4LO9A

Human p53 core domain mutant n235k
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
194
structure length
194
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Structures of oncogenic, suppressor and rescued p53 core-domain variants: mechanisms of mutant p53 rescue.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 46
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4lo9A00
3WTVA 1KZYA 4LOEA 2AHIA 2J1XA 2RMNA 5KBDA 2BIPA 2P52A 5G4NA 3D05A 2FEJA 4AGQA 3WTUA 2XWRA 4IBYA 5ECGA 4AGPA 1EANA 4KVPA 1IO4C 2J21A 1TSRA 1HU8A 3D07A 3IGLA 1HJBC 2X0VA 5AOLA 2X0WA 4A63A 5AOKA 4MZIA 2XWCA 5G4OA 3QYNA 2PCXA 2J1WA 5BUAA 2ADYA 3US0A 2MEJB 4AGMA 3KZ8A 5AOJA 2H1LM 5AOIA 3ZMEA 4AGNA 3WTTA 1T4WA 3D08A 2BIMA 2IOIA 5LGYA 4IBWA 4L0YA 4IBTA 3WTXA 4QO1B 4G82A 4IJTA 2J1ZA 3TS8A 3EXLA 1YCSA 5AB9A 2ATAA 4HJEA 3WTSA 1HJCA 2X0UA 3VD0A 3Q06A 4GUOA 4IBZA 2GEQA 5G4MA 4IBUA 2VUKA 2BIQA 3D06A 3WTWA 3KMDA 1GZHA 1EAQA 2IOMA 3QYMA 1E50A 3EXJA 3VD2A 3D09A 2IOOA 1CMOA 2J20A 3D0AA 1LJMA 2BIOA 2J1YA 1EAOA 4MZRA 4AGLA 4IBQA 1H9DA 2YBGA 3Q01A 1GZHC 3WU1A 5LAPA 2J6WA 1TUPA 3IGKA 4LO9A 4GUQA 1CO1A 4IBSA 4L0ZA 2WGXA 3WTYA 3VD1A 4L18A 5AOMA 4G83A 3US1A 2OCJA 4AGOA 2AC0A 5A7BA 2BINA 4IBVA 5ABAA 3Q05A 4XR8C 4LOFA 1UOLA
chains in the Genus database with same CATH superfamily
3O4OB 1EO7A 5HVFB 4KK8C 1KY7A 4Z7VE 4XMVA 2GAZB 3BP7A 3GHEH 3MLRL 4N85A 1NBVH 3NCYP 2PP7A 1JHLL 3GFUA 4G8GE 5I26A 4ANWA 2AMUA 3HZ3A 1AJ7L 3GSXA 1XF2A 3QZBA 3GBDA 5AVYB 5FYJE 3APMA 3T4YA 5F70A 4A63A 5A6IA 4ONGH 4AWJC 1QNZL 1YC7A 3K72A 1H5BB 2IWFA 2PR4H 3P2BA 4AJYV 1OPOA 1VRSA 3E1ZA 5B4MD 3K4ZA 1E5BA 2H6OA 3UBXB 1EK3A 5C2BH 3L1GA 1EEQA 1CLYH 4DH2A 1URLA 4JUTA 1LHZA 2APBA 3AU1A 4YMPA 4I48A 3WHXB 4P2OA 4ABWA 5I24A 1J0HA 2LV4A 5I75B 2W9DH 5FS5A 1GOHA 2X89A 3N85H 1U3ZA 4NO5B 2R2HA 4LSRL 4ZFOL 5ICZA 2EUWA 2JF1A 2BSTA 4IRZH 2DIAA 3LN9A 2CBMA 5JXEC 5HGGS 4ZUWB 2VE6B 1ACYL 3K80A 5F9OL 3UTTB 5E7FA 4EI5C 3K6SA 1U8CA 4FNRA 4R7XA 3BAIA 1RHFA 1FFNB 2X4QB 3HR5A 3IWVA 1PY0A 1XFPA 3PHOB 3BQUD 4XOBA 5DYFA 4TSCH 4IOFD 3ULSA 3ZDXE 4WFHE 2EUXA 1E42A 4KI5C 1P9MC 3GDCA 3SO3B 1UA7A 3JVFC 5GGSB 1PF3A 3HE6B 3FSZA 3LPPA 3FF7A 1Q1JH 3RUGE 5GZOA 4J5VA 5JQ6L 2M26A 2FJFA 3GSNH 5L2KB 5IWLC 2AW2A 1K8DB 4PB9H 3CX2A 5BZDA 5E08H 2ICWI 3FJTA 3K6IA 1KCLA 1KCBA 4HCIA 3DO4A 4KKCC 1LILA 2MCAA 1TJHL 3S48A 4Z5RB 2P24A 4NZJA 5LNEA 2JFCA 2DQFB 3KL3A 3QHZH 3O6MH 2R4SH 3H55A 1EJFA 2WNWA 3I50H 4XNUL 4KXDA 3V52L 2EXSA 1CBVH 2VGLM 2KPWA 2VLJE 3MV9E 1DP0A 3RWFB 4A7GF 3IMBA 4RA3A 1AFVH 1JMZA 4NN7C 2ZWZA 4Z7NB 1YEDA 1FC2D 4QI3A 4J8RB 2H0EA 3VI3A 5J11C 4Y4HC 1WBXB 4GIAA 1G7JA 2X1QA 4DKFL 2DM3A 4GY4A 4MXWH 3VQ2C 4PRHB 5GGTL 3TBVA 4AV5A 2A83A 1R46A 2AVGA 3SYOA 3AB0B 3VVWA 3VFOB 2WXRA 4A7VA 4ADIA 3X1EA 3UJIH 1IBHA 2NW3B 4N1HB 2VH5H 4OF5A 4FI7A 4OR1A 3UIZA 2YAMA 4FNLL 3PQYE 5KBMA 5EH1A 1AD9A 2IBZY 4Y4FD 1PEZA 2EP6A 3ARRA 2ESVA 3DC0A 1F3DJ 3GMNB 4JO4H 1S7RA 2EE0A 3PGCB 5BZWA 4KK8D 4M43L 3CFMA 3QG7L 2OR9L 4AMKL 4LLWB 4Q0XL 3NABL 1CFMA 4OZFB 2X4TB 2OMYB 1JRHH 1X9UA 3HE7B 5E2UL 5JHMA 2FL5A 3IVKB 4R90H 4EN2A 4YHML 1L9SA 4ZAKA 3HI6H 1D5IH 2DQHL 3JXAA 2PXYC 4PJGE 1UD6A 4JVPA 5HVHC 1X9LA 3ES6B 5DRNA 1A25A 1LEKB 5DQJA 2OZ4L 2NSXA 1U8IA 2YPLA 3D25B 4BWUA 5EIIA 3DUSB 2J5WA 4PJDE 3F6JA 4Z0BL 1FP5A 5L88L 5B39G 2EIMB 2FWUA 2NY5C 3B2VH 4AEFA 1JYXA 4I3RH 2EDFA 1F8TH 2H32B 3EOYG 3ATFA 1D3CA 4PRDA 5L0QB 1NAMB 1OLLA 1UC6A 4H5SB 5AOZA 4U6XA 3BD5A 2P5WB 3HC3H 5JXED 5CGBA 4YH6A 4GH7B 4EI5D 4YEFA 5BS0E 1NIEA 2A2QT 2VERA 3BFQG 4N8CH 4OF3A 1GZHC 5B7EA 4XMXA 1CU4H 3IMSA 1WZ1L 1JNLL 3UXFA 5LBSL 3T09A 2ROYA 5J7CC 4ZXBC 4KI5D 3SCMB 4RNRB 1X5HA 5HDBB 4QEGA 2W07B 1NCAH 3UEQA 3VXRB 3W57A 1ZS8A 4LSVL 4WHDA 1DN0B 1Q94B 1O0VA 2VO8A 2VJ8A 3VXUB 1UD4A 3AAZA 4LPUA 4UOJA 4XBGA 4KKCD 1IGTB 4JJOA 2DN7A 1C5BH 1NPJA 3KPRB 1I1AC 5BV7B 2ZXEB 5G4NA 5ICUA 4R7DA 5LGJA 4EO5A 3QQ3B 2B1AL 1UCBH 4PQXA 2VN6A 1AOZA 4N0YH 2GJZB 1BPLB 3U1QA 3UBGA 3VXSB 3QDJA 3RVXC 1D5MB 3KXFD 4NSKA 3GXFA 1MIEH 3NQKA 2WJ5A 3AXHA 3RA7L 3AADB 5DQDH 4BHUI 2HFGL 3N9GH 1DDHA 4Y2DA 3DHPA 4NHCL 5LGHL 3QO0B 4UDTA 3UOAB 5I0DA 4RMUA 4Y4HD 3IJSB 3DSFL 2HUEA 2BH0A 3E6FA 4M6OH 3WJJC 4YXLL 3FUKA 3KWWA 1I1RA 1RIVH 1EZVY 3SEPA 1FA4A 4HT1L 4EN3A 2X2IA 4PS4L 2ZX6A 3MC0A 4RBPH 4P2AA 2WAQA 1I7ZA 2OQJB 3CFJB 4FFZA 4QJ3B 4HWEL 4ELMB 2VL5A 1ZIAA 1OTTC 4DVRL 2CLVB 1NFDE 4WFGE 1E9PA 4YS4A 4A7SA 2IDSA 4P4KA 2HG5A 4CVZA 3H1ZA 5JIIA 1PQZA 3IKCB 3CZGA 5HTSA 4FTVD 4Z7WA 1PD0A 4YOKA 2VUKA 2F58L 2A9MH 4HALA 1EO8H 3WENA 1C7SA 3FU0A 3VXMD 2JB5H 2V2XB 5K9OA 4O2FA 4G7VL 3LXCA 3BZ4A 3WNMA 4KMTH 4Z7UF 3IBEA 5BW7C 4BQ9A 1R3HA 3IDNB 4KI1A 4S0SD 5FHAH 3GHPA 3H0TB 4MQXC 4AM0Q 2NSQA 2PXYD 2QDVA 3CVHB 5FFGA 2EXYC 4CA4A 2LAGB 3BKYL 2LU4A 3LKOA 1AG0A 3OKKB 1AGCB 4XZ4A 3ZKXC 1T3FB 5ACLA 3QUHA 1JZGA 4MVBC 4JQXC 2AXHA 1LDPL 2WBJA 3EIFA 3N41B 1KCUL 2DQIL 2Y06H 3VI3E 3TGXA 2OCCB 2VCOA 4KJPC 4J6RH 1RIUH 5DZ9A 3IDXL 4D7PA 1MHPH 3THMH 3QQ9C 1HL4A 2ZSWA 1P5VB 3BUBA 3OG6B 4LRNH 3MCG1 3BSZL 5EBMA 5A2LH 4RWYL 5HD8C 1NGWA 4RLDA 3ARBA 5ABAA 3V8OA 4XPBL 4Q74A 