJB 4OUUB 5AG9A 3QEQB 1F4WH 1S7QB 2VL5A 3DNKA 2FCBA 4JM4L 5F6IC 3G04B 4R9HA 4OM0L 4U1SB 1ZHLA 2VDOH 1KPRB 3UJIH 1XH3A 3KJ4C 3MRNB 1C5DA 2DDQL 5DZLA 5B38B 3CDYA 4JO1H 1DANU 5EIVA 3CLEL 4FXGB 3PDDA 1MJUL 2E27L 5DJ2B 4JZJA 1HKLL 4LCWB 4LHQB 4D3CH 5MENA 3VMPA 1UM5H 4JDVA 1A9EA 1S9WB 2C3HA 3CLFL 1UB5A 3MLVH 4GXVH 2KPNA 2YD2A 1WCBA 4KVCH 4ZTOH 3DO7A 1Z0NA 5I74B 4QWWD 2YZ8A 1UH3A 3KLAA 3CU1A 5GGSB 4CADB 1OGAB 5EZIH 5M95B 2E5EA 4L8DB 4OD2A 1OP3H 4Z7NF 2Y36L 1YMMA 3QP3A 2P4AB 3MJ8A 4ZQKA 4K94C 1FNAA 5KVEH 3ZE0E 3D3VD 3S3JA 1CFTB 3FQUB 4KKAC 1U8HA 1WT5A 1MFEH 3GSVA 3VGFA 1NFIA 5FKPB 1CF8L 1XR9B 3LEVH 1BOGB 1N8ZA 3TIEB 2ICWI 1MCQA 1TJGL 3L3HA 4M6OL 2EKSA 1HE7A 1QEWA 2ZG2A 1DL7L 1T0PB 1DBAH 3RJDA 1MUJB 3FO2A 2FZ3B 4PB9L 2X40A 3IKKA 1OM3L 4Y4FB 4OLVL 4C57C 3EOTL 3BIKB 1OAKL 3PWPE 4FQCL 5JW5B 4IDJH 4OSUL 5FF6B 4UT6L 1I8IA 4PJFE 1A4KA 4O58L 5K33A 4YHZL 4U1JA 3PP4L 2DLTA 4DW2H 4XPAH 4KTEL 4AIZB 4AEIH 3EOAA 4GBXA 4JM2F 4P9HH 1SJVA 1MJJA 5E6IB 3EHBC 5JNYB 4A6YH 1XF1A 1AY1H 1U8KB 1XGUA 4PGCA 4S2SB 1IC4L 1NBQA 2JELH 3F7YB 1R5VB 1MCOL 4OLYL 5I18H 4O5LH 4QRPA 1SMOA 2QTEA 3VWJC 1ADQA 2YPLE 3BGMA 4M43H 2ZCKH 1KYOK 5C0BB 1OP9A 3ZYZA 5CHNA 3VW3H 4N5EC 2L7UA 3VD7A 3MOBL 1YMHA 4MS8C 1FG9C 5BS0D 4MX7A 5JR1L 1ZHBB 5E8NA 4ZTPL 5EC1A 1ZHKB 1EH9A 2P24A 3CC5A 4M5YH 3QJHA 1A7BA 3HCVA 4PS4H 4EI5D 4LSDA 1U95A 5AD0B 4NFDA 1B4JH 4R4BA 2BC4B 4KH2A 3V0VB 3BW9B 3DYPA 5KG9A 2G2RB 2HJFA 4F9PC 2ZUSA 2XZCL 2A77H 2RFXB 1F5WA 5EU7C 5DK0A 2DIJA 2ZSWB 2O5ZL 4XP6L 5JMRA 4JRXA 3HS0B 3RGVC 5C2UB 2VLKE 3E1F1 3QPQC 5LWYL 3L5WA 2IMNA 2NY1D 3OKNB 2A0LC 2J8OA 3BKCH 5C0CB 2JCCF 4X4YB 4M62H 5IB1B 4Y4KA 4BA8A 4HBQA 3MRMA 2X05A 1UJ3B 5D5MB 2CUMA 1MHEA 2OQJB 4OF3A 1OOAA 1K2DA 4KRMB 5ACMA 1LO5B 2YK1L 3DPBA 3RIAF 1LO3H 4NZDA 3PP3K 1IAIL 2QQKL 3NTCH 4YDLB 3GO1H 1F58H 1WBZB 3WHE1 2VQUA 1CG9B 1JPFB 3OJDB 4N0CC 3GHEH 2R56L 4Z8FL 3DLQR 5ILTH 1DLFH 3FRUB 1D6VH 1PKOA 4QXGH 1YNTB 4IOIB 3EYQD 5I16B 3TT1H 3HZMB 1UACL 4P5KB 4XXDB 1W2KT 1NCNA 4MD4A 3T1FA 3D0VB 4Y4FD 3AC0A 2ADIA 3BHBB 1Z9OA 3FCTA 1FE8H 2B7DT 2B4CC 3KHQA 1KLUB 4X6DF 1CLYL 4NWUL 1EIBA 1RIVH 5JDSA 5CAYB 5MHSE 4EI6A 2KBGA 1JGUL 4AY0A 4Z95H 3TO2A 2GTZB 4XWGH 1UCBH 1F3RB 2Y06H 1BHGA 4PRBA 1T1XA 4P23D 2EZ0C 4GKNB 1MJ8H 2XN9A 5EFIA 5E2WL 5HD8D 4LSSL 4R96B 4LPWA 2CDFA 1OCWH 4BK5A 2GJZB 3IETB 15C8H 1IKFL 2H1PH 3SGEI 5HHNB 2VTFA 4P4RB 1FC2D 1KLGA 4O2FA 4YE4H 1TTGA 2HJLB 4MZ2A 3V4VL 4IRZH 4PV8B 1EEYB 1TZGH 1HNGA 1PSKH 3S96B 1JPGB 1WC7A 2VXVH 3PQYA 4UDUA 3MR9B 5FYJU 3P73A 1IEBB 5K59F 5IK3A 5CGTA 5F97E 4WWID 3GSXA 3SDXF 3GSNA 8FABB 4LGSB 4GW4B 3MREB 2PYEB 3IDYC 5ESAB 4OI9A 5D70H 3W9DB 1UWGL 4XVUD 2X7LA 4ODSH 4I13B 4DN4L 1IM3A 5D6DA 3HZVB 4EEEA 3JWDH 5DJZB 4UUJA 4TNWK 1U8IB 3INUL 4IS6A 1L7IH 3UPCA 1S7WB 4R0LC 2K3TA 4ELMA 3HLAA 1WGOA 4GRLA 1X5HA 2X4TB 2XQBL 1OSPH 4MA3A 4ODXA 4MXQC 5INDA 3MRRB 4KUCF 1BEYL 3HR5A 3C60B 4LVNB 4BQ8A 5D1QA 4X7TB 5D7KE 1ZLSH 5IJKA 4GMSL 2F19L 3H9HB 5L88L 1NPUA 1TDQA 4PJIF 3QNZB 5IFJA 1QO3A 1JGVH 4PJAF 5IB3A 4IOFC 3EYOA 1IAIM 1S7TA 2GAZA 1T0MA 3KPPB 2OTWB 2IANB 4HLJA 1DDHB 2ZOKA 5AUMA 5GS0H 2P5WB 4U1HB 5IVOA 1G6VK 3O9WA 4U1IA 2EO1A 3K81A 2XICA 4HUXB 4PJDE 3I3BA 4P5MA 4ZPVB 5AAWA 3H3BC 1T89A 1MFAL 4LSVL 3BZFA 3B9AA 1H3PL 1ZVHA 4IRSA 4N90D 1QA9B 4X4ME 3GGWA 1OARH 4QF1A 3SDCC 3CFIC 1WICA 3G9VA 3JZ7A 3WD5H 3NPZB 5C9JB 1ZT1A 4M6NL 3HI5L 4JRYB 4ORGB 3CCHB 4S1RH 4PLJD 3ARSA 4GXUM 5C2BH 4FTVE 3S34H 4UILL 4RIRB 4KZEH 3MGOA 2D9QB 5D8JL 4K7FA 1CYGA 2HKFH 3KPSE 4FFWC 3LS5H 4H20L 5C09B 3FQNB 2FHFA 2J6EH 3MLWH 5CJ5A 4NN5B 4EBQH 1NEZB 2B2XH 2P1YA 1CD1A 3GSQA 4ESKA 1UG9A 2QQNL 4K9EL 1D9KD 4Y5VB 4XRCA 3KJ6H 4LVOB 4NQEB 3MRLA 2QHRL 4ZFGH 4LRNL 1DQJA 1RZFL 2ADJA 4OGXL 5C0AE 2OZ4H 4Y5YA 1T1WB 1FNLA 1XGRA 3WIHL 1R6VA 3U36B 1YQVL 3WKNA 4X98A 5I19H 1SY6H 2DBLL 1J0ZA 3GMPA 5HYSA 4ZUUA 2PYED 5I6XC 4R7DB 1FZJA 3IJHA 5F1KC 3EFDL 2ZSVB 3KDMB 1F90H 3N1MC 4HJGB 3IAGC 2A83B 4XP5H 1AHWB 5KTEL 3GKZA 2NNAB 1MFCL 5L8JB 2H9GB 2WV3A 1RZ8B 2ZCHL 5HGDB 5C0IB 3LEYL 1S7SA 1JRHL 1UVQA 2BOBB 4MJ6A 3CAFA 3OXSB 5EOQH 3QEUB 1AXSA 2DM3A 4PJCB 5FYLH 1L0XA 4PG9B 3VCLB 4CN1A 4FHBD 4JB9H 3IT8D 3FO9A 3TYGL 1ZA6B 3OGOE 3MRBA 3QWQB 4XP1L 1A7PL 4K94H 1IARB 4G9DB 5FECB 2VXSL 4JGJA 3HAEA 4XI5D 3LRHA 3PWVA 4P5TB 4E42B 1RK1A 3RVWD 3PWNB 4RQQB 4XPBL 1LE9A 1T21A 5DSCA 1W0WA 4KKCC 1IGYB 1PEWA 1LD9A 2W92A 4JY6A 3T1WA 1BF8A 2LTQB 3WSQH 5IMKB 1C08A 3ORJA 2CH8A 1OTSD 3TN0A 2E9IA 2ZOLB 5F8QC 4KZDH 4I77H 4R8WH 1M7IB 4NKOB 3GMNA 4JFQB 3DGCR 5DQDL 2PO6A 3BE1L 3KYKL 3T8XA 3VXTA 4ODHL 5A43C 5L8KB 1ETZB 2WQ8A 3ULVC 3L5JA 1U3JA 2X4OA 1AP2B 4TSBH 3QFDB 4ZO9A 5DLMH 3ELAT 5DQ9B 1JE6A 1GGCH 4KKBD 4PGZA 4XMPH 5C09D 3GBML 3MLXL 4H25B 4UQ3A 2ADFL 4MWFA 1QFUL 5FYJH 3RUGB 3L3DA 3QQ4A 4PRNB 3NAAH 3FT4B 4NDMA 1C12A 2K9UA 2IH3B 1MCWM 5HVGB 4PYHA 4GG8A 3MACH 1AO7D 1F2QA 2R2BA 1F11A 5LQBL 3MV9A 1LDPH 3PWPB 