4LO9A

Human p53 core domain mutant n235k
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
194
structure length
194
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Cellular tumor antigen p53
publication title Structures of oncogenic, suppressor and rescued p53 core-domain variants: mechanisms of mutant p53 rescue.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4lo9A00
1HJCA 5AOKA 4MZIA 1UOLA 4LOFA 4IJTA 5G4NA 3D06A 2J20A 4IBTA 2RMNA 2BIPA 3WTYA 2XWCA 4MZRA 5AOIA 4AGPA 4L18A 3EXJA 5AB9A 4LOEA 3IGKA 4IBQA 2BIMA 1LJMA 3D07A 5ECGA 1KZYA 2J21A 4A63A 2IOOA 2J1YA 3QYMA 2BIQA 4G82A 5LAPA 4IBSA 2AHIA 3WTVA 2PCXA 2J6WA 3TS8A 2ATAA 2P52A 1H9DA 3WTXA 2YBGA 3D0AA 5KBDA 4LO9A 1EAQA 1TSRA 3KMDA 4GUQA 2IOMA 1E50A 2J1ZA 4AGNA 2X0WA 3VD0A 2J1XA 3EXLA 5AOJA 2GEQA 2OCJA 5G4MA 3WTTA 5BUAA 1TUPA 1YCSA 2H1LM 4IBUA 3D05A 4AGLA 1CO1A 3KZ8A 2BIOA 4IBYA 1HJBC 4HJEA 3WTSA 5A7BA 1T4WA 3Q05A 1IO4C 4GUOA 3D09A 1EANA 4L0ZA 3QYNA 4QO1B 3ZMEA 1EAOA 4XR8C 4IBVA 2ADYA 4IBZA 1GZHC 3D08A 3WU1A 3US0A 2VUKA 3VD1A 5AOMA 4IBWA 3US1A 5ABAA 4AGMA 3IGLA 4AGQA 4G83A 2AC0A 3VD2A 4L0YA 4KVPA 5G4OA 3Q01A 3Q06A 2X0UA 3WTUA 2X0VA 5AOLA 2WGXA 1HU8A 2MEJB 1CMOA 2FEJA 2XWRA 2IOIA 3WTWA 2BINA 1GZHA 5LGYA 4AGOA 2J1WA
chains in the Genus database with same CATH superfamily
1NBVH 4H5SB 3THML 4OJEH 1Y18A 2NY3B 3L2MA 4X5RA 2FR4B 2PYFB 5MEND 2P26A 1MCJA 3RZCC 4CVXB 1SPDA 2LW3A 1IFGA 2QHRL 2VM3A 2ZWKA 3QR2A 4RAVB 4JKWA 4BINA 1MCHA 4GRMA 4WFHE 2W59A 3JTSA 1PZBA 4FFZH 5T33H 5DRXA 3MJ7B 4JN2B 3NN8B 2DQCL 3D07A 1U3HB 2YZ8A 1IAIH 4OSUL 4Z78A 5TQ0L 5E8DH 3FCBA 4U3SB 3RB5A 3ZMRA 4BJLA 3N41B 1F1DA 4U1GB 4IKNA 4S2SA 3IFOB 3OHXB 1QPXA 2WUCH 4O02L 5I6MA 3CG8A 4NKMB 2J2ZA 5LBSL 5IHLB 4XP4H 5IHZB 4JKKA 3MRKB 2OAAA 3QUXB 2APSA 4HA1A 5GJTL 3D85D 5HY9A 5EULV 1NAML 4APXA 4Z7QE 4N0YL 2WZAA 4N0UB 1EA9C 1JHLL 4QLWA 1MFCL 2QV4A 2W5PA 4I1PA 1FL3B 4F8TA 5ACZA 3QUYA 4Q58C 2MHAA 4L5FE 5K9JH 2JLLA 3GBMH 4Y7MA 2OS7A 2PCFB 1P5VA 4G7YH 1SUJA 1EAPB 2RJMA 3L1EA 4JX0A 4WUUB 2QSVA 5DDHA 2GC7C 4XCCH 1WWAX 3STLA 4PVLA 3ULAB 4BCYA 1IKNC 1RZ8B 3HG0A 1RSFA 2PYEE 2AJSL 2RACA 1AXSA 3FK3A 3NAAL 4GAAA 3KWUA 1A3LL 5I6XC 2JXMB 4U6TA 3LD8C 1B3JA 1G7HA 3LHAA 1KLGB 2MCAA 3MRNA 1MH5B 4LSRH 3U9UB 3BP7A 3DRTB 2BSDA 5JXED 2HJKB 3FPXA 2BXYA 3QC5X 4JFDB 4NZDA 2R59A 3NZ8A 3UBXG 2OCFD 4FZEH 1QFWH 2HJFB 4WCYH 4XCEA 5C3LD 1MWAH 2BOCA 3ARGC 2V5YA 2HLAB 5BVJB 1D5BB 3ZHNA 1WV7T 3CU7A 4N0FA 4XNBA 3K71A 2P80A 5EFIA 5I1AA 2PO6D 5EUKB 4WEMB 4L3CA 3BD3A 2OR7A 4TPRH 1PYWA 3MRCB 1KYFA 4OVVA 4YEFA 4FXTA 3DLQR 3NGBC 1A02N 4HCRH 1JOIA 2MQ3A 1P7BA 1OSPL 5F1NB 4KFMA 3ELQA 4JL1A 4HHAB 1UA6H 2VUYA 1KJ3L 2EVJA 1J1XH 1V3LA 1XDTT 2ZX7A 2C9PA 3EZJB 2LAGB 3AT8A 5KVFE 2VCOA 3LZNA 2QZQA 3DVNB 3U1SL 4IGBC 3NCEB 3UGUA 1IEAA 3H9SA 1FPTH 1IUZA 2E6QA 3ET9F 3TV3L 1ZVSB 2V7HB 4WK2B 4LZKA 2CR0A 3QNYB 1T03L 1INEH 4OZIA 1FG9C 3QRGH 3QVAA 1IGCL 5JUEL 5AG9A 4LCIL 4HJUA 3QJFA 1FGVL 3FUFA 3VJ6A 3MOBL 2I9TA 3PV6B 4IHOB 4NAQA 2F18A 3NA9H 3OL2A 1HVXA 3B2VH 3NTCH 2K45A 2AHIA 5I6NA 1YAZA 4MYWB 4EUPB 1P5UC 3P40A 1U8JA 1KFGA 2QZ5A 3FRPB 2F68X 5DMYA 3UG4A 5ISZA 1HH9A 4XMLL 4C55A 2FHBA 3IMVA 5CJXA 3N44F 4KK6D 4APQC 1U8NA 1ML0A 3BYTA 2P24A 4MAYC 3VWKC 3AU0A 3V95A 3TT3H 1NLBH 1XH3B 2X4UA 2D31B 3FU5A 2FT8A 4NQCA 5C7XH 5DC4B 1YA5A 1U8MB 2WLJA 2ZJSL 3VTTA 3TNNA 3FQ1A 1UACL 3AMLA 3NCBB 3QULA 1P1VA 1IZJA 1RHHA 4ZX3A 4XVSH 5IEHA 4JPVH 4KZDL 5IEKB 5BV7C 4EI5D 1SYSA 1WZAA 1DJWA 4R7VA 5C0JB 2UY7A 2HVBA 5LWYL 4BBWA 2I32A 1ZT4A 2X4OA 4DGVH 3AUWB 1FYTA 4X7SH 2QJDA 2W0FA 2Q6WB 4HU8A 4BFIA 1PLAA 2VXVH 2DLIA 4DZ8A 1R17A 3LRSB 1T22A 1QBML 2EH7H 2JNZA 5LQBL 4Z1PA 1K72A 2CK0L 4GKSB 1U2CA 4TNVF 3T2NL 1WS8A 3CSFA 3MRDB 5DJZA 5CSZB 5HYEA 1AY1H 1NMCC 4LKCB 2CXGA 4NUGH 1D5ZB 4Y4FD 4BM7A 4H25B 3LH8A 4JFEB 1B2WH 2B14A 3DVFA 2BNRB 4OFPA 3T2OA 5L4MA 3EOAB 4R2GB 4MCZB 5EIVA 2GK0B 1DYZA 1LO2L 3I6KA 2QTVA 3LVTA 4IOSA 4JY6B 5GS0C 1IBYA 4HQQH 1FNLA 5I5JA 4OLUH 3HE6D 5J6HA 2D73A 5A6MA 2HT3D 2OR9L 3NG5A 5K1NA 4R7NB 1PZSA 3ZK0A 1KYAA 3A4FA 3HAEH 1WA0X 5BOJA 2IPUK 1D7FA 1SGKA 1KZQA 5TK2A 4UAHA 1F8TH 4NC0B 5HHOB 1KF9B 4YPGB 5IBUG 4EE2A 4C56D 1QFUL 3PGCA 2ZCLH 5D7JA 1W16A 1GYUA 2YPVA 3I6LD 1Q8MA 3CX5J 1X5KA 3PPSA 3MRIA 4FYQA 4L48A 4RZCB 4F2MA 2FNBA 1AIFB 3ZU8A 4ZX4A 4PBWD 1HXMA 1IBGL 4FNPA 5C09D 2ZOLB 3O6FB 1FZOA 4PWGA 4L8SC 1A1OB 3GMLA 1J5IA 1MUJA 4UILH 3X1BA 4FQXB 5FM4A 4MS8D 1K4DB 1ZLWK 1N8ZB 1GOFA 2ITDB 3FULA 2NSMA 3QJSB 1SYVA 4QRPA 4Y4HA 2GTZA 3VXQB 3RI5F 2BNQE 4U2YA 3TFKD 1UWGL 3ZVVA 3BAEH 3WGUB 4PJFB 1P7QD 1BW8A 2VLME 2DQDH 3ARBC 2AXHA 2MRYA 4LSTL 5KVGL 2VO5A 4Q74A 5CKGA 3BVNB 1F4YL 4FTVA 4N2NA 4FJYA 2H1LM 7FABH 3DX6A 1CGUA 5E6IB 1HWHB 3EH1A 4W4NA 3CLFL 2QGDA 4U6HB 4JFYA 5INCA 3C6SB 1H8SA 2XI9A 2MPAL 3UZEA 5E9DD 3NFSH 5B39B 1W72H 2EDNA 2HFFB 1MXDA 3BGMA 1E4XI 2VN7A 3QI9A 5A6IA 3WS3A 5B3SB 1TPXB 2AKRA 3ULUL 1D5IH 1QLEL 3HZKA 1R3HB 5HGAB 4QXGL 1HL5A 1OF2A 4I85A 3PDOB 1BQSA 4P2OB 4JLRB 2WWMD 3QXWA 5IESH 4IRSA 3OKLA 5F9WB 4CA4A 4X6CB 1JRHH 4NO2A 3QZLA 3R18A 4U6YB 2JJTC 5F1IB 3D9AH 5C08B 1MJJA 