4H8WH

Crystal structure of non-neutralizing and adcc-potent antibody n5-i5 in complex with hiv-1 clade a/e gp120 and scd4.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
212
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSTYAMSWVRQAPGKGLEWVSSINNSGRNTFSADSVKGRFTISRDNSKNTLFLVMNSLRAEDTAVYYCAKDLRLGGGSDYWGQGTLVTVSSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Definition of an Antibody-Dependent Cellular Cytotoxicity Response Implicated in Reduced Risk for HIV-1 Infection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
molecule keywords HIV-1 CLADE A/E 93TH057 (H375S) GP120
total genus 42
structure length 212
sequence length 219
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h8wH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h8wH01
5EOQL 4NPYA 3MRJA 3LKQB 4ELMB 5CP3A 1KEML 4WDIB 4MD4A 5DHXB 1PVHA 3QI9B 1A6WL 1FN4A 4NUJB 2UZYB 5MERB 3AREB 1LNUA 4JO2H 4KV5E 4ONOA 4YXHL 5IQ7L 3MPCA 3U7YL 2FZ3A 4JHBA 3ARFA 3VXOA 2A6KB 2AEQL 3NFPB 3BIKA 4CVXA 2VDMH 4L4VA 1CIDA 2YBRB 2WLYA 4BSJA 5GS0D 3D85D 5C0AE 1GGCL 4WO4B 1D5IH 1UCTA 2PW2A 3OKOA 5FUCE 1A1NB 1QFUH 3U36B 4ZPVA 3C6LA 3AREC 5DMKA 5BV7B 2OL3H 4FZEL 5ANME 1CQYA 1UEMA 2IPUG 3TBSB 1CE1L 2DQIL 3QUXD 3LKNB 1SJHA 1AXSA 3VDBA 4ELME 3G08B 4HIXL 1HQRA 3D69B 4I4WA 3DURB 3R0NA 4QRQA 3CX5J 2HFFA 1C16B 4NQDE 3BP7A 2NNAB 3T2QA 1KTLA 1JGLL 3NBNA 1FNAA 3QNZB 4HULB 1KN2L 4Z78A 1NFDA 1IQDB 4XH2A 1V3MA 2CMRL 5L2KD 2AI0H 3UBXI 4XP9L 2FECL 3MRHA 1LEGA 5L2KE 1KCUH 1J1OH 4DVBB 2VQ1B 5SWSD 1N8ZB 4XXDA 4Y19E 4HHAB 4UQ2A 1WBZB 5SWSE 5L7XH 4L4TE 2D4FA 1B88A 1K4CA 4CNIB 3N85L 1UM5H 2VN4A 1P2CA 1KCUL 4N0UB 1U93A 2H2SD 4DGIH 5E6ID 1SM3H 3MUHL 4UOW1 1OAYH 1R5IA 1CVRA 1I3VA 5JXEA 3VG9C 4LSVL 3S88H 3WUZA 1LVEA 4ODUB 5BOZG 4R6UA 1A8JH 4Y16B 4TOYH 1OAYL 2MQCA 3EKCA 4AM0A 5AZEL 2ZSVA 3DI3B 3R4DA 1OWRM 2G5RA 3MRBA 4O51A 4NBYB 3UAJD 4L8SA 2YN5A 4H8WC 4FNLH 5J8OA 2CDGA 3IJSB 1RUAL 4I9WE 1EO8L 1JGUL 4ALAL 1S7XB 5HYQB 4X7CC 1JI1A 1YA5A 4LSTH 3H3PH 2HT2C 5C0CE 5LQBL 5IVOA 5B8CA 3VW3L 1QA9B 4BKLB 2VLRD 4YUEL 1SY6L 1OTTD 2J6EL 2R0KL 4U6YA 2DQDH 4QF1A 2QQQA 4P5KA 4PG2C 5J13B 3SDXB 3GSUB 3PWPB 1IFHH 4MJID 4RDQF 4YUEH 5IEKA 3V4UH 2PTUA 1LO2L 1PLGH 3PXJA 3T0DA 1OSPH 1EZVX 4NBZB 1IM9D 1LEIA 1IFHL 5EA0L 4UQ3B 3T4YA 1VA9A 2YD2A 4MAUH 1L7TH 3Q6GL 1BHGA 1M05B 4G42A 2AEPL 3VGBA 2DQGH 2FGWH 4FQIH 3CFEA 5JPNA 4IS6A 4TTGA 2GW5A 4P3CH 1NCBL 4HWZA 4D3CL 4MAUL 3ZKXB 1FNFA 2ESVD 4JN1H 3G5ZA 1OD9A 4MHHI 4Z7UF 3PIQA 1EERB 1QEWA 4MA1C 4W4NA 2XACC 3G5XA 2J8UE 5FOJA 1UZ6E 3H42H 3RA7L 4ZD3L 1SJEB 3BMWA 3ARGA 2Q7YB 2CLRA 4MD5B 1SJHB 5CJXC 1A22B 3NZ8B 1OWWA 3LEYL 1T22B 4U6VL 1PQZB 5IHZB 4JGUA 4K3EH 1BFTA 2VWEC 2FO1A 1U95A 5I1EL 3T0EB 3P9LB 3EO9L 3KWWA 1H0DB 2OBGA 3TF7C 1EGJA 1MVUA 3ARGC 3ILPA 1JWMA 2YOCA 3GNMH 2AJSL 1GL4B 1FVEB 3UBXA 1D6EA 2CJUH 3VD7A 3JVGC 1RZKC 1AI1L 5CP7A 3BZEB 4FQLL 43C9B 3NCFB 4GKSB 2R39A 2BMKB 2X5PA 1CICB 1WVZA 4BQCA 1N5YL 2AJSH 4HIJA 1OVZA 3IDUA 3CZFA 4NNXB 2R29L 1QSFE 3X3FH 5GRVK 5HBBA 4OCWL 1LO3H 3A0OA 4PJDB 5FO8A 1N5YH 4N8VB 4X4ZA 3LKRB 1R0AH 5T1MA 3PL6A 4R26L 3VFRA 4M03A 5CJQL 5BJTA 5J3HD 4JLRB 2DI8A 5IMKB 1E6OL 1AGFB 1ORQA 3O45A 1TZHB 3F7QA 4JFHE 4N1CA 3KLAA 4HS8H 3KJ6H 1R0AL 3HMXL 4FA8A 1INQA 1FVCB 3AMLA 3UTQA 2H1PL 1LQSR 5MEOA 3L5WB 1PYWA 4OFYD 3KPMA 4JY6A 4MQ7A 3M8OH 3HRPA 2EO9A 4KJWD 4BSWB 4E41B 1GGIH 5ICZA 1E4WH 3MRRA 3W2DH 4LFHD 3OKNA 2P43B 2XA8H 5GJTH 5EN2B 4NBXB 4IOFD 3O81A 2F54E 5HGHA 1E6JL 4HMDA 1MEXH 5F7UA 4K7FA 5LGHH 4PGBA 4ZTPH 3AAZA 4AMKL 3V0WH 4WHDA 4ZSOE 1OF2A 3T09A 1RIUH 4OV6F 5L2KA 2ADJA 5FKAA 3L3DA 4ZTPL 3GMLB 3FOLA 4JCLA 2FJGA 5DJ2B 2CIKA 3E6FA 3S35L 1G7MB 4L4TA 4N5UA 3JBG7 4Z8FH 4HUVA 4ETQA 1JPFB 5C8JB 3LKOB 4Z7WA 2BC4A 3TVMB 2X9YA 4KK6D 5ERWA 3MRIB 4E9LA 2EH7L 1CBVH 2VR5A 4IS6B 4PRBB 3Q1SL 5CEXA 2P5EA 3N9GL 5JOFB 4Y4KC 3BKCH 5FHAH 3DUSA 5M95B 1CD8A 1KJ2H 3G6DH 5GS1C 2GIYA 2Z4QA 2NX5E 1EHLH 3MV7E 1OTSD 3N9GH 3P9MA 4G9FB 5KSUA 5M94B 3I75A 4PRHD 3UTOA 4OD1L 1KJ2L 2NY5C 3QSKB 5DT1L 3MUJA 5BQ7B 4NT6A 5E00A 2P5WB 3HAEH 4J4PC 5F88B 5C2BH 1U93B 5HYJB 4PB9L 1WF5A 5DYOB 3V7MA 1TZIB 2HTKC 4WI2A 4OGXH 3RVWD 2IADA 5HYSB 4NQDA 5TJWK 3SJVB 3R1GH 2BFVH 5HI3C 3UBXB 4FFVD 1HHIA 5BS0A 5DK0B 5HHQA 3DV6B 2FSEA 5J56B 4Y16A 5JNYB 2ZSVB 4O58L 4Q97A 1NAKL 3UO1L 1YNTB 1BFVL 4PD4J 5K9QI 1IM9A 4E5XB 4EJ1C 5KW9L 1FFQA 1T6VN 3VXSB 4BFIA 4DQOH 4O58H 3SBWA 4QCIB 1BF8A 1MRFL 1MLBB 2EC9T 5KW9H 5IBLC 4HPOL 1YNLL 2P5WE 3BUTA 4OGYH 4JM4L 1ZK9A 1W72H 3GMQB 4OLWH 4PRIB 4KDVA 4KDWA 1RUKL 4RX4A 3NCJH 4UUJB 3QH3B 4KHTL 3DXAD 4GXUN 5ITFA 4LARH 1NGYB 5ADPH 5K9KB 1LO4L 2VLJB 5KVEH 5MEOB 2VXUL 1W72L 5IB2B 2ADGB 3I2CL 3DMMD 3R8QA 5FYJD 1YYMH 3LN9A 3OKEB 4U1MA 1X7QA 5ITBH 1P7HL 4FHBD 3WN5A 3O6KL 5IVXB 1C5BL 1F3RB 5F6IB 5E6ZA 2F5BH 2LVCA 5JPMB 1E28A 1MJ7H 5B39G 1PDKA 1HWHB 2SEBA 1XCQA 5FKAB 3EHBD 3OKOB 1I1FA 2GTZB 1JGEB 3ARFD 4D0BA 4F7MB 4OM1H 5KVDH 4D2NA 2CH8A 2X4QA 2Z93B 3FQXB 3UTSA 43CAA 1GGTA 2KL6A 1LP9B 4KQ4L 5FYJL 1LK2A 4IRSA 4XNMB 1J8KA 3QIWD 2VE6B 2OM5A 2PETA 3H6JA 1A6AA 1NMCC 4KZEL 2ZWLT 1O7VA 1UJTA 3S97C 3W39B 4Y5YB 3ARRA 1MVUB 3QDHA 