5AL8A 5E4AA 3LEVH 2Y5TA 4JPQA 3VFWA 3ULUF 3BKMH 1RUML 5KBDA 1YEGH 5TDOB 2FJSA 4H7VA 1BGXH 1C16A 4J27A 1AHWB 3RVWC 4M8RA 2CRYA 3DX7A 4M1GH 1GYAA 1KJ2L 2ESVE 3NJNA 5DMYA 4LDEB 3BPNB 1N8OE 4ZXBD 2JJUA 3LV3B 1KXQA 2X4OB 4KUCF 1K6QL 3OJDB 2HTKC 2BVYA 3GKWL 1Y18A 2F74A 2EAEA 2IV8A 1WAPA 1TTFA 2XKUA 2XQ0A 3GEFA 3K74B 4M6MH 1D5BA 5EUOB 4NUGL 4GBXB 3E8UL 3QNYA 5D96C 3GGWA 3L9RA 3AY4C 4BFIA 4CSSA 2MQCA 1XZWA 1I1AD 1WFOA 1G9HA 2C3HA 4NWUL 4WY7L 5E2TL 2XBDA 3QI9A 1ZLSL 1ZHKB 3GS0A 1MFDH 1EO5A 1PNDA 4G7SB 4Q9QH 1MRFL 5IFAL 3MOBL 2ZX8A 5D7IA 1AD0B 5TJWK 4I1RA 1F4WH 4LXFA 2APVA 3ETSA 1JWUA 1MY5A 2YPLE 3GMRA 1BJ1H 2CIKA 3RVXD 3KGRA 1OK0A 3MBXH 3UBHA 3N1GC 3QH3A 2X6VA 3D0VB 2NW2A 5AYTA 3QORA 1L0PA 1KN2H 3MCLH 4DZBB 2UXGA 1DQIA 1YEFH 1CS6A 3EH3B 3S5ZA 1I8UA 5AG8A 2ATPA 1NGPH 4APQA 2AVFA 3TBBA 3VXOA 4JFFD 4UIMA 2Z4QB 3OKDB 4JZNB 3U9UA 1N9PA 4AITA 1XR8B 2ZQKA 4HH9A 1NCBH 2UX7A 1S7UA 3SDAA 1AQ8A 5T5FL 5JUEH 3GQFA 3N42F 1NANI 4NWTL 4UAOC 1CT8B 1GIGH 2H6PB 1I7UB 4TQPA 2VR7A 4JY4B 4OI8A 1N5YL 3HAEH 2X1OA 5FO9B 1N8ZA 3DJZA 4WHTA 4JM2F 1VEMA 2G0KA 3VFUA 3HAEA 4MNHB 4PY7A 4P8QA 1OT2A 5DHYA 4UV4L 1H9DA 1QPPA 3JUZA 4MA1B 3VM5A 3FTGB 2BZCA 4XP4L 5DLLA 3RHWK 1P6FA 3QAZC 2DDQL 1N26A 2GYSA 4BGDA 1SLXA 5EIVA 4OCXL 4HIHB 5DRZA 1CDHA 3VO0A 3ZRFC 1E4XH 3RVVC 4TUKL 4JZOB 4MQXD 4P9MH 3NFPA 3FQTB 2AC0A 1V7NL 2WXMA 4ZODA 2EXYD 3QDJE 1HIML 1H8SA 4MVBD 2DWEB 4X0KB 4LAQL 4Y1AB 1A9VA 3BP4A 2BOBB 4LASL 3ZDYB 4AZUA 4CN1A 4TNGA 2I26N 1NBVL 3S37X 1HI6B 2EDBA 4WW2A 1Q90A 4KJPD 2F54D 1GCFA 4Y2NA 2KERA 3WHE1 5E7BA 4YC2C 4I1NB 2HZHA 2NNCA 3AFLA 1OHQA 3QQ9D 3TU6A 3B2UC 2X1XR 4IDLA 4NT6A 3NCWA 4FXKA 1KNOA 4ONGL 5AOKA 3VFSA 4PBXA 5HD8D 3BCFA 1F0LA 1CE6A 1R1CA 1WICA 3MJ8B 1G7PA 3DX3A 1BWMA 3QDAA 2R7EB 1CB4A 1R17A 1TFHA 3GSRB 3QQDA 5F3BA 2BSEA 5C2BL 1CLYL 1TSHA 4HKBB 2BZDA 2JLPA 4PJ7F 3BUYA 1TJGH 1AGBA 1P6AB 4EDXA 1JF6A 1KLUA 1VKXB 4ENEC 4KKRA 2XV2A 2HPOA 2MNWA 4Z7WE 1BZ7A 5FHBH 5HHQA 2HTKD 2IIJA 3FTVA 3N85L 2WK2A 3K0WA 3FKUS 2CDGA 1SXCA 3L5WB 4OLVH 4JPSA 5G4MA 4BKLA 4N2GA 1ZKAA 5GISH 2N7SA 3C9NB 3ECQA 4TSCL 5DEZA 5DYOA 4JM0A 2NY1C 1XBDA 7PCYA 3K71A 2X41A 3EYVB 4RIRB 4CKVX 3CFUA 4YAQA 5EORL 5GZNC 4HUXB 3G7TA 2YS4A 4X7TB 1Q1JL 3VYNA 5SWSD 1SEBA 1U0QA 2Y6SC 4IRJC 3QIBC 2EKJA 1N2RA 4PB9L 2WKGA 2F6AA 4PP1C 2PWHA 4S0HA 1M3IA 2FGWH 4Y9BA 2P5ED 3TEXA 2GAZA 3DJTA 4E68A 2I27N 2XU9A 5IB4B 1Z9SB 3GPEA 3QHZL 3O6ML 4JDEB 2R4SL 4DEPC 2VAAB 3VW3H 3BWUC 5I19L 4M1CC 3EBHA 3C08L 1AH1A 1UQSB 2V5TA 4KHXL 2F61A 5H35B 1CXKA 3PDOA 3ROLB 2G3ZA 2ZPKH 3WTYA 2CA4A 2DLTA 4DN3H 1OLZA 3VFTB 2Q20A 1AFVL 1WHPA 5HGBB 2MSPA 5FXCH 3OPZH 4X99B 1BREA 1KXQE 3D39E 1MCRA 2H6UA 2XTJB 3MRJB 1JPEA 3BJ91 4MXWL 4QTFA 2DMCA 3ASWA 1QLFB 2CNYA 2UY6B 4M3HA 2EH8H 1Q1PA 4X7DC 1ZLVH 2VXQH 3WHXA 3HRPA 1WIPA 2XXMB 2VDMB 4C8XA 1YN6B 5TQ2H 3MPCA 3OQRA 3UJIL 4EZMA 2BC4A 3LS4H 2ZYIA 4UQEA 5DVPA 3OKNB 5IB5B 4J3XA 1MEXH 3RVVD 1ZV9A 3AM8A 3FCUB 4YHLH 5D7IE 3UTTA 3T65B 1FL5B 3LKPB 3DTDA 4L8SC 2R56H 4B9JA 2AQPA 2XETA 3V6FB 1FFNA 2X4QA 4JO4L 2KI6A 3PHOA 4RETB 5D1ZC 1RZGA 1KJVB 5E6SB 1TIUA 1X5GA 1T2JA 2QGDA 4AOFA 1MCCA 3L3DB 5GGSA 3UAAA 3HE6A 2BRRH 2FO8A 2AJZA 3QK0A 1SVBA 3QJXA 4I0PA 2VQTA 4R90L 4F7KA 2D03L 2B0SH 5EBWB 1E40A 3QEQB 3HI6L 1D5IL 3X12B 3FTUA 3B2UD 3L48A 2F7QA 4HX1A 2XIIA 5ID1B 1WFTA 4JL1A 2DQFA 4Q6IB 3TBTB 4LMQI 4FG6C 2DJ4A 2QVKA 4X5WB 2NLJB 4S1QH 1BXXA 4P2CG 4V1DB 3VFNB 4Z3TA 2Q0ZX 3VXNB 3T0EC 3D06A 2YBRA 1J8RA 3B2VL 4UF7C 5C0BE 3AW5A 4I3RL 3ULVF 1F8TL 2IF7A 2WIIB 4L3AA 3PABB 2Z1KA 2XZZA 2Z31B 1TQVA 4ENED 3MTXA 4NXKA 4UYQA 4WV1A 1LWJA 5CHNA 5E6IB 2HPTA 4DP7X 1NM4A 3K5RA 4LGSB 3FZUC 4N9GB 5B1KA 3HC3L 1U3JA 1RJLA 3APFA 4XP5H 4N8CL 4PRHA 2H3NB 1KCRL 5CJXC 7FABH 2XKNA 1CU4L 1O5PA 2FECI 1G84A 2NY1D 4JDTL 3UZVA 1L7TH 3NZHH 4JY5H 4YDNA 1P7KB 3O4LD 2NW3A 5JORB 2WVVA 3APCA 4NN6C 5DJXA 3WNOA 3RDJA 2VITB 5GZND 2X7LB 1ANUA 1NCAL 4GRWE 3GLDA 3HB3D 1J7VR 3FOLB 3SDDC 2Y6SD 2R8SH 3QIBD 2BHYA 2CXKA 3ALXA 3EG9A 1QR1B 5DK0B 4NUMA 3BRDA 3QUYC 2OCFD 4PP1D 3NCXA 3PGCA 1OAYL 2VDRL 1C5BL 4M03A 2VJ0A 4JLRA 1IKFH 1LDSA 1XZ0B 2X4TA 4XMTA 1GS8A 2CO7B 3G5XB 3LD8C 2N4IA 4M1CD 2VZUA 4J3BA 4YZFE 1UJ3B 3SGKC 4LCYB 4MD0B 5AVRB 3HBGA 2YUZA 1HWGB 4QHKI 1T0OA 4YSDA 3QC6X 4QDGA 2ZYRA 4Y88A 5E00B 3I6KB 3L4VA 1GW6A 1LEKA 1QFWL 1N70A 4XMLH 2KZBA 3DUSA 4KOBA 3DTXB 4L4TB 4AYMC 5D1ZI 2UX6A 4M6OL 3CVBA 1HNYA 2OXGA 3WD5H 2H32A 4HUWA 1RIVL 2TSBA 4YWGH 3BZ5A 5H4ZA 4ODSH 4PJAF 1CK0H 1I1YA 5HDRA 1A1MB 3K91A 1YA5A 5BRZB 1NOAA 3LH9A 1UWEH 3FO1B 2UZYB 4HJUA 4QKXB 4PJHF 2VDKB 2J8OA 5KYXA 4L3FA 3M45A 4OZHE 5I1JH 2Y25A 3APDA 1KSRA 4U33A 3S8GB 1BF5A 1JWSA 4RMWA 4PJ5D 1XGTB 4FI8A 2XN9A 5D1ZD 1V27A 2A9ML 4HCFA 5IMLB 1EO8L 3V7MA 1XIWB 4L29B 3GM8A 4MCMA 2JB5L 1XB8A 3EJJX 5LQBH 5IQNA 1G9NC 4KMTL 4WFFD 1Q9OB 4FI6A 3UYOD 5E1QA 1DN0A 1IAIH 1IB5A 4R4BB 2D7QA 4AVJA 4DW2H 4LCWB 5FHAL 3QAQA 3VXUA 1TZIA 1IGTA 2XN1A 4QYAA 4R4FH 3KPRA 3JUYA 3UACA 1QNIA 1A7RL 1OD7A 2W81C 4FG6D 4OB5H 1SY6A 1SOQA 4EIGB 4LLQB 2VQUA 5H37A 1H15B 2OYKA 3T3PF 5DI8A 3G6JB 4U05A 2G75B 3HKFA 3VXSA 1YQ2A 3T0ED 1E2WA 