4H8WH

Crystal structure of non-neutralizing and adcc-potent antibody n5-i5 in complex with hiv-1 clade a/e gp120 and scd4.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
212
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSTYAMSWVRQAPGKGLEWVSSINNSGRNTFSADSVKGRFTISRDNSKNTLFLVMNSLRAEDTAVYYCAKDLRLGGGSDYWGQGTLVTVSSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords HIV-1 CLADE A/E 93TH057 (H375S) GP120
publication title Structural Definition of an Antibody-Dependent Cellular Cytotoxicity Response Implicated in Reduced Risk for HIV-1 Infection.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 212
sequence length 219
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h8wH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h8wH01
3T3ME 1QVOA 3L3DA 4WO4C 4JFFA 1R5WA 5TDPA 5B4MD 3V6OA 4RQQA 3HN3A 3MREB 5GJTL 2AJXH 4PP2A 5TH2A 3SE9H 2GK2A 1CZ8H 3ARZA 1IC4H 3S35H 3X3GH 1G7JB 2P8LB 3OKLA 3VE0B 2BC4B 3EFFA 1W2KT 1JFQL 3NN8A 4OCXL 1C5BL 4Z95H 3BUTA 3MJGX 2H6PA 1R3IL 1TCRA 3RPIA 1WIOA 4JY5H 3BPCB 5HHNB 4CRPA 1EVTC 3VFNB 3BRFA 2GCYB 1X7QB 1EBPA 3OKKA 3RVWC 2HFTA 2YBRA 3ARGD 1LE5A 2CLVB 4PJGE 2XTLA 3SDAC 4JFEE 5KSUB 1MAML 1N0LA 3ESVF 4PLJC 3SQOH 3T1FB 5HVHC 2Y23A 2DQGL 4QHNB 1G7MA 4E0RB 3VFOA 4DKFL 1G0DA 3AREA 5A16B 1X5HA 1MFNA 2DQEH 4XP4H 4MDIB 4HPOH 5D2NC 3PP3H 3T77B 5EBLA 5IBTH 3LS5L 2CH8A 3FZUD 2WBJD 1I7UB 3B6SB 5TJWK 3TZVD 3B4NA 3WN5B 2XWBB 4L8SB 5EO0B 3RWCA 1RZIB 4ELKB 1RZJH 5IJVA 2DQUH 4M7JH 1JGUH 1OD9A 1U93B 5F21B 5GSVB 2GAZA 1WZMA 5IR1B 4O9HL 2VZTA 1YYML 2EIZA 3C87A 4PJXE 1S7WA 4L4TD 2Z31D 1TENA 3FN3A 2VDNL 3EOAA 4TTDD 4R4BB 1EDQA 1OW0C 2C4XA 4GS7B 1JYXA 4OQTL 1Z9MA 3VXUD 4UQ3A 1OSPL 3U48A 5C0BA 5D1ZB 2F58H 1YEHH 2RQ8A 5D72H 3DX8B 3EYOB 4F58H 2WIMA 2XQBL 3S37X 3W5NA 4JFFB 5D1QB 2IH3A 1SVCP 5FYLD 1RHFA 1S8DA 1ZVSA 1AP2A 4JDTL 4KKBD 2IQAB 1KT2A 2VABA 2DWEB 3UZVB 1FNEA 1MCSA 1T80A 1AGFA 2D0HA 1MHHA 3IKKA 1FL5B 5I73B 5LCVL 5JORB 1FAIH 4D3CH 5JR1H 2YD7A 1TCRB 1XH3A 3AB0B 5E99L 1JN6A 2BVYA 2YKLL 4OZGF 4JRWA 4QCIB 1WFNA 4NQDD 5ANMB 3UC0H 3FAWA 1KIUA 5D7JD 4PJHE 2VISA 4HIXL 1C1EL 3U46A 3HNSL 1CDGA 9CGTA 1RK1A 5CZXC 2HFFA 4D0BA 5GS0L 2XACC 2X4RB 3Q1SH 4IRJD 4MA8H 4S2SA 4TVPE 3PIQA 2VR5A 3Q3GA 1NEZG 4F7TA 3RVTC 1CCZA 2E9IA 2NY6B 1OWWA 2ATKA 4LSTH 3BKYH 5EBLB 5D8JH 3OHXA 1LK2A 4LVOB 2W60B 1SYSB 2QSQA 5IHUL 3TO4A 2YD9A 3ARYA 1MHEA 2GEEA 4NN5B 4PB0L 5EZLA 5FK9A 5F1SA 1OGTA 3QRGH 4RGOH 3VD4A 4TUOA 4JM2D 4JHWH 4P2OB 2C3WA 1LD9B 2YXMA 1BPVA 5HGHB 5MERA 1MFAH 1A1NA 5I1JH 3GDBA 3MRDB 4ORZC 4Z77B 5DQJB 1YNLH 3TH4T 4WCYL 1WJ3A 5MENB 3D18A 5ESVB 4Q2ZA 5I76A 3CC5A 4QXUL 2F19H 1UXWB 3MRCB 5F3BA 5D2LA 5MI0B 2ITDA 3QDGD 1FNLA 1H8NA 2CDFA 3VWJD 3TCLA 2NMSA 1H5BA 4QHKI 3GI8L 1NCDH 5IGXH 4JGUA 1KF9B 2ZUTA 3LKOB 4NYLA 2O61B 4S10A 2JJSC 4JRXE 5T1KD 4GSDL 4KJQD 1AGFB 1KBGH 3KPNB 4L4VD 4XT1C 4YGAB 1J0YA 4FTVB 5D71L 1JHTA 1S7QA 2QQNL 2Y4SA 4FZEH 5LKNA 5JXEA 5DRZB 5KZCB 4N90E 3E1F1 2P5EE 1LWRA 3BN9C 5KSBA 4E41B 3BQUC 3V6BR 4YFEA 1RJYB 3FO9B 5GHWH 4AG4H 5T3XL 1AKJA 1A9EB 5FGRA 4RGNC 3UDWA 2F8VA 3HFMH 4P23B 3QEHA 5I1AB 3U46B 2DYPA 4S1DC 3RUGF 3U36A 3MJ9L 3DLQR 4NGHL 4PJ8A 1RK1B 4RDQG 4BKLA 4I4WB 4DCQB 1PKQA 4P9MH 1VFMA 5E8OA 2EE6A 3GBML 4YQXH 3O8XD 4WTZG 5F9AC 3LKRA 2C9AA 3MLTA 3TNMB 2QEJA 4NN6C 5HI4C 3PIQB 3REVA 3V4VH 1KNOB 4OFYD 1AGCA 1U8IA 4KHTH 3EO1A 5E2TL 4HK0B 4OGXL 2XA8L 2BSSA 1Q9KA 1ZWIA 5FYJL 2UY6A 3TNNB 3AC0A 1QQDB 1XGQA 5CZKA 3VFGL 1Y6MR 1KCSL 1CFVL 2BCKA 1NANI 5EZLB 3MRHA 1K2DA 2WLZA 4NRZA 4QEGA 3WL9A 1MCPL 4TUOB 1DBBL 3KLAA 3T04D 4LRIC 2G2RA 5E1AA 3SDCC 2D0GA 2W92A 1R3LA 4P3CL 2P8PA 3WYRA 1YNTB 1B4JL 3N85L 4X6DE 3WIFB 4S1QL 2E7LC 3D18B 4Q2ZB 1BEYH 3VFPA 5D2LB 2W1NA 5EU5A 3DPBA 3AU1A 2M1KA 3PWJA 1MELA 5EU7E 4NSKB 2W0FA 4LAQL 5IG7A 1RJZB 3D0VB 5KS9E 4PUBH 1ES0B 1KB5L 3Q6GH 2YRPA 5C0RH 3DMMD 4OJFH 5CILL 3WXVL 3O0RH 2EDYA 3E2HC 2F53D 1KENL 3P2TA 1JL8A 3RAJL 1YC8A 3FT2B 1NUGA 2NR6C 3TN0D 4OSUH 4DGVH 2KQMA 2VXTL 3BKCH 1MCWM 2GSGA 4BQ6A 1HE7A 3RIAF 4F2MB 5IEKB 5FO8A 4EOWH 2FX8H 1BVLB 3G6AA 4PRIA 5KVEH 3HUJB 1AE6L 4EUPA 3IDXL 1OLLA 3IAQA 4UU9A 3CGTA 4UNVA 1CDIA 1KUMA 3UJIH 2Y36H 4BZ1L 4OZFG 2JJTC 1I4FB 4I5BA 5DJXB 5DUML 5ISZA 3E6HA 1AY1H 1U2HA 3AS3A 1VDGA 2Z4QB 4NNYA 3CFJB 3L3KA 3MLWL 3STZB 5DVMA 5C2BH 1T3FB 1OTTC 4XPBL 1CLOH 5AUMA 5IK3A 5MHSD 4LCIL 2H9GA 4J4PD 4P2QA 3DBXB 3QDAA 3VXRA 3C2AH 4JANA 3TVMB 4WDIB 2DDQH 1UB5A 4X6BB 5LBSH 1HXMA 3MRHB 5FV1L 3ARWA 5CSZA 3P11L 4UAOC 3KLAB 1DJSA 4LOUD 5C3LD 4GKZA 4UQ2A 2Q86A 2G2RB 5IQ7L 3EYUH 3SKMB 5J6GB 2MQ3A 1B90A 2P8PB 1IILE 4P4KB 4HIHB 1R24A 4UT9L 4AENB 2XZCH 4OM0H 2DM7A 2AXHA 2E7HA 2HN7B 4OM1H 3QUKB 4XGZB 3WO4B 3FFCA 1H3TA 3M17A 3U9PL 3MUHL 1T0MB 2AEQH 1R3JB 4MAYA 2D7TL 1JPGB 3MV7D 2W0FB 4HQQH 3BGFB 4NO2B 1AXTL 4ZO7A 4DEPB 4EI5B 4P2YA 5C0CA 3HC0B 1VGKA 4BUGA 1ORSB 1YMMD 1FL3B 2HJLB 3VFMB 3MFGB 4UDUB 5DTFB 3S3PA 4G9FE 4ALAL 5JHDB 3JTSA 1NANH 2D31B 2JE8A 2QR0A 3VFSA 3RHWK 2F74A 4XNUL 2DOCA 3MV8A 3IGAA 4Y4KD 4M62L 2GSGB 1KTKE 4NQEE 3DGGA 2FB4L 4WU5B 2ZCKH 3F7VA 1QBLH 2A1WH 4D2NA 3BIKB 1CXHA 5T1LA 4F9LA 2GJ6E 5LQBH 5E2VL 2VAAA 