4H8WH

Crystal structure of non-neutralizing and adcc-potent antibody n5-i5 in complex with hiv-1 clade a/e gp120 and scd4.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
212
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSTYAMSWVRQAPGKGLEWVSSINNSGRNTFSADSVKGRFTISRDNSKNTLFLVMNSLRAEDTAVYYCAKDLRLGGGSDYWGQGTLVTVSSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 CLADE A/E 93TH057 (H375S) GP120
publication title Structural Definition of an Antibody-Dependent Cellular Cytotoxicity Response Implicated in Reduced Risk for HIV-1 Infection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
total genus 42
structure length 212
sequence length 219
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h8wH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h8wH01
2VITA 2R2CA 2R56H 1CFSB 2Z92B 1G9NL 5J1TC 3TIEB 3V4PH 5BVJB 1RUML 3KYMB 2AQ1A 5SWSE 3KPOA 4U6HA 2JCCB 4JKWA 5GIRA 2A77L 2B20A 4BZ2H 5ITFB 5JXED 1OGTB 3ZKQD 3V95A 4BFIA 1MCPL 1DDHB 2HRPL 3ARBC 2XKSA 1J5OL 3SBWC 5I6XB 2W0LA 5IMMB 3MNWB 5FDYA 4WI8A 3N1MC 3E6FA 2NY6C 2H2SC 1BVLA 4K3JH 2OZ4L 4PRPA 5HDLA 4ELKA 3TJEH 3IS0X 3NFNA 2CRZA 3PE9A 5JHLH 1NBQA 4B50A 3MYJB 3RWDB 2NY3B 3BP7B 1MCLA 4HF5L 3OKMA 2DQJL 5HHME 5IFJB 1LO0L 4UINL 4X80L 3TH2T 1V05A 4G6JH 4JHBA 3B8SA 4H26B 5K9OA 3MXWL 5JTWA 3UBXB 3RWCA 3X17A 1BD2A 2NZ9C 3V4VL 5I8OL 1Q1JL 3DX9A 3DROA 2IPTL 1VSCA 3FTGB 1WFOA 4YH6A 3ET9F 2ZUSA 4OZGE 1SYSA 3MA7A 4O58H 5TF1L 1IGTA 1YEFL 4P46D 3MV01 4F7TB 3QXDB 4KI1A 4AIOA 1NLBH 4OZHE 2V9TA 2MQ3A 5EULV 1M7IB 4XBGB 3W0WB 4XP6L 2CXKA 4ZUUB 4R4ND 3HE7D 4G8FA 3PWUB 2PCPB 2R39A 2EZ0C 4QOKE 1NAMB 3LN4A 2W60B 2AAVA 2MQCA 4PRDB 3RI5F 4D0DA 1T0PB 1TIUA 5JPNB 1BFSA 1T1WA 3JZ7A 3TVMD 3EFFA 3T77A 1KIRA 2ZKHL 3S4SB 5E95B 3KPMA 4F9PC 3KNBB 3BN9C 4P5TA 2FR4A 2BNQB 2CO7B 3QJFA 4J4PC 4GG6B 2BVPA 1JPGA 1BZ9A 1FJ1B 3A67H 3CFEA 4FFYH 1QFOA 1KJMA 3MV7B 1SBSL 5LWYL 3KPRB 1N0XL 4YUEH 2X4QA 1KLFA 1MI5D 4TNVK 3RJQB 4OUUA 3IFLL 4YC2C 1G7IA 1ZA6A 3OPZH 3MFFA 2KPNA 3ARDC 4HK0B 4I18B 1A1NB 4HIXL 1YMMA 1KCSL 4Y16C 2Q87A 1RURH 1AHWA 4CMMB 2FEDC 5IWLC 4JO4L 2QHRH 1L0QA 4JPVL 3ZKXB 2XY2A 2WBJC 3PJSB 1KLUB 4HC1L 2WUCL 4JZNA 3ZMRA 5EN2A 3Q5YA 1AGFB 1UEMA 4RIRA 4P4KA 3MLXL 2J4WL 4P2RA 3E1F1 3LKOB 3WIHA 1P7HL 1A0QL 1GPOL 5JA9A 2B2XH 3REVA 1KPUB 2V5RA 3B5HA 4MA7L 2H32A 1QLFA 4OZIB 1RSFA 1H5BC 2B5IC 1Y18A 1U92B 4YDIL 3OJDA 1GC1H 3P77A 4MAYB 4ODBD 1I1AD 3SGEI 2JKXA 3L5IA 3BEVA 1HQ4B 1EEUA 3IKKA 1YYML 4N8CH 3AREB 3DXAA 3MRKA 1QR4A 1AXSB 5B8CA 4JN2B 1IAOB 5KVFH 4ZTPH 2I9TB 2I5YH 1CL7H 4ELMF 3F6LA 3GHBH 5E2VH 1G0DA 4C83A 4N5EC 4G6FD 1RIUL 1C16B 2CR6A 1AE6L 3R06B 2J88L 3CVHB 4MJ6B 1FORH 1BM3L 4P23B 5IROC 1IILE 2NXYB 3E3QC 1WCQA 1AKJD 5H35A 1P1ZA 3MOQA 2WWKT 2IPUG 1C12A 2VLLB 2D2OA 1OAZH 4PP2B 5C2BL 3L3OB 1JZ6A 1EAJA 1HCFX 1X6LA 2YD1A 3O3EA 3RKDC 5JQ6H 3NIGF 1INDL 2WP3T 4JFYA 1OY3B 3UCRA 1A14L 2JJSC 7FABH 4NKOA 4LQFH 1D7FA 3BP5B 2ATPB 2VAJA 5D2NC 1KJ2A 1E6OL 2OR7A 5IB2A 4Q74A 3VFMA 3D39D 1J10A 2PR4H 3CH1B 1QSEE 5MERB 4HHAA 2XXMB 3GMPB 3U46B 2XYCA 1WT5A 5EU6B 3L95A 2RAMA 4AG4H 5CIPB 3L3DB 3F5WB 3IU4L 5KOMC 4U6XB 4JM2A 4W6WB 4I2XE 3MLUH 2BXZA 2JF1A 5CINH 5DA4A 4PG2A 1OARH 1TJHH 5GRVK 4K8RH 4WWKC 5E00B 3TPUA 5IOPA 4NWTH 1DJSA 2YK1H 5GS1B 3P73B 4JQXC 5FKAB 2A74A 4OM1L 3CMOH 5F7KC 1BAFL 4NUJA 1MHEA 5DRNA 5K9QG 3BH9A 1NEUA 1IVLA 3V6FB 2YR3A 1GZPB 4G3YL 1PG7H 2VZUA 1FIEA 4OCXH 2BRRL 2HLFC 3AS0A 2VAAA 4Z7OF 3QDJA 4LSUL 2EE3A 3RUGB 2HA1A 4FN0A 1QRND 4PJFA 1YUHA 2ESVE 4WW2B 4JPIB 4PLJD 4F37K 5GGQL 1K3ZA 1ZHNB 2YD8A 3ESVF 4ZSOE 4KGJA 2XV6B 5J3HD 1UCBH 4R4BB 1PG7W 2BHUA 3QDAA 3HE6A 3SKMA 4ETQB 2DMBA 4WW1A 4BFGA 1HIML 3PP4L 3QQ4A 5I8EB 5JUEH 4LLYB 5H94A 2FZ3B 3O2VH 1J8KA 1C5BH 3KJ4B 5DUPH 3FQTA 1R5VB 1A1MB 5C0BD 4CNIB 4OTXH 1A1OA 2G9HA 2FH8A 3MBEA 2WNGA 1CGSH 4EOWH 4P2OA 2BNRD 5CFHA 1A5FL 1EFXD 5E5UB 4G6AD 1UH3A 5DFWH 2X89A 5TGBB 2ENSA 2R15A 2A9MH 4G8GD 5D1QA 4NT6A 4N90E 1CU4H 3N06B 4HULB 1X44A 2JCCF 5C0AE 1HXMB 4F7EB 1MFBL 3I6KB 4DGVH 4LLDB 3GK8L 1DQML 2Z8SA 4YHKL 4UMGA 3P4LA 5IVXB 5GRJH 1SEBB 5EU5A 3CPLB 2W07A 1DQJA 4YDJB 3S96A 1H3PH 3CFBA 2EDJA 2ICES 2ZCLL 2QQLL 5CILH 5D2LA 1RUQH 3ARGD 3O6LH 4WV1A 1BOGB 2M8XA 5EU4B 2EXWD 1K6QH 3IFPB 5FYLE 4KMLB 2QLVB 4PJEB 1Q9OB 4XNZC 1B4JL 5C0IA 4XH2B 4RZCA 3QDMB 4LU5L 3QCUH 2CKBH 4LAQH 4ZD3L 5JO5A 3O41A 2ORBH 4MD0B 1DLHB 2GTWA 1H15A 4X5WA 3LIZL 1G7MB 3ALWA 4XPGH 3VFOB 4I3GA 2BJML 3R1GL 2DQIL 3U7AA 1AQKH 3GI8L 2LU7A 3G04B 4I48A 1BX2B 3BZDA 3OJVC 1NBZB 5K9KA 2NLJA 1XAUA 5E94A 3QIWB 4P5KB 3VFTB 4UZGA 3MODL 4IMKC 5EIVA 1I8MA 1HILB 4JAMB 5DS8A 1VGEL 3QIBA 2PNDA 4MCZA 3R8QA 3VI3E 4MLIA 1KIPA 4NCC1 2F74B 4MSWA 3V6OE 3RDTC 1NMCB 3MNZB 4PJAE 4KHXL 1NGPH 5HVWA 3FB7A 1YNTB 5KJRH 2XPGA 5LGJB 2AEIT 5KSAA 4NPYB 4FXKB 4L29A 1T5WA 2VQUA 4OT1H 3TWCL 3ISWA 1QLRB 1N6VA 5BRZA 4CUCA 4AYFA 4GG6F 1NBVH 5B38A 2JE8A 3RVTC 2J2ZA 4Z7VE 3OJ2C 4N0UB 1SJEA 1QO3A 5DJAB 5CAYB 4W6XB 5E9DE 2PTTA 1QBML 3H42L 3SKJL 3FO0H 1FG2A 2ATKB 2PO6A 1UACL 1OW0A 1SJHA 5FFLA 5CEZH 3B9VA 1ITCA 2I60H 5T3ZE 1DE4B 3C87A 4HJGB 4D9RD 4U1KB 4FXLA 3GKWH 3WS3B 4ZS7H 1J9CT 4Y2DC 