2WVUA 3FAWA 2Y06L 4S1SH 1K85A 1D5MA 4HU8A 4X42A 1ZIBA 4YNYA 1E3ZA 1RIUL 1CXIA 1M7DA 1U8QB 2CIIA 4AQ8C 2UVEA 1PAZA 2OV0A 3BZEB 4LRNL 3LRSA 4DP4X 3QPQC 3QO0A 1PDKA 4G1MA 3FZUD 4ZOEA 4Z23A 1BVNP 2J55A 3IJSA 3LN4A 1KPUB 3IS1X 1HOCA 5CWSA 1BYNA 1HAUA 3BKML 1Z66A 3DKHA 1YEGL 1M2VB 1BGXL 3CZSA 1MCJA 3QEUB 3UTTE 2PLTA 1WYJA 3NIGF 4M1GL 1NIFA 3CFJA 2VXUH 3BAWA 3SBQA 4FFWC 3GMOA 1HU8A 2VLKD 1ZT1B 1BMWA 3L4YA 2V7HB 5GS2D 3DVGB 4UAHA 4KAQH 3SDDD 1E8WA 3ARDB 4AY0A 1R3LB 5I17B 1K2DB 5EN3A 1RZKC 1KIPB 4M6ML 3PWJB 3TVMC 2B5IB 3LY6A 2VOTA 3R19A 3P73B 4NQDD 2JXMB 3WS6A 4IRSA 1FFOB 1QRKA 4JR9H 3TOPA 5E4EB 5L2KE 3T0WA 2NTFB 2V2XA 1TU2B 2YD4A 4KTDH 2YQGA 3SJVA 1MFDL 1O75A 4Q9QL 1VHPA 3PHQA 2HJLA 5PCYA 1F4WL 3AGWA 3N06B 3W0WD 1T21A 4K4KA 4A7QA 4L4VA 5F1SA 3MBXL 3H0TA 1B4LA 4N0UB 4P23A 2GY5A 3MCLL 4MWFB 4PRPD 1H3XA 3LSOB 1AGCA 3DRQB 1KCWA 1IV8A 4UZSA 3QXVA 4Y19D 2AJSH 3EYSH 1FZJA 4QXGH 3PJNA 2ZNWA 4LP4A 2I5YH 5E99L 4LB8A 2IG2L 4NZDA 2OMBA 4YXHH 4Z3FA 2DICA 1DQTA 1IAMA 2K9FB 4F8LA 5DVMA 4KHTH 1NCBL 3VGDA 1P5VA 4PRHE 4M4PA 2CHDA 2CO6B 3B2MA 1QR4A 1WZKA 1O5DT 4NRXB 2HFFB 3ZE2B 4FQXC 3AREC 3KPOA 2CK0H 2XBTA 1GYVA 3DXAB 4MTMA 3B4NA 4P5TA 3UTPD 1JTPA 1NBZB 3CSYA 1LVEA 1PLBA 3MBWB 4UZGA 5FM8A 3ULUH 3GMQB 3IJYB 1DVZA 4P04A 4YHOL 2QVTA 3GBMH 5E2WH 3W37A 4OKDA 3FT4B 4X6DF 3ISRA 3LV3A 4TS6A 1NMAH 2X4OA 4EBQH 3EH2A 3OJDA 1AS6A 4K94H 1HINH 3KPSB 3B6SB 4GLRH 4I2XB 4ZRGA 3PGDB 5IKCB 1MHCA 4ETQA 5E4OA 4P9ML 1I9JH 1S9XB 3KLQA 1CIUA 1AGEB 2O6DA 2QQKH 3BEVB 2XWEA 2YXFA 2C9VA 1JWMA 2R0KH 5GHWH 2D3JA 1BX2B 2GY7B 4GAAA 2E75C 1ZJBA 5IHHA 3AQZA 2C4FT 4RDQF 3E80A 3TNMB 2I9LB 1BEYH 3WS3A 1HSAB 3SKJH 2DQ6A 1IRAY 4FCAA 2VAJA 2IAMB 3KPTA 5I0WA 2OMWB 4MMZC 1W9XA 3VWKB 1DQKA 1GR7A 4OF8A 5T33L 3D0VA 1XCTB 4EIBA 2B77A 5CUSH 2Y07H 4HFUL 3SE6A 4WQOA 4HWNA 4TPRH 3V0VB 4FLRA 4R5XA 1VERA 3QPQD 1DQQB 3RAJL 3S3JA 5DO8A 4NNPH 1V3LA 1HHIA 5KVFE 2EYSB 2Z92B 5K9JH 1T0NB 1IC4H 5DZPA 1GC1H 1SZNA 2C7FA 5A6MA 2AGJL 2Z4QA 1U95B 4MKMA 3R8QA 4U6VH 1KGUA 1UYWH 3B8SA 4L9LA 4LFHG 1RKRA 1TJGL 3IGFA 5AOIA 2E5EA 4AW7A 1CT8A 3ZTJH 1KPVB 3TBSA 4FFWD 5FHBL 3BSGA 3B83A 3RY6A 1C12B 3AROA 5FO9A 2NT1A 1CXLA 1CLOL 2JVUA 5IHUH 4MNHA 3MRIA 5DHXB 5HDBE 3TVMD 5AB2A 1DLFH 4O4YH 4WSJA 3LKNB 5LHDA 1S9YB 1YEIH 3B2PA 4JM2A 1HNFA 4OLVL 1U3HA 5HVGB 2X38A 1J88A 1J9CT 1VEOA 5GISL 3VXUE 3GTVA 5T3XH 5KOVC 5HHMB 3JTSB 4HIHA 3KPRE 1RUPH 5I8OH 4JB9H 1IEAB 3CQQA 3R7RA 3WGUB 2IEPA 4JZOA 2DW5A 2J20A 4WUUB 4KY1H 4MBRA 5E03A 3VXSE 3LPOA 4ONFH 4Z7OF 4HIPA 5KJRL 3SOBH 2Y23A 3W2DH 4D9QD 1CE1H 1OGAD 2DWEA 1HH6B 2FGWL 3WKPA 3KLKA 5IQOA 3O2WH 2C9RA 4BUHA 4U31A 2BOBA 4HYTB 5FX3A 3T4AC 3VW3L 1CD0A 3KBFA 1M3JA 2V7NA 4TNFA 4ZMQA 2BSSA 3MRCB 2E76C 4Z7QB 2FT6A 2AJUH 3ABKB 5EU4B 2ZPKL 4DPCX 1DVSA 1XTLA 4XAWH 5MERB 3IF1A 4RZCB 2PO6B 4NQSB 4QHNA 2W59A 4KRNA 4FQXD 4ELME 1XL4A 2H0FA 3ARED 3I2CL 2R7EA 3O6LH 3UZEC 3WBDA 5EUKB 1Z0MA 3EJCA 4IS6B 2EH8L 3AWGA 4H26A 3RIAK 2EYTB 1WK0A 2FX7H 3S0PA 1T5KA 1QFWM 3P30H 3OGOE 4MA8L 4PJ7A 4FFYH 4WDIB 5TQ2L 3WSQH 3LS4L 3QUZC 4I3SL 2QDWA 4MB3A 1MEXL 4H8VA 2D2OA 3VFRB 3L5WA 1VGEH 2GBUA 3DUUB 4H13C 4PP2B 4QOKD 3N1PC 4L4VE 4N2NA 5HYJB 2ADYA 1TZHB 2HYMA 2YC1B 4BFOA 4QHUB 4KNSA 3GRWH 4U6HA 4RDBA 4GW5B 1AHKA 2BRRL 4DQAA 1MJUH 3O3EB 4XH2B 4HS8L 4JN2B 2WBKA 4QRSA 1U8MA 3QCUH 4BGLA 5C6PB 3MVSA 4ZPTB 4I0CC 2B0SL 2WAHA 3MMEB 4P2QD 1TFPA 2EEDA 3MOAH 4YQXL 4XX1G 3S2CA 1WRFA 1IGIH 1FF5A 4TOYH 1E4HA 1BZ9A 2Z7UA 5IB4A 1Z9SA 3ZHFA 1JXJA 3QCTL 2Z8WC 4UT9H 4HIXH 1HHGB 2IGLA 2R29H 5H94B 5H2BB 2RHEA 4PPTA 5H35A 3ROLA 5CO1A 3U9PL 4BJLA 5I1LB 1BA9A 3JV6A 4NO2B 5DJCB 2I60H 4PGCB 5DRWB 5CLWA 4WI8A 5DJAA 3DGGB 4X99A 1JHTA 3D50A 1AAJA 2D4DA 3B5TA 2DIEA 3ZKMC 4YBLB 2A7BA 4WLCA 3T2QA 2UY6A 2Y1YA 4XP5L 1IBGH 1UWFA 3J07A 3GI8L 2IO5A 5EZPA 7FABL 2VZ3A 3ECUA 1DQJA 2J2ZB 1YN6A 1L7TL 3NZHL 4JY5L 1Q72H 3EW3B 2IDFA 2Y69B 3OKNA 5IB5A 5FA3A 3N40F 4ZUTB 4NPJA 3HUJF 4ELKA 3LKPA 5EFIB 3WKYA 2R8SL 1LMKA 3OHMB 4K55A 4MDIB 3MLZL 1P5UC 2XKSA 3SE9L 5JMRA 4JKWA 1J0YA 2EJ1A 1KJVA 3TESA 2P26A 2AFNA 3FU5A 3L3DA 4MDJB 2WHVA 4XNXH 4GYBA 1IKFL 1MJ7H 3U1SL 4KKBC 4L23A 1JZHA 4TVPD 4CU8A 2XWRA 3JZ7A 3I3DA 1JF1A 1QUNB 3QEQA 5AZEH 1KGIA 2WIMA 3X12A 3BQUB 5HP5A 1YQVH 3MO1B 3K2KA 3LRGA 4N25A 3GBNH 5HI5C 5F6IC 2OMVB 5ID1A 1PNCA 3UGEA 4U3XA 3TBTA 5KZCD 3A21A 4IIQB 4XMLL 1YMMA 3ESNA 2AXFA 2NLJA 4M00A 5J8OA 1XEUA 4X5PA 4X6EA 1NLDH 2MOGA 1DVFB 1A6AA 3RURA 3WD5L 4P4RA 3CDZA 4B0MB 2OTUB 4YWGL 1J5HA 3ULVH 2VLME 1MSPA 1T4WA 3DGCR 4U6YA 4ODSL 5E6IA 4WU7A 5B21A 2JWYA 2WM0A 3JYCA 3TS8A 3QUZD 3BGAA 4N9GA 5HHXH 2BSCA 3D3VB 4PWIA 3I84A 3LZOA 3IBOA 4WTWA 2WCSA 5AW3B 3U6XS 3V7AE 2G3XA 3M8OH 4QCIA 1HOEA 4NS0A 1OCOB 2ICEC 1TQWA 1EEZB 1A1NB 2O6CA 4GI6A 3NPZB 4JVUA 1K5NB 3CN2A 1BQHB 5HPMA 4FZEH 1H3WM 4DP1X 5JORA 1P7KA 4AJWA 3TV8A 1DZ0A 3V0JA 2JIXD 1KGCE 1TZGH 2VITA 5J56B 5LQBL 3SIKA 3V10A 4BV1A 1OP5K 4JE4B 4WENB 1IAIL 5DK0A 4DW2L 3ATAA 2KDGA 1CDUA 2J5LC 1HHKB 2OX5B 2R0LH 5BV7L 3BW9B 1M9SA 4R4FL 4GS7C 5DQ9B 2A1WH 2J8UB 5I5MA 1RURH 4OB5L 1QPXA 1XZ0A 5L8JB 2WLJA 3JZYA 3SN6N 3W39A 2CO7A 