4LHQB 1NL0L 4OIIH 4HLZG 1L0YA 35C8L 2X41A 2ZUWA 1ZLSL 2EYRB 3PDOA 4I18C 1BD2B 5KSBE 4K7PY 3AB0C 2M1KA 1VKXA 3HS0A 1CFTB 3TJEL 3V6ZB 1Q1JH 4M8VA 2ENYA 5ANMA 3GKWL 1TCRB 4PJEF 2PW1A 4HK3J 4J8RB 1X5FA 4PJXB 1T83C 4ZFOB 4JKMA 4KY1L 4S1RL 5ILTL 3B3IB 3ULUE 3BPNC 4ZSOA 4KGLA 3GKWH 5IJKC 3P30H 2OSLA 3WV0A 2EICA 3EYSH 5BS0B 4F33A 3FFDA 4WIQA 4C83A 1G1CA 3OR7B 4N9GB 2A6JA 4M00A 3S4SB 4JM2D 1Q9OB 1GZPB 3BN9D 1WWCA 4R7DB 5E1HB 4F9PC 4XPBL 4BFIB 1MPAH 4PRNA 2OTWA 3FB8A 5FM5O 4P59H 4LOUD 4U1LA 1NMCB 4S11A 4NQEB 3QUXC 3RWJB 1OW0C 3GJFB 5D1XC 4YGVA 4LNRA 4MAYC 3N1QC 4Z7OF 3QNXA 4TRPH 1KNOA 3ZYOA 1NSNL 1VFUA 1FH5H 3MLYH 4U1GC 3RDTD 4I2XE 1UB5A 2H26A 1FDLH 4XWGL 3C08H 2LTQC 4YDVB 3F62A 3PWVB 1K6QL 4P49A 1XF4B 4G8IA 3KJ4B 1IE5A 5KS9E 2CK2A 1YPZA 4PJIF 1V7ML 2DS4A 2N1KA 4I0KA 4LSUH 1P4BH 1RIVH 1QHOA 1JYWA 3LPFA 4GBXB 1U8OB 4KAQH 4BUGA 5BV7L 5F89B 2AV7B 4EI6A 4GG6E 3RQ3A 4EBQH 3RDTC 2AEQH 1U8JA 1J8HE 2GI7A 2QKIA 3BH9B 2BSED 4LRIC 1T0NB 4OZFA 2BNQE 5DJXA 3SDDC 2A9ML 2NLJB 1OAXH 3CX2A 3WE6B 2H32H 4ODBD 5IVXF 2V9TA 3RGVB 2XG5A 5EU7C 3KLDA 3FRPG 5A43C 4JFEA 3VFTB 3L5XH 3U0WL 4XNMA 2GY5A 1DANU 1SJVA 5E70A 3VG9B 3LPWA 4HKXB 5TDOA 5FDWA 2P5EE 3AS3A 2YN3A 4XCCL 3Q2CA 5C3LD 1S5HA 2ZUUA 1IKNA 4UTAH 3ILPB 1YEHL 3DV6A 5E7FA 2IPUK 3VG0L 8FABB 2VWEE 4Q6IA 2HRPH 4XVUC 4QT5B 4ZFOL 2X1QA 5E2WL 1H5BC 5JO5B 1KTRL 4OCYH 2APXA 4YX2L 1HYRC 5I71C 3G5VB 5EG6C 3VG0H 4CU6A 3SPVB 5MP6L 2OXGA 1F2QA 3ZT6A 1F97A 1QKZL 2A38A 3QUZB 4XPGL 2DQCH 1AO7A 1T2JA 4P2RD 4UB0L 5L7XL 5DUPH 3D39E 5HHVL 5ELIA 2FZ3B 2F8XC 2Q7NA 3V79C 4YHKH 2VOTA 3K2UL 4PJIA 2YD7A 2DM4A 4QXWA 2XTJC 3IFNL 3QH3A 2DQHH 5HHVH 3CDYA 1N64H 3G04B 4L1HA 3MREA 3SEPA 5T3XH 3LIZL 3LRHA 4JFXB 4UZGA 2VLKE 3L3KA 4K2UL 1CGUA 4Z7OE 1CLOH 4HF5L 4FNLL 1R3KB 4LHUD 3C8KA 3QUYA 4HS3A 5MEQB 5E9DB 4LVHC 3D2UB 4K2UH 3CU7A 1S5IL 3WLWC 1AD9B 1BM3L 2DI7A 5GJSH 3HNVL 4OLUL 1WK0A 4WW1B 15C8L 4PJ9D 4L8CA 3DHMA 1P1ZB 4PJFF 2WBJD 5F7MC 4WGVB 4PLNC 1GCFA 2BY3A 3QDMD 3M17A 4G3YL 1QLRA 3RY4A 5F9JB 1F4AA 2EH8L 5I73B 4P4RA 1EEZB 1Q9LB 2BNRE 3C2AH 1LO2H 4CBPA 1LP9A 2BK8A 5C86A 1DVFB 3AS1A 2Q6WB 1WZLA 4OZ4A 4UQ2B 3K3QA 3QR2A 2X4SB 2BC4B 3EJZC 4J7RA 3KS0J 5IG7B 5F1KC 4NFBA 4H8WL 3DSFH 2A0LD 3FQNB 5EIIB 4K71B 5HHNB 2Q8AL 5HDQH 3JTSA 2X7LB 4RSVA 4JCMA 3H9ZA 3TH4T 3O3BB 3MMEA 4K7PH 3HG1B 5DD6B 3P77A 2ZZUT 5DJZB 4MJ4A 1V3LA 4KVNL 2AEWA 1X9QA 4ERSH 5HDQL 4DW2H 1A6VL 4XNXH 3ARBD 3ARPA 2R56H 5FFLA 4NN7B 5KN5B 4X99A 4ZD3H 3QJFA 4JDTL 4LPXA 1T0MB 4NKDA 3JVGA 2CDGB 2UUDK 3IJSA 4HH9B 3BH8A 4U1NA 5ALCH 4WI5A 2DICA 2JELL 3AUVA 5HYJA 4PJCB 5HYQA 1CD1B 1GIGH 2HJKA 4KKAC 4UILL 4WUUE 4OD2B 2IADB 3T77B 4HIIA 1YPZE 4OD3H 5KG9B 1L6ZA 3VWJD 3NPSB 2MNUA 1INEH 1Y18B 3I50L 3BAEL 3OAYK 1IILE 3QEQA 3JXAA 4YHPB 5JW3H 4FQ1H 5GGUB 4FFZL 3RDTA 3RGVC 4KHXL 3I6KA 4JPVH 5D6CA 3S6CA 1J8HA 1FNGA 4KWUA 3TA3C 4LBEA 4U33A 3EOTL 2F53D 5HGBB 1IGML 5EIQA 2A1WH 3VFSA 3PGCA 4R26H 4KK5D 2NXYB 2FRGP 3MRLB 5DJ6B 3BD4A 1KUMA 4HXBH 2R2BA 1LMKA 2IEPA 4S10A 4MJIA 4PRIA 2CXGA 5FYLD 2Z31A 4LCUB 3S5LB 4L4JA 2ENSA 4HBQA 3ZE2F 1G9NC 2BP3A 3IVKA 1PSKL 1F13A 1KPVA 3ULSA 1OM3L 3CXDH 1I8LC 1N7MH 4UDTA 3GMOA 4K3GA 5FF6B 3TNMB 1IC1A 2DKMA 2XZCL 1SYSA 4ZPTB 4KTDL 2K9UA 3BW9A 4O2EB 2H3NA 4XHQA 3B9VA 3DX7A 3WIHL 5BMFL 3IETA 1AXTH 1FO0L 2NY7H 4L8SC 4AMKH 3MUGA 4PJHA 2VITB 4UT7H 1WBYB 2P5WD 3MLVH 1A4KA 3OHXB 2IPTH 4KGJA 4UIMB 4KQ3H 2G9HA 5B38A 2OS7A 3U0TA 3SJVD 5EU5A 1NGZA 1EAPA 1QSEE 1FFOB 4O5LL 3C9NA 3DUUA 3S36H 2CSPA 2D7TL 4JO4L 4HKJA 2ZNWA 5FO8B 4FN0A 2ZUYA 5IB4A 5FYLE 2RIKA 3FQWA 3CFJA 1VGKA 3JTSB 2DQTL 2BY1A 3BP5A 3TO4A 3VGEA 2E3VA 5C0RH 3DUHA 1KJVA 1ORQB 1XGYH 3BJ91 3NAAH 3Q6FA 3CFCL 2X4PA 3G6DL 3UZVB 3UTSD 5F7WC 1IT9H 3UPAA 3UP1A 4BZ1H 1LHZA 3R06B 2WANA 3V4VL 3RL1B 4YDJB 4HFWB 2EYSB 4MS8D 4NJ9H 5D5MB 4DAGL 4IMKA 4OQ1A 4HUWA 5ICZB 4HH9A 4WFHE 4P9HH 1OP3H 2HVKA 3TCLB 4C56B 4D9RE 1K8IA 3OKNB 2NX5D 2DIJA 4ZFOA 1MRCH 1IMHC 4PP1C 5EN2A 5KTEL 1YN7B 2B2XL 2HJKB 4UU9B 5KAQG 1T1ZB 5IQ9B 4PJ9A 3KYOA 3RY6A 2ICWJ 1XCTB 3BP4A 4WI3A 4YH6A 3SQOH 3CVHH 1HK6A 1J9CT 1NJ9B 5FM4A 2QADB 5FCUH 1DBJH 1U3YA 5E2TL 1VPOL 1OB1A 2IH3B 1DN0B 1XGUB 2HYMA 2HJFB 2X9WA 1I8IB 4NZRL 1IGIL 1GZPA 3NIDE 1MCPL 2D7MA 2Y06H 3U6RB 2AJZA 2QHRL 3TBYA 3HUJF 2PO6C 3K46A 4XCEB 2IJ0C 4JFPB 4H5SB 3QIBD 3LKOA 3SDXF 3BGFC 4Q9RL 4G8FA 1IGIH 2RHEA 1R3IL 1F3JB 3BHBA 4PGDB 3WDIA 1CDYA 4O2CA 3F8UB 1AJ7L 5GGQH 4QF1B 3GSNA 4DUWA 4PJIE 5F72S 4OLWL 1UB5B 2H26B 4QTHA 1N5AA 4WENB 2OZ4A 2J4WH 4NO0A 4JRYE 4IDJH 1R3JA 3O3AB 5FKPA 3BN9C 4MNGB 2EIZA 1W72A 1T4KB 4OZHA 1P4LA 1CDHA 1NUGA 4M7LT 2B4CL 4NZJA 3WJJC 5HHNA 2CRZA 3ROLA 1UKTA 4L3EB 1UM6L 3O3BA 3VFWA 3VXPA 2JCCB 5F7DB 2M8XA 1YMMD 2AV1A 4X98B 2GAZB 4BUHA 2R0ZL 1H3XA 2AJXH 5CEZE 4YBLC 4NN6B 4QXTA 1RUPH 5T5FL 1B6UA 1TJHL 4QTIL 1T0MA 4NKDB 2ED7A 4P2QB 3SCMA 4UAOB 5TE6H 3WJLA 2ESVB 1T3FA 1EEQA 3S8WA 4M48H 2X1WL 5EU7E 1Q8MA 1UWEL 2Z8WC 2JIXB 3FQWB 5D2NC 1URLA 2G2RA 1J5OL 4HQQL 2CRYA 3T77A 4DGYL 1U8NA 3HZKB 5T33H 3WXWL 1U92A 1ZWIA 5C92A 2H2SC 1VFMA 2V2WA 4JFED 1FVEA 35C8H 4TUKH 1B0RB 2D9QB 2V9RA 3T2NH 3AXLA 1J5OH 5D93B 1ZT1A 2B1AH 2A77L 4R2GB 5JQ6H 2VDQL 