2YPVH

Crystal structure of the meningococcal vaccine antigen factor h binding protein in complex with a bactericidal antibody
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
218
structure length
215
Chain Sequence
QVQLQESGPELVKPGASVKISCKASGYSFSDYNMSWVKQSNGKSLEWIGIIDPKYGTINYNQKFKGKATLTVDQASSTAYMQLNSLTSEDSAVYYCVRDYYGSSYFDYWGQGTTLTVSSAKTTPPSVYPLAPGCTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIPOPROTEIN
publication title Defining a Protective Epitope on Factor H Binding Protein, a Key Meningococcal Virulence Factor and Vaccine Antigen.
pubmed doi rcsb
source organism Neisseria meningitidis mc58
molecule tags Immune system
total genus 46
structure length 215
sequence length 218
ec nomenclature
pdb deposition date 2012-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ypvH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ypvH02
4YBQD 4NQEB 4GBXB 4IRJB 1VPOL 1JZ4A 4HK0A 4NQSA 3MLYH 4QRPB 1KELL 2V2XB 3EYFA 2V2WA 1CFTA 2A0LC 2Q6WA 3D39D 2XA8L 5HHOA 1PVHA 4G7YH 4MDIB 1DEEA 1OLZA 1GJIA 4HV8B 4GRLD 4M8QB 5C0FB 4Q74A 5KAQG 2VLJE 3GZKA 2X9YA 2GK0B 5DA4A 4ZPTB 2VO5A 2R8SH 1CQKA 1A6PA 2DM3A 5T1LB 4BQCA 4X6BB 4IOFD 2H45A 4PJCB 3OBAA 3P4LA 3PP3H 4KAQL 1C5CL 2FGWH 2ZKHL 1G9MH 4L4VA 3SBWC 1YEGL 4OB5L 1BZ9B 3GK8L 2OCFD 4HAGA 1X4XA 2EC9T 4CN4A 3RWIA 5C0RL 1YY8A 4XNYH 3NH7H 5JHDD 5JPMB 4JVWA 5TH2A 2AK4A 4UTBH 1OF2B 4JFDE 1L0QA 4EBQH 4XP4L 1T7VA 2B20A 2CMRH 1ORSB 5GS0C 1Q0YL 4JGUA 1I3VA 4H1LB 1N8ZB 2DQTL 2YPLE 2Y7QB 5IFJB 3KXFA 2I60H 4R6UA 1A2YA 3TYFB 5IJKA 2P5WA 2XI9A 3NA9L 4YXHH 4OLWH 4MSWB 4YK4C 1CGSL 4ZAKA 3GRWL 1H9VA 2W0PA 3VXRE 1GZQB 1YEEL 3LDBC 3DUUA 3B83A 3UROR 4XGZA 5EBGA 3UBXI 1SBSH 4E0RB 4RDQF 2JB6A 4RGMC 3LRSB 5D7LB 3BQUB 3MJGX 1YQ2A 3UZVB 3KYKL 4O2CB 3JTTB 5C0GB 3VXUA 4LP5A 2VDQH 3DIFB 2PR4L 1IARB 2OLDA 5HGDB 2P42B 4O9HH 2YPKA 2GAZA 1S5IH 3RWDB 4FZEH 4Z7VA 4ETQA 4YDIL 2OI9B 2YEZA 2NY4B 2WW8A 1AGEB 5GIRA 3MLVL 3AU1B 5I8KL 2XTJD 1LO3H 2JELH 4IIQA 5HI4C 3WDHA 1XCTA 4X6CB 1JZ3A 5BMFL 1MCKA 4XCNB 2EYSB 4P3DA 4YE4L 1G7JB 2Q87A 1S8DB 3OXSA 5I1IH 2VISA 1AD9B 1F4HA 4KK9D 4LLUB 5D1XD 3HFMH 3MV7B 3L5WB 4X7SL 4GG6A 4L8SA 4Z0BL 4HZLA 1HXYA 1TJIH 2MFNA 2VL5A 5J3HD 3WIFB 2RCSL 4UOJA 4PFEA 5FUCC 5ABDE 1CZ8L 4YO0B 1IEAB 4YXKH 2R0ZL 2JB5H 5J11C 1T1WA 4YQXH 3IAGC 3CXDH 3DMMA 5J7CC 1Z5LB 1BF2A 3OG6B 3GI9L 3EYQC 3KS0J 1RUQH 2AV1A 4XNZB 4MQXC 2ADGA 2VXVH 4PGBB 4AENB 5HHNB 2VXQH 5JXEC 2AP2A 4JFQA 2J6EA 4XMPH 4XVTH 4BFEA 3MV8E 5CZVH 2AEQH 3QYCA 1U8HB 5E9DD 5EU6A 1MIMH 3RVXC 3NN8A 4LL9A 1FPTL 3W5NA 1VADA 1VEMA 2HFTA 2Z35A 5E6YA 1DUYA 1Z9OA 2QHRH 4OGAC 1JF5A 1GAFL 1IGFL 2OYPA 3WFDL 2FX9H 4PUBL 2CXKA 3SQOH 1MI5D 1FRGL 2A9NH 5D2NE 5H94A 1TZIB 2ADJA 3CIQA 3PE9A 4WV1A 4PTTB 4FP8L 4OKVB 1JGLH 1ACYH 5DWUH 5FM8A 4M9OA 5C08B 1MCFA 3R4DA 3EGSB 3BWAA 5T5NG 1A6TB 2VH5H 2E8ZA 1W72A 3H6JA 1N64L 4UAOC 3S97C 5GRWA 2VXUH 4U1KB 4YGVA 1H3VA 1KJ2H 4NUGL 4OBRA 4LHUB 4RBPH 1EV2E 1D6VH 1CT8B 2EDEA 3MBXL 4WEUD 2F8OA 5I74B 1OAUH 1S7WA 4NQCB 5CSGA 2XN9A 3QFJE 5E5MA 4JCMA 1LO4H 2XWJB 4MNGE 5D6DC 4HX1B 4U6XA 2FLRT 3AY4C 4OQ1A 2ZJSH 5DD6A 3VFNB 4U1GB 1D5ZA 4PJIA 3C8KA 1B2WH 4BKLA 2XV6B 2O26U 2Z8RA 5EIQA 4XPTL 3RIAK 3DYOA 2BK8A 4GUPA 5E8DH 3FB8A 4ZNCD 1RVFL 4JFED 3T2NL 5HHXH 4G6KL 5TDPB 1K8DB 2YD8A 4MZ3A 1P69B 4MD4B 4P2QA 5KSUB 1JWMA 2XKUA 4N1CA 2QBWA 5I8CA 5CHNA 5CBEB 5D1QD 3FFCE 3QIUD 5F7WC 3UBXG 3O6LL 1P7KA 5I1GL 2A1WH 3SCMA 2B0SL 4R0LB 1QG3A 1WBYB 5FM5M 5IQ7H 5AZ2H 2BNUB 4JPWH 1KJMB 2RHEA 3WFHB 1G1YA 4HXBH 2NX5E 1QLEH 1DCLA 1OTSC 3ZE0E 4LVHB 1UWEL 3MRKB 5JPNB 1T89A 2QKIB 4ODSH 3CVHB 4P49A 3EYUH 5D2LB 3LQAL 4PB9H 5E6IA 5CBAA 1UQSB 1URLA 1DN0A 5F1IB 4DVBA 5FECA 1VEPA 1LMKA 4U2YA 1F4XH 1LO5A 1NBVH 3OF6A 3RVTC 3AROA 1P4LA 5IFAH 1AO7E 1NGZB 1J5OL 1KENH 3QQ9C 1VA9A 5F7EL 3EBAA 4Z7UF 2ITCA 4NCDA 3HC4L 3OKEB 3W81A 3WHE1 3V8OA 1UKQA 4MA1C 2D9QB 4AT6B 5ICYB 3HG1E 1DTUA 2DRUA 3FO2B 1KN2H 3WHXA 1ZT4A 3PL6C 2R15A 3VFGL 1NBZA 3MA9L 4BUGA 5ID1B 4GW5A 1GCFA 4NKDA 4WWKA 1K8IA 5HI5C 2Q7YB 5HHVH 4OCWH 1QSEE 2IH1A 3RL1B 4LFHG 4C56B 3JUYA 5HY9B 5DQDH 4MQTB 4XXDB 5FYKU 3CK0H 3QUZA 5ALCH 2IADA 1MWAL 1YNKH 1F6AA 1M1SA 4RSVA 4HQQH 5IEHA 1OGAD 4P4KA 5FYLH 1Q94B 3OZ9H 5GRUL 5DK3A 3J7HA 3LKPB 1T03H 3G6DL 1EMTL 2C7UB 5IB1B 3O2VL 1NDGA 1WZLA 4MNQB 3BP4A 5K59F 4KVNH 1RUML 3RWEB 1JK8B 5MENE 4Z5RB 1T66C 3VXQA 2Y6SD 3QXUA 1N6UA 5IMLB 1UM4L 4IRSD 4OLYL 4UV4L 3DX7B 4WU7B 3GSNB 3WL9A 4JJ5B 1MCOL 1GZPA 1LEGB 1OB1B 4KY1H 2Q86B 4ODWB 4ZDHB 3FOMA 3GSXA 1O5DT 2FWOB 6FABH 3FN0L 2XQBH 1JVKA 3VFMA 3WEXA 2VMFA 4ONGL 1QQDB 3G5YA 2BSSA 3RPKA 3BD3A 3OTTA 1T1XA 3TWCL 1HINH 4JFFB 1IC1A 4EDXB 3F6LA 3DWTA 3DX8A 2HJKA 2IANE 3MRNA 4LEOA 3PQYA 2QSQA 3QDHA 5C07D 1PJ9A 4OGZA 4HJJL 5FCUH 5DJZA 2UZXB 1A14L 3ILPA 4FTVA 5IUSA 2VAAB 1FG2A 1ZT1A 3N0PB 3B9KD 4CMHB 3X14B 5KVFL 2JK5B 3D3VE 1CF8L 4C57C 4W70A 1MF2H 1A1MA 4JHWL 3MJ8A 5E94B 1FL6A 2WUCL 4PLJD 1WCQA 2BSTB 4HIIA 4D94A 3L5XL 5EBWB 2P48B 4QOKE 3K0WA 1R3JA 2E9BA 3H7BB 3WXVH 1YMHB 4P23A 4UDTB 3U82B 1ZT7A 3P73A 3HLAA 4YUEL 1RIVH 2HP4A 3RVUC 3SE8H 1KJVA 3ZYJA 5H8DA 2LAGB 1QFWH 4U33A 4DTGL 4DW2H 1HOCA 4HUXB 2EDKA 