1R3JA 3O0RL 3VXUA 4XBGA 3N1QC 4PJFB 2V2XA 4J3XA 3QWRA 2WINA 3QDAA 4JR9L 5LXGL 4HQQH 5DTFB 2FX7L 1G7LA 3CX5K 4F37K 3QXAB 3SQBA 3HC0A 3K0WA 4Z7QF 4R6UA 3ILPA 5ESQB 1KN2L 1XT5A 4XH2A 3ME0A 4ZXBC 4CU8A 5JW4N 4UTAL 4PJXA 3ILQD 3L5IA 1NSNH 5A16B 2MFNA 1EJOH 1AQDA 1JTTA 1Q8MA 1HCFX 5EO0A 4ENEC 3T65A 1NCUA 3CH1B 1A6VH 4ZS7H 1OTUC 7CGTA 1GJIA 1JWUB 4PJGE 2BVYA 5T3XH 4GG6E 4LF3A 2ZUUA 2Q6WA 2JF1A 4JFFA 1JFQH 4M9PA 1A7RH 4QRTA 2Q76B 1Q72L 3MCLH 4ZG1A 5D72L 3C6LC 3QSKB 1FVDB 1MY7A 3TIDB 4LARL 2UWEB 3HNTL 4UT7H 4P5TD 4ZUVB 1PKQA 1Q9OB 2X44D 3MV7A 3PWLA 3F12A 1JPTH 2VLKB 3L3JA 3MRKA 4H26B 2VDRL 3KPMA 4YHYB 1P5VA 5ABDE 7FABL 5IHZB 1G7PA 4X6BB 5E1AA 4G6AD 4WDIA 4L29B 4JDZA 4MAYA 1ZGLB 1J88A 1BFVL 5FFLA 2B4CH 4WHYG 5KAQG 4MB3A 5KVFL 1A6WH 4U6XB 2JKXA 1GZQA 1EVTC 3D85A 3BYTA 3TF7C 1UCTA 3A6BL 4NNYA 1QBLH 3ALPA 1KCVL 2NY7L 4NKMB 4HIHA 3TA3A 4NCC2 4M03A 1NAKH 5FKAB 4PR5A 3HPJA 3GMQA 3L6FA 1BJ1J 4R3SB 3FB7A 1CK0L 1INDL 2RJMA 4F3FB 4F7CA 3PHSA 3BPNB 2IADB 2HWZL 3E6HB 4ZS6D 1V3LA 4QWWC 1PQZA 4LSRH 4PRHD 5C8JA 1QSEE 2FWOB 2UVEA 4MA8H 3TVMB 2NY3B 4WHYH 2ADGB 2EDXA 4K3EL 3BEWB 3PWPD 3EO9L 2ICES 1WITA 4L8SC 4QY8B 2H26B 4K3GA 3WDJA 2B8OT 4KWUA 4EUPA 1DVFB 1SJEA 3V52H 3I02B 2Q3AA 5BV7C 1NCWL 1S9YA 3O6KL 1DBML 3ROOA 4WGVB 4LOUD 3RWGB 1J0JA 1E28B 2YPLD 5SX4H 3ARDA 3QDJE 4I2XE 3D39A 1BGXL 5JQ6L 3MSPA 3QO1B 3QR2A 1ADQL 3LQMA 2EO9A 3BUYA 4PY8I 4Y4HB 1V3JA 1J1OH 1KJVB 4MNHB 1DE4A 3RWFA 5IBLD 1U8MA 1KN4H 3N0PB 3UBXI 3V6FA 2EDFA 6FABH 5I9QB 3V6ZA 1CQYA 4PTUA 5EDXA 2AJUH 1LEIB 3LKSB 1Q9LB 3LZFL 5GSVA 5F9OH 3D6GA 1ZEAL 4CGTA 1MCHA 3WNLA 1MFNA 4Q6IB 1N4XL 3B9KD 3QUMH 3CNKA 5TQ2H 4PTTA 5DRWA 1R3HA 4FMKA 1R3LB 3FB6B 5EBMB 1QRNE 3N06B 4QLRA 1KGCE 4HWEH 3E3QE 4F7TA 2AQ3A 2BVOB 2A9ML 5I1IH 3IFLH 4MQXD 1BD2A 4EI5C 3IVKB 1TTFA 4PRIE 4J12A 1CFBA 2OR7A 4R90H 4NUJB 1M1SA 4YNYA 4WUKL 1G7MA 4GBXB 2VQTA 1EUUA 4OZIE 5GJSH 1GOGA 2NLJB 3MRPB 4P4KB 4FQJL 4F15B 5F93C 2APFA 3IFPA 1TNNA 1BQHG 1BQSA 2YR3A 4QXWA 1Q0XL 1ES0B 2DQHL 5DYOA 1KCUL 2NY0B 4YGVA 3BP5B 2CLVA 1U8PB 2A74B 4IRJD 4PJDB 1EXUB 4F7MA 2XTJB 5J4MA 3WE6A 4MJ5B 1CWVA 1G0XA 4OFPA 3MBXL 2NY1C 3SKMA 3WO4B 4HUVB 1RZKH 3RNKA 3P9LA 4PREB 4ODTL 5I74C 2EDOA 4X5LA 4JQXC 1ZE3C 5IBUB 1MFBH 2EC9U 4HS6B 4KKNA 4LEXL 4AM0A 1JZ2A 4Z7WE 2PW1B 2CKBH 4HUKB 4FTVB 4PGBA 1J05A 2EDTA 4QTHA 4HW6A 1HOCB 3KPQB 3K3QA 4UDTB 1KEMH 3RZCD 1KC5L 3REWA 3T0WA 1W72B 1DVFD 1FNEB 1DANT 4LNRB 1F6AA 3HRZB 3KXFE 1HI6A 3CD4A 2IQ9H 4KHXL 4HS3B 1VPOL 1WTGT 2CDGA 3EYQC 4LLUB 5EUOF 1BM3L 4O2CB 4N8VA 3DIFB 2AXGA 3FMGL 1CIDA 5C0AB 1RVFL 2EE6A 2OJZL 1HXMA 3NFNA 5HDQL 4Y4FC 2F53D 1B88A 1YN7A 3M17B 1I1AA 5IB2A 3OKKB 2E7BA 1AGFA 1WVZA 2E8ZA 3AS2A 1JZ3A 1Q9WB 3WN5B 1OAZL 3OB8A 2YUVA 3GKWL 4JFHE 1DQDL 1QHPA 1M71A 4OBRA 4UB0L 4BKLB 4P23C 1JGEB 4HXBH 3OMZA 1YJDC 4CDGC 5AEAA 5HD8C 5J89A 4ZFFB 3GSNL 5F96H 1SBSL 5DUPH 2A9NL 3QZWG 1I8LC 5BMFL 3U7WH 1IL1B 4JLRB 1C5CH 1CICB 5EU5A 4JZNB 1VSCA 4MAUL 3T0XA 1JPSL 2WWMD 3FQXB 4Z7NE 2AJSH 3VFNB 4NO2A 2AK4A 2P49B 3BQUB 3O6FA 1XF5A 5D7KD 3ARGA 3VXOB 4NN6B 1IEAB 4NQSB 4XNXL 4JG1H 3FQWA 2D9CA 4GFTB 2WIMA 5E5MA 4XVUC 4U0RB 1AGCB 1T20A 1KUMA 4M4PA 4AG4H 4OFIA 3RWJB 4I3RL 5FA4A 3U0TB 5FUOL 1YPZA 1MAMH 4P4KD 1G7QB 4XNUH 5T1KB 4HIJB 3QT2A 4U7MA 3N9GL 1CBVL 5IJVB 1ZLWK 3BZDA 4GKZB 2VYRE 2FD6L 2Z0BA 1CFVH 1NDGA 4XCNA 3VD4A 3UTQA 4MHHI 1FYTD 3I50L 2P8PB 3U6RB 1IZJA 5DFVD 5T1DL 1B0RB 2H32B 1UJTA 3ARZA 3BDYL 4P2RD 3SKUD 1UKQA 1FL5B 1ZS8A 3B2VH 5ACZA 1P2CB 1HH9A 1LK3H 3TC9A 4GW1B 3SGJA 1YEGH 5D7SL 1MCRA 5CZVL 5D7JD 2PUQT 3AS3A 2G5RA 4ONHA 3KPSD 5E7FA 5IVZB 2ARWA 3U4BH 1XIWB 4R4FH 4UIMA 4JO3L 4LVHB 4L5FL 3CK0H 4EOWL 4RAVB 5C71A 3QDMA 3HE6A 1KYOJ 1K8IB 4JY5H 4F7EA 5BVPL 4RWHA 5GGQH 1H3UA 3QQ3A 5C0AD 4EDXB 1MREL 3TWCH 2IH1B 1LILA 3C8KB 5EA0H 4PLJC 1QRKA 3FRPA 4OKVB 4P99A 1JYXA 4K55A 2YBRA 2WUBH 3I6LE 4GAJH 1O0VA 3E8UH 1BX2B 2VQ1B 4JFXA 1X4ZA 3QFJA 5JHDE 1SVCP 2F54E 1B90A 3PABA 2IALB 2HJKA 2HTKD 3IDXH 4R4ND 1I9IL 1JF6A 1D9KC 1E4XL 2JCCE 1A7OL 5CINL 1NEUA 5K9OB 2LAGB 3KGRA 3AS1A 4JKLA 4XHJD 4FRWA 3SDDA 5T1MB 3RU8H 2AGJL 5C0GB 2EE3A 2XFXA 2KUTA 1H5BC 4DCQA 4KK9D 3GIZL 1XR8A 1DQQA 1X5XA 4PJGB 2YA2A 1F3DJ 5JPMA 1A6ZB 1X7QB 5EWIH 1UM6H 4Z0BH 4BSWA 3PHOA 4QOKE 4O4YL 5T5NF 3CSYB 2X09A 1TQCC 5DA0B 3IFNH 2BVEA 2AJYL 4E5XA 3AB0C 1E27A 2VABA 1OB1A 4NN7C 2X4NA 2HT4D 3MRLB 3SY0B 1A3LL 1XGPB 3VXPB 4M7LT 4P2QE 3RL1B 4NM4H 4ZUWB 3EOYG 1P84K 5DEFB 4X6DE 5JLZA 5SX5K 2AABH 1S7RB 4JQVA 1MVUB 4TOYL 4GXUN 4P59L 5DJDA 3X17A 5C7XL 5DDHA 3IJSB 2VAAB 4PJHA 5JA9A 4QYOA 1JGLL 2R1XB 1QFWL 1OT1A 4OCMC 3SCMB 3RAJL 4YHKH 4XI5C 1OSZB 3VGAC 1CE6B 1F6FB 3QJFB 4UIKH 4TULH 4L9LB 1X5GA 4DKEL 2AK1L 3UBXB 5DHVA 5BV7H 3RVWC 1KG0B 1BZQK 2WLYA 3LKQA 4TNVF 4JFPB 2BNUA 1MIML 3I85A 5J12B 3VJ6A 5C6PB 5K59E 4LFHD 2NX5D 1MAJA 3OPZL 4OKDA 4XZUB 5C0ND 5F7EL 3SDXE 2BZDA 2R39A 3FT2A 4AEHL 2CIKA 1OTSC 