3ULVF 1C8PA 4F9PA 3SDXF 4OCYH 4FQ2H 3LZFL 2FWSA 4ZUVB 1Z9SA 4CJ1A 4AGQA 4G83A 1NFDA 3EADA 4AH2A 4MVBD 3N5AA 3UERA 3WIHH 2X7LB 3ISRA 4MD5A 4BZ1A 1NM9A 1RHFA 4L4TD 4LPXA 2D2OA 2HFGH 5L9DH 2QKIB 3RILA 1BM3H 3JTBA 3CE1A 3N40P 2GCYA 4YVNA 2ZG2A 3DMMA 1O9ZA 4X6BB 4Z95L 3PQYA 4NO5B 4RQQB 5E8PA 4EKXA 1YYCA 4QRQA 1FORL 4JG1L 1RPKA 4XNMB 1ZGLB 3GGWB 1N3NB 2VERN 1YZZA 2JIXD 5FFOA 4HWZB 2VISA 3C5SA 3GTTA 4R90L 2EYRA 4XCFH 3MR9A 1S9YB 4JKNA 1SZNA 5I8EB 2FO4A 3EHBB 4OCNC 2W0KA 4UT9H 1GGBL 3U46A 1RUMH 1NC2B 4HIXL 5DURB 4P0DA 2R69H 4K8RC 3BAWA 2P43B 4AIZA 5I8OL 1ITCA 3A6OA 3A21A 4FXKB 1NH6A 3LQMA 2OP4H 3VRLE 1J5CA 3NSYA 4XXCC 5EU4A 1ZLUK 1WVZA 2CLZA 1B0RA 2EEDA 4OIBA 2X1XR 1X9LA 2QMKA 2XZCH 3JWOH 3BN9D 4P3WA 1QI3A 3CZJA 4LBEB 5D1ZD 3QORC 2Q7YB 5D5MA 1BQLH 1ZLVH 1AZNA 3LVEA 1HCZA 1GGCH 3BE1L 3CH1A 3EH5B 4QJ3B 1NIAA 1NCAH 4NIKB 1SQ2N 4PJ5B 3M1OA 1BAGA 3NCMA 3QZPA 1AYOA 1XSOA 4GT7A 5ESQB 1MVFA 1AD0B 2J44A 3H6JA 4P5SA 3WXVH 4EQ2A 2Y1AA 3CHRA 3R06B 1KNOB 4L3FA 4QXTA 4TRPL 3L4ZA 4X98A 2UVEA 2B4CC 1LE5A 3CBRA 3MGOB 2ZOWA 3NACL 1HCYA 4I9WD 1CFBA 3RGVA 3SDXE 3DTXB 1IC7L 1URZA 1JZGA 5CCHE 5CCKH 1T21A 1KIUA 3F5WB 1F4WL 3IFNL 4MD0A 5A6LA 3GK8H 2BIHA 2OZ4A 1MQKH 1NOFA 4KROC 3C60D 5J13C 2DBJA 2YAOA 4GW1B 2A6JB 1L9PA 3AROA 4HH8A 3PWPB 4F15C 4F57H 5GJSL 1KWGA 4ODWB 4L8CA 1QAWA 1E4WH 2EC9U 2ZSWB 2QR0B 1YUKB 1JGEA 4TS6A 3HW7A 5ITFA 1ND0A 2OTWA 2YKLH 4WEEA 5EWIH 5D2LF 4PS3A 1IL1B 2FK9A 5IB2B 4KH9A 3G3LA 5IQOA 2IPTL 4AXWB 1NUDA 1Q9OB 3P0GB 1RJZB 2X4RB 4K5MA 2NUTA 1WAAF 4I2XB 4YIQA 4PG9A 1TOXA 4ZUTA 5AKRA 1DUZA 3DURA 3RA7L 3WTUA 3VG0L 2H0FA 3BRFA 2ICWJ 3Q8EA 5ILTL 1HU8A 5SWQA 4J3BA 4R84A 4GW4B 1VADB 3KPQB 1L9QA 1NCWH 3V4VH 3QO1B 5MEQA 3ABLB 3DARA 1A2YA 3GMRB 1MPAL 5C97A 2VDQL 1BJ1H 4ORZC 2X9YA 2GFBA 1MCFA 4WUKH 1QNZL 1B3IA 2CUIA 1WYJA 5E23A 1AH1A 2ENSA 4V1DE 5EEXA 3RURA 5AYTA 5ETUB 4DCQA 2R51A 3ZE2B 3FN0L 5EC1B 3OLDA 5FYKL 4HKJB 5H35B 1BZOA 3MV8A 1DO6A 1MREL 3QJHB 2EH8L 2QHRH 5HI3C 1E2WA 4Q52A 1LDPL 4K7PY 3QZWA 3FQUB 1NDMB 3BO8A 4HISA 4A7UA 3MNZA 2ZWNA 2WO3B 3X11B 5CEZD 3QDJA 3RWGB 1HIML 2DQCH 4UNIA 2OYLA 4F92B 2V2TB 3EBHA 3NEEA 1Z5HA 4OSUH 3Q3GB 3BESR 5BZWB 4X6FB 4LRNL 2HTLC 2G2NA 3LKNB 3GSRA 1G6VK 5D2LE 4L23A 1KJ2A 4Q6IB 2N0KA 3D0VA 4GSQA 2N0MA 1LGVA 1N0XL 5F6HJ 4A2FA 4O02H 4YC2C 2GSGA 5BRQA 3SDCB 5HYQB 4X80L 1QACA 5T1KD 2E76C 2R23A 4HKXB 4B41A 4B0MM 5C0AA 4CGTA 4QRAA 5GJTH 3RUGF 3UBFA 3ECVA 2BHYA 2O26U 3C5JA 1NAMH 5HGDB 4Z7OF 4N0YH 4AT6A 4PJDB 2OCCB 3RTQC 4M8QB 3PWUA 1JHLH 4XVOA 1MFCH 4NKIL 2NY4B 1Z5YD 4U1JA 2YZ1A 3FSWA 4TUUA 3VMOA 2X6AA 3BP5B 3B34A 3BGAA 2P8MA 4BH7A 5IV2B 2YD8A 1NC4B 2E7MA 1EVUA 4YL4A 1HHIB 2WCPA 1U58B 2MIZA 4XO4A 1BAFL 2AJSH 3NAAH 4UQ3B 5D4JA 1A3LH 2YPVL 3RQ3A 3L6FA 1YNKL 1DJSA 5B7FA 4WI9A 2Q2LA 4GRLB 1DEEA 3MV7B 5CSGA 4Y9GA 1ETA1 3VXUD 2ALAA 4UM8B 5DYOB 4DEWA 4TVPE 4BFBD 3Q01A 4BKTC 3FQRB 3OKNB 4P5KA 5GGQL 3ZBMA 5JXEA 2V0AA 3OMZA 3GXTA 2BNUA 4MQTB 1KENH 1NCGA 4Y89A 4ELMA 5IB3B 4S1QL 3MBED 1MRCL 5J7CC 1L9TA 1PEWA 3BEWB 3MNVA 3OXSA 5DC0A 2K78A 3E2HC 4P59L 5EEUA 5FWRA 4QDGA 4WHDA 5GISL 3UJIL 1XSIA 1WAEA 2G5BA 4HFWB 4S1DD 3WY3A 4JKMA 5DHVH 5D2NB 3KPNB 4HLEA 1QFHA 3BAKA 1BJ8A 1T6BX 4BQ6A 1HL4A 1FN4A 1OSPH 5K1VA 3EJZC 2HP4A 1MG2C 3FB6B 4A7TA 1KJ3H 2W8CA 1KEML 2I7OA 1RURL 1AXIB 4G7RB 4Z7OE 1DQJA 3UX9B 4ZUSA 4XC1L 3QEGL 2VM9A 1ZEAL 3V4LA 5FKPA 2DMGA 5EZOL 3SDAA 4XTRD 1DJYA 3RWJA 3RY6C 1JFQL 4ANVA 1INDL 3FAXA 4N2FA 1KIRA 2OMTA 2Z92A 2D4DA 1T03H 4BA0A 4CGUB 5JUEH 1J9SA 3WTVA 4Z0XB 4LCIH 4U0RB 4HLZG 1FGVH 2UZPA 3VTAA 3MOBH 2CWRA 4ZNCD 4OF0A 1H6FA 5IBLC 4UNVA 4GBXC 2H6OA 1NMAL 5FDWB 2AQRA 2QQQA 1PD6A 3CHSA 3SBWA 1HDMA 2FQGA 3KJ4C 2GBVA 3C9NB 4MLIA 1PL3A 3IJEB 3B56A 3LAFA 4X99A 1H6TA 3VFSA 1UXSA 3FQ2A 3IAQA 1MWAB 2XXMB 4ESKA 4B27A 1ZIBA 3KXFB 3BVTA 2G3XA 3U2SB 3CPLA 3M45A 4QD2E 1TYJA 4HPOL 3R0MA 4U7MA 4WU5A 3QQ9D 4BZ1L 4P3CL 4E9XA 3BP4B 3O9WD 3RAJL 4DP6X 4DOHE 1MHPL 2CDEB 2E47A 4G42B 4DP1X 1T4WA 2R9HC 3RYMA 1FWXA 1ZLWH 2AXJA 2VTFA 2ZJSH 2NSQA 4PJ9A 3ZKNC 1XF3B 1J5DA 4UANA 4PJCB 1UACH 4ZXBD 2J3SA 1LNUB 2WBXA 4GOSA 1ZTXL 5C71A 1YEHL 4HXAL 2W1NA 4NSKB 5FV1L 1YLBB 1C9SA 4KZDH 3TXAA 1Q94A 1R5VA 5TPWL 2R1WA 1MFUA 2YK1L 1SN2A 5LWYH 4P4KD 2H2PD 2W9LA 1PQZB 3TLRA 3T0DA 1FNEA 4HAKA 4PJ8B 2O93L 4PVBA 1MAKA 1I4FA 2DQJL 1NEZA 2NQCA 4DERA 1QBMH 1HE8A 5B4MD 5EU6A 2CK0H 3PAZA 2H32B 3T2NH 2WMPB 3L3IA 1LL1A 4JRYA 3SDDC 4ONGL 1G7PA 4C8XA 4YHZL 4JRXB 4W9IC 2X6UA 1J0HA 1XCWA 4MJ5A 5IWLC 3VVWA 4LCCC 1ECZA 2ILLA 3X13A 2H8PB 5I6KA 2QDWA 2BVEA 5TE4L 1KXQE 4GG8A 2A73A 2YR3A 5D7IE 1S7TB 5KSAA 3K3QA 1RUQL 2GJPA 5I2IB 3SODB 1LO2H 1U8HA 4PJ7E 4ZAKB 5CD3B 3B1UA 3EOBA 5BVPL 4M5SA 4PIRF 1IFHL 4WENB 5EBLB 5FM5M 5KUKA 1RK7A 2ARJB 2OR9H 4HIIB 1JXKA 4R97B 2P5EE 4F1SA 3OKEB 4GAJL 1TQCC 4JFQB 2BS9A 3QDGE 1OB0A 4XCNA 3SE3C 3M6DA 4WFED 2CO4A 4C59B 3DTUB 2DTML 4Q89A 6PCYA 5BQDA 1M4KA 2JE8A 3ZDXF 3WUWB 3KYNA 1BVNT 3D30A 5ICYB 4OF8A 3TO2A 2AV7A 2OZ4L 4W9DC 1QFUH 4XT1C 3CLEL 2XWBB 5IFJA 3MVSA 2OLDA 1ADWA 1TETL 4KKLC 2W91A 4N9GA 3EYFB 3VGBA 2B16A 2X4SB 4BUHA 1IBGH 5AW0B 3H9HA 5L0QC 