4H26A 1IGMH 3CH8A 3FT3A 3EO1A 4CADA 3L3GB 1OD7A 3HZYA 3RDTA 2ZPKH 3VXSB 4YAQB 1QVOA 4PRPE 1EUTA 3DBXA 2XZQL 4HK0B 4NQSB 3KPRD 1XT5A 4KTYA 1T7ZA 4XAKD 3EYFB 3ARDC 2V2WB 3MODL 4G8GA 4FFYH 5I19L 1CFTB 4LSDA 2I5YL 4JE4B 4LQ1A 4XCCH 2Q6WB 1J1PL 3HR6A 3FL7A 5HHOB 1DEEB 4L29A 1DBJL 2DQIH 3T2PA 4F8TA 3ZT6A 3HNVH 4OI7A 4RX4A 1K6QH 3BPOC 3FO9A 1C1EL 3IU3A 4PRHE 3EHBC 5BW7C 5DD3H 1VGKA 4GRLA 3SDYL 5J8OA 2AI0L 4RISL 3LZFH 2GTWA 4DAGL 3LHPH 2W9DH 4L4VB 4XB7A 2JIXD 4M7LT 2ITDA 3WCYA 3SKJL 1R6VA 2YOCA 1DSFH 2J4WH 3RWIB 3NCJH 1YY8B 1OTUD 2PKDA 2X4SA 2E7LA 1T7XA 3GRWA 2E5EA 3I9GL 4KUZH 4BH8A 5TH2B 3SJVE 1U8LA 2AK4B 3MV11 5CEZE 1RULH 2QADC 4FFVD 4POYA 2VDPH 2VDNL 3SDXA 3I02A 3VMNA 4RGNE 1ND0A 1A1OA 3KXFB 4PJBF 2YSSA 1A2YB 1J0ZA 3VFUA 3JV6A 5EZOL 2P5WB 2HRPH 4K7FA 5JHDA 4IDJH 2NNAA 2EE9A 4ZTPL 1RZ7H 4ZAKB 4QRTA 3QIWC 4G6MH 4JZOA 2F5BL 4C59B 1IFHL 3DUUB 3GMQA 4OF3A 2DM7A 4XGZB 3RWHA 1NDMA 2JB6B 1KC5H 4R9HA 5DD0H 1CDBA 3T0DA 2P8LA 3VXUB 1CG9A 5CFHA 5DT1L 2DQGH 4JRXB 2JJTA 2YPKB 2GAZB 3OWEA 3CCHA 1AC0A 4JRYD 5EU4B 1ULVA 4KI5C 4Z7VB 3T3MF 4ETQB 1YEIL 2C3WA 4QGTA 2YEZB 1I1FA 3STZA 5HHPA 3EO9H 1MIEH 5GIRB 1MHHA 4QXGH 3FZUC 3TPKA 4IIQB 5FK9A 4QWWD 1XCTB 4UIKH 1I85A 3FB6A 4ONFL 5TJWK 5HI3C 1DL7H 3LH2H 3P77A 3B3IB 3TN0D 4KGJA 1PFCA 3A67L 4HG4J 1BGXH 2V9RA 4P3DB 5ADPH 1QR4A 3OXSB 2VISB 3ARED 2R9HC 3B4NA 1NEZA 2FSEA 4LPCA 3U2SA 4U49A 1IT9L 4GG6B 4L8SB 4GXUM 2CKNA 1BM3H 1HXYB 1UC6A 4HZLB 3GMRA 2VL5B 5DVKA 3T8XA 3OPZL 4O58H 4EDWH 2J8OA 1T1WB 3DMMB 5DC4B 35C8L 1FORL 3HHRB 5D1XA 4OFYD 5CZKA 3I3DA 2ZUWA 3WLWD 4R8WL 5DEGA 2AV1B 2R29L 2ADGB 1QBLH 1XAUA 4Y16C 4JFQB 5CUSL 2MHAA 4NCC2 1JNHA 2UZYB 5EU6B 3NN8B 3IAQA 5DRXA 1SMOA 1HI6A 1VADB 1MAML 4JO1L 4HJ0C 3WUWG 3O6ML 4D9LH 4DN4H 1SQ2N 4CL7A 4HPOL 2Z35B 5T3XH 3R8BB 1DUYB 4WHYH 1TLKA 1EO8L 3MACH 3UMTA 2VSDA 1XF4A 1HN1A 5E9DA 5DLML 5H94B 3UTPD 4M1DH 2ADJB 4OF7A 4WV1B 4PJDF 1GHFH 1FE8H 2B4CL 3NACH 1PYWA 2VZTA 5JOFB 3BWAB 4MJIE 1W72B 3BX7C 3IJSA 1ZLVK 1J11A 4O2EA 1F90H 3QEQD 4YGVB 3ZKQD 5KSBA 1Q38A 3QDJE 4NSKA 4WFHE 1T2QH 2XN9B 5E5MB 4KKNA 4Y2DD 1CLOL 3TJHD 2CRIA 4U6XB 1LO0L 9CGTA 1KT2A 2DJUA 4WI8A 5DD6B 2G60L 1MLCA 1D5ZB 4PJIB 5CJ8A 3ZZ1A 3KNBA 4M5YL 3QDMA 3IFLH 3C8KB 4F57H 4BKLB 3PDOA 5AG9A 3VW3H 2ZG1A 2LTQB 2AXFA 2BOCA 3IXTA 4GUPB 4KC3B 5HYSA 1FGVH 2G5BA 3VE0A 4PJ9C 3FB8B 4MVBD 5I1KL 5CP3H 4HWEH 4GMTL 4P2QB 1JWMB 2OJZL 4EN3D 5I8CB 3X3FL 5CHNB 5KANG 2QSCL 5CMAA 2ZG2A 1T1ZA 2CRYA 4FQ2L 1U9KA 1HWHB 3QO0A 8FABA 3SCMB 4G7VH 4Z7WA 1MPAH 4JN2A 3WO3B 4BZ2H 2ZSWA 1I3RA 4NKIL 5K93A 2FX7L 5D1QA 3UO1H 4BZYA 3QIUA 2QQNL 2D31A 1P4IL 5E6IB 5CBAB 4YHYB 1DN0B 3F5WA 4G6FD 4N90D 4DVBB 5FECB 1JI1A 1OAXL 1SM3H 1LO5B 2HLFC 5CJBA 4MA8L 4PY8I 1YEJH 4XMKH 1T04A 1KULA 5DD5L 1J8HD 1DP0A 1P4LB 4WFGE 5H2BA 5J13B 1AD0A 1CR9L 5KVDH 1UH2A 1D5MA 3U30C 2ADFL 4NYLA 4XTRC 1BOGA 4LSUH 2ITCB 3DLQR 2WBKA 3HNTH 3P40A 4U31A 5EUOE 2D7MA 3FQXA 5EZLA 32C2A 1MWAA 1ZANH 1GOHA 2PO6D 2AW2A 3BKML 4OUUA 4XBEL 4IRJC 2O5ZH 1CI5A 1QBBA 1ZT4B 3SE4A 2IFFH 4M7KL 1UXWA 4N8CL 2EKJA 1NBZB 3LPGA 4GW5B 1CFBA 4NKDB 1K8IB 1CXHA 2MQCA 3QRFM 1FZOA 4L4TD 2IH1B 5AUMA 3UJIL 4HH9A 1N2RA 2BVEA 5F9OH 1LVEA 1ZVSA 4M03A 3VWJC 1DR9A 3TZVA 3GSOA 3QUZB 5AAWA 2IADB 4LCWD 1F6AB 2VLJD 1SHMA 1T0MA 4HKBA 4LSRL 5FYKH 5IEHB 3FO0H 1GGIH 4P4KB 4W4OC 2X1QA 3BZEA 3ARQA 3OAZK 1OQXA 1GPOH 5LG1A 1BPVA 4KKLC 3QNZA 3RY6C 3FQWA 3OQ3B 4S1QH 1NDGB 3BP4B 2Q3ZA 4Y7MA 1OGAA 3LKRA 3VXQB 4NOBA 1LE5B 4X7TA 3RQ3A 5DRWA 3C08L 3WL9B 4NP4H 2XY1A 1GZPB 1WZ1L 4UB0H 4JFDD 1FQ9C 5KW9H 3FOMB 3GSXB 2UUDH 2CR6A 3MRFA 5AYUH 3VFMB 3WEXB 2YPLD 3VU2A 2QL1A 3G5YB 3VD9A 4IRSA 4JPVH 5E99H 4F9LA 1A47A 1T1XB 5IB2A 3MUGA 4XZUA 3DX8B 2HJKB 4LEOB 3IJHA 3N9GL 3PQYB 3V0VA 2YUVA 3U1SL 5E2TL 2AJZA 3PWLA 4JY5H 3BD4A 3VXRD 4N8VA 5MEPA 2AJUL 3ME0A 3MRJA 3KAAA 3A6CL 2PW2B 5DJZB 4OQTL 1JRHH 3TNMA 3ILPB 4FTVB 1FG2B 1ZT1B 3THMH 5C0EB 4H1LH 3DO7A 2ICWA 4HIEA 5K33A 1UVQA 4GQPH 4I3SL 2OI9C 3R0MA 3VA6A 2ZNWA 5BO1H 4QRRD 2XWTA 4DGVH 3RZWA 1EHLL 3MFFA 1U92A 1A1MB 2F5AL 3MJ8B 1FL6B 4HIXL 4AEIL 3FMGH 3O4OB 2XZCH 3TV3L 1CCZA 5IROA 4XI5D 1BVZA 1R3JB 2OM5A 2DMKA 5EN2A 4P23B 1ZT7B 3P73B 1PG7X 3H42H 3HLAB 4PLOB 4R90H 2DLTA 4JZJA 1KJVB 1RMFH 3GIZL 3TIDA 4H26B 1YEFH 1IBGL 3FT3B 4CADB 4M1GL 4BQ9A 3HZYB 3RDTB 1QVOB 3VFWA 3JSSA 4XNZC 3DBXB 3CVIH 4YHMH 1L9MA 4XVSL 2VWEC 4G8GB 4P46A 3ULVE 5IFHH 4XRCA 3MOAL 4L29B 5D4QA 4NRYA 3MV8D 3G04A 4JLRA 5BCAA 3FO9B 4FNLH 4Z6AT 2WQ8A 4YDLB 2VXSH 3BT2L 3O11A 3KPRA 3IU3B 2YRPA 2CLZA 3Q5OA 5D1ZD 1T83C 5KVEH 4I77L 2QSTA 3JVGC 3T2OA 3HTLX 1VGKB 3JTSA 4GRLB 4KMTH 3RWGA 2GTWB 1PD6A 3LMJH 5E08H 4X8JA 2ITDB 4O5LH 3O6FC 5TFSL 4ALAL 1J0YA 1X5XA 1AHWA 1X44A 2X4SB 4BH8B 4L5FL 3K2UH 3FN9A 5IHZA 3NZ8A 1U8LB 5TPWL 3MPCA 5IGXL 5ETUA 1BFOA 2JIXA 4U1GC 3I02B 3SDXB 3QFJD 1ND0B 3N50A 1BAFH 1JHKL 1A1OB 3MTRA 4QYOA 3C6SA 2ZUTA 2YSSB 3BMWA 4NKOA 3SDCD 3VFUB 3JV6B 1MFAL 4ZUUA 4K7FB 4TOYL 5JHDB 2XA3A 1CXEA 4FQCH 2NNAB 1OLLA 2XG4A 2A83A 4QRTB 4PJ8D 3FFDA 4JZOB 4W6YB 3IDUA 3GMQB 3S98A 4UNVA 3ARFB 3RWHB 4CU7A 1NDMB 5BZWB 2VUOA 4JVPA 4IJ3B 3MROA 1MNUH 2P8LB 3MUZ1 4R0LC 4OLZH 1CG9B 4AIOA 2LE9A 7CGTA 