5DGRA 3G5XA 3GHBH 4Y4FB 2HX9A 5EO0A 2R39A 4OLYH 5FYJD 5FO8A 2DWXA 4S1SL 4N1CA 3OZKA 4DKAA 3L3OB 1V55B 4OZIB 1I82A 5E00A 3I6KA 1E8ZA 2DMBA 1CG9A 1G1YA 4L37B 4CMMB 4L18A 2UXFA 2VISB 2WZ5A 3DTXA 4EVNA 4L4TA 3L1OH 4FQLH 4PJ7E 2YGVA 1D9KC 4K7PY 4NKOA 3ZKMD 2ZCZA 1SMDA 1AIFB 3GZOA 4KTYA 4DO6A 3M07A 3FULA 3G6AB 1SOXA 3WMQA 3RPIB 3CFQA 3D05A 2MHAB 3UX9B 1BVKB 2EDXA 3C8KB 1Z0NA 2DLIA 3E2HB 3B5GA 5BRZA 1RZQA 4IOSA 5FO2A 3U4KA 4DK6A 2UZYA 4EAEA 1MCNA 2QLYA 3KD4A 2IVFC 4OJCA 1LEGA 1WHOA 1JVLA 1IX2A 3QXTA 3B7RL 3L7FB 4KAQL 4PJIF 4ZTOH 1N0LB 1BM3H 1HL8A 2YO3A 1D2OA 4XMUA 1XGTA 3MKKA 1MLCA 2DWDB 4YPGA 2X4NB 4NKIH 4JR9L 1T7XA 2Y22A 1GZQB 4LP5A 1AZBA 1JN6B 5IMLA 4PMEA 3HOGA 4L29A 2V2TB 4KTDL 2R9HC 4KKBD 4HLZH 3WL9B 3MBEA 1Q9OA 3NJIA 2VDLB 2P80D 1C08B 2EDRA 4JJ5B 2CBPA 4LCWA 5CIPH 2P7TB 1FORL 3CU7A 3MRHB 3WFBH 5C0GA 2PTTB 3B7YA 2ADFH 2OYMA 2WLLB 1XBRA 1QPKA 2XOTA 2O6FA 4TQEH 5HI5D 3KR3H 2DAVA 5F89A 4NM8H 5TGBA 4NHUA 2CHNA 4AMXA 1AQHA 1OANA 2GQHA 2DOCA 2HRPH 3X3GH 2NY3C 2VLJD 5DS2A 3RZCA 1D5XB 2AJSL 3EYSL 3TO4A 4QXGL 2VIRA 5FWQA 4Y89A 2BWQA 4HA1A 3ZYOA 4GRMB 2XTJE 4YXHL 1BBJA 1XH0A 4P2OC 4KGJA 4G80B 4KHTL 1U8QA 1UG9A 3BZEA 5DS8A 3Q6GH 1L9RA 1PG7X 5LN8A 2FO4B 2AF2A 3BFOA 1SXNA 1UGNA 4H40A 5B3JE 2ZYHA 1RK1B 4U3CA 1OT4A 5IIEB 1JXKA 3KXFB 2CK0L 4ANUA 5TF0A 3IK2A 4PJ9A 2GIMA 2JE8A 1M2VA 2ZWYA 3ULUL 4NN7B 4OLUH 4P5RA 2FQEA 5FGSA 1U21A 3PQYD 3TONA 3GBML 5E2WL 3PJLA 4Y4HB 5J11B 2OSLB 4PWFA 4NO3B 3LH8A 3G04B 1NMAL 5E8PB 3VSVA 4EBQL 1ZVSB 3T9WA 3QDMD 3OWRA 1NCTA 3U0TB 5KVEH 2V7HA 1BVNT 3ARSA 1PZBA 3V9EA 5BOPA 1KIPA 3BWSA 2WXLA 3ZTCC 1I9JL 3NDZE 1OHZA 3P73A 3MUUA 1J11A 2JXMA 1FFOA 2QQKL 2XJLA 2R0KL 3NCJH 3LEXA 3QEQE 3BYTA 4H4NA 5GHWL 4OV5B 1BLNA 2NTFA 3CN1A 3NCBB 5CLYA 3QRFM 2EC8A 4AYID 2N01B 1AS7A 1B6UA 2BVOB 1KGXA 3RP1A 1R5VA 3VG9C 1HE7A 5JTWA 5AAPA 4YIQB 4EEEA 3SD2A 2CLZB 1YMME 4OGYH 2FUTA 5I9QC 4W4NA 1G0DA 4WTQA 1JGUH 3CIQA 4B5ZA 4V1DE 4N0UA 3RIAF 4W4OA 5CUSL 2Y07L 2F9BT 3OJMB 4Z95H 3FBKA 4N86A 2FATH 2FBJH 1QOKA 1WAAA 3BX7C 1D9KD 3DX2A 1MJ8H 3KL5A 3OXRA 5K9JL 2P1YA 1IC4L 1RL1A 3X2QB 1GC1L 3N3EA 2FIRT 1YEEL 3Q2VA 3ZT5A 3HJEA 5HVHB 4KNTA 1NC4D 5DEFB 3G3LA 3I75B 4GUCA 1UYWL 2N56A 2D0FA 2Q3AA 5E1HB 5C7XL 1USQA 1HTYA 3K1KC 5BVJB 2CO6A 4NRXA 4AL8H 2HFFA 5E0QA 4GEJA 4GKNB 1EPFA 3KDPB 1WZMA 4MFHA 4NGHH 3K6DA 4MJ2A 2VT0A 5EC2B 3DXAA 5ERWB 2WO3B 3MBWA 4UTCA 1DLFL 2ZP8A 4O4YL 4LT7A 2CCLA 5SWQA 3EGDB 1YEIL 1YHPA 1KOAA 3FT0A 4MS6A 2M8XA 4M3KB 2NMSA 5T3XL 2R9HD 3UMTA 4NBXB 4BUGA 2V8MA 5DUBA 4MA7H 1RUPL 1LNUB 5I8OL 4G7QB 3KPSA 3B6SA 4JB9L 5C0CB 4LCIL 4X6DA 5C0NC 4DOHE 1FHNA 4LFHD 4ZAKC 3H2QA 4RH4A 1NBCA 3UO1H 1S9XA 3UG4A 1B4JH 4M3JA 3RJOA 4KY1L 4FA6A 4ONFL 1CJYA 3BEVA 2CXGA 4ZXBB 4NQVB 1Q9LB 1BX2A 3H9YA 5TF1L 4ZMTA 4X7EC 2NY3D 3O2WL 3ZK0A 4BEIA 2HH0L 5L4IA 4FJYA 2HVJB 2N1KA 3TNMA 2I9LA 1WIOA 1A6VH 1HSAA 3Q01A 4IU2B 4MXQC 1KTBA 3TT3L 1G7HA 2OMWA 5EOCH 2GI0A 4L4TE 4UILH 5B8CA 1XCTA 3BKJH 3PGFH 3B7TA 1P1ZB 4P2OD 4OBSA 1BMGA 4H20H 2AJUL 3V0VA 1K8IB 3NA9H 3RWGB 3T3MF 1DQQA 4XAWL 3PG2A 4OCLC 5KSUA 4YX2H 4NC1E 5AW8B 3Q1EA 4ODVH 3SKOB 3KPNB 3RVTC 5BRZE 5J3HC 3B2XA 3O0LA 3FBQA 4XO8A 5F97E 1KB5H 2A9CA 2Q7YB 1FBIH 3HHRB 2AHIA 4JCLA 3N0AA 5CM1A 5I76B 5FFLA 5I2IB 2ENJA 2FZ3A 2EO7A 2ARJB 3P30L 4TULH 4XGZB 3TH4T 5IFJB 5C3TA 4FFYL 4JFFB 2NDGA 2XVKA 5D93C 2YSSB 1C12A 1TMQA 4F1SA 5JW5B 2W92A 3IDIA 2DKMA 4XPTL 1A02N 4G42B 1H6TA 1JAEA 3BPLC 1S9YA 1DJWA 1VGEL 2R69H 4FP8L 3WUWB 4LCWE 3NA4A 2R69A 1VFOA 3WFEH 3HCVA 3GRWL 4P3WA 2HJFB 5EU5B 5TK2A 5HHPB 1MJUL 4LOUC 2ITFA 5DJ6B 3TCXA 7TAAA 3QCUL 1UEYA 3NK3A 4QO1B 3HC4H 5GPRA 3FHQA 2XFXB 3TF7C 3MOAL 4KUZH 4Y2DC 4HFWB 2B39A 3EBGA 2GVYA 1IGIL 4X4YB 4TOYL 4ERSH 2QZQA 1WUZA 5KAQF 3LPWA 4MNQA 4N6QA 1PTZA 3NFNB 3N04A 4HIXL 4QF1B 1IAIM 4KQ0A 3MRCA 4EN3C 1S46A 3F7VA 5DC9B 1XB6A 4OH2A 3ZKXB 5K9QI 2DM2A 5I1IH 4U4BA 1FNLA 2GIYA 3IFLH 1A21A 1BQLH 3WO4C 1RHHB 2V5YA 2Z35B 5MERA 1A7PH 2F5AH 4BFFA 2I60L 4E5XB 4W9JC 4DPAX 4RZCA 1CMOA 3WE6B 1UWXH 2EVIA 2FLRT 4OM1H 3VGFA 2F54B 5EUOF 4P4KC 4RMQA 2ESVD 5C3LD 3D69B 3VGGA 1EBPA 2CRMA 1XSJA 4YK4C 3UEZA 1MLBB 1U41A 4M9PA 4PTUB 3KLDA 1OVZA 1XF5B 1X5JA 4DCQA 2H0JA 3FCTB 4WDIA 2EDMA 1Q72L 4ODUB 5C0ND 2WXQA 2X4UB 3SDXB 2QQQA 4ZAKD 1DCLA 4TF4A 3DI2B 1MHHB 2IFGA 2G60H 1P7BA 2PW1A 2Z0BA 3VFRA 1FG2B 4LSPH 3DUUA 4JS7A 4KPHH 4PP2A 4U1IB 1V3KA 4TUJB 1KLFB 4M7LL 1HL9A 2VR6A 3NZUA 1B0RB 1TZHA 3W1ZA 4LLDB 1VA9A 2YC1A 2YPLD 4N0UE 4QHUA 3CXHK 1RU9H 2AQ2A 5C0IB 4F7MB 1P1VA 2P42B 2WBJC 1JDCA 4PJBB 3OKLB 4GW5A 1MJ7L 4MXQD 1QBLL 1WAAE 2WGNB 4ZPTA 3GINA 1WIUA 3QULB 1JD7A 5ECGA 3TF4A 2VDNH 3FB7B 3MMEA 5AZEL 4PUBH 4CRPA 2CCVA 4JZJA 4MZ3A 1YQVL 2J4WH 3EOBB 1GZPB 3GBNL 3ARBC 1TKWB 3FFCD 4BDVB 2ZUXA 1P2CA 1CGUA 4G6JH 4GMTH 3RVTD 3IXTB 3NIDB 3Q2LA 5J3HD 4HV8B 3QQ4A 1NGXB 3IJHB 3ZOAA 5SWSB 4BZ2A 4FA8A 2NY7H 3U2SB 1HHGA 1NLDL 4LPXA 4OFPA 5DHVH 1LO3H 3ZE2E 1I3RB 1ADWA 4XO9A 5H94A 5H2BA 3GRGA 5E8NA 1GHFL 4HOXA 3ABGA 1DO5A 3DXAE 5EBLA 1S7XB 4PJCA 5I1LA 2P5EB 4K5PA 3ULVL 1XAUA 5DJCA 4ZO8A 3JV4A 4PGCA 3DGGA 1PX3A 2NYYC 5IEHB 5HHXL 3MUHL 