3KNBA 3VGGA 4OFIA 1E27A 5GGQL 3CFEA 4M00A 4NQTA 1AGBA 4BA8A 1EO8H 1KPRA 1OAUH 3IU3B 1OGAB 3WIIL 3TT3H 1BGXL 2IQ9H 3VH8A 5CUSL 2UZXB 5IBLC 3L7EA 4LCCB 3L3KB 3PDDA 1OP9A 4KUZH 4XBGB 4YHYC 3UJTH 2VNCA 3QUXC 1FGVL 3H9HA 2NYYC 4FN0A 4KJWD 1IAII 4PJEB 3VWKA 4NM4H 2VUYA 3TIEB 1PG7X 3QQ4A 1OF2B 3DHJA 5SWSE 4RIRA 2AV1A 3STLA 2DLIA 4J7RA 4JANB 2R2EA 5C8JB 4NWUL 1UB5B 1HXMB 1X5AA 4HDIA 4PJ9C 3QZWB 3H8NA 5LAXA 1VEOA 4N68A 1GGCH 1I1YA 4F33A 4WHDA 4YDIH 1FBIH 1HHKB 3HE6D 3BPOC 4FQXD 3RBSA 4ZTPH 3SE9L 2AJXL 3D2UB 1S9VA 3BP5B 1BECA 3BH9A 5JOFA 3RL1B 3BZDA 1CZ8L 4PRNA 1IC4L 4JY4A 3S35L 4RBPH 3X3GL 3CCHA 5D6CB 4RMRA 4PJ7F 4K8RD 2CO7B 5IFJB 3NZHH 1I1CA 4WENB 4WTWA 3WDIA 3G5ZA 4WTXA 1YDPA 4KDWA 2A6IA 4Z95L 3O4OB 5CJQH 1WBYB 4JFED 4OT1H 3ORJA 4JY5L 3U0PA 5JW5A 5L0QC 3GSXB 1DBKH 3QIBC 3G5VA 1WISA 1TQCB 2IPUG 4HS3A 3CVHH 1XMWA 3VG9B 4C56A 1JWSA 4H0GA 3SQOL 1ZHKA 2X4PA 3NTCH 4Z5RA 1HHIA 1L0XA 4QY8A 1BREA 5LGJA 2DQEL 4XP4L 2DIBA 3D87B 3IJSA 2EE3A 4HPOL 1NCUA 2ENYA 2PTTB 5IBTL 5FKAB 1W8NA 4CVWA 5ETUB 1DDHB 3G08A 4BH7B 3KNBB 1XF2A 2Y1VA 5B4MC 4DKDC 2UWEF 1LEKB 1AGBB 1RZJL 2G75B 3TBVB 3H3PH 1I75A 5CJOH 5T33H 2DQUL 4M7JL 1JGUL 1YNKH 2HT3C 4YXKH 3DUHA 4BYHA 2BVQB 4G6AC 1DEEA 3ET9F 5IV2B 1DLFH 4PJAA 3F7YA 5E9DB 5FB8A 5F6HJ 4CU7A 3LQMA 5FO9A 3OTTA 3MYJB 3QQ4B 2GJJA 3NIDE 3C6LB 3FHAA 2DKUA 1B9ZA 3Q5YA 2F58L 4HDIB 3C2SA 3SBWC 4LHUG 1YEHL 5D72L 4I0CC 4F58L 2I9TA 1EJ6A 1MHCA 2QTEA 3X13B 3KDMB 5IOPB 3C5ZC 3SO3B 3CFDB 1VKXA 5HD8C 1QSFE 3V5DB 2YHGA 3TA3B 1KCRH 2VIRA 3LKNB 2V2TA 3G5ZB 4P9HH 1P4LB 2A6IB 4IIQA 4ELMA 1UEMA 5B3JF 3BD4A 1AQKH 1FAIL 5HGBB 4D3CL 5JR1L 3FRUA 5EIQA 1A4JA 4YHIA 1E4JA 2A6KB 4YGVA 2JCCB 3UC0L 3FB8B 2ORBH 4Y4HC 1IAIH 4TVPD 3TH3T 3QUMH 4XHQA 3SDDD 2H1PH 3QJHA 3G5YB 3RX7A 5E6ID 5IVXB 4IEFB 5E4EC 4N1CA 3Q1SL 4NWTH 4QY8B 4MA8L 3QEUA 5LGJB 1JZ7A 4C55A 1F2XK 1ERNA 4R0LA 4UMGA 4UB0H 4AH2B 3W11D 4LSTL 2ADJA 2J8UB 3BKYL 1NC2A 1NMBH 1QYGH 5D8JL 4RRPA 2R2BA 3W39A 4JB9H 3G08B 4MXVF 1T20A 2PTUA 3L3IB 4H20H 2VL5A 1XF2B 5TPWH 4QYOA 4Y8AA 1DVFC 3L9RA 1AC6A 3QUZC 5C2UB 3T2OA 3PE9A 4P5MB 3QRGL 1IM3B 4LSRH 4RGOL 3E3QC 3V6OE 4JHWL 3FOMB 4YEEA 4AJ0A 1QHOA 4TN9A 4I2XA 5ICXA 2V9QA 1QLFB 3O2DA 1MFAL 1YN7A 5I1JL 5GGTH 2X05A 1LO4H 2A74A 2QKIA 3DRTA 1TVDA 1YNLL 4JFHE 4CGTA 1DUYB 2EIBA 4MJIB 4G43A 3PHQA 4WHYG 5JW4M 2F19L 2BERA 1U8NA 1A2YB 2FJHA 3GSNH 4JRXD 2V5SA 5EU3A 4GBXC 4GKNA 1E4WH 2EDHA 1BFVH 4IMKC 3VRJB 1JZ3A 1TJHH 5CD5C 2KH2B 1NCDL 5IGXL 1KC5H 4W6WB 3X17A 4N90D 5DS8B 2P5ED 4U6VH 5FF6A 3DURA 2ED9A 3L95B 3OKDB 3DX6A 5IW6A 1KBGL 4YBLB 1QFOA 4DK6A 3WS3B 2ADIA 1I3RB 1AHWA 4FZEL 2QSCH 4UDTA 4IIQB 4KRLB 1BQHA 3MLYH 5HYSA 2HA1A 1RY7B 4F80A 2YZ8A 1L9NA 3MRIB 1L4IA 2FLRT 2V5MA 2WIIA 4NZUH 3TJHD 5GHWL 4AG4L 4Y88A 3HFML 5B38B 3GM8A 5C0NC 5F6IC 3UTSA 5DXWA 4YWGH 5EC2A 5JO5B 3JV6B 2CKBH 2YOCA 1ZOXA 1F2QA 2FSEB 2EECA 4P9ML 3V5KB 5C86A 4MXQD 4YQXL 1CGVA 4PRBA 3V4VL 5HYFA 5MEOA 4J3WA 4KHTL 5HYJA 3ULUE 3KXFB 1GCFA 4C58B 3ULVE 1MJUH 4HKXB 3AUVA 4OZ4B 2OQJB 4IRSC 3SKNB 2R69H 5C0BE 4WFEE 1JNHA 4GG6F 2XTJC 5KSAA 2RB8A 2DL9A 1MREH 5FOBB 4G80B 4XAWH 2R2HA 5INCB 2ZUVA 3CVHB 2EYTA 1FFOA 1ZE3C 2J3SA 1ZTXH 5EG6C 3P0GB 3HZKA 4NO5B 2A74B 2QKIB 3DRTB 4KK6C 4KI1A 3X12B 4HH9A 3F6LA 1FP5A 3IU4H 3MJ7B 1BEYL 4LQFH 1K6QH 3EGSA 3UTTA 4CJ0A 4PUBL 5SWZD 1KGCE 5ITFB 3Q6GL 5C0RL 4OJFL 1WZKA 1KTRL 2BK8A 1NFIB 1EBAA 2UUDH 4FFVC 3O0RL 4OKDA 4UBDD 4Y8DC 3S5LA 4U1KA 4MQXC 5DQDH 1ITCA 5FDWA 1A1MB 3BH8A 3LCYA 4Q6IA 1FSKC 2PNDA 3V9FA 4MCYA 4KTDH 3VJ6B 4OSUL 4DGVL 3DRQA 1NFKA 1X5FA 1EK3A 3LZFH 3BKCL 3ZLQC 2HKFH 2Q7YB 4OKVB 2BVUA 5FKPA 1C12B 3ARBB 2WIIB 3IF1A 4EOWL 5B8CA 2FX8L 2C4FT 1NGZA 2IAMD 5C0AB 1F97A 5KVEL 1U8KA 2HP4A 4OQTA 2XWTA 5DJYA 3EDDA 3UJIL 2Y36L 2CMRH 4QHKJ 3VDCA 3CFBB 5SX5K 3BEVB 2WWMD 1AY1L 4ZO9A 4N0UB 3FL7A 4WUUA 3ZE1E 2Y07H 3RY4A 1VFAB 5AYUH 1QSVA 4UIMB 2VL4A 5C2BL 4ODXA 3VFWA 1CLOL 3EOTH 5TE6H 5JMOC 3WLBA 3FB6B 3B43A 2DRUA 1KIPA 3MCLH 4ZXBC 2AXGA 5B3NA 3C2AL 4JREC 2DDQL 3L3OB 5LBSL 3O11A 4M1CD 5K9JH 2AEIT 4HKBA 3GB7B 2V2WA 4P4RB 3EYUL 1FFOB 4MLIA 5AEAA 3MSPA 5D7LA 1UH3A 2OJEA 1OM3H 1KJVB 2GFBB 1Z9SA 2XZCL 4HH9B 4HMCA 3LKQA 4OM0L 1OCWH 2YN3A 4OM1L 3MLPA 3O6FB 4ZUUB 3L3JA 4Y2OA 2AEQL 3VD9A 1W0WB 4LLQB 1F3DH 5KSBE 5DK3A 4DZ8A 4B53A 1CFQB 3EGSB 3UTTB 4HQQL 3BP7A 1T1ZA 5GXBB 4ZAKC 2X4SB 1DQJA 3D69B 2FATH 2CD0A 1AXSA 4X98A 1UG9A 4I8DA 3N1FC 2XY2A 1HOCA 4NQED 1PKQE 3QUYA 3SJVA 5IBUB 2HLAB 2VSCA 4N8VA 1TFHA 5C0GB 2X4TA 2GJ6D 4OD2A 5ALBH 1OP3H 2ESVA 4XI5C 2Q76B 1DZBA 1HWHB 3F8UB 1TVBA 1Z0MA 4H1LG 2I07B 2ZCKL 1QBLL 2A1WL 4J8RB 5FYKE 5TF1H 3RWJA 3BZ4A 1U8KB 2J5LC 3HCVA 5LQBL 2X40A 2XWTB 3NZ8A 1X9QA 3BJLA 2PYEA 1JZ6A 3D25A 5KOVC 1AO7B 1S7RB 1EO8L 4JM2F 1OAUL 4S0TD 3TT3L 2IQ9L 3MBEC 2PW1B 3REWA 4KUZL 3UJTL 4Z7UB 5BVJA 4L5FH 5E56A 2MOVA 4JZJA 3WLBB 3IKCA 4NM4L 5ID1B 4GRWH 1K8IB 5EO9A 1H3WM 4FG6C 4NKOB 3B5TA 3LV3B 4Y5XB 3QIUD 4ZO8A 5DI8A 2NTFB 2QSTA 3QWRA 1GGCL 2E6PA 4YDIL 1FBIL 5CHNA 5D4QA 2NQCA 4TRPH 4ZTPL 3KPMA 4V2BA 4BQ8A 5JA9A 5HI5C 4Q6YA 2CKBB 5KBNC 4G8FB 3ZZ1A 4GAYB 1EO5A 1YY9D 3G5XB 3RWHA 3ZKMD 3MJ9A 3RNQA 3J7HA 3NZHL 3L3GB 4YX2H 