4ZS6C 4PD4J 5M95B 4YFLF 4GKNA 3BAEH 1G9NC 3LN5A 3CCHB 1XF3B 2D0HA 3DRTA 1QRKA 4LVHC 4DGIL 5C7XL 3STZB 5HHPB 4MQ7A 1IC7L 2NX5D 3WIIH 1NGPH 5LKNA 1MHHB 5I18L 4KTEH 2UZIL 5FHBL 5TDNB 1FIGL 3NPZB 5FK9B 4GH7B 5C0CD 3FB6B 4J8RA 4JRYA 2EXWD 3P77B 3HNSL 5DQJA 4OCYL 2FIRT 5E03A 3BPLB 1BBDL 4R2GD 1MVUA 4UV7L 2EH8L 4WVRA 2IQ9H 1NEZB 2FSEB 4WEBL 2XTJB 3U2SB 1I1CA 1AO7D 4JG1L 3GMRB 3WNOA 3T8XB 4CDGC 5C92A 1M05A 4PJ7A 3TN0A 3M1BA 5DJYA 3D2UA 4NJAL 2CO6B 5D7KD 3AREA 2EIZA 1A7QL 1ZEAL 1KTRL 3CVHH 4X7EC 4YHIA 5D1XB 3HG1D 1IKNA 5DEGB 4DK6A 1A3QA 5JW3L 4QHMA 2H1PH 1WISA 2MHAB 1JNHB 5C09E 3V4PH 4GRWE 5KAQF 1YEDA 5DRXB 2BJMH 1HI6B 5I1CH 1I9IL 2HMID 1OSPH 5F7KC 1UZ8A 1KCKA 5CZXC 1LE9A 3M07A 4HS6A 4MYWB 2IG2L 2R0KL 4LNRA 1XF4B 1JPTH 3MJ7A 1U36A 3OJDA 5E9DB 2BVUA 3TESA 4JO3L 3GSWA 1NANI 1PYWB 3I84A 2M1KA 3IJSB 1JTTA 2GIYA 4AMKH 4PJ5E 4O2EB 3G08A 5BVPL 1MCRA 4MCZA 5KSBB 4N0YL 4B50A 2HH0L 4NSKB 4UTAH 4OZFA 1ZLUH 3SDDC 3WMSA 1OT1A 1I9JL 1MLCB 2X4UA 3HI6L 4ELME 3KNBB 5SWSA 5I30H 3QDMB 4BQ8A 2HFEA 1R5IA 3PDOB 4XP5L 4JQVC 2AXFB 3IXTB 4M62L 5C0ND 2XYCA 5HYSB 2G5BB 4KJYA 1A7NL 4HCRA 3U0PA 2CRMA 4K3JL 4PRDA 3LN4A 4OCLC 5IBTH 4OM1L 3LEYL 5CMAB 1CGYA 3KR3L 2IAND 1T1ZB 2H3NA 3MJ6A 3QO0B 4YDVA 3BKCL 8FABB 5LGHL 1REIA 3GSNH 4Z7WB 2W1NA 2XWBA 3MLZH 4CMHC 2ZSWB 2NY7H 5GS0L 1I3RB 4EN3A 1Z3GL 3BISA 1U41A 5D1QB 4RA0C 3QIUB 4KZEH 5FDYA 3D3VD 2D31B 3FT4A 4J4PD 4JFZH 1FGNH 2RIKA 2F53E 4D2NA 5EOQL 5DVOA 1AGDA 2GEEA 2HVKA 1VCAA 3U9PL 3MGOA 5TE7H 1RIHH 1TXKA 3U79A 2JCCA 3EOBA 1T04B 2A73A 3NZHH 1D9KC 4FFWC 4MB4A 5H2BB 1AD0B 2B5IB 5EUOF 1D5MB 4QOKD 4NYLB 5FHAH 1BOGB 3WNLA 3K81A 2ID5A 1YYMH 4J23A 3SE9L 1TETH 1H3PL 3FQXB 1TCRA 4OSUH 1HDMA 4L9LA 1NGYA 1N0XL 5FO8A 1MWAB 2DIAA 4OJFL 1J8HA 1G6RB 1FG9C 4NRZA 5HD8C 3S36X 4OUUB 1MRFL 4WTXA 4IBLT 5FA4A 3MX0A 4K3EH 1WQVT 3L5HA 1UXWB 5MEOA 4PRPD 2VKWA 1G7QA 4HEPG 1UACH 4UT7L 5I8EA 1FZOB 1Q9LA 1EHNA 5AUMB 2WM0A 4HH9B 1N2RB 1PG7L 1ZVSB 5HBBA 1EJ6A 4P5KA 3MXWH 3TZVB 3N1MC 1HYSC 3GSOB 4BZ1L 3ZTJG 2NY0D 1CDGA 3ILQC 3HB3D 4HS8H 5GS2H 1OP5K 1T0MB 3LQZA 3A6BL 4HKBB 1XGYL 3EOTL 2NY5L 3BP5A 2OX5A 5EU3A 3MCLH 3BZEB 4L4TA 2BSED 4PRHD 1S3KL 2XPGA 5T5NF 5CIPA 1OAZH 3RTQD 3QNZB 4CVUA 4NM4L 4XNXH 3FQWB 2FCBA 2KL6A 3V7AG 3DSFH 4LCWA 2VLJA 5B38A 4X5WA 3QA3A 1OGAB 4GO6B 3LKRB 1MHEA 2IPUK 1UKSA 1JNNH 1AXIB 3GO1H 4X7TB 3KPSE 5F7HA 5DRWB 5I9QB 5E2WL 1HKLH 4J3TA 2C5DC 1CK0L 3RVWC 3MRBA 5CEZD 4M6AA 1I7ZA 2W91A 4BYHA 5IJKC 4Z8FL 4U1NA 3MRFB 4OQTA 4RGND 5D72H 4MXWL 2Z4QA 3TJEL 5EZIL 5D7SL 2YN5A 1UG9A 4IRSB 4YNYA 1C5DA 4ZAKC 2WBJD 4AEHL 2NXZD 5IB2B 3SGDI 3VGEA 4JFDA 4TUOA 4XZUB 2QQQA 1D5IH 3IJHB 3V0VB 3WS3A 2AJZB 3PWLB 4S1RH 5GRZA 2YPLA 1ZSDA 1CDUA 4N8VB 2FECL 3MRJB 3MLWL 4FQ1L 4PJAE 5E2JA 3CC5A 1XIWD 4CU8A 1L7TL 1CU4H 5KSAD 4ZUWA 5JIIA 2AJVH 4PJBA 4M7ZB 2AQ2A 5IB4A 3D5OF 3F58L 2JLLA 3Q6GL 3DO7B 2ICWB 4HIEB 1UVQB 1RU9H 3WFBH 4XCEA 2APWA 2ZUQB 3VXRA 3E3QC 5KN5A 1LEIA 3EJZD 5GZND 2XWTB 3W11D 4HBCL 3I50H 3O41A 4PGCA 3MFFB 4WWID 1KEMH 4IIQC 1U92B 2ZG3A 3WUZA 3RUGE 3U6RA 4JGMA 1VB9A 5DFVD 2B2XH 1IQWH 4IOIA 3GHBH 4NN6B 1QEWA 5SWZE 5C9JA 1J7VR 1NMBH 3DYPA 4QRRA 1GL4B 4EJ1C 1FAKT 4I4WA 5EN2B 1B88A 4L8SC 4LSTL 3ARUA 5FGBA 5F1OB 2WAHA 4JZJB 1DQLH 5CJQL 4G8FA 3TIDB 1FZJA 4WUUE 5HVFB 1SJXA 4M5ZH 3DMMC 5ECJE 1KG0B 5DUPL 4AM0A 5ISZB 3E6HA 3VFWB 1KXVC 3FB7A 5L8KB 5L2KA 3IDMA 5C3TA 2Q3AA 2NXYB 4P46B 4EQ3A 5CKAA 4KKAD 1T7WA 4XRCB 1CVSC 2H32A 5EU7C 3ELAT 3RGVA 1L9NA 1F45A 4NRYB 5JR1L 3G04B 4JLRB 4PJHE 4ZUVA 2DLEA 4NQTA 2DD8L 1DUZB 2P47B 1U8JA 3O11B 1YECH 3KPRB 1ZS8A 4ODHH 4TTGA 2CLZB 3KLHC 1TTFA 1OWRM 5DI8A 5EDXA 4XNUH 3TC9A 2CR3A 1J1XH 1JTOA 1NQBA 2V17H 3JTSB 3RA7H 4K9EC 4WV1C 1LP9E 1UB5A 3KPPB 2RGSA 3RWGB 1MJJA 3EDJA 3F7QA 4WO4D 5E95B 3WHE0 2FJFA 2YD5A 3MV9A 4X8JB 4DVRH 4BA8A 5ICZA 5D1ZA 5F7MC 2LVCA 4QRQA 2WV3A 1AHWB 2BNRE 4MJID 2J6EH 3VXOA 3WSQL 1B9ZA 5FGSA 3PGDA 4HG4K 5IHZB 3NZ8B 1WIOA 1KTLA 3GMNA 5ALBH 1RURH 4JN1H 5ETUB 4LEXH 1BFOB 2JIXB 3FTGA 4M48L 4WFHD 3NMEA 4S0SD 4RGOH 2V5SA 2J1KA 4QYOB 3C6SB 4GXVL 4NKOB 4NWUH 4PJDA 2P5ED 2LTQC 2IPTH 4ZUUB 3UTTE 2XKNA 3MBED 1CXIA 2A83B 1R0AH 1IAIL 2MQ0A 4MAUH 4PY8J 2NZ9D 2H6PA 2DWDA 2QQLH 1W72H 3FFDB 4KHXL 4MNGA 4M6OH 2HKHL 4HEME 4PJXF 3SDCA 4X9GA 4K3DH 2GITA 1BD2E 1QFUH 3SCMC 3MROB 5GZOD 4LSVL 2P8PA 3FB5A 1EEUA 2VJXA 5HGHA 4PJ8A 4GKNB 4YHZL 1EH9A 1RIUL 3LN5B 4R4FH 5KJRL 4NPYA 3DRTB 2EDQA 4PS4L 2R0WH 4MQ7B 1T89C 3NFNA 1S7XA 4RQQA 3V6FA 4XBPA 5E6IC 3D18A 4KJWD 4YHYC 4IRZH 5BRZE 1UB6A 4MB3A 1NEZG 2WUBH 4J8RB 4JRYB 1RI8A 1JE6A 1IAKA 5DQJB 5EO9B 3TT3L 12E8L 1MVUB 2NX5A 1NCAL 1DQDH 3IF1A 4WFGD 4KK5C 4WY7L 3UTQB 2XXMB 5C0CA 1LNUA 3D9AL 1YYLL 4G6JL 4KK6C 1M05B 1K4DA 4PJ7B 4XPBH 3TN0B 3NTCL 3M1BB 3CMOL 5DJYB 3DUHA 2DQUL 3D2UB 4FZ8H 2R39A 2WANA 3AREB 2DDQH 2EIZB 4L4JA 4YHIB 3SPVA 1QKZH 4FQJH 1AO7A 4QHMB 4GRWF 3REWA 4WWKC 4OV5A 1PZ5A 3S5LA 3BUYA 3LQMA 3VD7A 1IGIH 2R2EA 1A9EA 1YEDB 3O0RL 3MC0A 3QUZC 2CGRH 4KWUA 3V0AC 4RMQA 2RBLA 1UZ8B 4O4YH 5TE6L 3VG9B 3KPLA 1LE9B 2HT2D 4HS6B 4ZNEE 1J0HA 4P4KC 1G0YR 4LNRB 3MJ7B 3OJDB 3S36L 1FNAA 4NQDD 4OLVH 3U4EA 3WFCH 2QQKL 3IXAA 4Z77A 5BS0E 3DOSA 3GSWB 