1MXGA 3WKML 4D2NA 3RPBA 1TEGA 2XG5B 3GXDA 1N12A 1QFWI 3KPSE 3M8OL 2X87A 2CR0A 4X6DE 3STLB 2VC2B 3QUMB 3S5LB 2UVFA 4YBHA 4J12A 2XFGB 3QI9C 2J2ZA 3ZDYF 4FZEL 5EG6C 3NN8B 2HN7A 4ONHA 2XNAA 3ABLB 5KTEL 3IDYC 2VZ1A 1DL7H 1YO4A 1NUDA 2MFNA 5ALCL 4AQEB 1ORSA 5T1JA 4XBMA 2UZXA 3QORC 3QAZB 2X4PB 4MDIA 2P44B 4HXBH 5F1KC 2X1PA 5FKPB 3OLEA 4Y2DD 3VFVA 2VW4A 3D85A 3F8UB 4LEXH 1QEXA 4APQC 4MDJA 2CKBA 1F3RB 2A1WL 2ZOLA 5LGKA 4OFYA 4BE5A 4I18A 1C8QA 3LXBA 2NPLX 3CN0A 2OSYA 3TJHC 4OLYL 1KIRB 4WW1B 4F27A 4XTRC 4PB0H 3II2A 4DP9X 5JW4M 3LEYH 3CZFB 3SDAC 3ZSTA 4N8VG 1E9QA 4LEEA 3MO1A 3AITA 3S5YA 3FC8A 4KRLB 2ZUVA 3CD4A 2OMVA 4M4RB 1PZAA 4HISA 3SDYH 1S9VA 4IIQA 3GF8A 2D7NA 4P4KD 1MFEL 3L1OL 4FQLL 1DVFA 1KPRB 3QR1A 4OCYL 3AQDA 4GXFA 2VLLB 1QFHA 2OTUA 4OCSL 2Z1PA 4W9HC 1J5DA 1BZEA 4H8WH 2DZEA 2HMIC 1INEH 3BC9A 4L5FE 4MQTB 4QXWA 4CJ0A 3VFPA 2SEBB 1EANA 3B8YA 3MU3A 3D3VA 1OZUA 4JFSA 4MD4B 1QBMH 2BNUB 1XSOA 3D07A 5J6GB 2C9SA 1WT5A 4ZTOL 1Y1DA 4YUEH 4TUOB 1EMTH 4X50A 2DYRB 2WWOA 3N50A 1BQHA 2RALA 5EF2A 1RXLA 1SRDA 4FHBD 4QMEA 4XNMB 2ZKHH 3IDGB 3QHFH 3M1BA 5GGRB 1P7HL 1CFVH 2IDCA 2WBJD 1MG2C 5LJYH 5T3ZE 3CXHJ 1B9KA 4UUJB 3U6RA 3MNDA 4NRZB 1FNHA 3ORJA 1TLKA 1J1PH 1Z9OA 1H3VA 2K70A 3MNZA 2AQTA 1MF2H 4MNQE 3DARA 1WAEA 4N6RA 3WFBL 3KYNB 1VACB 4I7ZC 2OX5A 2ADFL 4HH8A 2DIJA 4FXKC 5B39B 5I0VA 4TQEL 4JPIB 3ARBD 2ZG2A 5DQ9A 3FTXA 4GRLC 1CUOA 1BVZA 3DTUB 3ZE1F 1KWKA 2HRPL 3X3GL 4ZX4A 3HB3B 5DFAA 3QIBB 5DMKB 5D71H 5FYKE 1W0YT 4KKAC 1CYWA 3CSGA 1NCCH 2YR3A 4Y5VA 1MY7A 1QBBA 4GKZB 4B7IA 3L3OA 4OM0H 4Y5XA 5F7DB 4DGVH 4OZIA 1ES0B 3CLEH 1WPCA 1M6OB 2AAVA 2BNRB 5AVZB 2J1KA 2PCYA 5CEYB 4DEPB 3Q6GL 2VNCA 3RIKA 2NYYD 2ADJA 3OLGA 1FE8H 2D8KA 3PWPA 4UT7H 4EXKA 1N64H 4G3YH 3ZZLA 2H47C 4GW4B 1AIFA 5FEBA 1ZS2A 3VSQA 3G6AA 1PFOA 2R4RH 4E9WA 3EFOA 3P9WB 1DO6A 3RPIA 4OLUL 5FIEA 3RI5K 4HIIB 2NT0A 1B90A 1OE3A 2MHAA 1ZRUA 3MLUH 3QI9D 4L8DB 3C8KA 3QJOA 5E1AB 3X13A 4RSYA 3WJLA 3DWTA 2WLYA 5HYJE 3QSKB 3G9VA 4XP6H 2X53A 2E86A 2Y72A 5ESVB 4JPVL 1KBBA 4FMKA 3NK4A 1LE9B 1C5DB 4WHYG 2Z65C 2X88A 4X4KA 9CGTA 3H7BB 3QORD 1N0LA 2JK5A 1ZK5A 4B9YA 2DWDA 2VKXA 4PJIA 2ARJQ 3ESMA 3NCJL 4APQD 2BVPA 2V2TA 2YXVA 2CBOA 2F18A 3PJSB 1QA9B 5DU7A 1E28A 3TJHD 4BSVA 4L8SB 3GT6A 3RL1B 3RNQB 2AMGA 2VR3A 3LNFA 4XTRD 3MFGB 2Q86A 3N43B 3FYIB 3BAJA 4OGYL 4DN4H 5E56A 3GKZA 1F11B 1IBYA 3MRHA 1SGKA 3IRZA 5D1ZB 3U36A 2PTTA 4FRWA 1JZ3A 3ZUCA 4RRPA 4OVVA 2W88A 3GBLA 2YAEA 2FATL 3D1MC 3ZHKA 2PPEA 4PJCE 1S3KL 2FBJL 2G5BA 4HHGA 5IW1B 1DUYB 1A7NH 1V3JA 1NCHA 3H3KA 5IWLA 3INOA 5AKTA 1N6UA 1I85A 3DIFB 5AVXB 1AGDA 1NPNA 4GRMA 1GGCH 4BK5A 4YHKH 1HHJB 4PREB 1UZ6F 3K6OA 3TL5A 2X3CA 4G80A 4WGWB 4J3OC 3V9FA 4H8QA 2HMID 4CW1B 3PWNB 4FYSA 4NUQA 2IBGA 4AL8L 3TO2B 3AG2B 3JWDH 4XXDA 1XGRB 3AM8C 5KYYB 3QDHA 1RK1A 4HAKA 3AJ7A 5IIEA 4NGHL 5ABDE 4HJSA 3PS6A 1O7SA 3PDGA 1DJZA 3LPFA 5E8EB 3AGVA 1PZ5B 1HK6A 1AMXA 5FWRA 1J8KA 4F37K 1WFUA 2OSLA 3LZQA 3G04A 5E8PA 3HE6C 2APWA 1ZVSA 5DVNA 3U0TA 4W93A 4MA7L 2YPVH 1RZIB 2MQ0A 5DUPH 4ANXA 3ZTJG 3BP6B 4I0PC 3B9EA 4OCRL 5H8DA 4WU5B 3UO1L 1BVLA 1B4JL 4XB7A 2YEQA 4NN6B 4LF3B 3BEWB 3S8FB 4OV5A 4GRLD 1PX4A 2ZUWA 3PWLA 4G8FB 3S4SG 5K59F 3SDDB 2BVOA 2EDKA 3NVQA 5ID0B 2BSED 3IXAA 3U4AA 2PPFA 4KKAD 4YIQA 1A6VL 2NY4C 4NQDB 2YRBA 4ZMNA 5EOCL 4HVBA 4UILL 1ETZA 3FRPA 5JOPE 4MMXB 1S5IH 1NEZG 4WV1C 1E7VA 2A4CA 3L4ZA 5I66B 3BFWA 4Q9BA 3VD5A 1ET7A 4H20L 5DSCA 1CO1A 4HIJB 3NA9L 4K2UL 1TETH 2JJVA 2LGNA 4YX2L 4LEOB 3GJFB 1ITCA 2BWIA 3W0WB 4ODVL 2ZCHH 3SGDH 5IP4A 3FQYA 1U8PB 1PZUB 3X1FA 3D3VE 1KB5L 4PRPB 1FBIL 5DEFA 1CTOA 3I75A 4RGNC 3AB0C 1QFOA 4X9FA 5E94B 5BVJA 4MHHI 2XWJB 3KGTA 4Y19B 3V55A 2CMRH 4GKNA 4H44C 4LSDA 5INCA 1SLVA 3F05A 1RJYB 5EC2A 4YO0A 3ZZSA 1YEWA 3V4UH 4S2SB 3HHSB 4L5FL 2PYFA 4M8VA 4NRYA 3EGDA 3SZ6A 3GYRA 1TG8A 2R69L 4YZWA 2F5BH 3LQZB 1KDJA 3CG8A 2L04A 5IVXB 4E9TA 4LSUH 4PLJC 3G6JF 3WIHA 4ATWA 3WFEL 4ODXB 2YOAA 4PRNB 2ED8A 1X7QB 3VI4F 2ZIDA 3LJ3A 5F0PB 1LNUA 4AZ8B 5C0CA 3FHAA 1FZOB 5F7NC 2GITA 2R2BA 3BXNA 2F2HA 5HGDA 4BYHA 3D18B 1GYCA 4L1BA 3DDFA 5TK4A 1EEUA 1V05A 2C5DC 3SQRA 1CQKA 1JXGA 4NQVA 3VVVA 1Q9LA 5BO1H 4YHPB 3WXVH 5I82A 5E95B 4BE6A 1H19A 4NQTA 1YCSA 1GJIA 4DP0X 3VFMB 4OZIE 3O0RL 4ERSL 3MCYA 2HVJA 4LCUA 1RI8A 2RACA 5FK9B 2WKOA 4B9CA 2AXWA 4IU2A 4L05A 4U0QB 4N3UA 1W72H 5D1QA 1BJ8A 1AR1B 1R5WB 3UIYA 1BXUA 2IGFL 3EUUA 4J3OD 5EMYA 5I1IL 1FYTA 3MLSH 3ZX1A 5L0QC 3IFLL 5FGBA 1BQLL 5J1SC 4OUUB 4HUVA 3JV5A 3FN3A 1K8IA 2DBLH 2XN2A 6PAZA 1MFBH 1RZ8B 2F5AL 4WWKB 4DK5A 1MCEA 1UWGL 4OU3A 5DMJB 2LABA 3UTTD 1Z5HA 4KKNA 3OR7B 3Q2CA 4OM1L 1IGCH 1HEJC 4U3SB 1LK3H 1XVSA 5DJDB 2Q7YA 1RMFH 5KSBF 4P57B 5I76A 1H0DB 2W95A 2FTAA 3FPYA 5GGRY 3ZHNA 2M83A 3ZTDC 3HE6D 4PJIE 4XGZA 5IFJA 4LDLB 1KFGA 2YSSA 5KW9H 1KLGB 1BBDH 3QRBA 4I0PD 3RGHA 4F7CA 4YDIH 1MJJB 4ABVA 5DEGB 1YRKA 2NR6D 4OCWH 3VNYA 4L3EA 2EICA 4G42A 3WNJA 3OSKA 2ZXAA 2A38A 4LSPL 4KPHL 3OSVA 5BV7C 1WWWX 2L7QA 2EXTA 5CCKH 4PJEB 1RU9L 5B38G 2HJFA 2ZKWA 1ZA6A 4LEBA 2NY4D 3TVMB 5HHPA 2AV7B 3KPQB 1PZSA 2DEXX 2XI9A 1MFAH 5CJQH 4NZFA 1SXSA 2FRGP 4AGPA 4X8CA 3DK2A 