4H8WH

Crystal structure of non-neutralizing and adcc-potent antibody n5-i5 in complex with hiv-1 clade a/e gp120 and scd4.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
212
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSTYAMSWVRQAPGKGLEWVSSINNSGRNTFSADSVKGRFTISRDNSKNTLFLVMNSLRAEDTAVYYCAKDLRLGGGSDYWGQGTLVTVSSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Definition of an Antibody-Dependent Cellular Cytotoxicity Response Implicated in Reduced Risk for HIV-1 Infection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
molecule keywords HIV-1 CLADE A/E 93TH057 (H375S) GP120
total genus 42
structure length 212
sequence length 219
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h8wH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h8wH01
4MDIB 5GGTL 1DQLL 4QKXB 4U3CA 4K23H 5DJAB 4XCNA 2EIBA 2FGZA 2J7LA 4OLUH 2D4DA 2J8UB 3DV6A 4WU7A 3U9PL 4NCC2 5D7IB 3RWDA 1JGUH 4JDVB 3V6OC 4QCIB 5FF6A 4ZFZA 5JZ7D 2RAMA 3CAFA 2X1QA 4G8GA 1JBJA 1XF2A 1YN6A 4MD5A 1D9KD 1X3DA 3RI5F 4MNQD 4UV7H 3UBXG 4EN3B 2OTUB 2WBJB 1CK0H 4DQOL 2IPTH 3ZTJG 1NQBA 2ZSWB 4QF1A 1VADA 2AJVL 4X4ME 3PXJA 4MJID 1Z2KA 3UXFA 3OPZH 3FN0H 2D0GA 2VL5B 4JFYB 5F9WC 3N1GC 4XXDB 3TIEA 3RWIB 1I1YB 2EH8L 1BBJB 3VGGA 2X42A 4KDVA 1OSPH 2BHUA 4XCNB 5JXAL 2MTPA 5E1AB 5IIEB 3L3JA 4F37F 4U6YA 1LE5B 1HOCA 2B5IB 3HUJE 4NP4H 3NBNA 4C56D 3T2NH 3FMGL 4PJHB 4QOKD 1INDH 3WUZA 4MAUH 2FYYB 2DBLH 1P7QA 3B2VL 5BW7C 5HHOA 4N0UE 5DQJB 4GG8B 3L3GB 2UZIH 1VCAA 5CD5D 3DRQB 3G5YA 3DYMA 4Y1AA 3RZCC 1K8IA 3A67H 2ADGA 1BVLA 3MZGB 1TZIB 1UH4A 1XF5B 4IHOB 4NQSA 1U8HB 5HI3D 4KHTH 5EBMA 1PY9A 4P5TA 1OWWA 1TPXB 1IRAY 1VACA 2P8MB 4Y5XB 4DGYH 4MD0A 2NCMA 1BVKB 2FECI 3QNZA 4MHHG 2JJSA 3KNBA 4LSQH 3SKJH 4KZDH 1QSEB 3IT8D 5TPWH 3PIQA 4LLVA 2BJML 3C6LC 3RPKA 4TTDC 4NKQB 2I60H 4IOIA 2VO5A 2WP3T 3MLSH 1B0GA 3VCLA 1GPOL 2VN4A 2CO6B 2OTPA 4N0RA 5SV3A 1A7QH 2EDWA 3OF6D 3LN5A 1DVFD 3MRDA 4L8SB 1S9KC 3P9MB 4R90L 5MERB 4Y89A 1C5BL 4KU1A 4CVXB 1I7TA 2Z8RA 4QHKJ 4RISH 5SWQA 3GMPB 2LV4A 3IDGB 4IM8A 5EG6C 3GBML 3H9HA 1ZGLP 2VE6A 4QY8A 4RAUB 5EO9A 2QHRL 1F3JA 2W9LA 5LJYH 2BNRB 1A02N 1U3JA 3SGJA 2Z8SA 1EXUA 1INEL 1E27A 1H3XA 4XCFH 5BMFH 7FABL 4PYHA 2ZG2A 3MV7A 1QFPA 4EDXA 2ESVD 3QCUL 1BJ8A 1MHPL 2I26N 4LSSH 2AI0L 5JOFA 2LFGA 1BBJA 4GSDL 3S97C 1IL1B 1K4DB 4P2RA 4Z7QF 1ZLUH 1KACB 5F7EL 3IJYA 5E8DH 3F7PC 4XNYL 3FB8B 2DWDA 5CEXB 2DLIA 3OAZK 5L88L 3PQYD 2V9TA 5E8PA 2XQBL 1XGPB 5ANME 3AU1A 3EYOA 2SEBB 5JW4M 3VXUB 3F7QA 3V0VA 3KPSB 4R26H 3VDAA 4EQ3A 1I3RA 1UZ6F 1U9KA 3MR9B 4MA1C 5C0BA 5EBLA 5F9OL 1YQVH 4WI3A 1RZIA 1K2DB 3LIZL 4UI2A 1NAMH 1UB6A 1X4XA 2DM2A 2Y23A 3QPQD 4EDWH 1M6OA 5F7DB 3STZA 3EDDA 1YYLH 4G7VH 3MV7D 3BWUC 1FNGA 5CUSL 4LASL 3RX5A 1MCKA 3PDDA 1NBYA 1CU4H 1AXTL 4OFIA 2OLDA 4OCWL 5DTFB 5E8EB 2BK8A 2HJKB 4U1SA 4GQ9L 1I9JH 4YDKL 3V5HB 1J05B 5C0AB 3BZDA 3NFSL 3PUCA 1MIMH 1MJUH 5DMIH 2APXA 1ZEAL 3AM8C 3GMOA 3LEVL 3GK8L 4Y5YC 2EXWD 2HT3D 2IAMC 3QG7H 3OQ3B 1AGCB 3G6JF 2HKHL 5LVEA 5I17B 1BLNB 2BSTB 3VFOA 5D5MB 2NY3C 5ISZA 1BPVA 3TBSA 3UZEA 5CLWA 2VDML 3ULSB 4YHNB 2R69L 4KJWC 4KTDL 3RWGB 3MV9E 2J6EH 1UZ8B 4YAQA 2EKJA 2A38A 3EDJA 3FO1A 3ARDA 1HI6B 4XPFH 3MNVA 2F74B 1MI5A 5AG8A 4Q9CA 1QLEH 2OL3A 1JHTA 4QEGA 5FV1L 2HJKA 5DQJA 1OAKH 1KPUA 1RHHA 2GCYA 2F54B 4RQQB 5L2KA 4OD2A 3NIFE 1MRCL 5GS0L 3L7EA 5I1EL 2VLMD 2ZUQB 5DQ9B 4ZS6C 5HHVL 5F3BB 1I8IA 4FQ1L 2E7CA 2DRUA 2C4FT 5F9JA 4L9LA 2HT4C 5E94A 35C8H 2OJZH 3TVMD 2CJUH 4ELMA 4DUXA 2FHFA 1IQDA 2EC8A 3OKOB 2J8OA 4BFIB 5J11B 1PJ9A 5SWZB 3HA0A 1A4KB 2WQ8A 4PJFE 4KQ4H 1P4LA 1W72A 3STLB 1SMOA 4OIAA 3TV3H 3G5YB 4XNUL 2DQGL 4Z9KB 2XWBA 1X5FA 2ORBL 3G08B 5JORB 4UT7L 4WEBL 4Z0BH 4H0GA 4GAGH 4AEEA 2LVCA 5FXCH 4BFGA 4ERSL 4PJGA 5EIQA 4ZG1A 2GT9B 3CCHB 2XWJA 2B1HL 4YEFA 1K4CA 3QQ3B 1T2QL 2DKMA 3W11C 2CIIA 2HJLA 3SOBL 1XFPA 4S1RL 4GBXC 1A1NB 1UACL 1QSFB 1HYRC 4PUBH 2LAAA 2R0LH 1FVDB 3O4LB 4RGOL 3VI3F 3KLHC 5CHNB 2ZCKH 1D5BB 1S5HB 2VABA 4CAGA 1X44A 3QEHA 3G5VB 3MPCA 3VRLF 5IB3B 4OKVA 2B0SL 3U1SL 3UTTE 3KPSD 1SBBA 5IHZA 3QEUA 3JWOH 1DN0B 3N9GL 3MX0A 4HKZA 2QEJA 4G42B 2ZUVA 3ZT6A 1MFDL 5I74C 3EFDH 3VFOB 5D70L 4L3CB 1I3GL 2DYPD 5KSVA 4GXVL 2E3VA 5D4QA 1MHEA 1YEKH 5D2LF 4NQCB 1BEYH 4IOIB 1YMMA 4IMLA 4WO4D 1UG9A 1XR9B 1IFHL 1D9KC 4KZEH 3QP3A 3ET9F 2GJZA 2Z91A 3KDMA 1T03L 3DO3A 2PYEB 3GSNH 4M1DL 1NUNB 4FQXC 3RP1A 4PGBB 1JZ4A 3BKMH 4L8BB 3RDTA 4XPAL 3CFBB 2FEEI 1N6VA 4XMKL 5F88B 1RK1B 4YHOH 2YZ1A 1G7PB 2JB6B 4APQA 2FZ3B 5D7KE 4M6NL 3FQUB 3G6AA 3RNKB 1AQDB 5MEOB 1FIEA 4UIKH 2VXUL 3VFPA 3PJSB 3QEQA 3OAYH 3MUY1 3VXQB 5IMMB 3DO7B 1AKJA 3TCLA 1KJMA 2YWYA 4TUKL 1OGTB 4MA8L 4OUUB 4ODBD 1R0AL 3L3DB 5IGXL 3CXHK 1SY6A 4G6AC 5F7KC 3F7VB 3IJYB 4WTXA 4KI1A 3KYOB 1CS6A 3PGFH 3QCTH 2HJLB 3C5ZD 1T0PB 1XGYL 3QO0B 4WDIB 3EYUH 5FOBA 3GIVB 5EB9A 1CVSC 4ZUSB 2H9GB 3Q3GB 4M03A 5ICYB 2VXVL 1AY1H 4B7IA 4E41B 5DF0A 1JZ8A 4TUKH 3WIHH 4Z76B 2IAMB 2NXZC 1DQJB 5L2KD 1BVLB 3H9ZA 1LP9A 4BQBA 3GBNH 4JO3H 4JHAH 4M7ZB 3VFMA 2VDKH 2XZCH 5KSAB 5EO1B 3K1DA 2R1YA 1KIPA 2FO4B 4DAGL 2O5ZH 3BSZH 4NZRH 3HS0A 4HIXL 2YSSA 5HJ3B 1UADC 1OTSD 1E4JA 5JUEL 5E00B 