4H8WH

Crystal structure of non-neutralizing and adcc-potent antibody n5-i5 in complex with hiv-1 clade a/e gp120 and scd4.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
212
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCAASGFTFSTYAMSWVRQAPGKGLEWVSSINNSGRNTFSADSVKGRFTISRDNSKNTLFLVMNSLRAEDTAVYYCAKDLRLGGGSDYWGQGTLVTVSSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 CLADE A/E 93TH057 (H375S) GP120
molecule tags Viral protein/immune system
source organism Homo sapiens
publication title Structural Definition of an Antibody-Dependent Cellular Cytotoxicity Response Implicated in Reduced Risk for HIV-1 Infection.
pubmed doi rcsb
total genus 42
structure length 212
sequence length 219
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h8wH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h8wH01
4M6OL 3WFEL 4UV4L 4TOYH 4MD4A 4JFDE 2CIIA 3AU1B 3MODL 4Q9RL 3NOIA 2Q76A 3LN5A 4WI5A 2F9BT 1Z9LA 4A2LA 2CKBA 4AM0B 4MVBC 3JWOL 3HE6C 3T4YB 1NAMB 1XGUA 4J4PA 3RL2B 3QDGB 2BY1A 1B4JH 4TSCH 4I3RH 2MQ0A 1J1PL 4FFWC 1JHTB 1JGDA 4I9WD 1U8HA 1U3HA 2JCCE 3O2DH 4XAWL 4JAMB 1VADB 3JZ7A 3FZUD 4MNQD 4PJAA 5DWUH 1ZLVK 3WSQL 3ROLA 5K9KB 4HS3A 3PGCB 2NR6C 5K9QG 3ILQD 1A6PA 4I4WB 4R3SA 3FHQA 1Y6MR 5DVMA 1UA6L 2B5IC 3ULVH 2O61A 2A73A 2XV6B 4K9EC 1I3VA 3HRZA 4NKIH 4JDZA 4Y5XB 3CLEL 3N1MC 3SOBL 3P40A 4YDVB 3QDAA 1C16A 4D3CH 5DRZA 2WUBL 4IM8A 3VDAA 2ICEB 2FHBA 3JUYA 2BVPB 1FFQA 5GGSB 2AK4B 1ND0B 4NBZB 4OIAA 4UNUA 2MMXA 4YHZL 3ALXA 2P5EB 5I1LA 5KVEL 2YEZB 3QUYB 1IMHC 5FF6A 3NMEA 3N0PB 4CVUA 5DWUL 1F8TL 3KHQA 5AAMA 1LEIA 5BQ7A 1LP9B 3AAZA 2YC1B 5DURB 2E9JA 5ACLA 4NKIL 1JFQL 3C9NA 3GSXB 5E9DA 5INDA 3WXWL 1BBJB 3B2UD 4ZYKA 1NCCL 5F9WC 5HI4C 4FQIL 2YS4A 1YJDC 1WICA 3MLRH 2FX7L 2C4XA 2DBLL 1P6AB 4R8WH 5FIEA 3S5LB 4PD4K 1U0QA 4PLNC 5EU6B 3TBWB 3DMMC 1KUMA 3LB6D 1KTLA 4PJDE 2R0LH 4PTTA 4AMKH 4NHUB 1B4RA 2WIIA 5SWZE 5EU6A 5CZKA 3TH2T 4IRJA 5HHXL 3EAKA 1MCJA 4OGYL 3OKDB 5CGMA 3QQNA 4JFHD 3SGKC 1UZ8B 1V7NL 1IILE 4QXUH 3GFUA 4XH2A 1D9KD 1SJEB 4D9RD 1YECH 2Z8RA 3FN0L 3PG2A 2AJUL 4OT1L 1BBJA 1DE4B 5DRXA 3EYOA 3S88L 3LKSA 4PREB 1X7QB 1JTPA 4PJDF 3D5OF 3QBTB 4QXTA 5CFHA 3WS6C 4OD3H 3U46A 3RZCB 3DLQR 4XC3H 1QHOA 4MAYB 4AG4L 3VXMD 5CHNB 1WSST 4JE4B 2X4SA 4OCYH 2HFTA 4DFHA 4CN1A 3WN5C 3CH1A 5EULV 3MV11 2NW3B 4UDUB 3O9WD 2OXHA 5F1NA 5EO9A 4M7JH 3PQYD 4FP8L 2EDFA 4KY1L 4XNUH 4ZXBB 1O5DT 5DYOB 1NCDL 1QBAA 3O6LL 4YHPA 4ELMA 4HUUA 2WMPA 3TM6A 1YECL 3WKML 3PDGA 4ZSOE 1W72H 1OTUD 2BHYA 1RFDH 4LASL 4BSVA 1N0XH 3NIDE 1YC8A 3RVUD 4HFUH 3IT8D 3O0RL 1T7ZA 4PV9A 2LVCA 2V17H 3HC3L 3FT2B 1MJJB 4KROC 1PGRB 1ZOXA 3PGCA 8FABB 4UINH 4JFHE 3C6LC 3O6KL 4NNXB 3GHBL 5T1MB 1PKQA 3IFOB 5C09D 3STLB 4CL7A 3MGTB 3MRCB 1CL7L 2PR4H 3VGBA 2BNUB 1QRNE 1XR8B 5FM5O 4MJID 5DVLA 1HDMA 3S7GA 3NZHH 4ONHA 1QBML 3NN8A 3CFJB 4JPWL 4KTEL 1FNFA 3OF6D 2I24N 3SGEI 3EFFB 1BZ9A 3UJJL 3AGVA 4GAJL 4HJJL 1ZSDA 5IEKA 2W59A 3FT3A 4QTIH 4XPTH 3RVVC 4F7EB 5CCKL 4LSTH 2AXFB 3EFFA 4X5WA 4KVCL 4GUPB 5IROC 3HUJB 1RJZA 5ILTH 2DF3A 4IDLA 1OSZB 3FKUS 3RWJB 3SDXB 1RUKH 4NFDA 1KB9K 2FEEI 2QSCH 3CD4A 2B4CL 3I9GH 4PRPE 4OD2B 2HVKB 3QEGH 3FT2A 4J3UA 5MENA 4XXDB 1P4LA 3UJTH 4MJ5A 1A4JB 1A6VL 1NMAL 1KENH 5TE7H 5T3ZE 1U8IA 1DQQB 5C07D 3SE9H 2BNRB 2IMMA 3STZB 2LVEA 5DTFB 5A3IC 1I3UA 4H20L 5F8RC 4NRXA 5CCKH 4XVUD 3TT3L 5GJTL 3LD8C 1GOHA 3M8OH 4HD9A 1IGIL 3MOBL 2XG5A 2R23A 4AENA 3Q6FA 1E6OH 5SV3A 5I8CB 4Q2ZA 2EIEA 4K07A 3LQZA 4LSPL 1LO0L 3SGJC 1KOAA 4PRHD 4G8FB 2QQLL 4NRZA 1UKTA 2Y7QB 3KHOA 5GGUA 3SQOL 3EKCA 5IKCA 2C4FT 2A9ML 3E6HA 1JF6A 3RWHB 4IIQB 5FB8A 3H9SE 3K2UH 4GRLD 3MRIA 1R5IB 3KLAA 1FE8H 1DQLH 5GRWA 4PJBE 2EZ0D 5B38A 3UJIL 1CGSL 4Y16D 5F9OH 3GBNL 4KHXH 3MR9A 4I0CC 3GMLA 2VDLL 1U95B 4PRPD 3X12B 3L5JA 5HGBB 3PWJB 5D96B 4OFVA 4GQ9L 2EE6A 3VXSA 2APVA 1R0AH 1G9MC 4XCFH 3ULSB 1G7MB 4PJ8B 4BUGA 5CEXA 2EYSB 5TPWH 1BWWA 2OX5A 1WZ1L 5KZCD 1IKFH 4FQXC 4NO5A 3UDWC 4PJFE 1OTSD 1BD2B 3LV3B 2WINB 2IF7A 5JZ7D 3TC9A 1IAMA 1S5IH 3EUUA 1WBYB 5JZ7C 1MJ7L 2IADA 3GJFA 4K3EH 12E8L 1GGBH 5I1EL 4OF8A 2PETA 1O7SA 3QPXH 1RUPH 2HMID 4HC1L 3LOWA 2E9IA 1JYXA 4N1HB 4OV5B 5ICXA 2L4OA 2XT1B 1S7QA 1ZT1A 2R56L 1G6VK 3HE6A 4J23A 4ZUUA 5L2KE 1RZ7L 3MCG1 3IF1A 1I8LC 3HI1A 1FBIL 3OKEA 2Z31A 3RUGB 4KK8D 5DQDH 2GHWB 4NC1E 1IC1A 1I1RA 4TUKH 3AVEA 1FPTL 1AO7B 1TCRB 5JA9A 3F7YA 4Y1AB 4Z7WB 3DRTA 5EBMB 4NJAH 1S78C 4M8QB 2YPLE 1QP1A 3RDTA 3BZFB 4MXVF 3SDXE 5C0FA 3C60A 3MA9H 5C6PB 3GMRB 1TFHA 5CGTA 1X6NA 4HC1H 3DPBA 3HRZB 4X80L 1FNLA 3E0GA 1PBYA 4K94C 4NGHH 1JPTL 1XT5A 2ILLA 4NNYB 4L3CB 4LLWB 1KBGH 5IG7A 2R1WB 3IAQA 1LD9A 1XF3A 3P9MA 5DJDA 3RGVD 4PGEA 5KS9F 3NCFB 2ENYA 5CINL 3VXTB 4YFLF 4X6FB 4X9HA 3EIFA 4NNPH 3ZT5A 1LO2H 3JXAA 4HS8H 3RA7L 2IBZY 2QQNH 4RZCB 5CP3A 1MWAA 5I16B 4Y19E 5C08D 1A7OH 1S9VB 3ET9F 5HI3C 2ID5A 2LTQC 3B5TA 1CVSC 4FZ8L 4L4TB 4KQ3H 2B1HL 2ZPKL 2FNBA 1XGUB 4MCZB 3D69B 3L3OA 4UT7L 1V3JA 3A0OA 3HRPA 1U8MA 2N4IA 1MCSA 4WFGE 4DEPC 2ZUQC 2CD0A 4LEXH 1F3RB 1QA9A 3ZE1E 3NTCL 1D3CA 4RAVA 4XMKH 4DVRL 1WCQA 5D5MF 5GQBA 3LS5H 1JNHA 2D7OA 1S7XA 3O6ML 1J5OH 1JBJA 1AHWC 4O2FB 1A6WH 4R4FL 3DVIA 