4WO4A 3U0PA 4X4YB 3RQ3A 3IETA 5D7JA 4Y2OA 2O93L 1ZK9A 3G5YA 3STLB 2CLRB 3ARRA 1LILA 3WEXB 4IRZH 5KVGH 3MJ7A 2GK0B 3QUXC 3QUYD 5ERWB 3GHEH 2B0SL 2R0KH 1ZEAH 1G9EA 4UUJB 2C4FT 4XCCL 3HB3C 2VL5A 4LCWB 1JE6A 1IGFH 1X7QA 1A6AA 3CAFA 3OKDB 1VADB 5FDWB 1KGCD 2BCKB 2R2EA 4OLZL 1P2CA 3NFPA 5C08B 4R3SB 3TT1H 3HRPA 4OZIF 5F9WC 1K4CB 3K4DA 3TH4T 3S3JA 1MCKA 4OGAD 4KUCD 4FG6D 2FGWH 3NZHH 3TA3C 1C08A 5MEQB 1IEAA 2XN9D 3EYUH 1BBJB 2NX5D 3GMNB 4ODUB 1OAUL 4X4XA 3ZZ1A 5FGCE 2ZG1A 1M05B 4TUJB 2SEBB 3ULVD 3Q3GA 1P4BL 5E1HB 2F8OA 4JVWA 4QXGL 4DKEH 2Q86A 3SE8H 1MPAH 4Q6IB 5IFAL 2ITCB 2IANA 2QJDA 3QG6A 3VG9C 2DQTH 1PYWA 3D9AL 3O9WD 5JW4M 1CS6A 1B0GB 5AYUH 4U1HB 1JBJA 2VXVL 1MCQA 4AEEA 1E27B 3H3KA 5SWSA 3UTSE 4LF3B 4CU6A 5DK2B 4WCYL 3P11L 2IC2A 5DHVH 3MRMA 1XF2A 2QHLA 1G7PA 3I84A 5HYSG 2NR6D 4D0BA 4AT6B 4MCYB 1F11B 2YSSB 1F13A 4RA3A 3U48A 1XF4A 4IOSD 4H8WL 4N8VB 1H8SA 4PJBB 3SCMA 3HPLB 4IIQC 4PJ8C 3GJEA 1U8KB 2R2BB 3H9HA 1QEWA 4BQBA 4MNHB 2ADJB 3CDGB 4OCSL 1RUPL 2YWZA 2PKDA 1KBGL 1XGYH 3CK0H 3CJJA 4HBCL 3VXRD 3VCLB 2JIXA 2NW3A 3U2SA 3QPQC 3DRQB 3I6GB 4KVCH 3UTPD 1UQSB 1OP9A 1SHMA 4U1NA 4G9DB 5LXGL 1X3DA 3DURB 5EOCJ 1O7SA 5CP3H 3I50L 4X4ME 4F7MB 3IRZA 5F1KC 5EC1A 4KV5F 3ZDXE 4RFNB 3FMGH 1JGDA 2P42B 5B4MC 3RVUD 4J7RA 4X0KA 4OZHA 3WNNA 2G75B 1WCBB 2F54E 1G7LA 5E6IB 4JFDB 3VXMB 3RUGF 5LBSH 4WW2F 5KBNC 4QOKA 4ZS6D 4ZUVA 1AQDA 4DK3A 3AMKA 3BJ91 2MCPH 4LGRB 5EOCL 4YDLB 3C8KA 1AO7D 3C6LC 1KCLA 1OHQA 4IM8A 4NHCH 3DGGA 1X5FA 1NFDA 3MUZ1 3JWOH 3P4MA 3QZWB 5I1EH 1CFNA 5BS0E 1U42A 2VLRE 5GGRY 5GRVL 4CAGA 5KVMC 3NA9L 3EJZC 3BZEB 2NY0C 5C0DA 2GHWB 3UMTA 4RAUA 4IDJL 1IT9L 3GSOA 1D6VH 4QLRA 3AUVA 5M7QA 2CK0H 3FQNA 3MA9H 4GAGL 5I18L 4LHJB 2E9JA 4OLWL 3OB0H 4JPKL 4L8CA 4GFTB 1SYVA 4NNPL 2ADFH 4PJCB 4MS8C 1HSBB 1F6AB 3WJJC 5IVXF 1CDBA 3TBVA 2VLKB 4KTDH 2X42A 1ZSDA 3VDAA 3MGTB 1N0LA 1NGYA 4LVOC 5FGRA 3MOBL 5IF0B 1CLZH 4IRJD 4XVJL 1C1EL 4KDTA 3Q5TA 3G5ZA 4LIQE 4YLQT 3LH2L 4KWUA 4KI5F 2VDPL 1RVFL 4PJEF 4J8RB 1MQKH 4WHTB 3JV0A 4NQCE 4AEIH 5IFHH 1RZJH 4OF8A 1X5AA 2JK5A 2BMKB 4Y1AB 5I71B 4K9EL 1T0NB 4OCNC 1YY9D 4JFHE 4X6DB 1HINH 5I2IB 4FNLH 1S7SA 1DSFL 3FT2A 2V5SA 4OV5B 1UH4A 5EC2B 1I7UA 2BRQA 1SM3H 2HN7B 1IQDA 2FX9L 3DRTB 3QEQD 4P49A 4PRAA 2AERT 5JW4N 1NAKH 3JWDL 1XGUB 4D2NA 1FFNB 3DVNA 2YC1B 5BV7L 5KTEL 1I1YB 3QRFM 4PJIE 4NJAL 1TJGL 1CXIA 3OX8A 2P49B 3OB8A 4HGWA 3UC0L 4O5LH 5I1LA 1ED3B 5TQ2H 1FH5L 3U9UB 4YHIB 2B4CH 2CKNA 1INEH 3NTCH 4Q0XH 5HDBE 1ADQA 1JF1B 3O2WH 4QHMA 3CLFH 1TZHB 1A7PH 43C9B 1NEZG 4I0KA 1JN6A 5C07B 3VW3H 2A1WL 4RX4A 4EVNA 1YN6B 4Y19B 3TO4B 4WI2A 4GRLB 1AC0A 1GZQB 4L4TE 4K3GA 2G5BA 4LOUD 1S9YB 3EYVB 4MB5A 1UENA 1ZHBB 1KIQB 3QI9C 2EEBA 5FEBA 3TP4A 3LPFA 4AENB 3MOAH 3T0XA 1QSEA 4LHUB 2ZCKL 1UC6A 2DKMA 4PRID 1P9MA 4C58B 1Q9WA 5D7LA 3UTQA 4BUHA 3P4OB 4ZOEA 4I2XA 4CVUA 1S3KH 3FQUA 3O8XB 3ULUF 2OK0L 2X7LA 3GB7A 5HHOE 3FQWA 5JXAL 1K2DA 2WWKO 3SDXB 1BJ1J 3BIAX 2VE6A 3SE4C 4ODVH 4NRZB 1YQVL 2Z8VC 3FFCB 4LVHB 1H0DB 5DJCB 1KTLB 3H0TB 4EIGB 1A7RL 2LVEA 1U91B 3BN3B 3QQ3B 4HKBA 1DBJH 4JFFE 4K7FB 3PP3H 4EN3B 4BQ6A 4HJJH 2QSCL 2XQYG 3VJ6B 5I1IL 3QCTH 1E28B 4KDVA 1A6VL 4JO2H 4OCLC 1RIVL 1NC4A 5HGGS 1PD6A 4M7KH 5A2JH 1G6RB 3MRRA 3BSZH 4I0PC 3B2UC 3B9KA 3OAZH 2ESVA 3RJDA 5LQBL 5EPMB 4NZRH 5F1NB 1IC7L 5DJYB 5ELIA 4ZSOA 3FKUS 3GRWL 1JGVL 4MWFA 1LEKB 4NO5B 4ODWA 3M1BB 4NQDE 3GSNA 1EUTA 1Q9KB 5DD1L 2O5YH 1MJJB 4HJ0C 1WQVT 3KYOA 1T4KA 1XGQB 2DTML 2PF6A 1OAQH 3ARFD 4DUVA 4OLEA 2R29H 3OWEA 3ZTNL 2YUZA 5IP4A 5KVEL 5M94B 2FIRT 3L3KB 2B1AL 1MCHA 1JNLL 1QSFE 2ZNWA 3Q6GH 4MGXA 4YJZL 4IHOA 1IAIM 3E6HB 3UJJH 3TFKC 2Z4QB 1JYXA 4S10A 1DBAL 1J1PH 3WN5C 4JZJC 3TBTA 4QRUB 2ERJC 1OVZA 1S9VB 3OGCA 5A2KH 5ITBL 5J13C 5C0AA 4AM0B 1WAAF 5DRZA 4K8RC 1G1CA 1GH7A 1YYLH 1H3XA 2EDRA 1HH6B 2Z31D 1AGDA 3MV9E 5FF6A 1G7QA 3ORJA 2PXYB 4I9WE 4M6AA 5KSBB 3IKCB 3ARBA 3PWNA 5HHNA 4Q58C 4K94L 4EI5B 4WEUD 4PJBF 3ULUH 2CIIB 1WF5A 4NQTA 1RK0B 4XCFL 4HDIB 4TULH 5F88B 1XR8B 5CUSH 3MMEB 3LQMA 2HP4A 2OL3L 3QHFL 4XX1G 5KS9A 4NNXB 5DMGD 2DIJA 3QA3B 2AK4D 2FH6A 3LMJL 3IDUA 4QHKI 1SY6H 2W65B 5IJKC 2OMBA 4RSVA 1PGRB 1D5XB 5HHVH 1PX4A 2VJXA 2VISA 3DMMA 2X4OA 1CDHA 5DRXB 1CICC 5D1ZD 3UYRH 2K7QA 4PGEA 2DRUA 3SOBH 4NHUB 4NZUL 3V0VB 3KLHC 2DWDA 4D0CB 1CG9A 2VABB 1V5JA 2FWOA 5FA3A 4F2MA 1OB1B 1N5YH 2VDLL 3BZFA 1JYWA 3RRQA 4PJAA 1DQQA 3BKCH 3EAKA 4LPUA 1YPZE 2BZDA 3KS0J 3QO1A 2R1XB 2JJVA 3HTLX 4Q2ZB 5INDB 3ARSA 4R0LB 2XXCB 3U4BL 4LKXA 1WEJH 2ICWB 2FO4A 2P7TA 2VDNL 3KYKH 4FXGA 3K2UL 4F33B 4I4WB 4F9PA 2D4DA 2DN7A 4S1SL 5CHNB 4G42B 5MENB 4RMTA 5T1LD 4Z7VA 1BFVL 2H2SD 4J4PA 1YEKH 4POZD 3O4LE 1O0VA 4KZEL 5GGUB 5E9DA 1YEHL 1KF9B 4YFLF 2D31B 4L8SA 5FGBA 1KYOK 5FYJL 2HG5A 1AR2A 1U3ZA 4YHLL 3PWLB 4L1DA 4WUUB 4DQOH 2AVGA 4WU5A 1T6VN 3K2MC 5L2KE 5BJTB 5EBWB 2VLJE 3O3BB 4OSUL 1TZGL 4A6YL 1UZ6E 4ONHA 2KQNA 1A3RL 4P9MH 2NZ9D 4PJCF 5DA0B 4MJIE 5HHQA 5FO8B 4X98A 3ARDA 1WIUA 1QBLH 4G43B 1ND0B 1RULH 2HWZH 4QHKJ 1KENL 4Y16A 4YO0A 4JDZA 1MVUA 4U3HA 1RZKL 2Y9RT 1JRHL 2VXQL 5FOJA 4CU7A 3KG5A 3HLAA 4OJFL 2J8UB 5D7IE 4NN6C 1ZVSA 1EHLH 4NYLB 1OCWH 1YNLL 2CJUL 4QTIH 5TE7L 1T80A 4KJWC 3SQBA 