1CGVA 3NCEB 4X6DE 2FGZA 3W0WE 4K7PX 1JZ6A 5TGBA 1GGCH 3GJFK 4EI5D 4LASH 1JGEA 1OP3H 4PTUA 5JOEA 3MLTA 3G08B 4GQ9H 4HF5L 4MCZB 4XWOD 2HFGH 5JZ7C 2XOTA 3ZE1E 1IGJA 1FNFA 4M3JA 4OZFB 2EEBA 1BREA 4MAYC 1AFVH 1AR1D 4XVUC 1F4YH 3MLRH 5DJXB 2X4UB 5E2VL 4U6YA 1N6VA 2BNQD 5SWSB 1CL7H 3LVEA 2HFEB 1R5IB 3OAUH 2DWEA 5GS1A 3MLXH 3HE7D 3B6SA 2GJ6B 3U0PB 4EVNB 3CFBA 3DV4A 2DLGA 2VXTL 4YHPA 4PRDB 2J5LC 2W07A 5EC2A 1UXSA 3V5KA 1EXUA 3LN4B 3WFEH 2HJLA 5FGRA 1MAKA 1I7UA 3ZLQC 4UBDD 1QPXA 3GHEL 4YDVB 4GSDH 3T0EC 3P11H 3CNKA 4Z76A 1A5FL 2XWBB 2WWKT 1YPZE 4FABL 3WNNA 3MOQA 4EN3B 5I71B 3BDYH 4OGXH 4WUKH 5L7XL 3BDXA 2FIKA 4MCYA 3FT4B 4MJ6A 2CDGA 4GKOA 1BJ1H 2OTPA 4MA7L 5F70A 1RZFL 2FATH 4HK3J 1L0XA 3O4OC 4JO2L 1YNLH 1AGDB 1CIUA 1S78C 2HVKB 3DVNA 4NBXB 5FV2A 3UYPA 3MGOB 1E0OB 4JY4A 4KJPC 5D8JL 5F88A 3TBTA 4Q9CA 5LCVH 2JCCB 1NMAH 3EOBB 2BCKA 5FYJE 4XPAL 2A73B 4P23C 5L9DH 4J4PA 4E41B 4H88H 5HJ3A 1Q9WA 5CGYD 4FQXC 1AY1L 1AI1L 4JKPL 1CICD 4L9LB 4LOUD 4WFED 1NGYB 1UM6H 2OR8A 4M43L 3RDTC 4HLJA 1J8HB 4NRZB 4I9WD 2CLVA 5FYLE 3S34H 5FA4B 4HWNA 1FDLL 1PKOA 4D3CL 2LABA 3SGKA 5MEOB 1G7QB 1B0WA 1FCCA 3VD5A 3PV7A 5ANMA 5I8EB 2FBJL 2DJSA 1Q9LB 5IQ9A 3INUL 3ULVD 3BYYA 3ARTA 1VPOH 4X9IA 1KELH 1R3KA 5DK2A 4P5KB 3UAJC 5HYQA 4C83B 4KRMB 2J8UE 4LFHD 1R3HA 2XA8H 3HR5A 4U1IA 4H5SA 4YDLC 1ZE3C 4HAFA 2X44D 2D9CA 1CIDA 4PRPA 1ZK9A 3LQZB 2V7NA 3IDIA 4WCYL 1EERB 2ZUYA 3BP5B 5EU3B 4GRLC 3ZHLA 4L4TB 1MJ8L 4UQ2A 4HFUL 2KQNA 1MRDL 2XPGB 1GOGA 1U93A 5CIPB 2ZUUA 4LCWB 2VLJB 4IOFC 1VFOA 1JHLL 2LU4A 3QA3B 1C5CH 1KIUA 2ZKHH 1F2XK 4KAQH 5JNYA 3PF2A 1MHEB 1YEGH 2CXGA 4OB5H 3HCVA 4PRHA 1FFPA 1UCBL 3GK8H 1RZJL 1TQCC 3RY4A 3RTQA 1S9XA 5C0RH 3MRBB 1XGUA 5ACMA 1I7ZB 2BY3A 3QUKA 4U1NB 3HI5L 4XP4H 2Z4QB 4Y1AA 1Q0YH 1HCVA 4YNYB 1C5DB 2DQTH 3VXME 4D9QE 4N8VG 2CRZA 3ALXA 1MFDL 2N7BA 4MGXA 4JFDB 4TUOB 3NA9H 1K85A 4Y19E 3WS3B 4G8EA 1BQHA 4YX2L 3VXPA 1CGSH 1E28A 4IJ3C 2YPLB 4ZPVA 4YHLL 3GRWH 1XF2A 3JBG7 3CC5B 1AE6L 2VQUA 2WBJA 1YEEH 3ZKMD 4ZUWB 5ICXA 4PJBB 2VLKE 2BHUA 2WIMA 5TF0A 2Z93A 3SKNA 1DBBL 3QEHA 2HG5A 3KYKH 3VXRB 3U4BL 5KN5B 2PR4H 1LEIB 3NFSL 1XIWA 3RUGF 1UCTA 3O41B 4PGCB 5KSAA 3C09C 1DQTA 4NHCL 4YDIH 3U6RB 1I9RL 3VGBA 4IOIB 3MLVH 5I8KH 1QEWB 3BPLC 4YHNA 5C9JB 4RCAA 4QRRB 3TBWA 1JZ7A 4XMLL 1F3JA 3RPIA 4I4WB 4ELKA 1ITBB 2XTJC 1YDPA 1Y6NR 3QULA 4OM0L 1U0QA 5BMFH 2W65A 3CDGA 4YE4H 1W0WA 5IK3A 3DXAE 1IAMA 1WITA 4HC1L 4G8FB 4HUWA 4LCUA 1U3HD 1UEMA 1FZJB 1PGRB 4R7NA 4X7SH 1RJYA 4KK9C 4Z0BH 5D1XC 4AM0B 3E6HB 4NO2A 2Q7NA 4YDKL 2RCSH 3FB7B 4RFOL 3VGFA 5L2KB 3V9FA 3PWPD 1X4YA 1WC7A 1CZ8H 5J3HC 4RFNB 4C4KO 4CN6A 4UZGA 2R0ZH 3AS3A 2M8XA 1SMAA 2H32B 2VERN 3I6KA 4I2XE 3RGVB 1B0GA 3GI9H 1EBAA 2BDNL 5C09D 1I8MA 1EA9C 3VMPA 3PL6A 5CLWA 4ZUVB 2CK0L 4JHAL 4PD4K 1QPPA 5B39A 1ZS8B 1OGTA 2MPAL 5DI8B 1LP9F 1FPTH 2Y07L 1FNEA 3PNWA 4L8DA 4TUJA 2Y1VA 1UB5B 3OV6A 4HMEA 1MJJB 3GDBA 5F9WB 1GAFH 1IGFH 2H2PD 3WFDH 2FJFB 5IWLA 4PUBH 1MCCA 4JB9L 3MV9B 1FRGH 5ICZB 2CUIA 5D1ZB 4QRQB 4OCSL 4OZIE 5DHVA 4HD9A 1LWRA 4FP8H 5E8OA 3VXOB 2EEAA 3PGDB 3W2DL 2Z8VC 5D6CA 1P7QD 1N64H 1KTLB 3GMNB 4WO4A 4DKFL 4NQVA 3H3BC 4NUGH 3FTGB 2YD4A 3SE3C 3MBXH 3ZDXE 2EDHA 1BVKA 1OP9A 4MJIA 4PJDB 1I3UA 4XC1L 4K7PL 1NCWL 3DV6A 2XKNB 5DUML 1CE6B 2X4TA 3C5JA 1NLBL 2ARJA 2H6PB 2DWDB 3E0GA 3GIVA 4XPTH 4MNGB 5I0DA 5KG9A 3ZHKA 3LQAC 3SDCB 2P5EA 4PRIE 3H7LA 1RVFH 3T2NH 3IKKA 2GITB 4G6KH 4WJ5A 5JQHC 2P8PB 2YBRA 3D87B 3FB5B 1RUAL 5DMIL 1G1CA 4PJ8B 1CD0A 5HGHB 1A4JA 2NW2A 1F58L 5D1QC 5I1GH 3O6LH 4NPYB 2B0SH 3QIUC 1NC2D 1W0YT 2ZCKL 4OGYL 3NFNB 1S7XB 4RQQB 2DJ4A 2OR7A 4K8RD 1ZTXL 2X9WA 4XBPB 3V6FB 3VFVA 3D18B 3I6LD 1H15A 5I1LB 4P3WA 1UB6B 4K7PY 1JHTB 1T20A 5E4IA 1UWEH 4UIMA 1QFOA 4OF6A 3MNVA 3JXAA 4FG6D 5CCKL 3L1OL 3LQAH 5GJSL 3QIBD 2B5IC 2NX5B 2G9HA 5SWQA 3IF1B 1Z6JT 4QHLA 5ELIA 5C0CB 1LNUB 2EZ0D 1FCGA 1K4DB 1J5OH 1BJMA 5F7EH 3D69A 4F37F 1WFOA 3HC4H 4R2GB 4LVNB 1HEZA 3SE4C 3SPVB 3QXAA 1AO7B 1FP5A 3REWB 4OV5B 4K8RL 1PZ5B 3S5LB 3N1QC 2ZSVA 3BUYB 3MXVL 4GOSA 2PUQT 3GM0A 4F7PB 2IFGA 2R2EB 1A9EB 3VFGH 3TZVC 3MA9H 5DRNA 4GKSA 3KPLB 5DMKA 3T77A 1UH3A 2ARWA 2MQ3A 3GKWL 3UYOD 2NY3D 3CU1A 4R97C 3V6OC 4X6DF 3U4EB 4NFBA 1MWAH 2PF6A 3IXAB 4Z77B 3CSPA 1A6AA 5F71A 5TGBB 1E4XI 4NWTL 1JGEB 5CSZA 4PTUB 5GRUH 3MLTB 3ZE1F 1EHAA 2DL9A 3GJFA 2X1XR 3G6DH 1ZOXA 1HK6A 3TBYA 4NQDA 1IGJB 1EMTH 3CPLA 3O2VH 5I9QC 1UA6L 2VDRL 1RUMH 2FO4A 3BSZL 3KPSD 2OL3L 2EE6A 4U6YB 3ZDZE 1NUGA 1UM4H 4OLYH 2Y6SC 4UV4H 4GAGL 2DWEB 1MCOH 3MUY1 4IRSC 5GS1B 5JMOC 4U0RB 4F9LC 2VZVA 3NFPA 3B6SB 2HRLA 4F7CA 4U1HA 3FN0H 3CFBB 3DV4B 4YHPB 4ONGH 3ZKND 2WWMD 1CQYA 5EC2B 1UXSB 3V5KB 1EXUB 2BNQA 5C6WH 2HJLB 1QSFD 3TWCH 3Q5YA 4JPKL 1I7UB 5L88L 5DS8A 4Y88A 3SO5A 1YPZF 5ACLA 3QIWA 3CU7A 4Z76B 1E6OL 3LDBB 2IPKA 4MJ2A 4HJJH 2Y36L 1CTOA 4Y89A 5DJ0A 4RGMB 1A14H 3MFGB 4U3XA 4M00A 2R2CA 1EDQA 3NIGE 2FIKB 4MCYB 1KCUL 3W9DA 1IGTA 4MJ6B 2CDGB 5KVFH 2ENSA 3U46A 3B9KC 3QDGE 1MQKL 4LSQL 1CF8H 3UBXA 3ARRA 5CKGA 1HWGB 4NN6C 5IROC 3AC0A 3DVNB 4JY4B 3TBTB 5F88B 3VCLA 3WKNA 1H8OA 2BCKB 4JHWH 5J12B 2CUHA 4LCCA 2WUCH 5SWZD 5HJ3B 5JLZA 5BQ7A 4M7LL 4X7CC 1Q9WB 3L5XH 2YPVL 5F1NA 2BFVL 