4HGKC 4PG2A 3IDJB 5ENWA 2B1AL 5C0AD 5GRJL 5E4IA 2XRAH 5A16B 1QLFB 1UXWB 2OJEB 4M62L 4D0DA 3V6OA 1ROWA 4FA8A 1R0AH 2BXZA 3GJFA 4QNPE 4I13B 1OL0A 25C8H 1LDSA 1A22B 4HUNB 5DWUH 1OB1A 3MNZB 1NCCH 2W59A 3IAQA 3K8KA 3KJ6L 5C71A 5IGXH 2BVQB 1U93B 4RA3A 3LDBB 5EPMB 5JTWA 4L9LB 1HHKB 4YHML 1X5HA 1TDQA 5GIRB 2VAAA 3H9SB 2FSEB 1D9KA 5DVOA 4HZAA 4QLRA 1MCDA 1KCUH 1KCLA 2DAVA 3FZUC 5HHPB 1XCQA 3KXFB 4PJDE 3E0GA 1CG9A 1BAFL 3VFWB 4AL8L 1G1YA 3PQYA 2DS4A 4RFNB 2R2BB 3WNOA 4M93C 1U41A 1UXWA 2OJEA 5LQBH 4JO3L 2OYPA 4PJIE 3RNQA 2YXFA 3BN9C 3BJ91 3CZFA 4JQXA 4W6XB 1K9TA 5EZJA 1CXEA 1JTOA 2YKLL 3I50H 1RZ8A 4B0MM 3VW3H 3B2UD 1EHXA 5DDHA 3KJ6H 2OMBA 4ERSH 1OAYL 5D7SH 2LQRA 1OD9A 1OTTD 1HCFX 1KB5H 3QDGA 4H26A 4TUOA 3RX8A 2WLYA 3FN3A 4ZOEA 3VD3A 2H41A 1QACA 4P3DA 4WHYG 3MRJB 3MOQA 1A3LL 3RX7A 2DLTA 2R9HC 3U0TA 3FO2B 3VE0B 4Y8DC 4P2OC 3U83A 1MSPA 2DD8H 2NXZB 3O8XA 1W0YT 5JW4Q 3T77B 1JPGA 3EBAA 4FQXA 1V3JA 4WFFE 1VKXA 5HHQA 4P2YA 1UQSA 5KSUB 1P7QD 2YC1A 3GUTB 3EO0A 3OR6A 3CFKA 1AHWB 4PTTB 3HR5A 4NRZB 1NUGA 4E42B 3K2UH 3C8KB 4PUBL 3HFMH 4YPGA 1A6AB 3O3BB 1S7UA 3CVHA 3Q1SH 3VFVB 3L9RA 2CDEB 4U7KA 3VD4A 2XG5A 1NDMA 3VXUA 1A1OA 4LHUD 5F96H 5FO7B 4PRPB 4L8DB 3LKOA 3VMOA 1WC7B 4WI2A 5D9SA 2FD6H 4UMGA 5CMAA 5KVEH 2JB6A 3IXTA 3UC0H 4WIQA 1U8JA 3MBED 3KYOA 4E9LA 2A6IA 4IRSC 4PP2A 2HG5B 2VDQH 4PRBB 1CDCA 3BP5B 1JGVH 1M7IB 3KPPB 3OMZA 4YC2C 1MFBH 3QUKA 5DRWB 1X5IA 4XI5D 2BY0A 1MJUL 5JHDE 5DFWH 4YDJA 1FFNB 1SBSL 1JHKH 4FQ1H 2BY1A 2AKRA 3BKJL 3S4SB 2G75A 1Z0MA 4HCRA 3JV0A 4JM4L 4LPYA 3RVTC 1KNOB 3SDDD 1IM3A 3RJDA 2BVYA 5D1XA 3JXAA 2W9DH 3NCYP 5CUSH 2H2PD 4GMTH 5ALBH 4CNIB 4KTDH 2IQ9L 3U30B 4TSCH 5EZLA 1A1OB 4PJDA 3UMTA 4HKXB 3M1BA 4DKFL 5IFJA 4FQIH 4IOFD 2A6KB 4TQEH 3NPZB 2J6EL 4P2QB 4HC1L 4ZFOB 3D69A 2ADGB 4GS7B 2ZOKA 4I48B 3DIFB 4OCRH 1E0OB 4KQ3L 2Z31C 2JJWA 1C12B 3H7BB 1M7IA 3KPPA 3B9KB 2OI9C 3TBWA 5HD8D 1AD9B 1YNKH 3FO0L 3HHRB 5FHBH 1DQMH 1OSZB 1HHIA 2GITB 2XA8H 3O11B 3QFDB 1W0WB 2IPKB 1NFDA 3B9KD 3QDGE 2FJFA 3QH3A 4L4TD 4GSDH 3VXOA 4HS6B 3FAXA 4M4PA 5EPMA 2Y06L 1KN4H 2EYSB 2RJMA 4JQVA 1R3HB 2AW2A 3QEUB 1OLLA 3FONA 2OXGA 2EE2A 1JMXA 3FHQA 5DJDA 1BGXH 5JIIA 3WXWL 3FFDA 3L9RB 5EOTA 1U8MA 1MWAH 1CICC 1MEXH 4OF3A 1T83C 2D0HA 2NNAB 4HPOH 4GG6F 4NWUL 3AMKA 1VFAB 4ZD3H 4R26L 3ULUF 4DGVL 5GGSY 2B1HH 3BXNA 1BF8A 1NC4D 3ARTA 3IDJA 4YFLF 5DC0A 4BH8A 3IS1X 3L3JB 4OGYL 1G7JA 1JF1B 3MJ6A 4R0LA 1ZVYA 4FQLL 1FNGB 4OI7A 1P2CA 1Z9OA 4F2MA 3ULVL 3FCTB 3AREB 1UH3A 2C3XA 1I1FB 1OF2B 1EXUB 3U48A 4PGDA 4IRJA 3RVXD 4BSWB 4M7JH 1JZ6A 3I6KA 4OZIB 3T0XA 1T1YA 5IW6B 4PLKD 3S3SA 3QULA 4ISVB 4XPGL 4X80H 3OGOE 2H2SD 1VERA 3IDUA 4M61B 4NRYB 5L0QB 4G6ML 4U1NA 4WUKL 3IJHB 4KRPC 4I18B 1XGPA 4UT9H 4PRIB 4WJ5A 2DQIL 4U49A 1Z3GH 1YN7B 3LS5H 4HXBH 2I5YH 4D9QE 1QRKA 3BP6A 3DLQR 3TA3D 4FQXB 1Y6NR 5EU6D 3L6FA 5BV7B 2GJ6D 4HQQL 4BQ9A 5JPMA 3WKML 3ARFC 2X4UB 1J5OL 4X7TB 4BA8A 1DVFC 1QOKA 1MNUH 4UB0H 5K9KB 2A0LC 4NJ9H 3IFOB 3UCRA 2F53E 2WNGA 5CZKA 5SWSD 5GGVL 5CKAA 4I18C 4PJEF 3ARWA 1CZ8L 3SDDB 5HGHA 2OZ4A 1UM4H 4OFVA 1K3ZA 4L8CB 1N59B 4YDLC 3F8UB 3RKDD 5J3HD 2V6HA 2DQJL 3GMPA 1SM3L 4D0BA 3WUWB 3I3DA 4NGHL 1ZTXL 2GK0A 1UXSB 4X6FA 5DMIL 1M71A 2V7HA 1FORL 3JV5A 3QDMA 3CZFB 4JR9L 5CBAA 2FJHB 5CSGA 1A6AA 2CRZA 1FYTA 4Y2DD 4HAGA 5E2VH 5ESQB 4XVJL 5IG7A 2WBJD 1CU4L 4LF3B 4N90D 3PL6B 4HWNA 3GSRB 5I8EB 3U6RA 3TEUA 1KCVL 3V0WL 5AD0A 1UQSB 4NUJA 2DDQH 4JFQB 3VI4E 4U1LA 3IU4H 4I0PC 5FYJD 3SGKA 3WNMA 3TBYA 3PGDB 1H9VA 4KI5E 3L3DA 5GSRA 2DLFH 3V2AR 4OM1L 1VGEL 1SJXA 3VH8G 2X7LB 3QZWB 1ETZB 2IGFL 3HB3D 4HPYH 4DWHA 3FQRB 3CXDH 3P40A 5CS7A 3O81A 3KR3H 5L9DL 2BOBA 3P77B 5C0FA 1T83A 5J06A 3QQ4B 4HJJH 1UXSA 4X6FB 3B83A 2N7BA 1YN6B 3P0YH 4LOUC 2R1XA 3BT2L 4JFOA 3W81A 5TDNB 3BIKA 4GRLA 1AE6H 5ACLA 4JGJA 4Z76A 3KLAA 4BFIA 4L5FL 5ITBH 4ZDHA 2NY7H 4I3SL 1U8IA 1Q9LB 1Q9WA 3D0LA 4KKBD 3T3PE 2BNQB 5HI5C 3N06B 3O3DB 4WWKB 2EE3A 5I8EA 2FJFB 3B5TA 4PJHF 3AC0A 3HZYA 1LO3L 4NFDA 4QNPF 1BWWA 4OLZL 2EDFA 5DRNB 1CD1B 1BQLL 4UDUA 1IGCH 4PJEE 2O93L 3ARGB 2BNUA 4KTEL 4JKMA 4PLJC 2CD0A 3DMMC 4LPUA 4ELMF 3BPOB 4MAYC 3D39B 4GLRH 4I4WA 2CKBL 4RAUA 5DJDB 5EO9B 4NOFA 5FDWA 4E41D 4ZFFB 5AWNH 1YEDA 1F5WA 2ICEA 4PGZA 1XGRA 1ZS8A 2H26B 4JHBA 4HMDA 1CFTA 2H8PB 2VLRE 5IFJB 2L7JA 4H20L 3TBSB 3MRHB 2R39A 3W39B 1K6QH 1AD0A 1BMGA 5ID1B 4PRID 4QCIA 5FF6B 1HE7A 4DW2H 1FFPB 3O6KL 1FZMB 5IHZB 4XC1L 1PDKA 4N8VG 5F7WC 4FTVD 5ICZA 1NCTA 1KNOA 4OBRA 1R5IB 4OTXL 3Q6FA 3C8HA 3ZYIA 4XVUC 5KVFH 4HIEA 3EAKA 4TOYL 5JQ6H 4Z77B 1KPUB 3MC0A 3OPZL 1ZANL 4XNXL 1T89C 3QXAA 1ZT1B 2VQ1B 3H42L 3QG6B 4UDUB 3L7FB 1I1AA 5LAXB 2MCPL 2AK4B 3O8XD 4EUPB 5MEPA 3T3PF 4JFHE 5EA0H 2H45A 4YE4H 5HGAA 3QPXL 4BH8B 2B4CC 3K4AA 1H3WM 4Q9BA 4RNRB 2YEZB 5MP6H 3LMJL 1E6JH 3TT1H 3U4EB 5DHVB 1G0YR 2BHYA 2VKXA 4GRWE 4P2OD 3UAJC 3D2UB 3WDHA 1E4WH 5K9JL 1RIUH 5IJVB 1BJMA 2QKIB 1AGCA 3P9LA 3FFDB 4ELKB 4M7KH 3GB7A 3KPRB 1V3MA 1R5WA 1U42A 3RIAK 4ODXA 5ESVB 1JHKL 1NJ9B 4XI5C 4FTVA 1OP9A 3CFJB 3KPMB 2EDQA 2FCBA 4NP4L 4X4XA 4CGTA 3UO1L 5I1KH 4DTGL 5I1DB 3LPGA 5F9DC 1I8LC 2EO9A 1R5VA 4JZJB 4WW2B 5F7FA 2WANA 3ARGC 3MLZL 2DYPB 2HA1A 1JRHL 1KN2H 