3FONB 1KT2B 4FQQA 5AUMB 2IAMC 3GSVB 2C3HA 4XZUB 2EYSA 4R8WL 2EDBA 1LK3L 2K3TA 3ARZA 2NCMA 3LRHA 4M1GL 5K93A 4NKMB 3EOYG 3BEWB 3LOWA 5D6CB 1LEIB 1AFVL 1TTGA 3MRHB 1BPVA 1CD1A 4X6FA 1WFNA 4Q9RH 5HPOA 1KJ3H 2CLVA 5D72L 4P46B 4X6DF 1Z2KA 4JFEE 1ZLUK 1FL3A 3BN9D 4XAKE 1NGZA 1R3IL 4J3XA 1U8PB 3LRSA 2E7CA 3WFHB 2HVJB 1KTKE 1T21A 1A6UL 3EGSA 4LSQL 3DGCR 3QB7C 1NCNA 2YPKA 4KXZH 1GJIA 4L4VE 1QUNA 1E4WH 3PF2A 1BQHG 3S6CA 3HE7B 1GHFH 4R26H 1WK0A 3SO5A 4GAJH 3WUZA 1IC5L 4XCYB 4U0QB 4KMTL 3D3VE 3VWKA 3PDOB 1KXVC 1A2YB 3MLSH 2CD0A 5IROA 4QCIA 4RFEA 5D8JL 4OCWH 3KJ6H 3OSKA 4R97C 1IAII 2OP4L 2V17H 5EOTB 3PWPD 1MJ8L 4YIQA 5T3XE 4GKNA 2FEDD 2AJSH 2HJLA 4NRYA 4JO1H 4K07A 2E6QA 2H9GA 4M5YL 2WBJD 4HXAH 1RZ7L 2C9AA 3RGVD 5DVMA 2JJSA 5EBMA 5ALBH 3SE3C 5DD5H 1MI5B 4Y5YB 3RHWF 3RZCA 3WNOA 5D2NA 3G5XB 1BD2B 1F4AA 5J1AA 1DP0A 4K23H 2DQUH 3L3JA 4ZUWB 3GGWA 2NY5L 3NCMA 4U6YB 2XIDA 2ZOKA 3F12B 1YNKH 5DJXB 1I9JL 2ZUQB 3X11B 1RZGB 3SDXF 4UBDC 4BELD 3SHSA 2FIKA 4AEHL 1N8ZB 3SKNB 3UROR 3UPRA 4FRWA 3K46A 5SX4H 3X12B 4X9IA 4WUKH 4JN1H 4TN9A 1OAYH 5HVHB 3HAEG 4N5ED 3U83A 5M95B 2R1YA 1S9WA 2DDQH 1T1WB 2IQAB 1I1AB 1TQBC 5B22A 3EYSL 1GGBL 5DUBA 5JQHC 1WWWX 3KLAB 2JELL 3O45B 2IBZY 1MJUH 2BVPB 4NNYA 4TOYL 1D5MA 3OAYK 3UYOD 3VWJC 3RKDD 4S1RH 3VXUD 3GJFA 4G6FB 4DOHB 4JFXA 1OAKL 4AIXA 3GMLA 3T8XB 2EH8H 5BS0A 2H26A 1D5BB 1HZHH 1WLHA 1DBBH 1ZA6B 2VLRA 2VR9A 2Y36H 2W9DL 4P3DA 1ZGLA 1XCQB 1AKJB 3O4OC 5INCA 1RPQA 4DCQA 3UZQA 1E4JA 1T1ZB 1AHWB 5IM7A 5ANMB 4YAQA 2OTUA 3K81A 1EVTC 3FT3A 3QH3B 4HIHA 4DUWA 1A7QL 2MFNA 1PX3A 4M48H 1I85A 4HPYH 5MP6L 2Y1VA 4WWKD 5GZND 5I19L 5KSBF 5DD6A 3CU1A 4OZ4B 5FYKU 3EO0A 2H32B 1QLFB 1U6AH 4X7DC 2YZ8A 3DX6A 1Y18B 1X5IA 1QLEH 4LBEB 4PREA 4YHNB 1MCBA 4NQXA 2YD2A 4S1QL 5DJZB 3P77B 3HS0B 1NMAH 3QUKB 4PGCB 5L88H 3NCCB 4NQCA 3BEVB 2HLFD 3DXAB 4Y4FD 4ZTOH 4CU8A 1QFUL 2IADA 1NH6A 3HZMA 4HIIA 4ELME 3LEYL 3RL2A 4XNMA 1Z5LA 2E6JA 1IGYB 2VH5L 3WUWB 1T0MA 4L8DB 4U2YA 5GRUL 5JW5A 5DHXB 3JWOC 2EICA 1GGYA 3UTZB 4IRSA 3EJYD 1IEHA 1DQLL 4F7PA 2A9NH 1A3LL 2FBJH 2YKLH 5HI5D 1P1ZB 4WEBH 2CXGA 4IMKA 3S36H 4NO0D 1QRNB 4PJIA 5I1JL 4YXLL 3EBAA 1Q9LA 1IGJA 2APWA 2COQA 5F6IB 4WJ5A 3MLZH 4UIKL 4KHTL 3WYRA 1QVOB 3RDTA 1JZ4A 5IKCB 4ODTH 3ILPA 3ULSA 4OI8A 5IB2B 3W81A 3C08L 4OD1L 3BGFC 3OXSB 3QPXL 5C0BB 1MLCB 1MCDA 2VDML 3EFDH 2C3XA 1RMFH 1U8NA 3V52H 5HYQA 4TTGA 2VXUH 4JY4A 4L4TA 3WNPA 4PG9A 4KROC 5J4MA 1EFXB 5C9JB 2HTLC 4HK3J 4GT7A 4PJHA 1YZZA 4JPWL 2NY2D 1NFIA 4G8GB 2YD6A 3VFVA 3W9EA 2R23A 3FQRA 3T0ED 4DZBA 3WBDA 1RZJC 1BLNB 1K8IB 4XBEL 5CJXC 3VFWA 3BGMA 5IOPB 2H1PH 2HT4C 1QFWH 2YBRA 1LE9A 5TJWK 4X7TA 5HHOA 3T1WA 5IMOA 4NUJB 5KZCD 3NABH 5C70A 4NN7B 5DHYB 3TCLB 1KYOJ 1DUZA 4HUWA 2GSGB 3S5LG 2H6PA 2UZYB 4Z7OE 1T03L 2J8UF 1JHTA 3QDJB 5ESAB 4JFFA 4M6NL 4ISVA 1YUHB 2FSEA 3HI5L 4NP4H 1A6PA 4C54A 5IESL 2FEEL 4MNGE 1G9NH 1EZVY 1RUMH 4NQVB 2VDQL 2B4CC 1LGVA 4ZODA 3S3PA 2FJHB 3H6JA 2A77H 5H94B 4L9LC 1MCPH 2HRPH 2YUVA 4HLZG 1ODAA 1J5OH 1KCVL 4XGZA 1CE1L 5CP7B 3MBEB 4NQDA 4LPCA 4HIEB 5BW7C 1AIFB 1OQOA 2OZ4H 4PRNB 3TC9A 4M5ZH 1LDSA 3PQYD 4PTUA 3RVTD 4M9OA 4K3DL 2EC8A 1CZ8L 3OAUH 1AGBA 3VH8B 4K7PL 4HF5H 2DQJH 1NPUA 5D1QB 1LO0H 2JCCE 4NT6B 4UINH 4X80H 2OSLB 2JB5L 5EZOL 4FQPA 4AJ0A 1QSFA 5TQ0L 5DZLA 3MRCA 2HLAA 3MXWH 4OAWB 5FM8A 4N0CC 3PL6C 2H45A 3V4VH 2I27N 1Q1JH 5I8OH 1L7IH 2Y5TA 3EYFB 3BFOA 2IPTH 2YWYA 3S96B 3STBA 4Y2DD 4ZAKA 3CFBB 5C0ND 3OG4B 2ILLA 4QRQA 3ZHLA 3U0WL 1JMXA 2DIBA 1MFDL 1YEFH 1AH1A 5C92A 3IDXL 3MV9A 4OLYL 1QSZA 4OF6A 4N9OB 3QIUC 5F7FA 4LRIC 2IEPA 3QUXD 4ZO8A 3VRJA 1XF3B 5AAWA 2BVTA 1HI6B 3HB3D 1T66C 5ESVB 4XP6H 2ED7A 3VXPB 4BZYA 3GMOA 4JRXD 1H15B 1H3GA 1NMBL 2AXGA 1E4KA 4Y4HC 2UUDK 5E8NB 2FHCA 2VIRA 1KG0B 4YZFF 3JV4A 4UDTB 5J12C 2HH0L 3DSFL 1LE5A 4I48B 2ZKHH 4QHLB 3WHXA 4FQ1L 3TA3D 3U0TA 2WQ8A 5K9KB 5E94B 1I8MB 1EFQA 4BQCA 2XWJB 2E7MA 4QRPA 5GGRB 3W0WE 1VFMA 2BDNL 4MCZB 3WIHL 4NSKB 4OQTH 3QDGA 2FJFB 1SBSH 3C60A 1UWGH 5LWYH 4KTEL 1N0XH 3BP4A 1U58A 4M6ML 4NZJA 3EIFA 5KSAB 2DJUA 2W59A 3IFLH 4L29B 3LY6A 1T5WB 4G5ZL 4HMCA 4MDJA 4GG8B 2BNQE 2BY3A 4HIXH 2XN9B 1N6QL 1KCSH 1YPZA 2NX5B 4GG6E 4QRTA 4UQ2A 5DFVC 4GW5A 4PY7A 3OKKA 3MV7E 4IBLT 4JO4H 4JPVH 3KPRE 1CR9H 2WIIA 4K7PY 1OM3L 3SO3C 1UWEH 4HC1H 3LS4L 2EO1A 1FG2B 1AXIB 3MRFA 1FNFA 4GRWH 4XP4L 2YXFA 3MLXH 2J4WH 4JFQB 1A0QH 1GPOH 1UJ3C 4LCUA 3U82B 5C6TL 4AQ1B 4MA7H 4PJ8D 5DQDL 2LV4A 4MQSB 4UAOB 3W82A 2AQ2A 3G5YB 4YDIH 3HAEH 2FLRT 2HJFB 3MJ7B 1YYMH 4RGNC 3QPQD 2EIBA 4MJIA 3L5WB 5JA8B 3P0VL 2VL5B 2ADIA 2Q7YB 1KJ2L 5F93C 4BKLB 1RJYA 1OAXL 1U8MB 3WKNA 3L5JA 4ZUTA 3VFSB 4BK4A 1GGCL 1N5AA 4OZIE 1FL6A 1RIUH 3E2HC 3I3EA 1MHCA 2NTSP 1AE6H 3QUZA 4NKIL 2J88H 3GUTA 1IAKA 5B4MD 1VB9A 1KLGA 2YEZA 1BM3H 4HT1L 4IMLA 3VXRB 3LS5L 1C08B 4NQED 4UT7L 2X05A 1IEAB 1ZHLB 4QF1B 1D9KA 3RVXC 5C2BH 3GEWB 5E1AA 1M71B 1QRKA 4JREC 4BQ8A 1INDH 1FSKB 1A14H 5JIHA 5I75B 4JGUA 3C6LD 4JFEA 3TH3T 1HK6A 3AAZB 5E8EA 1I7RB 1E6OH 3GSQA 4YQXL 3Q6FA 3ARVA 1ZWIA 5GHWL 4L1HA 4GXVH 1PYWB 1MJ7L 2BOCA 4P2QA 1DL7L 5HD8C 1IFHL 1HKFA 2BX5A 1BZQK 1GGIH 2W0PA 4L4VA 3EJZD 2EECA 5SX5K 5IB1A 4TUKL 2NY0D 4J23A 1YY8A 