4NO2A 1KACB 5IFHL 5B4MD 5JNYA 5GGSY 1DANU 2JIXD 4KTDH 2R9HC 4WV1C 3RWJA 3UTSE 1U6AH 4OLXH 3BZEB 4YXLL 4YXHL 1N3NB 4QRRA 2DN7A 3T2NL 1MUJA 1FJ1B 3CVHH 4HIIA 2N7BA 3U6RA 5E95B 3CVIH 4F9PC 2VZTA 4TVPH 2HYMA 3ARFC 1I9JL 3IDGA 3B2VH 5DHYB 4OD1H 1NL0H 4FQXB 4G9DB 3WFDL 2HT3D 1RZJL 5JUEL 2WBKA 1HQRA 4IHOA 4CRPA 1DSFH 2BVTA 4WI8A 1E4XH 4M7LH 2OTWA 4CNIB 3ABZA 5GGSA 3FQWA 3I2CH 3VFOA 3MLVH 1HXYA 5J6HA 4TVPE 1CFQB 2OR8A 4HS6B 1KIQB 4L29A 1BREA 3WS6A 3WHXB 2VDKH 1J1XH 1U36A 2H32A 3HS0A 3O8XD 4ODHL 3SKNA 5J6GA 3KYOA 3IAPA 5CJOH 4ZQKB 4WI3A 4GBXA 4ZOCA 1AD9B 2PTVA 1A7RL 5L2KB 1JGUL 3B3IA 1Y18A 4XNMA 3TN0A 3E6HB 1AIFA 4MA8H 4M6NH 1NL0L 2V9RA 4MA3B 4YIQA 4XP6L 4YDKH 5ALBH 3RIFK 1MJ8H 4FQJL 1G7QB 3T77B 4LSQH 2CRIA 1MRFL 1MAKA 3B9KA 4YO0A 3EBAA 3L5XL 4NBYB 4DFIA 2F54E 3UTTD 4N8VB 3SO3C 4XZUB 2BMKA 4HC1A 3DGCR 5HY9A 3CMGA 2GTWA 2A0LD 3NPSB 2X9WA 3HE7A 3ROOB 4ESKA 4FQQB 1HSBA 2CKBB 2CLZA 3P4MB 2EEBA 4MNHA 4YQXL 1JRHH 5EPMA 4M8QA 5E94A 2E7HA 2H8PB 3KYKL 4WW1B 4B41A 4NQCE 3MLYH 4OCSH 5DFTA 4YHIA 4FRWA 1GZPA 5D5MB 3NPZB 5H94A 1TZHB 3U0WL 2F74A 4PJIE 2GY7B 2V5YA 4L3EB 2BFVL 5DK3A 4PJXA 2VLLA 3IDMA 2DWDB 2F58H 2VMFA 4JB9H 3GNML 3OJ2C 4ONOA 4HK3J 3AROA 4Y8DC 5C3TA 4ZYKB 4LARL 3L3GB 4JVPA 5IMLB 4YHZH 4JM2D 1K2DB 4X5XA 2JTDA 4G8IB 5GGUB 5HHPA 2X4UA 1T20B 2Y5TB 2PO6A 3HPLB 3AREB 4IBLT 2NY5L 5KTEH 1DBBH 3OB8A 2XXCB 1YMMD 2X1PA 2AEQL 2KPNA 5I8EB 4WHTB 4PJEA 4JDVB 2F53A 3TCLA 1OW0C 1H3GA 3QH3B 2EECA 3IKKA 2YEZA 3PV7A 3QISA 4X98A 4NN5C 4O5LH 3RVXC 2G9HA 5L2KA 4LKCB 2VLRA 3BN9D 4TRPH 3UYRH 4G42A 2WUCL 2J8UF 1GOFA 3EYUL 3FAXA 4HQQH 2VDRL 1EX0A 3LY6A 5EORL 4WWKD 1TETL 3ZL4L 1P9MC 3KLHD 1MVUB 4UI2A 5I0DA 4FQCL 4IMKC 5DJZB 4HK0A 3CSBA 3VFUB 3KNBA 5DD3H 1Q9KB 1HQRB 2GJZA 4FFWD 4IHOB 5D1ZC 5C0BA 4GW4B 4R9HA 4JRYE 2PYED 4PJAF 1EUTA 5JR1L 5K9KA 5SWZA 1G7PA 1KCVL 3ARZA 4X7EC 5DFVC 5J12C 2PW2A 3U82B 3UBXA 5F71A 4MQXD 1WT5C 3BPOB 3MRRB 1T4KA 2Z8WC 4AQOA 5F3BA 4F58L 5D5ME 3GMMB 5C0RL 4KKLD 3MV7E 4S2SB 5E5MB 5E99L 4L4JA 2ICCA 1JGVH 4BSWA 1J0HA 1CLZH 1HSAB 1AFVH 4P3DA 2CDFA 4P2QE 1D5BB 5DVNA 3U36A 2O5YL 5EU3B 3DX7A 2BNQA 4UOJA 2IALB 3QCVH 1JNLL 4XXDA 1FC1A 4HHAA 2UY7A 2VXSL 4HKJA 5K59F 4XP4L 1B0WA 4ZFGL 1JF1B 3QT2A 1H8OA 3U4EB 2VITB 4N8CL 2Z35B 5KS9B 5HYSG 3IJYB 3JV6A 3S5LA 3U30B 5SWSB 3MYJB 5FB8B 5IQ7L 4C56E 3QIUC 4S10A 1WIUA 4B7LA 1CK0H 3D3VB 2GI7A 3GBLA 4IIQC 2JLLA 3RPIB 4AZ8A 4ZNEE 4G8FA 2MNUA 1RURL 2V7NB 1EO5A 4IMLB 2DQFB 4PRIE 4WW2B 4OLVL 3DUUB 3ULUC 4G43A 4XNUL 2VH5H 3ULVE 1PKQB 1Q9OA 1I3GH 1CXHA 4Y2DC 4WW2A 4YEFA 2DWEA 4PJIB 3V5DB 4PGBA 3IDJA 3DURB 4L1DA 5HHMB 1QYGL 5IHUH 1S78D 4N8CH 4QYOA 5BS0D 1MCPL 5MERB 1CFNB 3RNQA 4GBXB 4I13B 5CEZD 3D3VA 5E0QA 1AKJB 4M5ZL 1K8IA 4XCYA 4RGNB 2EDQA 2XWBB 4BFIA 1ZGLA 5SWSA 2XFXB 5B22A 4OZIF 1X4XA 3OAYH 3VWKA 4MJ6B 3C5JB 2OTWB 4OGXH 4ZNCD 1UB5A 4UB0L 3HC4H 3Q3GA 1IC5L 1MREL 1CFTA 2I5YH 1GXEA 4D9LH 3QDMD 3WS3A 4KH2A 4UT9H 5E8OA 2XN9D 5F89B 1LEGB 1EV2E 4JKLA 5JXEC 4LPVA 5F44A 2X4QB 1AC6A 3ME0A 3BQUC 5DMKA 1DBKH 2ICES 3DXAA 4WW2C 3UTSD 3QEUB 1MUJB 4NZJA 4S1QL 5EUOF 3VWJB 3NN8B 3HI6L 3UC0L 4C4KO 4NQDD 2VN4A 4LNRA 4JHWL 3QIBC 5F88B 3REVB 1S3KH 2XZZA 1MHEA 2FWOA 2QHRL 3QIBD 2J6EA 4XPAL 4RAUB 3DBXA 4PRNB 5F1KC 2RQ8A 4G9FA 3UJTL 1NMAH 4X6EA 5BO1H 4ZXBC 2GJZB 5C0BB 3T08A 1QBLL 2OR9L 1I75A 2I5YL 1BJ1J 5HGGS 4H26A 3SDAB 1U8KB 2A6JB 1S8DA 4HUVB 2YRLA 4P2RD 5JHDE 2PYFA 5DHVA 2WIMA 5F7DA 4XHJC 4UQ3A 3TPKA 4XBGA 2Y25A 4AIXA 1P69B 4S0TD 5EOTA 5KSAA 3UPRB 3C5SA 3MNVB 5C0JA 4OF5A 5GS0H 4HUXA 2UVFA 1OGAB 2HMIC 3TGXA 5KN5A 3LN9A 3RWGA 4OKDA 4QYOB 4P3WA 3NAAL 4GG6E 3RWCB 1TMCB 1KT2B 3DVGA 3QNXA 5FOBA 3MRMB 4M4PA 1F90H 2CSPA 2FDBP 1IEBB 3S37X 5FECB 3Q5TA 3H3BC 4HZLB 3KXFD 3WIHA 4NQVA 1X5HA 1UG9A 3L6FB 3AXLA 4S1RL 3GMQB 2AXJA 2X4UB 3S9DB 3QUMA 2MOVA 2HP4A 4RA3A 1W0YT 2CXKA 3GBNH 3V5KA 1K2DA 4NKDB 1RZ8B 3QA3B 2K7PA 1PVHA 1YEJH 1KCRH 4PGCB 3JV6B 5DUMH 1R0AL 4KJWC 5FO8A 1ZV5A 3CDCA 3TBVB 2ERJB 2VAJA 4K7FB 3O3AB 2APTA 4X4XA 3CH8A 3QUKA 3QXDB 1UXSA 4WTZG 1T04B 2ITCA 4O2EA 3KVQA 4XP1H 3Q0HA 43C9B 5JW3L 4LLAA 1U8LB 5DZNA 1A1OB 2NX5B 4YHLL 1WBZA 1TVBB 1RUQL 3L3DB 4I5BA 3BQUA 2CMRH 1KCSL 1O0VA 2D7NA 1FAIL 2ARWA 4BK4A 2H6PA 3KPMA 2EDLA 3BEWB 2GUOA 4HF5L 4D0DA 1SEBB 1U8JA 5JIKA 4YGVA 1CLOH 3CNKA 3P4NA 5DD6A 1WFOA 3QUXB 4MLSA 4XPBH 1JGDB 3RBGA 4RX4A 4NQEA 4J1UB 1ACYH 2H2SD 3TNNB 4AT6B 2C1PA 2D9CA 4GW1A 5J3HD 2HRPL 1UZ6F 1WFTA 1S7SA 1AC0A 3VWKC 3KPSA 2ATKA 4RBPK 4MB3A 3D2UD 5D7IB 3IFOA 3STLA 2NY1D 1JV5B 1BM3L 3SDDD 4FQLH 4KKAD 1QHPA 3RKDC 4U2ZA 5K9QI 4X5LA 3PGFL 3W39B 5ESAB 1NGZB 3ARDA 3KYOB 1M7XA 4E9LA 3LDBC 3BKCL 3VWJC 3DHMA 3UZQA 5JXED 4ORGA 2X6MA 2MTPA 4ZS6D 5GRUH 1N7ML 4HS6A 15C8H 4I18B 3EYSH 3LIZH 3U9PL 5BZWA 1YEHH 1I4FA 1Y0LB 5I30H 2V5SA 1MRCL 3ARTA 4UNTA 3OKMB 2GJ6B 3F58H 2XWBA 4BFIB 2ITDB 1T7YA 2I25N 3P73A 4LRNL 43CAB 5JHDB 3RA7H 2H3NA 1X4YA 3BYTA 5GZOD 5IW1A 5J7CC 1A7OL 2G5BB 4JJ5B 1UM5H 4M6ML 4PJDB 2PYEE 4MD5A 2YD8A 4D8PA 1U42A 5I8KL 1T89A 5D7JA 4ZDHB 4W68A 1HHKA 1KC5L 1JHKH 4HT1H 1F6LL 4S1SL 5D6DA 1Y6NR 1CICC 3LS4L 1XMWA 2ADFH 4LCWB 1DE4A 5HVGB 1SJHB 4KK9C 2JJSA 4FQ1H 5KN5B 1OLZA 3JWDH 