3QXVA 4OZGA 3T0XA 3DI3B 4ZDHA 5CJQL 2RFXA 1FIGH 4F7MB 4FFWC 2QADC 4OT1L 4JVPA 3OKMA 5I15H 1CN4A 4PRIE 1JHKH 1DBKL 3MFFA 1YY8B 2ICCA 3VRLE 5HBBA 4POZD 4HJ0D 1AXSB 2Z93B 4K07A 3LKPB 3CVHL 1NGYB 4KK5D 1QPXA 4KROC 4PJFF 3SJVB 5ISZE 2EDLA 3AAZA 2CK0H 3NTCL 3KHOA 5IKCA 2ESVB 1DE4B 3MNWA 3WDJA 1T22A 4Y89A 4RMTA 2EDXA 4RSVA 3RZWA 3T2QA 3TWCH 2FR4A 1OP5H 4P2QE 2BSRB 5IVOA 5MEPB 3VXRE 3WUZA 3HCVB 1HHGB 3BUYB 3DVIA 2C1PB 2XOTA 1OAXH 4U49A 3X11A 3D25B 3H3PL 5CJOL 5T33L 1YNKL 1HNGA 4YXKL 4OIBA 1DLFL 3MV9A 3MRJB 1FNAA 4RDQF 1MLBB 3RP1A 5DZOA 3DARA 1T7VA 1FV1B 4LVHB 3FFCE 2J4WH 4HUXB 5IEHA 2CKNA 5IM7B 3NACH 3O9WD 3PNWB 1FDLH 5IIEA 1CE1H 1RUMH 1QSFD 2X4OB 3SKJH 2AAVA 5C0CE 3VDAA 1I8KB 4WO4A 1XGTA 3RWEB 4U0QB 3RWDA 1FVDB 2W07A 4XAKE 4D9LH 3AM8C 3BRDA 2VXVH 4M7ZC 1WF5A 4EEEA 2ZOKA 5ECJE 35C8H 2VTFA 4TPRH 4U6XA 4PJBF 3A67H 1KCRL 3MV8E 4LPTA 5D7KE 2CRIA 4P9HL 3VXNA 3QIWC 3VGEA 2H8PB 4D8PA 4GKSA 1AQKL 4HUNB 5JPMA 1EIBA 5F89A 1QRKA 5GGRB 1M7IA 3SPVB 4LLUB 3WKNA 2X70B 1UT9A 1IARB 4ISVB 5DHYA 3RUGA 2E6QA 3MFFB 3BW9B 1AFVH 2ORBL 1IAIL 5DJDA 1SJHB 3QUML 2PW2B 1F3JA 2H1PL 4F7PA 4LCUB 4OZHF 4I3SH 2ZSWA 4WHYH 4J3XA 4X4ZA 5F88A 1J7VR 3SDAA 4HCRA 1Y6NR 4GJTB 3WE6A 1JI2A 4A6YH 4OGYH 4LCYB 4NWTL 4O2EA 4NCDA 1BFTA 3MNWB 2H32A 5HVWA 3ESUF 4JFFD 4UB0L 4BZ2H 3A6CH 2FR4B 4UZGA 5D2NA 2GYSA 1NMBL 3O45B 1QYGL 1D5ZB 2WAHA 3OB8A 2PXYC 4JB9L 4H20L 2EDRA 2VKXA 1S7XB 5TPWL 5BS0B 5D93B 3MRLB 4JFHD 5IB4B 1DR9A 1DQMH 2IANA 3OXRA 3X11B 4HG4J 3C09B 4LSRL 5SWQA 4HIEB 5DHXB 3KPSA 2PO6C 3B2UD 3GSRB 1UWGH 5ACMA 1A6PA 4HUVB 5GGTL 5T5FH 1LO4L 4DOHB 4JPIA 2BNQA 1CT8B 3WIHA 4TUKH 5J13B 1OW0A 3BP4B 3QO1A 5F7YC 1GVIA 4YDKH 4G8IA 4Y5VB 3GSNL 3S98A 3PHOB 4QRRB 1HSAA 1T04B 3SCMC 1E4WL 1DP0A 1BFVL 5SV3A 1TJHL 3ARED 4Z7VF 3S35X 1KC5L 1N3NB 3I2CH 2B2XH 5I1CH 3RWDB 4U6VL 5H94B 4C56E 4MB3A 3FB5B 4U6XB 4U1JA 2X1OA 3LN5A 3DXAA 2QSCL 4LSUH 1YQVH 2FGWH 1JGEA 1MI5B 3MLYL 4LSQH 1XGPA 4NZUL 4GRWB 2XQYK 5KVFH 5I66B 5DHYB 5I1LB 2BDNH 4XP6H 3UPRB 2ZNWA 4QHUB 3TYGH 3RGVC 3QQ3A 4PYHA 4YWGL 1F3JB 1BOYA 1F4XH 4F7PB 1FIEA 5IMKB 3CDGA 1T7XA 3U82B 3ULVD 2CKBL 5KN5A 4RFEB 1U91B 1KIQA 5C0BD 4O2EB 4PJAE 4WFED 5D6DC 4PLKD 1IAKA 2HTLC 5CLTA 5C09A 3D5OF 3CK0H 1ZHBB 3T3MF 1KYOJ 3E0GA 3T4YB 3ROOB 3ETBF 4M61B 1MJUL 3FT3A 1N4XH 3UBXA 3KPLB 1T2XA 3EZ8A 4U1NB 4UT7H 4KK8C 2R69L 4PJ5A 2P24A 1CDHA 5GS1C 2EC9U 4KVCH 1ZA3B 3EUUA 4AMKH 3CXDH 4MXWH 1MREL 5IROC 1CICC 4LSDA 4XPTH 5I75C 4XAWL 3C9NA 4HWBA 4XRCB 1ZTXL 3BDXA 1JCKA 4PJCF 5M95B 4JPIB 3LB6D 2BNQB 2Q6WA 3DIFA 4KI5C 1NFDF 3ARTA 3IU4L 1FVCB 3L7FB 5DSCA 1YEEH 1TPXC 5IB5B 3I3DA 4W70A 4ELME 3QO1B 2FL5A 4BSVA 1I8LC 2R9HC 4LQFL 1K6QL 4X5WA 5ESAA 1OAZH 3MR9B 1V3KA 1P2CA 4WU7A 2NLJB 1RK0B 3C5JA 5DQDL 3HRZA 1A7OH 4MXQC 1HH9A 4XVSH 2JJSA 3IDJB 2HFEB 3TO4D 2A0LD 3DROB 2VSDA 3LN5B 4KTDL 4XC1H 2AK4B 4KK9D 2CXKA 1JGEB 3LZFL 2BY1A 4TNVF 2HKFL 1N6VA 2J88H 1V3JA 3BQUA 2NNAB 5F3HB 1JF1A 3BP6A 3MGAA 3TIDB 2YN5A 4L4JA 5DVLA 1PD6A 1TZHB 3M45A 4ZFOL 4B50A 1GYAA 5I8KH 2XXCB 3CDGB 2CMRL 1U42A 4O4YH 2I5YH 5IVNA 4H25A 5KN5B 4I2XE 3WFHB 1INQB 2Y07L 4K7FA 1IAKB 1IC1A 1KLGB 2XXMB 5AYUL 3HB3C 1PDKA 4Z0BH 2ADGA 5J89A 4MNQB 5K9QG 5F1NB 3EOTL 5TE6L 1A6ZA 3K4DA 2VOTA 2Y72A 3FT4A 4JFXB 3TH2T 1UEYA 5ID0B 2IC2A 3MCLL 3IETB 1P9MC 4YFLI 5I1IH 1KLFA 2WZPD 1T5WA 5K9JL 5DDHB 4ODUB 1VGEH 3C9NB 3OV6A 3PWUB 1C7SA 3I3EA 5JXED 5DD6B 4LRIA 2A73B 3SDCA 1EV2E 4PJ7A 4GRMA 4YIQB 2WWKO 4MQTB 1AKJD 1OM3L 4MA3A 4H1LH 1FYTB 1OCWL 3ARFB 2CDGB 2F8XC 5DSCB 1F3DJ 3WNPA 2DYPD 2E7LA 4PJHF 3F6IA 3MX0A 3WEXA 4PJ8D 5F9WC 4OF3A 5A40E 2IGFH 2ZUUA 1II4E 4FQIH 4OLXH 1AR1D 4HH8A 4Q97A 3ZMRA 1GL4B 5HHPA 2DLEA 2BSTB 2FATL 5DJ8A 3UTSE 1HINH 3GHEH 4FMKA 3CSYA 3V6FB 4EJ1C 3KPTA 1T03H 5DEGA 2YC1B 5FYKD 4N0CC 1NBZB 5ALBL 5DHVB 3CMGA 3QNYA 1NGQH 2FIKB 1ND0B 2DQDH 5HYJE 3GFUA 1U8LB 1E6OH 1RAMA 3OKNA 3X3FH 1P5VA 1XF4B 5F1IB 1HEZA 1TETH 2RCSH 4HUMB 5TF1L 3BP6B 3RKPA 4R97C 2PR4H 2UWEA 4I48A 1CL7I 3MLSH 3IDMA 5I74C 4R7DA 3MRNA 4NBZB 2JJTA 3HAEG 5J0BA 4JQVC 5L2JB 1YN6B 1JGVH 3V6ZA 1YUHB 4L5FL 2DI9A 2HT4D 1AXIB 1MCCA 4ENEC 4P0DA 3FT4B 3IVKA 5EFIA 1P6FA 3H0TA 4C59B 1CDUA 1BFSA 4HLZG 1RIVH 4L3AA 3WHXA 5CEXB 5LXGH 4UT6H 1XCTA 1T5WB 4GRLC 2XZZA 4LASH 4V1DE 2DS4A 2KBGA 3BYTA 4I0KA 1S9XA 3QHZH 4TRPL 3UMTA 5JLZB 5F44A 8FABB 1MCJA 4MA3B 5IF0B 4PRID 3ZT5A 5TGBB 1RFDH 1UXSA 2BVTA 4YX2L 1NUNB 4HF5H 3MC0A 3WNMA 4KI5F 1WTGT 3T2PA 1WBZA 1N5AB 1FIGL 4HUWB 4Y5YB 2XICA 1IM9A 5ISZD 5GGVY 1D3CA 5I15L 4WEUD 1JHKL 7CGTA 5C92A 3GSUB 2I26N 3H6JA 1QR1B 5HHPB 1I3GH 1RZFH 4F7CA 4PRAA 1KTDA 4ZUSA 4YNYB 4PIRF 1YEFH 2EKSA 1E0OB 1R5IA 1FORH 2L0DA 1NH6A 4LFHG 2BOCA 1JTOA 4P2QD 4JY6B 1K8DA 2Q3ZA 4WUUE 4QRSB 3VXRD 1X5IA 2CK0L 2Y06H 1KPVA 1AD0A 2ITCA 5IJKC 4P5TC 5E1HB 1C5DB 1MY5A 2HRLA 3OKNB 2EYSB 3PP3K 3LHPH 3TWCL 2C1OB 1HEZB 4XPGH 2NXZC 5DA0B 3FKUS 3MRMA 4N0YH 4MVBC 1IKFH 1UJ3C 4N8CH 4R7DB 2HJFA 4ZPTA 1CQKA 1OAXL 4EN3B 3FFCD 2BVOB 2LV4A 5DD5H 4U1MA 3LRHA 3JVGC 3E8UH 1TJGH 1YEKH 4MAYD 1EMTH 5TF0A 1IEBA 4PGCA 5D7LE 3DUUA 3T0EC 3VCLB 4IOSD 1XR9A 3QUXA 5C0CD 2BP3A 2J4WL 5C7XH 2P7TA 4QXTA 3NACL 2VLRA 3KYNB 2AXJA 