3O3DB 1HNGA 3RIAK 5GPRA 3D3VA 3MRMB 1G7PB 1JNNL 3LKQB 1JWUB 5DWUL 3HI6L 3CFCL 1AO7B 3UZEA 4PB0H 4P59L 2D3VA 4X7FC 4NBYB 1W0YT 3JV5A 1CF8L 4M4RA 4Y8DC 3C9NA 4MS8D 5EUOB 4B5EA 4CVZB 3NCJL 5EZLB 3FZUD 4LDOB 4Z95L 4OM1H 5HVFB 1WIPA 2BSTA 3TN0C 3CIQA 2QKIA 1BAFH 1JV5A 4QWWC 5EU6E 5JHDA 4TYUA 3QAZC 2VZSA 4O9HL 4NUGL 4P9HL 4G3YH 2GEEA 35C8L 2X4TB 2ZZUT 1NCAL 2LTQB 2JIXB 1DZBA 2CMRL 4LSUH 3W11C 1M4KA 4FP8L 5FYKE 3CH8A 2BP3A 3MSPA 5GGQH 3SGKA 3FOLA 1N3NA 3ROOA 3SGEH 1LO4L 5BV7B 3MR9A 3UTTA 4PRHD 2E7HA 5ESQA 2W38A 4KV5E 2X9YA 4LLVA 1HIMH 4X6EA 1KPVA 1JGDB 4ZPVA 4IRJB 1H3VA 3OZ9L 3WFCL 1ACZA 1V3LA 3TNNA 2XZAL 3GMQA 1F4WL 4FQLL 4WI9A 1G7LB 3RUGE 4RCAA 4NIKB 4JRYA 4RGMC 3D69B 3WFEL 2PUQT 1MAML 1A5FH 4ZUVB 4YBLC 5MI0B 4KK9C 4L3CB 2F19L 3FQXB 2V7NA 1U8HA 3QUMB 5F7EL 2CUIA 1MFBH 4KKAC 3QFDA 3DUUA 2GW5A 1NLBL 3DGGB 5DTFB 1NFDB 3GK8H 1OF2A 3OHXA 1DQMH 4YHKH 4GO6B 5CGYC 5FUCC 1ZLWH 1CFNB 4QRRD 4PP1C 1IL1B 1T22B 4DGYH 2DF3A 3VMPA 3QEQB 3L6FA 3SDAC 2ZCLH 5I9QB 2QQLH 4UT9L 2ZOLA 1WC7A 3GSOB 4I1NB 2F58L 3QWOA 3KPQA 2BK8A 1B4JH 4LU5H 4HUUA 3QI9D 2OXHA 4JCMA 2EDXA 4RRPG 5IVXE 5L0QC 5ADPL 5DI8A 1JGLL 5JNYA 5E4IA 3S3SA 3LIZH 2YN3A 2NXZB 3FOMA 1ZSDB 4FQCL 5I1DA 3K7UA 5IB5A 3TJHD 3BVNA 1I9EA 4YEFA 2BJMH 4JZJA 2DQIH 1S7UB 3H7LA 4EDWL 4Y89A 3HG1D 5FCSH 3IVKB 1DEEA 4KI5E 2F5BH 4U6VL 4PJEE 3U9PH 4GQPH 3MUHL 3QDME 3GBMH 3RTQA 2NMSA 3MODH 4HLZH 2D9QB 5GZOC 5ISZD 1ZVHA 2ZUWA 1VGEH 1FO0A 3SQOL 4P0DA 2QQQA 1RURL 4EDXB 2JK5B 1Z6JT 1M7DA 3BH8B 4PRIB 1JWSA 1QHOA 4X4ZA 5DDHA 1OSZA 4JZOA 4NGHL 2AW2A 1WTGT 4Q9CA 3IDIA 5E5MA 1CTOA 4YHPA 5BCAA 1E4XL 4I0PD 5ENWB 3TWCH 2H3NB 25C8L 4ELMA 4PRAB 1VACB 2P48B 3L9RB 1B90A 5FCUL 1WZKA 2L0DA 5IJKA 4ORGB 4ZFFB 4LCYA 4XVUC 1ULVA 3DX8A 3N0PB 4HJ0D 4EUPA 4HGWB 1TQCB 3SKJH 1QBMH 3H42H 3R8BB 3LD8C 4Y4KC 4BSJA 1FAKT 5D1XC 1UACH 5DQJB 2ADGA 3LN5A 4KUCF 4GRLC 5HGHB 1YECL 1ZT1A 4LCIL 4QRSB 2R2HA 4ZTPL 2C3VB 5F7NC 4PLOB 3BQUD 2BVQB 4M7JL 4N0UE 4RMUA 2FD6H 3B6SA 3ULVF 4JVPA 2C7UB 3GDBA 4K8RD 1KULA 3GIVA 3ARFB 4U31A 2B0SH 3BXNB 5DUML 3CC5A 4XCCH 3BRFA 1H9VA 4Z5RA 3D2UA 1TITA 4OLZH 2NTFB 5D7LB 3L3GA 4OFPA 3ULUE 1S7RB 3RWJA 3QEHA 3MRIA 2DM4A 1URLA 5FA4A 3HCVA 4IJ3B 4TNWF 5MEPB 4GOSA 1DLFL 4U3XA 2DQDL 1LP9B 4XCNA 2DLHA 5KOVC 4XT1C 2Z31B 4PIRF 1OAUH 4JG0L 4LCWE 3WE6A 1MVFA 1MFCH 2V2TA 1P4BH 2A6JA 1EX0A 4ZFGH 4FQXA 5C08E 5JPMA 5KANI 3HMXA 4QXGH 1XR9B 1CICD 2VLME 5DZNA 2YOCA 4U1IA 5IFAH 5J11B 2YXMA 4XXDB 2V2WA 3C8DA 3D9AH 1WTLA 4ZUSA 2B39A 4ZNEE 2AK4B 5E4EB 1BVKB 3QXWA 1HHIB 2VXVH 4MWFB 4DTGL 3HC4L 5MEOB 2I9LB 4PTTA 3RX7A 2GUOA 5D7SL 2XWTB 3BJLA 3P11H 4WCYH 5I74C 3VFRA 2AEPL 2Q1EA 2GT9A 3FO1A 5D1ZB 1MRDL 4ZYKA 4W4OA 1QR1B 3OKOA 5ECJE 4H8WH 1CFSA 1S78C 2VXTL 1U9KA 2Z92A 3K0WA 4OLUL 1FZMB 3S98A 4M1DL 5BVJA 3KYMA 3FB6B 2VDOL 5I8KL 4OCSH 5C8JB 3IT8D 2JCCA 4N0FA 1WAAE 1KBGH 1GGUA 2MNUA 3T65B 4EZMA 5ITFA 5DRZB 5C0EB 3TGXA 1OGTA 1DDHA 4RMSA 5E7BA 1HWHB 2Y5EA 5ADOH 1CXFA 3MCKA 5IMMA 6CGTA 3T04D 3MNWA 3CGTA 3AVEA 1CGSL 3ARBB 4X8JB 4B53A 5LXGH 2IH1A 3PWNB 4PJBE 3C09C 4M1CC 4Z7WA 5EUOF 3RWDA 3S8WA 4LSRL 5T1LB 2NY6B 2V2XA 3DPBA 4EJ1C 3I50H 5FIEA 2ZUVA 3S34L 1A47A 3JTSB 2MOVA 3MV8A 4RAHA 2ARJB 5KS9B 5F89B 3KPSD 3UBXA 3PV6A 3GSWA 4KJWD 2DL2A 1G9NC 3MJ9A 5I15L 2IAMD 4BZ1L 3BISA 3FTGA 3PABA 3MACL 4C55A 4LGPB 5EOCH 2X4OB 4F7TA 3SDDC 4LSSL 3PGDA 1XIWC 1I8LC 5A16B 4QY8A 4R7DB 1Q38A 5LG1A 4XBGA 3W0WA 3MC0A 4JFDE 5FA3B 3VXME 4F2MB 2NQCA 4ZUUA 3PWUA 2PCPA 3NA9H 3F58H 1DBML 2PYFB 2J5LC 5HTSA 1KTRL 4IDJH 4PRDA 1IT9H 3V5KB 5JPNA 1T1XA 5HYJD 4GAGH 3S4SA 2D7TL 5I18H 5CEZD 4OLWH 3STZB 5FHAL 4JPKH 3T0DA 2P7TB 4NNPH 4FXGB 4GLRI 1NFDF 2X4PB 4GG6A 1FJ1A 2VWEE 2A6DB 3MV7A 1ZMYA 4X6BB 3FRUB 3KPRA 1P7QD 1T89C 3MOBH 2HG5B 5KJRL 4XVJH 3VWJA 3QBTB 1C1EH 5JXEC 1UCTA 3LH2H 1WWBX 2VDPH 4WU5B 1RVFH 1N2RB 4HK0A 3GSXA 1U3JA 4I18A 1A1NA 4PJCE 4MA1C 3W39B 4ORZC 4YC2B 4ONHB 4CMMA 5HHQB 1UM6L 3ARDB 2VLKE 3LZFL 1TENA 4FZEL 4K9EH 4Y16B 3EJJX 3PWPB 1YA5A 3D85D 4JDZB 1KLUA 3AMLA 2DLIA 1AGFA 2WBJB 1DSFH 4FFWD 3LKOA 1UXWB 4FMFA 4QNPF 4UBDD 1KPUA 5DMIL 2FX9H 1I1FB 4FQQB 3JWDH 5HY9B 1BFTA 4OZIA 1XF5A 1G6VK 5BV7H 2EYSB 4NC1C 5CP3A 5KTEH 4NJAH 1TJGH 4Y1AE 3UC0H 4KC3B 5DGRA 4P46C 3GJFK 3MLYL 4MAYA 4ODXB 1H5BB 1FH5H 1K8DA 2B5IB 5IBUB 1F3DJ 3QISA 4X6DE 5E03A 3AREA 4DVRL 1AXSA 2RJMA 3OKNA 2A1WH 1NGZB 2I9TA 1IGCL 3LRSB 5B39B 2QQNL 2FX7L 1C16A 3EGSB 1TCMA 4JKPH 3TT1L 3QP3A 1FFPA 3CVHA 4MJ6A 1I8KB 4N90D 1HQRB 3TVMC 1KN2L 1FVDA 4P23A 1QBBA 2FBOJ 5L9DL 1B9ZA 3EYUL 2VLLA 2M26A 2VQ1B 1G84A 1BF8A 3G08B 3DSNA 3H2WA 5C07E 2ZCKH 3L3OA 4MJ2A 1CLCA 3HUJB 5IJVB 4Y19E 2XZQL 1HYRC 4HUKB 1JK8B 1REIA 4CADA 3K3QA 3P9LB 4GKNB 2OK0H 4J1UA 1UB5B 2UYLB 1J8HA 2XI9A 5JXAH 2Y06L 3VXUB 3NAAL 5EBLB 1ZGLM 5F7WC 3CLEL 5EBMB 1YQVH 4GKSA 5D2NB 5MERA 1A7RH 5CMAB 3GMPA 3U46A 3B43A 5EU6A 3L3DA 4JQVA 3F5WA 3P0GB 2QSCH 3BE1L 5I1IH 1UB6B 5F9DC 3KLSA 5CGMA 1A6VH 4KK5C 3GBNH 1XGRA 3I3BA 1RIVH 3WIIL 2AV7B 5E00A 1MFNA 3SDXE 3OR6A 1BJ1H 1XH3B 1IC7H 1MOEA 1LP9F 5GS1A 1XMWA 3P73A 2KDGA 3FFCE 2W9EL 4LAJH 3GRWH 3VFUA 1JGVH 4WWKB 2XG5A 4OF5A 1T1YA 5CJXA 2P8LB 2AI0L 3T3PF 4HZLA 1JF6A 