1MEXH 1ZT4B 4A2MA 3BDBA 4WUUE 1B9ZA 2RGSA 1C8PA 4WVRA 4RFNC 4CVWA 3NCFB 5HSFA 4LLWB 5HY9A 1JN6A 3T3PF 1RU9H 3MNWB 2IG2H 1IGML 3HUJB 5J1SC 4NP4H 4KKBC 3DX8A 5BCAA 3BP4A 4TRPH 1UXWB 4KAQH 1W0YT 1P4LB 4K2UH 2GK2A 1IGIH 2AJZA 2Z31A 3TLRA 1UM4H 3TJHD 2J12B 3OGCB 1MCLA 3BRGC 4L3CA 4PJ5B 3QXWA 4Y5VC 3QDJB 4I2XB 4PJIE 2X4RB 4U6YB 3AREA 5DZNA 3R4DA 1N59A 2GCYB 4JGUA 4QRSB 5TE6L 4M3JA 1ERNA 4X6EA 1AGEB 1TFHA 3DUSB 1TNMA 2R0KL 4PJXF 2PO6B 1YC7A 2J8HA 1GXEA 3NMEA 3P0YL 1UYWH 2SEBA 4WNQA 1CN4A 1N0XH 2DD8L 3BH9B 1QSVA 2YD9A 3M1BB 3PDOA 4HPOH 5F7WC 4ERSH 4NKIL 2V17H 1WWAX 3H9SE 3IYLW 2YPVL 4HG4J 3MJ7A 1WK0A 1Y6NR 4HAGA 3QCTL 4NGHL 3ILQC 4XCCH 3VMOA 2ATPA 2QHLA 4XPGL 5D2NC 5IQ7L 4JY4A 4GG8B 4DUVA 5I66B 3V7MA 2YD3A 3KYNB 4PJBB 1R5WA 4JHAH 4YHIA 3TESA 1QFWM 1VFOA 4HUNB 2ZUYA 1J0HA 1J1PL 3SDYL 4PRIB 2CXGA 3ZL4L 1A1OB 2APTA 1U2CA 3CZFA 3UO1L 2BNQB 4OZIB 2IAMA 4QEGA 3SCMD 2BSTB 4KI5F 1BLNA 1S9XB 4RISL 5IHUL 3DGGA 1I8MA 3IAPA 3PNWA 5JUEL 2OP4L 1MWAA 3P0VL 3BT2L 2QKIA 4P5TC 4P2OB 5DVLA 1CTOA 5GXBB 3EYUH 3HC4H 3NZ8B 5DURB 2ARJQ 2CO7B 1NBZA 4U49A 2G9HA 3U1SH 5HHOA 1SEBB 4G6AC 5J9PA 1B3JA 2QEJA 5F9WC 3VDAA 3S35X 3C5JB 4P3WA 1QSED 3UTSA 4DQOL 2ID5A 1FORH 5HGHB 4Y19A 5ELIA 5DJYA 1H3TA 4ZUSA 4JVPA 1RI8A 3E6FA 4M61A 2W65A 2I07A 5GGRA 3WFEH 4NWTL 3P11H 3E2HB 3DI3B 3IU3A 3SDAD 4Y5XC 1BBJB 1VFMA 2DQUH 3A6OA 2AVGA 3MRCB 3MUHL 1T1ZA 3BPLB 2M8XA 2DIAA 4HIEA 1YA5A 4EZMA 4IMLA 4GW5B 1BVKB 3G6JB 3PV6A 1SQ2N 3QDJD 1MHCB 4ZS6C 1PAMA 2VR5A 1Y18A 3S4SG 1DSFL 1E6JL 1J12A 1WBXA 4HSQA 1FGNL 4U2YA 2Y5EA 3VI3F 1YNKH 4OV5B 2BHUA 5FCUH 3VGGA 1MI5A 1F3DH 4M1DL 3DRQB 1FNSH 3EBAA 4F58L 5GS1A 1CXHA 1TITA 3BI9X 1CS6A 3BH8A 3G5XB 1R3IH 3CMOL 3MV8A 5E00B 3ULUL 3ULUF 5ISZA 4I3SH 2CK0L 1B6DA 3EO1A 4X9FA 4FQXD 5L6YH 1H0DA 4LOUC 2FJGA 4PJ9B 3B3IB 5GGUA 4E41A 2XXCB 4OLZH 3LMJL 1NDMB 1BP3B 1T6WA 1QRND 2OTUB 3LIZH 5SWQA 1GIGL 1R24A 1KGCD 5IBLC 3MXVH 2KQMA 4TQEL 1T2QL 25C8L 3DX9A 4AMKH 1VGEH 3LH2L 4U1KB 4A6YA 3TBWB 1YY9D 4PRID 2L0DA 4NHCH 4GAGH 3GM0A 2Q86B 2GSGB 5K9KA 4FQHA 3MLRL 1GGBH 2CR3A 5LGJA 4HIIA 1LE5B 3B9KC 3IDIB 1V7NH 3SE3C 1B0GA 3P9MB 2IPTL 3QEGL 3QUZB 5DURD 5F3HB 3PJSB 3HZKA 5L9DL 1K4DB 3MCKA 5GGTA 2I5YL 5DF0A 1UXSA 4MQXC 4WI4A 2GSIB 5L8LB 5IVNA 3BP6B 1TVHA 5FGCE 5IR1A 3MJ9H 3VFVA 3C2SA 3GSRB 4KDTC 4Q6YA 2IGFL 2FHCA 2YPKB 4MQ7B 1HILA 1P6FA 4Z7QE 3RTQA 1MCPL 1P5UA 3IFOA 1FLRH 4CMMB 1MFDL 2ATKA 1PG7X 4WO4B 4MNGE 2HG5B 3MLTA 4RMVA 3MGTA 2DYPA 5DMIH 1JL8A 1NC2A 1G9EA 1IM9A 4Z7UA 5HHPB 1JYWA 4IRJC 4HEME 1MHHA 3KXFD 1KXTB 4YFLF 4FABH 1YECL 5F88B 5E2JA 3EJZD 2W9EH 1N3NB 3BPNC 2H6PB 2OSLB 5TFSH 5AYUL 2KZWA 2YRPA 5C1MB 5ID1A 2P5EE 5CZKA 2NY2D 4JVWA 3TFKD 4QHUA 3QXVA 1QVOA 3MODH 3SGDH 3LSOA 3ROLB 4XCEA 5EU6A 3FONA 4JFHD 3RZCC 1DVFC 5HPMA 1G7IB 5F7HA 4CL7A 4WI8A 2PR4H 4HHAB 1FVEA 1KCSL 3HMWL 2ESVE 2F54B 3QHZL 3CDFA 2JCCB 3BWAA 1M7XA 3BVNA 5KSUB 5LCVL 1HHHA 4DWHA 3G6DH 4R26L 3D1MC 5E94B 5EBLB 4KMQA 5EOCH 1X9QA 2DQTL 1KIUA 5E8DH 2CMRH 1PX4A 1S7XA 3VFGH 3V95A 4WHTB 5JHLL 4FQLL 2FH6A 2LE9A 4X99A 5E8OA 5ITFB 1CD8A 5D9SB 4JG0H 5DRXA 1DQLH 4NQDA 3T0BA 4X5WA 4Q6IC 4RAUB 1OAUL 3V5DA 1KB9K 1CQKA 5ESVB 4YPGA 5JIPA 2OR9H 4JFYA 1NEZG 1E0OB 1YPZF 3H7BB 4G9FA 4OZFB 2WWMC 2GJJA 5DI8B 4KJWD 2X4QA 3QUZD 3WEXB 5FB8B 4Y1AD 2JK5B 4M7KL 1HQRB 5HYQA 3LN4B 4AT6A 1NGPH 2VL4A 1P1ZB 1VEOA 3LD8C 4BFIA 5IG7A 2MCPL 4DKFL 3L1OH 3PV7A 2Z4QB 3I9GH 1XF4B 1GCFA 3RI5F 5CJOL 1S9VB 3NCJL 4EN3B 2BNRE 1S5HB 3BWUC 5EO9B 1QYGH 2W0FB 3GSOB 3VFMA 4P4KC 4F15C 1G1CA 4WO4D 3BFOA 3LKRB 3KPNB 1EBPA 3CVIL 1K6QH 1FSKB 4QRPE 2WANA 3O41B 1IFHL 1OLLA 1NAMB 1CL7H 5EPMA 5C70A 4ZUTB 3UJJL 1N6QH 2DTML 3DOSA 5E4EC 2OK0H 4LAQL 3L7FA 1Z3GL 5DFVC 1DLHA 1E6OL 4RX4D 5IHBA 1FFOA 4WUUB 3HE7B 2NY6B 2P46B 3QA3A 3HG1D 4QT5B 3TZVB 3JV6B 4OM1L 1HWHB 1HSAB 2NXZD 2IPKA 2DAVA 3TCLA 4L3EA 5D7JC 2VLJA 5IF0B 2AEQH 2VUYA 5JOPE 4HULB 3I6LD 2CRIA 1M6OB 1S8DB 2D7OA 4B7IA 3L3GB 4JANA 1EFXA 2QV2A 4XCFL 4HF5L 5JHDD 4QCIB 1KTDA 3CVHB 4K23L 1NCDH 4Y89A 5ECJE 1AD0A 4NO5B 3JTTB 1KTLA 1C16A 1WIOA 3HTLX 2R2HA 3STZA 4NKDB 4HFUH 1U58B 1ZVSB 3BGFC 4LLMA 2VLRD 2PN5A 1BAFL 3WN5C 5B8CB 4K7PX 2J6EA 1KCKA 2P8MB 1PDKA 4JKMA 4PLNC 2GHWB 4HT1L 4U6VL 4BFBD 3WFDH 5CS7A 1WAAA 4QOKD 4DVBB 5EBGA 1OT2A 2HTKC 2MHAB 4R4NC 2EDYA 4NKQB 3P9WB 1I7ZB 5LGHL 1LP9F 2EDDA 2OZ4A 4Y16B 4MNQB 3SKNA 4UAOB 1NC4A 4XHJC 4HWZB 4YC2C 4I3GA 3MRIB 4PG2C 1ZK9A 1RIUH 4MXWH 4P2QD 4TVPE 3O6LL 4KK9C 3PHQA 1X4XA 1SY6A 5ICXA 2DWEB 5DUBB 1CR9H 5A3ID 4C55A 2HRLA 1NCCH 5D1XA 2GFBB 4H5SB 4BH7A 5CBAA 5D1ZD 4EN3D 4P57B 1X44A 2W9DL 3DMMB 4PJHF 1YEFL 5EUOE 3U82B 1RZIA 2FX9H 2R1YA 2Q7NA 3OF6A 2NXYB 2HT4C 1QBAA 5D2LB 3T0DA 4X6CA 4Y0GA 1P7KA 4C56E 5DRZA 1U36A 4JFEE 1GSMA 1T3FB 2ZNXA 4GSDH 4ODWB 3TBSA 3EFFA 2JB6A 4NRYB 4HS8L 4QHLB 3K2MC 1A6UL 4D0CB 3EO0B 4Z18A 3OB0H 2GUOA 4KJQD 2NY6D 3KNBB 4M7JH 5E1HB 4YIQA 3UYPA 2Q8BH 1YNLL 