2ICEA 3M1BB 5FYKL 4XHJC 1FLRH 4G6AD 1JCKA 5GHWL 4L3CA 4KY1H 4S1RH 5H94B 4M62L 1KLGA 2ZNXA 3MRMB 5I1LB 2ESVE 3RTQB 3MQIA 4JRWA 2R2BB 4JO1H 5E5MA 2AERT 1FCGA 1G0DA 5GGTA 3CFKB 5EOTB 3C2SA 3ZKSD 1QBLH 4NSKB 4OV5A 4EUPH 3MGTA 2Q1EA 5DJ8A 3P9WB 3HMXA 4FG6C 5D1XD 4CW1A 2MSPA 1MCFA 5DGQA 5DD3H 2FJFB 4FQQA 1K3IA 4O2FA 5J0BA 4UDTB 1GGYA 4XMLL 1VADB 3MV9B 2FX7H 1A0QH 3D0VB 4HZAA 3DROA 5I8KL 2F54A 5IW6B 1KULA 3TH2T 1QPXA 1H3TA 1TZGH 4JHAH 5FA3B 4WV1B 3VFOA 3SE8L 1RK0B 4I2XB 4QNPE 3B8SA 3VXTB 4JN2B 1M7XA 5I1CH 4YHIB 4Z0XB 4LSSH 1U8LB 4EOWH 4FQXB 2CGRH 1ACYH 3BE1H 4H25A 1OAZL 3V6ZA 4L4VD 5TH2B 3UTTB 3EFFA 4F2MA 5I15L 5ERWB 1DE4B 2P8MA 3FHQA 5D7JB 5ECJE 4PJBF 4UMGA 6FABL 1Q72H 3GRWH 4P48A 3IU3A 2RBLA 4EBQL 1I3RA 4X0KB 4CKVX 3QCUH 5IHUL 2IBGA 3ARTA 4DN4L 1KEGH 1Q72L 4BELD 1MFDL 4Z7QF 4YQXH 2WBJA 5IHUH 5CMAA 1MI5D 4HBCL 2CK0L 4RWYH 5LAXB 4Q0XH 1DFBH 4JFDE 4HMEA 2BCKB 1BEYH 4YQXL 4KRMB 2GQHA 1J1PH 3EJYD 4OCRL 1EV2E 3EBAA 2JIXA 1DEEB 2P1YA 3G5YB 5DHYA 3GJFA 4E0RA 1CLYH 4G9FD 4G8GD 3HC4H 1U92B 1JHTA 4M43H 3HI6H 3QEHB 4BFBD 1WITA 3AS2A 3F7RA 1YEHH 3B6SA 2O61B 4X6DE 3C6SB 1F90H 3GMPA 3Q48A 4Z7WF 5A40E 3FQUA 5F8RC 4M7JH 3O2DH 3WNOA 2VL5A 4I3RL 1XF4A 4YX2H 3QFDA 4GG8A 1GSMA 5FUZH 1B3JA 2R1YB 3HTLX 4IMLA 3SY0A 1X5IA 3FO2B 3HC3H 4JFPA 2AQ2A 3QHTC 1M7IB 1T7VA 4JFFB 1NMBH 1NCUA 2DQCL 1KC5L 3GGWB 2OZ4L 3FRUB 3WFCH 5AWNL 1N26A 3NTCL 1NLBL 1FNGB 2Z8RA 2OJZH 3VXRE 2M26A 3RVUC 3GMQA 2XTJE 4L9LB 2W91A 3MJ9L 2BVTA 3K2UH 3BH9A 1A6ZA 4JDVA 3DVFA 4JRXA 1CFBA 4CW1B 2E7BA 5C0JA 5KZCB 1R3JB 3O3AA 5FKPB 4NNPL 4J4PA 1CLZH 3AU1A 4H1LA 3GB7B 2BNRD 1W72B 1WC7A 2PCPA 1I7ZA 1LK3H 4NHUA 4GRLC 3CC5B 5GRJH 4PB0L 3TNMA 4DFIA 3KYMB 4JFOA 3ME0A 1WCBB 1FAIH 3ARBB 1IM3A 1E28B 2HWZH 3SKOA 1U41A 3BGMB 1CK0L 2NY1D 5EH1A 1UADC 2NY4B 5GRVL 3OHXA 2X89A 5CEYB 2GAZA 4A6YB 2VR4A 1U8MB 4RQQB 3JUZA 4H25B 3RUGB 2G9HB 1T1XB 5D71H 5AUMA 3LKPA 1DBBL 1LK2B 4IRSB 4KRPD 4NKIL 4WW2B 5ESVA 4X6CB 2UUDH 3CSYA 1RK1A 3SDAA 4YNYA 4PJXF 5AD0A 2HFGH 3FN9A 5DQDL 2PUQT 1H9VA 3T0AA 3T3MF 1ORSB 5DDHB 2VUOA 2Q8AH 3T0ED 1IAKB 5JIHA 1CGYA 1AKJA 1CF8L 5F1IB 5DQDH 4EIGB 1ETZA 4D0DB 4LF3A 2I60L 4PJ5E 1NAML 1MFBH 4KJYB 5IP4A 1RVFH 1CF8H 3C5JA 1S9YB 2XFXB 1FE8L 5HI4C 1QR1A 3L3KB 4LVOB 3BKJL 4F7EA 5DJCA 3K8LA 3VRIB 4PG9A 4KTEH 5IJVA 3QISA 4WNQA 2PTTA 4G7VL 1AY1H 2IANA 1K5NB 5H8DA 3ULUD 3IFPB 3BWAA 1HXYB 5IK3B 1DQQB 1MRDL 2YUWA 3I6GB 3EYFB 1FYTA 2FLBT 5GRUH 4G9DA 3STBA 2J8UF 2Q86B 4ETYA 3V7AE 4GUPB 3H8NA 1KCVL 2Y07L 3BAEH 1DN0A 3QFDB 5CGYC 4MJ2A 3NPZB 1G9MC 3MO1A 3ROOB 3B2UC 3V95A 2OTWB 1CN4A 2DQUH 4N8CL 2V2TA 5IHBA 4KHXH 1T0PB 3M07A 2DJUA 1V7NL 5D4QA 1FPTL 4KUZL 2BOBB 4NGHH 5CWSB 2Z9TA 1Q0XH 5CSBA 3FFCB 3NACH 5KOMC 3U0PA 3UBXG 3WFBH 4LIQH 5BRZB 4L9LA 3RY5A 1TNMA 1NEZG 3LEXB 3MLSL 3SE4C 3O6ML 2MPAL 3CXHJ 3RZWA 4LIQL 3X13B 3LQZB 5SWQA 3WKNA 1DQJB 4IHOB 3EAKA 4HCRL 5DK2A 1JHKL 4ELMA 3KPSE 3JV5A 5CZVH 5BCAA 4MWFB 5GRXG 3CXDL 5C71A 1CTOA 2PN5A 4EDWH 1NC4A 3ARFC 3B8YA 3PGFL 1YMHB 3SE4A 4ZUVA 3FONA 4W4OA 5MHSD 3PJSB 4PTUB 1TITA 2A6KA 1R5WB 3TT3L 4PJCA 3MA7B 1KEMH 2WWKO 3BPOB 3FFCE 1A14H 3IF1A 2ICWB 1U2CA 4BQ6A 1G7IB 2YK1H 3H3BC 4ZOAA 1G7LB 2B8OT 5FK9A 4RMWA 1ERNA 4GFTB 3WHXB 1JFQL 5SWSA 4LCCC 4QRPD 2BCKA 5CIPH 5TQ0L 5SX4I 5CD3B 5GS0L 3I6KB 4WI6A 3AS0A 5HHXH 3VXRA 5JW4N 2OQJB 1BLNB 2DIAA 1BFOA 2W9EL 3EO0B 4JO4H 2C3HA 3Q5TA 4QKXB 2EZ0D 4KKLC 4U2ZA 5HGBA 2DTML 4BQ8A 1DDHB 4NQCE 1G6RA 1HINH 3PGCB 5DVOA 5DZOA 3VI4F 2DQTH 3MRKB 2QR0B 5M7QA 3MODH 4X6DF 4XPAL 5JXAH 1HQ4B 5DRXB 5C07E 3LS4H 1OP5H 4ZDHA 3ZDYF 4A2MA 5HHPA 3V4VH 3GJEA 2VMFA 1C5DA 1KLFA 3MODL 2FB4L 1JPST 1LGVA 3ARYA 4H1LH 4ODHH 2CPCA 1SEBA 3D85B 3KXFA 1WBZA 5F70A 5C0CA 4GKOA 3EYQD 4LKXB 4QRSA 1QSEB 2FB4H 3EFDL 1KFAH 2AJVH 1T7XA 1T2QL 3MXWL 1CDUA 4M1DH 2B2XH 1EFQA 3RTQA 1J1OL 2P24B 3DYMA 5D8JL 1EEYB 4PYGA 1DBJL 5C0JB 2FJHB 1WIUA 4TVPH 1I8MB 4YEEA 3CMGA 1I7ZB 3KAAA 4L8SB 4NZRH 2BVQA 1MCPH 1HHKA 1G7QB 1IGFH 1P53A 1WTLA 1LWRA 3NZ8A 1WZKA 4F37K 2P4AB 2B5IB 1LO0H 1A6TA 1IBGH 2YD1A 1R3IH 1MJJA 5GSVB 5DVLA 2AABH 4HKZB 3UDWC 3MACL 4ORGA 4I0PA 4HX1A 1SY6A 2J6EA 3CLEL 3K0WA 5I1GL 2D7PA 5CEYA 4JM2C 3LQZA 1QVOA 5SWQB 1ZMYA 3MACH 3HB3C 4LLVA 3CMOL 3QDME 2GFBB 5EZOH 4NM4H 1FLTX 2QSCH 3MLPA 4OLYH 4MX7B 3D2UD 4P2RE 1SY6H 1UZ8B 2J6EH 2R0KH 5EU6B 4W6XB 2H9GB 5EZIH 3RUGF 5IB3B 1BBDL 5EC2A 4X6EB 2O5ZH 5IVXE 4QRRB 3CFEB 5JPNB 1I75A 4LVNC 1VFAA 1DQML 4KI5D 4Z76A 3VI3E 1CDGA 2W65B 1XCTA 1AGFA 3O45B 4OFKA 2O5ZL 3NABL 5EA0H 4TNVK 1UM6H 5GS3A 5A2JH 5EORL 1TTUA 4OF5A 2ORBH 3OAZH 3H3KA 3TT1H 5KN5A 3U9PL 1JVKA 1R3HB 5I1AB 4K94L 4P9HC 5DR5H 1FFPB 1AE6H 4H5SA 1FZKA 2Z8VC 2Y23A 4M48L 4LQFL 3IFPA 4AEHH 2JE8A 1DDHA 5DHYB 4WUUA 5DR5L 4NN7C 1CFNA 1PKOA 1UC6A 3PP4H 1AE6L 3LEYH 4WUUD 3GI9H 4U6VH 1QHPA 2P45B 3FAWA 3KPSA 5HHME 3QEQE 4D9LH 4GAGH 2BNUA 1CFQB 4ZNEE 4M3JA 2XNAA 2OL3A 1PAMA 4X7SH 4HIJB 2ZKHL 2HTKD 1J0ZA 4PJ5A 3QRFM 5HD8C 3FO9B 3HUJE 4Q9QH 1ZSDB 3E6HB 3B5TA 3RHWF 5IR1A 4GAGL 2CJUL 1J1XH 4K8RD 2R15A 4R8WL 4Z7UA 4YBHA 1AO7E 2BVUA 2DYPB 2ZKHH 3VMPA 2I5YL 1OQXA 5C0EB 4MDIA 5CEXB 4HPYH 2HFTA 4M6ML 4B41A 2DWDB 2AK1L 4L3EA 2I5YH 3NIGF 