3LPWA 5DD1H 1CXHA 3FN0L 1XGYL 4WFGE 1GZPA 3S35X 3UP1A 4APQD 5FYLL 3ZTNH 4FQIL 5J6GB 5KVEH 4LLUB 3RUGA 4WW2A 2B1AH 4JPIA 2HT2D 3MRJB 5BQ7A 4NNYB 1DBAH 4R4BA 1DQDH 1D5MB 1OD7A 4ETQA 5ITBH 4OZFB 5T5NG 5JORA 5T1KD 1IM3A 5I8EA 4LLYA 4LP4A 2FZ3A 4JFXB 2YD7A 4NOFA 1R5VA 1EERB 3GMLB 4OCYL 1TMCB 1S7VA 2GJZA 5T3ZD 1ZT7A 4MB3A 4YXHH 1L0XA 3BZ4B 2A6IB 3DI2B 4DGIH 4OKVB 4X7SL 4K94H 2MCPL 2A0LC 4KROD 4Y5XC 4XCFH 1F42A 2AP2A 2HTLD 4UB0L 1IC1A 4F7EA 3HMWL 3I6KA 2OL3H 3QHFH 5EU7E 3VRIB 1WVZA 4LLDA 1TFHA 4LSTL 2P5WD 4N8PA 3RP1A 3LMJH 1GIGL 1SEBA 3CPLA 5KSBE 4YDJA 2VUYA 4UNTA 1I7ZA 3KXFD 2DYPA 1WBXB 2HT4D 3PL6A 1CLOL 3GIZH 1BOGA 5EU4A 5ACMA 2BVEA 2NW2B 2ZG3A 3IFPA 1MH5B 4KK8C 5I1CL 2I26N 4RWHA 4PJEA 5H37G 4NQXB 1FVCB 4XH2A 2XQBL 1FG9C 4NZUH 3FB8A 1T7VA 5KS9F 4MD0A 5J57B 1DLHA 3HZVA 3QIUA 4XNZB 4LRIA 1JPFA 5T3ZL 2VDLH 1AY1L 3SJVD 1G7MA 1HHHA 4O02H 4KAQL 1EPFA 4HIIB 3VFOA 2X9WA 3I6LD 3RL2B 3G04A 4HQQL 1BX2A 3LKRA 2UZIL 3U4BH 5KZCB 4IOFC 1NBZA 1JIBA 2VDNH 3VFTA 3K2UH 2ZUXA 1HILA 3LKSB 4G8EB 4PLJC 3CXDL 2L4OA 4JAMA 3WLBB 3GMMB 4S1SH 1CGWA 4HSQA 5BZDB 3MNZA 5J3HC 3UTSD 3VU2A 4KZEH 1YEHH 4WJ5B 1YNTA 1OP5K 3KS0H 4YHLH 5FYJH 4YWGL 5LGJA 3RDTB 4NPYA 1YQ2A 4FXKA 2EH7L 1HINL 5C9KA 3ILPB 3B83A 1KB5L 4R7NB 4ZFOL 1QLRA 4MD5B 2DQFA 4A6YH 4OSUH 1TZGH 3UZVB 1V3MA 3F7VB 4N0CD 1A3RH 5MENE 4U1JB 3T2OA 4N0UA 1KENH 5DJAA 4OFIA 4U49A 1BREA 4PG9B 3VGFA 4O5LL 5SV3A 5GS0L 4LMQI 1RZKH 3DARA 3LSOB 1JRHH 2ATKA 2VXQH 4PJHB 5EG6C 5FO9B 4OJFH 4OFYA 4WUUE 4D9QD 3IXTB 2BFVL 3O6KL 3VFVB 4CVXB 2CJUH 3CLFL 1DE4A 4HJGA 5F8RC 4O4YL 4U1KA 3DV6B 5TDPB 1NKRA 3WS3A 1P53A 1A4JB 3BGMB 4UU9B 1T66D 1NQBA 1UJ3A 4R8WH 1ZLSL 1S9KC 1LK3H 4M1GH 3ARGC 4Y4HD 4JKKA 3STLA 2CLRA 2P47B 4Y2DB 1AFVH 4R6UA 3RWIB 3WEXA 4NO3A 4HKXA 1U8LB 5ERWA 2D03L 2J8UE 4UUJA 1VDGA 4JM4H 1SY6A 5GXBB 4LCWA 1EIBA 1R3IH 3OKDA 1VADA 3QUXB 5FDWA 1A6UH 5CSZB 4LSQH 5C08A 1A6TB 1EDQA 2X4NA 1K4CA 4JRXB 4YHML 2DMCA 3RPIB 3U79A 4MD4B 3P2TA 5F9WB 4KMTH 5MEQA 5ILTL 3GMNA 4ZNEA 4TVPH 4XGZB 4RMRA 2AJXL 4HWNA 3TA3B 3X3GH 2C26A 5D8JH 3FCTA 4OV6F 3VXQA 1GYAA 1M05A 2OP4H 2SEBA 4TUJA 1DBJL 2EXYC 3K4AA 3WDHA 2EIEA 1MJ8H 1QYGL 4KZDH 1UKSA 5DFVD 3F6IA 3PGCB 4M5YH 1AGBB 3PDGA 3IDGB 4MZ2A 1N4XL 1VESA 1RZ7H 2ITCA 1S7XA 3FB5B 2P5ED 1I7TA 1SMOA 4DN4L 3MRCB 1B0GA 1I8IA 4U1HA 3VG9B 1E27A 1VGKA 2AS5M 4Q9QL 5DK2A 1WAAA 3IRPX 2NY5H 1DN0A 1BQUA 1OQXA 4MXWH 5DMJB 1PKQB 1I9JH 2HRLA 4AT6A 4MCYA 1F11A 4M61B 2YSSA 4EQ3A 4U1SB 4RGND 1CIDA 3R0MA 3RNKB 4HWEL 4N8VA 3UPAA 1MI5E 4AEHH 1QPPA 2WMPA 4PJBA 3HN3A 4F57L 4PJ7B 2R2BA 4LASL 1BD2E 4GUPB 4MNHA 1S5HB 2ADJA 3GMOB 3CDGA 1I3GL 4YZFE 5IBTL 2X1QA 4IIQB 3TN0A 4PJ8B 4HWBA 4ACPA 4AL8L 1NCUA 3IXAB 4P4RA 3VCLA 3DRQA 3I6GA 3QUYC 5F1IA 1KC5H 1NANH 1UQSA 3WHXB 3P0YL 3EYSH 1GGBH 4PV9A 1KNOB 1FDLL 4G9DA 1P4LB 4YE4L 1RUKL 2JELH 3QR2A 3G9VA 1KJVB 3DURA 4KMQA 1MWAL 1MHPL 4QRPB 3MGAA 3RVXD 4TOYH 3QDGB 4F7MA 3ZL4L 3QXVA 4DEPC 1HSAA 1U58B 3BUYB 1HN1A 5BVPL 4OGAC 4R4FH 4FG6C 1DEDA 1OAKH 5E8OA 2G75A 2PYED 4JLRB 2PTVA 3V0AC 1X5GA 4H8WC 1DVFC 5L2JB 4JFDA 1RK1A 1JNJA 5FM5M 2W9DH 2V5YA 1CGYA 4NQEB 5HD8D 1I3UA 2CK2A 2GJ6A 4F3FB 3TBSB 2OR8A 1CXKA 2DQGL 4GW5B 3SKOB 5TFSL 4JB9L 4L3ED 1RI8A 4LK4A 3UDWC 2WIIB 4DOHE 1A7QH 1IAIH 2X70B 3T3MF 3QZWA 4FQ2L 3WHE0 2XACC 3C6LB 1W0WB 3CXHK 5EU3A 3O9WC 5I19H 2DKUA 4KPHL 4LP5A 4PGBB 5DO2C 2X40A 3BZEA 2W0KA 3BKCL 5A2IH 4P3WA 3DVGB 2QTEA 4WFFD 4PJ9D 3KPPA 4MXQC 3CSPA 2NY0B 3IU3B 5ANME 4S1QH 2W92A 3O3UN 2IG2L 3GMRB 1WFUA 1F6AA 4MJIB 3W11D 1QFUH 1JTPA 3KDMB 2ARWA 3MGTA 3DYPA 4UT6L 3KVQA 1RJYB 1A6WL 3RI5K 1TPXC 3LEYH 4ZUTB 3S7GA 3TM6A 5IF0A 3RIFF 3TO2B 2VH5H 1OLLA 1NGQL 1LHZA 3LV3A 1EEZA 3WCYA 4HWZB 5GRUH 1PZUB 1W72H 4LVOB 1AJ7L 4YGVB 3OF6A 1KLGB 3B5GA 4J8RA 1MLBB 1DQLH 4WHTA 4IMLB 3U6RA 5AZEL 1F4HA 1GRWA 2VYRE 4Y1AA 5I1JH 4YXLH 3B3IB 1T0NA 4UIKH 5GGTL 3RVUC 4KK9D 4PRHB 5I2IA 3QNYA 1N59B 4NOBA 4KKAD 1OCWL 5EC2A 5E8EB 2HN7A 3GSQB 3HZYB 3DRTA 1U3YA 1L7TL 3C08H 4OD1H 4ZXBD 3Q6FB 2OYPA 1JCKA 5CGYD 1XGUA 1ZWIB 3QPXH 2DICA 1FFNA 2BOCB 4P2QB 2VDMH 4PP1D 2AKRB 2YC1A 3T09A 1FGNL 2DQEL 1QRNE 4HH9B 3SDAD 1OTSC 4PJIF 1NC2D 4OZFH 5E2WL 3EZJB 3RU8H 4YHIA 1FVEA 1JHLL 1AGCB 1I9IL 3X3FL 1JF1A 5H37H 5HDBF 1TZHA 1UVQB 43C9A 1A6ZA 3NCBB 4NCDA 5D1XA 5C07A 1RFDL 1YN6A 4Y19A 1JGUL 5C0BE 4K9EC 4QRRB 4GRLA 1OSPL 1GZQA 2IBBA 1K5NB 1EHNA 2C5DC 1JV5B 5JHDB 4PGDB 1S9YA 1CLYL 3EYVA 4RISL 3U7YL 4Z76A 4G8GE 1ZHBA 3ES6B 4PJHF 1KIQA 1H3WM 4AENA 1T03H 4RAVA 1ERNA 3JWDC 5DMYA 4LHUA 3AM8A 1Q0YL 4UIMB 2IPKA 3KJ6L 3JWNC 4M6NH 4OLXL 2Q76B 5GZOD 3DO3A 3QI9B 5DVLA 4CN1A 3FOLB 5IESH 3VD9A 1N3NB 1FNHA 1UWXK 3O8XA 1KELL 3MR9B 2AJSL 3UTTB 1F3RB 2OJEB 4JO1L 5B38G 4U05A 5DZOA 4AIZB 5E6ZA 5ACZB 3CFJA 5IVNA 1QP1A 1FNLA 4HKJA 3ZTJG 3WDIA 3JVGC 3HG1B 5ALBL 5DD5L 3FFCA 3TNNB 3PNWB 5DJCA 1KTLA 3H0TA 1CE1H 3QDJE 3QQ3A 2ED9A 4K23L 1FNSL 4JRYB 4K7FA 1A4KB 1E28A 5JMRA 4XVUD 2NY1D 4K3DH 3PIQA 1CZ8H 3BUTA 1VERA 1G6RA 1I75A 1U8HB 1WUNT 2JB5H 5EZOH 2UY7A 4Y4KD 3KR3L 3QFDB 5EPMA 5F1NA 3DUUB 4I3RL 5TQ0H 1IZJA 5DJYA 3OHXB 4TUOA 1LEGB 1RZFL 4I0PB 4NO5A 1HE7A 3M1BA 1LEKA 1V7NH 1Q9KA 2NZIA 3O4LD 4JN1L 5T1DH 