5CILL 1G9NL 3STLB 4Y5VA 1ZLWK 5T3ZL 4YUEH 5JA8B 4ZOBA 4WUUD 2PNDA 2AEIT 4DTGH 1MCQA 1RJCA 3MRDA 1I8LA 1R5WA 4GAYA 2IGFL 5IW6A 2HVJA 2EYTA 3GB7A 4V2CB 5ANMB 4QRPE 3M8OL 5CWSA 3TIEA 5IQ9B 5DK0B 5DYOA 5IOPA 1R5VB 2XZQH 3P4OA 4U7SA 2ESVE 4Z7OF 5DK2B 4HKZA 2QLVB 5I19H 2HT3D 2CKBL 3MODH 5HYQB 2I5YH 1J12A 1J1PH 3HR5B 4U1IB 4H5SB 4UILL 1FVEA 4Y16A 1DBJH 4PRPB 2V7NB 1J0IA 4RNRA 3U4AA 1QA9A 1G7IA 5JHLL 5B38G 4NOFA 1S7VA 3PWUA 4OF5A 1MSPA 4UQ2B 1C1EH 4PJCE 4XBGA 1U93B 5TQ0L 1Q72L 5F6HI 4XXCA 4QGYA 3LOWA 5AZEL 4M02A 1AHWC 3SDYH 2O61B 2AI0H 4L3EA 2DI7A 4RISH 4DAGH 5JNYB 3MR9A 3HCVB 2EDJA 2R1YA 5ILTL 4PRHB 1FFPB 2BNRD 3SKJH 2AXHA 4PIRF 3RTQB 1S9XB 4KKCD 1ROWA 3AB0C 4LRIA 2QR0A 4HHAA 1IILE 1XGUB 3I9GH 2YD9A 3CLFL 2NYYD 4HKJA 1OTUC 3QUKB 3QBTB 3WN5C 4JFYA 2VDNH 4Y1AB 5IMMA 1VFBA 4FFVC 4PRBB 1U8PA 3AMKA 4N9GA 1U8MA 2WP3O 1MREL 3G5ZA 2R56L 5F21B 3SKMA 1XGRA 5EZOH 3FHAA 2BXZA 4Y8DC 4G8EB 1BQHB 3VXPB 4RGNB 4ZTPH 1E28B 1B6UA 1XF2B 4AEFA 2DI9A 2F5BH 2WBJB 4P9HL 4TULL 1IFHH 1KIQA 2VLRD 5D7LE 4LLMA 5ICXB 1BD2D 3DX9A 3CX5J 4KQ4L 1HHGA 2Z93B 2OP4L 2X70A 3SKNB 3QEHB 3G6JE 2HG5B 4ZXBD 1A22B 5ACZA 1NCDL 4FQQA 5DT1H 4YBHA 4BFGA 5INCA 4AG4L 4EIGB 5KSAB 1YEKL 4PJXA 4HC1A 2IMMA 4NZTL 1U8QA 1YEIH 1K3IA 3GSVA 1U8IA 3PXHA 2JKXA 2CIKA 5GXBB 3UTOA 4YHNB 3TBWB 1F3JB 1NGXA 4I0PA 1CXLA 3NCCB 3RPIB 4ELKB 1YDPB 4ONFH 3IDXL 2F19L 3QULB 4QWWC 3VFRA 5GGSY 2D7OA 2W65B 4K71B 4C54A 3A67H 2X4NA 2YXMA 3CDGB 3KYAA 3MV7E 4J2XA 3TN0C 1W0WB 5IK3B 2IEPA 4DWHA 4B7LA 5A3ID 2GI7A 1IT9H 4R7NB 1RJYB 1OVZA 2C3VA 3AREC 4NO2B 2PXYD 3N1PC 3OPZH 3UJJL 1WC7B 2BVTA 1T6VN 2FNBA 2B4CC 2XIDA 4IMKA 2BHYA 4NHUA 1U3HA 1FORH 35C8H 4APQD 3I6KB 4WFFE 3EYSL 1B0GB 1FNLA 4R8WH 5EZJB 1I8MB 1HXMA 2R29H 3AS2A 1ERNA 3EYQD 3PL6B 2DKSA 3WLWC 1YMMD 2IAMD 3PWVA 3BPNC 4MQXD 5CUSH 5JXED 3PWPA 5B39B 3LKOA 1OGTB 2YN3A 3O2WL 1MAMH 4JO1H 3O6MH 1FNEB 3PNWB 4L8DB 4HPOH 4P2OD 4TUJB 4YPJA 3VWJA 5C09A 4KVCL 1EO8H 1EGJL 1I1YA 5BS0D 5DLMH 1VACA 5F1SA 1QYGL 5DHVB 5C08E 3TF7C 5E8OB 2B4CH 4HUKB 1CDJA 1MCHA 5D6CB 4NN5B 3Q5TA 3RY6A 4KRLB 4ZFGL 4WO4B 3QRGL 1MEXL 4JKMA 4NQVB 3O3AA 3ZDXF 3RNQA 5IT2L 4RIRA 2DOCA 3T0BA 1JPGA 5HHMB 4CDHA 4JO4L 4KQ3L 4FRWA 4MJIB 4B0MM 1BEYL 1CLOH 1LO0H 1CE1L 1P7QA 3QAZB 4Y2DC 1TENA 1JN6A 2G60H 3DV6B 3M45A 4KRNA 3TJHC 2BERA 3QISA 2PYEB 2X4TB 3C5JB 4M5YH 1CFVL 2ZOLA 2ARJB 2IBZX 5HDBE 2GTZA 2ZCHL 3GIVB 3RZCD 3KDMA 4ZS7L 5BOPA 5KG9B 1I3GL 2P5EB 4PBWD 1ZLVH 4DKEL 5I1KH 4WJ5B 3TBSA 4GMTH 4QHKI 4QF1A 2W59A 1FC2D 4GRMB 4OZFH 1Z9MA 4MVBC 2YBRB 2OJZH 3X3FH 2R4RL 2DMCA 2QSCH 5GISL 2GKIA 4RWYL 5BJTB 1A4JB 2NW2B 4FQ2H 4EN3C 3P2TA 4LCIL 5I71C 3QPQD 1MCWM 4WHDA 4JDVA 3U7YL 3E6FA 4X9HA 2KUTA 3VFVB 4NKIH 1WUNT 1H15B 2FX7H 4LGRB 1MCWW 1WFUA 2Q8AL 4F2MB 1GC1C 1WWAX 1T20B 5D2LE 3FQRA 3NAAL 3TNNA 2QQNH 4KGLA 1CFNA 4LDLB 4O02L 4TRPL 4UIMB 3MNVB 1P4IH 1WBZA 3AS1A 5TE4L 1NC2A 3PP4L 1BFVL 4G43A 1HH9A 2G9HB 7FABL 1A7OL 5SWQB 5FYJD 4XVJL 1OAXH 5F7DA 4FFZL 4MA8H 1MCPL 2OSLA 5DD5H 2FEEI 3N06B 4L9LC 1CR9H 4XWGL 1KPUA 3VH8G 4OLXL 2ADFH 3D69B 1H5BA 3SGJC 2B1HL 2V2TA 4ZFOL 43C9A 1HEZB 1FL3A 4HUUA 3QXAB 3JV4A 4QT5A 1KB5L 1A0QL 3BJ91 5E00A 5FYLD 1NEUA 4MWFA 5FUOL 1HYRC 3Q2CA 4EI6A 1B0RA 4HZAA 2ZSVB 3BKMH 5LJYH 3OKNA 4XBEH 4NO0D 1JGDA 2PO6C 5FCSH 1FFNA 3BZDA 4M7KH 5L2JA 4N8CH 2APFA 2Z92A 1J8KA 4C56E 5DRNB 4F9PC 2X10A 4GKSB 2D4DA 3T77B 5DMKB 3BN9D 1Q1JL 3UJIH 3TT1L 2NTSP 5FYJL 2BZDA 2EO9A 4KRPD 1E27A 1E4WL 4G42A 2OL3A 1KLGA 1IAOA 4BFIA 4LSRH 3BRDA 3REVA 4MS8D 1T83A 4XP6L 4NN7B 5CSZB 3WUWA 1U2HA 4NC2B 3M17A 3GJFB 3NABL 5JUEL 4MNQE 3TBYB 4NQDB 3CPLB 1P9MC 4X9FA 5EH1A 1ZA6A 2FO4B 3ZDZF 2W9EL 1ORQA 1U95A 3R06A 1BBJA 1FNSL 1MLBA 3IAPA 5C0IA 3C08H 2QADB 1WZ1H 1Z2KA 3L95A 5CIPH 4K9EL 4F7CB 1QBML 4U1HB 3OAZH 1WEJL 1OAKL 5F97E 2R1WA 3KPSA 3VXMD 3FN3A 3RX7A 2BNQB 4JFFE 2WSKA 3SQBA 2VAJA 1ZHKA 1FL5A 3ECBA 4MNHA 4R96A 4Y19D 1V05A 2Y9RT 5DS8B 4PGDA 4X83A 3N9GH 2LU7A 3QIWB 3QZWA 3U1SH 3F65A 5E2TH 4KROD 5FKAA 2IPKB 2BVQA 2DTML 2AJUH 1TZGL 2FEDD 4ZUSA 2IJ0C 5DJ0B 3A6CH 2VLKD 4PGZA 1QSFA 1XR9A 3NIGF 4OQTH 4YZFE 3VD4A 3IVKB 1LEKA 1G0DA 4BSVA 4LHQB 2VOTA 3W9DB 1IGTB 4I3SH 4XCFL 3U46B 1C7SA 3UBXB 4LLWA 3CFKA 1EHLH 2AEWA 3VCLB 5L0QC 2F5AH 2OXHA 5IF0A 4HIXH 3ABZA 4GMSL 4AEIH 4LCCB 2VZ1A 2EDXA 2YR3A 5FGBC 3RBGA 2PTUA 3TV3H 5JLZB 5HVGB 5BQ7B 2BY1A 1D6EA 5F1NB 3SGEH 4XI5C 2CKBA 3RUGA 4Y5VB 4ZO6A 5B3JE 5C3LD 3DXAD 3UYRL 3AVEA 3MRDB 4LLYA 1R5WB 3GIZH 4UI2A 4FQIL 5IW6B 3VXSE 1IBGH 2FBOJ 2HVJB 5I73C 2V9TA 4M1GH 3GB7B 3RGVC 5CWSB 3WJLA 3TIEB 5C0DA 5DYOB 5IOPB 3G5VA 5HHOE 4XVSH 5DMYA 4HKZB 5DR5L 1EAPA 4WUUA 1EZVY 1FVEB 2ZCLL 3IFPA 4Y16B 3MOAH 3SN6N 4ZTOL 5ADOL 3IU4L 4RNRB 5E5UB 4FFYL 4WW1A 5FUZL 1QA9B 1G7IB 2H2SD 4PJCF 4BSJA 3RJQB 1S7VB 3PWUB 3D85D 5F9WC 3BT2H 4XBGB 4I77H 3V6BR 5K9JL 5D7IF 5D1ZC 3EO0A 2YMXL 2GHWB 4L4VE 2BSRA 4L3EB 2YUXA 5EBMA 3MR9B 2H32H 3BKYL 3DTXA 1AGFA 2R1YB 5D2NC 1OHQA 5TFSH 4ALAH 2OBGA 2QR0B 4HHAB 1R24A 2YRLA 1AIFA 5GGSA 4L5FH 1QHOA 4XNMA 3VI4E 5IBLD 4HKJB 5TPWH 3X3GL 4NZJA 3DECA 5IGXH 1BWMA 3HPJA 4JFYB 2W92A 3KXFE 5IMMB 1VFBB 3VGDA 2W0LA 2BNRA 1U8PB 1JHKH 1U8MB 2P5WE 4N9GB 4LSPL 3SDDA 