4QRRE 2VWEE 4AK1A 3KR3L 4HWBL 2GY5A 5C0RH 3QUXD 3WS6C 1I1FA 5E8PB 5KANI 2PYFB 1FYHB 2AKRA 1MCBA 3LKNA 4R2GD 4KUCD 5FGBC 5CLTA 1S7UB 5LBSL 2FJFA 3SOBH 4U7KA 5DHYB 3UTPE 3QIWA 2ZJSH 4GMTH 2QBWA 5SWSE 5C0NC 4NHUA 5E2UH 2IJ0C 3BP7A 3QXUA 2NY5L 1BIIB 5D6CB 3TJEL 4LKCA 4XCYA 2FL5A 4HDIB 5CWSB 1X5AA 3OAYK 3GHBL 4JQIL 5TDOA 4U1MA 3PE9A 1OF2B 5I8CA 3TBYB 1TCRB 5INCB 3CFCL 4N1HB 4D0BA 3X12A 1RZJH 4OCRH 1MRDH 2CLRB 3TJHC 3H9SD 5IHLB 2EIDA 5HJ3A 1D5ZA 3MC0A 1P9MC 2I9TB 1NGWA 5BVJA 4P9MH 1L0YA 5D7IF 5FUZL 1TZIB 5BZWA 5GGVL 5DJ0A 1IMHC 1NFDB 3OG4B 1I85C 2C1PA 4H88L 1RUPL 5GRXG 1EPFA 1QR1B 2YUWA 3A67L 1GVIA 2GYSA 4B50A 1QR4A 3S36X 4F9LA 4OTXH 4PGEB 5F1NB 4YEFA 5CILL 1JWSB 5T5FL 5HGAA 2NXYD 3FO1A 3MYZA 2YMXL 5GRJL 3T77A 2A6DB 1F4XL 1MWAL 4NBZB 4JPKL 4DOHE 1IGJA 3VXSA 4LCCB 3P4NA 4JFDD 2NY4B 3WJJC 5L2KA 1EBAA 1ZWIB 3CU7A 2VDNL 5FGCB 4LP4A 3G6AA 2BMKB 3UDWC 1NANI 2GT9B 4IJ3B 4ZAKB 3CFBA 3DYMA 3P0GB 5DJXB 1F4WL 4G7YH 3ZE1F 1HKFA 1CGSH 3SCMC 4HIXH 5BO1H 4MNGB 1KELH 4J3TA 2VDOL 1T22B 4GKOA 5HDBE 1TZHB 1KCLA 4JO1L 4OUOA 2YEZA 4F33B 3CFDB 4D3CL 5JPNB 2VIRB 2O61B 1JNHB 4HD9A 3VD5A 1UM5L 1D6EB 5H8DA 4JY4B 3SE9H 3LRSB 1GYAA 3MLVL 4GXVL 3SHSA 2X89A 4DJMA 4QRQB 3QIUA 2VXQH 4KVCL 3WV0A 4ZTOL 2DKUA 3C8HA 3N1FC 1INQB 2OJEB 4KUZH 2DQFB 2EDBA 3WKMH 5EIIA 1G6RB 1LK2B 5EZIL 4ORZC 4PJ8A 2F74B 2P47B 1XF2B 3HPLB 3AAZA 1UFUA 5KVEL 3MFFB 3UZEA 4YDVA 5BRZE 1QSFA 3SDAC 2BSRA 2ZWLT 3O3AB 3MRHB 4JO4L 1MFEL 2E7LC 3ZTNH 2ESVB 5ANMA 3SBWC 1HHJB 3LEVL 3QDGE 4RWYH 1DN0B 4NYLB 4OCXH 4PRDB 4TUOA 3FN3A 4NQCA 1DBAL 4Z7VA 3EOBB 2UZYB 3L9RA 5A2FA 4BQ6A 4DGIH 1WWCA 4IDJL 4M7ZB 4WTWA 1KULA 5AWNH 4DW2L 3OXRB 4XPAL 5IBUG 1KNOB 4AEIL 3HZYB 4NRXA 4Z7OE 1I7TA 4P9HL 3HI1A 2JLLA 3DXAA 4A6YL 1AY1L 2HN7A 3QCVH 5T3ZH 2JELL 3PWUB 4FQXC 3OKOA 2XQYK 4O5LL 3ZSSA 2ZCKL 5IBTH 3VXME 4GQ9H 4XNQB 3WNPA 3VW3L 2O93L 2HT3D 2VZTA 2WWKO 1PLGH 1UEYA 2IBZX 2XY2A 4CVZB 1GHFH 5GJTH 4FA8A 3T3PE 4PRPA 4M5YL 5F1IA 3T0ED 4PUBH 2NY4D 3VXUE 4G7VH 5IIEA 1GGIH 1YY9C 3MRJB 4WI6A 3BH8B 3WFHB 3PWJB 1B4JL 3BGAA 2R23B 4OF0A 3W9EB 3HC3L 3MV8B 2BNRB 4G8GE 4KC3B 3RPKA 3QUMA 1CXKA 5JIKA 1X6NA 4NT6A 3O4LB 5CEZE 2A77L 5TDNB 1JF5A 5FO9B 2ZZUT 2R4RH 4GJTB 3RDTA 5KSBF 1QLEH 1BWMA 1AGBA 1NL0H 4Z7UF 3WHXA 3GI8H 1OP3K 1DCLA 5MEPA 4K8RH 5B21A 5IMOB 3BKCL 4M62L 3V8OA 3O45A 2EH8H 2P5ED 3BMVA 3MRDB 2HH0H 2WK2A 4CW1B 1QFOA 3BJ91 4GT7A 5EU7E 4X7SH 2FHBA 4RSVA 3AM8C 1GPOH 3OR6A 5EUKA 4D8PB 2P8LB 1I1YA 1LO3L 1I9RH 3NTCL 3GO1L 3O81A 1P53A 4DTGH 2X4SA 5B39A 4PFEA 1W8OA 3F6LA 3PDGA 4H8WC 3GHEL 4TTGA 5CP7A 2ESVD 1V5JA 5ILTL 1DLFL 1OGTB 1D6VL 1PKQE 4QXGL 3EJZC 3S9DB 3DVNB 3TO4B 2BY2A 3ARVA 1MNUH 4TSCH 1E4KC 3KVQA 1AE6L 1NGZA 2DMKA 1T4KB 4WU5A 2CKBA 2NY2C 3T4AA 1RHFA 1LVEA 1IILE 4JPWH 5C08E 3TFKC 4HJ0D 4KI5E 5KSVA 1BQHA 1FZOA 1FE8L 2Z91A 2DQDH 3MTRA 5E4IA 5CFHA 1RIVL 4N8CH 4Q2ZB 3NPSC 4Z95L 4XWGL 1UCBL 4R97B 3K46A 3L3IB 2H8PB 4NO0B 2H3NA 3K2UH 1MJ8L 1T0NB 2VJXA 5J6HB 4YR6B 4UOW0 3D5OF 3V4UH 3QNYA 1HSBB 2GJ6E 3QXDA 3JV0A 1UZ6F 1OCWL 5B4MD 4U3XA 1J0KA 4DGVH 15C8L 2H1PL 1EMTH 2Y72A 1BECA 4YE4L 1KF9B 3IDGB 3DX7B 1S7VB 4IRZL 3ZKXB 1TZGL 3QIBB 3ZKND 1T80A 3KLHD 1PSKL 3PIQA 1VKXB 1A6TA 1JHKH 2VXVL 3QUYA 3GMRA 4PJ7B 1KPUB 3NIDF 4TUJB 1RUQH 3ES6A 3RQ3A 3C5ZB 2LU7A 4L4VA 5DJ8A 2H32H 3RP1A 3FJTA 3MFGB 4NNPH 2AV7B 4LDEB 32C2A 4YHPB 3BZEA 2BVQA 4OZHA 4NCC1 5D70L 2WQRA 2BCKB 4LSTH 4ODSL 2BNRD 3RHWF 3W2DH 3B5TA 2XOTA 4O9HH 3S37H 3MOAL 4WWKB 1HEZB 3JWDL 5EUOB 3UP1A 5CD3A 4CKVX 5F72S 4E0RB 1QLRA 4H0HB 5DJ6B 4YHNB 1L7IL 2LU4A 4QRPD 5MEOA 4BQCA 5ICYB 4NJ9H 4KJWC 2Y07H 4W4OA 3TH2T 2BOCA 3QUZC 4OZGE 4C56B 3PL6B 2VKXA 4JFEB 3X14B 1OSPL 3FHQA 4ZFOA 2V2TA 2C5DC 1MLBA 4B0MM 1ZLSL 5I76B 2E9JA 5L0QC 4LGPB 3KPRE 3D25B 2X4UA 4QHMB 3EDDA 2HFFB 3L95A 5GIRB 2OR8A 1JGVL 1TPXC 1T2XA 3GIVA 5BZDA 5FDWA 1RZGA 2GW5A 2W0PA 1CGXA 3QG6B 4AEFA 5T33H 4IIQB 3EYSH 1WEJH 4QRRB 4WO4C 2J5LC 2BDNH 5H37G 4N0UE 4AIXA 5IEHA 3U0PA 5B3JF 5D7LB 5EN2B 4MLSA 3DV6A 2DQEH 4KU1A 2IQAA 4BYHA 5IOPB 5EBWA 4KI1A 5CZXD 1FVCA 1BVLB 3VFOA 5SWSB 2UUDK 1H15A 2X4PA 5IROC 3ZMRA 3TO4D 1OARL 2NZ9D 3O3EB 3TBVB 2D7PA 4RFEA 3WD5L 4N0YH 4KJYA 3L3KA 2NXZC 1RHHB 1VB9A 4S1RL 4HUUA 4LLYB 3S98A 4I5BB 5H37H 5C2BL 3S34L 2EH7H 3CPLA 2UZIL 4KZEL 3KPOA 2HKFL 2X1WL 5HYSG 3SJVB 4PV9A 1DEEA 2J6EL 3MLWL 4EBQL 4QGTA 2GK0A 2B2XL 3V6OC 1JYNA 3UBXG 3QO0A 1WAAF 5E2VH 1F2XK 3U2SB 1F3JA 2VNCA 3KJ6L 2EIBA 5KN5B 3KPLA 3CFJB 3OHXB 4ZFGL 3ARBA 5DD5H 1KACB 5I8EB 4OCSH 5ETUA 5IW6B 5I1HH 1N5AB 2O5XH 2OZ4L 2MKWA 3QIBD 4YFDB 3K4AA 4TVPD 1FG2B 5IFHH 2QR0B 5E9DA 4MCYA 1VENA 4KY1H 1OWRM 3BD5A 1U3HA 3D2UA 4XAKE 5DJAB 2JTDA 5H35B 1Z0MA 2PTTB 4YDIH 5JW4Q 1MELA 3VXRA 1OP5K 5HYJA 5I19L 2HTLD 1SY6L 3N1PC 4X5XB 3LB6D 3OTTA 5EZLA 5F9DC 2XN9D 1IAMA 4M93B 2I26N 4HKZB 4WWKD 5BW7A 1F90L 3X3FH 4WEMB 4YHMH 4C4KT 3FN0H 4XP5L 1AR1D 4LNVA 3ZTJG 3L3OB 2B0SH 2X10A 