3CVIH 4WNQA 3FN3A 4WI6A 3MUY1 1XGQA 3U0WH 1MFDH 1HWGB 3QWOB 3IDXH 1ZGLP 4OLYH 3L3KA 5DEGB 2NY7L 1ZVYA 5L2KD 3C5SB 2VLJD 5JOEA 1KEML 4HUUB 2UV3A 2APXA 3E6HA 1MJUL 2Z4QA 5JNYB 1ZLUH 1NMBH 2AJVL 3FOMB 4QGYA 1S9VA 4QRUA 3UX9B 3EOBB 2ZUTA 2I07B 4CJ1A 3FRPA 3BW9B 4AM0A 2D7QA 5IB5B 4KKNA 2XA8L 3QWRA 3CCHB 3WN5B 4JZJB 2DM3A 2ERJB 5KSUB 3VXTB 3DSFH 2HH0H 5J13B 1MFEH 1HH6A 2VB5A 1J0IA 1T2JA 4FQ1H 4N1EA 2PXYA 5KSBA 1GXEA 2JLLA 1DBBL 3IKCA 3RBSA 1EH9A 1BGXL 2XG4A 2VXSL 4H1LB 3VA2C 2R0ZL 3IDNA 2CIIA 3RFZC 4PJ7F 4H25A 5HI3C 5HGBB 2BDNH 3WIHH 4D9RE 3WD5L 4ODSH 4KTEH 5F88A 1XR8A 4EQ2A 1ZANL 2WV3A 5C0RH 3MMEA 4M6MH 4NNXA 1UKTA 3NVQA 3ELAT 3QA3A 4HPYL 4XXCC 3VMOA 2Y25A 2W65A 3K1DA 1MELA 3CFIC 3ECBA 1D5XA 1W8OA 1FN4B 4PB9L 4ESKA 1TQCC 2DJSA 2R0LL 1T83C 4LCYB 5DRXA 1E6JL 1KGCE 3ZYIA 2CPCA 4JHWH 2X4UA 1OM3H 1OOAA 3I75B 3V0VA 5FECB 3LS4H 3SDCC 2XT1B 4D0CA 1CICB 1UT9A 4TPRL 3SDDA 4XP4H 4PJDB 4RFOL 1XIWA 4K94C 4ZTOL 3NZ8B 4CRPA 2ADGB 2WINB 1G0XA 1VFAB 2XN9E 4LLMA 2NX5E 4WIQA 2OZ4A 2XKNA 5DQDH 2R1XA 5IVOA 1YPZF 3L3IB 1CXEA 3PXHA 3VXSD 2QSTA 4Q2ZA 4UNUA 3D0VB 3ULVE 1OL0A 4WVRA 1DUYB 4FQHB 2ICWA 3IDJB 4F33A 3LKNB 1PJ9A 1N26A 5CHNA 4PJ5D 4G42A 5MENA 3P0VH 1TVHB 1KJ2H 3MRDB 4IDLA 3VMNA 3RWFB 4Z5RB 1OAXH 5C0GA 4M1CD 5D5MB 1GGCH 5GRWA 2D31A 1INQB 2DWEB 2E7BA 5ICXB 4BSWA 3PWLA 1ZKAA 4NKIH 1T89A 3HCVB 3OAYH 2NNAB 1EGJL 4HT1H 5BJTA 4K2UL 5JXEA 3LS5H 5EBWA 1TNNA 3O3BA 2CKBB 4UT7H 32C2A 5EWIL 1JYVA 5I76B 1LO2H 2YA0A 5FO8A 3CXHJ 2XNAB 4G43A 3V52L 3EDFA 1ND0A 3WE6B 2Y6SD 2V2TB 5DC9B 5T3XL 5FHBL 5IHZA 4WFEE 2LAAA 2J8UA 4GBXC 5DMGC 4U1IB 4OGZA 1DFBL 4L8BB 4YQXH 4LHQB 2DI9A 2EDNA 3FONA 3T2NL 1KT2A 5CZXC 3VXRE 1TCRB 4GMTL 1BEYL 3NMEA 4NN6B 5GHWH 3GSVA 1MJ7H 2O5ZL 3KPSB 1DL7H 2H8PB 1IFHH 4M9PA 4RBPK 3UTPE 2EEDA 2K9UA 3HC0B 2AJZB 4NKMA 2IAMB 4ONGL 4U6TA 3QEUB 4TUKH 2FJGA 3GNMH 3MRHA 4KVNL 4XB8A 1T5XA 3NABL 3VFRB 1F4YL 2D0GA 4FTVD 1B2WL 1U3HD 2I24N 3GFUA 1JNNH 4P46A 2WIMA 1BQSA 3HI6H 5DWUH 2J6EL 3CFCH 4P59H 4ZYKB 3V6BR 1IKFL 3BX7C 1NCDL 1MSPA 1CF8H 1U8PA 4XCEA 5I1AB 2HVJA 5ETUB 5E8DL 5HGDB 3ROLB 3VFPA 3NCJH 4Z95H 5I17B 4MMXC 1RZKC 1EJOL 3BDXA 3HE7A 4DKAA 4LVNC 3MLWH 4J6RH 4N0FB 2NY4C 1IBGL 4O9HH 4XCYA 4NUGH 4P9HH 4JKLA 1NLDL 4HC1A 5TE4L 1D5IL 1IGML 2ENYA 35C8H 3PDOA 1CFVL 1NCAH 5HYJB 1A2YA 1J86A 3O6FC 3TVMA 3P9WB 3TZVC 1AO7E 3N85L 3MCKB 3V0WL 2CMRH 5TH2B 4FP8H 3KPTA 3S37X 5EOTA 3HC3H 4POZC 5EUOE 2WUBH 2IH1B 4Z7WB 4M5ZL 3DLQR 1LO4H 3UPCA 4R97B 3HFML 2F53D 2V2XB 1GOHA 3OAUL 5L8LB 4LLQA 3BKJL 1P7QB 4E0RA 4RA0C 3OZ9H 3MV8B 2XFXB 3WFCH 2WZPD 1MI5A 4Y5YA 5IIEB 2XZAH 1F4WH 3G5XA 1S7TA 3OL2A 3PV6B 4FQLH 3GSWB 1A3QA 2CRIA 1L7IL 4ZUWA 1I3RB 3WS6C 3WFEH 1T3FB 1MAMH 1BJMA 3PABB 3OKLB 4U6YA 3LCYA 1T7YA 3F12A 2ID5A 3NACL 5TF0A 3AY4C 5DJXA 2F19H 5D96C 1UM5L 3BWAA 2BXYA 1S7WB 3X11A 3PHQA 5F7EH 3D85B 1CDUA 1O7VA 1IEBB 1RZGA 5CJQL 3TYGH 3PGDB 4M62L 1N8ZA 4QY8B 3SKNA 4OIAA 1EEQA 2B8OT 3X12A 1YC7A 2PTUA 4UT9H 5FKPA 3O3AB 3LQZB 3BKYL 2F58H 5EZJA 2IBGA 1T1XB 4B0MM 2IQAA 1I1AA 1UJTA 1OP3K 1A22B 1NFDE 5SWQB 5JR1L 3KLAA 4YDKL 3O45A 1CDYA 5ADPH 2UWEA 1TQBB 2NY5C 1JGLH 4IS6B 3WO4C 4OQTL 3QEQE 5BOPA 4YR6B 4FQCH 3E0GA 1UWGL 1BBDL 1MCWW 5KG9B 5DHVB 5DGQA 4EDWH 3VWJB 4POYA 3T8XA 3T4AB 1D5BA 4U6VH 3IGAA 2C1PB 3ZTJH 2P8MB 1XCQA 1AKJA 3GSXB 3V5HA 5ID1B 2BC4B 1HH9B 3SQOH 4LPVA 1T1ZA 3EZ8A 1IKNA 1WBYA 3O4OB 1JWMA 3TEUA 5ANMA 1YDPB 3F7PC 2P24B 1CR9L 4ZDHB 4NGHH 2AJUL 3QH3A 3RGVC 4OFDA 4KK5D 5DJ2A 1UWEL 3MCG1 1FAIL 3KPNB 3MLVL 2X41A 5MHSD 1E4XH 2CSPA 4QNPE 2OTWB 1F45A 25C8H 3D39A 5KAQG 4OZ4A 5FCUH 1RAMA 1XF5B 1F6FB 3MRNA 2QADD 4LBEA 4PRIE 4YHNA 1RHHA 2C3GA 3C5ZC 5L8JB 5DJZA 1KTDB 4XC3L 4F15C 3HS0A 3UBXI 3QUKA 4PGCA 4AH2B 3WXVL 1K8DB 4FOMA 4MVBC 3DIFB 4C56A 4PLNC 3SGJC 4DKFL 1JPTL 1JPST 4S1DD 3OKNB 1YECH 4LCIH 1JZ7A 2EDEA 3ABZA 3UO1L 4M7JH 1IGYA 3WUWA 4L8DA 1FFPB 2VKWA 3UTZA 2UUDH 4U3CA 1FVDB 4NZTH 4KGLA 1VEOA 5DUMH 5DF0A 1ZT4A 4PJDF 3BDYL 3FO2B 1QRNA 2W91A 1OGAD 2ZJSL 4CMHC 5I1HL 1QVOA 3GM0A 4CN4A 2A0LD 4CADB 5IKCA 2R69L 3SE9L 4J1UB 4F9LC 1J87A 1J8HB 2LVCA 3DUHA 5T1KB 2R4SL 2BHYA 1J12A 1DLFH 4EEEA 3S5LA 2DQDH 3RZWA 4XPAL 5KW9L 3OXSA 2QBWA 1MLCA 5C0BA 4GXVL 1J0JA 3BPNC 4GKSB 5AZ2H 1GGIL 2X1OA 4JG0H 3ARQA 3BGFB 2BNRA 1JJUA 1EFXA 5D7LE 5C9JA 1F5WA 5D5MF 5C1MB 3RX8A 4PJGA 4PD4K 4KK8D 4G8GA 4OCMC 4KROB 1XGRB 2DLEA 1A7OH 3P30L 4WGWB 4C56D 4LCCC 4HCRL 5BZWB 4PB0L 4HIJB 1BLNA 1K8IA 4MA3A 5GZNC 3OXRB 1LP9E 3OR6B 3NFSL 4H1LH 3QCVL 4LPWA 2P5WB 3VFUB 3Q1SL 4DTGH 1T1YB 3HC4H 1YEIL 1X6NA 3T3PE 3G6DL 5C0CD 4OGXL 3B5TA 3KXFB 5D7SH 4HZLB 3VD4A 3TCLA 5DHYA 2AEPH 3ARGA 2GSGA 3J7HA 4F7CB 3RWGB 2IGFL 5JW4R 4PV8A 1MRDH 4IOFD 2YPLD 5AWNL 4OI7A 2IBZX 4R90L 4Y4FC 5EB9A 5ESAA 4ZFOB 3LKPB 1UG9A 2BNQD 4BQ9A 2VXTH 4OLUH 4P57B 2AK4E 4KJPC 4M1DH 4NQVA 3SJVB 5BQ7B 3MJ9L 2VDOH 5I8KH 2FJHA 3C5JB 4NKDB 5T5FH 1FYHB 5JORB 1IM3B 3WFBL 3EJYC 4X9GA 1CFQA 3H9SA 2Q7NA 2DAVA 1ZA3A 3LAFA 4HKZB 5HI5C 5CP7A 4ZO9A 1JHKH 5GSRA 1S7VB 2GJZB 4HIEA 1ZT7B 4TRPL 1HEZB 4L9LB 4F80A 1AIFA 1W8NA 3GO1L 3OGOE 3QXAA 4PRNA 1IM9D 2ZPKL 4J2XA 4GQ9L 5HGAB 2X5PA 2VUOA 4LSRH 3VGBA 1MREL 3VH8A 4D8PB 