2OXHA 1BJ1H 3I6LD 4HKBA 1KJ2L 4X5WB 4EN3C 3IFNH 3BP6B 2XTJC 4U1JB 4Z7UF 5FDYA 2QTEA 1JI1A 5CWSB 3T0VA 3WLWC 1DDHB 1T7ZA 4N5EC 3QHZL 5F44A 4XC1H 2RFXA 5IVZB 5IUSA 3HAEB 4Z8FH 5INDA 4LCYA 1UGNA 5IB2A 4LRIA 2HFFB 3MSPA 2KZWA 2GSIA 4XVUD 3AU1B 3EYOB 4WTZA 5GZND 3OKKA 3L5JA 4M02A 4MA1B 2X1PA 4JFFB 4LEXH 5IVXF 4X6DA 2YXMA 3S7GA 4Y4FA 2Q6WB 3DXAB 5MENE 5HDQH 2VLJB 2Y5EA 1EPFA 3T0EC 3WE6B 3P9MA 5DD6B 1D5XA 1FBIH 1DQLH 3WJLC 4OFPA 4LCWB 4X7SH 1NEZG 3C6LB 3QEGL 4OLZH 3DTXA 4NN5B 2X4OB 3CLFL 2GTZB 2C3VA 1OSZA 3CVHL 2FL5A 2E9BA 4LSTL 4NO5A 2HT4D 4HUVB 4I3RL 1A3RL 1S7XA 3D2UD 4U0RC 4F33A 3SE4A 3MA7B 5AYUL 5KVFL 3ZKQD 5BVPL 2AEIT 5DSCB 1AE6L 3DSNA 1ND0B 1K85A 2AXHA 2VUOA 1T6VN 5DRXA 1FHGA 1AIFA 3O6KH 2Z93A 2D0FA 1EK3A 1CICA 4KKBC 1VA9A 3KR3L 1AC0A 1CXHA 4RMVA 2AJ3A 4HMEA 2DICA 3SQBA 5J6HA 1A6WL 1KBGL 4ZXBD 5CJOL 3MNZA 4G6AD 5GPRA 5B3NA 1HIMH 4UB0L 2J88L 3TIDA 3X11A 1DJSA 3A6CL 4AENB 1MWAB 4FQQB 2PNDA 1F2QA 3V7AG 1F4HA 2GK2A 3DIFA 3PHQA 2IH1A 2HWZH 3C5ZC 1KCSH 5E4EC 5EIIB 1Z3GL 1AGFB 1XGQB 3O3DA 4WWKA 3UTPE 1LO3H 2ZWLT 2J4WH 4JPKH 2X4SB 1IGJB 2NYYC 3LRGA 4WUKH 4RFOL 2BY2A 3PGCB 4O9HL 4LLUB 1E4XI 1AIFB 2A1WH 4LHUG 1URLA 4U1IB 4TVPE 4YLQT 2R1XB 2CK0H 5GHWL 3VFMB 1HEZB 1CT8B 1H0DB 4WTWA 3VFVA 2W0LA 1UWXH 2QL1A 2JCCA 1F4XL 1FO0L 1YEEL 2R9HD 1CZ8H 5DEFB 1KT2A 3ZE0F 4WO4C 2EEDA 5F1IA 1BBDL 4LARH 1WWWX 4LAQL 1AGEA 5D6DC 2Z92A 1U3HC 5IB5B 4PB9H 5GZOD 1NEZB 2IH1B 5ICXA 3RZWA 3KVQA 4RIRB 1OW0A 4IDLA 5EOCL 5SWZD 4Z7NF 2X4PB 1MCIA 5DYOA 3GRWL 3LEYH 1NGYA 3VGEA 1MWAL 5KSAA 3LH2L 4O02L 1A2YB 4K07A 4JHAL 3WO4B 4K7PY 1RUKL 4FTVB 4YIQB 3RGVB 5EU7C 3BOVA 3MRKB 1CLYH 3S6CA 3QSKB 4NCDA 1FH5H 1IKFL 5M95B 4Z7WE 1WLHA 2Z93B 3P9WB 5BXFA 1I8KB 3DV6B 1DBBH 4MB5A 3T2OA 3PQYB 4MJ4A 4S1SL 4JG0H 4CADA 4TRPH 3RA7L 3M8OH 3MNVB 4U6HA 1E6OH 4CN6A 3B5GA 2D9CA 5IEKB 5ENWB 3BVNA 4N9OB 2EXYC 3WFBL 3PV6B 2Z9TA 3EYQD 3LHPH 5D2LB 2Z8WC 3FQTB 3GHBH 5GIRA 4XCEB 5HGGS 4BSJA 2A6IB 1G9ML 3T4YA 1CFSA 5MI0B 3LB6C 4C56E 2QQLL 1KFAL 2JELL 1WGOA 2R1YB 4G8GE 4X6DB 1OT2A 4ZUTB 2XPGB 5T5NG 3IFPB 1U6AH 5HPMB 4WO4B 3CLEH 4LU5H 2FRGP 3D87B 5HGHB 4XMKH 3QQ4A 2AKRB 5HY9A 5KSAD 4PJ8B 3RTQD 4I0PA 4XRCA 2H32H 3TJEL 2ITDA 1UM6L 1EMTH 1IM9B 2FJGA 1DBJH 5T5FH 1JGVL 3DX7B 3GJFB 3SO5A 4NKOB 4MQ7B 1UFUA 2IQAA 3PF2A 3FTGA 3EW3B 3EOAB 4MJ2A 2OZ4H 1YNKL 1WUNT 3HMXH 4YDIH 3TT3H 1F42A 1KEGH 4LOUD 3BE1L 5FKPA 5TGBB 1XGTB 1JF1A 3GSVB 3PWPE 4NSKA 1K4CB 3QQ3A 1N5YL 2KBGA 5BQ7A 1I3GH 4ODSL 4BZ2H 4GAYB 3MMEB 3KHOA 3MLPA 1QNZH 4WEUD 3HI6H 5HHOE 1T22A 1LNUB 3BZEA 1JGLL 1CFQA 2AEWA 4PREA 3VH8A 1U8NB 1WEJH 3GO1H 3L3HB 4JDZB 3QDGB 1BGXL 1SMAA 2FX8H 3NCEB 1XGUB 5EOQL 4Y4KA 2YC1B 4J3SA 3C08H 1FE8L 1FG2A 1MRFL 1IQDB 3IDNA 3UYRL 1RIHH 2YD7A 1CR9H 3V7MA 2DMKA 5GSVB 4M7LL 4MQ7A 5F8RC 2N7AA 1AGBA 4J8RA 5EUKA 2WK2A 3KYMB 5EC2A 2V2TA 3PWNB 4YXKL 3JV6B 1Q9LA 4ZOCA 3RHWF 4LCIL 3QG6A 5JORA 1N5YH 3PABB 2X4UA 3RIAF 3VXQA 4UT6H 5ALCH 4PG2C 5M7QA 1G7LB 4LLVB 3KAAA 4YDIL 3TT3L 4L1DA 3WKNA 1HEZA 3TV3L 4G3YH 3FO1B 4KQ3H 1UJ3C 4FQXD 2EDNA 5D7SL 1ES0B 1S7WA 1F4AA 3F7YA 3DBXB 5C0RL 3CFEB 4NHCL 2CJUL 5CIPH 4FQIL 1OAXH 2Q20A 3O9WD 5IB1A 2BVEA 1SQ2N 2F53A 5GGRB 1KSRA 1FVEA 4YX2H 3S37H 2G75B 3TO4C 5EO0A 3ZDYF 1NGYB 3GI9H 4IJ3B 1JF5A 3OKEB 4JVWA 3WL9B 4GXUN 1QBML 1DANT 5D93B 4WI8A 5IG7B 4HWBH 1BHGA 5FM5M 1KCUL 4QRUA 4JKWA 3NACH 3TM6A 3NTCL 4QT5A 3HI6L 4OCYH 3QDMD 2AJ3B 2HKFH 4YO0A 3WFBH 1IGTA 3ULUL 4UINL 2XKSA 5C0JA 2KQMA 4OLWH 1VFOA 1J0IA 4PGEA 1NAMB 4XP5L 1B3JA 4LVHB 4K3EH 4IEFB 3SJVD 1EEUA 3HNSL 3VXPB 3NIGE 1E28B 3UC0L 1IGFL 3RUGF 4D9LL 4YQXH 5DMGD 5DWUL 1DBJL 1ZA3A 5T5FL 1EMTL 5C0FB 1KEGL 4JANA 5HHNB 5E5MA 2ATPA 4PJEB 1FVDA 1TENA 3O4LA 4P5MB 5FECB 3FRUA 1EHLH 4MNQE 3VW3L 5HHMD 2Z0BA 4U7MA 3KHQA 3U0WL 1MRDH 2GIYA 5AZEH 3LPWA 4LVNB 1LEIA 4U6VH 5D6CA 3HRZA 3DGGA 4YGAB 2MPAH 1OP5K 2DQUL 3EDKA 1OF2A 2VIRB 4LGPB 3IB4A 4Z95L 2UUDK 4FZ8L 1BAFH 3GRWH 3LEYL 4NC1E 4ORZC 3UBXI 3ULVC 3U36B 5FUCE 3RJQB 1QFWH 3QDAA 4HMCA 5I75C 1ZA6A 4KK5C 4WI4A 4TTDD 2XICA 1XCTA 4ONGH 2G2RB 2WIIB 5D7LB 1S7VA 2RBLA 1DQDL 1JPST 2LU4A 5EWIH 1P5VA 4TRPL 4OT1L 5KSBA 1HSBB 3BGMA 3MJ7B 4NZJA 4LVNC 1CICD 5I1GL 3KWWA 1MCNA 3T0ED 4JKPL 3GSQA 2AK4E 5I9QC 2RQ8A 2WSKA 2GFBA 2IEPA 4ZODA 1HILB 1KIUA 4KJWD 4RAHA 1L0QA 43CAA 3VXNB 1J0ZA 2AQ1A 4WNQB 5D71L 3UJTH 3VXMA 3WD5L 2A2QT 4BQ8A 1TFHA 5EC1B 2JIXD 1NUFA 4WGWB 3MUGA 5F9AC 1ZT1A 1KLGA 2Q7YA 5F6HJ 1R3JA 8FABB 2FHBA 1KEML 4AT6B 3IDYB 3HTLX 5JDSA 1TJGH 1N2RA 5A2JH 2XZCL 1I7ZA 5I17A 4D0BB 4M8VA 3V79C 4WWID 2ARWA 3RPIA 2F15A 5T3ZL 4F33B 4OZHE 2C26A 4P46A 3TA3B 3I2CH 2VJXA 3HE7C 4ENEC 3U7YH 2HVJA 4CNIA 5HVHC 1YEDB 3MRGB 4Y2DC 3WIFB 1YEEH 3UTQA 3HI5L 3KJ4C 5DJ8B 5HI4D 3KJ4B 4OQTA 2OR7A 1RHHB 3ARXA 1IGIH 4P2OA 1FNSL 4BSWA 4RA0C 3CPLB 1JUFB 4D9LH 2OSLA 3PV7A 3QUYB 3DMMA 4WY7L 3CJJA 3OGCA 4M62H 4MA8H 2X41A 5D1QB 1PZUB 1UYWH 5DEGA 2X09A 3CCHA 3GSNA 1YYMH 1XAUA 2OP4H 2OI9B 4P4RA 3VRIB 5F7DA 3FT2A 4K7PX 1VDGA 4JFYA 4P4KA 1G7MA 1Z5LA 4CU7A 5E08L 1QSEE 2A9NL 4OF7A 2NLJA 4WRLA 1VFMA 2QR0B 5D7LA 4JREC 3A6CH 1HZHL 3LKRA 2B4CH 2VERN 3WFHA 3W9EB 4BQ6A 5IB2B 1ITCA 1PD6A 2ZCKL 5FYLE 1MREH 