4DPAX 1IRAY 2A74B 4HIHB 1DDTA 3L5XL 1K8DB 4UT7L 3LEYL 2OMZB 2PMZA 3RDTB 4I18B 4NCC2 1HZHL 3MC0A 4XNXL 3EYQC 3DO7A 4XH2A 4L3EA 1KV7A 3CCHB 3S35L 2MQGA 3IYLW 1BBJA 1T66C 2CO6B 2CALA 5JHAA 3MO1B 1RK1A 2D7OA 2OQJA 1HHKB 3ARED 3OC5A 1UWGH 1ZLUH 4BSWB 4HK0B 4AWJC 3ILQD 2ZCKL 1KIPB 4Q2ZB 5F7MC 4I3RL 3IKCB 1XR9A 4LSTH 4RFEB 2Y2YA 2EZ0D 4YSOA 5KVGH 2Y07L 4NFCA 4OJYA 1F4YH 3BAJA 2OSYA 1S8DB 4LFHG 3ZQWA 2YBRB 4L9LC 4CC0A 4MDRA 5TF0A 1AGFB 2XNAA 3CLFH 3TVMB 1MSPA 2XZQL 4L8BB 4PJEA 2HVKB 3II1A 4HIJA 1BX2B 2IWGA 4P46A 4P2RD 3DSNA 3U6RB 5FDYA 2FEEI 1WFMA 5DFAA 2IAAC 5GGSB 2WSPA 3ZDXE 3ULUH 1QLEH 1BQ5A 4MHHG 1KB9K 4XZ4A 4QXGH 5KAQG 3ZDYB 2EXSA 4D7PA 3LXBA 3TPUB 2GUOB 5F3FA 1T3FA 4GW5B 1JTOA 2M26A 3V79C 1BWWA 4IIQA 1JHKL 4WFHD 4YSEA 3N6YA 3KCPB 2GUYA 5FA3A 1W0YT 3PV7A 4R9HA 2H0JA 4UB0L 1A7PL 2XKNA 2Z9TA 2LR4A 1SY6H 5I0WA 2EVFA 4NNPL 1AZRA 3GI8L 4OJFL 5DVNA 4K9EC 4F8PA 3VGEA 3T3MF 1KJ2L 4JDZA 4UQAA 1OIOA 4N2EA 4Z95H 4BRJA 2V5MA 3WTYA 4E41D 1OD7A 2NX5D 2X70A 2YSSB 5TDPA 1FORH 4JG1H 4ZTEA 1P6FA 1E6OL 4WGVB 3LKQB 4GG6B 1FHGA 2Q7NA 3MRLA 1BD2A 2YUXA 3NSFA 4Y1AE 3TEXA 4X6DF 4MA3B 4HIXH 2QQKL 4QO1A 5MERA 2H0PA 1JPEA 2H9GA 2YXMA 2CBPA 4N2AA 2IDQA 5FYKU 4Q6KA 5EN2A 4MMXB 4BSVB 3QHZL 2RIKA 2IAMC 2XPYA 3BKML 4E9QA 1N26A 1KCVL 1ZHBA 4FJZA 4OJAA 5K39B 3DUSA 1XCQB 5C6WH 4MJ4A 2AK4A 4G1MB 4ECNA 3VW3L 2I07A 2CGZA 5KTEL 5BMFH 1DLHB 3BE1H 1BMZA 3M7OA 3QUZD 3WAKA 1T0MB 3DPBB 4KUCF 3D18B 3QIBB 3IMWA 2OMVA 2O6EA 1Q72L 4PRPA 3VO0A 1AR1B 2NY0D 3SGEH 2Y3AA 3HN3A 4PGJA 4DO5A 2AVFA 4FXGA 3PE9A 4TRPH 3KPMB 3WNPA 1P1ZB 1SN5A 5KBNC 2HT4C 1QSFE 4O00A 3NACH 3NPZB 3ARFA 3KWWA 1OTSC 5KVEL 1IC7H 3D39D 4IKJA 1OT4A 4LKXB 4MNGB 4YHPA 3TBTA 4KDVA 4ZZKA 4MQSB 5FECA 4OFDA 4XAKD 2YA0A 1F4WH 3PHAA 3D3VB 2HFEB 2X3AA 3IFNH 3PWNA 3GMOA 1ED3B 2O6CA 4FD0A 4DVBA 2QSTA 5LAXA 1W0WB 5C07D 4AMKL 2H3NA 3QO0A 2PCYA 2IDTA 3IJYA 3T3ME 3FU7B 4JO1L 4Q9BA 3GHPA 4GP4B 1SJVA 3UTTA 3SE9L 3C60A 5JIIA 4YSTA 4NO3B 5GJSH 4LOUD 5HDRA 1CE6A 3SO3C 5GRXG 5JOPE 1CT8A 2CCLA 3VH8B 2QDVA 4KJPD 1AO7A 2YMTA 1YEGL 3CFBA 1HAUA 4YNYB 3F58L 3CBKB 4X6DE 1TIUA 3FSOA 5CLYA 5C0CB 3FW6A 5TDOB 5SWZB 3BJ91 2JB5L 4PLJC 2F58L 3RNKB 2IPTH 4G6AC 5KVDE 2UXFA 4X4XB 4PW3A 4ZPTA 4N2DA 4QOKA 4FFYA 1ETZB 4MQXD 1ZV9A 3R7QA 3RA7H 1U3JA 3VG0H 5ILTH 1CGWA 3U6XA 3CSYA 3UO1L 4QRFA 3BRGC 3W0WB 4MJ6B 1PLGL 3GYRA 3O6KL 4G5ZL 4K7PL 4RSYA 3MRRB 3FTGA 4Z5RB 2NR6D 3CUPB 1ZE3C 4JHBA 2Z8VC 2C4FU 4ZZFA 5JW4M 4N5UA 5ENWB 1ZMYA 2VDQH 4M93C 2F1EA 3VFOB 4QY8B 4Y16A 2FQEA 1MDAA 2VR5A 1QNIA 5AEAA 2HMIC 1MCNA 1QNZH 4NT6B 4RESB 1NGZB 3ZIMA 1UJ3B 3ZHLA 4FC3E 1XF2B 4JQVC 1YNTA 5DJ6A 2Z7ZA 3WNMA 1UCTA 3FN0H 4IBSA 5HI4C 3JV4A 3TBVA 4CN1A 2ICEA 1TLMA 2JJSA 4JMXA 3OKDB 5FYKH 2ERJC 2KZ1B 2EH8H 3OQRA 1SXSA 4B50A 1FG2B 1MIML 3PHQA 3PL6C 4U6XB 5D1QA 1DVUA 3MREB 2IDFA 5LNDA 1O9VA 2O6FA 3QDMB 4YPJA 4JJ5B 1HIMH 1E9OA 1JN6B 3IDJA 3L3KB 3MRMA 3QXDA 7CGTA 4JFTA 4LCWD 1EJ8A 1WISA 3VNYA 1A9EB 3VXSD 3E6FB 2HJLA 5F72S 4U6VL 4XMUA 3REVA 4LRNH 1DP0A 1HK6A 2CHNA 3QEQD 2EEXA 3AB0C 1SBSL 2EIBA 3TPKA 5E1AA 1N0XH 4L4VE 3GMNA 1ZHKB 1CGVA 3V0AC 2WXRA 1RCYA 4X80H 1NBCA 3VGDA 3MROA 5FPIA 3LRMA 4PTUB 4I88A 5SWSB 1LK2B 5E2UL 3V4VB 5FOBB 3B5GA 3VXTB 2VLKB 2DDQL 3ZE1B 1DBML 1OO2A 1J0YA 1ZK9A 3FQYA 4L05A 5D6CA 3ULSB 2X1PA 3Q44A 4DKDC 2PABA 3CLWA 4NKIH 3MFGB 1YY8A 3HIZA 1KWKA 2CO7A 4L1HA 1QLRA 5BQ7A 1JZJA 2YPLA 1GYAA 4QTFA 3N40F 3ARDD 2WJ5A 5DMGC 2GJZA 1INQA 4JQXA 1X7TA 2QSCL 1BAFH 1T2QL 2MH4A 2YPVH 1JGDB 4PQXA 2HTKD 1F3JA 1YNKH 1DBAL 3Q48A 5HYJD 1SJHB 4RLDA 2XG5B 1J86A 3SGDH 1FYHB 4Q56A 1XMWA 3MRBA 2P28B 1HOEA 1I9EA 1MLCA 1CK0L 3BP6B 1S7RB 4N0CC 3TYFA 2X4NB 4RMBA 5GZND 5I75B 5T1LB 3WIFA 1FFPB 3CFQA 4LEEA 3VXUA 4S1QH 4TUJA 1MRCH 2A9ML 4RA0C 4W4OC 4MJID 4P59H 4O02B 5GISH 3UJIH 1W2KT 3EDKA 1XR8A 3SYPA 2OMYA 3DA0A 4KVNL 5D1XE 4ICWA 4QPEA 3UAJC 1T0NA 3FN3A 4M6AA 4AGPA 1WIPA 5T8IA 5E8OB 4U1LA 2BIMA 2VLMD 4PYGA 2F0CA 5I66A 5HDLA 4HD9A 3HBGA 2JTDA 5EEYA 1KEMH 1RURH 4XWOC 5D7LE 3RE0A 4UZSA 1USZA 4XC1H 2XA3A 5HHPB 1ZEAH 4JFFB 3PIQB 5EZOH 3BDBA 4PRBB 4XNYL 1F2XK 3VVVA 4FFVD 1EEYA 4U7KA 4BGDA 1JNJA 1WK0A 1JFQH 3DK2A 1TCRA 1H9DA 2GSIB 3WYRA 4Z7VF 1TSRA 1OAJA 2EYSA 3IDGB 3C5ZC 1JZ3A 2XV0A 3T0BA 3OGOE 1QEWA 4QF1A 2KZWA 3HRZC 1RUAL 2YC1B 1HEHC 2DWDA 5KS9A 4IRJB 5KSVA 3EXLA 3ZYJA 1NMAH 3G5ZA 3KWXA 3K46A 5IMLB 5CBAA 4MKTA 2AQQA 3VMNA 1AANA 1G7MA 1RZKL 2WAHA 3F65A 3LCYA 3PG2A 3QFJB 3T77B 3SOBL 3VD5A 4ODXB 3FB5B 2ZNXA 1PNCA 1P4BL 2BVOB 4WEUD 3MYJA 4FN0A 4ZPVB 3WNOA 3V9CA 3QUGA 4Y2DD 1EEZA 1T20B 1OTTC 2O6DA 2DYPA 2ZX6A 1IV8A 5I1LA 1F0LA 4P23C 4BZ1H 4P3CH 1UD4A 3II2A 3RAJH 1DJXA 2ATPA 5DHVB 1TMCB 4HIPA 3TJEH 3CN3A 1MHPH 3U2JA 4DETA 1FA4A 2DQIL 3D08A 1A4AA 5DK0A 4YBLC 1VFOA 5LG6A 1IGFL 3G5WA 5AYUL 5IW6B 1MCKA 3O9WA 1T6WA 4ZFZA 5F44A 2NY5C 4X8CA 1KYOJ 1ZLDA 2BP0A 1TDQA 1XGTB 3HZVA 5EO1B 1ZTXH 1YEHH 4HXAH 3QWOA 1KEGL 1MEXL 2XV6B 5DUJA 5TPWH 4BZ2A 5AW4B 2YK1H 3B1TA 1K85A 2Y6TE 1ONQB 3SY0A 3WHXA 3KGUA 3VXRA 1CDIA 4MXVE 1FC2D 2DQJH 4FTDA 4DKTA 1FZKB 3G6AB 3U4BL 2BSBA 2EE9A 1T0PB 1MQ8A 4ONGH 1PGRB 4WNJA 