3ARZA 4YAQA 2GY7B 1I7UA 4WCYH 1T89A 4K07A 4LPYA 1TJIL 2AV1B 3SE3A 1MJ8H 4X6DA 1L0XA 1HHKB 3ZL4H 4ZUUB 4PREB 2VLKA 2NXYD 4LVHB 4LLWA 3TV3H 2YHGA 4PGZA 4M4RA 3S96A 2C4XA 4GG6B 1F4XL 3H9YA 4KJPC 4R4BA 3WHE1 5CHNB 4OCSH 4K7FB 1ZHLB 1UYWH 1NGQL 5A2FA 3K4DA 5E0QA 4XP1H 4HZLA 2DTSA 2ARJA 5E6YA 1B0RA 2GFBA 3O3EB 3V6OC 5INDB 5SWSB 3D3VD 3LZFH 3LN4A 2NY1C 3V8OA 1NC2D 3GKZA 2BNRA 5HJ3A 2EYTB 3MCLL 3TVMA 3QT2A 2VLRE 4TTDC 1NBVH 4FABH 2KH2B 3CSYB 2NY4C 1A7OH 4XGZB 3GHEH 3ZDXF 2XI9A 2H32B 2PO6A 4FQPA 1AQDA 3MRKA 4JB9L 4XTRC 5E8PB 2OJEA 2R69H 4NDMA 3P0VL 2DMCA 5KVGH 1IGTB 4UUJA 4XP9H 4I1NB 1ZKAA 3Q1SH 5D1ZB 4ZAKC 2EYSA 3MNWA 2ADGA 3IDXL 2H6PB 2W60A 2CDFB 2O93L 3C5JB 1SYVB 4FXKB 4C56A 4MXWL 1IGYA 4F7EB 1T89C 2PNDA 4H1LG 4HIEA 3DX8A 4NQXB 4TVPE 5DQJB 3IDXH 4OCRH 4IRSC 4RBPK 4OD1H 5HVHB 5DMJB 4MXWH 2IGFL 3BWAB 4D9QE 2QSQA 2XRAH 3NIDF 2IH1B 3O4OB 4U7SA 4X83A 4APQA 1CFQA 3HZYB 5DJAA 3MLTA 1PKQB 3GSQB 4OZIF 1I8IA 3B2VL 5FYLL 2F8OA 1RUAH 3LH2L 3U6RA 3ARQA 5FUZL 5LBSL 1KOAA 1AC6A 2HLAA 1A6TB 3UJJH 3WXVL 1JGDB 1KC5H 5JZ7C 3WFCL 3MRDB 5LBSH 3WUWA 4IJ3B 1FGVL 3HE6B 3GSNB 2G75A 3OKMA 1MIEH 1BQHA 4U6TA 1BBJA 3QHFH 5D2NA 2P8PA 1T1WA 1BQLL 4IIQB 1ND0A 2V6HA 2DJSA 1KV3A 2WBJB 4NNPH 4ZUSA 5E6IB 2V5RA 4L29B 2OP4L 4L9LC 4EZMA 4RZCB 3B9DA 1I9IL 2H9GA 3VI4E 4OUOA 5TQ2L 4M7ZC 2XQBL 1T66C 4PBWD 1DSFH 1BIIA 2GITA 3PV6B 1P7KB 3HAEA 3PJSA 4PTUA 3VGHA 1KB5H 2O5YH 4JN1L 1A7NH 2RR3A 2GUOB 3DRQA 2XQBH 4MDJA 2UYLA 3DBXB 1AGBB 4P3DA 4ZNEA 4WWKA 5DURB 5ITBL 2NX5A 1V3KA 3BYYA 2COQA 3OJDA 1W0WB 4XC1H 4XVSL 1A5FH 4XCNA 3CVIH 5I76A 3QDMA 3OX8A 3HG1D 4JQIL 1U0QA 2DB8A 4PRID 5B38G 1IAOA 1EJOL 1KBGL 1R5VB 4H0GA 3W9EA 2YSSB 2ZOLA 3LEVH 1IGCH 3IGAB 5CUSH 5J9PA 5CJBA 1JI2A 2VDPL 1F8TH 1EJOH 3L3JB 1Z3GL 1HH9B 1IC7L 5DMIL 1AI1H 1U3HA 2GJ6D 3AB0B 4FQLH 5D1ZA 5HDLA 2IWGA 2IPKA 1O7SA 2PYED 4DN3L 1PBYA 4OJFL 1MY5A 4PJ5B 4H1LB 5D9SB 3UYRH 1MFAH 2YMXH 3P11H 1F4WH 4OCWH 1WBXB 1UXWA 1P4IH 3WFEL 4C55A 2EDNA 32C2A 1ZGLM 4LASH 2IG2H 3MRMA 5I1LA 3P11L 4TNVF 1IM3B 4LSPL 5EBLA 2HFEB 3BIKB 4JM2F 4AQ1B 4EVNB 4Z5RA 5DC4B 5HVHC 3VXUD 2QKIB 3QDJD 2FX9H 3PQYD 4K9EL 2AXGA 2NW3B 1VFBB 5KANI 3WO4C 2AJUL 4UINH 2B0SL 5DMKB 2I26N 3P30L 4F9LC 3GM8A 5C07A 2GTWA 3RVVC 3MJ7A 5HI5D 3RUGA 4BZ2H 2Q76A 4U1IA 1OLLA 1HI6A 2QBWA 2B0SH 1IL1B 1E6JH 4KVCL 2D9CA 3MLUL 4KH2A 1K4DB 4QOKD 5AYUH 3OTTA 3WIFB 4AEIH 3HI5L 4WV1A 5AD0B 1ADQL 3U2SB 4N0FA 4PUBH 1E4XH 4S2SA 3PP3K 1QFOA 4ORGB 5LG1A 3SCMD 2J88H 2NNAA 4OKVB 3MLUH 5D2NB 1VENA 4W4OC 4BK4A 1F2XK 3TBTB 2ICCA 3P4NA 4NZTH 5INDA 5IWLA 1IQDA 2YPLD 1B0GB 3LKQA 4WI8A 4D0DA 5HYSG 4OBSA 4RZCA 3VWKB 1LEGB 2UZXB 1EXUA 3FAXA 2DJ4A 3HZVA 1CBVL 4EDWL 4NOFA 4J23A 2BERA 4XBEH 1BIIB 4PJBB 4GW1A 4I3SH 1LDPL 2IANB 1RJZB 1T04B 2KQNA 3X11B 3Q3GB 4PGEA 5D93C 2QHLA 1U8QB 2OR8A 1FYTB 4IRJD 4QXUL 1JTOA 2D31B 3MFFA 4JKKA 1DBAH 2OTPA 1FZJA 5GXBB 1W0YT 3D6GA 1HNGA 1HCVA 2UWEA 2DI9A 5GSRA 1OP3K 4LK4A 2A9MH 1VERA 1DEDA 4OGXL 1HWGB 3PWLB 5D5ME 4KDTA 5JR1H 3UTZB 4I5BA 4YDKH 4JHZA 4YHOH 5I2IA 5FA4B 4HC1H 4YBLB 2Q3ZA 2HJLB 3KDMB 4JZNB 4Q6IB 3QXUA 1D9KC 3BVNB 3ZDZE 4ZFFA 1XGRA 5JORA 4YHOL 1MCWW 2VZ1A 5F9JA 4GG8B 5FGBA 1BGXL 5CD5C 1AGDA 4DVBA 1E27A 1TDQA 3ULVC 4R4NC 4M1GL 3X3GL 4J3VA 3I85A 4JY5H 4MB4A 4C56E 1BGXH 3SDCC 5JOEA 2L7UA 3ESVF 4OCNC 4TN9A 3UJIH 4JHWL 1R5IB 3H9SE 3KG5A 4XPHH 3NCJL 4MDIB 5I18H 4YXLL 4X7TA 5BVJA 3ABZA 3OG6B 2C1OB 2PF6A 2JK5B 3IDGB 4MNGE 4LLMA 1LP9E 3OZ9H 5KS9A 1WC7B 2PCPB 3RVXD 5AAMA 4HWEL 3ZHDA 4TSAL 5TDNB 2VXQL 5E08L 4FQ2L 1S7UA 3I3BA 5KJRH 2JB5L 2NY3C 2DWEA 3BKMH 3IRPX 1X4YA 4UBDC 3BGFB 2V7HB 1CDJA 4G8GE 4GG6A 2ZCLL 3U2SA 1MJ7L 1GGBL 1NFDE 5IKCB 1U8HA 4KK6C 4P5KB 3BQUB 2QR0A 3IU4H 3Q5OA 2X1OA 1BIHA 2LAGB 4H88H 1U6AH 1D6EB 1NDMB 1MVFA 4Y19A 3TIEA 1S9XA 2MQ0A 2NR6D 4NM4L 4XPTL 5FYJH 1YMMB 4GW5B 1QQDA 4H88L 3ARDB 1HHHA 1HQRB 5EPMA 2APTA 5F9WC 1PLGL 1JWSA 1A47A 4N8PA 3BDXA 1KCLA 4P2QD 1IC4L 2LV4A 4P23B 4OZIE 5AZ2L 2AAVA 1DQMH 3BUYA 1CICC 3S3JA 1JN6A 1QOKA 3LD8B 4PJCF 2HG5A 2W92A 1AR1D 2YXMA 1QRNE 3RVWC 1J05B 3G5XB 2FH6A 2YD8A 3RAJH 5E9DD 2DD8L 3VU2A 3F12B 5DK3A 3ARGB 2VH5L 2VIRA 4M93B 5GZND 2H6PA 2W60B 1S7QB 3H42L 3RA7H 1MH5B 3O41B 4HUXB 4Y8AA 1FQ9C 2YUZA 2GSGA 3ILQC 1CD1A 1L7IL 4LPWA 3C60C 4JFQB 4KJWC 3IETB 4HKZA 1XF5B 2CR6A 2NZIA 4JQVC 5T1DL 3ETBF 4YPJA 2QQKL 4ZFFB 2IH1A 1YUHB 2MHAA 3QEQB 3BSZL 3AFLA 3L3DB 1G6RL 1RZJL 1T1YB 2EDFA 4RGNB 4RGMC 4XNYH 4X7SL 4MQXC 2D7OA 1I1AD 4QOKB 3BSZH 2HLAB 2F19L 3C09C 1MJUL 3C9NB 4P9ML 4JDZA 5JDSB 2XKUA 1INEL 1ZHKB 3N0PB 1BD2D 1AGEA 3MV9D 1CWVA 3NZHH 1MAJA 2ZP0T 4M5YL 5BJTB 2RFXB 1OY3B 4OF8A 5HGDB 3VCLB 3MBXL 3WUWB 5GISL 1Q38A 4KK9D 2JJSC 5CJQH 5JA8B 2AK1H 1PZ5A 5D1QA 2Z4QB 3MBXH 1A3RH 3ZDZF 5DD1H 3N06B 3UTTE 4HEPG 1MJ8L 5EZJA 5F8QC 1AR1C 4ZPTA 5C0DA 1YEJL 1GGIL 5GPRA 1WAAF 5LGKA 3QG6B 1KF9B 2NY6C 4U3HA 4QRTB 2KPNA 3RL2A 4Z7QE 3LKSB 4IRJB 1HHGB 5FYKU 1U8HB 5C0IB 2XZCH 3BP4B 5DRZA 3CJJA 5KSAA 1I3UA 1ZT7A 1ITCA 3OG4B 1A3QA 2FNBA 4GW4B 3WHE0 2ED9A 2CUIA 5D6DC 3JWDH 1AXTL 4YHLL 3VXNB 4AY0A 3IDYC 3SQBA 4HJ0D 5E8EA 4XAKD 3TNNA 3S35H 4JE4B 2OQJA 5IB1A 1IAOB 4KQ3L 5J1TC 3P9LA 1XR9A 3VGAC 