3WYRA 5CCKL 1JGEA 3V4PL 2B2XL 1DBMH 3EYFA 2FX9L 3HZYB 3HC3L 1MFNA 1YNTA 1FSKC 2WLZA 1ZLSL 1FL6A 4KVCH 4U3HA 1D5XB 4L4VE 3QHZH 4UZGA 5D2NA 5DJYA 4GAGL 3IDIA 1FYTD 5ILTL 4RWYL 3NABL 1XGUA 4OZ4A 3KPLA 1UT9A 4LQFL 1YEKL 5JA8B 2VITB 4NPYB 5L2JB 4J4PD 2HVKB 3THML 2X4RA 1AXSA 3U4AA 4QXTA 1DBAH 1HQRB 3V7AE 1OWRM 5E8NB 5CBAB 5E5MB 1H8OA 3E3QC 3WLBA 4LIQH 5E2TH 4YHZH 1LMKA 3FQXB 3QUMB 4HH9B 2OJZL 2BRQA 1NFIA 4JEGB 4UQ2B 4PV8A 4XGZB 4FTVE 4RGNB 4LPVA 5E5RB 1AHWA 4PTTA 5E7BA 2I9LA 5F97E 2Q8BH 3OBAA 4FG6D 1F6FB 1A64A 1QG3A 1QFWM 4LVOB 3VA6A 1GC1C 3DURB 4K23L 1P7QB 4NQEE 2EYTA 3LKQA 4KPHH 1QYGH 4B5EA 3OZ9H 3RTQB 1GGBH 4G6FD 1ZK9A 4JJ5B 4XMPH 1FAKT 1X6NA 3LQZB 4PGCA 4NO0A 3MROB 4GKNB 5ELIA 1F6LL 3DI3B 4JKLA 4PJCF 5I0ZA 1KIRA 4N90E 1ZHBB 5GRYA 3TN0A 1L9MA 5ICZB 3WFEH 4TOYH 1BM3L 5F1OB 5JQ6L 4PLOB 1YJDC 5JA9A 2O61A 1S3KH 4HX1B 4CDHA 1QLRB 1NFIB 4UQ2A 3MRFA 1XIWC 1ZT4B 2BVOB 3W9DB 3EFDL 1UZ6E 4DKAA 3D25A 4NNPL 2H8PA 1MCWM 4K3JL 2A9ML 1H3GA 1XF5A 1N7MH 2VLKB 4JLRB 3UO1H 5HYQA 4ZTPL 5FCUH 1FVCB 1CD1A 4G6KL 1MJ8L 3C09B 3QEHB 4WFHE 4XHQA 5DRZB 3BH9B 4K9EC 3GJEB 5HHVH 2OTWA 4OQ1A 5FUZH 3FT4B 2CIKB 4Z7UA 4X98B 5FO8B 1SHMA 4ODVH 4I8DA 3LQAC 1LGVA 4C57C 1G6RL 1CLOH 4KTEH 3ZHKA 4F3FA 1V7NH 4MJ6A 5D9SB 5HJ3A 4KV5F 1Z9SA 1D5ZB 5KZCB 3GHEH 5FYJE 5JLZB 1B0RA 4MD4A 2J2ZA 4HFWB 5I1DA 1VFBA 4S11A 2AJZB 1DQJA 3CD4A 5DD0H 1R3KB 1KTDA 1HQRA 4P9HC 4ETQA 4G5ZL 5KVGH 4XC3H 2X7LA 1DBBL 4ODUA 4Y19D 2P1YA 1O0VA 5BV7L 5I1LB 3LQAH 4Z7VE 4HJ0C 2XG4A 3MRPA 3OKMA 3CFBA 1KLUB 2VXTH 1XF2B 2QSCH 1AR2A 5E00A 5HGAB 5JXED 1J12A 4R96B 3OHXB 3RWEA 2AP2A 4LVEA 2QQQA 1LEGB 4XH2B 1MF2H 4ZFGH 1NMBH 5C08A 4KK6D 4X5XA 3ARBB 4D3CL 2IWGA 4QXGL 1RUKH 5C0GA 1AXTH 4CADB 4NKIH 1FC1A 4M5ZL 2YA0A 2A73A 2DDQL 1VEOA 5ESQA 1OTUD 3W0WA 4KH2A 5IJKC 1HQ4A 1N5AB 3NFNB 3VJ6A 3A6BL 3UTZB 3H7LA 2WAHA 5JQHC 2RCSH 4U31A 1HH6A 4LAQH 4LARL 4IMKC 2VXQH 5J0BA 4JG0L 3OR7B 3QWQB 4I3SH 2WW8A 4U0QB 1DFBL 1GPOH 3QFJE 2YS4A 1R24A 3C2AL 3DRQA 1BX2A 2XV6B 5DUBB 1LE9B 1J0JA 1PAMA 2OMNA 4OZ4B 3JWDC 2BJMH 1GAFH 4W4OA 2VISA 4BJLA 2GUOA 3FT3B 4H88L 2ZUQC 3GSUB 5EIVA 2YD2A 1IZKA 1YZZA 1MAJA 1LE5A 1U3YA 2ED9A 5E8EA 4U2ZA 3DX8A 1JZ2A 1H5BB 4NZUH 1NMCB 1H15B 2IANE 4HH9A 2DQTL 3L3IA 4GFTB 5DR5H 5ISZB 4JFED 5FOJA 4JHZA 3MV9A 1F3RB 4JZOA 3PHOB 5I1CL 2D7PA 3KLDA 5DSCA 3QI9B 3WFHB 2NTFB 1IM3B 1EO5A 3VFNA 2IH3A 3BEWA 2A83A 1FV1A 3VFRA 4OUOA 2W0KA 5AZ2H 5L7XH 1KTDB 3DUSA 1WAAA 4XPTH 3I6GB 1FFOB 3B2VH 4Q9RH 3FB6A 1KCRH 4F58L 5DD5L 5L6YL 3T2NL 1FLRH 2VZ3A 4AK1A 1RJLA 1WV7T 1FO0H 4EOWH 1KXVC 4PRPD 1CQKA 3SGDI 3WHXB 4LDEB 4A2MA 2FLBT 4U6XA 2AV7B 4XNYH 5CEYB 3C2AH 3SO3C 1MQKH 3EOBB 1IC5H 5HYFA 5EUOA 4WW2A 4L4TA 4ZUWB 2Q8AH 2Q3ZA 2AJVH 5C07A 1JNNH 1ULVA 1KT2B 4JM2C 1QR1B 3RAJH 3QEGH 3G9VA 3U9UA 5CGMA 2EYSA 5GGRY 3SCMD 5E6ZA 4M3JA 2NY0B 2VYRE 3VXTA 5FOBB 5IFAH 2X4PA 4HSQA 4KJPD 1EFQA 2I07B 1S5IL 4EI6A 2AAVA 3RY6A 5FO8A 2D9QB 1FGVL 2JIXB 4XB8A 5KG9A 1HIML 1CE6B 4D3CH 2DBLL 4UT9L 3MJGX 4X6BA 1X5XA 3DX9A 3CH8A 3O6LH 3DROA 1UM5H 1AP2A 5K93A 3PP4L 5IFAL 3H9SE 3JWDH 3LRSB 2I24N 2IBBA 3WNPA 2GUOB 1UZ8A 1YEGH 4NNPH 3PWJB 4UV4L 3UDWA 4P3DB 1X5GA 5KVMC 5BVPH 5TPWL 4M6ML 3HMXA 5ABDE 3IFLH 2YRPA 1GGYA 3HUJB 4PS4H 4NYLB 3QR2A 4ZFOL 4FQLH 4OCRL 4HKXA 1Q0YH 1S9XB 1T7XA 3VWJD 5EBLB 4M61A 4OM0L 4AMKL 3EOTH 1YPZE 1A7NH 1ND0A 2I9TA 1J0HA 4G9DB 2ATKA 1FBIL 4JDTL 4F15B 1QSED 1NMCC 2I25N 2DLHA 2ZCHL 3FB7A 4LSRL 3L1OL 1MJJB 2DM4A 3EYVA 4Q6YA 2UZIL 1KV3A 1OP3H 5I2IB 2A6JA 5IBUB 4KK8C 1MI5D 3R4DA 4Y5YA 1D5IL 3S36H 4ORGB 4JFDE 4MAUL 3UBXA 1DR9A 3O6FC 5T1KB 1SBSH 1OD7A 1JWSA 4AIZA 4WU5B 4POZC 4YDVA 4ODHH 2EDRA 3ZZ1A 1KELH 5CP3H 4W4NA 3JTTA 1FCGA 4U0RB 3MNWB 1SEQH 1DBAL 3M17B 1JPFB 2P42B 3FL7A 3ZE1F 1SJHA 2E8ZA 4WVRA 3NZ8A 1XCTB 1U8NA 3PWPA 2A73B 1T1YB 4LCCB 4JFDB 1DQQB 4LPTA 4QOKB 5CJQH 2JB5H 4OZIE 4YDJB 2BNUB 5TF1L 4DQOH 2CDGB 4Z7VB 5I71C 5CP7B 5J56B 5DDHB 4HFWA 5GGUB 1K4DA 1Q94B 1MHCB 2F58H 2AABL 2FIRT 4O00A 4XVTL 5FYKH 2HLAA 4F7TA 4P3CL 4WDIA 1BQUA 5D7JC 1DE4A 4CMHC 2NY0C 1NSNL 2PF6A 3MOAH 5DD6A 3GKWL 5IHLB 5CILH 3D0VB 1IILE 2GCYB 3U6RB 2VMFA 2YZ8A 3GMNA 1EAPB 5ACMA 2CKBH 3HNVL 2AEQL 1MJ8H 3BEWB 4N5UA 3TT1L 5L8KB 1YEHL 1TNMA 4RFNC 4I48A 3IF1A 4HK0A 1IAIM 3I6GA 3UJJL 4WW1B 1EZVY 1HH6B 3WFZA 1RUPL 3CFCH 2GW5A 1GRWA 4ONHA 4QGTA 3QXUA 3TPUB 4TSAH 4ZO9A 1SJEA 3O2DA 2WUCH 4TUJA 4MNQA 4LRNL 1FIGH 3MV9B 3LS4H 2JCCE 2WBWB 2UZXB 4LGSB 1HYSD 5BZDA 5IVXA 1T3FA 4NCC1 3TO4D 1UB5B 3QHFH 4PBXA 5KS9E 1OAYH 4M5YH 4QTHB 1N0XL 3BH9A 2FYYA 4U4BA 5B3JF 4HWUA 3VWKB 1U2CA 1UM5L 1DBML 1FYTB 4R6UA 2NZ9D 4LSPL 5EZIL 3VGDA 4C56B 2ESVB 5J8OA 2XXMB 1QTYT 2DLFL 5LQBL 5D7KD 2PYFA 4HFUH 1JYVA 1H3VA 2B4CL 4PLJD 2W07A 3C2SA 5FB8B 1S7TB 3TYFA 4MXVE 3S34L 5F3HB 4KJPC 3TN0B 3UDWC 4Z7WB 3BAEH 4ETQB 2Z4QA 3FOLB 1OAZL 2Y07L 5D7IE 4GW5B 1FZKA 1YYML 1LK3H 1QR1A 4NQTA 4Q2ZB 2HH0L 2QV2A 2BFVH 4TPRL 1U0QA 3DUHA 3RVUC 4PJ9A 4DVBA 4NN7B 2CXGA 2ZUUA 2C1OB 1NCBH 5LCVH 3MCG1 5JR1H 5E24E 3VXME 5DZOA 5FYKE 2VLRD 2XI9A 4H8WH 4R4FL 4XH2A 3TNMB 3QQNA 4FFZH 2CLZA 4YEEA 3N1QC 4PJ8D 3FB5B 2XQYK 4L8DA 4P2QE 4WHYH 5DJCB 1RZFH 3HG1D 3I2CL 3TCLB 3L5XH 