1N7ML 3G5ZB 4Y4HD 2GY5A 3SKMB 1MFAH 1XGRB 4QTIL 4TOYH 1DVFD 3RI5F 4KXZH 3SDCC 4OFVA 4BK5A 2NMSA 4PJGA 1FFOB 3V8CA 3HZKA 5HGBB 3TYGL 1AGCA 4G80A 4PRID 4PJEA 1JPST 3D0LA 5JIKA 5F7UA 1KIQB 4PJ8C 4LLMB 3G6JF 3DX9B 3VXUE 4KK8D 1HHGB 4JRXE 2X70B 5ACZB 4FQQB 5M94B 4R3SB 4XT1C 4Z7VE 4K2UL 5INCB 4JQIL 4D8PA 2VLRA 4RAVA 3E3QE 4PJXB 4U1MA 1AXSA 1U8QB 1T80A 4DGIH 5C7XH 3B43A 3GSVB 2J88L 2FHBA 1CBVL 4GAJL 1V7ML 5HYJE 3KS0H 1IC7H 4ZXBA 3GUTA 2C4FT 2CIKB 5I18H 2UZIH 5FHBH 1FIGH 1NGXB 4I0PB 3O3UN 2FZ3A 3OKOA 3Q48A 3VFRB 5HPMA 3HNSH 3NBNA 4OCYH 5HI3D 1A3LL 1MHPL 2X4NB 3CXHJ 4D9RE 5I66A 1KTDA 1BBDH 2EXWC 4GG6E 4UV7H 2EH8H 4PGEA 1D9KA 3AM8A 4WEBH 4R2GC 4OTXL 4LVNC 1FIEA 3TCLA 2FJGA 2C3VB 3S6CA 4JG1H 5CP7A 3U30B 2E6PA 4U2ZA 3U0TA 5H37G 5FO7A 4OZHF 1LGVA 2Y5TA 1RAMA 3PDGA 4FQHA 4NJAH 2IBZY 5B39G 1EGJA 4NHUB 3LS4L 3MRIA 1U3HB 1A7QH 1ZEAH 5A1AA 3V7MA 1HSBA 1WIUA 5CGTA 4YC2B 5JW3H 1HXMB 3G9AB 5EU6E 4JKKA 3U9UA 2PXYA 4QXTB 3PWVB 1WTGT 3B9AA 5AD0A 4F58L 3PWPB 3D1MC 3LKOB 1OARL 5B4MD 2PYFA 1I1RA 2OQJA 2EH7L 1I9IH 1ZGLP 4APQA 3TO4D 5GHWL 1XF1A 3VWJB 2HMIC 3DROA 5MHSE 15C8L 5EIVA 5C09B 3GJEA 2VLMD 1YMMA 2IAMA 2IG2H 1UGNA 2R0KH 1I1YB 4HS3A 2ARJQ 5JW4Q 5MI0B 5CD5D 1VACB 1WAAE 1VEOA 4Q6IA 4XP9L 5C6TL 4JO3H 4NIKB 3FCTA 1UWXK 4P2OA 4GLRH 2D0GA 5DHYA 5HHQA 2L0DA 3MRLA 3BE1L 4TUKL 4PR5A 5IB5A 3O3AB 3RNQB 5BVPH 3O3DA 4RIRB 5IVXB 5BS0A 2C4FU 4N0YH 2XN9E 3EIFA 2HH0H 3Q1SL 1JPGB 5GS1C 5HYFA 4U0RC 1OSZA 1P7QB 2B7DT 4XC3L 4YGAB 4ODXA 1JN6B 1I9JH 4P5TD 5HDBF 3HI6H 5E6ZA 4TVSa 2KKQA 2VE6A 5IV2A 2ZOLB 3RIFK 3LS5L 3I6GA 4XP5H 4ZD3L 2GTZB 3RWFA 3KDMB 4M62H 3U83A 4HXAL 4P2QE 1A7NH 4DQOL 2ERJC 5C0NC 4K3JH 2AJYL 4PLKD 3TBSB 3C2AL 4QF1B 1XR8A 3OX8A 4GAFB 3LEYH 4OM1H 1Y18A 3DETD 1FSKC 3OAYH 1AP2A 3KR3H 4ZOCA 3F7VA 1QRNB 5SX4I 4ONOA 3BKCH 5LGHH 1KV3A 4YFEA 4Z7QF 4MXQD 1GYAA 2M26A 3ZYOA 3E6FB 4UQ3A 5F9AC 1RUKL 3DO3A 1H3UA 3T4YA 3LKSA 5GS0H 5I1EL 3U36A 1Z3GH 1DQJA 3FQRB 3TNNB 1T5WA 5DTFA 4ZFOA 1CFNB 3QDGD 3O4LE 2MOVA 1YPZA 5J12C 4XH2A 1KB5A 4LKXA 4G43B 4J4PC 1FYTE 1HH9B 1QACA 1MFCL 4N5ED 1DDHA 1TPXC 5EOQH 2NZIA 3U9PH 2OMBA 4DOHB 5F7DB 2OSLB 1X9QA 1RZKL 3KLAA 3KYMB 4HDIA 1KPUB 3N85L 4DZBA 5F6HJ 1HQ4A 3CFCL 3L3DA 3BH8B 2EC9U 1S9VA 1H5BB 3SE9H 2V2TB 2NY5C 1H3PH 43C9B 3T1WA 3EYOA 1FL3B 4HUUB 3S4SG 3JV4B 3SGKC 1K9TA 2NR6C 3BPCA 4QT5B 5E00B 1N0XH 4MWFB 1NPUA 3RWCA 3K4AA 4EI6B 1B0RB 2X40A 4OJFH 4HH8A 1CGUA 4K3HA 3MRMA 1MRFH 3OKNB 1JGDB 4GBXD 3NCFB 5C9KA 5L2JB 2Z92B 5GGVL 3L3HA 4UT7H 2ESVD 3DGGA 3QCTL 1PG7H 4WHCA 5E56A 3KG5A 4NO0A 4P3CL 4RMSA 4BZ1H 4G42B 2OL3B 1KLGB 4JEGB 1IAOB 4BFIB 5CEXA 3A6BH 4HUVA 1XGYH 3EOTH 2NY5H 3HB3C 4XPHL 1FHGA 3WUWB 1BWWA 1S3KH 2CIIB 3M17B 1Z9LA 2NY3B 2D7PA 2I26N 4MX7A 4V1DA 4NM4H 3HC3L 4S1SL 3RTQC 5J6HA 2K7PA 1FAIL 1AGBB 1ZA6B 3O6FB 1FC1A 1ORQB 1LILA 1U95B 2GSIA 5DO2D 3R06B 1BBJB 5GGVY 5LGKA 4N0UA 3EZJB 1MLBB 5HDLA 5C0IB 1WWBX 5EU5A 1NL0L 5E2WH 1OP5H 3ARGD 4ODBD 1CK0H 5B8CA 3LB6C 5BV7L 3BHBA 5KSVA 3L95B 4D0BB 3UTZA 2CH8A 4OUOA 4Z8FH 4OLEA 3NPSB 2VITA 2DKUA 2R1WB 3KPSB 4MXWH 3TJEH 5EZIH 4JY6A 4MHHI 5D7SH 4BQ6A 4RGNC 5MP6L 4R4ND 4AEHH 1ZHKB 1FL5B 3ECBB 4MNHB 3PQYE 5HDQL 2WBJC 4CVWA 1PEWA 2NXZC 1BFTA 3AGVA 1U8KA 4J3UA 5MERB 1JZ2A 1DLFL 1NSNL 4H0GA 4P0DA 5FKAB 3VXMA 1ZA3A 2BVQB 3B9VA 4YZFF 5D7LD 3BQUD 3MLWH 4FQ1H 4ZUSB 3W9EA 3OJMB 1L7TH 3NCMA 3QHZL 1QSFB 1XR9B 3HMWL 1LEKB 4Y19A 4BUHA 1XIWC 4BSVB 5KZCD 2AXJA 3AMLA 1ZWIA 3F58H 3Q6GH 5KSAC 3WD5L 5CINL 5EB9A 2NY4D 4LLWB 5E8EA 1J0JA 4HBCH 3CFKB 1QOKA 3U7WL 3U0WL 4OIAA 4H8WL 5GZNC 3W11C 5IF0B 4YHKH 1X7QA 4K71C 5KS9A 2N1KA 1D6EB 3WE6A 5DFVC 1GRWA 5B3JF 2I24N 1A3RL 2CKBB 1MCBA 4LSTH 1OOAA 3MV7D 1LK3L 3JWDL 1S7QA 5IW3A 2C1PA 1DBKL 3F12A 4WNQA 5CJQH 1G9EA 4OD3L 5EBLA 3O6KL 1YC7A 1G0XA 1YN6A 4X8XA 3KLSA 3CSYA 5DUPH 1F42A 5C0DB 1F97A 4HSQA 3G5VB 1EAPB 1TZHB 3RGHA 4JM2F 4XPFL 4ERSL 4MLIA 5EIIA 2X9XA 1F6FB 3CX5K 3IFPB 1NGWA 5I1HL 4KKAC 3S9DB 5GJTL 4WW1B 3FT2A 5JR1H 4N1EA 2O5XL 1ZHBA 2B1AL 1YZZA 2DD8H 4K23L 2AS5M 1XGPA 3K74B 5IWLC 4M8VA 4CW1A 2EE3A 3EO0B 3ESVF 1D5BA 4QHKJ 5E7BA 2BSRB 4Z95L 4AIXA 5EBMB 3DTXB 4NN5C 1AGFB 5C08D 3TFKD 3D85A 4NFCA 4WO4C 5JDSA 1WBXA 5C6PB 1QO3A 1JYVA 1R24B 4LHUD 3WSQH 4TTDD 1AIFB 5GGSB 5A2LH 4XNMB 1TVHA 3SDXE 4OCMC 3EFDL 4LPTA 3HPJB 4NGHL 3QAZC 4M48H 1OAYL 4MAYA 2BNRB 4CBPA 2EKSA 4Q9QL 2X1WL 3BZFA 4CU6A 2MMXA 4GXVH 3SDDB 1A1NA 3CZJA 3C5SA 1Y0LA 5C0AA 5DHVH 1HKFA 4PJGB 4HUMB 5E8PA 2VDML 3HZKB 4MHHG 3VDCA 4MZ2A 1IAIH 3A6OA 1CD8A 3MBEC 1AGCB 2HLAB 4KHXH 4ODUA 4PJEB 3D0LB 5CD3A 5KTEL 2HKHH 2BXYA 3MRRA 4Y4HA 3RL2B 3DJ9A 2X4RA 5EPMA 2NCMA 3HRPA 4Z7VF 4LSVH 2CSPA 3U7AA 1J1OL 5GZOC 4YHZH 3T0EA 5DC9B 5DQ9A 1Q0XL 1RIUH 4D8PB 5KJRH 1X5ZA 2VLRB 1K2DA 1KIRA 1VGEL 4RAVB 4U1MB 4ACPA 1AXSB 4Z78A 4PS4H 1KNOA 4QRSA 5GSVA 2RAMA 1C16A 4M6ML 4ZXBB 3GUTB 2NLJA 4MD0A 4S1DD 4B53A 4J3WA 2FZ3B 3N1FC 3OKOB 2VR5A 1A6ZA 3FQNA 4GG6F 5FIEA 2QTEA 5DVNA 3TT3H 12E8H 1KTDB 1FLTX 1BMGA 4JG0L 4GG8A 3ULUE 4NZRL 1NCAH 3H3PL 1D9KB 1WT5A 4HPYL 4PGEB 3RNKA 4ZSOA 3TCLB 4NO3A 2FJGB 2UV3A 4WY7H 5CP7B 1BF8A 3D9AH 3U0TB 1YYLH 5FO7B 4G6JH 2X05A 2CD0A 4FQXA 4JCLA 4U3HA 3NTCH 1RV6X 2Y5TB 4PRNA 