4M7LH 1FDLL 4GFTB 3OR7B 2X4UA 1BF8A 4QF1A 1T1XB 1CE1L 1RUML 1BF2A 3V5HA 4PJ9A 2NY5H 4EXKA 4L29B 3MV8D 4FQHB 5D7KD 5C0JA 4ZSOA 3SKJL 3RIFK 4J2XA 3IJHA 1BZ9A 1C7TA 3IJYA 1G7LB 4M9OA 4NHUA 2W9EH 4HGWB 4D9LL 2VXVL 2BNRA 2C26A 1CL7H 2YR3A 35C8L 5T1LD 1U8JA 4TPRL 1EHLH 2EEAA 3K8LA 3D39A 3A67L 3VXPA 1JF5A 4YBQC 3MNZA 4HS6B 4L8CA 4DN3H 3A6OA 4IHOA 4U0RC 3IDIB 3QXTA 1YEIH 1HQRA 4PRHB 5FA3A 5FYLH 1AFVL 4LAJH 1U3HB 4P2RA 3QIBA 5BZDA 3U7WH 4Y1AE 3S36H 2C7UB 4ZUSB 1U36A 4WHTA 3OMZA 2PYEE 3VWKD 2CRMA 3VXSE 2EZ0D 3RVXD 2X4QB 2F54B 4TYUA 1UH4A 1WEJH 4I3SL 4A6YL 4OGYL 4LNVA 2OL3A 4RZCB 1U95A 1BIIB 4GW1B 4Z76B 5J1SC 2AGJH 3QDMA 4IS6A 4BZ2L 3A6CL 3HLAB 4GG6A 1KEGH 5CP3A 1U8MA 5K9QI 1CXEA 2A77H 3H9SB 4PV9A 5ADPH 2VQ1A 2HJFB 1QSEA 2IFFH 3GMRA 4HZLB 4XVTH 2Y6SD 1DQML 1VFBA 1YECH 3X14B 3BZEB 5BRZB 2FIRT 3EOBB 4NC0B 4ACPA 3NMEA 5DUBB 1FFPB 4BSJA 1FO0H 3PGCB 1UWGL 2GSIA 3T0DA 2YPLB 5T5FL 2PYFA 3RTQB 5DJ0A 2XNAA 3KPPA 4XBPA 4A2MA 4LQ1A 4MD4A 4PR5A 4FNLH 1OY3B 4TUKL 4OZGE 2VLRB 4YDKL 1YMHA 3UX9B 1K5NA 4C56D 5E7BA 4QF1B 3D48R 1EERB 3EO0B 3SBWA 1MUJB 4BK5A 4ESKA 4ETQB 3L5IA 4WUKH 3IJHB 5E5UB 2RR3A 4QHMB 3I2CL 5FYJE 2B2XL 5I1CL 2EIDA 4G6KH 3C5ZA 3P9WB 3NCMA 1Q8MA 3NCFB 3P9MA 4M03A 4JQIH 3QQ9C 4HKZA 4PGDA 4JRYA 4LSUL 1YQVL 2FGWL 5CGYC 3P0YH 4FQJH 4LSQL 1ZS8B 4L8CB 3P4NA 1DFBH 4U1LA 3S37H 1Q1JH 3O4LA 4NHCH 4CKVX 5KVFL 2D7NA 4PGEA 4YHNB 2BDNL 4XP6L 4F7EB 5EUOB 4CN6A 4NBYB 3TYGL 4Y4HA 2C3HA 1ONQB 1X5ZA 3UTOA 4WHTB 1I8IA 5DFTA 1F4XL 1IQDA 4X6FB 3B8YA 1NCCH 4Y4FB 2R1XB 3RRQA 5MEQB 3ILQC 5DJCB 3S4SG 3MV9E 4OI7A 4MNGB 2DMCA 3CK0L 1TVHB 1R3KA 3FONA 1BMGA 2JB6B 3QDMB 4BJLA 1CLCA 2YRLA 3P30H 1N4XL 4UT7L 2W9LA 4FQQA 4LVNC 4KVCL 5DWUH 4AMKL 1DVFA 1Z9OA 3CXDL 4MXWL 1FZJB 1NGWB 3TLRA 3QUZA 3GSVA 5TE7H 2YD2A 3LRSB 4U7KA 4XPTL 4MDJA 1N26A 5CD3B 4KZEH 5I8EA 5F7KC 2AJUH 2ENSA 4B41A 3AGVA 1N59A 2LU7A 1DUZA 1OPGH 4UTBH 2VUOA 3ES6A 4HWUA 4OCSH 5DJ0B 1A1OA 5FIEA 3SOBH 1IMHC 4PR5B 2FECI 2DD8H 1YEEL 1D5IH 4QRUA 4YPGB 4ZUVB 4FXKB 3ZDZF 2VQUA 4OLZH 2I9LA 1CFBA 1H8SA 1TZIA 3T0AA 4NDMB 4NO0A 1GOFA 1IAOB 5DK0B 4GBXA 3RUGE 1QO3A 2YXFA 1I1FA 3SKOA 4IMKA 3ARGB 1CVSC 1OAZL 3ULUC 2I24N 4PD4J 4LPYA 1BIHA 2CDEA 4WI5A 3W81A 4NNXB 4U1SB 1A7OL 1EEZB 4KDTC 1NC2D 1HDMB 4XVSL 5CWSA 5E4IA 3HZVB 3GBNH 43CAA 4MYWB 4RAUA 3H7BB 4XC1L 3V7AG 2SEBA 5DEZA 2WBJB 2J88L 5B21A 8CGTA 3I84A 3SDXB 4HWZA 5D2NE 4L9LC 3KWWB 4BFIB 1WBXA 1K4DA 5HTSA 3MMEB 3MJ6A 4X6CE 4UILH 3C60C 2IANE 1IQDB 5F8RC 5I8KL 3IDYC 3S96B 3KPSE 2XKNB 3FN9A 4O4YL 4JR9H 2I5YL 1MPAH 3ARSA 1KIRB 3G9VA 4L4TB 2Z31B 4ZTOH 3B9KC 5HHMB 4ZO6A 3TYFA 2EE2A 4Z0BL 5FAAA 1R3KB 1CTNA 3VXUB 2GUOB 1I7TB 1NEZA 3EJYC 1WCBA 1CIUA 3KPQB 3EKCA 2XRAH 2WSKA 4IRSA 1U2CA 5I1IL 3PWVB 1XF1A 3VFTA 1OSZA 3F58H 4XHJD 5KTEH 4MLSA 2E3VA 1VGEL 4G9DB 1NJ9A 3DYOA 3OB0H 3PJSA 1N59B 2MTPA 3EYFA 1TQBB 1GSMA 5CIPH 1RHHA 4JJ5A 1QACA 5HGDB 4PJIF 3QUMA 5K9OB 2DICA 3JWOH 3NFPA 1T1WA 3VFUB 3UP1A 3DXAE 1M7DB 3UTSD 4NPYA 3MUGA 4HXAH 4LLMB 1ZLWH 3BMVA 4OV5A 4M7KH 2IGFL 4FQIL 5F9DC 4GBXB 4JQXC 4R96B 4X0KB 1T6WA 3QSKB 4OLXL 4QRTA 3HAEH 3OBAA 5EUKB 5K59E 1RZKH 3ZKQD 4ZUWA 5A3ID 1HQ4A 3MRFA 1HINL 2YA2A 2GW5A 4KKLD 4EIZC 3GHEL 5HYJD 2FZ3A 3RPKA 4OUUA 5CWSB 1T03L 2A9NH 1FO0B 1GGUA 1MFBH 2FH6A 2A2QT 3GJFH 4HLZH 5KSAD 5BV7H 5C09E 1NGQL 2DQDL 5DJAB 2R1WB 1E6OL 3L3HA 3X3FL 1JGDB 1TETL 2RCSL 3BXNB 1XIWC 2PR4L 4PJ5E 3MLSL 1CFTB 4G8EB 4JM2B 1WWCA 3TBSB 3GSNA 3DSFH 1N8ZB 3D0LA 4JFOA 3SO5A 2EH8H 4RISH 5DRXA 3VFRB 1A14H 43C9A 1JGVL 3MRGA 4WTZA 3TYFB 3UTTD 3VD5A 4FQLH 3ZYOA 2X42A 2A6DA 1QTYT 3QWOB 4JZOB 3QDGB 4MQ7A 5DRNA 1HH6A 3VWJB 2APBA 3U0TB 3EBAA 2FYYB 4R3SA 3IRZA 5EU4A 4ZXBA 1RIVL 5HI3D 4XP9H 5LXGL 5INDB 4UT6L 5DO2C 4LASL 4G42A 1G9MH 1K85A 2VO5A 1LK3H 3QHZL 3PJSB 4L4VB 1BQLH 2I27N 1XEDA 4PJBA 4RBPK 1HILA 2VDPH 4OF6A 1RD6A 4N9GA 3V4UH 1RFDL 2JJVA 5DEFA 4ONGH 5ICYB 5B39B 3ZYZA 5E94A 4NPYB 3QI9C 3MUGB 4HF5L 3V0WH 2NY0D 5K9KA 1RUKH 1IGJA 2J6EH 4X6EA 1YEGH 4TULH 4EDXA 1MIMH 3PL6C 4LLAA 5KANG 4WUUD 1P84J 2NX5A 5IMOA 4D0DB 1T0NB 1MRDH 3EDFA 5L88H 4RGNE 1HCFX 4J3TA 1I3GL 4ZAKA 3QWQB 1RZFL 4OZHA 4PJFB 1RZ8A 3WFZA 3GGWA 1YEFL 5HHOA 2ZZUT 4B5EA 1FORL 3ULUF 3O8XB 3VI4F 4K8RH 4U3HA 4GUPB 1T83C 2Y06L 2YS4A 4F9PC 3QH3B 4HX1B 1M4KA 5EOTA 3DVNA 1C8PA 5FV2A 3DV6B 3HZYA 5HSFA 3L3HB 5DMKB 3EYQD 1PAMA 4JFDA 3BWUC 3LHPL 5TDOB 4JKMA 3GMQA 3JWOC 4YDLC 4XPGL 1MFEH 5D7LD 4N0YL 1IKFL 1WAAA 3CZFA 4N8CL 4QRQA 5TQ2H 3D1MC 1E4XI 1FRGH 1Z3GH 2V7NA 5DD5L 3DWTA 3E8UL 4OZFA 1TJGL 2X9WA 1YEKL 4PJ7E 1EMTL 2IH1B 1EAPA 3MBEA 1RZKC 1QFHA 4NQVA 1ED3B 4NQXB 5EULV 1P4BH 4HHAB 3LMJH 1I8MA 4KMQA 1A9BA 1SEQH 2B0SH 2R1YB 5DRNB 5C7XL 4Y2DC 3RFZC 2ZSVB 3O2WH 2P4AB 4M7LL 4ZXBB 3VXQA 3QUYD 4DGYH 1XAUA 3SJVD 3DMMB 4Z7VA 2VDLH 2OYPA 2I60H 1NC4A 2NY5L 3GIZH 5DRWA 2ESVD 3CLEH 3LH2H 4LIQH 4JJHA 4LSVH 3DO7A 2W9EL 4NQSA 1JZ4A 2R0LH 3TN0B 2D7OA 1CL7L 2WUBH 3FOLB 1D9KC 4IDLA 5DEFB 3NGBC 5FGCB 1EHLL 4HV8B 2XQYG 4QWWC 5K9KB 3QNZB 2PYED 5IFAH 4DN3L 1IGJB 4MJ6B 4OLVH 4XXDB 1YEIL 4J6RH 2UWEE 5FYLL 2ICEA 1T89C 2EDJA 4X4XA 4ZAKB 3QDJA 3U7WL 3S36L 3GIVA 1ZLVH 4YC2C 2MWCA 1FG2A 4KTEH 5A1AA 1MCRA 