3QDJE 4TTGA 2DF3A 1F4YH 4JREB 2NY5C 1FL5A 4G7YH 3DHMA 2NY4D 1MAMH 3QAZC 3HZKA 3OG6B 3MZTA 3ROLB 1J88A 3IU4L 3OAUH 1G6RB 4HQQH 2X70A 1UWXK 3BP7A 1TQCC 4FZ8H 1DBKH 2VSDA 5BO1L 4QYOA 2AV1B 3D18B 1E4KA 1P1ZB 5DR5L 1I1FA 5I1IL 5F7UA 1B88A 5LGJB 5EBGA 4EEEA 2DQIH 5ICYA 1PKQE 3RI5K 4OV5A 1T7WA 4LK4A 4G8EB 5I18L 3LN4A 2FH8A 4R8WH 3TO4B 4AY0A 1IAII 4XPGH 3SBWC 4I3GA 1U36A 1XT5A 2ZNWA 2L7UA 25C8L 4KK5D 2J1KA 1IGFH 4QWWC 3HI5H 1L7TL 5H2BA 4P49A 1U8OA 3HZVB 2OS7A 3D85D 3SDXE 4K3EL 3MOBH 5BZWA 2Z35A 2YWZA 4KKLC 1PG7L 3ROOA 3NCJH 4JRXA 1CXIA 5IESL 4UTAH 3F12A 4ZUTA 1FNEA 1UA6L 5LGHL 1HH9B 3SN6N 1W0WA 3MBXL 3UTOA 3U2SB 4OZHF 2PCPB 3ZKMC 5I2IA 4RZCA 3QXAB 4QRPD 1CXKA 3I75A 1WT5A 2OL3H 3ES6A 4NJAH 1T1WB 4Y19A 4EI5B 4YUEL 4OGAD 2EXYD 2PTUA 3RVVC 5GGQH 2YUWA 4GOSA 5E1AA 3BP5A 4ZUVA 3ZYJA 1NBVL 4GKSB 1CXFA 1RURH 2VDPL 3ABZA 5D7JB 5F1SA 3EYSL 2H1PH 3VFUA 1GZQA 1WBZA 4R2GC 2ZCLL 4JAMB 1S8DB 1U58A 3C6LD 2OK0H 3HCVB 1GYAA 5D70H 4DN3L 5FIEA 4W81A 1QHPA 3BKYH 5HGDA 3DTXB 5JOPE 4ONOA 3QJFB 4UIMA 3I6KB 1RUMH 4YPJA 2DJUA 3X13B 4M7LT 4GH7B 4HPOL 2R29L 4WW2C 1F90H 3LEXB 5ACZB 3VU2A 5J11C 4LSVL 1KLUA 1MPAL 1IGYA 4Z95H 2ZSVA 3T77A 5HI3C 2BNRE 3IXTB 1SYSB 2WUBH 1VSCA 3O6FB 1WZKA 4RMWA 3RU8L 2EEAA 1F90L 3T65B 2X9YA 3L3KA 2XN9B 1F02I 4LCWE 5FM5O 3KS0J 4AIXA 2J5LB 1U8MB 3MRCA 3QO1A 3LKSA 4ZNCD 4FXGA 4K55A 2E8YA 4XP4H 2QR0A 2LAGB 2VZOA 3SDAA 1EZVX 1QP1A 3GMNB 1TJHH 5FB8A 1J8KA 2OZ4L 1MCRA 4V1DB 2COQA 3L5WB 2CMRH 2VLKD 4Q58C 3BEVB 4X7FC 5DJAA 3TBVA 3HKFA 3ZLQC 3MRNA 4IJ3C 5F1IB 1CDBA 4FOMA 5TQ0L 1G7QB 3ES6B 3VD7A 3T1WA 2R56L 2EDBA 3WL9A 4O2CA 4TSCL 2HFGH 4P5TD 5SWSB 5C92A 2ZJSL 5IVXB 1YEFH 4NKMB 1BQSA 2Y6SC 3MRBB 2CSPA 3L95A 1JTPA 3IVKB 3ME0A 4WUUA 3TN0C 3SPVA 4ZSOB 1J8HA 1KPRA 4MDJB 1IMHC 2UYLA 1NMAL 4GLRI 3V6ZA 4L4VB 4JO1L 4C56A 2JK5B 3NCFB 4R4BA 2R0KH 2PXYD 4K71B 2CR6A 4PJCB 5E1HB 4J23A 4XVSH 4M6AA 2AK4A 1Y0LA 3ARFA 5KZCD 1SVZA 2W92A 3DVNA 3KPOB 4KRPD 4CMHB 1CFVH 3B9AA 4KV5E 5DMKB 1QEWB 5C8JB 1GGIH 3VRLE 4LCIH 1LO0H 1EO7A 2ATKB 3BPNC 3QRFM 1UM6H 3TCXA 3QUZD 4I9WD 5ACZA 3WN5C 2VZUA 5TF0A 3UPCA 1BZ9A 4I0KA 1EBAA 4JFFA 3C60C 3T2QA 4LVOC 1CLYL 3U0PA 1KOAA 1A6ZA 2YPLB 2WUBL 1S7SA 3OWEA 1TZIA 2P5WB 4IHOA 4M6OL 1KB9J 5GQBA 1F8TH 2VZVA 1QVOA 4QHNB 2AGJL 1IEBB 4P9HL 5E8PB 2A9NH 3E6FB 2DD8L 1G7MB 2PUQT 3GMMB 3ARGA 5T33L 1EJOL 3N50A 3TF7C 2WP3O 3ALPA 4X5WA 4XBEH 2X05A 4NIKB 3ALXA 2OP4L 3BN3B 1B0RB 4J12A 4CVUA 1O5DT 3WV0A 5C6PB 4OJFL 1LP9E 5LXGL 3EO0B 1OP3K 4FG6C 4S1SH 4PD4K 3CH1A 3QBTB 2ZCLH 4MJIB 3C6SA 3P11L 4IIQB 5GS3A 1OGAE 3EJZC 3E6HA 1PKOA 3DVGB 1KB5L 3LKNA 3I02B 4EN3D 3EO9L 4RZCB 5LCVL 2Q86B 3T4AA 3PNWB 3G5ZA 1F6AA 2CKBB 2C7UB 4JGUA 1NFKA 1FVEB 2VXSL 1MIML 3QIUA 4PBWD 1IAIH 5GGQL 4PJFF 1EEYA 1FL3B 1ADQA 2AJSL 3RL1A 5LGKA 1LDPH 4BQCA 5F3HA 5SX5H 3RUGA 3BAEL 5EBMB 1TETH 5CWSA 5D1QA 4Z18A 5MEPB 2FH6A 5H35B 4EUPA 5CJXC 3RNQB 3UJIL 1AQKH 1MIEL 4Y2OA 3P30L 1MFEH 4ZAKC 1QUNA 2IADA 3ZSSA 5IM7A 3RWHA 5J13C 3MFFA 4E41E 3GBNL 1K5NB 2ERJB 2BMKB 3REWA 5K9KA 1RZFL 3QUYC 4HS3A 1WBXA 4YAQB 5EUKB 4HIJB 3MGTA 1XF3A 4NM8H 5GS1A 2H32B 4Y4FD 1N0XH 2VB5A 4PRDA 3MCKB 3CMOH 4K94C 1MJ7L 1GZQB 1A3QA 5ERWA 3TFKC 1BREA 1HQ4B 1N5AA 3NFNA 1RURL 1EUUA 4KROD 1IKFH 4OKDA 4RFOH 1YECH 4NQVA 1R3JB 1IJ9A 4R4NC 4PJDF 5F9WB 5I16A 1INQB 4NJAL 1AGDB 1JHLL 1NEUA 4K3DH 1A47A 3BSZL 4NZRL 1GZPB 4NQCD 5T3ZE 4FHBD 4IDJH 2YBRB 3WJJC 5MENA 5DTFA 3WS3B 1IAOB 1JNLL 4OLVL 1FN4A 1YUHA 4LLQA 4BK5A 3GM8A 2AV7A 2X6MA 1I1CA 1FG2B 3IDNB 3LDBC 3O2DH 2F5AH 1RY7B 1YNTB 3QB7C 5HYSB 3OKKB 4P46D 1NFDF 2HRPH 4XNMA 1KXTB 3ARFD 5T1MA 4XVTH 5FYKL 3N1MC 4MSWA 3LKSB 2EE9A 1B6UA 3N1FC 2KKQA 4H5SA 3AS0A 5DA0B 1F4XH 5ESVA 3MLSL 5TF1H 4S1QH 1A1MA 3MJ8B 4PJ5E 5HVHB 5DT1L 4POYA 2YR3A 5I73C 2Z31D 2DLEA 3D39A 5FUCC 3ZKSD 1JK8A 3JVGA 4NDMA 1J8HE 4U1HA 5DMGC 4GRLD 4G6FB 3VG0H 2XZQL 4KY1L 2DWEB 1BZ9B 4NN6C 5B8CB 4OCYL 2XNAB 4MAYA 3KPQA 1P6AB 1J9CT 2HWZL 1IC4L 4HWBL 2R1WA 1JL8A 1RZKH 3U1SH 4AIOA 5TFSL 4L8SC 2F5BL 2IBZY 3BIKB 3LV3A 5IBTH 4G8IB 4M7KL 3Q6FB 5B4MC 5FYJL 2A83B 1QVOB 4PB0H 2C4XA 5EU6A 3G6AB 3RNKA 4PPTA 4DZBA 1INDL 2ZCHH 1JNJA 3FQNA 1MOEA 5IROC 4H25B 4XPAH 5I0DA 4DK3A 3MRRA 1I7TB 5JOPD 4F37K 3DECA 4LAJH 1QO3B 4BSVA 4IRSD 5GJTH 3SDXB 5C0RH 3NA9H 1JPTH 4E0RB 2EYRA 5EA0L 4RMUA 4KZEL 3V5DA 5I6XC 3GSVA 1IFHH 2JB5L 2WWKO 1RK1A 1CBVL 4FQHA 5B39G 1KJVB 4ZAKA 2DOCA 2R0WL 3KLSA 3IFNL 1CD0A 5D6DA 3VXUD 2V2XA 4ZTOH 2R23B 1C1EH 1DEEA 3CK0L 1RUPH 2IPTL 2NXZD 2DLGA 2GY5A 1U8LB 5IOPA 4IRJD 1JFQL 4J2XA 5HTSA 3QEQD 1QRND 3N9GH 2BSSA 3LZFL 3CMGA 1A4JA 2FATL 3O0RL 1A7RH 3CFCL 5L2KE 3ARPA 4OFYA 4XAKD 4OZGA 5EZLB 5IT2H 1KJ3H 2XOTA 5I1JL 2UY6A 2FX8L 5HYIA 3FOMA 1E4WL 4QHNA 1D6VH 1LO4H 5FDWB 1A9EB 2EICA 3PWPB 5TQ2H 1OTSC 1P7KA 3W0WD 1ZWIA 3I6LE 3Q0HA 4FXGB 1A9BA 2W91A 3FQTA 3QPXH 3LRSA 3MBEB 2R69H 3NZHL 2CRMA 1A6UH 2D03L 4S2SB 4KHXH 5EIIA 1NBYB 1NC2D 4GW4B 4KGJA 4K9EH 1QKZH 3ARRA 4OZFB 2J8UA 3BPLB 1MQKL 3CSYA 2VL5A 3ULUD 5K33A 3X13A 1S9YA 5CJQL 3MODH 1RJLB 4P48A 3STBA 4PJ9B 3TVMC 3CX5K 1I3UA 4RGMC 2HP4A 4HWEL 3D3VD 4BKLB 3FONB 2P43B 3RZCD 5SWZA 3ZTNL 2QLVB 2EIZB 1RU9L 1I1AD 1RVFH 2M1KA 2VH5H 