5D1QB 4IOFD 1Z5LA 1CXIA 1A1MA 4MGXA 5DK0A 4DW2L 2DBJA 3WMSA 5KSAB 5IQ9A 1L0XA 3VRIA 3QZWB 1NBVH 3RWDA 3S97C 1NAML 4U1HB 4M6OH 2N7AA 3P0VH 1Q38A 2I26N 4X7SL 3MRJA 3W82A 2PNDA 4QOKA 3PJSB 3NIDF 1IT9L 1CE6A 3QI9B 2NZ9C 4F7PB 4MAYC 4WO4A 1MF2H 1G7LA 1ZA6A 2VUYA 4NKDA 1H8SA 4UOW1 1AGCB 4WUUA 3NCBB 4I3RL 1JYVA 5SX4H 2BP3A 1A4KB 5CEYB 3HR5B 3OAYK 3RY6A 4TVPL 1SBSL 3MRGA 4MA8L 1WLHA 3MJ7A 4LCIH 5JUEH 1MIMH 4FABL 1M7DB 1NAMH 3QNZB 2DS4A 3JBG7 1FL3B 2R1YA 4BK5A 2ZCLH 3ULVD 4CGTA 3JTSB 1EK3A 1XIWA 1KYOK 1LILA 2BNRE 1RIUH 1RUML 2GTZB 3KG5A 4LHQB 4Y4FC 3MLZH 3B3IB 3FN9A 5ISZD 3T1WA 3KPOB 4Y5VC 3G6AA 4WI6A 1FNHA 2Q8AH 2Y07H 2JB6B 5I1GH 1DL7H 3T0EE 2ZUTA 1R3HA 4ODHH 1ZK9A 1FYTB 1X5GA 4ZUWA 5CJ8A 5J56B 1RUAL 1F8TH 1T0MA 4X6CA 5LGJB 3GGWA 3C09C 4CDHA 4PJBF 1S8DB 4HUVA 1VESA 4K9EH 3V6ZA 3BH8B 6FABH 1ADQL 1KEML 5T1KD 3QXUA 4OZGA 3EW3B 4G42B 4RGMB 3ARBA 1U92B 4G8GA 2GY5A 5D7LB 4DTGH 2DYPB 3CSYB 4FS0A 3JTSA 3O11A 2Y36H 3GSUB 5GGRA 1KCUH 5EZOL 3VGDA 3DECA 4U1MA 3UMTA 2BRRL 2BHZA 3BGFC 2VLKA 3DMMB 3GMMA 5ESQA 5KAQG 4OV5A 3MJ9A 5LWYL 3AREC 1HYSC 1PSKH 1J10A 2QKIA 3SJVA 4PJGB 4XX1G 3KYKH 3PGDB 1SJEA 2OYPA 4LPWA 2YK1H 4OQTH 4YHNA 2LE9A 4Z7WE 3QO1A 2YXMA 1EBAA 5IW6A 3A6CH 3CU1A 2Y1VA 5CJXC 5E6IA 5MHSD 3MFFB 3PWLA 2ICWB 5L9DL 1H3PL 4JY4A 5A2JH 1HHGA 4X6BB 5I1KH 2CDGB 1JZ4A 5IIEB 1JPSL 5DJ6A 3ZHKA 5I1DB 5E08L 3DIFB 3WHE1 1HEZB 4X6DB 5JDSA 4U1GC 4QLRA 5JOPE 4ZFOA 4ELKA 1BQHA 2OBGA 2Z92A 1MHCB 5DJ0B 3RY6C 4D0CB 2AJUH 2CLVA 4KRLB 1OQOA 4LLVA 2KUTA 4GBXC 4LGSB 2UY6A 4Y0GA 1TQBC 2FZ3A 3HLAA 4G5ZH 4CW1B 3HE7B 3ROOA 4BQBA 5EIIA 4GAFB 2BERA 5C0CB 3WNKA 1T2JA 3U48A 5GZNC 3TO4D 3TBTB 3CZFB 1EFXA 5A43C 3DVNA 3U4BH 4NZUH 4AQ1B 4HUMB 1OM3H 5F6IC 2BJML 3DVNB 5LGHH 4U1GB 5IW1B 4HQQL 3ULUL 4NN5B 5TH2B 2IEPA 3MUHL 4OD3L 1C12A 3P77B 4GXUM 5ERWA 5FCUL 3V4UL 5JHLH 2V17L 3JV4B 4KI5D 1MCCA 5F7MC 3TIEB 3GO1L 1WK0A 4OGZA 3QUYD 4K3JH 1DVFA 3NZ8A 1QSED 1NBZB 3MRKB 1LO5A 3QUZD 3NCJH 3OKLB 4V1DA 4UV7L 1IAOA 2PW1A 3MROA 4Z0XB 5C6TL 4JHZA 1CDBA 4KDTA 2DI9A 3QIUB 2O93L 5IQ7H 5HHOA 1NGYA 1I3RA 2VZSA 1MQKL 4Z7VB 3OGCB 3CJJA 4UINL 5HYJA 5KANI 1MCQA 1RZKC 5I1CH 4J4PD 1F13A 4P4KD 1GGUA 3JTTB 4WV1A 3LV3A 1S7TA 4O58L 1U8JB 2O5YH 1G7QA 4O51A 1YPZB 4LU5L 2X4QA 1OWRM 1QFUL 3UJJH 1U3HD 1YC7A 4UU9A 4N0FA 3U1SH 1MCIA 5HGAB 1AHWA 1VEPA 4HIHA 3LRHA 2AXGA 5JW4M 4X9IA 3H9SD 1R6VA 1D9KB 1TPXC 1ZKAA 3ARWA 3FO9A 3NIFF 4M03A 4L8CA 2VXQH 4P2OA 2EYRA 2IANA 1CE1L 3QZWG 5EA0L 1EEZB 2R2HA 2JCCB 5KSVA 4OCLC 4XI5C 4X4ME 1NDMB 4R7NA 5A16B 2IBZX 2NW2A 1A8JH 3BPCB 4PV8A 3TWCH 5JXAH 3QXTA 5FGCE 3VE0A 3WO3B 5C7XL 5I1IL 2OM5A 4HGWA 2BC4B 4Y16C 5HY9B 4JRWA 2DQEH 5FUCE 4XWOD 2BNQE 4RIRA 3L1OH 4WI7A 4YE4H 5IB2A 1S9WA 1ZT4A 5BVJB 2FBJL 1UH4A 2EDRA 1SVZA 4YHYB 3EDKA 5IHZA 3D1MC 4FQXD 3SQOH 4DKDC 1V3KA 1DBKL 5BJTA 5K33A 4YIQB 2VXQL 1IL1A 2FX8H 4QXTB 3SE8H 2HH0H 2P5WB 5J89A 3V9FA 4EI5D 1CXFA 3L7FA 3FJTA 1A4KA 5CEYA 4H8WL 4LLVB 4X7TA 4HMEA 4AL8H 4HUXB 2R0KH 5GHWH 5I1JL 1AI1L 5I15L 1I8LA 2NW2B 2MPAL 3T0DA 1GOGA 5GXBB 4WO4B 5H94B 2OQJB 4D2NA 4JRYA 3OTTA 4XPHH 3VXOB 4GKOA 2DLFH 4XCFL 1AY1L 1C08B 5KG9B 1J0KA 1DUYB 1TJGL 1WZ1H 4J3XA 2A6JA 4IRSD 3QFJB 1IFHL 3TBWA 1JK8B 3PWUA 4FZEL 4O02H 3SDYL 2VL4A 2RB8A 4MX7A 3PABA 3GJEA 2YPKA 8CGTA 1KIRB 3JWNC 5FUZL 4GH7B 1R3LB 5I1EH 1QFWH 4OCXH 5MEPB 4EQ2A 4LLUA 2VABA 5IOPA 1OP3K 1OOAA 1L7TL 5DI8A 2R0KL 5GHWL 5BRZE 3K3QA 4GKSB 3B9EA 4OUUA 1OCWH 5IVXF 5I1AA 2ESVA 4LEOA 5CEZL 1E27B 2FO4B 1LEIB 1YQVH 2DLEA 2E6JA 5CZXC 1A6TB 2P7TB 4NM8H 5IJKC 2K3TA 3QCTL 4L3EE 3VXRD 2J4WL 5C07B 1MFDH 2BNRD 1ZLVH 1U3YA 1WQVT 1BQSA 1JWMA 5CBEB 3FQUB 4XAKE 1J8HB 1U8QB 2W9EL 3MGOB 1HKLL 1RIVL 2HWZL 5FO7B 4Z7UF 1IGYA 1D5IH 4K7PY 4M02A 3BIAX 3VG0H 3ZKSD 1KB5H 2F19L 3C5ZA 1KULA 1C16B 3QEHB 3S98A 4FHBD 1JPTH 4LDLB 2JB6A 3BISA 4XP1L 4POUB 1FHGA 3IYLW 1P4IL 3NPSC 4KU1A 1N59A 3GMPA 5CLTA 5T3XE 2P8LA 1I7UA 3MUZ1 3RUGE 5IMKB 3FB7A 4Y8AA 1FVDB 1EGJA 4URTB 5F7EL 1ACZA 4HWBA 2AV7A 3QEQB 4NZTL 4RMSA 3RKPA 4M9PA 2AW2A 4YK4C 3H7BB 1L9MA 1S9WB 1IGTB 3V5HB 4O4YL 4GQPH 2UV3A 1SQ2N 1JWSA 2WBJA 2R2EA 3VGEA 1A6ZB 3CDGA 1H3XA 1PAMA 1NFDE 4OLYH 5EIIB 1RAMA 2DQGH 1UYWH 3GBML 3HB3D 4B5EA 3DO3A 2UVEA 4LOUC 5JW3H 5I8OH 4PR5A 4A6YL 3FO0H 3BMWA 4FFZL 2RCSH 4XVSL 5JO5B 5TDNB 4Z7WF 5L88L 5FAAA 5AYUL 3OQ3B 4WJ5A 3IKCA 4F8QA 4LP5A 1ZVSA 5IHLB 4C58B 4JY6B 2XN9E 4PGDA 5C0EB 2OMBA 4YHIB 1D5BA 3VFSB 4ZS7L 4M3JA 4CUCA 1M7IA 3K46A 5IWLC 4JVUA 1A0QL 5FYJE 1JPST 1SJHA 1GIGH 1C8PA 3T0EB 5LXGL 4UIKL 4R4FH 5FO9B 3VFPB 4G7VH 3VFWB 2VDML 1OAYH 5EZJB 3RTQD 3TZVD 4TNWF 2NY3B 4L9LC 4KRPD 5FECA 4GMTL 3UPCA 4NUGH 4WU5B 5EN2A 2JJTA 3GSOB 3CIQA 4L5FL 5JMOC 5A1AA 4I2XA 5IM7A 4ZPVB 5DEFB 3QDHA 3WFCH 4PP1C 1T5XB 3LQAL 2B0SH 2EICA 3MRPB 5CIPA 3PWNB 3VRLE 4KI5E 4PRBA 3KLSA 1DQQA 2BVEA 2G5RA 1J87A 5IF0A 5HBBA 3WSQH 1XGQB 3VFOB 3O8XC 2Q3ZA 3KYMA 4GO6B 1KV3A 2HLAA 1UEMA 1MCOL 1D5XB 2QJDA 5I71B 2DIAA 5TE4H 1KJMB 1SM3H 1NAKH 5ALBL 2W38A 1JMZA 2GTZA 4KMQA 4U1NA 3VGAC 2DQHH 2UUDH 4JAMA 1YQ2A 2X4NB 3KXFE 5CJOL 5ICXB 1A9BB 2P7TA 3SGKA 1ZGLP 4X5WB 4IMKA 3QHFL 2AQ1A 5HHMD 2O5ZL 1HINH 4JFDB 3RZCA 2XWJB 5TF0A 4HIEA 4L3AA 4HDIA 