1LNUA 2B4CH 2G9HB 1UVQB 1WEJL 2OMBA 4X7TB 3IXAA 1K4CB 5CIPB 1G9MC 3LEYH 5E8PA 3E6FB 5DMGC 1DQQA 4ZUTA 3FCTB 3QWRD 2AGJL 1LO5B 1S7TB 4R4FH 3P3YA 3GMQB 3FQTA 1KEGL 5J3HD 5DD3H 3ABZA 4DUVA 2VE6A 1A4KB 3BZFA 2A77L 3CZFB 3DETD 4MCZB 4ZD3H 5ADPL 2VN7A 3HAEB 2IFFL 4PTUB 4XVTL 1CDCA 4PJCA 3I02A 1YECL 2JIXA 1FO0L 1NFDA 2CLZA 3P73A 5GJSH 2NXYD 3WFCH 3GJFB 3G6DH 4H88H 4G8GA 1HHHA 1UFUA 5EZOH 5BV7B 4JFPB 4FNLL 1IGTA 1ACZA 2ZUYA 3MV7B 2R23B 2ZPKH 1DBAH 1Y18A 3O2VH 2NY1C 5J06A 1YMMB 5DRWB 2VZUA 4WUKL 4X8JA 5FCSH 5IP4A 3UEZA 2CR6A 4AT6B 2RAMA 4G6KL 4XCFH 3AM8A 4E5XB 4JKPH 3LEXB 4JQIL 3VG0H 4Y4KB 3SEPA 4K9EH 1E4XH 4LDOB 5M94B 3P0YL 4FQJL 1G6RH 1MHPH 3QIWA 5KSVA 3ZL4H 1B0RA 1DFBL 3S37L 3SE3C 4HWEH 1Q1JL 4QGTA 4MXVE 5HPMB 4NHCL 1G9NH 3W9DB 4FP8H 3GSQA 1FC1A 1QP1A 3MV9D 3QPQD 2VXSH 1GJIA 3PV6B 2FO1A 3GIVB 3VXMA 3BKJH 2VC2H 5L0QB 1WC7B 2BY3A 1NCCL 1V3MA 3T1WA 1MH5A 1NLBH 4AEIH 3B8SA 1CDJA 3KPOA 5EIIB 3RX8A 1RURH 4NQCA 4WO4D 2Z91B 3TBYA 1I9RH 5GSRB 1Q9LB 3EZJB 3FQTB 1AJ7H 3P30L 4CMMA 4IDJH 1BVZA 2ICWI 1G7IA 4PLNC 2PXYA 2DLFH 3MROA 5DWUL 3HE6B 4PBWD 5TE7L 5E08H 5EBMA 4ZSOE 3JSSA 4XVJH 5DK2B 1FFNA 4W4OC 1IE5A 5CINH 4KZEL 1EX0A 2PO6A 2AJUL 4JFYA 4LLWB 5HJ3A 2BNRE 1OPGL 4UTBL 4GW5A 3G6JE 4KH2A 4M6OH 4U7MA 4AIXA 1SJEB 2X1WL 2YZ1A 4PJHA 4OCSL 4TVSa 3SOBL 3D39E 3CU7A 5F7DA 2DD8L 3DO3A 1D5IL 4PJGB 1P7KA 3RVWD 5JIKA 4YAQA 4ZFFA 4JFEB 1CGSH 3T4AA 4OLZL 1FZOB 5J1AB 5E5MA 3DYPA 3SDAD 1OTSC 4PLJD 1UKTA 5D7IF 4FQ2H 1WVZA 3RNKB 3SCMA 3O6KH 3EDJA 4LHUA 4P2RE 2Z92B 5JQ6H 3WFDH 2UUDK 2HT2C 4GXUN 1JZ2A 5KANI 2PTVA 4W6YB 2DBLH 1QG3A 2A6JA 4M7ZB 4PGBA 3RQ3A 1IZJA 4NKMB 4LPUA 1Y0LA 3GBNL 3BESR 3S6CA 3RZCC 4P3WA 4P99A 2NW3A 1ZVYA 2IAND 3FFDB 3L5WA 5EB9A 3KPSD 1BFOB 4PJXB 4GG6E 4PPTA 1YPZF 4Q58C 2DBJA 2XY1A 4ORGA 2AEPH 3RGVA 4EXPX 5I30H 1A6UH 1QSEE 2BNQD 4Z7OF 1QBMH 3BO8A 4X4MA 1FN4A 4UILL 2MKLC 2EDNA 3IFLH 2LTQC 4JR9L 1MPAL 4ZTOL 4O2FB 3SE4C 5D6DA 4U4BA 4RGMC 3R8QA 3B5GA 4IOFC 3T8XA 1E28A 5BZWA 5C0IB 3TBYB 5I19H 1I1AC 1S9YB 2ADFH 1BD2A 5EN2A 4CMMB 2XRAL 3HPLA 4ODWA 5EBWA 2CLRA 1IL1A 1I7RB 1I85C 1DN0A 5GGSY 5GS1A 1VACA 3CSPA 3F58L 5CZVH 3TPUA 5ACZA 5EOCH 3DXAD 1RQ5A 5KTEL 5IROA 1CICA 3MOQA 4I77H 3ROLA 3HPJA 1A7BA 4OQ1A 3AFLA 1PVHA 4O51B 1RI8A 4PJHB 1Q94B 4N9OB 3V4PH 3JWOL 5I9QB 4KY1H 2OTUB 1NCWH 4JRYE 4M43H 2ARJQ 2JLLA 4HXAL 1I8LA 4A6YA 3O4LE 4M7KL 5E5MB 5CZXD 3QXUA 5CGMA 5TQ0H 3CX5J 3LSOB 5FA4A 2UZIH 2OTPA 3O3DA 1SY6A 1RZKL 2Q7NA 3SDDB 5C09D 3JV5A 2P5WA 1EEYA 3RVTD 3BT2H 5E6IB 2PF6A 4YR6A 1A3LH 1CFSA 2A9NL 3NPSB 1MFBL 4OLUH 1I7ZA 4PJ5D 5LWYH 5CP7A 1OP3K 4UNUA 1PZ5B 1CLYH 5BV7L 5IMLA 4NT6B 4GAJH 4JLRB 5DZNA 1KOAA 5H35B 1DANT 5TDNB 4HC1H 1U8PA 4HIIB 3IDNA 2P43B 5GRYA 2FECL 4ZOCA 1PX3A 5JDSA 4O2CB 1EFXA 4JM4H 1BJMA 3E3QE 3DSFL 1CTOA 1RVFH 1URLA 2EH8L 2V9TA 4RISL 3LQAH 1A14L 5BCAA 1JV5B 2RJMA 1MWAH 1X3DA 4FQLL 1X4XA 1E28B 5CS7A 5BZWB 4BH8A 2X7LA 3GRWH 1JPSH 1KELH 3BYYA 2H3NB 4JRXB 5EN2B 3GKZA 3QFDA 3UTZA 3T65B 4HSQA 3W2DH 2IPUK 5EBWB 4XPHH 1IL1B 3FHQA 4NKDB 3EFDH 1P9MA 2FO4B 3NA4A 5ERWA 4XP9L 4HPYH 1DTUA 3WJLC 4EQ3A 4R8WH 2P5EB 2DL2A 3NA9H 1G9ML 3HPJB 5M7QA 5HDBF 2ID5A 3M1BB 1LK3L 2NY2C 5I18H 5E2UH 1BQLL 3BN9D 3EJJX 3U6RA 3BQUD 2YUWA 1RZGA 2VDPL 3P4OB 3V4UL 3IFOA 5EPMB 3MLUH 3OJVC 1I1RA 2IMNA 4RGND 4ONGL 2EDTA 1XCQA 1V5JA 2WINA 1CLZH 1CXIA 2MHAA 4S1DD 3V0WL 5GRVL 5C0EA 1P4IH 5E2WH 4NC2B 5T5NG 1RUKL 3WCYA 1F4HA 2EXYC 1T66C 2J6EL 2AV7A 2OJZH 1YEGL 1JVKA 4TULL 1MIML 4Z9KB 5HYQA 2IALB 5FA4B 4JZNB 1U92B 1MRDL 3N1MC 5IWLC 3NCBB 5L88L 5HI4D 1H0DA 3THMH 2CRZA 3BPLB 5E00A 5C0AE 4CVZB 3ARDC 4K8RL 1RJLA 5F72S 3KS0H 4WWKC 3OAZK 2VLLB 2EDQA 3ILPA 1D7FA 2E8ZA 1UQSB 4MA1C 1LO2H 5ICZB 4P3DA 2PETA 5D5MF 1NAMH 1LHZA 1MOEA 3SDCD 3RL2A 1OP5K 1U8PB 3R06B 4X6DB 1MFEL 1JHLH 1BBJB 1BX2A 3KHQA 4J1UA 2WANA 1U58B 2XTJE 4U3CA 5TQ2L 1XF3B 5IVZB 1EGJH 1ZLSH 1SHMA 1FRGL 1J8HA 1Z3GL 4WW2C 2XN9A 3FTGB 1XGUB 3FO1A 5KS9B 4U6TA 4JQVA 4C4KT 4MS8C 3HC4H 3MXWH 5AD0A 4BH8B 1P4BL 4P5KA 3LMJL 1SEQL 2B0SL 3DYMA 4KRPC 5ESQB 3QXDB 1QKZH 4G9FA 2XWJA 1OVZA 3O2WL 3LEVH 3P9LB 1EO7A 4DGYL 2AW2A 3QPXH 4LVEA 4QRPE 3AXLB 1U3YA 1G9EA 2VDLL 2I60L 2NR6D 4GRLA 4TUJB 3GIZL 4NO3A 2APFA 3CLEL 2IPKA 4NZRH 3OX8B 2CPCA 3LH2L 5FO7A 4LIQL 3D3VA 4LSVL 1ZA6B 2YA1A 3U6RB 2R0LL 2X4NA 2Z8SA 1JWMB 4HGMA 2WUBL 2OI9B 5BOPA 3WD5H 2R4SH 4K3JH 4RFNC 4RMVA 3HS0B 5GS3A 5IFAL 2P8MA 1JPFB 3QZWG 2IAMB 4OLVL 4J6RL 5HYQB 4OZIF 1RUAH 2D3VA 4XZUA 3QCUH 2NY4C 3CH8A 2NY3C 5J6HA 3ALPA 2FLBT 1OTTD 1CDBA 5GS0C 1KJ2A 2VLKA 5HGAA 5SWSA 2WNGA 4OIIH 1T4KA 3MRPB 4KTEL 2FX9H 4PP1C 4U6YA 4KKAC 5BJTA 2B4CL 3MQIA 4GQ9H 4U05A 3LEYL 5E8DH 5IJKA 3CUPB 4L8BB 4P5TA 3ARQA 1CD1A 5FUOH 3U7YH 3PDOA 4F3FB 3C8KA 4R4FL 4PJDF 1AIFA 1WZ1H 4W6XB 4H1LA 3F65A 5FECB 4UI2A 5DD3L 4ZYKB 1Z2KA 1BX2B 3ZO0A 4R2GC 1UJ3A 4PGJA 4ZODA 4ZD3L 4DN4H 1M6OB 4Y16C 4JPKH 4R9HA 3JVGA 5CBAA 3S34H 4RWHA 1IM9D 4APQC 4PJBE 2X1PA 3FQRB 3PP4H 1F90H 3AS0A 3T0EA 2R15A 5GJSL 3WFCL 5ITBH 1D5BB 3G6DL 4H88L 2IJ0C 5EZOL 4G9FB 2ZPKL 1DBAL 4Z0XB 2LQRA 5F9OH 2GJZA 3O2VL 4O00A 4RAVA 2DM2A 4NRXA 1CGXA 3GNMH 2NX5E 4CDHA 3EAKA 4I0PC 4UOJA 1F6AB 4AIZB 