4C56D 1CT8A 2YN3A 4LHUB 4DOHB 1EA9C 1HXYA 4L8CA 1U8LB 4NC2B 3AFLA 4X6CF 1XCQB 5EOQL 5DQJB 3PQYD 5A3IC 2NCMA 5FYLL 3WS3A 4BSVB 1JYVA 2PCPB 4QHKJ 4JB9L 4YO0B 3OKEA 5H2BA 4M8VA 3LN5B 3H42H 5D1ZC 2B1AH 4EN3C 5HXMA 4CN6A 4K94L 2HT2D 1FL3B 3I75B 5ICZA 2GEEA 1CFSB 2RR3A 4RMSA 3T2PA 3RX7A 4DUWA 4XPHH 3V5KB 5E7BA 1N0LA 3ZTJH 4I1NB 3NZHH 4UZGA 4X8XA 1IQWH 3EYVB 4M8QB 1U8NA 2P7TA 4GRLD 1QKZL 4NQVA 3UTPD 1WZMA 2HFEB 4GUPA 3WSQL 5JO5A 4F7PA 1XF3A 5D1QD 3P4OA 4YFLI 5F6IB 4KZDL 4OBSA 1UQSB 4I77L 4R8WL 4B41A 3VE0A 1EAPB 1GGTA 5DGRA 4KJQC 2NY6C 4NZUH 2V7HA 5I2IB 1YUHA 1CU4H 3LS4H 4HZAA 4TUKH 3BYYA 3U30C 5BRZB 4TSBL 3QUXC 3BUTA 1VACA 1YPZE 3R06B 2DWDB 5DLML 3ARQA 1GGCL 2ZUQC 4XMPL 4EQ2A 4X8JA 4R2GC 2FDBP 3W0WE 1X5YA 3L5XH 3O9WD 3QDGB 5LG1A 1T7VA 5FYJL 3TYFB 1KB9J 2V2WA 3CZJA 3GSUB 3NAAL 4EXKA 3JVGC 1EEUA 4IRSD 4JCMA 3MACL 3ULVE 1CD9B 3RWCB 1X5ZA 1IC5H 3O3DB 1LDPL 2XWTA 2FLRT 2D0FA 3EGSA 1CDIA 4UU9B 2IFFL 3JTSB 5I71C 4HQQL 2MNUA 1K5NA 4LRIC 5IW1A 4P3CH 1I3RA 3TH4T 2R0LH 4DZBB 1QZ1A 4GLRI 5CSGA 5HDLA 5KVGH 5BS0A 1JTPA 1PY9A 4OF8A 3RBGA 3WNMA 5IV2B 1AKJB 3VXMB 1XCTA 3VRIA 1C1EH 3MRQA 5EU4B 4PJEA 3D18A 2CLZA 4J3OC 1LO4H 1MHPH 2MQCA 4JN2A 2ZG3A 3RFZC 1NSNL 1EJOL 4KK5D 4MDJA 4LHUD 3MUGB 4OUUA 3QEQA 1S7QA 1A6VL 1J8HE 3LV3B 4ZS7L 1FC1A 3AXLB 3G04A 4JFOB 1ZANH 3K4DA 4U1SA 5T3XL 1KPRA 3MRNA 1RZ7H 5B38A 4G8GB 3VWJB 5IEKB 1JFQL 5M94B 2W9LA 4OAWB 4FXGA 1A7RL 3ARTA 3Q2CA 4G8FB 5DJ2A 3T3MF 4LCWA 4X4XB 3MCLL 4K9EC 4OIBA 1D5IH 1S9WA 5I15H 2NXYC 4UT7L 1D5MB 3DV4B 1ZT7B 1II4E 2JJUA 1B2WH 3N50A 1JPTL 3QQNA 4JAMB 5GGSA 4CADA 1OGAA 1T83C 2W0LA 4L8DA 3V7AG 4XC3H 3HN3A 1ZGLP 1U9KA 2F8XC 2BJML 1CFTA 2B4CL 5BJTB 3FQUA 1A6WL 3GJFH 1WZ1H 3CLEH 5CUSL 5FKPA 1LP9E 5FHBH 1XR9A 3RGVB 1BOGA 5BRZD 3TIEA 2F8OA 1QBLL 4LMQE 3PGCB 4JJHA 4OZ4B 1DUYB 5FOJA 1CI5A 1NAKL 5IWLC 1MUJA 1UZ8B 2FZ3A 4Y4FA 3BIKA 5JW5A 4BZ1H 1CGYA 5FF6A 5SWZE 4LSRL 4OLXH 3C9NB 4GO6B 3TN0D 4MA8L 4AIZA 4Q97A 4PJHE 5KAQF 1WBYB 2B1HH 2B5IC 5E6IA 5JNYA 3K74B 1U8KA 4S2SA 3G5YB 3F7YA 1JZ8A 1R5VA 5E0QA 2AJXH 1D7FA 5DD1H 4KHTH 2D3VA 2N7AA 1WJ3A 3V52L 2DLIA 5C0BA 4I4WB 5FA3B 4H0GA 3JUZA 2UY7A 2GJ6B 3C5SB 4Y2DB 5ID0B 3UPRB 4PBVC 2W38A 5E95B 4BUGA 3GNMH 1ZHBA 2JJTA 4DK3A 1AKJD 3VXMD 1ZHKA 5DWUH 5CBEB 1YEHH 3RY6A 4L4TE 1N7MH 3GMMB 2YA1A 3D3VE 1DUZB 5AD0A 5HHVH 2OLDA 5ADOH 4Z78B 2BC4A 1KN4L 3VXUD 3V0VA 3BW9A 6FABL 5DEZA 4V1DB 2G2RA 4LMQI 1J10A 4MXVF 1G9MH 2AJUL 3QWRD 4HK3N 4NFCA 2RFXA 4OLYH 2VDLH 4Z76B 4G8GD 3T0AA 2ZSWA 5F9OL 4WFFE 4Z6AT 3HS0A 4WV1C 1A3RH 3QUML 2HYMA 4G8IB 5JW3H 5TQ2L 5CEZD 4X80H 1DQMH 5IW3A 3OKNA 2HT3C 3HNVH 3MX0A 4OZGB 5C0CA 1PYWB 4K3JH 1UB6B 5C07B 4X4YA 2CD0A 4QHNB 4HWEL 5IB1A 4DVRH 3FQTB 4LCCC 3T0EC 2NY4C 2XTLA 3IDYB 1QBMH 1UJ3A 3IFLL 5D5MA 2OQJA 3KPRB 5L7XH 1YYLH 1JZ4A 5E99H 4IJ3C 4XVJH 2Q3ZA 4YJZL 1LO5A 4R90L 3MA7B 3BRDA 1RY7B 3BMWA 3JXAA 3KYAA 4XTRD 3H3KA 5GJSL 1WBZA 3ECBB 4JFFD 4HGMA 4R0LB 1CG9A 1JPFA 1Q94B 3OJDA 1HH6B 4N0UB 4NQXB 3FRUA 3O11B 1YNTA 4IOIA 5D7IE 2BVPB 5I16A 4Q9RH 3IGAB 2C7UB 3HZMA 4P5KA 4XXDA 5K9QI 4PD4K 4G3YH 3D0VA 3MJ9A 1FN4B 2MPAH 3MV7D 3UTZB 1V05A 4NO3B 3RVUD 1RZKL 2A2QT 3B5HA 3BHBA 5IM7B 4OZFG 4GS7C 4EQ3A 4WI9A 1EHLH 1KLUA 1NMCB 1CZ8H 5E08H 1HIMH 4Q7DA 1LNUB 4MAYD 1JI2A 1MFBL 2GTZA 5C08D 2I9LB 2EDKA 4KI5D 3DUUB 4GKNA 5I73C 2CKBL 4LU5H 2OXGA 9CGTA 4R96A 4LPYA 1IZKA 4Z8FH 1KEML 2GJZA 3IETA 2HFTA 3D85D 5HHNA 4P4RA 3SQOH 2XWBB 2AI0H 4JZJC 2FIRT 2HJLA 2IQ9L 4PV8A 1EEYA 3SDCB 1T5WB 4Y2DD 3S96A 4PPTA 3KAAA 3MR9A 1IEBA 3SO5A 4C58B 1FNHA 2VUOA 4AH2B 3ZE1E 3LQZB 4HJ0C 8FABA 2OTPA 3UTSE 4GW4A 3MREA 2PYEA 5ESAA 3W9DA 2XPGB 2FYYB 5BQ7B 4W6XB 3WL9B 2HA1A 2A6JB 3HZVA 4YH6A 5DJZA 4XGZB 3GK8H 3PG2A 1U8IA 2JIXB 3BESR 4HXBL 2DIBA 1A1MB 3HMXH 1S7WA 1WT5C 4HUWB 5F96L 1A7NH 5DUPL 5B4MC 4OZHF 2EE2A 2Z8RA 2X4TA 3MNVB 3RWIB 3U7WL 3MRRA 1LHZA 1OQXA 3C60A 1C5CL 1NAMH 4UMGA 3ZKNC 4JREB 3ARDD 4X7TA 3KLHC 3BPOC 3H9HA 3Q48A 3QNZA 2AJSL 3O2VH 1YEIH 1AJ7L 4HKBB 3OAZK 4ZFOL 5I6XB 3KPPA 2OTWA 2IANA 1KPVB 5IVXF 3ULUD 1DDHA 2YZ1A 1NGXB 4AZ8A 4AG4L 2P5WA 3OX8B 4U1HA 3INUH 1ITCA 1LGVA 3QWOB 2NZIA 5ISZE 1MAML 1VGKB 4HUXA 4KK6D 2LVEA 4XNUL 4ZPVA 5TDPB 2DM4A 4ODVH 3IJYB 4JZOB 4HH9B 3CVHH 4E41E 1QA9A 4AQ1B 4ZNEA 4F8QA 1DZBA 2PKDA 3NN8B 5C9JA 4HKXB 4CVXB 4JRYA 4ORGA 3CCHA 1U2HA 4WW2F 4HX1B 5IMMB 2DS4A 3DX6B 4U05A 4XXCA 4RIRA 3CDCA 2FBOJ 5C09A 1GZPB 2IC2A 3FQNA 3H8NA 3B2VL 1LK3L 1IGCH 1I1RA 1NEZA 5F89B 1YEGL 2E9BA 4L3AA 3U4BL 4Y5VA 1QFPA 3EYFB 4NQEA 4R4FL 3W0WB 3DO3A 5CZXC 2Q1EA 2C3GA 4S0SD 2ERJC 3B6SB 5DMKB 1T1WA 4JY5L 2V9RA 3TO4C 3LPGA 2NZ9C 4EJ1C 4TSAH 4P0DA 5GGQL 4U33A 5CMAB 3U36A 3O2WH 3X13B 2FECL 3TWCL 3PGDB 5IB5B 3BSZH 5EA0L 3GMLB 4XAKD 4R7DA 3O8XB 3BN3B 2ZUXA 3GMOB 4N0RA 5FUCE 5DK2B 2WUBL 2ZSVA 4S1QH 4GAJL 3KDMA 5E8EB 4JJ5B 3E8UL 5FGRA 2JIXD 4HJGA 5KSBE 4Z7UE 5KJRH 2A83A 4M5ZH 3BEVB 1AHWA 3IDXL 2AV1B 2NNAA 