1CN4A 2F8XC 1Q94B 3DUSB 3S34H 2EO9A 2GTZB 2OSLA 1NAML 5F1SA 5HI4C 2VO5A 4UOW0 3L5XL 4W4NA 2DD8L 4GS7C 4OAWA 5DK0A 4CL7A 5DD3L 2BOBB 3FHQA 4DGYL 3EYFA 1DBKL 4BZ1H 5I15H 5GISL 1I7ZB 2DYPB 3PL6B 5IUSA 5K9QI 3MACH 4Z7WF 1WZ1H 4TSAH 2NY2C 3I9GL 5SX5H 4LSSH 3T0EC 3S88L 5KS9E 1XF3A 3FB8B 1HOCB 3GI9L 1HI6A 5ESVA 3HZVB 3QIUB 4JDVB 1MCNA 3VXPA 1JPFB 4AY0A 1KOAA 1HHHB 5E8NA 1DBMH 1KG0A 3BPOC 3PWVB 1F97A 3U30C 1L9MA 3CDCA 1PVHA 4TSCL 4UDTA 1NCWL 4OGYL 4Y4HB 3H9SD 4QHLA 2D7TH 4LLAA 3LKRB 3U9PL 2F5BL 5FHAH 3GZKA 2DLFL 3GBML 5J12B 3QUYA 1EAPB 2XWJA 4P5TC 5GRYA 5GGRA 4WGVB 5CEXA 4NSKA 2EXYD 3BO8B 2FJFA 2HVKB 5H2BA 2YPVL 2Z93B 3M8OL 2AABL 5DR5L 4KY1L 5TDOB 1MNUH 2YRPA 5JW3H 4YDVA 5D70L 4GG8A 1BOYA 2GCYB 2XN9A 2DQFB 2NX5A 3WNMA 3LPGA 1EHAA 1VKXB 1UM6H 3LZFH 3QFJD 4FZEH 5J06A 2PETA 4JY6B 5AG9A 1TJIL 1QQDB 4HS3B 3WXWL 4DW2L 4GKZB 3UDWA 5GGVH 3CVHL 4ZO6A 4JFQA 4NCC2 1UM4H 1FL5B 4P4KC 3SO3B 2P5EB 5DMIH 3MBXH 5FYKD 1UGNA 3BKML 3O9WA 1FV1A 4KKBC 4M8QB 1UJ3B 1NGXB 5C0NC 2G2RB 4U7MA 5EIQA 1ZE3C 2VMFA 2YUXA 2FD6L 4I5BB 3PWPE 2HJFA 3MLYH 3PGFL 4NO3B 4HKXB 3ALXA 3I3DA 4GW4B 3FHAA 5CD5C 4DVRH 3L5WA 2CIKA 1CDJA 3V7AE 1CYGA 2Q7YA 4BKLA 3VGGA 4RGNB 1U8MA 5T1MB 5B8CC 1IGCH 3VFSA 1CI5A 5TPWL 2QQNH 2FX7H 2N1KA 4XC1L 4L9DA 2X4NB 4KUZH 1C7SA 1RV6X 5IHBA 2BNUB 4NZDA 2CRYA 1KN2H 3E2HB 3OJMB 3VXRA 2HFGL 4WTZA 5L9DH 2WSKA 5HYSB 1GSMA 1F3DH 3EYOB 3L7FA 3LEXA 1DVFD 1ZHLA 5EH1A 4QF1A 1KXQE 5T33L 4QHUA 3VXQB 3FCTB 2FDBP 1M71A 5HPMB 1OTTD 3N1PC 5FYKL 5C6PB 1MFCL 4MYWB 2XZQH 5JLZB 2W0FB 3B2VH 4ZFGL 5DURD 1R0AL 3RY6A 3CX5K 3MJ8B 1IAMA 4YNYB 3AFLA 4JREB 3AAZA 4X83A 1I7RA 2DB8A 2Y06H 1S7XB 3BT2L 3NAAH 1I7TB 3CLEH 2PYEB 4G6KL 4KJYB 1J1XL 4OM0L 1I8IB 5DO2D 3E3QE 1VGKB 4N1HB 3HUJE 4RGOL 3O3DA 4JE4B 1WT5C 1FLRL 2C1OA 3BE1H 1DN0B 4H20L 1CBVL 9CGTA 3L5HA 4MXQD 4JM2C 5A2LH 3LKQA 3WIIH 1JWUA 4RDQG 1ROWA 4L3EB 1AO7A 5IB3B 4XAWL 3VXUE 1CCZA 1GOGA 3QDMD 1GCFA 4Q97A 4HUVB 5EUOA 1S9XB 3QJHB 4CVZA 2W9EH 5EZLA 5D2NE 1J0KA 2ZG2A 43CAB 4OUOA 2AI0H 4QGTA 4XHQA 2HMIC 3FN0H 3TN0B 1XF1A 1SJVA 2X4TA 4P4RB 5ADOL 2OQJA 3I85A 5FYLH 4FQIH 1A9EB 3QAZB 4WI4A 5F1IB 4G7YL 3M17A 4PV9B 5DD0L 3QIWD 1MIML 2XICA 5JIPA 4GAYA 3AXLB 4PGJA 2C4XA 2YD5A 2OS7A 5D7KD 3IDYC 2GAZB 4YHZH 3HE6C 1HSAB 4IRJA 4PD4J 5IQ7L 5E8OB 5DFTA 1HHGB 4OB5H 4HUNB 4OCYH 3BD5A 1RK1B 4M43L 2LABA 2E7LA 2ZWLT 3D69A 1G0YR 1NSNL 4P2OC 4X7SH 1F02I 3QULB 2GJ6B 3WV0A 4Z0BL 4P9HC 1OTSD 4L3CA 1DN2A 4RGMB 3FQXA 1UA6H 1IARB 2GJJA 1IZKA 4YBLB 3QUMA 4UB0H 5DC0A 3HMWH 4XI5D 2EDYA 3RHWK 5DTFA 3T3ME 3NIFE 3V5DB 4LSTH 4LMQE 1GIGH 2XRAL 1IL1A 5EU3B 1T22A 1J05A 1CDCA 2VTFA 3QEQA 3F58L 4ONOA 1CLOH 5BO1L 4XMKL 5AYQA 1S8DB 3SDAB 5CLTA 3SKUD 2VN4A 5F3BB 5I1CH 3KPPB 4WV1C 1NC2B 3NCEB 1NL0L 1TETL 2XQBH 3P9MB 1FQ9C 4D9LL 2EDHA 1Q72L 1QD0A 2BHZA 5CZVL 1RJLB 2DIAA 4N9GB 1CT8A 5T3ZH 4JFZL 1AY1H 1T20B 3FZUC 3DI3B 4KAQH 3V79C 5L0QB 1NCCL 4AMKL 2EDQA 1YEDB 1S7UA 4Y0GA 4HQQH 4KQ3L 3IVKA 4X5LA 3LV3B 1EEZB 5DSCA 2UZIH 3JXAA 1B4RA 3WIFB 2RCSL 1M6OA 4QYOB 4KQ4L 1V3JA 5IV2A 4DZ8B 3CXDH 3U6RB 3GRWA 4E41D 1NEZB 4EDXA 2OM5A 3BH8A 3QIBC 4PRIA 4XHJC 2VSDA 3A6BL 4YWGH 5J6HB 2EH7H 3A0OA 3QNYB 1WSST 1KB5H 5ENWA 4HLJA 2H3NA 1F6LL 1VACA 3GSUB 3L9RA 3IFOB 4XXCA 3WFZA 4HBQA 5I8CA 4PBVC 4ORGA 4ZFFA 1TXKA 1NUDA 4DK6A 2MTPA 1MCFA 3EOAB 4ETYA 5GS0H 5EUKB 3CFDA 3CSYB 4K71B 1X5XA 2NY1B 1XFPA 1FVEB 1P4IL 2BFVH 3O6KH 2PO6C 5DQJA 1OW0C 2G60H 1A6ZB 3LD8B 4O4YH 4Y4KB 5JZ7C 5D1XB 3DO7A 5HGHA 4QRSA 2C3VA 1BFOB 2DS4A 1ZLSH 2BVQA 1JYNA 2V9RA 4HH8A 2JB6A 4JKPL 1EEYB 4WO4C 4WTWA 1U8OA 1FGVH 4PJXE 3EYQC 5D7JC 3MCLL 2C7UA 3CFKB 2VZ3A 5L6YH 4WHDA 1VHPA 4PJHE 3IDMB 3ARFA 4HW6A 3BXNA 4Z76B 2D03H 5E2TL 4RAVB 1AGEA 4MJ5B 4YFLI 1LD9A 3PG2A 5SWZD 3V2AR 3MRLB 1WBZA 3VGDA 2IPKB 2NTFA 1FRGL 4H0IA 5HI3D 5EZIL 1S7RA 3H3BC 3TJHC 1RJZB 4YHMH 1G7JA 2EEAA 4FS0A 5MEPA 2XTJC 3HNVL 3CFJB 1LP9A 5ILTH 4HKJB 1NDMB 3JUZA 2Z31A 1QFWM 1R3LB 2AJXH 3TIDB 3VXMD 3RKPA 4LDLB 4FFZH 2F15A 4V2CB 3HI1B 1QYGH 1GAFL 1XR9A 4JRXE 3PIQB 4YPGB 3GBNL 5F1OB 1N4XH 2HJKA 4XXDA 3SDCD 2WBKA 1JP5A 3P4NB 4DN4H 4FFVC 2AK4A 4TUOB 1BVKA 1HHIA 4LNRB 5MEOA 2I9LA 3K1KC 4Q9QH 1NBYB 2XWTA 1R3JA 3OKYA 4WNQB 4U7KA 2XY1A 5EIIB 4CGTA 1CWVA 5D1ZA 1LDPL 1QOKA 5I74B 5LCVH 1QR1A 1B0WA 3FAXA 4J3VA 1R24A 4X5XA 1A8JH 4A6YA 4HWEH 4F57H 4O51B 1FZMA 1WV7T 1Y6KR 2NPLX 4G9FD 5CEYA 3EOTH 4LASH 3BQUC 3FB6A 3SCMC 5IMKB 2VLKD 1I3GH 1DQDL 1B0RB 5C0JA 5C8JA 3SN6N 5HJ3B 5IBTH 5BOZG 3T65A 1UKQA 4AL8H 5C0EA 5IMLB 3VXSB 3CX5J 1RQ5A 5GGSA 1PKQE 1T6WA 4M7LT 4PLKC 2Z8WC 1J0YA 1RUAL 3P0YH 5GQBA 4YXHL 1FDLH 4X8JA 1F90L 1EO8L 2YD3A 4YE4H 3SBWA 1RUKH 1VEMA 2D7PA 4PJ7E 4DGIL 1EVUA 3CMGA 1MWAH 1MHPH 4PJ5B 3IDNB 5T1LA 4H25B 1Y0LB 3ZL4H 4Z7QF 2FATH 3C09B 3JTSA 4PBWD 5BVPH 2EYTB 2ARJA 5F89A 4GBXD 2EKSB 3O11A 4L3AA 1VFBB 3VI4F 5CZXD 1YMHA 4DWHA 4O2EB 3ECBB 3HZKB 5DYOB 1IMHC 4QRPE 1PW3A 1L0YA 2DQGH 5FYJD 3GIZL 3QDGE 3TT3L 3EO9L 5TFSH 4JB9H 2J12B 2EE6A 3RY5A 5L7XL 2X4UB 3DJ9A 5A16A 4DVBB 4FQ2H 5KN5B 4R7DA 4EXPX 1ZS8B 3SDDB 3PWJB 1XZ0B 1XIWB 4KPHH 2AV1B 4O02L 1U41A 2ITDB 4NQEE 3TO4D 2PYFA 4LLMB 2XKNB 1N64L 5CD3B 4Z7UB 3V5KA 1FZOA 