4YHZH 3NJNA 2MNWA 4PRHD 2VXUL 2BOBB 1R75A 3EG9A 2NCEA 3BIKA 4Q9CA 5HGBA 1PCSA 2IC2A 4J3OH 5TE4H 4DUXA 3DJSA 3KVQA 3KPSB 2OTUB 1YPZF 1RH8A 5D7SL 4R5VA 5K9QI 1IX2A 2Z35A 1RUQH 1VKXA 1EUUA 5KBPA 4LDLB 1D9KC 3T6XA 3H3KA 5JIQA 1H8LA 1MFEL 1IFHH 1VDGA 3HB3C 5BRZB 3ROLB 4PSPA 3LZOA 1YC8A 3IGUA 2Q76B 4GAJH 5DMJB 1H5BB 3ULVD 4AW7A 2Q87A 2DTMH 4M8VA 5T1MA 3T1FB 4G82A 2VW4A 4AQEB 5FYJD 1TTRA 2P5WE 1XVSA 1OZTG 1MCOL 4JCWA 2OZ4H 4WO4B 4B9FA 3G04B 4W93A 2F1AA 3CLEH 3QA3B 2YD6A 2Z34A 4J4PC 5F3BA 3AXHA 3M17B 4OLEA 3RVTD 5BUPA 4YR6B 4YZFE 1IFRA 2PR9A 5CCGE 3CDZB 1TETH 2YQ2A 4HEMA 3AM8C 3H56A 3L9RA 4NGHL 2O4EA 1DVFA 1EBAA 3FTZA 4Q6YA 3GSNA 1SJEA 1XF4A 2BS8A 3TA3B 4ZG1A 3UDWA 3L5XH 4UT7H 2CO1A 3NJGA 3LEYH 4RCAA 1O75A 3OB0H 3H7LA 3NIFB 1HZHH 4XNXH 4AEIL 3DX9B 1WT5C 1PZAA 2XA8L 3OPZL 2WUBL 4P8QA 3S35H 1OAKL 5DQJA 1UT1A 1FSKB 4LHUG 1JXFA 2V9UA 3O11A 5F6IB 3V7AE 1Q9WA 2NY3C 4FFYL 3I75B 1N2RA 5GRJL 3FQXB 3L95A 4X4ZA 3TEYA 1YEDA 2NW2B 1I7ZA 2NY7L 2ZCKH 3QRBA 5HHVL 2D4FA 2EDBA 1D5MA 3KH4A 2Y06L 2OXGB 4I3RH 1HYSD 2EQDA 1LD9B 2WXIA 1YPZE 3WLWD 2Y07H 1TU2A 4JW3A 4X7TB 4A39A 2G60L 3PU7A 3NJFA 3MUHL 3WNIA 2PPFA 1M71A 5DUPH 3J7HA 3LV3B 2LE9A 3NEOA 1KYOK 3APDA 3DUUB 4PJBF 3RX8A 4K2UL 3WNKA 2XZQH 1YC7A 4EIBA 2C3XA 3QWQB 2G9HB 4HPYL 4OKDA 3ZUCA 3KGTA 4UTBL 3JWDL 3HUJB 1KGIA 4GEIA 1S6NA 4JANA 4V1DD 2F1BA 2IWFA 1I1FA 2VMCA 5GRUL 3P4MB 3OHXC 1AGDB 1I1YB 4TSAL 2YD5A 4KKBC 4QRSB 5GGUA 2OXHB 3U7WL 1XIWB 2AEIT 4PJIA 3IAGC 1KYUA 2XN1A 1JHKH 3K6SA 1KLUB 1YN6B 1JVLA 3TO4D 3W5MA 4J39A 1HJCA 4LBAA 2FRGP 4UB0H 4XBMA 3SCMD 1D5XB 1A7PH 1V3JA 5JOFA 1FFQA 3NOIA 3NJLA 4G9FA 3KLAB 4XHJC 1QO3B 4NNPH 5J11B 3GI8H 4OZ4B 4OJFH 2X6CA 1Z9NA 3UTSB 4NQVB 1KJ2H 5GSVA 4M4PA 3RZCD 1DJGA 1AMXA 3WO3B 1N5YL 3FJTA 1CDGA 3EFOA 3W81A 3N43B 3PFUA 5DJ0B 2ADIA 4JVUA 4IOFC 3CFKA 1KLFA 2IG2H 5BXFA 1I8KA 3RVXC 1E6OH 3TNMB 1W0VA 4HUVB 2DM4A 2E46A 3QNZB 4ZNEE 2VAAB 5D96B 1KG0A 3UTZA 4DUWA 2HG0A 2CIKB 2XYCA 4X6EA 3TIEB 4ZUWB 2QQKH 3A6CH 4IOIA 3QIWD 3T65A 3POCA 1T1YA 2OMUA 4YAQB 1GS6X 1QLEB 3QHZH 5FXCH 1Y18B 4MASA 4PJBE 3KBEA 3BKMH 4B3EA 1KCVH 4R4BA 1LO4L 3V0VA 1CTMA 1S7SA 4XXWA 4KGLA 1B9ZA 2BCKA 1UVQA 3VW3H 1BHGA 3EO0A 2PYEA 4GRMB 4JZJA 4ZJ9A 5KTEH 3JTSB 1J8HD 2JH2A 3SGJC 3S4SA 3P9MA 1HSAB 2WANA 1AIZA 1HOCA 2ZE0A 1VA9A 4RMSA 1Q72H 1QX1A 5MEPA 5MHSE 4TVPD 5DZLA 1PY9A 1WFOA 1NDTA 1Y6KR 4XO3A 4ADIA 3HCVA 1B6UA 1BZ8A 4Z78B 1G6RA 4NRXA 3QUZA 3ZO9A 2VDKL 4KNUA 3B7TA 4DFIA 3CN0A 4FNSA 2P44B 1J05B 1S3KL 2C1PA 5A3IC 4S2SB 5KVEH 3O4OB 2IPKA 2J2ZB 1HTYA 2JKRM 4E9YA 1N67A 4TYUA 3PWVA 5HY9B 5LDUA 4APXB 3REWB 2UYLA 4AMKH 1ASQA 4WJ5A 3A24A 4HU2A 1KTLA 3T0EA 4JO1H 1ZLSL 1J1OL 1RKRA 4FFWD 2FDBP 1KPRA 3QUYB 3SE9H 2OA9A 1E9QA 2MHAB 4BGLA 2QFPA 4U05A 2D3NA 2XN9E 4YHIA 2W0PA 3NEXA 3BQUA 5DDHB 1L6ZA 4UZGA 5ACMA 3P3RA 3STLB 1YEGH 1G9EA 3PAUA 3AS0A 3RL2A 3F58H 1FLRL 4HEPG 4TQHA 4K3DL 4JO2L 3AGVA 1L6XA 1DN0A 5DI8B 1BFTA 3UABA 4A67A 3IEAA 2FECL 1ZJBA 2JB5H 4EXPX 2F58H 1JYXA 1G7HB 1W8OA 5C7ZA 2EDFA 3DSFL 3BP7B 2QPDB 4MMZA 2B2XL 2NPLX 5FGBA 3S48A 3FT2A 4Y2OA 3LNFA 1MY5A 2DYRB 3QG6B 5EO0B 2WBJD 2CDGA 5DHEA 4AV0A 3CN2A 3B2UD 4QIRA 2ZOUA 3DYMA 3GDBA 4W9ZA 5GPRA 3KYAA 3UO1H 2JV6A 2VDPL 1I8MB 1PLGH 3ZR6A 3KH3A 3O6KH 4G5ZH 1RZGB 4R5XA 4K7PH 4XCEB 1I3RA 4IGBD 2BOCB 3PP4H 4OZFA 3SKUD 3K71B 5H37G 5EFIB 5I1AB 3QYMA 4G2AA 3FTVA 4L3CB 1PEZA 1MFMA 2YLKA 4J2XA 4AL8L 1GYVA 1F45A 4LDOB 1XZ0A 3NRQA 5AW9B 5LHDA 1XMEB 3GSWB 1TQBB 3UAFA 4OVUA 4Z0BL 5PAZA 3WEAA 1IARB 4Z7WF 4QT5A 4YH6A 5T1JA 4LRIC 1HI6A 1N70A 4R2GC 5IQNA 2J57A 2QVFB 4PB0L 5TFSL 4MXWL 4P9HC 3F05A 1ET8A 4N2CA 3NJKA 1VZGA 1FVCB 3DIFA 3VI4F 3VGGA 4BZ2L 5KZCB 4FQIL 3MRHA 1MIMH 1IEAB 3O6LL 2YMXL 5I26A 2WLIB 5ABZA 3IJ7A 4APQD 1FAIL 2WLZA 4C57C 3L3GB 2QTEA 2JI1A 2IGLA 4XOCA 4OZIB 4LLUA 5I8KL 3CVDA 3EUUA 1SEBA 1UD5A 1I7TA 2GW5A 2Z31B 3TV8A 3QJFB 2G2PA 4QNPF 3VJ6B 2B3RA 5ID1A 4U6VH 1MCWW 1ZJAA 3LPOA 2I9TB 1EXUA 1ERNA 2CA3A 4IHBA 4M9PA 4XR8C 3PWLB 2Y23A 2QT6A 5FYLE 3WU1A 4OZGF 5DRNA 1GKOA 3IFPA 5E2UH 1OCZB 5C07B 3RHWK 1T1WA 3GO1L 1KTKE 1HH9B 1IE4A 2DDQH 1DBMH 2W65A 3VFWB 3O6FC 1QBLL 2VDQB 5JQ6L 4RRPG 1S78C 2P24B 5IIEB 3GKZA 4FQXC 2JB6A 2X4QA 4KKZA 2ICWB 4NQCB 4HV8A 4JGJA 1DR9A 4RFNB 5IUCA 2YRLA 3T8XB 4F80A 3TNNB 3MACL 3VD9A 2WWKT 5EZJA 1L4IA 1AHWA 4EJ1C 1FQ9C 3FB7A 4XMXA 2X1OA 3QULB 4J1UA 4XAWL 1QUNB 1RHHB 3O3BA 2AXFA 2QSCH 5IEHB 1T2QH 1NBYA 1SYSB 3S35X 1Z5LA 2AEOA 1KBWA 3ARDA 5GS0D 5DCCA 1GGYA 2PXYD 3SYOA 4UM9A 1DBAH 1ZT4B 1P84K 2DICA 2X4OB 2ESVE 4QAMB 3F7PC 1NFIA 1FYTB 3B9AA 4G1EA 1AG6A 1JNHA 2W0FB 5B1BB 5LBVA 2Y5TA 4OF6A 3NIGF 4IJTA 4DZ8B 4X0NA 1T22B 3GSNL 5E6IC 2RMNA 3BJLA 4I0PA 1CK0H 3VI4E 1E5AA 3IDYC 1PFOA 3CDFA 5CLTA 5DQDL 4EI6A 2A9MH 5E70A 1AKJA 5CAYB 4DJMA 3L5WB 2CJUL 4EDXA 4ZFFB 2XX0A 3K6FA 1LJMA 5HHMB 5J56B 3LZLA 1ES0A 2W92A 1IIKA 2J25A 4KVNH 1N8OE 3QK0A 4CC4C 3ESMA 3UTQA 4QNPE 1QI4A 1T89A 3I6KB 2QLVB 3P4LA 1RD6A 2AABL 4O51A 5EUOF 4EVNA 3OXRA 4P2OC 3O8XA 2BNQA 1IGYB 4FE9A 3SKNA 5L8KB 3E9TA 5F9WC 3MNWB 2V8MA 3GLDA 4G5AA 4LO9A 2DN7A 5I1HL 2DWXA 3B6SB 4IIZA 4XNYH 4XGZA 3OGCA 