5DGRA 3QUXA 5C0GA 1MJ8L 4FQJH 3L3GA 5IMLA 5CJQH 1WC7A 3D18B 5KW9L 1Q0YH 5E2TL 1NCCH 3QXVA 4Z5RB 4ONGL 2D9QB 5JA8B 3IU3A 3WV0A 4ELKB 4C57C 1BOGB 1DQMH 2ARJB 1T66C 4JFXB 4IOSD 2VLRE 4IRJB 4NJ9L 2DM4A 3ILQC 3T2PA 4JM4L 3HAEH 3QIWC 4UOW0 4K7FA 7FABH 4PTUB 4FQIH 2CGRH 3CXHK 4YFEA 5B38B 2QADB 1NDGB 1QZ1A 2AEQH 5C86A 2Y9RT 1OGTA 4J2XA 4ZS6C 1IGJA 5FA4B 3G6DL 5C0DA 3QG7H 4G7YH 2MQ3A 4P5TA 4WWKC 2CUMA 4K3HA 4HPOL 2BXZA 2Q8BL 4DTGL 2ZG3A 3DX8B 4PBWD 2NPLX 1NBYA 1A2YA 3AM8C 2Q86B 3EGSB 3RNKA 4J3VA 4KROD 1N6VA 1BAFL 2Q8AL 2EE9A 1OTTD 4IS6B 1I7UB 4AG4H 2Q87A 5C9KA 3BEVA 3ZMRA 2NY5H 4YPGB 5KTEL 2CLVB 4WU7A 4KJPC 3P9LA 4WEBL 4XC3L 4G7YL 5HYIA 1P2CB 4M43H 4Y19A 4XMLH 4P23B 2P24A 2VC2L 3VJ6A 4OCRL 3HNVL 4KKLC 5IB1B 4YDVA 4CNIA 3ESVF 4HKJB 2CDGA 3S88H 5E8PB 4J6RL 4NQTA 3WLBB 1AXSB 1J9CT 1FZMB 3GSVA 5HGAA 3TN0C 4OV6F 1K85A 1FL5B 4PRID 1J86A 4XMPH 1FN4B 1MFAH 4L8SC 4HCRH 3UP1A 1JIBA 4JZNA 4HJ0C 1N0LA 4PPTA 2ATKB 1LGVA 5I1AB 2WNGA 2EDEA 3CFJA 1JHTA 1UH3A 4M43L 3EO1B 3QWRA 1HH9B 4XMLL 3HR5A 2AS5M 1A02N 3U0TB 4M1GL 2VXUH 5CBAA 2C5DC 5TQ0H 4FG6D 3M17B 1DEEA 1KEGL 2AKRA 1BD2A 3MO1B 2PW1B 3MROB 1GGCL 1LE5B 5FKAB 4LHUD 1MH5B 4DOHB 4RDQG 1ZHNB 4JPKH 4NKMA 5ESVA 4WFHD 4YDLB 5A40E 1KPUA 4M62H 5FM5M 1JWUB 3BIKA 4QRQB 1I1YA 4HK0B 4XPTL 2FJFA 1FLTX 4CADB 2ICEA 5SV4A 4ZUTA 1WIPA 3KS0J 1WJ3A 5D7JC 2JJUA 3NCYS 1CZ8H 4K3JL 5IB5A 5D1XA 4N0YH 2H32H 3L3HA 2QTEA 2VH5L 2C4FU 3SKJH 1WCBB 1X3DA 2OI9B 2YSSB 2O5XH 4GG8B 4JZJB 4Z7UE 1F4XH 5E9DB 5IHUL 1IGTA 4LSTL 2X70A 4NQDE 4H25B 5J1AB 1NC2D 3CMOL 5DR5L 3HHRB 3W9DB 1T5WA 4YR6B 1DBJH 3RX7A 2YUXA 2DICA 1U9KA 3PL6A 4OBRA 1H5BB 4FQHB 1T20A 1ADQA 1XGTA 2SEBB 2AXHA 1ORSA 4MLIA 1OGAA 4JZJA 1CZ8L 5HVHB 1RK0B 4YUEL 4R96B 5SWSE 4JQIL 2LU7A 4MDJA 4FNLL 4JDTH 4L4VB 4WEUD 4RMWA 3C08L 4UV7H 35C8L 1PQZB 1CFVH 1S9XA 3VXPA 2QQLH 2DQTH 3PJSA 3FT4B 4CVZA 3TT3H 1VB9A 5GGVY 1P7QA 5DSCA 2IGFL 1W2KT 4Z6AT 2A9MH 3KYAA 3PWLB 5HHQB 1AQKH 5JHDD 3QZWA 2FX9L 3CK0L 3UC0H 4UBDC 2EXYD 3IU3B 4NKOA 2YUZA 3I3DA 4RMTA 3QR2A 2X1QA 4GKNA 1Z5LB 4BFEA 3DUSA 5C09E 1DLHB 3T3MF 3FAWA 1MI5E 3NFPB 4WTXA 1KYOJ 1WC7B 1VENA 2CDEB 1G9EA 2OJZL 1QNZL 2HFEA 1AD0A 4YHOH 4JFED 2VO5A 1ZS8A 2APFA 4LNRB 3UYOD 3K4ZA 5D1QD 4GMSH 1FO0H 4EBQH 4UT6L 4MA7L 4BSJA 1KTDA 4I18C 3QEUA 4DKAA 4H88H 5HHOB 3RHWK 1QPPA 2Q6WA 1QFPA 4EXKA 4H1LA 5HXMA 2VSCA 1CE1H 4Z0BH 3PDOA 1INEL 5CZVH 2C1OA 3O3EA 4PIRF 3O3BA 1EEYA 1EZVX 4OFDA 5LGJA 1ZWIB 4U1LA 4HH9A 5DUPH 4P5KB 5KOVC 1YMHA 4OI8A 4UZGA 5DJAA 1KJ2A 3V6FB 3MC0A 4M93C 3O4LE 4ODVL 1MFBH 1MFEH 1OAUH 1FBIH 1D5MB 2EKSA 4LKCA 3T0VA 4JQXC 3OKNA 3MV8A 2A6KB 4ODXB 3V8OA 4AEIL 2XA8H 3CPLA 3TCXA 1CLCA 4QHLB 2HFGL 4QY8A 1MI5D 4UAOC 1LE9A 2DB8A 5FUZH 4KXZI 3C8KA 3VFVA 4P5MA 4NYLA 2R0WL 4PJ9A 3ZSTA 1ZT4B 4CVXB 4R7DA 5ISZB 1N8ZB 3ORJA 4JHAH 4DCQA 2DLGA 4R0LC 1L7TH 5CZXD 5DUPL 5I15H 4RMQA 4CVWA 2JF1A 3K7UA 1MQ8A 2I07A 2W9LA 3R4DA 1B3JA 3DSNA 4HUKB 3TYGH 1HZHL 4KQ4L 2BY2A 1BWMA 4DEPB 4D0CA 2YRPA 3WLWC 5JQ6H 2ZUQB 1BZ7B 4JO4L 1TPXB 3LZFL 4G8EA 1TZGH 1CE6B 4NGHL 1J0JA 3C2AH 3R06A 2CMRL 1AHWB 2OMNA 2XTJB 2NY2D 2HRPH 4ODTH 3KPTA 4XT1C 4KGJA 3RWDB 4F80A 1CLOL 1DDHA 4OIIL 4N0UE 2IPTH 4KK5D 4LVHC 4PB9L 1FNEB 4M9OA 1DEEB 4JCLA 3ZYIA 3IJHA 1V7MH 4NQCA 2N1KA 4QO1A 1OAZH 1S9KC 5CS7A 1DFBH 5DJ2B 4YZFF 4WGVB 5IEKB 1BECA 3C8HA 4JG1H 3FB5A 2XPGB 3HB3C 5F9DC 3AS0A 1FNAA 2VDNL 5GS1B 2AJVL 2GAZA 3LZFH 3T2NH 4OIBA 5EWIL 1ODAA 4NCC1 3WJLA 3MJGX 3H42H 4JKWA 3O8XB 3GSWB 2DMBA 2H1PL 4RGOL 2YD6A 3SN6N 1BLNA 3B2VL 1CG9B 2O26U 4QT5A 2ZNXA 4MJIB 3VDCA 1MCBA 1MVUA 4IRZL 1E6JH 3BP7B 5E8PA 5DQJA 3OKKA 4YC2B 4WFFD 4PB9H 4ZOEA 3CVIL 4PRBB 1N5YL 3RP1A 3Q5YA 1WEJH 4APQD 1VEMA 2XFXA 1OPGL 4HFWA 4MDIA 1BP3B 4NN7B 4X98B 3S36H 3FTGB 5ICYA 5T33H 2VQUA 1ZHNA 5ESVB 4H1LB 1ORSB 3C6LA 3ZHLA 1XAUA 3EFDH 4JG0L 15C8L 3EYSL 3LIZL 4DN3L 2WZPD 2H1PH 4N0RA 2ED7A 5I6XC 1AP2B 4UUJA 1IM9A 4NO3A 4CMMA 4XWOC 5MEQB 3U0TA 4P59H 3BJLA 1F02I 4XP6H 1BX2B 4OLYL 2D2OA 2YD9A 5B8CA 2DQDL 2DD8L 5I8OL 2VABB 3U2SA 2CDEA 4ZFFB 4APQC 1FC2D 2JB5L 1EDQA 4P5TB 1SVCP 3SKUD 1W0WB 2UWEE 4MNQE 4F9LA 3WN5A 2XKUA 1JVKA 4R2GB 3GI8H 3OJVC 1UM6H 3O2DL 3OX8A 4N0UB 3BPNB 1D5ZA 1DZBA 5HDLA 3G9AB 4JVWA 4XP9H 1MCWW 2UZIH 4OF0A 5J9PB 3MLYL 5D5MA 2DQUH 4U1HA 1JGLH 3OWEA 5L6YH 1CVRA 3GHEL 4A6YA 5CLWA 4RSVA 1B0RA 4ZUVB 3MA7A 4Z5RA 3U30C 1G7JB 1YJDL 4FXLA 3BDXA 5BRZD 1KB5B 1SBSH 5HHNB 3V0AC 4Y16B 1FVCB 5GGVH 3WIIL 2F8OA 1XF4A 4OFIA 4FABH 1EVTC 1J7VR 1QLRA 3QUMB 1WV7T 4P99A 4LMQE 2ICWJ 1QVOA 2AAVA 4YK4B 4L9LB 2AERT 4N8VA 2AQ2A 1TVDA 4JGUA 1A9BA 2XTJE 3EJZD 3TV3L 4NFBA 4UILL 1QACA 1HH6A 4HUWA 1ITCA 3T2OA 4QHLA 5J13C 2EYTB 3EOBA 2LU3A 4HGWB 3D0VA 1CR9H 5FA4A 2AJXH 1UCBH 5IB1A 4WI9A 3WXWH 3QFDA 4WEMB 2BSRB 5IEHB 5M7QA 3FFCB 3O45B 1I85C 1T0MB 4TRPL 4JFYB 3V79C 1NAKL 4GLRH 3UTQA 1F4WH 32C2B 3OKKB 4NJ9H 4KKNA 1IAII 1NGZA 4U1LB 5CBEA 2YZ1A 4NSKA 5E00A 3UAJC 3MNWB 2R0LL 4AMKL 1IQDA 5FHAH 3T8XB 4DZBB 3VD4A 1P84J 3I02B 4OQTL 1P1ZA 5H35B 1AO7D 3T1FA 3CFBB 5IBTH 4K2UL 5TFSH 4HUNB 1FYTE 1P7HL 3IU4L 3I6KA 1P7KA 3RVXD 3BZEA 3MLWH 5IT2L 1Q0YL 1U3HC 3FN0H 5ADOH 4ALAL 4A2MA 3WO4B 1FJ1A 3B9KC 3W2DL 4GG6F 