3CMOH 3NOIA 4D0DA 4FQHB 2DQUH 1J87A 2F58L 3MRIB 1T22B 3SEPA 1HSBB 1H3GA 2DQJL 2R2BA 2FO1A 2R69L 5D5ME 3MUJA 2GUOA 4M7JL 1L6XA 3U9UB 1JYXA 2PXYB 4JM4L 1YEHL 5AAMA 3ARPA 5AD0B 3BD5A 3S7GA 2AV7A 2PYFB 4C56D 2OQJB 4XAWL 3O0RH 3PXJA 1JIBA 4APQB 3K46A 4TPRL 5TE6H 4MJ4A 3DROB 2A9ML 3KPOA 3GJEB 1WAAF 1YMMB 2IAMB 4HS3B 4NN7C 2HT2C 3D39A 3QFDA 4N0RA 3S36H 4Q6IB 2QQKH 3FOLA 3KYOA 4P2OB 1MAJA 4M61A 5DHYB 4EOWL 4R7DA 5HHQB 3MNWA 5KSBE 3MRLB 2VC2L 1XF5A 3MRPA 4MNQD 1Q9OA 5IB5B 4WU5A 2H41A 1QUNA 1C5BL 4HF5H 4EI5C 3O3DB 5I16A 2GFBA 5BS0B 3FKUS 2ADIA 1ZVYA 4XWOC 4CVXA 2UY7A 2F9BT 1OSZB 2BRQA 3QDME 3O81A 2E6QA 1ZHLA 4ODXB 1AR1C 5E2VH 2VE6B 5IV2B 3LEVL 2V5TA 5C2BL 3RWFB 1IKFL 3ULSA 3UP1A 1KCLA 3GJFH 1MH5A 3VD3A 4HT1L 2DQCL 3LN9A 2VXTH 3VWKD 3TGXA 1XR8B 4P5TA 4P2RE 1NCCL 3OX8B 2AEPL 1Y18B 3O9WD 4AJ0A 1AP2B 2A6DA 1T2JA 1IC4L 5F9JA 3F7VB 4WTZG 3GHEH 4UBDC 1XGQA 1A5FH 2CUMA 3Q0HA 4UQ3B 2EDNA 3T4YB 3LKSB 1JNJA 25C8L 4FABH 3U36B 3S88L 1DQJB 2DQFA 4P2YA 1FH5L 4YXLL 1MFEL 1T5WB 5FV1L 5DTFB 4BSWA 1YPZB 4HGMA 4XH2B 1GOFA 4MA7H 5LVEA 1KB5B 1RZFH 4I3RL 4LCCC 4LKXB 4LAQL 5EOTA 4JO2H 1DDHB 3PV6A 4PG2A 3ETBF 3O3EA 5D8JH 3V4UL 3BEWA 4XPAH 3KLAB 3BOVA 4Y5VC 3QDGA 4HDIB 3F7RA 1K4CA 3D6GA 1ZLSL 4DZBB 1HQ4B 3OL2A 4CGTA 3L3DB 2DF3A 1S9VB 3O8XD 4K94C 3OR6A 5GS2D 1UT9A 4X4XA 5JXAL 1I8LC 2YC1A 1AY1H 4GS7C 1AI1H 1INEL 3EYOB 4JKPH 4S11A 3X12A 4TNVF 3BPCB 5CGYC 1FVDA 3RWCB 3G9VA 4M43H 1CICC 3ALWA 4LOUC 2A38A 5IJVA 1FDLH 4G9FE 5EULV 4D3CH 4U6HA 4JREC 4X7FC 4YEEA 3L3HB 2XTLA 5HHOD 4WGVB 3DGGB 1RZJC 3INUH 1OTTD 4CN1A 1ZMYA 2E9IA 1AXTL 5KOMC 4NO0B 4JM2D 3KPQA 4E9LA 4HUVB 5CEXB 4WCYH 4XXCC 2ESVA 2VDKL 1SJVA 1MJ8H 4LU5L 2YKLL 4LARL 4HFUH 4J3OC 4M8QA 1MRDH 3F8UB 2EICA 1F4WL 4MX7B 2NTFA 4KRPB 2AAVA 4LHJB 1A02N 4V1DB 2UWEA 5J6HB 4LRIC 1JHLH 3DARA 3FAWA 4MMXC 2GSIB 1MI5A 2DLIA 4PP1D 1X6NA 1UCBH 4N0UB 1H0DA 1KBGL 3C5ZD 1RZJH 1S7WB 5K9OA 5EU5B 5D7IA 5B8CB 1BZ9A 2L7UA 3AUVA 3BHBB 2V5YA 5KSVB 5DGRA 4PLNC 3UTZB 2AKRA 3QQ4A 2NQCA 3KXFD 3SE3A 1Q9KA 2VITB 4QXWA 3HI5H 4Y2OA 1GGUA 2P5WD 3QZWG 3EOYG 4JY6B 1LDPL 1UEYA 5DD1L 2AK1L 2AJSL 1KOAA 3B5TA 2AGJL 3IKCA 1CGWA 3ARGA 4Q9RL 1MFDH 2L4OA 1S7RA 1ORSA 1U8KB 2YUWA 4P57A 4U1LA 1F3DJ 4NRXA 4YX2H 4ORZC 1ZA3B 4YHLH 3V4VL 2CPCA 3W9EB 1AE6H 1JCKA 1P7KB 3IFNL 3QB7C 4JRXD 4Y19B 4JFEA 1ZWIB 2DQHL 3ZKMC 1DBBH 3ZE0F 4KROB 4HCRL 5IG7A 4E0RA 3U4BH 3P9MA 3NFSH 3HUJA 4YDJA 5E8EB 4JFPA 3L5JA 2Y4SA 1RZ8A 5I15L 5HYJD 2X41A 4I0PC 5C70A 3G6JA 5F9DC 4NHCH 1S7SA 5DJ6A 1I9RH 1X7QB 5F7NC 2HWZL 1N0LA 5KS9B 1FJ1A 1XCQA 2NPLX 3WE6B 1KEGL 2NY2D 1YJDL 4XMLH 1AGEA 3S35X 3WIHL 1OW0A 4YAQA 4OM0H 1S7QB 2C1PB 5BZDA 3JWOL 3F12B 4JQXC 4WNQB 3TH4T 4JDTL 4HC1H 1I1AD 4XX1E 1MFBL 3ZYIA 5ISZE 4IMKC 3S37X 1A6WL 1YN6B 1ODAA 3CSYB 1G7JA 1U3HC 4PJFA 1GC1L 4YDKH 3WHXB 4YC2C 4LDOB 4RFOH 4TSCL 3MV7A 3KPNA 3FONA 2DL2A 3PGCA 1R3LA 2C1OA 3DHJA 5CJOL 4KV5E 3A0OA 4I0KA 4WWKB 1NGWB 5EFIA 5EU6D 2BDNH 2XNAA 5HVHB 3H9HA 3P0VL 2CK0H 4JHAH 4XAKE 1ZHBB 3TH3T 4OZHA 1OL0A 1XGPB 1CWVA 2MPAH 4E5XA 2Y07H 2DM4A 5MI0C 4G9DA 4KPHL 2OS7A 3UTSE 1D5BB 5GQBA 2WLYA 1YECL 4DZ8A 1PEZA 2FLBT 3V6OA 3R1GL 1WIPA 3IRPX 3UCRA 4XB8A 4JB9H 4OFKA 2H2PC 5JDSB 1WBXB 4OCSH 1GIGL 5T1KD 1QO3B 5EOCJ 3SDXF 3T04D 3W2DH 3B5GA 1TVHB 2XRAL 3GMOA 4JHZA 2XN9D 4DKFH 1JPFA 4WI4A 4MAYB 1OPGL 4RRPA 2EKSB 3BZFB 1E6JL 1A1NB 4FS0A 1A7PL 1ONQA 4H20L 4HUNB 4XC1H 1NCTA 1Y0LB 4K7PH 5C0AB 1NCWH 2BSSB 2G2RA 5DUMH 3C60D 4OCRL 5E8PB 3OGCA 1NLBH 1X5FA 4LQFL 2E27L 3VDAA 2VIRA 4ODUB 4P2QD 5CD3B 1CLYL 3IGAA 5DHXB 1NAML 3MRRB 3MRNB 4Y4HB 4ZFFA 2J5LB 1KLFA 3X17A 2X4RB 5EPMB 5D96B 1E4XL 4DFHA 1L7IL 2GCYA 1RUAH 3BFOA 5DMIH 3T0EB 1G7LA 1F58H 2B39A 5DQ9B 3DNKA 5IESL 1V7NL 1K2DB 4OIIL 1KIRB 1U2CA 3CGTA 3GBNL 5C07A 1KCVL 4Z78B 1KNOB 4QRSB 5JW4N 5GSVB 2ZCKH 4OGYH 1C16B 5DMJB 3ARYA 3GM8A 2Q1EA 5F89A 1ZTXH 2NLJB 4MD0B 1JTPA 4AK1A 4JRYE 4ODTL 3EJYD 1U91A 3TM6A 3O4LD 4K8RC 2Q20A 5H35A 3B9KA 2BC4A 1DLHA 2V6HA 5DSCA 4F3FA 1A6ZB 3FQNB 3ULUF 1FYTD 2X4PA 3OF6D 5CCKH 4HIIB 3L1OH 5GJSH 4CRPA 2D4FA 4GG8B 3T0AA 4FG6C 1Q8MA 5HGGS 3KHOA 1H5BC 3QIBC 3HZVA 4ZSOB 4NO3B 4PJ7E 3GBML 3IT8D 4F15C 3T0XA 1NLDL 3MCKA 1HOCB 4FQXB 4D0DB 4PRNB 1TQBB 2EZ0C 1RSFA 3EO1B 5SX5H 5HXMA 5D5MF 2W0KA 4YR6A 5F1KC 1JGVL 3PABA 2R2BB 3LKNA 1R3IL 2GUOB 4K8RH 3ARWA 4Q6YA 2APXA 3MXVH 5CJ5A 1MUJA 4QXUL 3FO2A 4TNVK 4YPGA 2Q8BL 4DK3A 3SKOA 3QUZD 5FYJU 2A6JA 4UOW0 3KPOB 3H8NA 4LIQE 3GKWH 3D39B 5B3NA 3QFDB 2IMNA 5F8QC 4ZYKA 2EO1A 2NY3C 3FOLB 5DEFA 5KSBF 1BECA 4M61B 3MMEA 3LRHA 4NWTH 4R7DB 3MNWB 3MRPB 1XF5B 1Q9OB 4WU5B 3C6LD 3LAFA 1EBPA 1FO0L 4RWHA 5I16B 3L3IA 2GFBB 5ITFA 2ADIB 4CVXB 1UA6H 2VDRH 2A77L 1S9KC 3BSZH 3N1GC 1TQCB 5SWSE 1YQVL 5C1MB 2OL3H 1ZHLB 2R1XA 1RZIA 4MNQA 3NPSC 3RIAF 4YLQT 3KPMA 4GAGH 2D7TL 3V5DA 2GJ6E 2GT9A 4JPIA 4XPGL 3U48A 3WN5A 5K59E 3ULSB 4RFEA 5IMLA 5FEBA 1MH5B 5A2IH 1DBAL 4DCQA 4I48A 5I6XB 1NFDE 1BQLL 4P5TB 4AH2A 5FXCH 1C12A 2R2HA 2ED8A 1EEZA 2P8MA 3JZ7A 3PQYD 2E7BA 5A2JH 3ZKNC 1GXEA 2WWMC 4JPKH 2A6DB 5L88H 5F9JB 2ZOKA 4XP1L 5DMGD 1XGQB 3FFCD 1QFWM 3VG0L 5ITBL 3DVFA 2W60A 4J3XA 1F4AA 3VWKA 1VESA 2Y36H 1QFWI 5J4MA 2DQFB 3O9WA 3HAEA 