3PUCA 3AMKA 4M1GH 4BJLA 3VXNB 1TENA 2H9GA 1RZ8A 5HGDA 5C0IA 4POZD 2BOBA 2WBJB 1A1NB 3OXSA 4NBYB 4YBHA 5TH2B 2XACC 3ZKXC 3QEUA 3QIBC 4PJCA 3RU8L 1G0YR 3OV6A 4PG9A 3VCLA 3IRZA 1ZA6A 2XWJB 3TBTB 3CGTA 3UTTB 1J8HB 5HGBB 1DFBH 1U8JB 4G9DA 4YDJB 5FECA 2NW3B 2HTLC 1UM6L 4Z0BL 3U7AA 4I9WD 5EU6E 3OAYH 3LB6C 4P5TA 4ZXBB 4E42A 5J56B 3O4OB 3PWNA 4RQQA 4N9OB 4WWKC 3IFNL 4C59B 3C09B 1RURH 3GB7B 1IGYA 1F3JB 1AR1C 3DHJA 5LAXB 3FKUS 5IMKA 3VXQB 4PB0H 1CGWA 4ETQB 4NM4L 2ZOLA 5FM5M 3QEHB 2GQHA 1M7IA 4NKOA 2AABL 4JFQA 4S1SH 4L8BB 2AK4D 2MWCA 3O6FD 1ETZA 1E4WH 3EIFA 3ARGD 4CJ1A 5IB4B 5DVNA 1AP2A 3ARWA 3C6LB 4G6FB 3QFDA 5DQ9A 2HT2C 2VWEC 1LP9B 4APQB 4H25A 5D6DC 4UIKL 4TULL 3RUGA 5EU3B 5DMGD 4PRNA 1KXVC 3DJ9A 4AJ0A 3FT4A 2EIEA 4YBLC 2IH3A 4GRLC 4G8EB 4KV5F 3TGXA 4J8RB 3PWPA 2VH5H 5I1LB 3MLUH 5KZCD 5D1QC 3Q6FB 1MEXL 1AI1H 3UC0H 4PJFA 5GRUH 5DRNB 2QLVB 1ZV5A 1C7SA 1HWGB 4ZO8A 5DTFA 5JTWA 1WQVT 1N64H 1OQOA 3QXAA 4LSUH 3B8YA 4U6HB 3N85H 1RU9L 3MLZH 4Y2OA 1JWMB 2IG2L 3O8XD 2Y4SA 5ESQA 4NP4L 4ODBD 1R3KB 1QQDB 1VADB 4U1GC 3X3GH 4TRPL 4KAQL 1PEZA 1H8SA 3DBXB 3O9WC 4K2UL 2HLAB 1IGIL 1IVLA 1MCKA 1UM4L 5A16A 1ZKAA 1T1YB 2ICEB 2WBJD 3HE6D 1ONQB 1HINH 3QDMD 8CGTA 3WMSA 5LQBH 3FT3B 3CH1A 4IRSC 4L4TB 3HHRB 5GRZA 3D3VB 4L8SB 1JWUA 5JXAH 2ZUTA 3VH8B 3FTGB 4CMHC 5JOFB 3RWDB 1ROWA 3UZVB 4JKKA 5FEBA 2GTWB 2WP3O 5BV7B 2Q76A 5F9AC 2VLJE 1N0XL 1KN2H 1FVDA 3TIDA 3SE3A 1IEHA 2UWEA 4HPOL 4ERSL 4N0FB 4ZUVA 4FZ8H 1ZLUH 3JSSA 1Q9OA 4M93C 5E6ZA 1ZHNB 1AO7E 2VLKA 4H26A 4MA1B 2XQYG 3QHTC 3F7RA 2FBJH 4Y88A 5IHZA 1I7RB 4X6BA 4XCCL 1EHAA 4KK5C 4JE4B 4L29A 1T5XB 1ZGLA 3IU4H 3SDDD 5J6GB 4Y5YC 1CXLA 4AL8H 1I1CA 4JHAL 4U6XA 1G6RH 3WNOA 3TV3H 1A4JB 4J7RA 1IC1A 1OD7A 1NKOA 3K7UA 4G6FD 5CEYB 1I3RB 2YHGA 1WAAE 1F00I 4NKMA 3OG6B 1T04B 3R0MA 4APQD 5FKAA 1DBKH 3A6CH 2CRYA 4G6MH 5EH1A 4R3SA 5FHAH 4F3FA 1A22B 2FX8H 2IADA 3HC4L 3E6HA 4GAFB 2VE6B 5DZOA 4WFEE 4EI5B 5FOBB 2FWOA 3U1SL 3D9AL 3TVMA 1HYSD 2ADGA 3BEWA 4HEPG 3VFTB 2VDMH 5H94B 1SMAA 4G5ZH 5SWZD 1RULH 3Q5TA 2DQCH 2ARJB 3BN9D 2H26A 4QY8A 4MDIB 4XMLH 3MV11 5J0BA 4D9RE 1OTTD 1DVFA 1P4IH 3LOWA 3A6BH 3I02A 1BZ7B 3WFEL 3P11L 3CFKB 2ORBH 4NNXB 3RWGA 1E28A 2EDJA 2NY1B 3MGAA 2AJ3B 2DQUL 5ADPL 1WISA 3QO1A 5FM5O 4X6CE 1MIEH 2Z8WC 4Y4HA 1KJVA 4MNHA 3B4NA 3F5WB 1JNNH 2EEDA 1TLKA 1G9NH 4L4TD 1YNKL 1TJIL 3TN0C 5FCUL 1LEIA 1FNSL 3P4MB 2XY1A 3LKSA 1Q9LA 1ACZA 3VFRB 3LCYA 3Q3GB 4MD5B 5DD3H 1R3IL 3QPXH 1NCWH 4Q6IA 1WFNA 4O2EB 4BFGA 4I3SL 4WFFD 4BSJA 1R3LA 3FB6A 4PRHE 5EBMA 5L6YL 3NCBB 1ZLVH 2Z31D 2Z8VC 3MJGX 2ED7A 2BVOA 4J4PA 4OLZL 3WUWB 1IGFH 3V79C 3IVKA 3LIZL 4NUJA 3MXVL 4P23B 4LIQE 4AMKL 1U92B 1VGEL 4OGYH 3S5LB 2NLJA 3MRPA 1YY8B 2NTSP 4P4KA 3I2CL 5D5MF 4NHCL 5FYKL 1T7ZA 4GAGL 1ES0A 4MJ4A 1IQDB 3BP5A 1GGBL 2EYTB 1U8PA 2A74A 4PJDA 1EXUA 1PVHA 1MCJA 2VB5A 1V7NL 4MJ5A 2C4XA 1IJ9A 4HUVA 2UYLB 2AXFB 4PREA 4X4MA 2N4IA 1JIBA 1NUGA 5HBBA 1GAFH 5BXFB 4HS6A 4YAQB 5KANG 1RIHH 35C8H 2PW1A 3MJ9L 4M4RA 4Z77B 3H9ZA 4FTVA 4XTRC 5MEQB 2R4SH 4HXAH 5ALBL 1HOCA 3KPQA 4UDTA 1EHXA 4ZPTB 1FLRL 4ZNCD 1W72A 3IXAB 1FNEA 2DQJH 4LNRA 1RJLB 1OWWA 2IAMD 3HRZA 5CEXB 4XT1C 2EYSB 4HS3A 43CAB 4AIOA 5DMIL 2ITDB 4LLUA 3WJLC 3RGHA 4TNWF 4QRUB 1RSFA 2XKUA 4O2CA 4YHOH 3DIFA 4FABL 2GITB 5C0AA 1OLZA 2H45A 3RVUC 4HV8B 1HZHH 2W9EL 5CSZB 3M17A 3VXSE 1PY4A 3SKJH 3OKKA 5TFSL 4TVPH 1Q9WA 1ZSDB 4URTB 2D0GA 3WN5A 2D7TH 4MAYC 3T3ME 4KI5C 4BKLA 1JGEA 3UTSD 3MODL 5I0ZA 4ZFFA 5JIHA 4Q74A 3K8LA 4WFHD 3QULB 3T04D 1MH5B 1AD9B 2G5BB 2PR4L 4RAHA 1IL1A 5KSBB 2R8SH 2VZUA 3QG7H 4JLRA 1CICA 2H41A 1WWBX 4JZNA 1W0VB 4TTDD 1JP5A 4Y2DC 3MYJB 3FQXA 4TYUA 3K8MA 4UQ2B 1VFBB 1MOEA 3LPFA 1OAXH 2XT1B 5HDQH 3VFNA 5GS2H 1IKNA 3MBEB 5J57B 2JJSA 5JA8B 2DM7A 3BQUA 3G6DL 2UUDH 2VAJA 3VXOA 4NQSA 1IEAA 2X9YA 5EOCL 5A2LH 1AFVH 3HNSL 2M2DA 4KPHH 5E8DL 4F2MB 1UWEH 2CMRL 3FFDB 1DQDH 4FNLH 5TGBB 1Q9KB 1U93B 3VGEA 1AGCA 5E03A 3VFGL 2YS4A 3RWJA 3U0TA 4PP2B 4JG0L 1G7QA 5T1KA 4HIJA 2J8UB 1D9KB 4J6RH 1DQLL 4OLUH 3G5VB 3NA9H 4LLAA 1X5LA 5B3NA 1VHPA 5IJVA 3LQAH 4GKZA 5ISZD 1P7QB 3U0WH 1KEGH 3NIFF 4Q9CA 2F53E 1H5BB 4FFZH 2OR9L 3ARDC 2OL3B 4IMKC 4RGND 4E41D 4UI2A 2P8PA 3U6RA 4YXLH 3C2AH 1B0RA 1TQBC 2H32A 4JO2H 4V2BA 1BFSA 2Z93B 5TQ0H 4NOFA 5FK9B 1NGPL 1AGDB 1FL5A 3C6SB 5I1AB 1P2CA 3ULUC 1TQCB 3L1OL 4GW1A 3I9GL 4HFWB 2R29H 3AB0B 1OP5H 3WS6A 4BUHA 5IVZA 4NN7B 1XIWA 1QYGL 2Q8AH 4KK6C 4P2YA 2CIIB 5E24E 5FGBA 3OKMB 1NLBH 5K93A 1NANH 1K6QL 4RAVA 1RJYB 1WIPA 5DD0H 1K8IA 3SGKC 1CL7L 1X5KA 1JF1B 5L2JB 1N6QL 3TNMB 1EO5A 4EDXA 1A8JH 2IH1A 1AXTH 3C8KA 4MXVE 5DD6B 1NMCC 4I0PB 1SHMA 4OKVA 3VU2A 4D94A 4J2XA 3VGAB 1SYSB 4HG4K 3KYMB 5DVOA 4DZ8B 1BX2A 3RTQD 2VQ1A 1N2RB 3I6GB 2IALA 2AEQL 1I3VA 4FXKB 1YEDB 4NC1E 4L1DA 1NC2D 5K9OA 1UA6H 4NJAH 1FYTE 5C0GA 5T1MA 3JUYA 1NCDL 1FZMB 4P2RE 4RFNB 3MBED 1AXIB 5AZEH 3HA0A 5EZOH 2E7CA 2FATH 1INEH 1M05A 4PJGA 2VXUH 3VI4F 