3ARXA 5DJ8B 3RVWC 2NY4D 4QTHB 2J5LB 4MNQD 3STZA 1OTUD 5I0DA 2GSIB 2IG2H 4FTVB 1FYTD 3DTXB 5TE6L 2X4PA 3O6FD 3TZVD 1C5DB 4I0CC 4BH8B 2EDLA 3JSSA 1JNHB 5EO1B 2A6DA 1R3HA 4X6BA 4UT6H 4WFHE 3FRUA 3VXNB 1MY7A 4JGJA 1A6WH 5C0GB 1FFRA 4AZ8A 1LMKA 4BSWB 1LO3L 1NGQH 4NRXB 2Y4SA 1LO5B 4KDTC 1AJ7H 4OD3H 4BSVA 1N2RA 4HV8B 1JFQL 5AZEH 2Z91A 3W39A 32C2B 1XGTB 2D4FA 2VDRL 4M7LH 1CVRA 1MIEL 4MA8L 4MA1B 4EN3D 3PWPA 3AB0C 1CDIA 3HR5B 1IC4L 5GGTH 4BH7B 5IWLA 2RIKA 1BQHB 2HAZA 4XPBL 4LGSB 2F53B 5IHZB 2WBJA 3BPCB 4TVPD 3NN8A 3RGVA 1UXWA 6FABH 3CD4A 5IHUL 3RBGA 4Q7DA 4HS6B 4QT5A 1L7TH 1I1FA 4NC0B 3MROB 4E5XB 5HY9A 3SGDH 5C09D 2QQKH 1FGNH 2DQEH 1GL4B 1D6EA 1OD9A 2FJGB 4ODXA 5E2WH 1H5BA 1UFUA 1NJ9B 2F8VA 2OBGA 3HHRB 1L4IA 1T5XB 1JHLH 1I9IH 3X3FH 4PRHE 2WQRA 5D9SB 4XMLL 2MWCA 3FO9B 4NFDA 4JM4L 1RFDH 3QG7L 4HUXB 4XCEB 5DK3A 5F96L 5B39A 1JGUH 3VFPB 4HFWA 4P2QE 3L1OL 2Q3AA 1OSPH 4JGMA 5IW6B 1Q8MA 5EA0L 1CE6B 1I8KA 1HQRA 1CLYH 5IEHB 1JTTA 2VDKL 4RISH 3U7YH 3R0NA 2AJ3A 1QA9B 3O2DA 4FABL 3TVMB 4GRWB 4O2FA 4TVPL 2VQ1A 3LQAL 1MRCL 3G08A 1Q0YH 3X3GL 4OLXH 3HUJA 5IJVA 1WISA 1EHXA 1P9MC 4KZDL 4D3CL 1JK8A 4QRRE 4EI5D 1JZ3A 3P9LA 1KELH 1UB5A 2ICWI 3D6GA 3QNXA 2UYLA 2Y07L 4DFHA 3Q2CA 4V1DA 4LLQB 1Z9SA 3HAEB 5JHDE 3VXUA 4E0RB 4EUPG 5EBLA 2ZCHL 1YEGL 5AEAA 1OP5H 1CGXA 3K8LA 1S7TB 5E8PB 5CMAA 1QKZL 3OV6A 2AK1L 1FNSH 4XVSL 3ILQC 1ONQB 3A6OA 4R2GC 2FHFA 1UB6A 3UTTE 4AQOA 3RNQB 4PRBB 2W1NA 4MXWL 3C5ZD 2AV7A 3BWAB 4FFWC 3PHQB 1A64A 5GGSY 1OPGL 4MVBD 3KR3H 1R3KB 5F3HB 5F9JB 1XH3A 4I3RH 3B9KC 3HG1E 1LK2B 2QR0B 1RZFH 4WWKA 2P8LA 5FO7B 1X5KA 3OR7B 4JRYE 4JQXA 4WY7L 1PG7X 5FKPB 5EZJB 5J6GA 1KC5L 4LLUA 1NKOA 2NY7H 3MJGX 2DLGA 1KEMH 3W5NA 3UJTL 4UILL 3S35L 5JOFA 4Y4FA 1AI1L 3MRJA 5CJ8A 2UWEB 3BHBB 1MAJA 1KACB 2XKUA 4KJQC 2AJVH 1KCKA 2DQCL 4OZFA 4V1DD 1R5IA 2XA8H 4R4FL 4OI9A 5JOPD 4F58L 3VGAC 4WUUD 2ICWJ 5A40E 3IGAB 4EBQL 3BZ4A 2A6IA 1BGXH 2VXSH 4N0YL 3V5HB 2R0ZH 4OKVA 1I1RA 2E5EA 5F9OL 4NO0A 4RNRB 3WD5H 4X99B 2AGJL 1WBYB 1OGAB 1JWMB 2H41A 3MLTB 1ZANH 2J7LA 1J7VR 3VRIA 4QHNB 3MTRA 1IAIL 3UXFA 4Y5XB 5DJ2B 4HWUA 3E8UL 4NM4L 2OXGA 3X14A 2PW1B 1WBXA 3D39B 2Q8BH 4PB9H 3MX0A 3KLDA 2R0LH 2P44B 2NW2A 1MH5A 1UH2A 4MXVF 5DQ9B 1E6JH 3MRNB 3DMMC 4ZPTB 4BFBD 1RHHB 1FVCA 2N7AA 3N1GC 1KSRA 3MXVL 4HAFA 1EJ6A 4TPRH 3T0EA 4C56B 3PHOB 4OD2B 4RFOH 1CGUA 2BVOB 4FMKA 3V6OC 3RY4A 1HHKB 4KJPD 3NH7L 4LSVL 4C4KT 5C0CB 1R5WB 1PQZB 2IMNA 4JJHA 4APQC 1W72L 5EO0B 2GFBB 3QNZB 1I9RH 3LKSA 4G8EA 3IYLW 3WLBA 3GMMA 3MUJA 4PJDE 2HT2C 1NCBH 3VG0L 2YPLB 5BZDA 1SMAA 5LKNA 5DJ0A 2EDOA 1CD8A 3UBXG 1ZT4B 1J0HA 1WIOA 2ICEA 1TVBB 4XMPL 2ZSVB 5BXFA 4PRPD 1W0VA 4E42B 1FNGB 4Z7UF 4L8SC 5FGBC 1X5LA 4WENB 4MDIB 4R7NA 1EGJH 3BP6B 5HI4D 4K2UH 4MD5A 5I1KH 3S5LB 3F7VA 4MZ3A 5EWIH 1Z9OA 1JI1A 3CUPA 1I3VA 1MHHB 4U1JA 1BD2D 2YHGA 4PJXA 1A9BB 3DYMA 2BNRB 4E9LA 5D5ME 3G5VA 1IM9B 5CKGA 3PQYA 4UQ3A 5T3XH 3LSOA 5FHBH 4N5UA 3RU8L 2VZTA 4HEPG 4PJGB 1MFAH 5FO9A 5AAMA 2BSRB 1F58L 3IXTA 1DFBH 4CVXA 2WK2A 3S4SG 3T2NH 2R4RL 4MA3B 4GMTH 3DV6A 4JFOB 5TDPA 3RA7L 1BEYH 1A4JA 4ONFH 2E27L 4UU9A 2O5ZH 4KRPC 5IT2L 1EA9C 2IFFH 4ONGH 1OT1A 4Y2DA 3NPSC 3RWIA 4HX1B 4KVNH 5J8OA 4G8IB 2Z35B 3N9GH 1F4YH 1U8LA 4YHYC 3ARGB 1B2WH 3J8F7 3JTTB 3FT4B 4LKCB 4QO1A 2J6EH 4PV8B 1HDMA 1IKFH 3QUXA 1NCDH 2EE2A 3HNTL 5F97E 4P5TD 1B88A 5E8DH 3FFDA 3U7WL 2MPAL 3KPSE 4I3SL 4ODHH 5CSZA 1A6TA 5DMKB 2HKFL 5GS0C 3TNMB 1D5ZB 4JRXA 1EJOH 1HNFA 3W9DA 1IBGH 3RPIA 4MD4A 3LHPL 1NLDH 5TE4H 7CGTA 1D5IH 1IGMH 3DHMA 1CFVH 1X5HA 1CFQB 3H9SB 3VWKC 3N85H 4RQQA 3V0WH 1ZA3B 3TA3A 3L7EB 5GSRB 4JKMA 4WHYG 2R8SL 3QXAB 1YMMD 5EBGA 4DAGL 3HFMH 3PGCA 4TNWK 5IW1B 3IDGA 3BKJH 2A6KB 5J7CC 3FB5A 3U4EA 1X4YA 5HYJE 3N50A 3D5OF 3OQ3B 5DK0B 5CEZE 4P4KD 4HXBH 4GRWF 3RZCC 4P2RD 1V7NL 2ICCA 2EDKA 1MEXL 1U93B 1HHJB 2QL1A 1ACYL 4KKBD 1CTNA 5T1DL 3CVIL 2P46B 4Z7WE 3RWHA 3NGBC 3QFJB 3NACH 2OX5A 1PKQA 5DJDB 4MX7B 1UM5H 2HFTA 4JG1H 1HXYB 2YRZA 1MRFL 3ARYA 4M61A 4MHHI 4U1SA 5CJQH 3MV8E 3RNKA 4M62H 4NO2B 5CD5D 5E2JA 4J3SA 5LVEA 4PJ7A 4OQ1A 3QHTC 2KZ1B 2OMNA 2CQVA 3DXAD 1UXSB 2BSSB 4PS4L 4GUPA 4XPFH 1S5HA 1MCRA 4FZ8H 5IB4A 4IIQA 4PJ8A 3V4UL 2CLZB 3IXAA 1FO0H 3ZDZF 3U36B 3BKYH 1BF2A 1MFEL 4YX2L 1YJDL 1H3TA 1KNOA 4M02A 3MLPA 1P4LA 1FC1A 3OKEB 3QUYB 5JR1H 4YDKH 1KJVA 3GSRA 5CEXB 4JJ5B 3VE0A 4ODSL 5H2BB 1BBDH 3BUYA 5C0RL 3BPLC 5KVDL 4JLRA 1UWXH 4DEPB 4YDVB 5L2JA 1AXTL 4EUPH 3TBWA 1P5UA 2O61A 1U36A 4NQEA 1DVFB 4F3FA 3X13B 3TBSA 3VFGL 5IK3B 4H88L 3SKOA 2UWEF 4XP1L 1MUJB 4O00A 2AJUH 4JHWL 1KPRB 5DURB 4JM2D 2X70A 4OKDA 5EOQH 2MMXA 1FAIH 3C6LA 3MLVH 4XNQB 1W0WA 3WL9B 1A7NL 2Z9TA 1I85C 3OTTA 4PGBA 4ZQKB 5DRWA 5BMFL 4R96B 5AD0B 3O9WB 4JO3L 1FV1B 3DVGA 2X1WL 1WJ3A 2HMID 3IU3A 5HDOA 2W9LA 1NUNB 4XC3H 3WXVH 5GJSL 3GMRA 3I2CL 1WICA 4BJLA 2MQ0A 4Z7NF 3IJHB 4DKFH 3ZKMC 2CIKB 1JPTH 3KDMA 4HMEA 3QDJD 3DV4A 3ARTA 4J3OC 2A73B 5E99L 1YEJH 3WJJA 3TO2A 3UO1H 2HKHL 5CLWA 4HWZA 5EORH 1TPXB 4YGVA 1XCTB 3HE6D 5ACLA 1MLBA 4BFEA 3HMXH 4IRSC 3L7FB 3LEXB 4AK1A 1LO2L 2CR3A 3BDYH 4QHUB 3MBED 3WLWC 2BY2A 3B3IA 4P2OD 2ZJSH 3VRLF 5I1HH 1CQYA 4NKQB 3T2QA 4PRHA 2X89D 1PAMA 2R69H 3MRBA 3SE9H