4MNHB 4NQEB 4OZHE 5FO7B 1JK8A 3U4EB 4RMUA 3QAZB 4XCFL 5HHOE 2YSSB 1DBMH 3PXHA 2GJ6B 5DYOA 4ZQKB 2VR9A 4JKPL 3VG0L 1MWAB 4K9EL 5EOQH 4F15C 1E4XL 3GJEA 4IJ3C 3IDGA 4L1HA 3HI1A 2E8YA 1G6RL 1MHPL 3MRRA 3ZL4L 3HE7C 4H8WH 4HWEL 4JFDE 5F7FA 4AQOA 1G9NL 4CAGA 2CJUH 1VB9A 5IBLD 4FP8L 4K7PH 4JHAH 5K93A 3S3JA 2VXSL 4L9DA 1WAAE 5J6HB 4XNQB 3QUXD 3IRPX 2IF7A 3RX5A 3BKJL 2VC2L 3WUWB 4U6YB 4XPFH 3MTRA 3RWGA 1NBYA 2VLRD 1ZSDB 4XB7A 1S9WA 1NLBL 4Z78A 4AEIL 3NABH 4R7NA 3W0WE 2JK5A 4KPHH 1KXTB 5IB3A 1RURL 4PJ9D 1CD1B 4LEOA 2BSED 1I9RL 4QT5B 1AJ7L 2BNRD 4JG0H 4IDJL 2BNUA 3QIUB 5DJ6A 2XG5A 4XB8A 2OP4H 4Z7VE 1OB1B 1QLRB 2O26U 2DLFL 3BWAB 3D39D 3GMNB 5E08L 4PREA 2BOBB 4XVJL 1AGDA 5CINL 4PJIA 4NOBA 3LKSA 1EUTA 1I3UA 3T0VA 4KRNA 3DUSB 4M6OL 4WW2F 4GW4B 5D9SB 3PF2A 1Z5LA 4P2RD 3QIBD 3BPNB 3NCYP 1YC7A 5D7SH 1VENA 2GTWA 2Y7QA 3QCTH 1CGSL 1NGXB 5IHZB 4L8SC 4LHQB 4LHJB 1D5MA 3O81A 4FQ2L 2YEZB 4XVUC 5H2BA 4JE4B 1C08B 1KCKA 3O6KL 4YDJB 5GQBA 3ZT7A 3QDJE 3WFDL 5JQ6L 1XT5A 3GMOB 4JAMA 3QDMD 2DBLL 5AG9A 4PD4K 5JOPD 2AJZA 4DZBA 1CVRA 4GS7C 3JTTB 1PJ9A 5DT1H 5DD0H 2P44B 5AWNH 1QSED 1HYRC 5D1ZC 4MHHG 4OAWB 3VMPA 4KQ3H 4AL8H 2DQFA 4TSAH 2HT3D 1SQ2N 1J05B 5D1QC 1T5XA 4G6AD 3S36X 4XCYB 2AEPL 1VHPA 5I30L 1LEGB 1A6UL 1TNMA 5IESH 1QBML 4UTAH 3C5SB 5E24E 1F8TH 3I6KB 4PJCE 3IFLL 3GMMB 3RU8H 2CIKA 3RWGB 1CIDA 1NBYB 1DLHA 2DQCH 4GO6B 1T1YA 1NFDE 2P46B 1HSBB 5D1XC 4M7LT 3AB0C 4V2CB 3FQUB 2IBBA 4G8GE 4PY8J 1JWUB 4KGLA 3O9WB 5I19L 3LN4A 2ADFL 5B38G 5JPNB 1AQDB 4DVBA 4WI6A 3C5ZD 1QSFB 2FCBA 5T3ZE 5T1MA 4HKJA 5HD8D 5CMAA 5CZVL 5GIRB 1IGYB 4JRYD 5EOCL 4HJGA 5JW4R 5KG9A 4I77L 4MSWB 1SMAA 2NZ9C 3IS1X 2EKJA 3GMPB 3O4LD 4MB5A 3Q5TA 2ICES 3AS1A 1NCBH 1NDGA 2NY6C 3OF6A 3PV7A 4KUCF 1KPUB 4X4YB 3V4PL 1W72B 4RRPG 4KY1L 1NCWL 4ODVH 2Y9RT 4Y4HD 1A7PH 1CE6A 2IBZX 5ELIA 2QQLH 4NJ9H 4M43L 1OQXA 3Q6FA 3QT2A 4NN5C 2YK1H 4RCAA 5C08E 2ILLA 2W65A 5TQ0L 4IOIA 4P2OC 4OLYH 3CSBA 2UZIL 5HHMD 3PWNB 1GGBH 1XZ0A 4KZDH 3QG6B 3HHRB 2ICWJ 3VXME 1WIPA 3BT2L 2VWEC 4KC3B 1U3ZA 4KDTA 1A3LL 4GMTH 2AQ3A 4OLUL 5LWYL 5MI0C 1QVOB 3L3DB 1R5WB 5TDPB 1KV3A 1CLYL 1DVFD 1FNHA 4NQCE 3MXVH 4RQQB 4Q9QH 2VLME 3QUZD 2X9YA 4PP2B 4GAJL 5TH2B 3AROA 4XNYH 3HZMA 1BHGA 2LABA 2C3XA 3BX7C 4YO0A 3OKLB 4HC1L 4L9LA 4JKWA 3EFFB 1LGVA 4NJAH 4KJYA 1YEJH 3NN8B 5DJZA 4Z7WE 1H3GA 3C60A 1FAKT 2H6PB 4JM4L 5FYKH 3V95A 4O58H 3RPIB 2X1QA 4HS8H 3TESA 5J9PA 1RVFL 1DLHB 1UZ8A 3LQAL 4NO0D 3B9KA 1MWAL 4GBXD 3OKKB 5CLWA 1NMCB 2YBRB 4PV8A 3GRWL 5CD5D 1LE5B 3SY0A 1JPSL 1KELL 3TBWA 4DVBB 4P23C 3W2DL 4XPHL 2HLFC 1G7MB 3QHTC 3VFOB 1MLCA 1OAQH 3JWDH 3EFDL 3MOAH 3AREB 5CMAB 3OKEA 4HPYL 3CXHJ 4R8WL 3NA9L 3O3AA 4PRPE 4KRMB 2DQHH 5I18L 2XPGA 5E2UL 5C0DA 3DJ9A 3RWCB 4C57C 3MLUL 2RIKA 5FHBH 5C0ND 3F12A 1CE6B 5IJVB 1CLZL 1T7WA 2X89A 2GAZB 2AKRA 1P4IL 5E2WL 5D96B 5D70H 2EIZB 1S7WB 4IOIB 2OJZL 2H2SC 4QTHA 4JQXA 1TJIH 1OTUC 3EOAB 3NFNA 2YPKA 4XTRC 5E8NA 1P84K 4X4ME 5DQ9A 3THML 4UQ3B 1JP5A 3MGTA 1UH2A 2GITA 5C0BB 4EUPH 4K23H 1CFNA 4IRSD 2C3GA 3Q0HA 1CXLA 3OJMB 2IH3B 2XTJD 1S8DB 1ZVSB 1AP2B 1LO2L 4JFQA 2KZ1B 2EDOA 1NAML 4HUUA 1BD2E 1KT2B 2VABB 1FNEB 3PGDA 3VXTA 1MHHB 4LK4A 1RZJC 1JHLL 4KJYB 3LPWA 1XIWA 2P42B 1RZ7H 4KK6D 1JTPA 3RWFA 5IBUG 1JZ8A 1VEMA 2Z9TA 3C60B 1EGJL 1ZLSL 1XH3B 1JN6B 2D4FA 3WHE0 4IMLA 1ZT1A 5DVKA 3AMKA 3BEWA 1VADA 1N5YH 5L8KB 3HC4L 2VISB 3MXWL 2B39A 1J1OH 1VSCA 4KI5E 4X7DC 4KXZI 4K3DH 1J88A 4G5ZH 4MGXA 3OXSA 1QKZL 4FFVD 1F45A 4MQXD 2HFFB 4D0BB 3LEVL 3QPXL 4S2SB 5BXFA 2LVCA 3OKEB 3W9EA 1BWMA 3Q3GB 4F7TB 3OAYH 5EU6A 4TQEH 3MA7A 2ATKB 3QHFH 3O3AB 2GHWB 4NZRL 2P5WE 5I16A 3OHXB 1LK2B 2XPGB 3LAFA 3TO4B 1D6VH 1G7HA 1MHEB 1N2RA 3K74B 1KJ3H 3WD5L 2XFXA 5FK9B 3L5HA 2R4SL 4K3JL 1OGTB 3K80A 5JUEH 1ZEAH 1FE8H 1OWRM 3VD7A 3QI9A 3TVMC 4X6CF 4OLEA 2G5BA 3FO2A 5MERB 2QJDA 1KFAH 1A1NB 3DX7A 3KYMA 4P48A 1RUAL 3PL6A 4MHHI 1KJMA 1X4ZA 2E7MA 3QCUL 5I76B 1XGRA 3CC5B 3SN6N 4M3JA 4P4KC 2FHCA 5F3BB 5BW7C 3QCVH 5EO1A 2ITDB 4OIIL 3BKMH 4X80H 5KAQG 2CDFB 2FX9L 2GK0A 3WO4C 4QOKE 3TCLB 1CFNB 4GQ9L 1H5BB 2DQJH 4ZXBD 1T83A 3CSGA 1NQBA 4F9PA 5E8DL 4NYLB 5FUOL 1KTLA 3BDBA 3RVUC 3U7YL 1NMAH 4EI5C 4M3KB 1WZ1L 3VXTB 1J18A 1JHTB 1S7QB 4UUJA 4DN4L 4LPWA 1CK0H 4X9HA 5KSBB 4JPKL 3MRQA 1GZPA 1EEUA 1AKJB 1FZMA 1OAYH 4HFWA 3S34L 4ZPVA 1G7PA 1JUFA 1UM5H 1HXYA 3QEHB 3PP4L 1F90L 2DYPB 2NX5D 5I0ZA 3U36B 5ITBL 3BIBX 4ZAKD 4PJ8B 5K59F 4BKLB 3OXSB 1PKQB 4Y2DA 5HHOD 5D7IA 1A6TA 5E8OB 3GKWH 1M05A 2CIIA 5F9OL 2KQNA 3LKRB 3MLTB 1D5XA 3JXAA 3REVB 3GNML 4L3EA 1AGCB 1U8IB 4JDZA 1ZHLA 3EO1B 5I0DA 3RWIA 2BSSB 1Q9KB 4LCCC 1M7XA 4XI5D 1ZWIB 4EVNA 2HJKA 1XGQB 4JFDD 1P1ZA 4KKNA 1DBML 2ZCLH 3GSOA 2BCKB 1D9KA 1K2DB 4NRZB 4MAUH 3WL9B 5J1TC 5EOQL 5E1AB 2HWZH 4ZFZA 2HMIC 2EDDA 1R3LB 3FO2B 3KJ6H 1YPZA 1A47A 4H8WL 4M48H 2IPTH 2CJUL 32C2A 3MBED 4K7PL 4JHAL 4ZOAA 4KXZH 1T89A 5DLMH 3VFPB 2Y5TA 3TBTA 3FO0H 2EDKA 5EU5B 3AU1B 4M4PA 1J8HE 3PWJB 4XPFL 2OZ4A 2XN9E 5IG7B 4FG6D 3O4OC 3NABL 5JNYA 1INEH 3WHE1 4KPHL 1MCHA 1U8QA 4UOW0 1NC4D 4U6HA 2P45B 3ZE2E 4M93B 1RMFH 4JG0L 5HI5D 1HZHH 1UB6A 4BZYA 1UGNA 2OP4L 4W68A 1X6LA 1EZVY 1A5FH 4Y0GA 5HHQA 1X5XA 3K1KC 3ZKXB 