4XB3A 4KK9C 4PUBL 4WI2A 2ITDB 2V3DA 4HFWA 5EPMB 1RK0B 2GCYA 2J4WL 1F90H 1ZHLA 3FO9A 2OR8A 2ZAGA 5HI4C 4X4YA 5J12C 3FTZA 4GMTL 4B50A 3ILEA 1NC2B 2NY7L 5F7KC 4QF1A 4NM4H 4PRHD 1LO3L 4DEUA 5D4HA 1SDYA 3FRUA 4RGND 2H9GB 4HPYH 3TBWB 1OGAB 3H53A 4KNQA 1N59B 1RHHA 3H54A 2A6KA 1W2KT 5CU9A 2KZWA 3CZJA 4ESKA 4LLAA 3NCMA 2QPSA 2B9BA 3K4AA 1GS7A 2F54A 1NSNH 2JKTM 2OSXA 1R5IA 4G9FA 5I15H 1KCVH 5C97A 4A67A 2IADA 1NCIA 2YN5A 1S2EA 2OXHB 4IRSC 1MLBA 4HAGA 3BVUA 3WS6C 4DGIH 2VR9A 3NDYE 4PTUA 5E5RB 4NB7A 1M2OA 2VR8A 4ZFOB 2Y1AA 4PLJD 1NCWH 1VCBC 3B1UA 3MLTB 5C6TH 4FQXB 3FCTA 4IBUA 3AREB 3BQVA 1XCQA 3DHJA 3WFHB 4WNJA 5JLZB 4ODUA 1CLCA 3L7EA 5B3NA 3SDXA 4U0RC 1A5FH 1BDYA 3L1FA 1DL7L 3QNZB 4XE0A 3F12A 1HHHB 3P9MB 4P23C 1L9OA 1FG2A 2VDOH 1CDYA 1NCOA 4U1IA 4TUJA 1KLFA 2YEZB 1E6JH 3KPMB 4HXBL 5I8KH 1SUJA 1B0RA 4AV0A 1OB1B 2YD3A 2CKBL 2EVHA 4LEXL 1EHNA 4AYSA 3C87A 4PJBA 2FAUA 3QXAA 1ND0B 3CBJB 3CK0L 2XWZA 4IBQA 4GSRA 4DP2X 3FMGH 2VWEE 1S7WB 5TDPA 4OZGA 1RCYA 3M7FB 4O02H 1FZKB 5F3FA 2YRZA 4QOKB 5MEOB 4PB0L 5CLZA 3EGXB 4FQIH 1G7LB 3IDMA 3KNBA 1BVOA 2CUMA 4L8CB 2G2RA 1EJ6A 3EOBA 1GZPA 4HUUA 4IBSA 1IAII 1TKWA 3NJKA 2VM3A 2CGRH 2FWOA 3Q44A 5F71A 3TYFA 4BDVA 1T4KB 2GTQA 1AE6H 1ZEAH 2HKFH 1DJYA 4MMZB 3BH9B 4HV8A 3SDYL 1NGXA 2BSDA 4P5TC 3DPBB 1WBYB 1R6VA 1UT9A 4KO5A 1P69B 1K5WA 4I5BB 2WWKT 3HN5A 4PLNC 5DD0H 2XN9D 4QD2E 1XGUB 3MRQB 3QO1B 3WOVA 5F3HB 1A6TB 1S7XA 1IBZA 4S1DC 5DUML 4AGQA 2FLMA 2A9AA 2FH8A 4H8WL 1ID5I 2YD8A 4DP8X 4GAYB 5C0FB 1ZGLP 1INEL 5FF6B 4XPFH 5DR5L 3TM6A 2DLHA 2YFOA 5SX4I 5EZIH 2GK0A 4UM8B 1QBML 4A2FA 1AXSB 1RIHH 3VXUD 4MRCA 5J1AB 4I4WA 3ZMRA 5F88B 2P46B 5C0CE 3OMAB 3WO3B 3STLA 1EMTL 1YAZA 2APXA 3KPRD 3QUMA 3L3IB 5FKAB 4LAJH 5DJ8B 1YYMH 2X09A 4GSQA 2ZKHL 4PCYA 4WO4B 2KL6A 1CR9L 3KYMA 3QHFL 3NN8A 3BUPA 2WO4A 5KSVB 1DBKH 3VXSD 8CGTA 1X3DA 3LNDA 4NAQA 4AQEA 4PJXB 1F4XL 2CJUH 1T7VA 1J1PL 2AZAA 3KHOA 4W9IC 2X4PA 1MF2L 3MV11 3PAUA 4D7BA 1IGYA 3I02B 3C2AH 4ZMYA 1HQ4B 5HI4D 5F9JB 2QL1A 3MGTA 5LCVH 5E6YA 2CUIA 3Q8AA 4H0GA 2IPTL 1JZJA 4AYFA 4HBCH 3X11A 3IEAA 4ONOA 4Z77A 2ZONA 1WWCA 2XACC 5D71L 1QW9A 3HPJB 1GC1C 1NCCL 3DX6B 4UOQA 4MYPA 4HLZG 1RZ7L 4XCYB 4L9LC 1IZJA 4OM0L 3SKNB 1EXGA 4DGVL 3CLEL 2E9IA 1I8MA 5D5MA 1R75A 1CDCA 4G8IB 4M4RA 3T4AB 1X7SA 3RY6C 2EDJA 3QFGA 4K07A 2GSMB 1LO2H 1Z5LB 2YRPA 3ARGA 1X5IA 4M8QA 4UT7L 4X6CA 1QFPA 2EIJB 3JWNE 1N64L 3OLIA 1A66A 4OBRA 1K3IA 2VLLA 4CSPA 3S96A 1JYNA 4IRSD 2N1TE 4JM2C 2R4RL 1U3HC 4IU3B 1MRCH 4L3EE 1FNEA 1TCRB 1B3IA 3SBRA 5A43C 3SJVD 5DZJA 1QQDB 5KZCB 1M1XB 2Y7OA 2SEBA 4PJFB 3RKPA 3T1FB 1LD9B 3P4LA 2GSGB 5JHAA 5GGQL 4Y9EA 1LYQA 4L4VD 4LQFH 2BNUA 4Z78B 5AW6B 2ED6A 2P8LB 4ZK8A 5J6GA 3OAZK 3UERA 4P23D 4TUOA 3U2IA 1XMWA 4CNIB 4U7KA 2WLMA 4R7NB 3DDGA 3ZQXA 3DJ9A 3KYOB 4GXUN 1IL1B 3ETBJ 5IB3A 2BP8A 3IM1A 1JYWA 1ASOA 2YZ8A 3IDGA 5F7WC 5GGUB 4OFKA 1KTRL 5GGRA 3N1MC 4A66A 3E9TA 4I87A 3WFCH 3UTQA 4ZI8A 4MCYB 1TCMA 2VDLL 3OR6B 3RX8A 4UUJA 4XODA 2Q8AH 3G5ZA 3T2OA 4AVIA 1IJ9A 3LN5B 4NRZA 4XO5A 4ACTA 4GAJH 1J0ZA 3EOAB 3BLKA 2X6MA 2YGQA 3KYNA 1VACA 3MRDB 5CSZA 3A67L 2EILB 1S7SB 3ZKQD 5B39A 5FUCE 5GS1A 15C8H 4GLRI 2JIXB 5GJSL 5GZNA 3IJEB 5D7HA 4AG4L 4D0CB 3ARXA 3VQ1C 1V8HA 5B3SB 4ZMVA 4C57C 3FO0H 1A7NL 4OIIH 4P5TD 3V6BR 5DMKA 2GUOA 2ITEA 5FUOL 4ZQKA 4I0KA 2E7BA 4H0HB 2F54E 4W68A 3ULUD 4Z1PA 4LKCA 4G83A 5E6ZA 2XQBH 1GGCL 3CUPB 4G9FE 4LHUG 1XQ4A 1RP9A 4S1DD 4YHKL 5F7DA 2JLLA 1ES0A 1LWHA 1A7QH 2XN0A 1M6OA 5CEYA 2BNRA 3GMLB 2F7PA 4XN4A 5F1NB 1CFQA 5JR1H 2R23B 3MACL 3SHSA 4Q89A 2A99A 5BOJA 2BIMA 2P5PA 4MAUH 4K3EH 3JWDL 3GMMB 2CLRB 2GTWB 2TSAA 5CCGE 2ZWNA 4R4NC 5I6OA 1JG9A 4UCFA 3SDXE 2XUWA 5C86A 2QKIB 2PR9A 3CFBA 4YSUA 4L8DA 1AZZC 43CAB 2PCPA 2A9DA 3MRKB 1BZOA 5L9DH 4HJJL 1AZUA 1ECYA 1H8LA 4IYKA 1M71A 3CXDH 3DX0A 2W65B 1GCYA 2WZ6A 1C5DA 2IDQA 3NEOA 2YPVL 3GO1H 4PJBE 3VMOA 3H7BA 4TNWK 4ICWA 1J5OH 2HFEB 5AD0B 4L8BB 1GAFH 4HUMB 4OZGE 1UVQA 4KRMB 4P9HC 4QJ5B 1LP9F 1FIGL 3PJSA 4TMPA 1B0GB 3MUGA 2ADIB 5FUZL 3NIFF 4YE0A 3RL1A 1OQOA 3LOWA 3RY4A 1V54B 3QZWB 5C0JA 5IOKA 2BFVL 3HS9A 3MN8A 3NIDE 4I77H 3MI6A 5SWSE 1ZT4B 1S5IL 5C08B 1GJWA 2F19H 3IMTA 3KPPB 3G6DH 4KO6A 1T5XA 5EBGA 5JO5B 5AVVB 3UJTL 4NIYE 1TETL 1QEWA 2FHFA 3Q5OA 4HUNB 4UNTA 2ZCHL 2VLMD 4OLWH 3NZ8B 4Y1TA 1I8LA 2WLIB 2FDBP 4OVUA 4YHNA 3SYCA 4JM2D 1U3HD 4R0LB 4X8JB 5M95B 25C8H 4PREA 3A23A 5F6IB 4RDQG 2GPZA 2AK4B 3EDEA 1PY4A 2M2DA 1DLHA 4CW1A 1NDMA 5IBUB 2ERJB 1KCSL 2XHNA 5T3XD 2VLJB 3BLBA 1A8JH 4BFEA 3TO2A 3DO7A 3DX1A 1UT2A 2OTWA 5AW5B 5KYYA 1N68A 3A4AA 1WFIA 4WUKH 3HNSH 3QWOA 4N5UA 2ZOUA 3V4UL 1KJ2B 4CU6A 1JGDB 3MDJA 1HEZB 4MMYA 1AIZA 4D0BA 5CP3A 3N91A 2Z7YA 2JJSA 2J8UF 1QTSA 3BPCB 2F5BL 1PD6A 3V0EA 4LSUL 1DN2A 3V6ZB 5EIQA 3H85A 4URTB 2FX9H 3L4XA 5CJOL 5D72H 2OS7A 1VESA 1CXEA 1RZIA 2WKLA 2ICEB 2QJDA 4G71B 1RUAH 2PP9A 3II3A 4I89A 4RBPK 2DM4A 3B5HA 2ZXWB 4WU5A 2EACA 4N2LA 1BW8A 1C1EL 1I4FB 3FCSB 1GY2A 3PQYB 5HYSG 1E8YA 4LF3A 1WVZA 3O3DB 4X6FB 3WXVL 3SE8H 4KK6C 2VLRA 2HVBA 5CBEA 4G8FA 3QDMB 3T5WA 1P84K 1AQMA 1TTGA 4TN9A 2KLTA 3N2JA 5F93C 5D5ME 2EVFA 4OJFH 1YEHL 2E9JA 