3H9HA 1U8NB 4NN7C 2EO9A 5FGCB 2R2CA 5D70H 1MFNA 5JIPA 5C0DB 4PG2C 3O6LH 4FN0A 1DN0A 3HPJB 3LKRB 3R0MA 3I02A 4TYUA 4X8JB 1NFIB 3HFML 4J12A 4KZEL 3X11B 3VFUA 5GRZA 1U3JA 5F9JA 3QDJA 4KRNA 5F89A 5DJ8A 1CLZL 3OAZK 1RFDL 4JM2B 1H3VA 1TCMA 3GRWL 1YEKH 5ENWB 3MJ8A 5T5FL 3U4AA 4KY1H 5C0RH 1T2XA 3UO1H 4P23C 1R5WB 1CDUA 5H37H 1NCDH 5JR1H 3O4LD 4KVNL 5FYJD 1QSEE 5C2UB 3KPNA 2GT9B 4OGAD 4X8XA 1NKRA 5DJYB 1OM3L 4G5ZL 5DF0A 5ITBH 2AK1L 5F6HJ 3BXNA 1MSPA 4PY8J 2M26A 1PYWB 3ULUH 1QBMH 4JPWH 5D72L 3MLTB 3JSSA 1XGPB 4XWGH 4JZOB 3QP3A 4DKFH 4V2CB 3ESUF 4KKBD 2WW8A 3L6FA 5I74B 1GZQB 3HFMH 2IQ9L 3MRHA 1X4ZA 1QRND 2HA1A 2BCKB 1MWAB 3V4VL 5I16A 4FTVD 3HI5H 2CQVA 1NLDH 2Y5TA 2FEEL 3HPLA 2X42A 4PJ8D 4R90H 5ANME 2BVQB 3FZUC 4GRWH 2BVUA 1KGCD 3UO1L 3NFSH 3V6BR 3MV9D 2BDNL 2GFBB 4PJCA 1QYGH 2X4PB 2YSSA 1A6AB 3CXHJ 4BFGA 2VLLB 3VFGL 2UWEA 3WFHB 1I1AB 1MHCA 4U6YA 2PYEB 4Z7UB 4QRUA 1I3GL 5D7LD 2IALA 3QIWB 4Z95L 4XTRD 3OL2A 4GJTB 3WDHA 1MQKH 3NIGE 4H1LH 1JF1A 2ENSA 1FNSL 3TA3D 1H3WM 1ROWA 1R3KB 3DX7B 5IHBA 3DGGB 2DAVA 2Q7NA 5IJVB 1C7TA 2C3WA 2ADJA 2X4RA 3NCJL 4LSPH 4TNWK 3QG6A 2NTFB 4K7PH 5I1CL 2WP3T 4KJPD 5DXWA 2AJSH 3QUXC 4P2RB 3STBA 4NQEB 4K23H 2XZCL 3FFDA 3PWVA 4HZAA 1G7PB 3RIFF 1FG2A 2EDWA 1NMCB 5DR5H 5C0IB 1UWEH 1XF2A 1S7UA 4LRIC 3LRSB 1AR2A 1BF8A 4YX2L 4FTVE 4Z95H 4P2QD 3MJ6A 1X5KA 1YYMH 1U8LA 1U92A 5SWQA 1CFTB 3OKLA 5JXAL 2F8XC 3DTXB 3V6OE 3BWUC 2IC2A 4HAFA 4JFQA 4YHYC 1KIQA 3QEHA 1Z9MA 2Z8VC 1QOKA 3SKMA 1BJ1H 3PDDA 4X0KB 5HGDB 1YYLH 1ZEAH 5IVOA 2IGFH 3CFDB 4PJCF 1GVIA 4OZHB 1FL6A 1EXUA 1B0GA 1G6RB 3HI6H 5EU6D 3S8WA 1XIWC 5I1HH 4IJ3C 3L5WB 3L9RB 4U1SA 3ISWA 2WQ8A 4RISL 1S3KL 4XVTL 5JOFB 2P8MB 4ZFZA 5IKCB 5D4QA 3HAEG 1MLBA 4M7JL 5IMOB 4YUEH 4YR6A 1Q0XH 5HJ3B 4E0RB 1CI5A 3IETA 1BPVA 5K9JL 4L3ED 1IJ9A 2DQEL 5K9OA 4Q6IB 1T1ZB 1YEGL 4PJ7A 4L3CA 3GSQA 4LLWA 2D0HA 3ARGA 4S1RH 3P4LA 3BP5B 2HRLA 4P46D 3T2QA 3UPRA 2JK5B 4Y4KC 4TQEH 1PG7L 3T09A 4EEEA 1OGTB 2DTML 4WHYH 5C6WH 1NANH 3X14A 3QI9A 1JUFA 4PB0H 1P5UA 1A21A 3NAAH 2J8UE 3PQYB 2X4TB 4OLEA 5CSBA 4H0HB 1OAXL 1QFWL 3O6FC 2AABH 4TNVF 4U3XA 3BGMA 5J11C 1GPOL 3P4MA 4PS4L 3FT3B 4WWKB 1IFHH 5EU6E 1BFSA 4Q9QL 5DMIH 3VXQB 1AJ7H 2HLFC 3EJYD 2DQCH 4LSSL 4YHMH 3T77A 3MREB 4Z0BL 2EXWC 1KPRA 4Q7DA 4NWUH 3EZJB 2H26B 3W9EA 5D93C 4NZRL 1NGYB 2GKIA 3C8KB 3VFVB 5IVZB 3VXUA 5D1QC 3BJ91 3D85D 2P43B 3TJHD 3L7EA 5BV7L 4ENED 2ZWLT 1A1NB 4XBPA 1I8IB 2MCPH 2FB4L 3NTCH 3RVTD 2OLDA 4K8RL 1OAKH 3WJLC 5HDQL 4XVJL 4QRTA 3SEPA 2J88L 2EIBA 1RUQH 3VJ6B 4PYHA 4U1IA 4GXVH 2QADD 1KIPA 2E7LC 5GJTH 4Z7WA 32C2A 5DYOA 3U79A 4EZMA 1V3MA 1X5ZA 1ZHBA 3IS0X 2X4PA 4HKBA 3NGBB 3KPOA 3JV4A 4YPGA 3G6JE 1QSEA 3HAEB 3B6SA 5F9JB 3PV6A 4B50A 1NUNB 3GSWA 3EYQC 2QEJA 1AQDA 1VADA 5CD3A 3DUUA 2DI8A 1WIOA 1NCWL 5CKAA 5ACMA 4RCAA 3TO2A 2P8PB 2FATH 4KZDL 1G1CA 5SWSD 1RZJH 5FV2A 3TLRA 1IC7L 3A6OA 5L2JA 3G6JF 4P9HH 2J2ZA 4PUBH 1JHKL 4AIZA 1U8OB 5E1AA 1F58L 1T2QL 2DKMA 3ILPB 3IVKB 5HHNA 3VWKD 5A16A 5HYJD 3EJYC 4DK6A 1S7VB 2DOCA 3RX8A 1LO4H 3DGGA 4QCIB 5FXCH 3RDTC 3QDGE 2MHAA 5KSBA 3WFDH 4LRNH 5DJCB 4LSUL 3D39A 3GBMH 5E8NB 1NKOA 3O3AA 3KJ4C 3CDFA 5AZ2L 2CDFB 3OR6B 1LP9E 2DTSA 4M6MH 1MJ7H 4MWFA 4UU9B 1NFIA 4OM0H 4RWYH 3UTSA 2WSKA 3ZTNL 4W4NA 1BMGA 4XVSH 4KDWA 3QPXL 4NQDA 5AYUH 5CP7B 3MRNA 2VDNH 4FQ2H 3GSXA 4PRPB 2D03H 4XNYL 3BGFB 3WUZA 2C7UB 4RZCA 4Y88A 2COQA 4DN3H 3CX5K 1CDGA 4Z7VA 1Q1JL 4HIXL 4NQVB 2BCKA 1FV1A 1J8HD 1R24A 4I0KA 4W6YB 1XF3B 3V52L 3P30L 3D3VE 3UAJD 1PX4A 3ZKXC 1CBVH 4U1KB 4ZFZB 2DDQL 4G6JL 5IV2A 2GSIA 4X7SH 3HAEA 1RUMH 2D4DA 3I84A 5KBNC 1JPGB 2DYPD 5TE4L 4X9BA 5HYJE 2XACC 4MJ4A 1UB6A 3HE6D 3EOAA 2CPCA 4HWNA 1TJHL 3S4SA 3ARDB 4P5KA 1A4JA 5DC9B 4E41D 5DJXB 1FZOA 4MNGB 1BBDH 3O3BB 3BT2H 4KUZH 1NCBH 4C56A 4S1DC 4X8JA 4EDWL 2HT2D 3GSOA 2AEPL 2QQNL 3WFBL 1QFHA 5CJQL 1W72B 2QHLA 4MXQD 4PJAB 5DDHB 5CHNA 4GW1B 3DO7A 4FZ8H 4PBXA 3CZFA 3ZLQC 1D6EA 5HYSB 5BXFB 2F5BL 5MEOA 3IDUA 3MBEA 4P2OC 3MRQA 4AM0A 1YMME 3FQNB 2E9WA 3UYRL 1YN6B 3QHFH 5GS3A 3THMH 4GKZA 5F7FA 2UZIL 4MS8D 2YK1L 4KUZL 4Z0XA 2R0ZH 5IJKA 3BYYA 3GMNA 1A6WL 4OI9A 4PV9B 5L7XL 5IVXA 3QUKB 4GS7B 1M6OB 4KAQL 3VRJB 5C9JA 5GPRA 1WUNT 3OKOA 1DQDL 3EYQD 3OJMB 3U7YH 5IIEA 1DUYA 3G04A 3QXAB 1RZGA 3Q48A 2P24B 2VZ3A 3L3JB 3O45A 5C0BE 3IDIB 3KPSE 1IAIM 1BZ7A 1BAFH 1G0YR 5BMFL 1A6AA 3C5ZD 2B20A 3BO8B 5TGBB 2IFGA 4NUJB 3GMQA 1N2RB 3LN4A 2W60B 5EUOE 3S96B 1FSKB 5GIRA 1JP5A 1PKOA 4QHNA 2I9LB 1N0XL 2R0ZL 4HZLA 4G6ML 3GMOB 4HIJB 2F15A 3QG7L 3O0RH 4OKVA 5L7XH 5D2NC 4KAQH 1IAKA 4R97B 4CMMB 4OZFB 1A2YB 3OB0H 2XYCA 1PYWA 1CD0A 3FQTA 2R4SH 5F9WB 1JNJA 3L5WA 4ALAH 3TVMD 3VXMB 3KPNB 3FCTB 2A6KA 3TH4T 4KK6D 4HKZA 1MAJA 3WL9B 4KI1A 1HI6A 1V5JA 5EO1A 4PJEF 2NZIA 3O41A 3I75A 1JGUH 5D7SH 1KPVA 2H9GA 5AUMB 4NQSB 1U8QA 1UVQA 2ICWA 4N0UA 4L8DB 5I66B 4G8EB 2X7LB 5D7JD 4U2YA 3L5XH 3DI2B 4GUPA 1EAJA 4OCRH 2VIRA 1WTGT 1WT5A 2XQYK 4LPUA 1GGCH 4GG6A 5D2NA 4OCMC 4KK6C 3VXQA 3JTTA 4M5YL 2AEWA 5FCUH 1P6FA 5TDPB 3FRPA 3RU8L 2PW2B 5CGYC 4MMXC 2VLKB 5IVNA 1VGEL 4UDTB 1KIUA 5AG8A 1AXTH 4JN2B 4NQCB 1MFAL 2VTFA 1RURH 3N9GH 4JFOB 3WIHH 5JPNA 3B9KD 4HBCL 1FO0A 3RTQA 3TZVA 3ZE2E 1LEKB 