5IMOB 3KPTA 4NQSA 1O5DT 4NP4L 1IC5L 1FO0B 3FMGL 3M45A 3Q6FB 4QNPF 5IGXL 4MSWA 4HXAL 5DO2D 4R3SA 4OCYL 4KDTC 3SDCB 4B50A 2OX5A 5KVGL 3EHBC 1BREA 4HXAH 3BZ4A 1MAMH 2EIZB 2VRAA 4G8GA 1ZLWH 3FO0H 1JPSL 4YJZL 4LPTA 2VLKB 1X5ZA 4QRSB 1BMGA 4RNRA 3ULUC 3NCYS 4LSVH 4M8QA 3GJFK 4OZGA 2VUYA 1YN7A 4F80A 2DQFA 4YHKL 4EI5B 2XTJB 4N5EC 4JLRA 4PJ9B 1JWUB 1NAMB 1CXIA 1YECH 5F1SA 3KPRA 2V2XB 5I73C 5DGRA 4KV5F 2AJYL 2RCSL 1EO8H 1MRCL 1NCTA 3D18B 4U49A 2V17H 4OZHE 1YECL 4Z7NF 5C6PB 3WD5H 5KSAC 5DF0A 4HF5H 1CXHA 5GGVL 2UY6A 1G1YA 4RMTA 2IAMD 4JGMA 4PJEB 5T1LB 2EYTA 3MNZA 1MHCB 3UJJL 5J11B 3VWJA 3WXVH 2G5BA 4NKOB 3DECA 4KRPC 15C8H 3MROB 1Q9KB 4R90L 2UVFA 1MWAB 2E9BA 5ISZB 2V9QA 2BXYA 1JZ5A 4KU1A 5ETUB 4XMKH 4KK8D 1I8KA 1BQLH 1FC1A 3DXAB 3SGDH 4MNGA 2FJGB 2BDNH 4OCXL 3WNMA 1ES0A 1S78C 5C0AB 3ARSA 4U1MB 1HIML 4NKQB 4OUUB 2FBJH 1ZTXL 2DF3A 3OKKB 1DCLA 2OMNA 4P46D 5SV3A 1E0OB 3WN5B 1A3LL 2YWYA 3BMVA 4PRBA 3BDYH 4L3CB 4P46A 3G6AA 4XB8A 3KPLB 2FBJL 5F7NC 2E7CA 5K9OB 3BUYB 2ZJSH 4EIZC 1OTTC 3O6FA 3HLAB 4POZC 3FB6B 4KKLD 4DOHE 3ARXA 3QFJE 3H0TB 5EUOA 1DUYA 3PGDB 1U8QA 2R0WL 3MTRA 3MRNB 4PJ8B 3RHWK 1G7JA 1JGEA 4WEBH 4PJFB 3EO9H 3VXUB 4U6XA 3HA0A 2YPLE 2KKQA 5FO9B 5ACZA 4HW6A 2GHWB 5IB1B 2P5WA 4WEBL 4KKBD 3E8UL 1AKJD 4P5MB 2LTQB 2AW2A 4U1LB 1KBGH 1C5CL 4PRAA 5D96C 3C09B 5FIEA 1TZIA 1ADQA 2EDKA 2HVJA 4IOIA 5HYSA 1U8NB 1TJHH 3HZKA 4RX4D 3IDJB 2XWJB 4AENB 1S7TB 3ZKND 4N0UE 1IC7H 4MNQB 4LFHG 4JY4B 2BNUB 1Q0YH 3F65A 1JV5A 1NBYA 1I1CA 2OI9C 1FL5B 5JLZA 3VA6A 1QNZL 3WXWH 4ODTL 5T33L 1FBIL 2PW1B 2D03L 3CDGB 5EO9A 3UJTH 4GRWH 2WK2A 3KXFE 1ZHKA 1YEDA 2YPLB 4UNUA 4F57L 4DGVH 1QFWH 3STLA 4DZ8A 3MLWH 1GHFH 3QFJD 2B1AL 1QFPA 1AFVL 3PV6A 4B0MM 4WHTB 3KPQB 3HR5B 5ENWA 4R4ND 1FG2B 1U8JB 3O0RL 3MLWL 4HGMA 1CU4L 4RAUB 4YAQB 5F3HB 4I77H 3UXFA 2MMXA 3EDJA 4FQQB 4LLMB 4WO4D 4ONHA 2VLMD 5HPMB 3QHZH 4GS7B 1CDIA 4PJEA 1T5XA 5J57B 5LGHL 1TVBA 5TDNA 5CGYD 2FR4B 1CZ8H 4GRMB 4ZG1A 4UT6H 4FP8H 2JJUA 3QUXB 4P59L 1WJ3A 1P5UA 3MLVL 3HI5H 4AIOA 4CDHA 3IJHA 5IW1B 3MBEC 4K23H 4KK9C 5J9PB 1N3NA 2IPTL 5EFIA 3BP7B 5HHOD 4Y5YC 4M02A 1I8KB 1UG9A 3H9SA 4XZUB 3B6SB 1I1FB 1RULH 2D7QA 2V5SA 5FUOL 1FJ1A 3RVXC 3RTQD 4DKEL 4JFYB 3GBML 4GXUM 1UB6B 1D7FA 1JF1B 2X70B 5CSZA 4Y2DB 5F7KC 1KGCE 5DLML 1A6AB 1N6UA 5DI8B 1F4HA 3JV0A 1HKLL 2BJML 4P2CG 1ACYL 1FO0A 1I7RA 2FEDD 3BEWA 2APFA 2P7TB 4XBPB 1G9NH 3S4SG 1RD6A 1IARB 3DRTA 4C4KT 4BZ1L 1UQSB 3PABB 3GMMB 4QEGA 1TQBB 3GRWL 3WE6A 1KT2B 1CVSC 4PJAF 3SBWC 1CFTA 5KSVA 4NN5C 3ZHKA 3GB7A 4JFXA 5ACZB 2P5ED 4NC1E 3MJ7B 2DLEA 1CG9B 1KEGL 3F7YB 5KTEH 2EO1A 4POYA 2E6JA 3QUYB 4TQEL 2CK0H 4QO1A 1K4DA 5E9DA 1M1SA 1U2HA 4NQCB 5F1NB 5FCUL 3KPNB 1UKSA 5E2TH 4AENA 1BEYL 1FNHA 3BGMA 1JMXA 5E4IA 4TQEH 4DQOL 1Y6KR 1J1PL 4OZIA 1QZ1A 3HI1B 4WFED 3HZYA 3SDXA 1KXQE 3WLWD 3QUKB 1QRNA 4G6ML 2QHRH 4AG4L 2W59A 2HLFC 3GDBA 5JW4M 3TPUB 4AEFA 3V0VB 5DJYB 4M1GH 4QYOA 1NBZA 3T4YB 1PG7W 3C8HA 4WW2A 5ESVB 1OP5K 5F9DC 4M7JL 3SKMB 4WEUD 3P2TA 3HE6A 2BNQA 3A6CL 1MCNA 5ISZA 1J12A 3OPZL 4ZOCA 5CAYB 1FNSL 5CJOL 2X7LA 1OHQA 4IDJL 1CGVA 4C56D 4L3EE 5AWNH 4XP6L 2VERN 4XVTL 1HILA 4JR9H 5CJOH 3CC5A 3EYUH 4KJQC 2XYCA 3OKKA 5J89A 3QCTL 2VXQH 3O9WA 4G6FB 3QUXA 1IQWH 5ACMA 4ZXBD 1JIBA 2HRLA 2CQVA 3EUUA 4HEME 4N0UA 1K5NA 3VWKC 1T0NA 2GJZB 1W8NA 3DVNA 5IK3A 3H9SB 3U9UB 1QYGL 4JFFD 5DRZB 5F7LB 1QLRB 1NEUA 1B4JL 5B4MD 3WSQH 1Y18A 3BGAA 5T5FH 4QTIH 2Z92B 5I75C 4AM0B 3DGGB 1HYSD 4G3YH 1S9WA 5E8OA 5CSZB 1AO7D 3NIFE 3SKJH 4UTBH 5HYEA 5E8EB 5I74C 3C2AL 1RZGB 4KKCD 3VXMB 5D6CB 5DTFB 1XFPA 1I1AC 1T5WB 4HDIB 4WU5A 4M61A 3PL6B 1HZHL 5B8CB 1NLDH 4LRIA 3L3JA 4LL9A 1TNNA 2DM3A 1S7TA 4L8DA 1A21A 1NGPH 3MMEB 4G5ZH 4L1DA 4MJIB 4DKFH 3MLXH 4WFGE 1DLFL 1HZHH 1CE6B 1INQB 4A2LA 4XCYA 4WGWB 2DBJA 2R4RL 4MQ7B 1JUFB 4F9LA 1DP0A 4BJLA 5F9OL 4U31A 3TVMC 2PTTB 1X4XA 5BVPH 4TSBL 3VFUB 1N2RA 1NAMH 3VXSE 3MOAH 2CXKA 4H0HB 3I6GA 4PFEA 4ZTOH 4NN5B 2GK2A 3DYPA 1R24B 3A6BL 4UILH 1VEPA 4B7IA 1OF2B 4G6JL 3TJHD 3IKKA 1NUNB 4I18A 5D7KE 1AY1L 3TN0A 5A3IC 3OJ2C 2Y1VA 2A6IB 4NHCH 2XKNB 4S0TD 3U48A 1FAKT 4Z77B 4R7NB 1IL1A 4QYOB 2C3XA 1KYOJ 3C8KB 3P4OB 4HUNB 2IQ9H 1FDLL 1K8DB 4XWGH 3HR6A 3RWIA 4JEGB 1HOCA 3PWUB 4M9PA 3T0BA 5JHLH 1QLFB 2BNQB 5IVNA 1AQKL 2G5BB 3KLSA 4NKOA 3D87B 4RA3A 3K4ZA 1V7MH 1TQCC 5T3ZH 2V7NB 4NFDA 2NY6B 4N68A 4U3XA 4PLKC 5HDOA 1ZGLP 1Q0XL 5DWUH 4X4MA 4DFHA 4IRZH 1A3RL 3GZKA 5T3ZL 3RNKA 3OL2A 4HFWA 3TWCL 3KR3H 4Y2DA 5K9QG 5C0CB 4GW1B 4A6YH 3TCLA 2ADFL 5ESAA 3DX7B 3HNSH 5FHBH 3T3PE 4R96A 3MA7A 1W0VA 4Z18A 3PWNB 3X11A 1KJ2A 4QHUB 1UQSA 3SDXE 5IMKA 2D3VA 2DM2A 3RVUD 1A2YB 3U83A 4EN3D 3QXVA 2WBJC 3GMMA 4M7KL 4HK0A 4IDLA 1RJCA 1JYNA 4UT7L 4IIQC 3KHQA 3MRNA 2BY2A 5IF0A 1MCKA 5GS2H 1MCHA 2Q7YA 2UWEE 3DIFA 4M7KH 3HE6C 3HKFA 2Y72A 3T65A 3VXRB 4C54A 5CJ8A 4U0QB 4O9HL 1JJUA 1G84A 3TBVA 2VDNL 2HT3C 5TE7H 5E2WH 4G8FB 3HE7A 5HYFA 1C1EH 4OAWA 1IC5H 3U46A 3FMGH 1WGOA 2YPVL 5GS0H 4JFHD 3AMKA 4ZDHB 2NYYC 3LS5L 1ZANH 1A6UL 2PYFB 4N0RA 4ZS7L 1BQHG 3ULUL 3MRJB 3FN0L 5B22A 4XCYB 4PS4H 5IMMA 1JNLL 1MAML 5IBUG 4AT6B 1MFCH 4C58B 2GSIB 3IFNH 3T0EE 3L1OL 4GAYB 3FN0H 4JO3L 5D96B 1EVUA 4LBEB 3NPSC 