4HXAH 3WHE1 1VHPA 2X4SA 3L3KB 5HDBF 5D5MA 3MV11 3DVGA 1NDGA 1T04A 1RD6A 1OAKL 5ERWB 4OFYD 3RWDB 4ALAL 4PJCE 5KANG 4ORGA 3L3IB 1D5IH 4P0DA 3S36L 4Z7UE 2Q87A 1WIUA 1G6VK 4NHUA 4WFGE 4AIZB 4OSUL 2F8VA 3WIHA 1R5VB 2J8HA 2DQEL 2DM7A 2X4OA 4S1DC 3SKMB 3BWAA 4Y4FC 5C2UB 1ZHLB 4P2QA 5DC9B 4XNXH 4JANB 4H88H 5HY9B 4Y5VC 1XCQB 3MRMB 1MFAL 5IW1B 5HBBA 3WO3B 4X9HA 4WWKD 4M1CC 5DEZA 3AAZA 2BZDA 4DW2L 4I0PD 1CF8L 2DKUA 3TZVC 1SVCP 4S1DD 2BCKB 5JDJA 4LSSL 3V8CA 4C54A 4P46B 3HG1B 4ZS7H 5SX5K 4K2UL 3BDBA 3QH3B 3CVHB 4YIQA 5GRVL 5KJRL 3O9WB 1CFBA 3LD8C 1PBYA 4JRYA 1PLGL 4LASH 4RX4A 3ILQD 3L7FA 2QSVA 1CGVA 5AZ2L 1DSFL 4XPHL 2JLLA 3CPLA 3ZDXE 1MFCH 4AEFA 1TVBA 1CE1H 3FB8A 1T21A 4UU9B 4V2CB 2F19L 1IGCL 1QLFA 1ZAGA 4F2MB 2DTMH 3CH1B 4XCYB 3V95A 3W0WE 1FO0A 3F5WA 4X8JA 4HV8A 3ECBB 1FGNL 2MOVA 2XZAH 3EYFB 2P8MA 4Y5XA 3V4VL 1ZMYA 1CXLA 2VNCA 3SDXA 1QA9A 2GFBB 5FHAH 1U3HD 1ZKAA 2VXTL 2R4SH 3KLAB 5DK2B 3FFCB 3P4OA 2AJUL 2V2WA 1X5LA 1A0QL 3SJVB 4RRPG 5F8QC 2DI7A 4A6YA 5BS0B 1JNNL 4PY7A 1S7QA 1YMHB 4QY8B 3WMSA 3BQUB 4YGVA 1T2JA 2NW2A 4O4YL 3O2WL 5E03A 2WBJA 2X2YA 3O2WH 4ESKA 2PTVA 3AS3A 1MHHA 3IGAB 3J8F7 1CGSH 3UTTD 1NAMA 3CUPB 2DQEH 1D5MA 3EHBC 2XKNA 1T89A 2IGFH 5DRWA 4XCFL 4NJ9L 4HS6A 1X6LA 1MCOH 1KIQB 3TBYB 2G9HB 4KHTL 3HS0B 4ZD3L 4NM4H 1NC4A 3RWIA 4J3XA 4JKKA 3BJLA 5CP7A 3T1FB 1J1XH 1RK0A 4F7PB 4XPHH 4EZMA 4NKOA 1SYVB 1W0VA 2X89D 1MCOL 3ORJA 4TVSa 4X5LA 4XVJH 1HSBA 3AROA 3BGMB 1CI5A 2D4FA 5E56A 1BZQK 1J1XL 1FNHA 4XMLL 1FFPA 5I1CH 5D7LD 3BZ4B 2ADFL 4G6MH 1MVUB 3MREA 1T5XB 3JV4A 4FQ2L 1VFBB 3HC0B 1R5WB 1FCCA 2ZG1A 4YDLB 1HK6A 2DQTH 3QDME 4O4YH 4AZ8A 4UILH 3AUVA 4NQSB 3HUJA 3MXVL 2YA1A 1DEDA 3WFCL 5FHBL 5AYUH 4JFPA 1EERB 3DSFH 4L29B 4LKXA 2J3SA 2VXQL 5DD0L 2VLJE 3GSRA 4YZFF 3K8LA 3NAAL 4A2LA 5I8KH 5DD5H 3MFGB 3T0DA 2PETA 1TQCB 4UV7L 3KPRD 3BP4A 2D3VA 3IAPA 3RWEB 2FJHA 3OXRB 5C6TH 4U6TA 1CLOL 1QYGL 2P49B 1I1YA 4RFEB 5CD5C 1TLKA 1KC5L 1KJVA 4KWUA 1A14L 5BS0D 3B9EA 3MGAA 3FOMB 1NDGB 3PWVA 4P3WA 1AD0B 3FRPG 3DV4A 1HHKA 3VXSD 3W0WB 5GS0D 2GSIB 1G7IA 3E1F1 2CUHA 1MY7A 4PRNA 3DOSA 1UH2A 5IMKB 4QF1B 5C0BE 1QFHA 5ANMB 3S96B 4X6EA 1K8IB 5ISZD 2PYEA 2YPVL 3SKMA 3FQWA 1HWGB 1DCLA 5CZVH 2VDQL 3MACH 4UOW0 3RGVD 5IJKA 5ADOH 4IRJB 2FO1A 1L7IH 4Y5XC 1LVEA 1UVQB 3T0WA 3BIAX 4ODWA 5J3HC 3RKDC 3BRGC 2G9HA 4C4KO 1Q1JH 1KTKE 2YBRA 4M1GH 4LL9A 3BXNB 1TXKA 1OOAA 1XF4B 2D31A 3GHEL 4MNGA 3PWUA 4HGWB 4DTGH 5JZ7C 3VFSB 2E6QA 4LP4A 4YHPB 5IMOB 4CVWA 2E9WA 4U1MB 1W72B 4MD5B 3U9PH 1W72L 3MLVL 5A2FA 5HPMA 1F11B 3VXPA 1ZLVK 1G6RH 2VH5L 4JCLA 4EN3A 1A6ZB 4LLDB 1P5UA 3LMJH 2EE6A 5BVJA 5D1ZD 5EU3B 3OHXA 1X5ZA 4YE4L 2A9MH 4XNZC 3VXSA 4KY1H 1NBZB 1A6TA 3MODL 1RVFL 2ITDB 1A7RL 4HXAL 1QFUH 1RJCA 5E6IC 3QI9D 5D8JL 1JVKA 1JWUA 3CFIC 1FZKB 1JFQH 1RJYA 1MLBB 4KJYA 4P57B 3KS0H 1LE9A 4GBXD 5KVEL 5DHYA 4JAMA 5CZXC 2NY5L 1IEAB 4LHJB 3CXHJ 1ZGLB 1N64L 4YHPA 1ZLSH 2VDOH 1MCJA 5FGSA 3MO1B 3INUL 3H3PH 5EORH 4XMPL 3D3VB 1KPRB 4MDJA 4G42A 4RGND 1KTLA 4HHAA 4ZQKB 1I85A 1WSST 3RDTB 4XX1E 3FQNB 4GAFB 5FUZL 2OR8A 3UEZA 5CJ8A 1WAAF 2WWMC 3QUXC 4D8PA 5KVDH 4JFQA 2NXYB 1F4WL 3F7VA 4EXPX 5MEND 2ZNXA 4LCUA 4PJXE 1JYNA 4O51A 5TQ2L 5B38A 4LPWA 1BQLH 4DKDC 1UKSA 4K3DL 4FQHB 2AQ2A 5A2KH 5INCB 5H35A 1FNAA 3MRNB 1AGBB 4HF5H 4Z7NE 2G5BB 4PP1C 1O7VA 5J9PB 3EJJX 3WJLA 4P5TC 1OY3B 4GKZB 4P4KC 3C09C 3FAWA 3NABH 2VQTA 4QRSB 2XZQH 3S3JA 1PQZA 3RZCA 2P24A 1VEPA 1C08A 1NUDA 4MJ5A 4JFEB 3SE8L 4G9FE 5CLTA 4AQ1B 1BFOA 3VWJA 4JFXA 2BY3A 3R1GL 1N3NB 3OZ9L 2G2RA 5JNYB 4F7CA 1WTGT 5DRNA 4JRXD 4QRPB 2F5AL 4U6YB 1MREL 4RGNC 1YY9C 4NSKB 4LCWA 1HSAA 4PY8I 4JN2A 1VPOL 2F5BH 5D1QD 2VIRA 5TE7L 1IQWH 4P23B 1YY8A 2MFNA 1TETL 1WCQA 4P46C 4Y4KD 4EDXB 5DVMA 3WNLA 4Y4HA 5KN5B 2P5EA 2VLKE 4QXUL 3S36X 3DXAE 1L6ZA 3GMQB 3FRUB 4N0YL 3RVWC 1T5XA 3JV4B 4GRWB 4JR9H 4JY4B 4OLYH 5ITFA 2DIBA 3Q6GL 4HAFA 4LHQB 1KENL 2FX7H 3QULB 2NMSA 2GK0B 4E42A 4DK6A 1RFDL 3U46A 3T65A 1RPQA 2BSTA 1OQXA 1MJ7H 1FNSH 1NGXB 4F3FB 1PSKH 2P7TB 1WWBX 4KI5C 3UTSA 5JW4R 2QBWA 1VKXB 4X4ZA 3MA7A 1FG9C 4L3ED 1L6XA 4ODWB 4J3WA 3S37X 4WY7H 2NX5B 4XCEA 2IQAB 1HSAB 3GNML 2R0ZL 3WEXB 1IGIL 3GSOB 1C12A 5TJWK 5JUEH 2X9XA 1MHCA 2CXKA 4HKJB 6FABH 4JG1H 3DMMD 5B38B 4G6JL 4FABH 3ARZA 2VXUH 1YMMD 2BX5A 4WI9A 4NHUB 3QIBC 5JXEA 5FEBA 2HRPL 4PJHE 1GSMA 1RSFA 3D25B 4KMQA 5I74B 4MLSA 1Y18B 4HCRL 4Z7WF 1VENA 2O5YL 4EVNB 2X4QB 5F1KC 1EFXD 4HUWA 3OKOA 5AUMB 4I18A 4Y2DA 5F88A 3UJIH 1YECL 3D48R 1OARH 4WI7A 2JTDA 5DEGB 4OFKA 4HIJA 2P8LA 4O58H 1U8OB 3HZVA 2DIJA 4KFZC 3IKCA 4MXWL 2YK1H 4AT6A 5DK0A 4GG8A 5D71H 3LKNB 4PJ7E 4CUCA 4OZHA 4JO4H 4UQ3A 5ESAA 4WENB 3AY4A 3E2HC 5GRZA 1K3IA 4XP5H 5ICXB 1VFUA 4HUXB 1NLBL 3IKKA 3OR7A 1N6QL 5E0QA 1Y6MR 2HKFL 2FR4A 4JZJA 5J1TC 3R06B 3HMWH 3W2DH 5CP3A 5K9OB 4K7FA 4EI6B 4KTYA 1P1ZA 5F72S 1WTLA 1FFOA 1XGRB 1OAQL 2W60A 5T5NF 4YJZL 1NKOA 1A5FL 5JHLH 4H1LA 4TUOB 4JY6B 5DD1H 1NH6A 3H9HB 4JQXC 3HR6A 3CFKB 5AAWA 4OZIF 4ZYKB 4WFED 1TQBB 4PG9B 5CEYA 1F8TL 1XF4A 4HK3N 1Q9OB 4N9GB 1EHLL 3VGFA 4M1DH 4Q97A 1RZ8B 4KMTL 5EUOB 4JN1L 5HDLA 2P44B 5IHBA 1NGWB 1Q9WB 3D0LB 3GIZH 5DGRA 2CLVB 3QJHB 4PRIE 3CUPA 3X12B 3TZVD 4K8RL 