1DBAL 4PRIB 1I8IB 4FNTA 4X6CE 1JCKA 1W72L 3D9AH 2ZUTA 3PP3H 4FQ1H 4GS7B 4MMXA 3WJMA 2YAPA 3MLSL 3ULVC 5E6IC 1OE2A 4UT6H 4MJIA 3N44F 4WVRA 1HCVA 1QYGH 2DBLL 2EEBA 1MFBL 2RQ8A 4K8RC 3TC9A 3KBEA 1JSYA 4JQIH 3W0WA 1XGPB 4FQQB 3UPCA 4QNPE 1KJ3H 1SEQL 4R4ND 4JQIA 5DS1A 4G6FD 1IGCL 5HYQB 1LK3L 35C8H 3G5YA 2CSPA 3R4RA 1KJMB 4PJDB 2VSKB 1CGSH 2OLDA 1RMFL 5CINH 2V0AA 3ELQA 1LM8V 2X3AA 5CMAB 2C9QA 4Y19A 2XWJA 1D9KB 3WU1A 1UM4H 1CI5A 4U1LB 2AJ3B 2MOQA 3U7AA 2CGYA 5ICXA 1BBDL 4AE0A 1N4XH 1RJYA 4IEFB 5KW9L 4Z8FL 4FCHA 4YDIL 5A7EA 1NC4B 1YUKB 4S2SA 2L8AA 4NFBA 3HHSA 2YAHA 3MGAA 3HZKB 3PAYA 2WPGA 2J56A 3VD1A 5KVGE 4PVLA 1CFBA 4DPRA 2Y7QB 5CFHA 1FRGH 5IVXA 1K4CA 4E42B 1T20B 2V9QA 1TYJA 2HLAA 5LDUA 4NAJA 4PRNA 3HBQA 6CGTA 3P0GB 1X7QA 1CF8H 4AZ8A 3IAQA 1QTYT 1FZOA 2XQYG 3D18A 1MFAL 5CJQL 2LR4A 1BD2A 2K3HA 3KVPA 4FN0A 4HGWB 3QIWB 2YLHA 3OXSB 3CJJA 3IRCA 1F90L 1CWVA 3VFMA 1T6WA 3N0PB 4TNVF 3IGLA 2O5NA 1RAMA 4Q14A 3W3BA 3O2VH 2BNRE 4U6TA 4FYRA 5C70A 3ASNB 3MUJA 5FK9A 1CVSC 3AXIA 5I71C 2ZXBA 4K7FB 4UMSA 3T4YB 4AKQA 3LHAA 3L5JA 4JDZB 4NM4L 3K72B 3Q8EA 4RGOH 1HWWA 2QVFB 2QADD 3ECBA 4WI0B 5EO1B 3BE1H 2NY3B 1OAZH 1KACB 3FT2B 1RZ8A 2ZXCA 3HEIB 5DZVA 4WWKA 4YXKL 3VGEA 1URIA 4KKZA 4L0YA 4EOWL 3AU1B 1L6ZA 3OR7A 5GXBB 1NSNL 4U3SA 4FXGB 4OTXL 4I48B 3NTCH 5I15L 5FLUA 4JBSA 1KCVL 4NQQA 3F7KA 2BX5A 1G7QA 3EJSA 4DGIL 1H0DA 2R2HB 4J8QA 1UURA 3SKMA 2AQ1A 2E46A 1UFUA 4OIBA 4NX0A 2VZVA 2O4EA 4NO0A 4LHJB 3MBEC 3O11B 1UXSA 3K6SB 2WVSA 5CS7A 4CC0A 1MJJA 3WTWA 5DEGA 1UH2A 4ES8A 2ITCB 1X4ZA 4MGXA 3QEQD 3HR5B 4DQOL 5IMOB 1IUZA 4LDOB 1FPTH 4XN5A 1F18A 1D7DA 3ECWA 5EA0H 3ULSB 2WWNA 4NKDB 2VDOL 1QKZH 4MXVE 1E6JL 2MNUA 5I8KL 2WANA 4FEMA 4KK6D 4JFTA 1EIBA 1XX9C 1YMMD 4PJEA 5JOEA 4NOBA 5ANHA 3RZCC 4OFVA 2FJFB 3TO4C 2E7LC 4Z9KB 3KWTA 5LBGA 4WFFE 5KVMC 1P84J 3KPQA 3GSNB 1X4YA 3KM1A 2R0WH 4UTBH 4YFEA 4PV1C 4UTBA 2CWRA 3ULVD 2WN2A 2ITDA 2X4RB 5EPMA 3H7LA 4K8RD 2XWXA 4RA0C 4UANA 1S5HB 4XOCA 2OK0H 4LESA 3AC0A 1AE6L 2LLNA 2HKFL 1UZ6E 2C3VB 4O58L 1NC2A 1XH3A 4PJ9C 4JKLA 1ICTA 2EADA 4HJ0C 4KDWA 4DFHA 3AMLA 3FHEA 4DUWA 1J1OL 1U42A 4RRPM 3K2UH 5I6XB 5DD0L 3TBWA 4ZQTA 4FTDA 1EZUA 4KDVA 5HGAA 5DCCA 1I8AA 3VI3B 2BW4A 4F8PA 4ISVB 1G7JB 3C09C 1FFQA 1JNNH 5FDYA 1N5AA 2ENQA 2A83B 1ET8A 1PFCA 2WQ8A 5EZIL 3RWDA 3QUML 2OXHA 1DVTA 5GS3A 3E8VA 1A0QL 5E4EC 2VDPH 1UFGA 2GC4C 4NFCA 1ODAA 4FQXA 4HPOH 2DI7A 3WFHA 1DQMH 3OQ3B 3RGVA 3WXWH 3WNNA 2VLRE 1IQDA 2JI1A 4X5XB 3QNZA 2E8YA 4XC3H 1DBBH 3RBGA 5BZWB 1Q9WA 1G6VK 2CJUL 3P9MA 4LNRB 5ECJE 3K8LA 4W4OC 3POHA 3H3BC 5IB1B 3NOIA 5DD3H 3KPMA 4I3GA 5IZ7A 4FL4B 4X83A 4PG2A 4GQRA 1Q0EA 5AW7B 5LCVL 4L4TD 5IVZA 4U1GC 4ZAKB 3WTSA 4HBCL 3BUDA 4ZW7A 4WZ9A 1WISA 3OMNB 4O9HL 1OGTB 1OGSA 1S7WA 4CADB 3W0WE 1FZKA 2GJ6B 3VTAA 5DRNB 3EGXA 1G7LA 5DQJB 3L4CA 1U8IB 3IJ8A 4LSTH 5EIIB 4L8CA 1TEFA 5BRZD 4DPBX 3QZOA 3KMDA 4IOSD 4YLBA 4AT6A 1MN4A 1A47A 4HXAH 1E50A 4AL8C 5IV2A 2OMXB 1LO2L 1BJ1J 3D09A 4QRAA 4Y19E 1WBYA 4RAUB 5GJTL 2KPNA 1DBJH 2X4SA 3ABZA 2LTQC 4I5BA 3ZT6A 4DFIA 3ZE0B 3MRQA 3JSSA 4H8HA 5F3HA 4PWEA 3UBXG 4U6XB 3VB9A 3GZKA 2J1YA 1MRCL 3LZFH 3V4LA 3FFCB 3BH8A 3ZRSA 1HC1A 3HBZA 3ZSSA 4DO5A 1HSBA 3MBED 1J48A 1WLHA 1BXAA 4K7PX 3GLAA 1PKQA 3H9HA 3A4EA 5IVXE 5HHOB 1PVHA 1MWAH 3BUTA 2EXWC 3HI1A 4LCWD 4OD2B 4LQFL 4N3TA 4UM8A 1AXSA 5J1AA 4CSZA 5I1EL 5F88A 1DUZB 3BIKA 5AAWA 1KIUB 4O2EB 3L3IA 4M61A 3CLFH 5TQ0H 1WCQA 2Z6FA 4WO4A 1BD2E 3WG7B 1ZS8B 1WCBA 3RZCD 1UXWB 3TO4D 1WFMA 3WEXB 4QRUA 5EO9B 5KVGL 2IDTA 1AQKH 3BPLB 2O5XH 4KXBA 1ZLVK 1TNNA 5F7EL 5B8CC 2PTVA 4GAJL 3BMVA 4HZLB 4HKJA 4X5LA 1ADQH 1I9IH 2IANA 4XN9A 3T77A 3TWCH 3PWVB 3BZDA 5LGJB 3Q6FB 3UMNA 3MJ7A 1ADQA 5DZNA 3ILQC 15C8L 5L2JB 1WS7A 4WNQB 4NSKB 4YE4L 5D2NA 3ZDZF 3FO0L 4PJ9D 3RU8H 4HJ0D 4PLKC 3Q7JA 3OGCA 4V2CB 3DX6A 3NSXA 4BD4A 1W15A 4Y2DB 4ES9A 3Q5TA 4GINA 2XQBL 4H0IA 1A4KA 4UQDA 3QEHA 3L08A 4QAMB 5ALBH 3FU7A 4CDGC 1A7QL 3E6FB 4RRPG 4G8IA 1YNLL 5JR1L 4AGNA 1P6WA 4MAUL 1FLRH 3KDMB 4K3EL 4ZYKB 2WXGA 2EDHA 3GK8H 1NUNB 2J6EA 2YXMA 2G5RA 1EAJA 1NAKH 5TE7H 4IU3A 4Y5YA 4UINH 1HH9A 4BELD 5DFTA 4JRXB 3V4VH 4RQQB 3V4VA 3ZHLA 5L9DL 2LU7A 2VXVH 1P7QB 4PJFA 1PQZB 3CXDL 1LD9A 4F9PA 2GSGA 4PJEE 1SDAB 5IT2H 4Z78A 4YK4B 2Y5EA 2P8LA 3D87B 3GIVA 1XCWA 4LLUA 4Q2ZA 2ODIA 2AV1B 3F58H 3QUKA 1J5OL 1AI1H 4CNIA 5K9OB 4WWOA 4C56A 2FLBT 1WQVT 4O2FB 3QIUB 1HXYB 1R34A 4R7NA 1GAFL 3BZ4B 3KYOA 1IL1A 5K93A 4AQOA 5DD1L 1QMUA 3L5XH 5IROA 5GGUA 4AIXA 1A9BA 1RSYA 1ZVNA 5CN1A 2IQ9H 3FXIC 1R3HB 2ZUYA 4LRIA 2WQVA 5DA4A 4WEMB 5JW3L 4MCYA 2YXWA 3OR6A 5DLMH 2RD0A 2WC7A 2Y7MA 3TZVA 1AG6A 3BT2L 4HS6A 2HT2C 3LN5A 4KDTA 4KO7A 3RDTA 2B7DT 4IK7A 4A39A 3EOAA 3LQAH 4I77L 4QRTB 3VFGH 5KVDH 5I1GH 1M4KA 1S7SA 4G2AA 3PPEA 1CQYA 3NPSC 2F19L 4D9QE 1OGAE 1S3RA 5E70A 3IJEA 3DOSA 4D0CA 1I8KB 2FR4A 4L0ZA 1HDMA 1PS3A 2KS0A 1KTDA 2MKLC 2IQAA 4E0RA 4FXTA 4OLWL 1MH5B 2WSDA 3HC0B 4X80H 2DJUA 2CO2A 3ZPDA 2ZSWB 4ZMZA 4MAYD 2GJPA 3CUPA 4XMPL 25C8L 5CEZH 2WUBH 2PP8A 3FRPG 1HESA 2Y5TB 2WV3A 3JV0A 4ODTH 5F1NA 1JPGA 2QSQA 2R23A 3ZN6A 1J12A 4H2AA 4H8PA 3KPSD 3NCCB 5AW9B 2NY2B 2CLRA 