1QYGL 4JO8A 5D7JB 2QKIC 2N7AA 4A7SA 3GRWA 3MXVL 4UF7C 1NM4A 1FL5A 3MRIB 3U4EA 1Q0XL 3T4AA 1XL4A 1RUAH 2YLHA 1RPQA 2MKWA 3ARBD 4MTMA 1HXMB 2VLJE 1IMHC 1TJIL 1FZOB 2WKOF 4G8FA 1GYWA 3GMLB 1RZKH 1MUJB 5BUGA 4LNRA 3SOBH 4AZ8A 4ILDA 3OZLA 5DFVC 5SX4H 3EHBC 1P4BH 1FJ1A 1M9SA 1M3IA 3UMNA 2WB7A 3EJTA 4F9LA 3KYOB 4HZ1A 4QRPB 2GTZB 3ZX1A 4JQIA 2AP2A 3A4DA 3KBPA 3HC3L 3NJHA 4Y2DA 2EILB 4HAFA 2DQIH 3BAXA 3R0NA 3SY6A 3NDZE 1IGFH 5AYUH 3BGFB 3T6QC 4FHKA 1CIUA 2ZWLT 2C9UA 3MHZA 4FTVB 3L7EA 4JPWL 3DX6B 3MLYL 3W11C 4IMLA 3H7BA 1KEGH 1MEXH 5EUOE 1SLUA 4GFTB 2OPCA 4Y1AD 4MQ7B 5INCB 4JFYB 4WFGD 3UBHA 2QPUA 3UYPB 3P9WB 2BVUA 2VZTA 4QRUA 4PGDA 3BGMB 3QI9B 4KH2A 3K72A 4OD3L 4KJWC 2AKRB 3U4BH 1GSKA 2KERA 1XB6A 4L5FL 3HZKB 1B4JL 4BK5A 4Y19E 3AUVA 1KIQA 3TN0C 2VXUH 1FFRA 3T2LA 3HMXA 5IBTL 4Z18A 1AQDA 5C3TA 4UNTA 4WKZA 4XRCA 5I71B 2IEPA 1AOHA 1OZUA 4Z7NB 5D7SH 4E36A 2BMKA 1MJJB 3TZVC 4QMEA 1Z9SB 2VN4A 2XYBA 3NJXA 1NFDB 4K8RD 4E5XA 2QGEA 1U8IA 5E2TL 4AH2B 1MFEH 1DN2A 1T2XA 4MD5B 1G6RL 3T9WA 1U9KA 3DX4A 4YDLC 2HG5A 5BS0D 3MRFA 3IXTA 4H13C 2BDNL 5C92A 5KYXA 2FLBT 3C6LD 5E2JA 1XF5A 1WEJL 2GCYB 3NIDF 4O2CA 3DMMB 3HZYB 2LFEA 5IQLA 3PQYB 5E8PB 3QRFM 2MOVA 1H3TA 2QQNL 1MCOH 3IS0X 3OR6B 2EUZA 2ODIA 2RB8A 5FW8A 4GUQA 2VMDA 2NYKA 2VISB 3C5SB 1PLBA 4S0TD 5F7NC 2EYRB 2VOTA 2IANE 3MR9B 4FQJL 4OD1H 1A6AA 2FO4B 4N6RA 3U46B 2QADC 4AIZB 3QE5A 5JLZA 4Q7DA 4NGHH 5JOPD 4LL4A 5CWSA 1T7VA 5EU4B 2CLZB 4ZMAT 3OJ2C 2G0KA 2RQ8A 4K7PX 1F6FB 2X89D 4MRCA 4OR1A 4D3CL 2ADJA 3DNKA 4AEIH 1SHWA 5KVFL 2XA8H 4BUQA 3BSZA 3OPZH 1BYOA 2CZNA 4M6ML 1OAKH 1Z3RA 4KROD 1ZANL 4IBZA 1GZHC 3CH1B 2TRHA 1IC5L 3FZUC 4FFYH 4K3GA 3FT9A 3J07A 4NQEE 5J1AA 2VQUA 2NXZD 3BH8A 3L2LA 5F9DC 1YHPA 3HG4A 4NJAL 2ZXAA 2NY7H 4GO6B 1AS8A 1XTMA 5HHXL 5HHVH 2Y36L 2IF7A 3BVUA 3F7LA 2Y06H 5CLZA 3HZMA 4HJGA 4R83A 1OGTA 1OSEA 2NY2B 3VFMB 3WL9A 1LE5B 4NB7A 1VIWA 3LOWA 3FT3A 2G60H 4KUCD 3RGVB 1RZIA 3N2JA 5T5FH 3WD5L 2Z8RA 1T21B 3VXNA 1FLTX 1QSEE 1KIUB 2BVPA 4UT6A 4K2UH 2XJLA 4MD0B 3ECUA 5CGMA 1BVKA 3CHXA 1O5PA 4HPYH 3O4LE 1RIUL 2PLTA 4UTBH 4XX5A 5BO1L 3JWDH 2EYTB 3ATFA 1BCIA 1IGJA 2KLSA 3S3CB 3NIDE 3KPRE 3SDCC 2WCGA 4TSAH 2EADA 1FZMB 2ITFA 2HLFC 1Q9LA 1GY1A 4V1DA 1CI3M 3U7WH 3X14B 3GLAA 4CJ0A 4L8CB 5I1EL 2X28A 1ZPUA 4PV9A 2PWHA 1JGEB 3HVNA 5ITFB 4EUPG 2OTWB 1MIEL 4PWEA 3FRPG 5DS2A 1UQSA 2NY4C 1HH6A 4WGWB 4JG9A 1SHMA 4PJ6A 1FVDA 5L4IA 3VGHA 3TO4A 1I8LA 2NUTB 3LSOB 4GXFA 1SM3L 2V5RA 2J1YA 3WN6A 4PG9B 6FABL 5T3XD 3N1QC 1DUZB 1G7QA 3DURB 1GCFA 3PGDA 1CXKA 3DKHA 4KKCC 3M86A 3T2PA 2Y5EA 4L4VD 1ILUA 4NPYA 1N5YH 3IS1X 4EN2A 1WUZA 3CQQA 5D2LA 1GTFA 4RGNE 2FJSA 5MEQB 1A2YB 4LLMB 4PRAA 3NRPA 5FO2A 5D55A 5FO8A 4XVUC 5H4ZA 3AT0A 1BP3B 1WA1X 4WUUE 4MNQD 4NC1C 2PPDA 2GFBB 4WJKB 3GZOA 4DT2A 3WEOA 2R4SL 2HTLD 4LL1A 4HIEB 4CBPA 3IJHA 5TD4A 4NENA 3VMPA 2WKLA 3WE1A 5IOPA 3WMQA 1LO4H 1XCXA 5D2NC 2HVJA 3MV8B 4UIMA 1OF0A 3KE0A 2YARA 4CU7A 3H0TA 5CFAA 5IVZA 3QZWB 5KANG 3RTQD 1FNGB 5F1OB 5F7HA 4JFDE 4IBVA 3MNZB 4D2NA 5JW4Q 3QDJB 2B1OA 4PP2A 3QDHA 3CFJA 4LIQE 2H3XC 3K8KA 4NQQA 1QFPA 3DGDA 2VDKH 5LGHL 3GSRB 1E90A 4TNWF 5IJVA 1S3KH 2V2WA 3D0VB 1TNNA 3C12A 3BVVA 2GSGB 2Y7NA 5JNYA 2Y69B 2DH3A 2R23B 1RERA 2X9ZA 1ZPLA 3DHJA 5C0AB 4U0RC 1IKNA 4EZJA 1H3GA 2WQWA 3C5JB 4BHUA 4MSWB 2RBLA 3ZDZF 4AT6B 4UAOC 3KW8A 3QB7C 3V9EA 3PWUB 4Q4EA 2X3BA 5IUSA 1ZLSH 1J1OH 2KBGA 3LQAL 5F7EL 4CVZA 2RR3A 5IM7A 3GBDA 1U33A 4WLCA 1K5WA 5GSRA 4Y88A 5LGYA 2LV4A 4U1JB 5TF1L 1UGNA 1RQ5A 2GJRA 5D7LD 4P04A 1KGWA 3BMWA 4TLKA 5DEGA 1D5RA 4OGZA 3G5XB 1TJHL 4L1TA 4OIFA 4TOYH 3GUTA 1FLRH 1NBZA 4IM8A 3UZVA 4K3DH 2A5UA 4JO2H 3ARGA 4FKEA 4PHXA 4HG4K 2C1OA 3GRWL 3L6FB 3D7PA 4JFOA 4J5VA 4JVPA 1MFNA 3K1DA 4S0SD 4AQ8C 4RMVA 1ZK5A 3AAZA 2D7MA 5PCYA 1CFTA 2W80C 3EJZD 1NCOA 1HWGB 5HHNA 2Z1KA 3FUHA 4WTWA 2ENPA 4P5KB 2VDPH 5TQ2L 3UJJL 3P73A 2BNUB 4K7FA 4PJ8C 3OXSB 1CE1H 1E8XA 3MNVB 4LPWA 1CFSB 3K80A 1TQVA 2QEJA 1J87A 5DGRA 2G5BB 4JQIL 4AL8H 4LLQA 5L2KE 5B39G 3HLAA 5AB0A 4Z7UE 3S96A 4MB4A 1PG7L 4GBXD 4Z0BH 1FN4B 4OTXL 4KGJA 1H3UA 5GS1A 3MRPA 3DX7A 4A2DA 5I1IL 5F8RC 1TTUA 4WI7A 5AVYB 4JKPL 3D05A 2FLMA 2AI0L 2KC0A 2OJ1A 1B88A 3FQWB 4PB0H 5TFSH 4N2GA 1R3KA 4ZUSB 4MXWH 1DQJB 1J10A 4ZAKC 4QRRD 3ZDZE 5FKPB 2D9CA 4BZ2H 4YOKA 5TH2A 3SDAB 1AZBA 4FQIH 3RWJB 2F61A 2VN5A 3D09A 5J9PA 3O6LH 2YMXH 3ZYIA 1P5UA 2NYZA 4UMGA 1FAIH 2WB1A 3LN9A 4CDHA 1KIRB 2OMTB 2Z92B 3P0YL 3MZGB 4PYHA 4PJFF 2V3DA 4C4KT 5I8KH 4X7CC 5B22A 3HE7B 3L3DB 4E2OA 4APQA 4MAYA 4JFEE 3ZKND 3VWKA 2PUQT 2BNRE 4NQSA 4TNVK 2V33A 1KOAA 2CD0A 2XY1A 4I0CC 4BWWA 2DEYX 3HMXL 1HDMB 4XMTA 3Q6GH 3CVBA 2JQAA 3H2PA 3VFSB 4ZMVA 3V5DA 2VQ1A 4GKLA 5CMAA 2DWYA 1KXQA 3GO1H 4PS4L 5JQ6H 3CPLB 5D7IA 4DEPC 1QBLH 4IQHA 3K6OA 2A74C 1J0KA 3RJOA 1HEJC 4PJ7A 2IOIA 4I18C 3RDTC 2RCSL 1GPOL 3SDDD 4PBVC 5HHOE 3SOTA 3VSQA 2P5EA 2ETWA 1VZHA 3MACH 1CS6A 3QDGA 2WZ0A 3FMGL 3DV4A 3RL1B 4X6CF 4XAWH 3WN5C 1BLIA 5BOZG 4BSJA 1Q94B 1R5VB 3JWNG 2R1WB 3FYIB 3IDIA 3LY6A 2A83A 1FNEB 2ZCZA 2XVGA 3F85A 4D0BA 2A38A 1I4FB 3TJPA 4FI7A 5ABDE 2ITEA 1NEZB 1U30A 3JV6B 1TF4A 1AI1L 3FSAA 3GSNH 