2FGWH 2NYYD 1JUFA 4M1CD 2DQGH 3K80A 5CMAB 4OLEA 1YEJL 4QGYA 1CT8A 5J89A 3DYPA 5I75B 5KSBB 4FN0A 1FDLH 3G04B 5HYJA 2OCFD 1NMAH 1E28A 4M48L 4PLKC 43C9A 1CFVL 2P8PB 3K4ZA 4ZQKA 3FT2B 1IGJA 1B4JH 1AO7A 4XVSL 1QPPA 1REIA 2V5SA 5GISL 2AGJH 5DFTA 1CFTB 2BCKA 3D39D 4OGXH 5T33H 5E2UL 2N1KA 1IEAA 4P5KB 4Y1AD 5B22A 4DCQB 2QQLH 1IC1A 3ZTJH 2F54A 1IGTB 3HRZB 4KK9D 8CGTA 3DX7A 1LD9B 4M3KB 4RSVA 1AI1H 1OVZA 5DGQA 3O2VL 1B0WA 2NTSP 4JJ5A 5FKAA 2X5PA 5FO9B 3HAEH 3TGXA 2MHAB 3BPOC 4MAYB 4PRAB 2VQ1A 4G8EA 5GRWA 3SCMC 2R56H 1YMMB 4IMLB 4PRHD 5EU5A 5IM7B 4GW1B 1T5WB 3R0MA 5IMLB 3GSWB 4PGJA 4HBCH 2F9BT 2DJSA 5FGBC 4LLYA 3F7YB 4M48H 1JK8B 5TH2B 5CEZH 4OF8A 2YD6A 3ZE2F 2O5XH 2D7NA 4FQCH 5H2BB 3MJ7A 4HZLB 3HUJF 3MCLH 4YWGL 3NTCH 4B41A 4GKNA 5IEKA 5D72L 4Y1AB 2NPLX 4HKJA 5CBEA 4WHDA 3N85H 4G8GB 4L4TB 4ZUWA 4IRSA 3NIGF 1LD9A 3SQOL 2X9WA 2J8UF 1M7XA 3W5NA 4X6CF 3U2SA 4JZJC 1I8KA 2V2TB 1M7DA 3VD9A 1S9WB 4Y4KB 3WO4C 1T2QH 1RMFH 4OUUA 3HNTH 3IDXL 4M4RA 3AY4C 1CGTA 4N0CD 5JHLL 3MA9H 5J57B 3ARED 3VRJB 1E6OL 2VDMH 5JW4N 3AFLA 4QTIL 4APQC 1I4FA 4MZ3A 4XHJD 2GAZA 5IWLA 4NQXA 1FPTL 2PW1B 2ORBH 3QUXB 1DN2A 3BPCB 2J8UE 3EDEA 3WS6A 2HLFC 4S0TD 4FRWA 4KXZI 3L3OB 5LG1A 3S35L 2XACC 2HFTA 3ILQC 4N8VB 2Q7NA 1JP5A 2XPGA 5KOMC 5ETUA 3X17A 1AH1A 3BW9A 1EV2E 5MERA 4JQVC 3NIFF 1ACZA 4Y16A 2FGWL 5JLZA 4NUGL 3M07A 5GGVY 2BSSB 2DQFB 4GQ9H 5KSBE 12E8L 4JN1H 3AXLA 4N0UB 2FBJH 5KTEH 4LU5L 2LABA 4Y4HD 1MRCH 1KCSL 3GMMA 5C07D 5ADPL 4JPVH 2P5WD 3MFFB 3GBLA 3LN9A 2YPLD 4Y19E 5LBSL 4JDZA 2DQDH 1I8MB 4P99A 3MLUH 3RVVD 3NCCB 4XPFL 1JCKA 5F93C 2R8SL 4MNQB 1DANU 2GJ6B 5CJ5A 4PJ8A 3W11D 1MCWW 4DN3H 4PJAE 5GS1C 1KYOJ 1J86A 3HPLA 3MMEA 2C3HA 4PJFA 3AS2A 1RUML 1IC7H 3VXRD 2XQBH 4N1CA 3MJ9A 3OTTA 3OGCB 3VWKA 2YK1L 5IK3B 5E8DL 4UTBL 4OD2B 3WDJA 4OZIA 2KZ1B 4YHLL 1D6EB 1ZEAH 1JF6A 1G9NC 1MY5A 1T0NB 3MUGB 1TCRB 4RAVB 1I3VA 1CDUA 3BGAA 4EUPH 4C4KT 1FLTX 3K2MC 4Z5RB 3BHBB 4MXWH 4YUEH 4N8PA 3GI8H 3TBVB 2E7MA 3QUZC 2XY1A 4N0FB 3NVQA 1KG0B 3QFJA 4PRIA 4WJ5B 3MJ9L 3ALWA 3LAFA 2O5ZL 5J4MA 2EO1A 2Y6SD 3WLBB 4U1GB 1T04B 3B2UC 3JUYA 4Y1AE 1XZ0B 5IBLC 2XWTA 4ZOAA 3DRTB 4FFYL 5FYLL 3NFPB 4PRHB 4XWGL 1GGTA 4RFEA 1DUZA 1YNLH 1DQTA 4MCYA 1I7UB 1OAQH 3T0EB 4G9FB 3RA7H 3Q5YA 5DURB 4POUB 3FQRA 3BWAB 5FKAB 3W2DL 4UTAL 2BVUA 5FAAA 2KQNA 4PJBE 2BXYA 4ZNEE 1ONQB 3ARDC 1E4XL 5F7EH 5T3XD 3MGOB 2V5YA 1GIGL 3FN0L 3LQMA 3GSQB 3MRLA 3VFTA 1U92A 4QHMB 1G84A 3TPUA 1YEIH 2F74A 3ZMRA 3ROLA 1KB9K 2AXGB 4R2GB 4HKZB 3B9KC 1OAZH 4U1IA 2PTTB 3O6FD 5IMMA 3DO7A 2A74B 4X7SL 4L4VA 1KENH 2X44D 3NCYS 3W9EA 3B43A 3GSXA 2Z8VC 2UVEA 1NPUA 1DLFH 1U8KA 3VXOB 5HYSA 1CDYA 2CLZB 5J6GA 4J6RL 1EEZA 4LEXL 4OLUL 1MCCA 2VAJA 3UTTA 2NW3B 2E7HA 3QIUC 1NSNH 3F7RA 2X1XR 3MXWL 1WBYB 1E6JL 1SY6H 4UUJB 4S10A 3R1GH 5J1AA 1MAML 5C70A 4N5ED 1QSZA 4YHYC 6FABL 4LEOA 4QRRA 3UYPA 3RWFA 4O51B 3C5ZA 1A6WH 1KBGH 1VESA 2HG5A 4F9LA 3IXAB 1R5IA 3LS4L 1HHGB 4P5KA 2ZOLB 1HDMB 2I07A 5MEQA 3FQUA 3P9LB 4NKDB 4JY5H 4R4FH 2L0DA 4LSTH 5IQ9A 5DJ2A 1SEQL 1SJEB 5F6IB 5C09D 1N26A 1KJ2B 5JIPA 1NCBL 1J1PH 1S9XA 4HD9A 3MRMA 5IW1A 2X1WL 4F7EB 2RB8A 2OR9H 1JPSH 3H9SD 4WW1A 3NCBB 4ZOBA 4MQTB 1UENA 2WWMD 3QUXD 4ZUUB 4ISVA 2ICWJ 5IB3A 4KUZL 5FFLA 1F97A 3TZVA 2ZUWA 1ZLVH 3CSBA 4APQD 2NY1C 3UJJH 3ZO0A 1B4RA 1Q38A 3GMLA 3HZMB 5HHOB 2NY3D 3E6HB 5A2IH 4NQDB 1QSEA 1PEZA 2NY6C 1X5JA 4MS8C 5EDXA 5C08D 2AEQH 3PWNA 3IKCB 5GGTH 4JN2B 4L3AA 1IBGH 1NANI 2VDLH 3ULVF 4KROB 4LHUA 4QRTA 1UEYA 3MTRA 3STZB 2NY5H 2BP3A 4D9QD 2HFFA 4L3EE 5E8NA 4I0CC 4AH2B 4I3RH 4PRPA 4HEPG 5C0CB 1CDHA 4OTXH 4OQTL 1I8MA 1QFUL 1S9VB 5FYKU 3IDGA 4DN4H 1HHHB 5E2WH 3UTSD 1JGDA 1LO5A 2WIIA 2WINA 3ZT5A 3NIDE 5D7JA 5I1KL 1KJ2H 1YDPA 3QUML 3C6LA 2YD1A 3FHAA 3DUUA 4HF5L 2HYMA 4X6CB 4JFEE 4L3EB 4OM1H 1RHFA 5FM8A 1WZ1L 4ONFH 2NXYD 2GI7A 1I75A 2UY7A 2IPUG 3L1OH 5JOFB 2XKUA 1EDQA 4BZYA 1GOHA 2HLFD 1F11A 1ZV5A 1UC6A 2VRAA 4PRHA 3ZKXB 2VLJD 3HZKB 4OIIL 1G9MC 5CILL 4O5LL 3ZKXC 2X4NA 4OAWA 2XTJB 5DVNA 1VACB 3C5JA 4JB9H 4L8SA 2P5EB 1V7MH 3IFLL 2UZYB 1R3IL 3GIVA 3O6FA 1ZS8B 2H26A 2CO7B 3REVA 4XX1G 1JRHH 1N2RB 3DARA 5HHQB 4Q74A 1BFVL 4Q9QH 4AM0B 2GEEA 2Y72A 2R2BA 4FQQA 4Y8AA 5GRVK 5CSBA 1H5BA 3LEVH 4OCNC 5T1LD 5I71B 1YQ2A 4HIHA 5C0GB 3BHBA 1PG7X 3GJFK 4H20H 1WZLA 1PGRB 2CKNA 5CD3B 1HXYB 2MQ3A 4PJBA 2P5EE 2VLKA 2VLRA 4LKXB 4YBLB 3Q48A 5IF0B 2PO6C 5C0IA 5HYSG 3JBG7 1S7WB 1TIUA 1F58H 4R9HA 4RCAA 5C6TL 2H6PB 1A7NL 4YHKL 3ARDD 3QPQC 2FWOB 4Z7OE 5DMYA 3VMPA 3QZWG 3BQUC 4N0FA 4HT1H 3NGBB 2PTTA 3BIBX 4MSWB 4XBPB 4KK9C 2CRYA 5K9QI 2NY7L 4M6MH 3G5ZB 3U79A 4NO2B 3FT3A 5I15H 1EX0A 4HIHB 4KRPB 4HUKB 4C83A 3AB0C 3WFCH 2XN9D 3U4BH 2BNQA 1MCPH 3MUJA 5A3ID 4WI6A 1QPXA 3SDYL 2PXYB 5C08B 4TYUA 3QUZB 4Z7OF 1M6OB 1QR4A 3AXLB 1Q9KA 4L3EA 5A40E 1SEBA 3TPKA 2VAAB 3H9SA 3ISWA 2ADFH 5F6HI 3U4BL 4HPYL 4LMQI 3MRPB 1CLCA 4R7NA 5EFIA 3CVIL 4JQIL 3MRKA 2WV3A 4NRYA 4OGAC 4XRCB 5ITFB 3HB3C 3F65A 3WKMH 4NWUH 4I5BA 3ZE1E 4UDTB 2O26U 4Q6IC 4IBLT 4F7MA 5DHVH 3EUUA 4A6YL 5C08E 3WXWH 4N1EA 4M5ZH 2B5IC 4RISL 3O3EA 4P23A 4YHKH 3RAJL 2F19H 4XCCL 4R90H 4J3VA 1ACYH 5FUOH 1PEWA 4LMQE 2VDRL 3AVEA 4LCWD 3R8BB 3BVNB 4QRPA 