2M1KA 1A6ZA 1X7QA 3IB4A 4HFUL 2F5BL 2ITCB 4PJCF 1A6AB 2VZ1A 5C0EB 4MMZC 3CSYA 3NIGF 1KTRL 3WFDL 1I9IH 5EU6D 3E0GA 1C5BH 3Q0HA 3S35H 3SY0A 1XGPA 3VXPA 3RL1A 1AO7B 4WW1A 1P7QD 4POZC 4ZUWA 5FAAA 1DBBH 5DEFA 1WTLA 2APVA 2C1OB 5EO1B 1S7RA 4JREC 5GRWA 1MVUA 4MXWL 1RIUL 4PD4J 5EIQA 4M9OA 2C4FU 1K4CB 3IJSA 2VAAA 4ONGH 2R1XA 1IBGH 2ZCLH 1VFAB 3MRFB 3SCMA 1CR9L 4O4YH 2FNBA 2FIKB 1AIFB 1NCCL 1OSZA 3LAFA 1CE6A 1FAIH 2H2PD 5DFWH 3QJFA 1XGQB 5DC4B 4L9LA 3RNQB 3UBXA 1SYVB 1U8OB 4GRWE 5B22A 1KG0A 4MGXA 4F37F 2NR6D 4JFPA 3VA2C 3HAEH 4LCUB 5D2NB 2FX9L 2YKLL 2NMSA 1BFOB 2QADD 5HVHC 1X5JA 5GISH 4EVNB 2VR4A 4XZUA 2ICWB 3RUGF 4MD0B 1ZT4A 4G9FD 4X83A 4R7NB 5IKCB 4WENB 4P59H 5KVMC 2D0HA 3D0LB 3FOMB 2BFVH 5JMOC 4GSDL 4LLWA 2BERA 2R1WB 1OY3B 3O6FC 4IM8A 3ARGC 3MNWA 4H1LB 4I0PD 3RAJH 3HUJA 4YEEA 2VC2H 1V7MH 4PJFF 4M7JL 1EDQA 4OZHE 2AK1H 1UXWA 2DQIH 4ISVB 2Q8BL 2A1WH 2E7LA 2BHYA 1P4LA 5HHME 4BH8B 4LVEA 4XPFH 1LDSA 2MCG1 2EXWD 5C0RL 5DMGC 3OGCA 4Q0XH 4PJ5A 4HK0B 3ULSB 3QDJA 3I84A 5GZND 4I2XA 5I1KH 3P77B 5MERB 2X4RA 4U6YA 5IQ9B 3OPZH 4QRSA 2GCYA 2YXMA 1FJ1B 2NPLX 5F9WB 3SOBL 1AGEA 3DUSA 4JRWA 2ZJSL 2K1MA 4GMTL 3DROB 4RA3A 4XPTH 3IXTB 5E2UL 5IVXE 3VFPB 4QGYA 5C6TH 2BRRH 3BH9A 4M7LH 2VLLB 5KS9E 4Y5XB 3M1BA 3O8XC 4OT1H 1BJMA 5J06A 4JN1H 4L3ED 2VLJD 3QDHA 3WNNA 1MQKL 2NX5E 4Q58C 4W68A 3LKOB 1RZJL 4OCRL 4JDTL 4UINH 1MRDL 4XB7A 5DVKA 5FM4A 4K71C 5CEZH 1EFXD 4PRHB 2QSCH 2UWEF 2WBJC 3BO8B 3HE6C 4N5UA 5I66A 1PG7H 2VOTA 1O5DT 3KYNA 1RD6A 4PJBA 1HQ4B 3AUVA 4P9ML 4XMKH 1MRCH 4HGWB 1GOFA 2R0WH 4PRIA 1A1OA 1YEEH 1IC7H 4S10A 1FGVH 2DD8H 2BNQA 4OZIA 4FS0A 4LKXB 3WDHA 2BSTA 1A9BB 1S9XA 4K3DH 1VA9A 2XKNB 1ORQB 2YPLB 1CGTA 4P2OA 4X6FB 3CX2A 3O4OC 2VN7A 3NZ8A 4OTXL 4CNIB 3C09C 1MPAH 3GJEB 1SEBA 4WI3A 4X7EC 1CVSC 1NC4D 2WBWB 3SDDC 4X0KB 2YC1B 4WFED 2DB8A 3C5JA 4KDWA 3OB0K 4LK4A 3T4YB 5E9DE 3NCCB 3FFCE 2AERT 5HGHA 2I60H 4Y7MA 1WFUA 1RPQA 3AM8A 4BFEA 5D71L 3B9KB 1DR9A 1NJ9B 4G7YL 1AH1A 1BBDH 2OP4H 5D1XD 4D9RD 5BO1L 4HIXL 2PF6A 1BBJA 3WIIH 4OD1L 4MSWB 2VSCA 1KELL 3MRCA 4APQC 5FV2A 5TF1H 2APBA 1JJUA 4U3CA 1T03H 4GW5A 1BVKA 3G6JA 5DR5H 1I7UB 1MHCA 4MJIE 1E4KA 5DEGB 1YZZA 3RL2B 2BSED 5FCSH 3SE9L 2AEWA 4OV5A 2VMFA 1HYSC 3GZKA 2VXQL 1BMGA 4EDWH 3DRQA 2I27N 3SE4A 2UZXB 1FV1B 3BN9C 3BIAX 4KUZL 4RDQF 3JWOL 3H3PH 1GGUA 3WKML 1OTTC 3G5XA 5D4QA 1FO0B 5E00A 1AC0A 3HI6H 2VITB 1J5OH 2ED8A 1WV7T 3GSWB 4IRJB 2VERN 2DQGH 4EUPH 4X9IA 5KSAB 2BY0A 3U46B 5ALCH 2BSSB 1ACYL 5ITBH 4PJ9A 1YDPB 4TPRL 3ZTNL 3B3IA 2ZPKH 3G5ZB 1FPTH 5DT1H 1NDMA 1YQ2A 3CSBA 4RWYL 4OCXL 2OTUA 4XC1H 4ZSOE 1CLOH 4DKAA 2VN4A 1PW3A 3SKOB 3QHFH 4FQQB 3QIWD 3NCEB 1ZGLM 4U1KA 3LEXB 3TBWA 4DGIL 1ZA3A 3RZCB 1FHGA 3AU1B 2Q86A 4YGAB 2GSGA 5AWNL 1LE5A 3IDIA 4Q9QH 2D03H 3IDMB 2VDQH 2DJ4A 3P9MA 3V5HB 3QCVL 5E56A 4KV5E 5T3ZL 3QUZA 5F3HA 2Z31C 3BXNB 3PJSA 2F53B 2VLME 1K4DA 1G7HB 5IBTL 4GQ9L 4MA1C 4XP4H 4L1HA 1RJCA 4PJDF 2K7PA 1QOKA 5GQBA 2GSIA 3BP6A 2NYYD 5T1LB 1FIEA 1D5BB 1PLGL 3GSRA 3BAEH 3LH2H 1GHFL 2LFGA 1FRGH 2YPKA 4MQ7A 2DF3A 5GJTL 1NGQH 1ED3B 1TVDA 4PUBL 1KENH 1S3KH 2O26U 3UYRH 4CMMA 4G7VL 1LQSR 4HUMB 4JGMA 1GGIL 1T7YA 4WO4A 2HG5A 4FG6D 5F70A 1HHKA 3TNNB 4ZD3H 3P4LA 5DO2D 5HHPA 3DVFA 3LHPL 3MJ6A 4WI7A 5F88A 2J7LA 1W72L 2X9XA 4P46B 1EUTA 5B39G 5HHQB 1N3NA 2H6PA 2OSLA 5IROA 4K7PH 1HDMB 4YXKH 5FO7B 4F80A 3ARPA 2R4RL 1P4BH 5DXWA 1XAUA 4RX4A 1QLEL 5F7DB 5F8RC 1NL0L 2WBKA 3LD8B 4WY7H 1JK8B 2IGFH 3DVGB 3GI8L 5DA4A 4K8RL 3VXSD 5HDOA 2YSSB 2NQCA 5L2KD 3F7VB 3ROLA 1G0DA 3OAZH 2EH8L 4UOJA 2Y5TB 3D48R 2HH0L 1I9EA 1G7IA 2W0KA 4X7SL 2IAMC 4HHAA 1GPOL 3MMEB 3VGBA 2F54A 4LCWE 5SV3A 1I9RL 3THMH 5KSAD 4DTGL 5E4EB 2JCCA 5KSUA 3T2QA 2D7NA 1FYTB 4ZDHB 1IAKB 2EE9A 5E94A 5EBLA 4LSPH 2VZVA 2UY6A 1CXFA 2YOCA 4P2RB 3AMLA 1JPST 2X89D 1MNUL 3QIUD 4TSCL 5EC2B 5F1OB 4WHTA 4OLEA 4ONOA 3BZ4B 5ITFA 5D93C 4JPWL 1FFNB 5D7JB 1YEKH 5D9SA 1A2YB 4YUEH 2ZUVA 2DQDL 3KPSB 4PJ8D 4OF7A 3QRFM 3HB3D 4N8CL 3RA7H 4W6YB 2CDEB 4J1UB 3MUZ1 3SO3B 4RAUA 2FJHB 4HKJB 3K2UL 1Y0LB 5ESVA 2DN7A 1RV6X 5CD5D 3V4UL 4TTDC 5LCVH 3H7BA 4OZFA 4ZO6A 5DI8A 1UKSA 4DGVL 4KGJA 3OKDB 3WEXA 5FB8A 1EMTL 3H0TB 3S8WA 2JK5A 5M7QA 5F21B 1HQRA 1AC6A 3LN4A 1FL6B 3BGFB 4G43B 1QLFB 2OBGA 4GLRH 1P1ZA 5T1LD 1SEQH 1JHKL 1KV3A 1SM3H 2Z4QA 1RK0B 1XF4A 3W5MA 1S9VA 1I4FB 4EN3A 4FFYH 1RUQL 3UYOD 1S5HA 5GS1C 3UJTH 5EO9A 1D5XB 2W0FA 3GSOA 4NNPL 43C9B 2A6KB 4CRPA 3LKRA 3KPNA 1YN6A 3W2DL 4LSTL 4GRWB 1L0QA 5C6WH 3O41A 4O9HL 4WEBH 3OAUH 5C0BE 2DJSA 3IS1X 3DXAD 3S37L 4DUXA 1NAMA 4YC2B 4FQPA 4ZUTA 2LV4A 4P46D 4RGNC 5A2KH 4ELMF 4ZOCA 3EJJX 2CGRH 4NJ9L 3O6MH 4HWUA 2J2ZA 4JFZL 1Q0YL 4CVUA 2R69H 3MA9H 4MVBD 3F8UB 3QNXB 4WUUA 3HE7A 2MCPH 1MJ7H 4DKFH 4JKPH 4FP8H 4QT5A 3TZVA 3JV6A 4FMFA 3ULVH 3Q6GH 1HSAA 4PRPD 1H3VA 2XIDA 3DETD 1R0AH 5IF0A 4HLZH 5DJCB 3QUKB 1LEKB 5T33L 3EYSL 1M6OA 1S8DA 1WEJL 3KYOB 3L3GA 2BDNL 4QCIA 3CVHA 4OCLC 