4F8QA 2J6EA 5FO8B 3D3VE 4ZPVB 1JJUA 3G6AB 1G7PB 1FL6A 1JUFB 4PRIB 4EUPB 4FFWD 2QADD 4NKIH 4UU9B 2GY5A 2GT9A 3BGAA 3WKMH 2ZWLT 3QDJD 2IADA 5C3TA 5EH1A 5D7SL 1MAKA 4I5BB 3QULA 5ISZB 3E6HB 4U1HA 1X5YA 3QCTL 3QXWA 4M8QA 4NNYB 4KMLB 5IQ9A 4KROD 3HUJF 1D5XB 2ERJB 3VMNA 4DTGH 1JNNH 2DKMA 3L6FA 4NRYA 1REIA 5AUMB 3QFJE 5IK3B 3RIFF 2XKSA 5I1DA 2H9GB 2VLKE 3MO1A 4P2QB 5GGUA 3IDUA 3MLRH 3VXRB 2MCPH 2VZVA 4LSPH 3C6LC 1UM4H 5CSZB 5DT1L 1ZGLA 5DD0L 4GKZB 4UQ2B 5AWNL 2Q86B 2QSVA 4NFDA 4KQ3L 4AL8L 2JIXD 3SE3A 4TSAL 1R24B 3QXAA 32C2B 4P46C 3WSQH 3FQNA 5T5NF 1HN1A 3FFCB 3VXOA 3SO3C 5HVGB 3M17B 1L7TH 4G8GD 5IESL 1TMCB 4UTAL 1LILA 3RDTC 4R90H 4LKCA 5JZ7C 1F8TL 4MAYB 3RU8L 4MX7A 3TA3C 1S7UA 1FG9C 1NL0H 2HG5A 4FXGA 2GKIA 2C4FU 3B9VA 4JO3H 2DQCL 1ZLUH 5T3ZD 2YD3A 1BZQK 4XH2A 4RMSA 5C0CB 3T0EE 4XCNA 1VGKB 5ENWA 3UYRH 4U6HB 3ZDZE 1PZUB 1FJ1A 1QFUH 1P7HL 1X5KA 2Z35A 3O2DH 4I1NB 1UCBH 1ZGLM 1F4AA 5IB2A 3JTSB 1LO0H 2AK1H 1UB6B 2QR0B 4BSWA 3VFSB 2EDBA 2F74B 4KQ4H 3MV8B 1H3VA 4XX1G 5DFVC 2UVEA 3IGAB 4WW1A 3VW3H 1ZT7A 4CVXA 5DD1H 1FCGA 5JOEA 3DGGB 2BMKA 4W4OA 3F7VB 3OB0K 3QIWD 3C08H 3U1SH 3VA2C 5T1LB 4HIJA 1NCBL 2VAAB 1G7QA 3BISA 2GT9B 1E27B 1IFHH 3CFEB 2IADB 4LMQI 4ODVL 1Q9OA 2ZUQB 1A7PL 3QULB 3VXMD 1KPRB 2QQLL 4NJ9L 5JW4N 1ZLWK 3VH8B 1JTTA 2KPNA 3L7EB 4M8QB 2YK1L 5IQ9B 1NCTA 3HRPA 3W82A 4PRDA 3L6FB 1UADC 4NRYB 4OLYL 3H9HB 1GGBL 3CX5K 3VWKB 4KZDL 4NQCD 1S7VA 2DM3A 4B7IA 5IHBA 5I1DB 5F7MC 1VPOH 3NIFF 3MNVA 2AV1B 4RIRB 4I9WE 2AJ3A 3STLB 2VXUH 1UM6H 2R2EB 2XZQH 3ECBA 3ALXA 4GMTL 1GOGA 3GJFK 2PXYD 5LAXB 5D5MA 4PJEF 3RZCA 1I1YB 3QA3A 4F33B 1QFWM 3MXVL 4Q9QL 1RV6X 1S9VB 3BH9B 4XNYL 5JOFB 2JJWA 4PRNB 1WT5C 4JY4B 3WFBH 2PO6D 2VH5H 3CCHB 5FEBA 1UKQA 2R56H 2M8XA 2AXFA 4NJAL 1T2QH 1YEJL 1YDPB 1LP9E 5L2KA 4YBLC 4G7VH 4X99A 3I6GA 5FYKL 4O58L 4HS8L 2DJSA 3Q2CA 4PJIE 3U0PB 5JW5B 2E9WA 2LAGB 3G5VB 4OV6F 3SE4A 3S4SA 3SCMD 3VFVA 4HS3B 4LHUD 1MVUA 1I1AA 1QEWA 1JWSB 4WGVB 4C56B 5IB2B 5KVDH 1FVEA 4BQ9A 1ZHKB 4ODHH 4BSWB 2X4PB 1HHJA 4Z5RB 3U2SA 1HHIB 1OAQL 3JWDL 3QEQA 3MOAL 3OG4B 1I85A 5HDOA 1ZT7B 2C3VA 4KMTH 3IJSB 2VLJA 2BMKB 4KTYA 2DQHL 2OR8A 3QO0A 5E03A 5HHVH 1M71A 5E8EA 2EEBA 1L0QA 4LF3A 1I9EA 1FGNH 3RGVD 5FHBL 5GRVK 2OXHA 4D0CA 4OZIA 1DEEB 1MCDA 1H3XA 4YZFE 5E5RB 4PJAB 5D70L 3S7GA 2VKWA 3F7YB 3K81A 5FB8B 1XR8A 1TJIL 1WCQA 1S7VB 5FO9B 1TITA 5F70A 2HTLD 2WW8A 3SGJC 1J0IA 4I3GA 1BD2D 2QQKH 4K23L 1P6AB 5LJYH 1PLGH 1ZT4A 4KK8D 2I9TB 1U41A 3A6BH 4ZS7H 3I50H 3QBTB 2O93L 1MHCB 4PJDA 3WFEH 2X6MA 5I71B 3ELAT 1CICD 3ZYJA 1VKXB 2ZJSH 1KLUA 3DX9A 3I6LE 5IW1A 3FB7A 1CXFA 5FYJU 2AXFB 1OOAA 1U8OA 2VIRB 3C8HA 3G6JF 2V2TB 1CWVA 1RZ7L 3P0VH 4TNWK 4ELMB 4KI5D 1SM3H 4X99B 3S9DB 3FRUB 1A4JB 4YHIB 1CBVH 4PS4H 5IB1A 1C16A 4YGVB 2R9HD 4LCWA 3AS2A 2L7JA 1S5HA 1N5YL 3ARBC 1F11A 1J1OL 1UWEH 1B0GA 5I6XB 4K3DL 4B0MM 3QJHB 2P5WD 3K46A 4G5ZL 1RUPH 3JWNC 4KFZC 4H0HB 2JCCF 3O3BA 1VERA 3QEUB 4QXGH 5FGBC 3OJDA 1CG9A 2C3VB 4E42A 4HXBH 4R0LB 4U1IA 4TQEL 3WJLA 3JV4A 4NQDE 3QHFL 1IBGH 1UENA 2ADJB 2GTZA 3VI4E 1S78C 4DFIA 1A02N 4U7SA 1NC2B 5DMJB 3UCRA 2R2BB 3W39B 1D6VL 4POUB 1T20B 3OQ3B 4M5YH 4P9HC 2VL5B 2XIDA 4LKXA 3ZKNC 4LF3B 4QYOB 1KJ3L 3L9RB 4EI6A 2HFGH 5JUEL 1ZEAL 4G6MH 5AZ2H 1FE8L 2J8UF 1EFXD 4I2XB 5ICXB 3OGOE 2HTKC 1KFAL 1YN7B 2E9BA 3OGCA 2VJXA 4DKAA 4URTB 1JRHI 4XCEA 5C07A 4EZMA 2NPLX 4Y19A 1DN2A 4NCC2 1WITA 3PHQB 4G43B 5E95B 5IWLA 3D85A 4G6FD 1VFOA 3HB3D 4TTGA 1ZLVK 4EIGB 1U8NB 2FJHB 3QCVL 4KAQH 1W0VA 4MWFA 3BKML 4X80L 4C83A 3MRBA 1PY4A 3O6FC 3IXTA 4ZS6C 5EU3B 2PN5A 3ARDA 1MCIA 4GKNB 3UTQA 3S97C 3FN0H 1ZT4B 2DQJL 2QHRH 4V1DA 4WWKA 2WBWB 4LGPB 1PEWA 3T3PF 4BQBA 5FF6B 3DURB 4KHXH 3DX6B 1NMAL 2MJWA 5IW6B 3WJJC 1NBQA 5IW1B 2ADIB 1AHWB 4OF7A 1U8OB 4H26A 1X5GA 3L1OH 4UDTB 1BQHB 5HYSB 1CK0L 2KUTA 2DTSA 5F1OB 3NBNA 4WW2A 1OAYL 3UPAA 1S5HB 2FD6H 2K7QA 1UM5L 4LLYA 3H3BC 3FAXA 3UTSB 1MEXH 5EC2B 1QRNA 2ICWA 5F7HA 3DSNA 2WQ8A 3OL2A 2R8SH 1U6AH 3GKWL 3BVNA 1L0YA 1MJJA 2L4OA 2D7PA 4PRBB 2HVKA 4N0CD 4U1IB 1R5VA 5MEOB 5HYJB 2P1YA 5C1MB 1TTGA 1XF5A 2NY2B 1MJ7H 4HC1A 4Q74A 3W5MA 1KG0A 4JCLA 1JNHB 2AJVH 2ZCLL 3EDKA 2V5YA 4LBEA 5KSAB 3FQXA 4MAUL 3TM6A 3DV4A 4DAGH 2R2HB 1KN4H 1T21A 2HWZL 4NUJA 2EYTB 3N50A 1D6EA 2QQQA 3KJ6L 4Y5XC 1J8HD 3HZKB 4M48L 4NNPH 2XN9D 5GGRY 5AAMA 3VRIA 1ZKAA 2IPTL 4K3HA 4G3YH 1BQSA 3GRWA 3ZDYF 5DLML 7FABH 4F37K 5L8LB 3FO0L 2B5IB 3HG1A 4ENED 4G9FD 3IXTB 3FQWA 1JPST 4J23A 3TO2A 4V1DB 3HR5A 3NIGF 4WWKB 1INEL 1NSNH 1KSRA 2VITA 4GRLD 3S5LB 4U1KB 4L3CA 4U1GC 1IJ9A 2D7QA 1WTLA 5FDWB 3DNKA 3BH8B 3D3VD 2AEWA 4Q6IB 3I9GH 1NCAH 3MACH 4MCYB 1RMFL 2DQIH 3KLHC 1HZHL 2BY2A 4LNRA 3F7QA 1A3RH 3DRQB 4JN1H 1LDSA 3IAPA 4S0SD 2W38A 3K4ZA 1A5FL 4U31A 5EU6E 5FKPB 3LD8B 4ONHA 3CH1A 4Y16A 4A2LA 3IF1B 4N1HB 5B8CB 1NGZB 1JRHH 4AM0A 3PWPA 4APQA 4NKIL 4Y1AA 4YE4H 3IS0X 5DJYB 2F53E 2NY0B 3WKML 3QJFA 3VXSA 3EO9H 2VLKD 5SWSD 4OCNC 4WUUB 5DUPH 3N1PC 4KDVA 2R29H 5J12B 4DTGL 1SMOA 4DQOH 1N64H 4ODXB 1JNNL 3VFWB 2EDWA 4I0PA 3CFKA 4LLVA 3ZHKA 4P5TD 3RVVC 4OFVA 4GG8A 5CKAA 1KIPB 1R6VA 1KG0B 5JQHC 2B1AH 3MLRL 2AXGB 4X5XA 4XMPH 4LVHC 2MCPL 2NXZD 4KKCC 4LBEB 3ME0A 1MSPA 