4L5FH 5BRZA 1QRNE 5JW3L 1OT1A 4PJ7F 3EFFB 5E2VL 1BOGA 4RAVA 4ZYKA 1A6VL 1MHHB 3MRJA 3C87A 4TNVF 5FV2A 4O2EA 3QEQB 4MXQC 1TZGH 1JHTB 2X70B 3BP7B 5CINH 1CGWA 1CL7I 5L9DH 1D9KB 4LNRA 4K8RC 5DFVC 4XP6L 1RZJC 1MFAH 1VGEH 2VWEE 4F7EA 1T2XA 3D85A 5JW3H 4MCZB 1WAAE 4JFHD 4TQEL 1BIHA 4WV1B 5FHAL 5GGVH 2R4RL 1MEXL 2QQKH 5HYJB 1CD9B 1KCVH 3V0WH 1KCRL 2PKDA 4F58H 1CVRA 1DSFH 5K59F 3HE7B 4O5LH 1VGKA 4RQQA 5B38G 3TA3C 4Y5VA 1DL7L 4MA3A 3NMEA 1EBPA 1NMBL 5CBEB 5C3LD 1QZ1A 4NO3A 1I9RL 5FYLD 1BIIA 4I2XA 3ZDYE 4RMSA 3BDXA 4X80L 4I0PB 4R96A 5JXAH 1CF8H 1MFBL 1ZTXH 4N0CC 4NGHH 1J0YA 1MF2L 4ODTH 4HWZA 2UUDH 1NGZA 3ARSA 3VXUE 5EOTB 5CINL 1LILA 5C0CE 4QRQA 3GSXB 4I5BB 3OJVC 2KDGA 2H32A 1ZT7A 3WXVL 2AJUH 1RJYB 1TZHA 2X4NB 4OAWB 4F7PA 2NY2B 4KKAC 4K9EL 4DGVH 2XT1B 1ADQL 4XP1H 2AXFB 1U95A 4R0LB 3HR5B 2Q86A 1EAPA 4XAKE 3DURA 3O6MH 4X6BB 3SDDC 4CL7A 5DQDL 5DS8A 4CN4A 3VXNA 4OSUH 2I5YL 1H3UA 3G5XB 4FZEH 4UQ3B 1FNFA 5IB5A 4KROC 1HHHA 3J7HA 3SHSA 1B6DA 3LKOB 5DD3L 4OI8A 1MUJA 4PG9A 2P45B 4HWEH 4CW1A 2C5DC 2VWEC 4JRYD 4DKEL 5I1JH 2P8PA 1LNUA 4TN9A 1EAJA 1AXSB 3O0RH 3HLAB 3THMH 1KN4L 1ZT4A 2BVOA 3MRFB 1KPVA 3W9DA 3MYZA 4NRZA 1N7ML 2V2WB 3SJVA 1CWVA 1NGPL 2P5WA 4K3JH 2BNRD 3AAZB 1FJ1B 1MCPL 5FKPB 5TGBA 1BFVH 3NA4A 2PXYA 1OGAA 1G9NH 4HDIA 1EIBA 3ELAT 3MRDB 1DE4B 4HK3J 4LNVA 5D7IF 1P69B 2OTWB 1IBGL 3WFEL 3CU1A 5DXWA 2XWJB 2VUYA 3HG1E 4KKNA 4MA7L 1T7VA 5FO9A 2B2XH 2IBGA 4Y5YB 3NZHH 5CJBA 4YBQD 5E8OB 4AENA 3V9FA 2EYTB 2IQ9H 4BH7B 2NX5A 4AEHL 2UWEB 3ZHLA 4BYHA 5JHDD 4Z7WA 2JF1A 5E9DE 1GGBL 5KOVC 5IB4B 1N8ZA 1HZHH 1ORQA 5MHSE 1UCTA 2ZG3A 3DYOA 4NN5C 2H6PA 1FZOA 4M8QB 3LZFH 4MD0B 4PP1D 1MH5A 2FB4H 5B3JE 3O4OB 1EVTC 3PQYE 1CFSB 1J8HB 3JVGC 4X6DF 1J1PL 3MRCB 1MVUA 3QO1B 2P46B 4CMMA 2NXYC 5I30H 2VLRB 1IAKA 2E5EA 1DQML 4PJ5A 2IPKA 2LTQC 4EXKA 1ZGLA 5GGTA 5DQ9A 5GGSA 5I19H 2EDXA 1NCCL 3LKQB 3VG0L 5MHSD 5C0EB 3BRFA 3TLRA 1S7RB 1C1EL 2BVPA 3RGHA 4KVCL 3NA9L 5DJ8A 1F2XK 2RHEA 3UYOD 4AG4H 3MV8B 3GKZA 1R6VA 1YN7A 1GGCL 3V5DB 4PJXF 1HHJA 5C0DB 1Q94A 3QWRD 4MCZA 4WFGD 3PWLB 5SX4H 4GMTL 3O2DL 4JM2D 2GHWB 3CC5A 5HDBE 5BZWB 1NGQH 3O41B 3SEPA 3HCVA 5TFSH 1XEDA 5TDNA 2IFFH 3BZFB 4ELKA 4URTB 4F80A 5L8LB 3BZEB 2NLJB 2DIAA 4EJ1C 1FFNA 4OBSA 4LLUA 3X14A 2W0PA 3G9AB 1W8NA 4R3SB 5IFHL 5AG9A 4P2RB 5JMOC 4GG6A 4JO2H 1WFTA 5C0JB 4TSBL 5D1ZC 5C1MB 3QUMH 4JPWL 1JPSL 3EZ8A 4YK4C 1SYSA 4LQFH 5F3BA 1T7YA 2PW2A 4YNYB 3K7UA 4CJ0A 1RULL 3HN3A 3VXRE 4KAQL 1JGEB 3MV9D 1E4XH 4RWYH 4KDTA 3VWKD 1QEWA 5C8JA 3B3IA 5T1KD 3SDAD 2BRRL 3VFWA 2BSRA 1ZA3B 3LKRB 3MBEA 4JRYB 1A1MB 1CBVH 4QHUB 5J13B 2CGRL 1T1ZB 4UTBH 3CFJA 3KPMA 3RY6C 1CYGA 3IRPX 2ADJB 3SY0A 4X9IA 4HJ0D 1WWAX 4WV1A 4NO0D 2IH3B 2JJTC 1MH5B 5I6XB 1SY6L 1A7PL 1RUAH 2RIKA 3DNKA 4RRPA 3SE3A 2AK1H 1JPGB 1IM9D 1UVQA 3MJ9H 4XWGH 3RTQC 3PP3K 4TVPD 4GKSA 4U6VL 3H6JA 4NQDE 4CRPA 1A3LH 3TZVB 1DUYA 2K7PA 4IMKA 3RUGE 2DI9A 3HI1B 4BFBD 3N0PB 4DEPB 1AY1L 5GZNC 4X6EB 3OB8A 1HOCB 3B9VA 1NBZA 2KH2B 4NNXB 1V3KA 2EXWC 2HT3C 4Z0XA 1M71B 1A9BB 2Z31B 4XP9H 5GRXG 1UKQA 1C5CH 1QO3A 3CDYA 2AS5M 4Y4FB 2Q1EA 5ETUB 2LE9A 4J1UA 4JM2B 5EWIL 3UTSE 2V5MA 1ZHBA 3QDGD 2C3WA 2JJTA 1BVZA 1G7LA 4JKPH 4ZAKD 1DQDH 4O2FA 1CL7L 4H25A 5I1GH 4M43H 3D9AH 3O3BA 1CLZH 2GTZA 3PXHA 4YFDB 1A6PA 4OT1H 1MFEL 3PL6C 3MQIA 4QTIH 3LRHA 4P9HH 2B0SH 2VISB 4PBVC 4G43A 2CDFB 1CG9B 2F54E 3IDXH 4ZXBC 1EJOH 5KSUA 5DFVD 4FNLH 3QCVL 5E6YA 3WE6A 3MLUL 1U8JB 4XXDA 3TIEB 5BRZB 2F53B 4NDMB 4YC2B 1DLFL 3WN5A 4N8CL 3U7WL 2WBKA 4RGMB 4HIIA 1A7PH 1RUAL 4IRSB 1KEMH 5E70A 4JFOB 4XWOD 4NHCH 4JRWA 3F6LA 3GSNL 4OFDA 3CNKA 1YJDH 5ISZE 1A7BA 1AGDA 4Q2ZA 2J6EA 1WWCA 2Y36H 1TMCB 12E8H 3EO9H 3G08A 3WIHL 1GGIL 4GRMB 4LNRB 5HDOA 4UT7H 4WEBH 3DGCR 2A77H 4Z0BL 2Y1VA 3MJ8A 4R7NB 3RDTC 4GAYA 4K7PH 3LV3B 4XNUH 1GIGH 3P73B 4YHLH 2YOCA 3EGSA 4ZO7A 5LXGH 1I4FB 3TNMA 3OAZH 1IAMA 3C6SB 3MA9L 4KAQH 3SDDA 4CJ1A 3GSNB 1ZLUK 4HIXH 4ZO6A 3RWCA 4FFWC 1D7FA 4FMKA 1FPTH 1AGEB 5DMJB 5T1DH 2I27N 4MB4A 5IVOA 3WNKA 1M1SA 3EJYC 1TTUA 2NQCA 2R2HA 2H3NA 1IAOA 1RUQH 3HNTL 1OTUC 3QDMB 3RY4A 2MPAL 3VFPB 1JYWA 4FFYH 2GJ6E 3SCMB 3P30H 3S35X 1AC6A 3QYCA 4L4JA 5FGBA 1LP9B 4Y16C 3ZKMD 3IRZA 1PYWB 2FSEA 3OKDB 4JPVL 4M6OH 5E2UH 2ZJSH 5C0IB 1H8SA 3MYJA 4KC3B 2FBJL 4BSVB 3FQXA 5C0DA 3CFDB 3GI8L 5J9PA 1AJ7L 5DHXB 1A4JB 1DVFA 1UCBL 4WFFD 2WWKT 1GGCH 4KVNH 2EIDA 4XCYA 4HH8A 3L5IA 3O9WC 4OD1H 1N8ZB 3P4MB 2BMKA 2YPKA 3FT4A 1S7RA 3TBWB 1JV5B 2O5XL 3C5SB 3RDTD 2R0KL 3MGTB 4QWWD 4YQXL 4HUUB 4FQJH 1AHWC 4OD1L 5I19L 1CQYA 3B9DA 3RHWK 4X9FA 2XNAA 1BECA 1IAKB 2X10A 3MRQB 4ZXBA 2AEPL 5FM4A 1I9JL 4JRXB 4UINH 1FE8H 1GHFH 4JFPB 4OLXL 5IKCA 4XBEL 5I1EH 4IRZL 5I76A 3SPVB 4L1HA 3S37L 3BKCL 3AREC 2OM5A 4P5TB 4PRHE 4V1DE 1Z9MA 5J6GB 4RGOH 2HFGL 5FA4A 3SKNB 4P2RD 2DQDL 4NKDA 3BMVA 1YA5A 5LBSH 1RIHL 1T20A 4YXHL 4LBEA 5EU5B 1AFVH 2ENSA 3GHBL 4TNVK 3FZUD 1JWUB 3U7AA 1A5FH 3QNYB 4PGCB 1MPAH 2NZIA 3HI1A 2PN5A 4KKCC 1MVFA 4V1DD 5E94B 4ELMB 3TO4A 5I8OL 5EBWB 1DDHA 4J8RB 2ED8A 3BEVA 5IHUH 3WDIA 4GXVH 4H1LH 3MCLL 3BKYL 4Y7MA 4KQ4L 4X98A 2D7TL 5L2KB 2AV1A 1MFDH 3TJHD 4MVBD 2VR4A 4JZNB 3TJEH 3SDCA 4TNWF 4K8RH 4XP4L 3JWOL 3VG9C 5I8OH