1YEDB 2YPLA 1CFVL 3MRIA 1B9ZA 2HAZA 5E1AB 2ERJB 4O00A 4UDUB 2X4NB 4JFZH 2B39A 4P0DA 2FJHA 2Z31B 5B4MC 2JCCA 4AIZB 5EBGA 3OGCB 2VQTA 3R0MA 4G9FA 4F7CA 1RU9L 5D72L 3WD5L 1AXSB 2QL1A 3RUGE 4CN1A 5L8KB 5BQ7A 2Y06L 1DL7H 5IROA 2XY2A 1F3JA 2YPKB 4QRQB 5FV1L 3T3ME 4Q9RH 5J1SC 1MCJA 5KSBF 2I27N 2VR9A 4R90H 4MSWB 5L9DH 5INCB 3DTXB 4UNTA 4OQTH 4QTHB 1NDMA 5DK0A 5HHQB 4MQXD 4Y5VB 1LDSA 4U1HA 3FOLB 2Z92A 4X8XA 4J3OC 4OSUL 1KCRL 1RZ7L 4MA7H 1G7MA 1KJ3L 3VRLF 5DRNB 5FDYA 4G6KL 1YMMA 2R0LH 3U4BL 4ETQB 4JFYA 1HIMH 4WTZG 4QHNA 4JRXD 1ZTXH 3W5NA 5T1LD 5HHOA 2D0FA 1G0YR 2F8VA 4PJEE 3NGBC 4G6KH 3BQUD 5MEPB 2JB6A 3U30B 5KZCD 2QSCL 3QDJE 5C07D 3EJYC 1NEZA 2WLZA 1I7RB 4XBPA 1JWUA 1NAMA 2OSLB 3QEGL 1AGCA 3VFWB 1H8OA 4ODSL 2YKLH 4ODWA 3ORJA 4N0CD 2R0WH 5AG9A 1DTUA 1H3UA 2CLVA 3S35X 3WDJA 2H8PB 1NGYA 5GZNC 2P42B 5K9KA 3I9GL 3SO3B 1U58B 1GOFA 5HTSA 3GK8L 3MLZH 2VISB 1JUFA 1RZKH 1VADA 3MRGA 3GIVB 4EI5C 4M6NL 3MNZB 4K8RL 5DD0H 1RUQH 3GK8H 5E2VH 2X10A 3VWJB 3S34H 1JTTA 4LNRB 2YD9A 2JIXD 4FQ1L 3HNTH 1UWGL 3A67H 1N6QL 1KTKE 3D9AL 4FXLA 4RMSA 4MNQE 4HZLB 3S9DB 1XH3A 5DRWA 5IM7B 4LQFH 3A67L 4MJ6A 1JNNH 1TFHA 3L3GB 1IEAA 2VXVL 3WL9A 1V7NH 4HWBH 2ICEB 1D6VL 1LEIB 4R2GD 4XCEA 2WP3O 3VGAB 3U30C 3WFBL 3GEWB 4F57H 4GBXA 3BO8A 4HWBL 3NFNA 3S7GA 4PP2A 1CT8A 4LAJH 1WQVT 4ZO9A 1KN4L 5ITFB 1A9BA 4JO1L 4Y5VC 3TJHC 4KTDH 3OSKA 1IGTA 1QBLL 1J8HD 2OR9L 4MQTB 5MEND 5EZJB 5TF1L 3MBED 1QSFD 4IRJC 3MJ8B 4NJAL 3MNWB 5CS7A 1KLUA 4U1KA 5EBWA 5DFWH 4LLWB 4NIKB 4YBQC 5IHZA 1TCRA 3E3QE 5I8EB 1NCAL 2A9NL 5IW6A 5IVXA 2EKSB 1JBJA 3KWWB 1MY7A 2VDML 3SGEH 4LOUC 1TENA 4CVWA 1XT5A 4JN2A 3ARBC 3ZSSA 5F7DA 4JM2B 3FFDB 1JF5A 4C83B 4U7KA 2FWOA 4OCSL 3O4LB 5FGCE 2BMKA 3UYOD 3QDGE 2E7HA 1ZHBA 5H35A 2VDRH 2DBLL 5HHXL 1F6AA 5HD8D 4MZ3A 2YXFA 3FO2A 2ESVA 3WO4B 3QAZC 5D7SL 5C6WH 1M7IA 1FIGL 4JFFA 4NCC2 3WIHA 4XGZA 3W39A 4QHKI 5DVMA 3I3EA 3EZ8A 1T5WA 1ZHNB 3VRJA 3S98A 4D9QD 3DSNA 5D7SH 4RGMB 4I0PC 1FIGH 4PGJA 1CD9B 4JVUA 4GMTL 3SGEI 3C5ZC 5E4EC 2CKBL 3MGOA 3OGOE 4F7PB 1TXKA 4NWUL 5CGMA 1OP9A 4IOFC 3HUJA 4OLEA 2XWBB 1YPZB 2NY2B 3F7PC 4XB7A 1A4JA 3SQOL 4WU7B 4I48B 5EO1A 1QFWI 5EIVA 4JKPL 1J0KA 2N56A 1DUZA 4WRLA 1CIUA 1FL6A 1ZGLB 4HMCA 4N0YL 5I1IH 5MEQA 3SKOB 3KPRE 1NC2B 1V5JA 2C5DC 4JPIA 2YBRA 4Q9CA 3CZJA 4MA8H 1DQLL 4OZFB 5IM7A 1M4KA 2JJWA 2A6JB 3GMRB 5GRYA 5DJXB 2MCPH 4ZPVB 2OK0H 3D25B 3NOIA 5EU6D 2IGFH 3SY0B 2ITCA 4WTZA 5SWZB 2L4OA 3W9DB 4GO6B 5T1KD 3FT4A 1K8DA 1I9RL 2VC2L 4S1QL 4PTTB 1VGEL 4MGXA 3ARDC 1EUUA 3LQAH 3CNKA 4BH8B 5F7YC 5FYJU 5GIRB 4UIKH 2VXSL 4MLSA 5C0BE 1QRKA 2DQDL 1RK0A 4LRNH 4ZQKA 5GGSB 1GAFL 1I9RH 2FATH 4F58L 3PWVA 1QBAA 3GSXB 4CU8A 1NFDB 4LU5L 5ICYA 2VXSH 2VZOA 3RNKB 4LRNL 4NRZA 1UXSA 1CLZL 5EZIL 2W38A 4G43A 3UTTA 3KYMA 3QCTH 5I8EA 4J3WA 5IWLC 4LU5H 3E2HC 4L3ED 2AEPH 5F89A 4ENEC 1UJ3B 2CLZB 3UC0H 3F58L 2OP4H 2R0ZH 5I16A 1QFWM 3GSNL 3SJVA 1QFHA 1RUPL 3N1MC 3UROR 3PGDA 1QYGH 2WBWB 1QBBA 4X9GA 3V5KB 1JRHH 1B4JH 3OBAA 5SV4A 1P7QB 4IMKC 4TTDD 1OAUH 1FGNL 2WUBH 1I3GL 1T1XA 5FO9A 2YEZB 5IT2H 2AXFA 4RIRB 2R1WB 2BVEA 3MV9E 5A3ID 3KPOA 5GZOD 2VLLB 3SKJL 4P2OD 4TYUA 4JREC 4K3EL 1R5VA 5K59F 2WUBL 4P2OA 1XMWA 3GI8L 4FQCH 4MA3B 3K7UA 3SKMA 2K7PA 1U42A 5I17A 3VD4A 3RTQC 3RU8H 5IFJA 2WAHA 3GI8H 5DVNA 3IDNA 5D7IF 1FL3B 1U91B 3GSUA 1HH6B 3P4NB 1SEQH 3T04D 3HUJB 4Q2ZA 5GZOC 3S37H 2A83B 3QULB 2AJ3B 3TZVC 3LHPH 1N4XH 2W0PA 2RGSA 1EHNA 1EHAA 4R8WH 1MFBL 2FEDC 1VEOA 1AO7B 3VFPB 5D1ZC 1LO3L 4K8RC 2Q6WA 5F6HI 4RGNE 3MCKA 4GAYA 1N0LA 2FIRT 3V5HA 3VXMD 4DJMA 1M05A 3BRFA 4OZGE 1EAJA 1FFNB 3KPQA 3VXME 3HR5A 1E6OH 1CT8B 2PYEE 4GRWB 4OFYA 2ICWI 3HE7D 4MXVF 2X4NA 3H7BB 3LQMA 3P73B 5I75B 4LCWB 5HPOA 1CS6A 2FX7L 3QDAA 1MRDH 3W0WB 1TJIH 2BSSB 3BPLB 1ZA6B 1HSBA 5I8KH 1AC0A 2DIBA 3ZYZA 4KK8C 4YHNB 4JJHA 5LGJA 4D0BB 5D5MF 4F7MA 2AS5M 3QWOA 3J7HA 3IXAA 1MQKL 1QD0A 4X99B 4JRYB 4RISH 1UKQA 4XVJH 4KZDL 4U1NB 4PTTA 4YZFF 3EGSB 1CI5A 3E0GA 3PWLA 5DTFA 1BVLA 3IJHB 5IW1A 3T0EA 5IB4B 1AQKH 1MAKA 4L3AA 4Y4KB 2HT3D 5I8OH 1YC8A 4E41D 1P1ZA 1HKFA 4Y89A 5E8DH 5GGVY 2EC8A 4JM2A 1E4KC 3IXTB 4Y4HB 1D3CA 4UV7L 1Q9LA 4HD9A 2MPAH 5IIEA 1UB6A 3MCLH 4XI5C 1FNEA 4ZS6C 1ONQB 4HC1A 1T2XA 4Y4FC 1ED3A 3QB7C 1T7ZA 4XX1G 3O6LL 2H45A 1MFDH 1LE5B 2ADFH 5MEPA 4ELKB 3ARVA 4D8PB 4CUCA 5EOCH 4I3GA 3TIDA 4NKMA 3FT3B 5FK9B 4HIHA 1UJ3C 3OR7A 1EHLL 2HKHL 3QFJA 3V8CA 4F15B 5EUOE 2VDKL 1ZS8B 4LPCA 5H37H 2YK1L 1U8KB 2QADD 3RWGB 4I3SL 2H8PA 5K59E 1CGSL 4ODVH 4YEFA 4U7MA 5CCKH 5F44A 12E8H 3VH8G 4NUGH 1LEKA 1WZ1H 4NQDD 1G7QA 5C0BD 5EWIL 3MNVB 1UENA 3GSVB 2DKUA 2NY0C 4H20L 2XRAL 3ALPA 4JKLA 3T0VA 1G9EA 4JZNA 5A2IH 2WINA 3ES6A 4YO0A 2HP4A 3SDDD 5FOBB 1KPUB 3GMRA 4YIQA 1LP9F 2N4IA 4OZFH 3TLRA 5JR1L 2Y7QB 3QUKA 1BVKB 4XC3H 1OARL 3K74B 5A1AA 2EECA 1U9KA 3MA9L 4MJ6B 4NM8L 1ZVHA 3DO3A 5EU5B 1JNLH 3THML 2BOBA 1BECA 2NXZD 4PJCE 3FFCA 1EMTL 2ILLA 4WY7H 3E2HB 1YNLH 4OGYL 3IYLW 4CMHC 2ITDB 3FB5B 3L5IA 1P9MC 1F4YH 4AJ0A 1X5GA 2Z91B 3PWNA 3MJ9A 1RZIA 1T2QH 1LK3L 3CDFA 1EX0A 2ZSWA 1RUKH 3MJ6A 3TZVA 1JPGB 2HG5B 1A2YA 4DKAA 3C5SA 3X13A 3FZUD 4OM0H 1FAIL 3QRGL 1WWWX 5E99H 1BZQK 2QLVB 3GMOB 5FF6A 5CLWA 4FTVB 