3K80A 3NFPA 1UVQB 3CXDH 1BQUA 3E3QE 4LRIA 4JKPH 4KMTH 3HE7D 2ZOLA 4KJYB 3KYMB 5DMJB 5JOPD 5ITBL 3QXDA 1MCPH 5GJSL 2BVOA 4LARH 2XA3A 4O58H 3SGEH 1F11B 3ULVC 1C1EL 2RFXA 4O2CB 1G0DA 5DJAB 3V6FA 3BP7A 1WBXA 4ZNEA 5CGYD 5D7IE 1T21B 1D6VL 2O61B 1VGEH 4KROB 4WCYL 2VLRB 4G6KH 3D0LB 1K6QH 2VZUA 5IV2B 4IDJL 1ZLSH 2VYRE 5BOPA 2HAZA 1BJ8A 1CGUA 1YY8A 5BJTB 3B4NA 1M7DA 5ISZA 2CLRB 3F12A 5I76B 3KPSB 2X4SB 2I9TA 4X7DC 5GGTH 3W9DA 1XGPA 2Q7YB 3QFJD 5IB3B 4JGJA 3VE0B 4PRPA 5GSVB 1IC4L 3MACL 2ITDA 2XIDA 3PWPE 3LH2L 1IGJB 1IM3A 4QRSA 4XXCA 5EU5B 2FBJH 3QUXD 4Z7VE 4QHUA 4LSVH 5EBGA 2VITA 3RGVC 2Q20A 4Y4FA 4WO4C 3RPKA 4Q0XL 4F57H 3R06B 4D0BB 5C7XH 2EDBA 5TJWK 1P4LB 3DIFA 4WJ5B 1T7WA 4D0BA 5M95B 1G9ML 3CZJA 3VFNB 3SO3B 3FL7A 3L1OL 1D5ZB 1KLGB 1AI1H 1JTTA 4RMRA 4EBQL 5DUBB 1OF2A 1GAFH 4U3HA 2H41A 1S7QB 3WNNA 1FYTD 2DJUA 3D9AH 1CDHA 1FNGA 4L4VE 1FGNL 2Z4QA 4M1CD 4QTHA 3BWAA 4Q97A 2YC1A 3KPRA 1T1WB 3IDNB 2YR3A 3FRUB 4LHUB 4OCWH 2DL9A 5LGKA 1MEXH 1FLRH 4P5TD 3WUWG 5E6ID 2ZUSA 4NYLB 1FZKA 4FQPA 1J8KA 2ADJB 2VLJB 3QQ3A 1P53A 3FONB 5CEZH 2XKNA 2B8OT 3TBSA 3L3DA 1CICA 3T0BA 2IAMB 3OG6B 3VFNA 1AR1D 1EHLH 3VXSB 2JJSC 2Z0BA 2GCYB 3DMMD 3GI9L 2AJYL 1HQ4B 1UB5B 4C56B 1AXIB 4X4XB 4NHCH 2XA8L 3WHXA 1A7QH 2CK2A 2VDQL 1HQ4A 4R0LB 1MCHA 5DJXA 4NM8L 4QHKI 2R0WH 1J0ZA 4QT5B 2ESVE 5DUML 5C0AD 1RJLB 2LFGA 4Y1AD 5DQJB 5DEFA 3PXHA 2NLJB 3TBSB 1UB6B 1JZ8A 1EHNA 3IFLL 5IWLA 3HNTL 4ZTPL 1ACYL 2GEEA 5LKNA 2VLJA 1G9NL 1TTUA 3VGAB 3MO1A 1KSRA 1OAXH 1WWBX 3IDGB 1CLYL 3RY5A 3QO0A 1KTDB 3INUL 4JFOA 3GSNL 5JPNB 4PJIA 3LKPA 1YEGH 1YN7B 4MA1B 4ZPTA 3BPLC 1EHLL 3EO0A 3RL1A 4L4VD 4I3SL 1A64A 4WNQA 4MXWL 4Q9QH 1OP5H 1R3IL 4ZSOB 5ID1A 1M71A 3QDGA 4GAYA 1FIEA 5D2LA 4NHCL 1ZLWK 1IARB 5L0QC 4TQEL 3VFTA 4AYFA 1E6OL 3WNOA 5MEND 1WTLA 5IOPB 1JF5A 1OT2A 3N06B 3DV6B 4HSQA 1N64L 4OLZL 3G5VA 3DI3B 3T0XA 3EO9H 4PJXB 1T66D 5F1IA 3KPLB 2Z92B 5F7EH 3O2WH 4KHTH 5IB5B 2YBRB 4KC3B 4PP1D 4MWFB 5I30L 5FYKU 4QOKB 3K2UL 5HDOA 4Y4FB 4RFNC 1JWUA 4QRQA 4PG9A 4GXVL 1SYVA 4PRDB 4LSRH 5DEGA 3U7WL 4F2MA 1Z3GH 2L7JA 2IPTL 4QRPA 5FKAA 4KHXL 4FQQA 1DEDA 4HKZB 1ONQB 4K94L 3SGDI 3FO0L 2D0GA 2Z91A 5F9AC 1JWSB 5C71A 2C3VB 2M8XA 3S35H 2E9BA 2CR3A 2BMKB 1H5BA 3AB0B 2AJVH 5E56A 2JIXB 4CDGC 1QRKA 1KXQE 5CILL 3TF7C 2ZP0T 4PJBA 2R39A 2ADGA 2XN9B 5IHZB 4LLMA 3H9SA 12E8H 1GGBL 3B6SB 5E1HB 2W60A 4Y7MA 5EBLB 2ZSWA 3CVHB 1DJSA 3RPIA 5I1LB 1FIGH 4NUGL 4G7VL 3VWJD 1CT8A 4HLJA 1QG3A 1QUNA 4BSVB 3GMRA 3RWEB 3TBYA 4MJ6A 1OGAE 5B3JE 1R3JA 2ADFL 2FIKA 2ZG1A 2JCCA 4U1IB 4ZUTB 5JIIA 4F7CA 3JVGA 1I9IL 3GKWL 4M8VA 3WFZA 3PE9A 2G2RB 4L5FH 3X3FL 5DQDL 2AVGA 5DD5L 2FJGB 3L5HA 1F90L 1IGML 4HH9B 2VLJE 4JG0H 4BH7B 4OAWA 5MERA 2F54A 3FFCE 4DKEL 5HSFA 4FQXA 4JQXA 5HHVL 3DETC 4XC1L 5IVZA 4CJ1A 2GITB 3W5MA 4LLMB 2VL5A 2YMXL 1OPGH 3BI9X 4JN2A 3QH3A 3A67H 1Q9OB 4WY7H 5C08E 4P9HL 1HH9A 2NTSP 4FQ2L 3GI8L 1JTOA 2ESVB 5C0IA 4RRPG 2ZG2A 5TDPA 3RHWF 2Q86A 3ARXA 4GKSA 4DGVH 5MP6H 4JFDA 5GGQH 1JGEA 2Y07L 2W9DH 5FO9A 1PLGL 5EZLA 4PRAA 2WINA 1DL7L 4IOIB 2PCPA 4DK3A 2ED9A 2QADC 2X89A 2XTJD 1G7IB 3QIWD 1P84K 5DUBA 1SMAA 5ISZE 2A77L 1CDJA 5ID0B 1NC4D 3KXFB 1RZGB 4OCNC 4FXGA 3WFEH 5CEXB 1KJMA 4GRMB 4PTUA 3T0ED 3C2SA 4V2BA 1CGWA 1GGIL 3U0PB 5TQ2H 5INCB 5C8JB 1Y6KR 2P5WD 5JO5A 3MOAH 4YBLB 5CUSL 3VGHA 2XRAL 1PW3A 5CIPB 3FCTA 1BZQK 1E0OB 4DWHA 5EU5A 3E2HB 3MYZA 1FFNB 1YEDA 3UXFA 4LCWA 5F1OB 3RWHA 2PXYB 2ZCHH 4Q6IA 5DLML 1FVEB 4JZJC 4WHYG 3VFTB 1QR4A 3GHEH 5AWNL 2YD3A 1FCCA 5I19H 4G43B 5EOCH 1TITA 1LP9A 3AAZB 2A77H 2DDQH 1LWRA 5FYLD 2Q3AA 5EBWA 3O9WC 4JRXB 1VSCA 1LE9B 1T22A 2X4NA 5EZOH 5KSUB 4RQQB 4Q6IC 4YXLH 4MA3A 43CAA 4KUCF 3QFJE 3SCMC 1NMBL 4LAQH 4P9MH 3RWCA 5LWYH 3BPCA 3CFCL 2PXYA 5I1KL 5DJZA 1JPSH 2V2WB 3ZDXF 4G3YH 4TVPD 3RDTB 1A6UL 1NEZA 4KKCC 5ANMB 1YEIL 1D9KC 4U1JB 3ZDYF 4WUKH 1EHAA 2X2YA 4WENB 3BPOC 1RU9L 2X1OA 2K9UA 3PWNA 4UBDD 2P42B 5TFSL 2OZ4A 3SDDB 3S35X 1GZPB 2XZQL 3IU4H 1UM5L 1ZA3B 3F7RA 2P5WE 2H8PA 4GKZB 2NY6D 3LKOB 4OZGF 1NUDA 3BKML 3QCVL 1T6WA 4Z7QF 1U93B 3MGAA 4WHTA 3UZEA 2B4CC 5HHME 4PY8I 1A6UH 3OGCA 5FGBC 1S7UB 1IQWH 2V9TA 1A5FH 2YPVH 5D70L 4BZ1H 3RX5A 3NACH 2DL2A 3I50L 2NTFA 3P0YH 2HTKD 1UEYA 1X5XA 1URLA 2EYSA 1IQDB 1ZMYA 3KR3L 2BJMH 5C2BL 3NFNB 5GISL 5GZND 4HV8A 1NCUA 3MV9E 4ODWB 2P47B 2IQAA 5E7FA 4JPKL 2ZCKL 3TN0D 1T03H 4U6YB 6CGTA 4NWTL 5ICZA 5D2NE 1EERB 3Q1SH 3ZYJA 3IS1X 4L8BA 1FP5A 3FO2A 4HUUB 2NXZD 2CRZA 1YEKL 2VAAB 1V05A 3PWPB 4MD0B 4QKXB 3JV0A 4RNRB 2NXYC 5F1NB 5EBLA 4YZFE 2Y6SC 5IVXE 1S9YB 1J8HE 4WO4D 3VCLA 3DROB 1TVHA 2VSDA 3QWQB 3OAZH 2V2TA 2CUHA 3HC4L 4LCUA 3D3VD 4HWEH 3CMOH 4JZOA 3P9WB 3SKJL 3RNKB 3GMPB 3D0LA 3HN3A 4NWTH 4XTRC 5IG7B 1LQSR 2C3VA 4RNRA 2VXVH 1JN6A 2CJUH 2H32B 4Z7OF 4N0YL 4PRIB 1KFAL 4OZIE 5DQ9B 4LAJH 4GBXD 1QLEL 2ZUXA 3QULB 1F00I 4JFXA 1K3ZA 1MCLA 3MZTA 1TXKA 4CADA 5CSZB 4I77H 5FO7A 3TJHC 1SY6A 2HJFB 1HNFA 3MJ8B 2VDRH 2PO6D 3E1F1 1G7HA 4BQ9A 1KN2L 2C9AA 2VXTH 3KYNB 5DHYA 4KDTC 2HLFD 1XGYH 3HUJA 4PRAB 4HJ0D 1KJ3H 1LDPH 4TSBL 3WNPA 1CFVL 4JFFD 5I18L 4L4TA 4X7TB 5LQBL 5FYJH 3FOLA 4LBEA 1WWWX 4PJGA 4P2YA 1J1OH 1S7TB 1K6QL 4LP4A 4E5XB 1GC1L 2CJUL 1ZLSL 1S7WA 