2GTWA 3FF8A 3GMMA 2EXWD 4MQ7A 4CVXA 3PXHA 4K9EL 4FQCH 4WUKL 3HNSL 5CJBA 4HSCX 2NRDA 4PYGA 2QKIA 3AVEA 4AKOA 3FYEB 4UB0H 3S97C 3JVGC 3U30C 4ZMXA 4BQBA 43CAA 2NNFA 4B3VA 4MNGB 3CHQA 1F42A 4JO1H 5KBNC 1KV3A 2FX9L 3W9EA 4IKKA 3QNYB 3GSUB 1JHKH 2XC8A 4HHWA 1RUAL 4B6ZA 2HFEA 1QTPA 4LARH 3F64A 1T04B 4JZJC 4AQZA 1IC5H 5D7IB 3SPVB 3ILQD 4O2CA 2AERT 5FYJU 5C9JB 3SE8L 5I30H 3GMRB 2CIKB 4LGRB 5EEXA 3IGUA 4Y8AA 1JGEA 2NW2B 3CMGA 5KBLA 3QORB 1DVXA 4PLKD 3FU3A 3V4PH 4KZDH 2K4AA 1F5WA 5KS9B 4N2BA 3LRLA 3AS0A 3V4PA 4H2CA 3D9AL 3IDJA 4FQ1L 2Z7WA 3UAFA 5C08A 4APQB 5BUGA 3W56A 1HAWA 4UT6L 4UIMB 4KH2A 2HB0A 4OQTA 3U9UB 2P80A 2RGSA 4JQIL 3L2LA 1FWXA 1AZNA 4HH9B 4F58H 3NZ8A 1KJ3L 3D2TA 1H3TA 4KU1A 5CGYC 3DBSA 4YBLC 5FOJA 4YSCA 1PKQE 4NIKB 4X0NA 5BPPA 4R0LA 1A3RH 3KW8A 4X8JA 2VUYA 5AVQB 3TWYA 2V2WA 4D8PB 3BSZA 1CGSL 4QRRD 2C3XA 2AK4A 1N8ZB 4IOIB 4S1RL 1FGVH 3HAEB 3UZQA 4MJ4A 3Q8FA 3P4NA 5I6NA 1UM4L 2EDNA 2QPFA 4MCNA 5IMKA 4P5KB 5ISZA 3UC2A 2LFGA 5LWYH 2Q87A 1JGDA 4W9EC 4FLHA 2A4ZA 5F7LB 3LHPH 4GKOA 3SE4A 3STBA 1FVEB 4EI6B 5T3ZD 1NPUA 3VDBA 5DRZB 2V9UA 3BPCA 2HWZH 4Q6KA 2IANE 4ZMPA 1FRGL 4G5ZH 5GGVH 4U4IA 3V6ZA 1UOVA 3GD1C 4MNQD 3NFPB 4I18C 1L9NA 1MHEB 1C5CH 2HT2D 4CVUA 1CF8L 3QZPA 2CRIA 1A3LH 4KH9A 3CHXA 3NEXA 2BIPA 2V3EA 1H6EA 1I4FA 3FCSA 3ROOA 3QR2A 1TJIH 3BP4B 3CFTA 3MLWH 1RPKA 3VJ6B 2WXIA 4IIQC 3T8MA 3HS8A 4ILDA 4ZMOA 3S3BB 1Q0YH 1DVFC 4PRIA 1I8IA 1PL3A 3P3RA 1V3MA 4XP9H 1UM6H 4NQCB 1KNOB 3VFSB 3IGAA 2PUQT 3VD7A 4RGOL 1JP5A 1CE6B 2KUTA 2QZ5A 4GRLB 3T04D 2VR4A 2WXHA 1G7PB 3BE1L 2X5PA 3EFFB 1OAZL 5GRUL 4M5ZH 4H8WC 4XMKL 1BFTA 3QRGL 4GUPB 4JO8A 5F3BB 3ESUF 2AP2A 3LPGA 1VJSA 1XGPA 4FQQA 1JV2A 1EXUB 3IU3B 3SBWA 1WT5C 4PJFE 3TIEB 1T66D 5T5FA 2ZCKH 1BZ7B 4N87A 3QS2A 4K3GA 5KAQG 3P3TA 2E7CA 4JPKH 4PS8A 2FQDA 2FYYA 5DHEA 3BDYL 1SN2A 1IARB 2I07A 1I3GH 4OJAA 4HULB 3EADA 1U93A 1HKFA 4PJ8B 2WNXA 2XPGB 2JCCF 2AJ3A 4U1LA 2MWCA 3BGMB 4TQIA 2WTRA 4BKLB 1NC4A 1EA9C 2ZX7A 3ZYJA 2GHZA 1YY9C 4AK1A 3US9A 4HAFA 5EA0L 3HZKA 5IY5B 1ZTXH 3ET9F 1JPFB 1BQ5A 1D7CA 3P4MA 3K71B 2EIZA 2VMDA 3EJQA 5DFWH 2Y7QA 1HZHH 4TTDC 4YFLI 2QTEA 4WF7A 1DANU 4E42A 1T20A 4YAQB 4WKZB 3G5VB 4QHMA 4ZS7H 3LQMA 1N2RB 4FABH 4XZUB 4Y5VC 3HA0A 2G4EA 2EC9U 2R0WL 1O7DC 2NX5D 4UTBL 4WI9A 4ZTPH 3L3OC 4Y5XC 1TTUA 1RJZB 2QELA 4HGWA 4HGKC 2ENPA 3QIWA 3OXSA 4IHBA 3ARTA 4XVSH 5I8EA 1CGXA 1JI2A 4Z3HA 1MFNA 4NZTH 2OK0L 5CEZE 5CGYD 2ZSVA 5SWZA 3PDOB 4B97A 2HT4C 3KG5A 4K7FA 1OARL 2AANA 2J71A 4Y7MA 4JDZA 4JK0D 2BDNL 2D3VA 4WI0A 4ZSOB 3K2UL 4JJHA 4LOFA 2LLLA 1A8ZA 5EO1A 1QHPA 2E56A 3WJLC 3E2HC 3FT2A 4TSBH 1T83A 3ESPA 4BRJA 3RNKA 3A0OA 1QABA 2P8PB 5IJDC 1L3NA 1B4TA 4FXGA 4AX3A 4NQEB 4F15C 4ACPA 3EDDA 1VLXA 4UOW1 5HYIA 1FNAA 3APNA 3D85D 4M48L 2BC4B 1MREH 1ZXKA 4QRQB 3L2NA 1OSYA 2PKDA 4B60A 2DQCH 1UATA 1TZOA 4OFYD 2L7JA 3AUWB 4BSWB 1TO5A 4IRZA 4WCYH 4GG6F 2VXSL 1EV2E 4HPOL 3O11A 4XWGL 1G7MB 1DQML 4XOEA 3RILA 3WXWL 4EZJA 2WLZA 3PRZA 4TLKA 4X9BA 5GRXG 1A14H 3O3AA 2ITCA 2FSEA 5IMOA 4ZG1A 2D7MA 4XC3L 1DBBL 4NKMB 1RZGB 3WELA 1JZDC 3F84A 4BCZA 4R97C 4NKDA 1CLVA 5BMFH 4UQ2B 1KIQB 1I7RB 3LNEA 4GAFB 5DD3L 3UCQA 2AJZB 1TVHA 5DO2C 5IHZB 1HILA 5KUMA 4P49A 5C08E 2F7OA 2R2EA 4I0PB 1MCOH 3AG1B 43C9A 3CTTA 1DVFD 5JOPD 2BMKB 2X1WL 4WAFA 3GSNA 1I85C 1MVUA 3QFJB 1FZMA 1XHHA 3VACA 1IVTA 1EJOH 4HX1B 4BK5C 3VMPA 4DGYH 2FB4L 5K69A 4GUOA 3NT0A 4EUPH 4XXWA 1ZPUA 1SHMA 4LSTL 1O9ZA 2LVEA 2X4RA 2V9RA 1L9QA 4GI8A 5DTFA 2AK4E 3D3VD 1S5HA 3LAFA 5IEKA 2NY4B 2YBRB 4AQ1A 1KGJA 4YSQA 1OAQL 1CL7H 1JIBA 2C3VA 3CBRA 5C7ZA 5FDWA 2HP4A 2C26A 3OAZH 4WV1B 1DBJL 1N18A 2Q6WB 1ED3A 1D6EB 1F2XK 5CHNB 3AQXA 3MV8B 2UYLA 3L4WA 4AEHH 3S88H 2AZUA 5ISZE 2ODHA 2MOVA 3DYOA 3P9LB 2XWBB 3OAUH 5C07A 4ISVA 3FQ2A 3PL6B 4M29A 5CNHA 4IKNA 1J8SA 2UZPA 1RJLB 2WTOA 3CMOH 1L6PA 3MXWL 1TLMA 3ARQA 3ENEA 3OWEA 1GGTA 2GUYA 1BQKA 5JPMA 2XKNB 1YY9D 3G5WA 2Y6TE 4JO5A 4RGNB 3UABA 3UZVB 5LG6A 1D6VH 2WVVB 3CFEB 4TTDD 5DJXB 3CLFL 5TQ0L 4M6NL 3ZRCC 4UU9A 2CUAA 2F8OA 3I9IA 5CKGA 5JYMA 3VX0A 2LU5A 3GTNA 4C4KT 3MHZA 2NNRA 3EG9B 4RFNC 4PI2A 2OMZB 3HG1B 3QDME 4X5XA 2ZZUT 1AQKL 2WXKA 2O5XL 3S35H 3IETB 3RWJB 4FMVA 2MKWA 4HDIB 5M7QA 4LNRA 1JZ4A 3MLXH 5IB1A 1ADQL 4PRIE 4JLRB 3NJXA 2EH7H 4YSAA 4GP5B 1BSIA 2E74C 3F7RA 2CDFB 3CDYA 3PWPD 3QHTC 4NLHA 2BJMH 2VWEC 4X9HA 4MLIA 3TA3B 5JYLA 2EABA 3LS5L 5BCAA 1EHKB 2HT4D 3FQRA 2BY0A 1OGTA 3C60A 3RU8L 4UOZA 4P46B 4JQVA 5AW0B 4CADA 1MW1A 2GJ6A 2ZX9A 5CD3A 2RJMA 4YBQC 1NQBA 4IKJA 2PETA 5JXAH 3L95B 5I1KH 3MLYH 1MI5A 5ALBL 1NDGA 1W6WA 2UV3A 2OXGB 5J9PB 4J2XA 1GY1A 1DFBL 5M94B 2OMXA 4HUWB 2FNWA 4NP4H 3FB5B 5F8QC 5LGYA 1YJDH 4RAUA 2J6EL 3K6NA 3GK8L 3LMJH 3CHOA 1I1YB 5IW3A 4DKDC 1BP3B 1X5ZA 1A4CA 2HJKB 1DSFL 1IZKA 2GIXA 2ATAA 3CN4A 5EZLA 4UINL 2C8NA 1FG9C 3FFCA 1T0MB 1KN4H 3V4VL 1FVCB 5KYXB 4DZ8A 2A6JB 4MZ2A 1KTLB 1BFOB 1LL1A 3NP4A 4IQHA 1IQWH 2VXVL 5HHOA 1JWSB 1UA6H 2PTUA 4O51A 1BYPA 2CHZA 4OD2A 3SGEI 1RZPA 2XN9B 4PCSA 1CPUA 1HQRA 2R0ZH 1DUZA 1BIIB 3F58L 1KIUA 3IFNH 3V0AC 4ODHH 1D7BA 1TVBA 1Z5YD 4O2EA 5D1XB 5EC1B 1MFUA 2N0MA 1ZHBA 1ID2A 3HNTL 4JFOB 1Y0LB