3O11B 2JKXA 4LSPL 1UM4L 4MVBD 4HKBB 1J86A 3KLSA 5CEYA 2V2WB 3U9UA 4OCWH 1TNNA 3GMLA 3HE7A 4HCRH 5D7LB 3IFPA 2OJEB 1MRCH 2H32H 3LKQB 5MHSE 3WSQL 3T0ED 4U3XA 2EXWC 3L3JB 3QP3A 4NN7B 2CRYA 4X8XA 1L7TL 3LOWA 4R90L 4DZ8B 3VE0A 2BC4A 1CQYA 3TO2B 1NL0L 4JO3L 3BP7B 4OFKA 1T1ZB 3KG5A 1DQJB 1O0VA 4F8TA 3UYRL 1T7ZA 4X98B 5F7EH 1HOCB 3BPCA 5HHNA 1QFUL 1WQVT 2B1HH 4PY7A 3VFNA 1QSZA 3O2DL 3QUYB 1UCBL 3B83A 5D7IE 2GCYA 1LO0L 1X7QA 4AEEA 4N8VB 2AK1L 2X4TB 4LNRB 3OAZH 4KQ4L 4OD2B 3WIHH 1FLRH 4L3EE 2CLVA 3VW3L 1JZ5A 5F6HI 5KSUA 5DD1L 3T1FA 1TVBB 4QHNA 3MOBH 4YBQD 3BDYH 3T2NH 4E0RA 2WUCH 3U1SL 3C08L 3FRPG 3RWJB 3BZ4B 2LVEA 5A16A 4CL7A 2XA3A 4MDIA 1QLEH 4MB4A 4Y1AB 1IFHL 3NZ8B 1LMKA 2PYEB 2VDOH 3T77A 3VXSB 1JNJA 1I7UA 3B6SA 3IB4A 3N1QC 4I9WD 2XWBA 2YUVA 1KB5A 1YPZE 2OR9H 3BMWA 4L8SA 4OLWH 1PSKH 5D93C 5EO0A 3ZTJG 1RZIA 3REWB 1EAJA 3K4AA 4Z7OE 5BVJB 5GSVA 4K71B 4JZJB 5IR1A 3IKCB 3L5XH 3V52H 2D7MA 4GG8B 1VPOL 4BQCA 4ERSH 5EO9B 2VXUL 1UM6L 2XZQL 3BE1H 4R4BA 5DI8B 4Z7UF 4Y5VC 3U9UB 5CHNB 5JDJA 3KPMB 5D1ZA 3GMLB 1HI6A 4K7PX 3IFPB 3DX8A 3WFBL 3EYOA 2VH5L 4GH7B 5D1QA 4JDVA 3RWHB 3RNQB 2R56L 4IM8A 1T2QL 2IQAA 4OZGB 2DWEA 4HGKC 4Z7QE 4ZDHB 2RFXB 4G7VL 1FL5A 5BQ7A 5EORH 3OKMB 5GS2D 1A22B 3CD4A 2NXYB 1UJTA 5JORA 4F57H 5D1XA 5KAQF 1GRWA 4HWBH 2G5RA 4P2CG 4QCIA 4PY7B 5ANMA 5DURD 3KYKH 2UV3A 3AAZB 4ODHL 1HKLH 5IKCB 1K3IA 4K3EH 1EHXA 3QQ9D 4FA8A 1T22B 5BVPH 4KMTL 1ZANH 3CXHK 4JN2A 5CGYD 2NZIA 2X4RA 2YPVH 5HHVL 4H0IA 4CW1A 1CYGA 4X6CA 1CF8H 3MJ8A 1FGNL 5F7UA 2W60A 1SYSA 5AZEH 1WAAF 3KJ4B 4H5SA 1KB5B 5CJXC 3MV9B 4Q9CA 1OD7A 3ILQD 3HMWH 5DHVH 4P2OA 1LD9A 4NC1C 2D0FA 5HGHA 3OR6A 5IEHB 2GQHA 3S88H 3MRDA 4Z77A 5DQJA 5IIEB 5MENA 2QQKL 3I6LD 4HFUH 1PLGL 5ESVA 5LGKA 3F7PC 3MRCA 1UXWA 3A6BL 4ZS7L 3I50L 4WO4B 4LIQE 1XGTB 4YHPA 3WFEL 1HI6B 3MUJA 2ZOKB 2ZJSL 4JDVB 4OBRA 3LKOA 3OF6D 4ODSH 2O61A 2DI8A 5HDBE 3P0VL 3VXNB 1DCLA 4D8PB 4GKSB 2FHFA 1SM3L 3KPNA 5JPMB 1QBAA 5F89B 4FTVA 1M7IB 5BQ7B 1CBVL 4PS4L 3RUGB 4P59H 4EBQH 3UJJH 4RFOH 1N7MH 5DRZA 4AY0A 5D1XB 5DJDB 4E41A 1RJYA 1UWEL 3FO9A 1KACB 3ULUD 3GUTA 1A9EA 1RUPL 2O5YH 1CGWA 2FBJH 2ZSWB 4P23A 5F88B 3SDAB 2ED7A 5I1AA 5HVHB 3WE6B 4QNPF 2H32B 5A2KH 4N5EC 4QXGL 4HXBL 4I4WA 1KCUH 5CGTA 4DCQA 3WBDA 4PBVC 3ZT6A 2X41A 4JN2B 1IBGL 4WEMB 3WLWC 5D2NB 3TNMA 3O3EA 2FEDC 5HYEA 3UZQA 1KNOA 2DTMH 4CW1B 2YUXA 1MCFA 4M5YL 4HK0A 4X6CB 3MJ8B 2IANB 3OXRB 5D5ME 2HFGL 5SWQB 4G6ML 5AZ2L 3TNNA 1QQDA 2W91A 3KPSB 3C60D 4H5SB 3BOVA 1EXUA 2BHZA 1KGCD 3B9KD 2YD6A 3OR6B 1YNTA 1ULVA 4JGJA 5L2KE 4G8IB 3EJYD 4KAQL 5BMFH 4OFDA 3ARFC 5B39G 4X83A 3WIFA 1HSAB 5CJ5A 3FN0L 1ROWA 2QHRL 2YD1A 4YHPB 3S8WA 5EA0H 3UO1H 2N7AA 4NSKA 4ZNCD 2WLYA 1QHPA 1RJZA 3D0VA 4KHXL 4OGAC 1ES0A 4GOSA 1A0QH 3C6SA 4KVNH 4U1JB 4MMZC 3QEQE 2W0LA 4WI8A 3DXAB 3L1OL 4WGWB 1XGPB 2APXA 2VLJE 3FT2A 2X89D 3H42H 2F5AH 2XT1B 2FD6L 1HWGB 5C6TH 4OCLC 3SDYH 3QQ3B 5HPOA 2VDMH 3AVEA 4F2MA 5EBGA 5IEKA 4Q7DA 1MEXL 4BFBD 3GUTB 1MCOH 1BVLA 3NH7H 3HUJA 3WMSA 4GRWF 2R8SL 4OZIE 1U6AL 3TF7C 1KIQB 2P48B 5L8JB 5C09B 1I4FA 3SQBA 5DJXA 5B22A 3PQYE 2Z4QA 1NAKH 3CFJA 3FT3B 1MJ7L 3O3EB 3LDBC 3UBXB 4GQPH 5I8CA 3STZA 4FRWA 5BO1H 1HYSC 1CGYA 1T3FA 4PJ5B 2P24B 2AJVL 4CJ1A 4NM8H 4BUHA 1XIWD 3NCEB 2E5EA 4DAGL 1KN4L 4PJDE 1IC5H 3DBXA 3V7AE 3V8CA 4Z7WF 3P4LA 3GM0A 2R0WH 1XGYH 3TVMA 4WDIA 4GMSH 4X6BA 5CEZE 1V05A 4YXLH 2YA0A 5E2JA 4NNPL 1EXUB 3N0PB 2Q6WB 3DIFB 2J1KA 4G3YL 3SKMA 5J6GA 2M26A 7FABL 1YJDH 3QEGH 2FL5B 2WM0A 4BSVB 4P4KA 4HIHA 2H2PC 1J8KA 5BW7A 4AENA 2HN7A 4DUXA 3QUKA 4XGZA 4X5WB 12E8H 5F96H 4LCWE 1DQTA 5ESAB 1T0MA 2VZOA 5T1DH 1NSNL 4M1GH 3MCG1 4Y5YC 1R3JA 1AGEA 1P2CB 4WU7B 5DO2D 5EU6D 1JPGA 3SGDI 3C5JB 4HD9A 4I13B 3HRZB 3TPKA 1HH9B 2ZG1A 4NO2A 4CADA 4EI5A 1QA9A 3C6SB 1NCAL 3I9GL 3MACL 2UYLA 3HC0A 1V7MH 2DQIL 3WS6C 1MJ8H 1ORSA 3V0VA 1FL3A 1CDYA 2E6JA 2HJLA 3VFMA 3AY4C 1A3RL 4EQ2A 4JN1L 4UDUA 2AI0H 5DTFA 4D9RE 5GZNC 3WNNA 5JHDA 2D31A 3QI9D 3BQUB 5SWZE 1JF1B 4NBXB 3LN9A 5HVFB 1JRHL 3ZHLA 4MQSB 4RGNB 5GZOC 2XG4A 3PL6D 4YE4L 3EJZC 4WU5A 5ADOH 3BIKA 3TT1H 3EO9L 4H25B 4HBCH 3GK8H 4JFZH 4HULB 5DUPL 4K7FB 4EN3C 2R29L 1UC6A 4NN6B 4DQOL 1N64L 5C07E 3HR6A 2ADGB 3PUCA 6CGTA 4Y19E 2R4RH 3IU3A 1OGAA 3VMOA 3MYZA 4RWYH 2VXQH 1A6ZB 3O6MH 5EIVA 4HT1H 4LCCA 4XBGA 5I8CB 2B1AL 4XMPL 4PJEA 1O7SA 4N0FA 3TIEA 2IBGA 1OF2A 2FWOA 1EVUA 2BXYA 4CMHC 3SDCB 4OCWL 5C8JA 4FXLA 4PJ7B 4GRMB 4HCRL 4JGMA 5F9JA 3QZWA 2OL3H 1MRCL 4X5LA 1HHKA 1PEZA 3D2UA 3BP5A 5EZIH 2X44D 3RL1A 3WEXB 2XI9A 5D6CA 5C6WH 3VI3F 4KJPC 5CP3H 5IFJA 4Y2DD 1Q0YH 4N5UA 5JIHA 3NOIA 1KB9K 2OS7A 1Y6KR 5H37G 3ZTJH 4L3ED 1AGEB 5DJ8B 4EBQL 1WBYA 4N0RA 5HDQH 5F7EL 1QRNE 3CSYB 2B7DT 3E2HB 3GSXA 2B1HL 1U3HC 1MCBA 4YHMH 5DEGB 4CADB 1IAMA 1QA9B 2UYLB 3V0VB 4HAGA 2E7BA 2CR3A 3QNYB 1D9KD 3WIHL 1FLRL 3B9DA 2CK2A 2EO1A 4LLDA 1MAJA 4QWWD 3MOBL 3BDYL 3T2NL 2H41A 3K2MC 2WUCL 1WFUA 3HI6H 2W9DH 3MBXH 2UWEB 4I48B 4NFCA 5FM5O 4FFZH 1YJDC 4KGJA 3IDMB 3RY6C 5JW4Q 1QLEL 2ZP0T 3KPRE 3DTXA 2PTTA 2VDOL 3MRNB 5FKAA 3J8F7 5ETUA 1DDHA 3U4AA 4BH7A 2OR9L 4OLWL 1PSKL 4R6UA 3CDFA 4NOFA 4LFHD 1LEKA 3V6ZB 2G75A 3BD3A 3TBVA 2Z8VC 3SGDH 2BVQA 5AG8A <