1FL6B 1VFBA 4MYPA 1FVEA 3L3IB 4JRYB 1V7NL 3TVMC 1G7PB 1L0QA 2OSLA 3BZ4B 5DQDH 4HS3A 4MJ5B 5E1QA 3BSZL 2CJUH 3X13B 1AJ7L 5E00B 2WLYA 4GG8B 1TZAA 1LO3L 3AITA 2A73B 4M29A 1OGAE 1IVLA 2CUHA 5KSAB 3EAKA 3IETA 3AC0A 1ZXQA 3C5XA 4KKLD 1U8HB 4YDZA 1W6WA 2AABH 3RI5K 2EO7A 4JE4B 1KBPA 4Y4FC 4NRYA 2APFA 4HJTA 1I3GL 2UUDH 3EOBB 3VA2C 2NMSA 3W9DA 2VR9A 4ODSL 1M2VA 4PMFA 4NUJA 4OF3A 1OP9A 1CD1B 4XCNB 4M02A 4F7EA 1M7IA 5AWNH 2Q86B 5I1HH 4N22A 1W8EA 3QIUD 5T5NG 3EYQD 2NT0A 4AGLA 4NZJA 3BAYA 4PJXF 3ZRSA 3CBJB 1QRNB 4HKBA 4UT6L 3TO2B 2G30A 2AV7B 5KW9L 1T66D 4POUB 1CICA 1QYGH 1NCNA 1MZYA 4G6FB 1I8UA 4HH9A 5D71L 3VFGL 3UAAA 5IFJB 3OV6A 1TTGA 3MXVH 5E0FA 4MXQD 4N9GB 1Q0XH 2YIHA 2WQSA 1BAWA 4F7TA 1EZSA 2VUKA 4X6CE 1JGVL 3U9WA 1TJIH 2C3WA 2XU9A 5FEBA 5C08E 3BEVA 3CFEB 4GEJA 4W9GC 4ZK8A 2WZPD 2XQYG 3ARBA 4C58B 3SZKC 3O45A 2QQLL 5LVEA 3B3BA 1DDHA 3DO7B 4K07A 4XH2B 4L3EB 1EBPA 4F3FA 1P9MC 4MB1A 4X50A 1BBJB 3D25A 4G43A 4MMXC 2GPZA 3A0OA 2OQJB 4YE0A 1JXGA 2V9TA 3HC3H 5DTFB 2MEJB 3MKGA 4FQLL 2WXOA 3U0PB 1PD0A 1A47A 5GRZA 5FK9A 4XP1H 1Z9MA 3U0WL 1XR9B 5ERWA 4RNRB 3PXLA 1S2EA 3S3SA 3M8OL 4ZFOA 3P77A 3QIBC 3FXIC 3ARTA 4JPWH 5HYIA 4NEHB 3IAPA 2EE2A 1T83C 3LYRA 4OZHA 2EDYA 2VABA 4PJEB 3F00A 1UEMA 2JJTA 4HIJB 3ZPDA 4P46B 5I15L 3SDYL 3GJFK 4Y1AA 4OD3H 4WF7A 2WD0A 3WMPA 3TWCL 3IE4A 1RZJC 4PJXE 4L5FH 1B4JH 2GIYA 2KMWA 4GI8A 3V6FA 2XPZA 2YAMA 4KRMB 4LLDA 4H8UA 5IBTH 5GGVY 4PJ5E 5AAMC 5DS8A 3BAIA 5EV7A 4UOW0 4ELKA 3SJVD 4IIQB 2CR6A 1JSYA 3ELAT 4HGKC 4DVRL 2E7CA 4DP8X 3OAYK 2XKNB 5GRVL 2J5LB 5E2TH 4DNLA 2WWMC 2YEVB 1G6RH 2H41A 3V0DA 2OSXA 2BDNH 3ZE2F 5FS5A 5JDJA 4GKZA 4TVPL 4TN9A 4JDZB 5HJBA 1WEJH 3CU1A 3EJJX 4YDVB 4GUPA 5CEXA 4MVBC 4XXCA 2YRBA 3STZA 1QSFA 1EJOL 2QQNH 2X70B 5JR1L 2X2IA 5TDPB 4PBDA 9PCYA 3NBNA 4BKLB 5F88A 4OIIL 3QORA 4D0DB 3SE4C 1BXVA 1BD2B 5CR8A 4FQJH 4PUBL 3CPUA 3OSVA 1WICA 4QO1B 4NQDD 3GB7A 5MERB 3AQXA 2H9GB 4JRFA 2ADYA 1NIFA 5EU3A 5EN2B 4MJ2A 1OTSD 3MQIA 2DIBA 3MRGA 1WO2A 1GKEA 1BBDL 4XN9A 3UO8B 1ZHBB 3KLQA 1CFNA 4D3CH 2DJSA 3DUSB 5DO2C 3UC0L 3A4EA 3I3DA 3NPSC 5KVFH 1BZQK 3ZL4H 2AK4B 4I2XE 5CGYC 4FG0A 5ADPL 4M6MH 1ZANH 3HHMA 1OAYL 4PJDF 4X6DA 1KGUA 2GG1A 1IC5H 1VFAA 3GJEA 3P4NB 4Z3FA 5CEYA 5A2FA 1OQOA 2FX8L 4P9ML 4PRPB 3OLEA 4XVJL 5MP6L 1N6QL 5HHXH 1PY0A 3A67L 2IH3B 4FXGB 2VUOA 3RIAK 1VLXA 3S8GB 2MCPL 3N1MC 4XN8A 4HCFA 1NL0L 1VEMA 1V3MA 3ARFB 4OZFH 3L2NA 3P2DA 3TBTB 5FECB 3AZUA 5I1CL 1TZ8A 4PLJD 1P6WA 3QAZB 5DD1L 5GS3A 4G6AD 1PKQA 1CJYA 4WK4B 4ZW8A 2B9AA 2DQHL 2PCPA 3GMOB 1RIUH 4DVBB 5BO1H 5LAXB 2G0LA 4LSDA 3ZE2E 2H3NB 1R1CA 2Y24A 3FOMA 3IJYB 3QO0B 4HUNB 4MKMA 4YLQT 1I1AA 2GY5A 3VSTA 3GZQA 1X5GA 1DQDL 1LYQA 3MRQB 3UTTB 5HPOA 1R3JA 2DD8L 1OAXL 2XWTA 2XXFA 4FS0A 4Y9EA 3VYNA 5LXGL 5K9OA 2BJML 2EUVA 3LKRB 5GRVK 1CE6B 3G6JE 1GZPA 4KTYA 5I1EH 1CT8B 1AZUA 2CHWA 2Y2WA 2F53E 2ZF9A 5GGTA 3WXWL 1I1RA 1AO7B 1OB1B 1AS6A 2BCMA 5C0ND 1MIEH 1VHPA 3WEXA 5C0RL 1UA3A 3MCG1 3TWYA 3LB6C 1UWEL 1Z9OA 4LEOA 1P69B 2VLLA 3E8VA 2I9LA 2D3LA 5FW7A 4ZPTB 5EF2A 4JFZL 1SM3H 4QOKB 3B3IA 4Y5XA 1ZA6A 2WV3A 1XAUA 6FABH 3FH5A 2WZ6A 1V8HA 3HG2A 1C7SA 4U1MB 3VGFA 1P2CA 3CSYB 1H0DA 5B3JE 2EKSB 3IU4L 5BZXA 2MWCA 5HBBA 2GVYA 3FTGB 5KYWA 1NFKA 3LEXA 4L4VA 4Z3EA 5BV7L 4M8RA 3WHE1 1GZQA 1RU9L 3AY4C 3LX9A 2O5NA 2VL5A 4KWUA 1S7WA 4Y16B 1DVQA 1NCHA 2GKIA 5CNHA 3EOYG 1SMAA 1X5MA 5DO8A 4KXDA 2X9WA 3NQKA 1YNTB 3N1PC 4LVNB 4UOJA 4PHZA 3HI5L 3JV4B 3OJVC 3TBVB 2ICEB 3DJTA 3GHEL 3HG1E 5E4EC 3CSGA 2J8UB 3BT0A 3MV7E 1U8KA 4YMPA 1ZSHA 2Z6FA 3PHQB 2ESVD 4W9CC 4HPHA 1RK0A 4YHLL 5D1QB 4PGEA 4NC1E 5GS0L 4H1LG 3RX9A 4I0KA 1E9OB 4EN3B 4G80A 3QXDB 4XXDA 3Q8BA 4HJ0D 2CJ3A 4Y4KD 3QXUA 4OFKA 2A9AA 1TJGL 3C2SA 4H0LC 4N85A 1FNSL 3REVB 5LGHH 5I8CA 4PJCF 2EDQA 5DMGD 1LHZA 2YN5A 2ID5A 4WZ9A 3P2BA 3WUWG 5IKCA 4FCAA 5D2NE 3GMNB 3JT0A 2W9DL 4MA8L 3DOSA 5T3ZL 4PRID 1G7IA 3G5VA 5F3HA 2ZYHA 2Y2TA 3AMKA 3BPOB 3LS4L 1JERA 2Y9RT 3S3DB 4ZYKA 5D1XA 4I89A 3JV0A 3LZQA 3D06A 4LCUA 4EMZA 1N68A 3LQAH 5F7EH 4N0CD 2PETA 2BY0A 3VXMB 5JHDD 1YY8B 1M57B 5TF1H 4JL2A 4PG2C 5BQ7B 2Y7QA 2YPLB 3CZUB 3WFHA 2FGZA 2IDUA 3MLVL 1I53A 4H44C 1TJHH 4PMEA 1DBBL 4TXVB 1A3QA 3BUQA 2GJZB 1INQB 4S10A 1RLWA 1IM9A 1BEYL 3UAJD 3GRWH 3OKOB 4X8GA 1F3JB 1E28A 3BOVA 2KLRA 2APXA 1ZXKA 3DXAB 1L7IL 2F5AL 2HH0L 3IJ8A 5ICXA 1JYVA 2VLJD 3MRBB 2DQEL 2JF1A 1F11A 1MLCB 4NN7B 3SGEI 1KCRL 3VFTA 3U25A 5TQ2H 4P2QD 3UJJH 2VDKB 3HAEG 3WIFB 2X4TA 2EC8A 4Q9QL 2X09A 4OGAD 1XR8B 4OFQA 2OMYB 3C5ZD 4JQIH 1J8RA 2GEEA 4ZW6A 2DKUA 4Q97A 3ETTA 4FI8A 3MBEC 1CD0A 4LPTA 4PJCE 1PG7H 4WSKA 2WLKA 4OTXH 4U1LB 1H8OA 3D5OF 5I1IH 3FO2A 5I66B 1G9HA 3ESVF 3TONA 4JKPH 2EKJA 2AI0H 4S1DC 1V5JA 4GBXA 2OFQA 4ZFOL 3ZYOA 4GH7B 4GG6A 5KVMC 1IGML 1CGSH 3E80A 4B9YA 1KTDA 3RU8L 1QWHA 3FUEA 2AJ3B 3V9FA 1EEYB 1OTTD 3GTNA 3MZTA 5DHXB 1M1XB 1YEFL 1TCRB 4P23D 4P99A 1H5BC 3HS9A 2DV6A 4ADJA 1IT9L 3MCLL 2F7RA 2EYSB 2VC2H 3LPFA 3P0YH 4RFOL 1RAMA 5EZPA 3G08A 3IKKA 2HKAA 4MCYB 1QEWB 5IQ7L 2DJ4A 2LHAA 2DWDB 2O5ZL 5KS9B 1U4EA 2AC0A 1E5ZA 4IU3A 3PABB 4WO4C 5KSVB 3G5ZB 1JZEA 2IMMA 4CC1A 1QSVA 2X0VA 3HMXH 