5BOZG 4EXPX 1Y6MR 2JE8A 3FRPG 1I1FB 1PBYA 4WW2F 4BSWB 1KCUH 5T1MA 1GGYA 4X4YA 1MQKH 4LSQH 5EOTB 3C09B 2JCCE 3PV6B 5FM5O 3OXRA 1CD1A 3DSNA 1L0YA 4LSSL 4A6YL 3BEWB 4E41E 3K80A 3KVQA 3QDGB 1K4CB 3PHQA 4N90E 3LEXA 3OR6B 1UFUA 4M7LH 5D71L 1IM9D 4PREA 2YPVH 3WKML 3ZYZA 4X4XB 4OCXL 2BFVH 2YC1B 2E7CA 2ICES 4PV9A 5CILH 2VDOL 1PY9A 4LPVA 3X12B 3LIZL 1G9NH 1J8HE 1TJHL 1FVDB 3MLUL 3BXNA 5T3ZH 3KJ6L 1OQOA 1JGUL 3WJLC 5TDOA 4L9DA 5IJVB 1M7IA 3O8XA 2IGFH 4U6HB 3WNPA 3CD4A 1S7UA 4N68A 1RY7B 3M8OH 1CLZL 2ED9A 3S35L 1KF9B 3MRCA 2CJUL 4Z7UA 1OCWL 3HMXL 3RVVD 2CKBH 4RX4D 1QSED 3KPQB 2MJWA 1WJ3A 4OFYA 4UILH 2HT3C 4L4TE 1ZLWH 2N7AA 3S37L 5JHLH 2ESVB 4TSBL 5BVJA 3B8SA 5J9PA 1O7VA 1MCDA 1SEBA 5J1SC 5BV7B 2NY6D 5E4EC 4LCWE 2NTFB 3Q3GA 5TQ0H 1H8SA 1Q72H 4JM2A 2UWEB 3IJYA 3LPWA 1MVFA 5AZEH 2C9AA 1SJHA 1KN4L 2DMBA 3BVNA 1MI5B 5I76A 1JV5A 5ILTH 3RKDD 4P9HC 5DVMA 5FGCB 1H0DB 3E8UL 3F7YA 5MEND 5K9OB 3OAYK 5FA3A 1U6AL 1T0PB 5D7IB 2Y06L 3GNML 1KT2B 4KKCC 3CLFH 3ZL4L 2AKRB 3QQ4B 3QEQA 1Q9KB 3QG7L 2NYYC 2APBA 4HWUA 4UDUA 2EDTA 1JZ5A 3BGFC 4KU1A 3BRGC 3C5ZA 4KZDL 2HKFL 2BOCB 1N6QL 3VE0B 3H9ZA 1MREH 4F7MA 3IKCB 1FNGA 3ARGB 1MQ8A 4Y2DA 2R56H 1S7RB 2VN4A 5LGJA 1KGCE 4KKBD 1I4FA 4LPUA 4KDWA 4P57B 4U1LB 1N5YL 4NRXB 5LAXA 1T2XA 3ARFD 3WFZA 1X3DA 3D0VA 3B2UD 2VABA 4PJBE 1FVCA 2RFXA 4P9HH 4TULH 1RUPL 5I75B 2ED7A 4JFEB 4ZFZA 3UPAA 4NNPL 4JN2B 4WI6A 4KQ4H 2OP4H 1KTKE 1P5VA 3WIHA 1NCDH 5IG7B 3WS6A 2X6MA 1X6LA 1F8TL 3P9MB 4ZXBC 3HUJB 3JUZA 4YDJB 4MDJA 4JFPB 4AG4H 1OD9A 1RZ8B 1YEKH 4JRXA 4NZTH 5KZCB 3G6JB 3OR7A 4LRNL 1X5LA 1S7SB 5DJ6B 5D70L 3F5WB 5IB3A 2JJSA 4QRRE 5EU4A 3ISWA 1FJ1B 1PKQE 1XCQB 4ZODA 5T5FL 4U1JA 3T3ME 3AM8C 5LQBL 1I75A 3IDXH 1KJ3L 2F19H 5HYJA 3ULUD 2X5PA 5BZDB 2MTPA 5EZLB 3B3IA 3SOBL 32C2B 5L2KE 4PJFB 5E2UL 3ET9F 5A3IC 3SGJA 1IRAY 1YUHA 3UJJH 3KPNB 4KV5F 3W5MA 3QUML 3FONB 5JDJA 3FQTA 2PXYC 3PGCB 1R3LB 2C1OB 2HTLD 1JNLL 1I1AA 5A2FA 2K9UA 5EFIB 3EYSH 2XNAB 4APQC 2PO6A 3H9HB 1N26A 1FFQA 4PB0L 4OZHB 1IGCL 4TQEL 4F9PA 1OM3L 2IAMC 3O2WH 2YK1L 4E5XB 2YA2A 4G9DB 3AXLA 4Q6IC 3ULUL 2VTFA 1O0VA 4DZ8B 2X7LA 4R97B 3MV9E 4KVCH 4TVPE 2N4IA 4P2OC 1EGJH 1SEQL 2FEEL 1N4XL 2D0FA 4OI8A 1UKTA 5C0JA 5IMOA 1QYGH 4S0TD 5EWIL 2DBJA 3MLSL 1LK2A 2E7HA 4QRUA 3UZEA 3GMOB 4O2FA 4ZFGH 3ARXA 3QRGH 1MEXH 1NAMA 1P9MA 1WAAA 5IT2H 1JPFB 5JOFA 4FN0A 3SJVD 4PJDE 1WVZA 2VDLL 5T1KA 3QDMD 4JO4H 4KQ3H 5IMKA 4EQ2A 1BEYH 1ONQB 4NBYB 5EORL 1CE1H 5EO1A 1PY4A 1DANT 4EKXA 4ODVL 2FD6L 2G2RB 1CFVH 3OGCB 2WLZA 2ZCHH 3MUGB 2VIRB 5DUBA 4ZS7H 3IGAB 4ZFFB 1I3GH 2KPNA 3T2QA 4DKEH 2IQAA 2EYRA 3RZCC 4P2RD 1B4JL 5MEPB 2VKXA 4UU9A 3QJHA 2GCYB 3C60A 3T3PE 3TNMB 2DI8A 2R4RH 5GISH 4RWYH 1I8KA 1U8OA 4HKXA 1G7LB 5J1TC 4LCIH 1CFQA 1QNZL 2ICEA 1WV7T 5C07B 4XNQA 5CEZL 4GFTB 4KTDL 3U7YH 1A7RL 3QPQC 2XFXA 3QH3A 3QUXD 4V2BA 3EDKA 5F89B 5GRXG 1AQDA 3QO1A 4JHBA 1KB9J 4W81A 1U91B 5L6YL 2Q8AH 5H35B 3P30L 3VGHA 1EJOL 3B9KB 2BC4B 1DLHB 3NAAH 4F3FB 5DSCB 4O02H 4TRPH 3BKJL 2X4PB 3QHFL 5TE4H 4DGYL 2LAAA 3PP4H 1BFVH 3ESUF 4FMKA 3V0WL 7FABH 4PJ7F 4PRAA 1A7OH 1UZ6E 5C0CE 2F8VA 4XVJH 1A7BA 3HZVB 4AQ1B 4FFZH 3O4LA 2ATPA 1MCPH 2PETA 4WENB 2PCPA 1AKJD 3T0WA 3MCKB 4WHYG 4XWGH 1FYTA 1JYWA 4OLXH 3WXWL 1E4KA 2B1HH 1ZGLA 4YR6B 1DBML 2FRGP 3VXNA 1ETZA 3PABB 3ULVF 1KB5H 1A0QH 3LKNB 5FUOH 4CAGA 5DGQA 3UX9B 1T5XA 4UNUA 4G9FD 4N0FA 1DANU 1JWUA 1MUJB 5D7KE 1KSRA 4YPGB 1FO0A 4NQXA 1FZMA 5TF1L 3TZVD 3UPRA 3QR2A 1PW3A 3QCUL 3SKOB 3WYRA 3I2CL 2A6JB 3K7UA 4AY0A 4JR9L 4X4ME 1Q1JH 4LCYA 3TT1H 1P6FA 5FYJH 4I1NB 3BN9C 3RU8L 4EUPA 4M6NL 1E4WH 4HWBL 4ZYKB 1TITA 3EAKA 1DFBL 4KRPC 2AABL 5DEFB 3MV8A 2D03L 3OJVC 3ZSTA 3VRLE 3MMEB 4XP6H 3OJ2C 3T0VA 4MS8C 1G6RL 3L3IB 4OD2A 3HA0A 1WWWX 3NABH 3QI9D 5ITFB 5JUEH 2V9QA 4I0CC 3L6FA 4S2SA 4JDZA 1JRHI 5D2NA 3QDJD 5B8CC 2W9EH 5F3HA 2VZUA 4MB5A 2R1XB 4U6VL 3AB0B 1RZIB 2HJFA 1FNSH 3C6LA 3KPMB 3V5DB 2GT9B 4JPIB 3WN5B 4RFEB 3UDWC 3DPBA 5IHLB 1LE5A 1NFDF 2JTDA 4DCQB 4K9EH 4I48B 1QBMH 1WEJH 5KVGL 1OAKH 6CGTA 2R4SL 5T1DL 5FF6A 2IH3A 3MJ9L 3QFJA 4AH2B 1C12B 2LV4A 2R2HB 1EEZB 2P8MB 5D7JD 5JW5A 1UYWL 2GK2A 3ARVA 1KFAL 2X4OA 2ZOKB 2AJ3A 4J3VA 5BXFA 1SVCP 4LMQI 2W60B 4YWGL 2VL4A 3VWKB 4A6YA 5IM7A 2DTMH 1ITCA 4N1HB 1TZGH 3EUUA 4KROC 1PDKA 1VFAA 3O9WB 2KQMA 3HAEB 2FEDC 1MELA 3STBA 4DN3L 3PWNA 1P5UA 2MCG1 1GH7A 2PW2A 2UVEA 1WZMA 1NCNA 4Q58C 3FFCA 5T1MB 3B2VL 5KBNC 4XCFH 2JCCF 2E9JA 4X4YB 5I1DA 3H3KA 5C0EA 1PX4A 3OXRB 1CD1B 3UEZA 1X5HA 1NCUA 4HJGA 2YXFA 4GMSH 1RFDL 2C3GA 3PHQB 2OTWA 2E3VA 2E7MA 2X42A 3O2DL 3LEXB 4GJTB 4PREB 3DI3B 4PV9B 3HMXA 2JJUA 4Y4FD 1K3ZA 5HGAA 1BFSA 3BXNB 1IE5A 2ORBL 2DBLL 4M1CD 3UYRH 4Q0XL 5TDOB 3UJTL 5ISZD 5TQ2L 5FUCE 1M7IB 1INQA 5C71A 3O8XB 1BP3B 4FQIH 2AJXL 5ANME 1IM9A 2NXYD 1S7UB 4GKZA 3VH8A 4P46D 1KYOJ 5F6IB 2CK2A 3S3JA 2YZ8A 1C7TA 1WTLA 5HVHC 3MRCB 5M7QA 1IZKA 4Z7UB 1A21A 3VFPA 5DR5H 3RAJL 2DQEL 1PSKL 2Z9TA 2ZCLH 3HG1A 1HHKA 4ZTOH 3BPNB 5ADOH 2I07A 3IU4H 2ZUSA 1JPSL 5FUZH 1EHXA 5DVLA 5BVJB 3L7FA 5J9PB 5D9SA 1SEBB 2H2SC 4U05A 1KXTB 3IB4A 3UTSD 3Q3GB 5K9JH 1QSEA 4JM2B 4RZCA 1C08A 3IJYB 5CLTA 4J6RL 1SJEA 2YMXH 1SJHB 3H9SE 3MREA 2DLFL 4LBEA 3BVNB 3QXWA 5IVZ