4Y1AE 2ICCA 1CFQB 1I3GH 4NO5A 4WTXA 2DQEL 4MMXC 2W60A 3JTTA 2OX5A 1KFAH 5C0CE 1Z3GH 1QG3A 4KMLB 1E6OH 4PY7B 4NKDA 1QD0A 3RDTD 3ET9F 3S36H 4HC1H 1U58A 1ZVSA 4LQ1A 1M7DB 5IVXB 5D5ME 4OFDA 5FYKE 5B8CA 1XZ0B 2PTVA 4KXZI 4LLQB 2P8MA 2DL2A 1XGTB 3R1GH 4KQ4L 3DWTA 3IF1B 3QZWB 3RTQC 5KS9B 2JJVA 1L6ZA 2Z35B 4WI2A 4DVBA 5JIIA 2EH7L 3UX9B 2EDWA 2MHAA 5FUCC 1I7ZA 2NX5B 4Y16A 4MNQA 5EZJB 4HWZA 1KBGH 3MRIA 3F7QA 1PGRB 3EZJB 2EEAA 1NCBH 4P3DB 3MBEC 3MROB 4WW2B 2X42A 3HG1E 1IT9H 5DD5L 3STLB 4OCSL 2DWEA 5DUBA 1UWXK 2BK8A 5I1HL 4UTBH 5IGXH 2X9WA 5IFHL 2LU3A 2FSEB 2GFBA 4H5SA 4QTIL 4XP9H 3BKMH 1OVZA 2CUHA 1MCWW 1EAJA 4P57A 4YDIL 3DMMA 4FZEL 3V6OE 2HP4A 2FR4B 3KHOA 1A3QA 5D2LA 4ODUB 4NZTH 3X3FL 3OWEA 1T3FA 1F02I 3CMGA 3RWEB 4YHML 1NCTA 5FO8B 4ODWA 3FN0L 1TVBA 2VLRE 5TE4H 4NRYA 2B0SL 4QHLA 2PTUA 4D0CA 1M05B 3EO0A 1YEJH 3AY4A 4GG6B 4LCYB 1M4KA 3FFCB 4O51B 2A73B 2C3VB 3KNBA 3NFPB 3QUYD 2C3XA 3KLDA 2W9DH 3MUY1 2H2PC 5K9QG 3VH8G 3NFSH 3H42L 1KIRB 2B1AL 5E8PA 2PYFA 4U1NB 2NR6C 4FOMA 3RWHB 3HUJF 3IAQA 5HHMD 3NABH 5FIEA 1S7UA 2QADC 4WW1B 1EO8H 3BKYH 5DHYA 1MVFA 4XPHL 4MJIB 4JPIB 1MAKA 3NZHL 1RJZB 5I75C 1SJXA 1IQWL 1WSST 1BIIA 4U6TA 4LLDB 3S97C 5D6CA 4I0PC 4LHJB 4OV6F 4HDIA 1YNLH 5CWSA 3G08B 1OF2A 3JWDC 1KIPB 1TCRA 4NZUL 5INCA 3TBYA 1CU4L 2XYCA 3NIFE 4ALAH 4TUKL 3O2DA 2CLRA 3DECA 2EXWC 1SJHB 5GZNC 2YWYA 1IAII 2I9TA 3L5XL 3V0WH 5F9JB 4HZLB 4ZNEE 1TZIA 2HVKB 4MLIA 1QSEB 3X11B 4ZSOB 3WLWD 1NFDA 2Z9TA 4DFIA 3VA6A 3S88H 1MF2H 4HWBA 4U3HA 1IC5L 4PJBF 3SDAB 4IEFB 4JCLA 1QR1A 4D0DB 1RMFH 3ALXA 3ABZA 1K8DB 3OZ9H 4OF6A 4PGEA 5F1NA 4ZMAT 5B38G 4OZIF 5C86A 4P3CL 1JWSA 2R0LL 3NCYS 1FLTX 1CDGA 3U9UB 4PJAE 3W39B 2A6DA 2HMID 4FQIH 1C1EL 2HVJB 4LCCA 3WFCH 1ZWIA 1MHPL 3ZO0A 2V6HA 3ARBD 1ORSB 5GGSY 2BMKA 2GT9A 4E9LA 4ZAKA 2V5RA 5DJXA 5E9DD 3FFCD 1KB5B 3D2UD 1U3HD 4RNRB 3DTXB 3WXVH 4DFHA 5IESH 1ZANL 2F58H 4MNGA 4PGDB 1T22A 2FRGP 4FQXB 1RZ7L 3VXRD 5HYJD 1F45A 1TZHA 3FOLB 4MA7H 1EHNA 4F33A 3CFDA 3P30H 5JPNA 2VIRA 2O61A 1JNHA 5K9JH 4MQTB 1QRNB 1D5IL 1D6EA 1MWAH 4ZYKB 1OD9A 3LRSA 4QRQA 4LBEB 3VI4E 4MJID 1INQA 1NMAH 1B2WL 2OJEA 3MV01 5EOCJ 2WIIB 4P49A 2VDNH 2DQFA 3KS0J 1MY5A 3G6JF 2R2EB 3QBTB 2XA8H 1G6RA 2C4FT 4X9HA 1LK2A 2F74A 3NOIA 3NIGE 1NMBH 3WUWG 4Z0XB 1FFQA 2M26A 4XC3L 1XF2A 3HPLA 3IKCB 1CL7I 3MFFA 4OCYH 4CDHA 5D1XC 1G7JB 2EYRB 4XNMB 3O3AA 3MRHA 1KJ2B 1WZ1L 3S5LG 2ESVA 3NA4A 4YBQD 5FHBL 1HHJA 1BZ9B 4NPYB 1DN0A 2DBJA 4NYLA 3O3BB 4PRDA 4JFDE 3LKPB 4HGKC 3EOBA 3RVXD 5I30H 3L7EB 3OJ2C 5GSRB 4ZFZB 3T08A 5DGQA 4LEOB 1LEGB 4BZ1L 4Z7WB 3MO1B 4OLXL 1I3UA 1MLCB 3GM8A 5HPOA 3OXRA 1HN1A 4IHOB 1KNOA 3UAJD 3HZYA 4D2NA 1OHQA 1YJDH 4UOW1 2B1HL 4EXPX 1ND0B 1J7VR 4N8PA 1H3WM 4JO4H 5GRVL 2EKJA 3KXFB 4WU7B 3PWUA 5C3TA 2AJXL 3IS0X 5I8KH 5DD1L 1PBYA 3B2UD 4KHTL 3B43A 3RUGE 4XNQA 2FGWH 2OS7A 1Q1JH 3BRFA 1I8KB 4F8TA 1BPVA 3GNML 4D9LH 2NY2B 2VLMD 4CVZA 4BQBA 4PRAB 3QIWC 3DUHA 5DWUL 3ARUA 1YEHL 1N7ML 2DLGA 3GJFB 3NPSB 3MRJA 5HHVL 2DI8A 3WFHA 2D31B 2X1QA 3PWJA 2R23A 5ADOL 3WIFB 3KWWB 3W9EA 2BNRA 3QAZB 5TPWH 5DMYA 1FBIH 4OD3L 1A6PA 4NBXB 3WLBB 3O4LA 1JNLH 1G9ML 3RIFK 2VDLL 1UC6A 1U42A 2BVTA 3PXHA 3BPCB 5TDNA 5FO9A 4YK4C 1A3RL 5JW3L 2MOVA 4G6KH 4X80L 1DQML 2Y7QB 4XHQA 3HNVL 5IMOA 2NYYC 2QQLH 4TVSa 4K3JL 1H8NA 2OI9B 5J11C 4WTZG 3EKCA 2AAVA 4J3VA 5GGTH 4CU6A 5HVFB 2ICWJ 4DVRL 3MRDA 3GJFK 1ZA3B 4CW1A 1QBML 1JRHI 1OW0C 3HC3H 3QEQD 5GS3A 5L7XL 1FZKB 1YYLL 3IDNB 4XBEH 3FB8B 4HPYH 2VKWA 5E99L 4XVJL 4D8PA 4FG6C 2P8LA 4YDKH 1XGYH 4DN3H 2RCSH 3W5NA 2NTFB 5DO2C 5C0DB 3HRPA 1D3CA 4I18B 2UWEE 2Q20A 4F9LC 3NACH 1J1XH 4LCWD 4YWGH 1OGTA 4Y1AB 3S4SB 5GZOD 1S78D 1PZ5B 3DVNA 4Q9RL 2Y25A 3DSFH 3T0EE 3TO4A 4ZOEA 4YFEA 5L0QB 4G3YL 4JM2B 2YXFA 1T4KA 2MPAL 3SPVB 1TPXB 3OR7B 2IMMA 1OGAD 5GRVK 1EHLL 1LO2H 1CZ8L 4Q2ZA 5E08L 3VFSB 1HIML 2J5LB 3GDBA 1HHKB 2XNAB 3L3IA 4O00A 2H8PA 4NO0A 4LU5L 1T0NA 5J6HA 4YR6A 5CIPB 1HSBA 5KSAC 2E6JA 1KT2A 3UPAA 3SQOL 2O5YL 1V8HA 2AI0L 4KMTH 3IDGA 3P2TA 3DX7A 1S7VA 1EO7A 3QIBA 5HYEA 1JTOA 1VKXA 1AE6H 5IFAH 2OL3H 2EIZB 3VD9A 1P6AB 3HG1B 4PJ7A 1KPUA 1WLHA 3CUPA 3QIUC 4TUJA 2NXZB 2FO4B 3C5ZA 1CFNB 3F6IA 3WCYA 4OB5H 4M48H 2YD8A 2AV7A 4YHPA 5BOZG 3TPUB 4PJ8C 1NLDH 3HB3C 4YHLH 2BCKA 3U83A 3FQRB 2OM5A 4OFYD 4RMRA 4NRZB 3RY5A 5JHDB 5E6ID 4WWKA 5MENE 1HEZA 5EUOA 3GK8L 3CDGB 4E0RA 3ARFB 5DJ6A 1X5FA 4YHNA 5CD5C 3HMXL 4GOSA 1A7NL 3FAWA 5C0BD 5ICYA 2MJWA 1F4YH 4C56A 3PL6A 4MQSB 3ZKMD 3X14A 4JFEA 2HRPH 4S0TD 2W59A 5F3BB 3KS0H 3QRGH 3ZE2F 1NAML 4I48B 2RQ8A 2VLRB 5I76A 5CP3H 4LPVA 3D25A 4QHMA 5JORB 1YYMH 1YMME 2HFFA 3O2VL 4KVNH 5GIRA 1YEIL 3I6KB 1F8TH 3QG6A 4QOKB 4IIQA 3N1GC 4QRRA 1FCCA 3MOAH 1QTYT 2X1OA 5D7LA 5EN2A 3MLSH 4FXLA 1J11A 5IOPA 4P2QB 4UV7H 4DEPC 3ZDXF 1HHIB 4ODVL 4P46C 1BVLA 2Z92B 4X6DB 5SWSA 4M6ML 3CVHL 4MVBC 3O3EA 3TBVA 3VRLF 3RIAK 2V7NB 4GRMB 5C0CD 2A38A 4JM2D 3VWKB 1G1YA 1TTUA 4C83B 1DBJH