1G7MB 1QRKA 2VDPB 3EGXA 2VMFA 1M7XA 3TBBA 4NHUA 1A4JA 4YBHA 5D6DC 4CUCA 4NPJA 2V17L 3MYJB 1TJMA 3IT8D 4GFXA 5FGCE 4I9XA 2L3BA 4PS4H 2FWOA 1EEZB 3KL0A 2ZSVA 2DYPB 3NZUA 5I1LB 5KOMC 3V52L 2ATPB 1W91A 4BE5A 2RCSH 1GPOH 4HZLA 4K8RL 2ZUXA 1UH4A 2ICWI 1SOKA 3ZDYF 5DK0B 4AQ1B 2E9JA 1LLAA 2BZDA 2YXVA 3QQ9C 3SDDA 4AI7A 5I17A 1FSKC 3FMGH 1N64L 4FX5A 5F6IC 2BP0B 1OPGL 4KO7A 5IB4A 2TSBA 1F00I 3P2TA 2EUXA 5H94A 1JV5A 5EEWA 1I9JL 2P5WA 3BUTA 1R46A 2DJMA 2WSDA 5C1MB 4FL4B 5HJ3A 1H15A 1R5IB 1S9VA 4XVTL 4ZXBC 3WHXB 3VXRB 3FB8A 5D4IA 1VRSA 1AI1H 4I77L 5TE6L 1E67A 4H1LA 3OAUL 1V7NH 4FYSA 4JPSA 1UM6L 3S37L 3SE3A 1JK9A 3X3GL 3BSZH 3BIKB 3TH2T 5HGBB 2FATL 1AJ7H 1SLWA 3RWIA 4J4PD 1GAFL 4GG6F 4UV7L 3EJRA 3VWJD 1F2QA 4UINL 32C2A 4J7RA 2Z35B 3D8MA 1ZOXA 1VKXB 5I1GL 4QAWA 2XIIA 5E6UB 4JN1L 4MA7L 5KVDL 4HIQA 2YQ3A 1NJ9A 4N8VG 1FGNL 1JS4A 2Z4QA 3SN6N 1I3GH 3DX1A 5HD8C 3BH4A 2Q3ZA 4ODSH 1CDBA 3K1KC 1TEGA 3QEUA 2Z7WA 4ZMOA 4W9LC 2OYPA 3TCLA 4ZMQA 4WEBH 1G9ML 5T1MB 1J9CT 2YN3A 1YPZA 1QSED 3B9EA 3WDHA 4UT6H 2WQXA 2XKUA 1BVLA 1HEZA 3O4LD 5KW9H 3US0A 3II3A 2AV1A 5F3BB 5D71H 3UOAB 1KN2L 2NY3D 3VFGH 4HSQA 4FNUA 5I19H 3D2UA 2DM3A 3ZDYE 4F58L 2WBWB 3LEVL 4CU8A 5EU5B 1EHNA 3GXIA 2BVYA 3DROA 3L9RB 5G55A 3RWHA 1JGVH 1DVFB 4HJIA 4N8UA 3TBWA 1XF4B 4L0YA 1F4XL 5GGTL 2CG9X 5I0XA 5JMRA 4QJ5B 5D96C 1U3HD 4B97A 4OI9A 2QQLH 2OMBA 2YUVA 1M6OA 4GRWE 5FUZH 3CIAA 5B38G 4L9LA 4ZUUA 4Y2NA 5DQJB 5F7WC 4XNAA 3WTWA 1UB5A 1IU1A 2YD2A 4H8WC 5D70L 5CLWA 1ADQA 1JF1A 1Q9WB 4KKBD 4I8DA 1ZV2A 2P8PA 2Z7UA 3QUXD 4X5WA 4ALAC 4CSPA 4FQLH 3L95B 3EYSL 1YEDB 1A4CA 1I7ZB 4C56E 3IGAA 2FHCA 1D5MB 3I6LE 3U0WH 2MCG1 2FL5A 4QTIH 1FE8L 1HFUA 1TU2B 3AREC 1KY7A 1QOKA 2OL3B 3M8OH 3MCYA 5FAAA 1M71B 4YFEA 1U36A 3ILQC 1PCXA 5C09E 2WVVA 5EOCJ 4QJ4B 3O6ML 4R8WL 1I7RA 4WUUD 5CF3A 4TUOA 1UENA 4K23L 5I15H 3SDYH 5ITBL 2HLEB 1A3ZA 1AQKL 1A1NA 3O4OC 3TWCH 3S7GA 3T6VA 2XG4A 5JXAL 2MNJB 2EJ1A 4GY4A 4FCHA 2FCBA 1RIHH 3V55A 1KGCE 4G8EB 3EOTH 1UT2A 4PJIB 4NUPA 4IOFD 3PNWA 3LKOA 4HBQA 2ZP0T 1JV2A 5EOCL 3QDAA 4PJBA 3WGVB 3GZPA 1Q9KB 4JFDD 3K6SB 3QUYC 1FC1A 1TENA 3HTLX 1S7XA 1OLZA 4I1RA 4NNXA 2J88L 1YEJL 1SOQA 1I9IL 5DFTA 5C6TL 2FUQA 1GW6A 3KBHE 4CNIB 4G9FB 3MLRL 2Q7AA 1Z1WA 5I5IA 1IKOP 1J5OL 4TVPH 4BDVB 1E8ZA 1V7ML 1E27B 2B9BA 5AZ2L 5GSVB 3VFPA 1MCQA 5E9DE 5C6PB 1NBQA 3EFOB 1CLOL 3KEDA 3GLEA 3HKFA 3ETBF 4EBQL 2ADIB 1EJOH 2IAMA 5JR1H 1LWJA 3CFKB 5BXFB 3NDYE 4JDVA 2WINA 2C9RA 2DIJA 3A47A 4OIIH 2A7BA 1W0VB 2W38A 1ZLEA 4OUUA 3FFDA 3SGKC 5D7HA 5EU7E 2YJLA 3LS5L 2IXQA 3D69A 2ED6A 4QRTA 2WBKA 1KXVA 1EEQA 4H0GA 4PUBH 5AVQB 4B60A 1U91A 4F8OA 2GTWA 4X6EB 3T65B 4IOIB 4A2MA 2GJJA 1T1YB 4FA6A 3S8WA 4CMMB 2OMUB 4MDIA 5A3ID 3B2DC 4A1RA 5SWZE 5IVXB 3TP4A 4PGZA 1BBDH 3VDCA 3AWGA 3FCSB 3QARA 2XN9A 2NZ9C 2BO0A 1P4IL 3V0VB 3UC0H 1G1CA 4L4TE 3O41B 2B77A 5DD5L 5AOLA 5ADPH 5HGGS 2BCKB 1UVQB 3BWAA 3NUKA 1OAYH 3EO0B 2PYEB 4JZJB 4M61A 1C7TA 5I5RA 1TTAA 3IWVA 3S4SB 3P9MB 5JIMA 2P8LA 3SQOL 3V0IA 2BP8A 1HOCB 2FX8H 2ZKYA 4P9MH 1PG7X 5MEPB 4XVJH 3MJ8A 4JPKL 4K71C 5MP6H 1N6QH 1OSZA 1F13A 1G6RB 3A67H 4LVOB 4NRXB 3HI1A 1F6AA 1MN4A 2MCPH 2ODHA 4N8VA 1NL0H 2QBWA 3L3HA 2C1PB 1O6SA 2QL1A 5AVZB 1R4XA 2AXGA 7PAZA 1NICA 5I1CH 4LSVH 1PVHA 1UG9A 5DD1H 5JDSA 3QFDA 2Z31C 3PWVB 3EJSA 2DQHH 4PCKA 1MELA 1I3UA 3ESPA 5DJAB 4WJ5B 2QVKA 3T0EB 1KTLB 2D0HA 1DQDH 1WD8A 2W81C 1TJXA 4XMKL 1KPRB 1KBGH 2WIIA 2DD8H 2Z8SA 4KU1A 1E9QB 1OAXH 5LXGH 3PYCA 2BJMH 2UZXA 3H4HA 4M1DL 1L6PA 3Q8AA 4YHIB 3WXWH 3V0JA 3FS9A 3BQUB 3LNGA 2D7NA 4D0CA 1I9RL 2OW6A 5CJXC 3RL2B 5C0RH 1T6VN 3BRDA 4ANKA 1LQBC 1JDCA 4NCDA 4ZT1A 1UWEH 1DN0B 5CO1A 2R83A 3KYMA 2WXMA 3N06B 4RFNC 1G7JA 4WNQB 4Y8DC 4LHJB 1NIBA 2GJ6B 3ESNA 4KJPC 4OGYL 4POZC 4MMZB 3ARWA 5B38A 4JFZH 4JFED 5G4MA 4Y2OB 3QPKA 4YVUA 2BNRD 4QHKJ 2WXPA 1P4UA 4R2GD 2CDGB 4LHUB 3UAEA 3FHQA 5SWSE 2VLKE 3ZTJH 1JF5A 4QHUA 3ESUF 1A4KA 3OZKA 4OZFB 1UA6L 4UMSA 2LLNA 5BV7H 2DQFA 4UYQA 1J1XL 4JJHA 5LCVA 4JGNA 1TCMA 5FO9B 3PL6A 4FAAB 1XZ0B 2FH6A 4NFDA 2R2CA 2NR6C 5IJBC 2ENYA 5HHOD 3LJ3A 5L8JB 1BIIA 1WPCA 3WCYA 2WPGA 5F70A 2IPUG 3H54A 1T7ZA 3OVUB 2UX6A 1OW0A 4QT5B 2IJ0C 4PGBA 3E38A 5EIIA 2YD3A 1ZWIB 1F1AA 1HI6B 1REIA 4RWYL 3HI5H 2WW8A 3GHEH 4L8DB 4OM0L 4J6IA 4N24A 4PSRA 3X3FL 1WGVA 4A6YL 5ICUA 1U0QA 4FRWA 3MRHB 4X7DC 3O6FD 3NA9L 2F7OA 1SLXA 1HNGA 1R34A 4YHLH 2L04A 2MFNA 3FC8A 4E68A 5GS0H 4FQXD 2VITB 2ESVA 1IC4L 4LLUB 1U42A 1L9RA 1SEBB 3U4AA 3BFWA 5ID1B 1TJGH 4F7CA 1FNSH 2WXHA 5DHDA 2KYIA 1EXUB 1NCIA 4JO5A 4N28A 1OGSA 5IOKA 3VI4A 2VDML 4KXAA 2A6DA 3CFUA 4NI3A 5DK2A 5C7XL 4MA8H 4G7SB 2XN0A 4BYHA 2Y6SC 3LIZA 4JCMA 5E2WL 5DRNB 4FLQA 3L3JA 3DGGB 4QYOA 5AOIA 2NQDA 2W65B 3LH2L 2X53A 2FT7A 3LS4H 5F0LB 5KG9B 1LK3L 3VXOA 1ZY9A 3ARZA 5E6ID 4BKSC 5F93C 2JB6B 1YY9D 3NP4A 1JBJA 4ENZA 3V6BR 4QI3A 4X7SL 2RGSA 1U92A 5CEZE 3MLVH 1UH3A 1AHWB 3TF7C 5F7FA 3CN4A 3FB7B 4J1UB 4P3DB 5HVGB 2DWEA 3TIDA 3BXNA 1XSJA 1NBYB 1BEYH 1Z5LB 4MWFA 5DYFA 5INDA 5HP5A 2ZXQA 3UTPD 1PAZA 3S34L 4AX3A 4UM9B 2PP7A 5DJ2A 4LPYA 4P2OD 1L7IH 3BGFC 3HNVH 4G1EB 2F5AH 1JD7A 1FRGL 3QFJE 2HH0H 2NTFB 4KJQD 