3QRGH 1G84A 2XWTB 3B83A 5HTSA 4GLRI 2A6DA 2NY7H 4DN4H 4E5XA 5HYJB 3LKQA 1E4KA 4JZNB 3CFBA 1CFSB 3GB7A 3VGGA 5GGTA 3H3PL 4PJCE 2KZWA 1OL0A 3G6JB 1K5NB 3B2UC 1R3LA 3LHPH 5EH1A 3PHQA 3ARUA 1F45A 1AD9A 1HOCA 4H88L 1IKNC 3B9AA 3SJVD 3PHSA 4MD0A 2DLFL 2HKHL 2PUQT 2MCG1 1FORL 1HILA 5F7LB 4F58H 2FX8L 1BGXH 3TH3T 1XGYL 1CD8A 3CK0H 4HEPG 5E9DD 1INEH 4U0RC 4MDIB 1RJLA 1A3RH 4MA1C 4RAVB 5C0BD 4EUPA 3SKMB 4YBQC 4AIOA 5E4EC 3SDYH 5EU4A 4P23A 4AL8L 2UWEF 3QFDB 4QRTB 1PY9A 4Q0XH 1HI6B 3MLPA 1QNZH 4EI5C 3BP5A 2NY0C 2MJWA 4Y4KA 2B1AH 1CG9A 5EN2B 4YHOL 4K55A 3U4BL 1LO0H 3K81A 3RWIA 1FG9C 4QHKJ 4M1CC 4ZPVA 4PJ5D 4JN1L 3V5DA 2W65B 1NGWB 4ZUUB 3MMEA 2HN7B 4IRJD 1YEFL 4MAYA 3KLDA 5EU7E 5IMOA 4AEIH 1RIHH 1RVFL 1IEAA 4Y5YB 3MJ7B 3LH2H 1MWAL 3OZ9L 5JOFA 1KCSH 1LO3H 5FKPB 5T1LA 3FO1B 3BW9A 3HG1E 1P5VA 2QSCL 2R1XA 4RISH 5DC0A 2B4CH 3I9GL 5TGBA 1DBML 2OSLB 3ZKND 3ZT6A 2NY2B 2CIKA 5E2VL 4ZTOH 4LLQA 2W0LA 1KENL 2Z93B 4PLJC 3X3GL 1D5IL 4PB0L 4DVBA 3VG0L 4L8BB 2Z35A 2CIIB 1JK8A 1K4DA 4JHAL 2XZAH 4MZ3A 4YXKH 1GSMA 3JWOC 4HKXB 4TUJA 1G7MA 1IGFL 4MQTB 3F7YB 3AM8A 2Y4SA 5E4EB 1IKFL 5HHOE 1K4DB 1X5IA 4NRYB 4JO4H 5EUOB 2YXFA 4N1CA 3MRBB 5DD0L 2R8SL 1XH3A 4NQED 1GPOH 2UYLB 1W0WA 1OP3H 4K3EL 1BIHA 5I71C 4WI2A 4PR5B 3MRDA 3PXJA 2WBJB 3SDXA 1DP0A 5DMIL 3PP3K 2R1XB 1KLFA 4JO2H 3L5IA 2BSTB 1T4KB 3AY4A 5E2VH 5GSVA 4F7MA 4ZTOL 5KJRH 3E8UL 5DD1L 3HNTH 5JDJA 1E4WH 5KVDH 1FVDA 2VWEE 1VA9A 3HZKB 2QLVB 3QNYA 4LU5H 4KDVA 1K8DB 5T5NF 5BW7C 4LKXB 3MJ9L 5IK3B 1I85A 4XP5H 4JRXA 1BVKA 5B8CB 2EH7H 5FYLE 3QO0B 5C92A 4APQB 4PGEB 4PJFF 5DJDB 5F70A 5FV1L 1T1YB 4LIQH 2VQ1B 3I85A 2R8SH 2BC4A 1SYSA 4M7KL 4EOWH 3OF6A 2OL3B 3W0WA 4PJ8A 4RGOH 4JG1L 2QHRH 2KH2B 3PIQA 4Y5XC 3ZZ1A 3BGAA 4C55A 3RZCC 3G5XA 4O9HL 5I1IH 1UYWL 3W81A 3C5ZB 4KK9D 1NCWH 5AD0A 1A9EA 1J11A 4YE4L 5EFIB 1QBBA 2VZOA 3OKEB 2EDDA 5EU7C 4FFZH 1T0PB 3BSZH 3A6BL 3VMNA 3ZDYE 3L3IB 3BP6A 1MAML 2VJXA 1CFSA 3GB7B 1EFQA 1MVFA 1AGDB 2XQBL 4HWUA 5EWIH 4U0QB 4Y4HD 1XF2B 4RAUA 4KZDH 3H9HB 2HT4D 5FYKE 1OD7A 2R9HD 1BOYA 4H8WH 1EFXB 2NY3C 3WD5H 1MRDL 3MLXL 2J5LC 3U46B 3IJHB 1VKXA 2OCFD 2D7QA 5IJVA 3MRCA 1EH9A 2DQDH 3WFCL 2APWA 1J05B 4LBEB 4LVOB 2IG2H 3FQXA 2RIKA 5KS9E 2MKLC 1ES0B 3FQRB 1WFNA 2OP4H 1A1OA 2JB5H 2NX5A 4TULH 3UDWA 25C8L 5HD8C 1EHXA 4EI5A 2FL5A 5KVMC 4X4YB 1HEZA 4NBXB 4X6DA 2D03L 1UM4H 4XNYH 5JORB 4KKAC 1DVFB 5I9QC 4PJGF 1I7RB 3BE1H 1L9NA 4XCNB 4X6CB 2HJKA 1WZLA 1B6DA 3MZGB 2C3HA 2ATPB 1MCRA 4DOHE 3HPJA 1G7IA 1GL4B 2E5EA 5ACZB 5I1GL 3OXSA 3QO1B 1EMTH 1U8MB 3WN5B 4ZXBA 2EH8L 1CQKA 1A6ZA 2H2SC 5E03A 1EPFA 1FGVH 5IFAH 3LQAC 4BQCA 1MCNA 3V5HA 5K9OB 1DQTA 3QCTH 2OP4L 4S11A 4I48A 3B9KB 1B6UA 4M00A 3V0VB 2HT2C 1ADQH 1BX2A 1KEMH 3MRLA 3W5NA 1GHFL 3VG9B 5I73C 3EDEA 5FYKD 5BQ7B 4R7DB 2FR4B 3PWPA 3MUJA 5F6HI 1DLFH 1KT2A 1FVEA 4XRCA 5DMYA 3LD8B 3L9RA 4U1SB 4ACPA 1Q1JH 2VISA 5DFVD 5FF6B 1I1CA 5F3HB 4M61B 2GT9A 3BH8A 1JI1A 2HG5A 2VERN 3C5SB 3MNVA 1B0RB 5DJ0A 1EEZA 1ND0A 4XAWH 1B9ZA 1PY4A 1EZVY 2KKQA 4MHHG 4OZ4B 5LCVH 1BM3H 1UKQA 5D9SB 1D9KA 5HPMA 5KW9H 4FQLL 3MV8D 1NGXA 5J06A 2VLRD 3CUPB 3U4EA 3QPQD 5I1DA 3HC0A 4D94A 4OFYD 1UA6H 3ULVL 3H2WA 4GRMA 1KTLB 1CT8B 1X6LA 2YHGA 3EJZC 1XCQB 4YHKH 2DJSA 4QHMB 1OSZA 2J3SA 3VW3H 3DRQB 3CCHA 3KPSD 1WAAF 1CD1B 3ROLB 5DO2C 4NZDA 3FQRA 1UT9A 1KLUA 2D3VA 4TOYL 2V9QA 4F37F 4U6VL 3REVA 2W9DL 4F3FB 5GS1A 1RY7B 3MBEB 1OTSC 4AEEA 5K59E 3MRGB 4OM1H 2V2XB 3DO7B 2VIRB 1PJ9A 1EIBA 3BGMB 3DSFH 3O4LB 5ADOL 2DIJA 4ODSL 3R1GL 3F62A 3OB0K 1GGIH 1RPQA 2ORBH 4BH7A 2E8YA 3QEQD 5C08A 4FFYL 5BRZB 1VFMA 3V6ZB 2NLJA 1NBZA 4JM2C 2VC2H 1TVBA 1YA5A 4ZS7H 1VFUA 2A83A 3L95A 3GNMH 4CJ0A 5FHAL 1PQZA 3O41B 2FCBA 4JCMA 3ULVF 1OWWA 4QWWC 3MV8E 5LXGH 4CVZB 3TO4A 2G75A 2VN7A 4DUXA 1BFOB 3MUGA 2XZQH 3PNWB 1OAYL 1OP9A 3MV01 1A22B 2IAMA 3RUGF 1N4XH 5E2UH 3W0WB 5BCAA 1UJTA 2A9NH 1QSFA 1JV5A 2F53B 5E6ZA 4LCUB 1MHHA 2R4SL 1U8HB 1P4BL 1GGTA 5I75C 5TQ0L 2Y72A 3MRHB 4LGRB 4R6UA 3ZE0F 4PP2A 2FLRT 2R1WA 5D96C 4G6FB 4YJZL 4NM4L 1NLDL 3ARDD 3MUGB 4R90L 5ITFA 4G6MH 3SO5A 4E41B 3MLUL 4QRRD 1KJ2H 4I0PD 1T83A 3V0WL 4F7MB 5D1ZA 4OB5H 3NFSL 4D0DB 3L3JA 2WQRA 1MCOH 3DRTB 3OR6A 2UYLA 4WFHE 4XHQA 1KEGH 1B2WL 1EAPA 3E6FB 3MRBA 5I73B 5ID0A 5HHOD 2ZCKH 1BOGA 1BQHG 5DJ8B 1JZ2A 5H2BA 5AEAA 2NNAB 1OD9A 2IQ9H 3ELAT 5JQHC 1HINL 2VDOH 3QUZB 2FO4A 4JO3L 5D7SL 3SBWC 5E8DL 5EPMB 4S2SA 5E5MA 1FH5H 2E6PA 3EO1A 1RZ8A 1MHPH 1IGCH 2D7MA 5C0GB 4Z77A 3I50H 5CBAB 3FB5B 4LLDB 4BQ8A 1F4XL 3TPUB 2P8PA 3AS3A 3QIUD 5EOQL 4OT1H 1ETZB 2NY4D 4PJ9B 5BW7A 2W07A 3ULUF 3BP4B 1Q9LB 1XR9A 1RK1A 1SEBA 4FNLH 4JDTL 4NO0D 3B5GA 4XBEL 3QQ9D 3ZL4H 4JFZH 1F3JA 4PY7B 1AXSA 4ORZC 4Y5VB 2D31A 1U2CA 4QOKD 4BZYA 1D6VH 2VR4A 2X10A 1OY3B 2F54B 4BJLA 1WVZA 1T1XB 4G9FD 3ZO0A 4IDJH 1UWEL 1AQKL 4R0LA 1NQBA 1C1EH 2HFFA 1P7QB 3G6DH 4G8GD 4FXKA 3VD3A 5JOEA 2PO6C 3EOAB 3V7AE 1H3PH 1ZHKA 4M61A 3WE6A 4HPOH 1CDIA 4JKPL 2GCYA 4Y2DD 3TA3C 5JTWA 1IM3B 4MMZC 4WHCA 1R3JB 3ARSA 5F7NC 2NXYB 3HUJF 3PF2A 5GJSH 2WANA 4Y5VA 4WRLA 4E41A 3OJDB 3WEXA 1U3ZA 5DVOA 1U58B 4P46B 1EEQA 4BH8A 5I2IA 1ZHLA 1GYAA 1UWGL 1LP9F 1FO0L 4LVNC 1ZHLB 4G6KL 3RI5F 1KGCE 4X99A 2DMKA 4H0GA 1W0VB 