4OM0L 4YXLH 4FXGA 5EO0B 1SYSB 4HKBA 1XGQA 3AGVA 4N8VG 2FYYB 1T83A 2IAMA 4ZYKB 3O41A 3NFSL 1MH5A 2CR3A 5C0FA 1FFPA 2HVKB 2I9LA 1B2WL 1LO0L 4J4PD 5C7XL 4I0PB 4MCZA 4TSAH 1YY9D 3O8XD 1NUDA 3U46B 2JB5H 3DV4B 3LQAC 2E8ZA 3CK0H 4FQXC 1UGNA 4HWNA 1NJ9A 5LXGL 1KXVC 4LLVB 5I9QB 1MREL 3TH3T 4RRPA 2HFGL 4H26B 4WJ5B 3DGGA 4LSQL 4Y7MA 2D2OA 1ONQA 2F74A 2VO5A 4KFZC 4IJ3C 4KQ4H 1EH9A 2XWTA 1U8PA 4OLYL 5JW4Q 1OGTB 1LE5A 4QCIA 3QPXH 4ZAKD 1EPFA 5CZXC 2HN7A 3D39B 1VGKB 4Z76B 5E1AA 5BRZE 4LLDA 3T1FA 1ZHNA 3VRJB 1RVFL 1CR9L 3MX0A 3PNWA 1CXLA 3G04A 1T7YA 1HH6A 1S9KC 1U8KA 1YEEH 5KVFL 3S3PA 5E8NA 2ZG3A 2WM0A 1IAMA 3MLZL 4XT1C 3D85A 3KXFB 3AM8C 2E27H 3HFML 5FM8A 3TT1L 1FN4B 4ZUUA 1YEEL 1Y6NR 4NO2A 3RAJL 4NO5A 5HHMD 3PHSA 3VFMB 1E4KA 3L6FA 1ZGLA 1H3VA 2GYSA 2W0FA 3H7BA 4R2GC 2LAAA 4L8CB 1N6QH 5D1QD 4C59B 4CVZA 2AJUH 4UINL 5B39B 5DFVC 1FP5A 1QLEL 2ARJB 2KBGA 3FJTA 4P2RA 2ZUXA 2J8UB 5E2UL 1EEZA 4U1HB 1U3JA 4LCIL 4JRYD 3D25A 2VDOL 1T03L 3QA3A 2QEJA 3TA3D 4FQXD 1U3HD 2GJ6A 4JDZB 5TH2A 2DM7A 2X4SA 2A74B 2XXMB 2PXYD 4PUBL 3VMNA 4PJBE 3NA9L 2Y6SC 4ZO7A 3V52L 3VWJC 4LCCA 1MJUH 1RY7B 4CRPA 5DJZA 1K6QH 4NDMB 3PDOB 2YRPA 3CSBA 2P8LB 1U3HC 1DVFC 3FTGB 1KXTB 4NYLB 2UY7A 4YXHH 5IQ7H 1MHPL 2BRRH 2JJSA 4NRZB 1GC1L 1A14L 4OFPA 5C0DB 2Y6SD 3RWHB 3M1BA 5ESAB 1X5XA 4M8QB 4YK4C 1QRND 1D5IL 4WW2F 1GC1H 1KJ2B 4S1SL 1HHGA 3C60D 4E0RB 1A6WH 4FZEH 2IMNA 5TQ0H 4U1JA 2NTFB 3CAFA 5KSAB 1JHTB 3CFKA 1KIUA 2CD0A 4LQ1A 1UYWL 5EOTA 4NZUH 4QHKJ 3NGBB 2X4UB 4PRDB 1OAXL 5DJAB 1T7WA 4CN4A 3WIIH 4O51B 2Z35A 4KRNA 2ATKB 4Z7UE 1YEGL 3G6JF 4Y4FD 4H0IA 4XPAH 4EUPA 1EDQA 4NNYB 2PO6B 3MLRH 3U1SL 1MCLA 4G7YH 1CFNB 4MA3A 2WINB 1P84K 5IB5A 4X9IA 3UZEA 3L7EB 3LDBC 2V2WB 5FOBA 2ZCKL 1A6ZB 4NQCD 4XBGB 4JB9H 4G7YL 2AK4E 3SJVE 3VXRD 3QUZC 2QADC 1ROWA 3MXWH 4P2QE 4I13B 5MP6H 1FV1A 1IAIM 3SGJC 4KK5C 1OAKH 4Z7UB 1H5BB 3WKMH 3ULVF 4TVPL 3S88L 3D5OF 3ZO0A 2FL5B 4PJDF 3PWPD 2Z8SA 5E5MB 4PJHB 5L88L 1I3RB 2GUOA 3DRQB 3BYTA 3FT2A 3CUPB 1ULVA 3WFHB 3OV6A 3HRZB 5D7LE 5T3XL 2NX5B 4P2RB 1A1NA 2XIDA 4G9FE 3C5ZA 2VLJD 5EULV 1VACA 2WWMC 3BXNA 1NGZB 3TFKC 5ADOL 1JGUH 3UAJC 4NFCA 1ZHBB 4HKBB 2WZPD 1QO3B 3L95B 4LVNB 3D0VA 3G08A 2V17L 4JPWH 4OGAD 1S5IH 2VC2H 1VGEH 3EOBA 1BVZA 4OZFG 3FOMA 4QGYA 1K85A 1SBSL 1ORSA 1S7SB 4WVRA 4V2BA 3O2VH 2FHBA 2I9TB 4F58H 2C1PB 3H9SD 2P8LA 3FTGA 1BP3B 1SBSH 2ZPKL 1YMME 3Q6GH 1W8OA 1WCQA 4KJYA 2WSKA 5JLZB 1EHXA 4OLVH 2R1YA 5IFAL 3VGFA 1FZOA 2ERJC 1MF2H 4TULL 4F8TA 5C08B 3O2WL 4POZD 3VH8B 1IZKA 1OTUC 5I9QC 3ZTNL 4RMRA 3HCVB 3QIWB 3FQTB 1K4CB 2RQ8A 4CNIA 2OCFD 4KXZH 1FL6B 5TQ2H 3VFRB 5BW7A 3EJZD 5DZNA 1AQDB 2LU4A 2AKRA 3O2WH 3HLAA 4NO3A 1KTDB 3ZTNH 4ISVB 4EVNA 3NCMA 3QIBA 2FGWL 1S9VB 2YC1B 3OWEA 5IESL 4P3CL 1WV7T 3TCXA 1JRHL 2QQLL 1HSAA 1ZS8A 2WW8A 4EQ3A 1PYWB 3B9KD 4AEHL 3DVGB 4XVSH 2AJZB 5C07B 3TM6A 3BPCB 3PP4L 3I84A 1TVBB 5CGTA 1OGAA 2K7QA 2XZQL 1QSZA 5HVGB 2JJTA 1SJXA 1KENL 4QWWC 4RFNC 3CCHB 3FT4B 4AQOA 3L3HA 2HVJB 4X9FA 4LGSB 5IV2B 3L7EA 1AD9A 3B9KC 1HH9A 1QTYT 1YQVL 3GMNA 1MHEB 4K55A 4MNQA 4FFVC 1C5CH 5CEZD 1WWAX 3QG7H 5F7EH 2VL5B 4F8QA 1IEAB 1HDMA 1NGWA 4F3FA 3DPBA 4HPYL 1CXEA 4DN3H 1CGTA 4F7TA 3UYRL 4HJ0C 5IOPB 4GQ9L 3BO8B 1YMHA 4Y8DC 2EIDA 4PLJD 3WFEH 3MOQA 2E7LA 1LILA 3VMOA 4ODTH 2G75B 3OKMB 2Z91A 4K3DL 2H1PH 4LCCB 3U7AA 1T04A 2AXGB 3IKCB 2WIMA 4DEPC 5I0DA 1IZJA 4OLZL 3J8F7 2YRZA 5DD6A 1Z6JT 3VRLE 4PG2A 5DSCB 4LSRL 3W11D 1N7ML 4GKNA 3BI9X 3L95A 4DK6A 4R9HA 3O0RH 4K71C 2FR4A 4XP1L 2EDOA 3EO1B 3WIFA 4M4PA 3EO0A 2YA0A 1FHGA 4RWHA 3LZFL 4MDJB 4MCZB 2EIEA 2JKXA 4OF3A 5I2IB 1ADQH 1HXYA 2XA8L 3RX7A 1QG3A 5F6IC 3AY4C 4XP4H 3WUWG 3JWDL 2FWOB 3NMEA 2MOVA 3QO1B 4HJGA 3W0WE 4HGKC 4K23L 4XP4L 4YDLB 3QCVL 4NC0B 3VWKD 2D7TH 3HCVA 2HTLC 1PZUB 4YWGL 5D7LD 2EDQA 2HT4C 5IROC 3BEWB 2WNGA 4Z8FL 4YPGB 4XBEL 4M6OL 3QDJA 3EYVB 5EU3A 1WISA 5DO2C 1EFXB 3QP3A 4NRYA 5DLMH 5DT1H 4B7LA 2D31A 2VLJA 1L4IA 1FYTD 1NH6A 4CN6A 3CFDB 5FHAL 5B8CC 2APWA 3FO1B 3OKDB 4PG9B 3MRRB 5GGTL 1HEZA 5EUKA 5ISZE 4NO2B 1DLHB 3QQ4B 2WIIB 4H20H 4Q58C 5GSVA 1F02I 3O8XC 2IQAB 3MV7D 5C2BL 1KELL 2JCCF 2X42A 2BVYA 1VPOH 3CGTA 3LV3B 4WUKL 1QSVA 3EYOB 5I8CA 5CBAA 5L2KB 1HDMB 1NGWB 2VSCA 3QNYA 4F3FB 5C09D 1E27B 3X14A 5BZDA 1WFOA 2Q76B 3U0TB 2VXTH 1DN2A 4L4TB 3EFFB 3EOYG 2F58L 2Y5TA 4BQ9A 2A74A 5ICXA 1U8IB 1EA9C 3X3GH 4WY7L 4U6HA 2OYPA 4YFLF 2A73B 4XNUH 1JGVH 2BDNL 4OCXH 3K81A 4U0RC 4JM4H 5DMGD 5B3JF 1DSFL 5IEHA 3RVTD 1DZBA 5CINH 3RWGA 3WNPA 4ZFGL 1XF3B 4Z0BL 5D5MA 5I1AA 1D5ZA 4MAYA 4D0CA 4NT6B 3NFSH 1DEEA 5DUBB 4ZFGH 2GCYB 1A5FL 3A6OA 1RJZA 3IF1B 5C7XH 3U7WH 5GRZA 3OXRA 4P5TB 4QXGH 3ZYJA 4JANB 1UCBH 2JJTC 4CVUA 3G6JE 1DQDL 3MXVL 3IT8D 1JF6A 5L8LB 1NBQA 3UTPE 4QGTA 3IFLH 4R7DA 2YEZA 1T1YA 1IGCL 3QDGA 2OLDA 1HXMB 3C60A 1Y0LB 2HH0H 3MSPA 3VXSA 2NY4D 5BS0D 1MCCA 2EE9A 1UWXH 3P4OA 3N1FC 3UTZA 4JFFE 3WCYA 4ZOEA 1P84J 2AXJA 2J5LB 3GMNB 1IGJB 3KDMA 2YMXL 3PHOB 2W07A 4B53A 2NY3D 5DEFA 5DRXA 3T2NL 3MRFA 5HHPB 1WWBX 2YD3A 3OAZK 1NL0H 4OIIL 3TO4C 4N0CC 4NHUB 2DD8H 2VDQH 4DGVL 1FLRL 3BIAX 2IFFH 1LNUB 1P4LB 5C2UB 3WFDH 4ZYKA 2ATPA 3N50A 4JFQA 1PEZA 3QG6A 5JIIA 2PYEA 1KACB 3RL2B 2EXWD 