1UD2A 3DHPA 1EZVY 2DQEH 2F19L 2WYZA 1WAPA 4ZMWA 5C08D 3U0TB 3LZRA 4J28A 1KCRH 4I0PB 2F5BL 3QUKA 2Y1VA 3FT1A 3WKQA 2VLJA 1QHQA 4A04A 5FW6A 2FD6L 4EI6B 2CRZA 2B15A 1AKJB 1T04A 3DYOA 3O3DA 3QI9C 4EDXB 4Q9QH 4B0MB 1NGXA 3LH9A 1ES0B 2W07B 4I4WB 4WRLA 5E5RB 1ADQL 4NNYA 5LJYH 5C8JA 4PRNA 3HA0A 5ANMB 4K73A 1Q0EA 3RY4A 4EVNB 2WN2A 3OXRB 3O8XB 2BNQB 4NN5C 5D72L 3SKNB 5EEZA 4NJ9L 3FONA 2OTPA 1GHFH 1BMWA 5M7QA 3HRZA 5T1DL 3BUPA 3RBGA 4JREB 3EHBD 3NIFF 1ZD6A 3U30B 4W9JC 1NC2D 5DURD 3ZHDA 1IGMH 3RU8H 3WFDL 2ZUTA 1OHZA 3E8UL 4XGZB 5DJXA 3CQFA 3OGCB 4U31A 1YEFH 3UBGA 2NNAA 3OKMA 3VI3E 5EUOA 1CL7I 5EG6C 5IMOA 1IT9H 2J71A 4RFOH 1QP1A 3L3OC 4PY8J 1B9KA 3CFTA 4FFVC 4CL7A 5IQ7H 2O5ZH 4K9EL 1H3VA 4G8FB 1OKEA 3SD2A 1ZS8A 4JFPA 2ZUYA 1QBBA 4PJ5D 5JPMC 1XBRA 3W11D 4LNRB 4AZ8B 4Y19A 2CDFA 2J5WA 5B7MA 2V17H 2V5TA 5BRZE 1J9TA 2UX7A 3HUJF 3FAWA 1I7UB 4U1IB 2GABA 1OVZA 1E40A 1ZT7A 4KJWD 3V52H 2OBGA 3ETSA 4K8RH 3VE0A 1MLBB 1U3YA 3IMRA 3RGHA 5HI5D 2FYYA 2JK5B 3HHSA 5B8CB 2GT9A 4KITB 1MAMH 2ZONA 5J1SC 1N64H 5ESVB 2PW1A 1OTUC 1OPGH 1Y07A 3L7EB 5C0FA 2OX5B 4UYPA 5DJCA 3BW9A 3PWPD 4IMLB 1I9JH 1TG8A 1UYWL 2A9NL 5E8EA 4F24A 5E94A 3EFFB 4WY7L 3M07A 4KOBA 2IBZY 4PV1C 4YO0A 1RULL 2NY2C 1D6EA 1BZEA 1E9PA 3QZNA 4QRUB 4F1ZA 2XSKA 4WKXA 3K72B 1D9KA 2IANA 4OCYL 5AQ0A 2B1HL 2PP9A 1A1MA 4I77H 1S3RA 5TE6H 1WLHA 3LKPA 3OAUH 3N43F 4ISVA 1UM6H 3S37H 1KIQB 1S7VA 1VPOL 3S88L 3X3GH 2ZOTA 1AQDB 2FATH 1EHXA 4XRCB 4G9DA 4HMCA 1OE1A 4CSTA 4NKDA 4UINH 3PLYA 1MXGA 1P4LB 1KV3A 4HS8L 4P05A 2ARWA 5DJDA 2PPEA 5IB1A 5I1GH 4JN1H 2OMNA 4MA7H 5KVDH 4E5XB 1FGNH 1U8IB 3LPWA 1BYNA 2N3JA 4N90E 4NQEA 2HG5B 2WGNB 3MRFB 5F7LB 1K3IA 3BT2L 4WK0B 5JW4R 5KYXB 1G9MH 5LN4A 1XF5B 1OANA 3VB9A 2EDOA 1TVHA 3PPEA 4O2CB 1HWWA 2H45A 3QZOA 5DU7A 4NLAA 4F5CE 2EDDA 3TT1L 1ORQA 4RA3A 4YDJA 1WT5A 4ZW3A 3ULVC 2CLRA 3FZUD 5C9JA 1KBKA 1KN2H 1QSEA 3K4AA 4LARL 5BOPA 2YOCA 4HUXB 3GRGA 4TMPA 1A6AB 4N6RB 4F58H 4AKOA 2X5PA 3LEVH 1A9BA 4FQHB 5CHNA 3L1FA 1NUGA 4HDIA 3KPRA 2NY6D 4PBXA 4PJAE 5CJ5A 5CWSB 5GGTH 1OCOB 1MCDA 1U8OA 4GB9A 2ADJB 1LP9B 5ISZB 3OQ3B 4OLXL 5I1KL 5DVLA 2R15A 1NOLA 1SMOA 4WFEE 4W9HC 5D70H 3DBSA 2B0SL 4NZTL 3SDCD 4U3SA 4MMYA 4BQ8A 3T09A 3BH8B 4O4YL 4XMWA 4L18A 2HLFD 3EYSH 5K59F 1HZLA 3B2XA 4FMVA 1BPVA 4KRPB 3IFOA 3OHXA 2OSWA 1OARL 4NKMA 3DI3B 2ZTBA 3HZMB 4D8OA 1OGTB 2FBRA 3MRKA 2XLLA 1G4MA 3WL9B 4AVIA 1FE8H 1TQTA 5FHAL 5AVSB 1CC3A 3CXHK 3FT3B 4XMZA 4FABL 2F8XC 2CBOA 4QGTA 1IAKA 2NY4D 25C8H 4K5NA 5FYLL 3UG3A 1EH9A 5LCVL 3VXNB 2RHEA 1YMMB 2PCXA 3FBKA 3O6MH 4R8WH 1HYSC 1C16A 4W6YB 1FL3A 1BVKB 3WLWC 3MAWA 1NC4D 3RVVC 2X2YA 1IGJB 5ITBH 1AQKH 4Y5YA 3GHBL 5C2UB 5JXAH 2HXAA 4AGNA 4ZS7L 2F54A 3RKDC 3QT2A 1CR9L 5HGHB 1Q9LB 3BMVA 1IE5A 2H26B 1QVOB 4GRLD 3MV7D 4PV9B 2BFGA 4PI2A 5EOCH 4DN4L 4HMEA 3PAVA 3NFNB 1TNMA 2C7UA 5SX4I 3U9UA 1JVKA 4XVUD 4CVUA 3W9EA 1FO0A 1UQSB 1HH6B 5C6TH 2J88H 1YEJH 1H3WM 1I9IH 2VN3A 4ACPA 4ATWA 4JFDA 1AFVL 3MLRH 2PWGA 3N3EA 2MKLC 3O81A 1X7QA 1G7QB 1HC1A 5BVJA 1V7MH 4NCC1 5AZ2H 4RSVA 3SCMC 2X9XA 4NPYB 3D4YA 1E65A 4P2RE 4JG5A 3M1BA 1CLOH 3UMTA 3LIZL 1DLFL 3MBXL 4EBQH 3GBEA 1U8LA 4PJGA 1JXJA 3FU9A 5FIEA 4PRAB 1ACZA 5K59E 1AVAA 4PIBA 3S97C 5FFGA 4OZIF 3LS5H 1E30A 3SGJA 1F3DJ 2JQZA 1WBXA 4OCXL 2YGNA 2WO4A 1KGJA 4Z3GA 4KMQA 5FA4A 3VFRB 1IM3A 3ZQ9A 2JKSA 3P4OA 4KMLB 3B2PA 4LNVA 5CXPA 3EF4A 3IPFA 5IOPB 1SY6A 5F9OL 4HK3J 3VB8A 4BK4A 3IRPX 1P4IH 5ESAA 2HVJB 3P54A 3QIWC 4UIMB 1MW1A 3AU1A 5DD5H 1U41A 1E4XH 3WELA 4F8NA 3AS2A 3VAEA 3N0AA 1NGYA 2FEEL 3SPIA 2E5EA 3EJYD 3KGSA 1BGXL 2DMKA 3SQOH 4GMSL 4D9LL 2YPKA 4E41E 2NX5E 4PP2B 3PV6A 1A6ZB 4IHOA 3BZFA 4JPKH 3SPGA 3KXFD 4J3WA 3H85A 5DC9B 2JKXA 2ZD0A 3SDAC 4CU6A 4MX7A 2UXGA 4YSUA 2VSDA 2VZSA 5IJVB 2JCCE 2V2WB 4HUWA 4WV1C 2HX7A 5HYSG 2A9BA 3K0WA 1GCYA 1SXNA 1XB3A 3SSGA 3HE7C 2KH2B 2ZYRA 1XAKA 4PVMA 5I6XB 1XH3A 3R8BB 5IFHL 3D4CA 5ICZB 1RJYA 5L2KA 2E86A 2E6JA 2N4IA 4KKAC 1UXMA 4XMKH 3D0AA 1FP5A 3LIUA 4Z7UA 5GSRB 4P5MB 3HBPA 3ILDA 5E99L 4M1DH 2WXGA 4DTGL 1QLFA 4PJ8D 4EOWH 5IEKA 3BZEA 4QXWA 4OIAA 5C0JA 1I9RH 1KBVA 4FFWC 5IROA 4X5PA 4OZIE 1UUNA 2XWDA 1NBZB 3GUTB 3UZVB 3ARGB 4DN3H 5E1HB 2IQAA 2C1OB 3EGDA 3OM3B 1KENL 2BIOA 5F7UA 2DJUA 3MA7A 4JRXD 1UUSA 3L45A 5B1CA 1N6VA 1QBAA 4OGYH 2HRLA 1KGYE 3D52A 3D39E 3IU3A 1QZ1A 3AAZB 3IXAA 2Z7YA 5BW7C 4XAKE 1UOWA 1WF5A 1CU4H 1G0DA 3NGBB 1BVZA 2XQ0A 4W68A 1D5ZA 5L8LB 5C07E 3RFZC 4ZAKD 4LVEA 2BNRA 2CRMA 3P73B 1EFXA 2NY5L 5KYUA 1SDYA 3AG4B 4K7FB 4KTGA 4DKEL 1Y6NR 2FAUA 4JY6A 5A2BA 2WBJC 5FUCC 3B2UC 4U33A 4XE0A 4AGMA 2N7BA 2MJWA 5HTSA 2NLJA 3UXFA 3R7RA 3HLAB 4R7NA 3S96B 2D8KA 2JELL 3Q2WA 4H8QA 1OOAA 1XCTA 4TSBL 4GS7B 5GS1B 3EBGA 4KOCA 3DX7B 2FGWL 1TTBA 5HHOA 5FX3A 4RWYH 5KSAC 3S37X 4YJZL 2BSSA 1R3KB 4OM0H 1LWHA 3X3FH 1GW0A 4KC3B 4MHHI 2ATKA 4A6YH 2E4FA 1DCEA 2XV2A 4AQAA 5TH2B 1BXXA 1JUFA 4LP4A 4D94A 5J9PB 2FZ3B 4WW2B 1AIFA 2DPKA 4UQ2A 1GJIA 2ED7A 3RDTD 2CPCA 2NRDA 3O6FA 1PAMA 3GD1C 1IC4H 2IV8A 3QQDA 3GIVA 4IBTA 1A1OA 3LPPA 2VAJA 4AENB 4H1LH 2CCVA 4MAYB 3VWKB 1T1XB 4FQXA 4RAUA 1B4LA 5AB9A 2VDMH 2ITDA 1ACCA 4MB3A 2XKSA 1O5DT