1E4XI 4NKQB 1UQSB 3DXAB 4YBQD 3TA3B 4J4PC 2VXSH 4MQ7B 4NRXB 3ZE2F 5D7LE 2PTTA 3BMVA 4P46C 1WWAX 2G60L 3AB0C 4PG9B 4J3TA 1FGNH 4M7ZC 3S34L 4OD2A 4BQ6A 5IW3A 4OFKA 3SDAA 3BIKB 1BVZA 1RHFA 4FXGB 4A6YH 1CGSH 3I75B 1S7VA 4DVBB 2GSGB 2VLKD 5D8JL 2W9EH 1RK1B 3QRFM 1HSBB 2ESVD 5C0AE 3R0NA 4OUOA 3P2TA 4WV1B 4Y1AE 2BZDA 4EN3A 3VXMA 1G9MH 4HIEB 1NFDB 1HHJB 4IEFB 3BRFA 5E2WL 5MENE 1AR1C 1Q9WB 5MEOB 1T3FB 2YPLA 3VA2C 4GXUN 3QDJD 3RL1B 3D9AL 3GMOA 2XQYG 3X13A 1JL8A 4D8PB 2DKUA 5IESH 1MWAH 3OZ9H 3MUY1 3S34H 1RHHA 4KGLA 3S96A 1OAQH 3ARBB 3SCMB 3ECBA 3QWRD 4XPGL 3PNWA 3MV7A 5BV7H 2IPUK 4U49A 1YNTA 1MREH 3GIVA 3OHXB 2MCPL 4LNVA 3TVMA 3IAGC 4ZAKD 2QQKL 4UT9L 3RVTC 2O5XL 3T3PF 2FSEA 4PLJD 4HLZG 1T1XA 3QAZB 1IGFH 1HILB 1PEZA 2A74A 2ZUWA 4MJIA 1G9NH 2BNQD 3BD4A 1CFNA 3TFKD 3SCMA 4R3SB 4Z78A 1T1YA 5IGXH 4G9DA 4XVJH 4YHML 2G9HB 3B5HA 1BLNB 2WWKT 3HA0A 3ARBC 2DJ4A 3WKNA 4Y89A 1WZKA 3ARYA 3GK8H 2J8UB 5TPWL 1R3IH 1INDH 3QQ3B 1HKFA 1QQDB 4PJ7F 4XPGH 4JO2L 1NGPH 3MV9A 2IFFH 4HJGB 3EGSA 1KELL 5DD1H 1XF4B 5DZLA 1KNOA 4TSAH 4AH2A 5GIRB 3FRUA 3SPVB 1DFBL 3RJDA 3CFEB 3MRDB 1DLHA 4YBLC 1HHHB 3IXAB 5LAXB 5SX5H 1LEGA 2OXGA 1W72A 1LO2L 4R4NC 2E27H 5TE6H 4BZ2L 5FA3A 3BEWA 2ICWI 5HHQA 2DWDA 1M7IB 2YD1A 4LQFH 4JKKA 2APXA 2FATL 1LO4L 1BQLL 1ERNA 5DA0B 4JKMA 4LSRL 4OZFG 3O4OC 1CN4A 3LEYH 4JREB 3X14B 4PUBL 4POYA 2YD4A 1Z2KA 4QHUB 2EC9U 4NRYA 4NKMB 2YBRA 1A7NH 4U6TA 2OJZH 3IGAA 5FOJA 4JFFE 1NCTA 5DMGC 1AKJA 3MJ9H 3PGDA 3ZKXB 1YPZE 2OSLA 3FMGL 5I6XB 4OZGE 2B2XL 3LQMA 2RHEA 3ARQA 3FFCD 2I60L 4LLQB 4PP2B 1RZIB 4RWHA 3U7WH 3MA9L 1CCZA 1Z3GL 2IPKB 4KJWD 4XNQB 1IAKB 2FR4A 2R2EB 1MAMH 1FIGL 2Q7YA 4BZ2H 2FYYA 3RVWC 3TYFA 4HIJA 5IBUB 5F8QC 5L8KB 2BSSA 1YN7A 3T65B 2W65A 3SE3A 1YUHB 5FOBB 5FM8A 1N59B 4MYWB 4M3KB 3DRQA 3LEYL 1KN4L 3MLXH 4PGZA 3S37H 5J8OA 1A7NL 1OCWL 3L3IA 3TN0B 4ODVH 4GFTB 1CBVL 4JRXE 2J6EL 5EC2A 4UV4H 1NDGA 1I9JH 2HKFL 2Q1EA 3V52H 4DZ8B 1B90A 5CD5D 5MI0C 4MNQA 4OD1L 3X3FH 1ZLWH 1H8NA 4J8RA 2CO7B 2KL6A 4OQ1A 3D39B 4DKEH 2YN3A 5D71L 5HI3D 3U0PA 5D7IF 2FL5B 2HFGH 3ES6B 3HZMB 1PEWA 2ZOLB 5T3XD 1EO7A 2Z31B 5I0ZA 4TVSa 3H9ZA 5MP6L 1LK2A 4XXCC 3BE1L 4ERSL 3P3YA 1HSAA 3CX2A 4EKXA 4FA8A 3AS2A 1PLGH 3DYPA 5DD5H 5FHBL 2EE3A 3V7AG 2A6DB 5IFHH 4K3GA 4TPRL 1E28A 2CGRL 2IH1B 5D2NB 1RJYA 4M48H 3JWDL 3TPUA 5EIQA 4HXBH 2IH1A 4UQ2B 4LVOC 1N3NA 4MCYA 4N9OB 2LABA 4ONHB 2X4RB 3V4PH 3CCHB 4YBHA 3V2AR 1UM4L 5C70A 5LBSL 3TP4A 5HVFB 3T8XA 4DZBA 1Y18B 3O9WA 2HLAB 3OMZA 1I1AC 3QJHA 1NCBL 3WJJA 1SBBA 4F7TB 1ZVSB 4JM2F 4OIIH 2BOBA 3MR9B 1OARL 4I0PC 3C5ZC 3FHAA 2PYEA 3VD5A 5HVWA 1U91A 1MCDA 5GRVL 2AJXL 4JFYA 1JN6B 2CUIA 5KVFH 4PD4J 4QWWD 2OK0L 4P0DA 3BUTA 1F6AB 4ZODA 3UYPA 5EG6C 2EDXA 1C12B 3P77A 5I19L 2DWEB 5JW5B 1F4YL 3UTOA 1I1AD 5EO9B 2GK2A 3IXTA 5BZDA 2VOTA 1HH6B 3HNVH 3HMXH 1AO7E 3W2DH 3V95A 4OZFA 2LQRA 5EBWB 2I9LA 1N5AB 4MS8C 4POZC 2CLRA 4N9GB 4C83A 1BVLB 4ELMF 3SDDC 1K8DA 2EEDA 1CU4L 3GIZL 1XZ0A 3KPQB 3MMEB 1JHLH 4YNYA 3T3PE 5JLZB 3MRMA 1Q72H 1RZKL 3MCLH 2QSVA 1UXWA 2VDMH 1T0NA 3MLWL 3RWGB 5DJYA 1PZUB 1A3LH 1ONQA 1B88A 4U7MA 3HS0B 2FEDC 3MXVL 3VFSA 4GMTH 3D2UA 4HG4J 2DM3A 5A2IH 4CMHC 5D7KE 2YD2A 1HHIA 1DVFC 4O5LL 4YQXH 3PQYA 3U36B 2MHAB 1L0QA 2PYFB 2YUWA 3D85B 3LQAH 3ZSSA 1L6XA 3ULUE 2C3GA 1HN1A 5EIVA 4AEHL 3ARFD 1BIIA 5DT1H 1VPOL 3GRWH 1CU4H 1MIML 1NPUA 1RU9H 3FB6A 2J12B 1QKZH 4LLYA 4P3DB 3NCCB 3TT1H 3Q2CA 3IF1B 4NCC2 5KSAC 4QRPE 1PG7X 4YWGH 2P49B 4WWID 4CN4A 1E27A 3U2SB 1Q94B 1P7KB 3QHZL 5J1SC 1M71B 3MXVH 1A7PL 1KJVB 4Z7NF 2QR0A 3D39E 1QQDA 4X9GA 4XWGL 4RFOH 5KSBE 2CK0H 1NGWA 2YD7A 3CLFH 5SWZB 2O5ZH 5KANG 1LD9B 3P9MB 3PHOB 3V4VH 5E8OB 3N9GL 3WIHL 2F5AH 3GJEB 4PGDB 3MODH 5C0EA 1EGJH 1SY6L 3EOYG 1PDKA 4HFUL 5FYKH 3WLBA 3ZDXE 2VLMD 3WCYA 2FJHB 3QUML 1TTFA 1O7VA 2HVJB 3Q1SL 4HFWB 3KJ6H 4F37K 1I7TB 4YH6A 2P5ED 1P9MA 4RMVA 1H5BC 1ITBB 1LO5B 3S4SB 3QSKB 1J1PH 5JW4N 2WV3A 4KTYA 4OSUH 3L3OB 3D69A 4H0IA 2LV4A 4P2OD 3ULUD 1JNLH 1PX3A 1NJ9A 3RNQB 3G6AB 1T03L 3L7FB 5DURD 5J11B 1NSNH 5C07A 3BKYH 3H7BA 3TV3H 1FV1B 1RMFH 3O2VL 3V7MA 5T3XL 2F5AL 3VH8G 3AREA 1IBGH 3MREA 3ZKMC 1KJ2L 3V0WH 5FYKL 1W8OA 2Y23A 2IPKA 2BY3A 3VCLB 1YYML 5L9DH 3EYOB 4P2RA 4Q2ZB 4MQXC 3QEGL 5CWSB 3BHBA 2IADB 2DIBA 2X4OA 4X5XB 1AGCA 4PJ7E 4WUUB 1A6VH 1OTUC 4K23L 3CFDA 4X83A 5TE7L 4F15C 5GRXG 5JNYB 1KN2H 5D1XB 4WFEE 4PRHA 3MACH 1A47A 4NO5B 4JY6A 3BZDA 1XIWD 3SJVE 3PL6C 5I18H 3IB4A 5HDBE 1RULH 2QBWA 1C5CL 1ZEAL 1AFVL 2FH6A 5E8NA 1I1YB 4P3CL 3O3UN 4F57L 2XNAB 5BV7B 5E6IB 3OX8B 5DQ9A 2GJJA 2ZUVA 1CQYA 4K2UH 5F7YC 1JFQH 3PUCA 5T3ZD 5LQBH 1QLEH 4D9QE 3KXFA 2DMCA 4XP4H 4ZFGH 5IT2H 1J1OL 1WAAA 5D1QA 4I77L 1GC1H 3RZCD 4ONFL 1G0XA 3LPFA 1JYNA 5T3ZH 3LRSA 1TJIH 1VFBB 3VXSD 2OTUA 3HG1D 1KTRL 4GRWF 3IETB 2X41A 3ARVA 1CS6A 4XZUA 2ZSVB 2VL5B 2V2TB 2BOCB 1DQLL 4KV5E 4XVTH 3UJIH 4OTXH 3VDBA 5IB2B 1GZQA 5JPMA 2BNUA 2DLHA 4DGIL 1AGDA 1LNUB 2D0FA 1AGBA 5EUKA 5HHXH 4OLVH 3ARGC 2VDLH 2FGWH 4ZQKA 1Q0XL 4NNXA 1FFRA 3UTPD 1R3KA 3EYVB 1PZ5A 1V7NH 2FD6H 4PV8B 2B1AL 4I2XE 2VNCA 4KVNH 2YA2A 3B8YA 1F5WA 3OR7B 3RIAF 1EJOH 4U31A 5KSVB 2ZJSH 4WFED 4KJQC 4JANA 2ZUUA 4S0SD 4PRIA 1NMCC 3F7VA 1ZGLB