4X4ME 3WFDL 3ROLB 3T0EC 2C3WA 1NQBA 3RI5K 3C6LB 5LVEA 4DCQB 4I18B 1ZLUH 5DD3L 4A6YA 3QNYB 5CD5D 2ADIB 2EC9U 4AEIL 3CH1A 1V05A 3HPLB 2BVQB 5B3JE 3LKPB 1EGJH 4UT6L 4U1SB 2RB8A 2R2EA 3D69A 3DURA 4P2QA 4GMSL 1AGEB 3T3PF 4XCFL 3R8BB 4MA1B 2VE6A 2RFXA 1EGJL 5FGSA 2VB5A 3LN5B 4NQSB 3SE8H 1O0VA 4GS7C 2IF7A 3FOMB 4M5YH 3V52H 1RULL 1JMZA 1EZVY 3F5WB 3L7FA 5E56A 3JWDC 7FABH 1I4FA 4LP4A 3MGAA 4JG1L 1DBKL 4JPKL 1UH4A 2J12B 2B7DT 5E95B 5EOQH 2X9XA 3OB0H 3MC0A 1DBMH 1UZ8A 5BZWB 3NVQA 4PV9B 4RA0C 5BV7H 1QR1B 4GKZB 1HHHB 5J6HB 3QUZA 3QUYD 2C7UB 4JG1H 4PJ8C 5CLTA 3CX5K 4IRZL 4HIEB 1A7RH 4YPGA 3OAYH 5DHVA 3U7YH 1UACL 3P4MB 4RBPH 3RWFB 5EU3B 3TWCH 1JN6B 1AD0A 1MSPA 4M5ZH 3DI2B 4LLYA 3FT3A 1J0YA 1VEMA 2V5TA 4OV5B 2IMMA 2OMBA 3CFDA 5B39A 4AEEA 1QFUL 5ACLA 5DVKA 4ZS6D 3WO3B 3MO1B 2VIRB 1S7WB 4ELMF 1LEKB 1S7QA 1CE1H 2DQIH 3MV9A 1F5WA 3ZTJG 4XCCH 1GZQB 4Y16C 1Q94A 1XR9B 5IMOA 4ODXA 3U0PB 1T80A 4R4BB 4JFDD 4OLXL 3MRDA 3L5XL 3L3IB 4OF7A 5BXFA 3QZWA 4WW1A 5DEFB 4PV8B 1JGLH 1F90L 2EDEA 1BBJB 2MHAB 1DQJA 3AY4A 1OAQH 1RFDH 4WFHD 3O2DL 2H2PD 2XNAB 4XMPL 5IMMB 4FQXA 4ZUSB 2AI0L 1RZ8A 3FO9A 4OB5L 3LN4B 1DANT 4GLRI 4XPHL 1HHJB 3B9KA 4X4YA 1OAQL 3GSOB 5JXED 1LD9B 2OZ4H 1OAKL 2VLKD 1V8HA 1XIWD 3NTCH 3WKML 2PR4L 3N85H 2ITDA 4MMZC 5HGDA 3VCLA 1OGAE 2RJMA 5E94B 4XP5L 5CJXA 4JQVA 5FYJE 3F7VB 3U79A 1MFCL 3INUH 1NCCL 3L1OH 4JO3H 5KJRL 3FB6A 4M3KB 3MFGB 2YD6A 5T1KA 3OJDB 3EYUL 5FO7B 3HPLA 4CADB 3QIBC 5K9JH 2ID5A 4X7DC 2CUMA 3QJFB 2DQHL 4I9WD 4LEXH 1OLZA 3VXSD 2WQRA 1XF1A 4L8BA 3SO3C 2GT9B 1PQZA 4BFGA 1J0JA 3X12B 1PD6A 4ACPA 1MHCA 1BLNA 1MHHA 5GJSL 3IU4L 3HNVH 4OLUH 3DX6A 2GCYA 4LEXL 4JPWL 4RFEA 2EDXA 1G6RB 4KROB 5LQBH 4XPTH 4P5TA 4DVRL 3IAQA 3O2VL 1HQ4A 2MJWA 3F5WA 3DVIA 3FN3A 4FTVD 4XBGA 5FECA 3B83A 5BO1H 3QI9C 3SDAD 4DVRH 1D9KD 3LSOA 2ZOKA 4PY8J 3VE0A 1KIRA 1HXMA 3QWRD 3SKUD 1G7HA 4O02L 5D9SA 3WJJA 2BHUA 4YDIL 2X44D 1OSPL 4PJDA 3RWEB 2JB6B 2NQCA 2W0LA 1NLDL 1Z5LB 2EDLA 3T4AA 5JMRA 1RHHB 5K9OA 2DQGL 3BJLA 2P24A 1IAIH 2R0LL 3U4BH 5FUCC 2YWZA 2CDEA 5DFTA 4PJIB 2ZJSL 4Z95L 1BQHB 3ZT7A 3EZJB 3GBNH 1YEKL 1EFXA 1H15B 2E6PA 4V1DE 4JDTH 3WMSA 1IKNC 3PQYB 3MV01 3BZ4B 1L7IH 4ONHB 5I1KH 4OIBA 4UV4H 1T5XB 2O5XL 4RNRB 3FO1A 4KPHH 4TSBH 1BX2B 4NO5B 1FC2D 3WS6A 4NUJA 4UBDD 2X1XR 4P2OC 5F3BB 2Z31C 3D0LA 5J06A 5I1KL 1DLHA 3QQ4A 4OD3L 1C7TA 4OI8A 4N1EA 4EEEA 1CICD 3IDJA 1FZMA 3IDYB 3MUGB 2VITA 4HX1B 4UOJA 5DZLA 5SX5H 4PV8A 3ULVH 2YA2A 3ECBA 5ALCL 1SBBA 2JELH 1F11B 1IEBB 1XH3B 2JCCE 3KXFD 5DRWB 4MD0B 4P9MH 1XAUA 3EYOA 2C1PA 4GRWE 3NZHL 4BSVA 4AZ8A 5I76B 3HNTL 5D70H 1HHJA 3B9KB 2ZUTA 3EOTH 2DQUL 4N8CH 3X14B 5TDPB 2R2EB 5H35B 1BWWA 5FM5M 1JPFA 2YR3A 1U36A 2VABB 4JG0L 3N1PC 3X3FL 3ARUA 3UJTL 4PJBA 5ICXB 2AQ3A 2J8HA 3FQTA 4FS0A 5C09A 4JPVL 3DUSB 1X4ZA 1KB9K 4G6AC 3LMJH 2BRQA 4J3SA 4GBXC 4PJ5D 2UWEF 4HJJL 4L29A 4U2YA 1R3HA 3ZKXC 4HUWB 1C08A 3MUZ1 2FBOJ 2VQ1A 1A4JB 3GUTB 2EKSA 4N1HB 4Z7VB 1EEUA 4RAHA 5LWYL 1FVDB 3KPLA 3NH7H 3TT3H 3SKNB 1P5VA 1GC1C 4YHLH 4XWOD 5TGBA 2E7LC 2VYRE 5JHDD 1YQ2A 3GBLA 1EBPA 1HHIB 5I1JH 1CDCA 4WTWA 3WIHH 2QSTA 1MWAH 1FJ1B 3KYKH 1FO0H 1UVQB 2NY7L 2EDDA 2IBZY 3RBGA 5C0GA 3Q0HA 4HV8B 2K3TA 2ATKA 4M1CD 4TSCH 2DDQH 2NXYC 3TBYB 3REWB 2GTWB 3TPUA 3QBTB 4O9HH 1MWAL 3C60B 3DETD 4F7TB 5IBLD 5JIKA 1INDH 5JW5B 4HLZH 1Z5LA 4ONFL 1NBZB 5LJYH 3GHBH 5C1MB 3CSGA 4WHYG 4QRPA 1IT9L 3MV8B 2B20A 2HLFD 4L4TD 3DARA 2AEIT 3O6FC 2NMSA 5BRZA 2BJMH 3FQRB 3MRLA 5DJ6A 4JVPA 3OXSB 4AK1A 4ZS7H 3FO0L 3BPNB 3GHBL 1IVLA 4PS4L 1FL5A 1CXKA 2FX8H 3O8XA 5GS2D 3SCMC 3ZDYE 3IFOB 3UMTA 4I48A 5IJKA 3F7YA 1H5BA 1BFSA 2DQEH 3WNNA 4PPTA 1H8SA 2G60H 4EDXB 3D3VA 5TE4H 3FKUS 5EBLB 2DQEL 3MV8E 1F11A 2GJZA 4HS6B 1JNHB 3P0GB 3HI1A 4ZAKA 4LDEB 4PJ7A 2BVOA 1RU9H 5D72H 4X98A 2XA3A 5F6HJ 3LCYA 2W1NA 4JZJB 3DOSA 5JUEH 3IJYB 3CH1B 1YEFL 2DLGA 1MLCB 3BPOC 4XAWH 3UTSB 3BZFB 2CIIA 43CAB 2CLRB 2D7NA 4XNQA 3QUMA 3MOBH 4V1DD 2AABL 1N3NB 2XN9B 5E8PA 1YNKH 2FO4B 3A6CH 1JWMB 3E3QC 5IFJB 4G8EA 4OSUH 5BV7C 3GSXA 1FNSH 3B5HA 3WFZA 3BX7C 5A2KH 1A3LH 2GK0A 5I74B 4WO4C 1LO4H 3BDYL 5KBNC 3LQAL 5KVEL 3VE0B 4ZUWB 4GKSA 5CINL 2R8SL 1C08B 4NQVB 4KROC 1EXUB 3HZVB 3HMWH 3ZZ1A 1NFKA 3CZFB 4NNXA 4R0LC 5E9DE 3B3IA 4U0RB 1ZVSA 1I7TA 3IDIA 3MCKB 2ZCHL 6CGTA 1RMFL 2P7TA 3UCRA 4QY8A 4ZXBB 3HMWL 4W70A 1BZ7A 1OQOA 3U7WL 3QIBB 2AJXL 1XF5A 3PABA 2DL2A 3W11C 4XPFL 4LLYB 5SWZD 2ZCHH 1J7VR 3P73A 4Q7DA 1R24A 2B4CH 2EE3A 3E8UH 1NGXA 1DQDH 3MXVH 3QIUC 4YC2C 3ET9F 5B3NA 1S9WB 4LVEA 2HJFA 4XPFH 1PKQE 4K3JH 1S7WA 1NDGB 1RUQL 4Z77A 4RGND 4GXVL 4HFUH 4DGYH 3BN3B 1NUFA 5HVFB 3NN8B 1Q0YL 1UWGH 2L0DA 5FYKE 1GPOL 3WLBA 5I71B 2FIKA 1KIQA 1M6OA 4O2CB 4ZO6A 3BVNA 1KTLB 2FLRT 1T1WB 2D03H 1S7VA 1FL3A 2D0HA 1HE7A 1JNNL 2BSTB 3KVQA 4X5XA 5D1QB 5FYKH 2BX5A 4YHZH 2VTFA 4FQCL 4XH2B 3IAGC 4Q9QL 1J88A 1DLFH 5IIEB 1ZLVK 5DS8A 3PE9A 1Q1JL 1RIHL 4F2MB 4PR5B 3AREA 4KKBC 1ED3B 3OKLB 1QUNA 4B5EA 3ARWA 3CPLA 1LD9A 3VFUA 4HK3N 1P7KA 1C12A 3HAEB 1XGTA 5C9JA 4GT7A 3P3YA 1WSST 5JHDA 1N4XL 3LHPL 5E94A 1A7PL 4HS6A 3VA2C 1ZA3B 3F7VA 3T2OA 5CEZL 5IHLB 3TA3A 2BVOB 2BSSA 5JQHC 1ZA6A 4JANA 2QV2A 2FH8A 4FP8L 2DYPD 1HN1A 1A0QL 1PY4A