4LO9A

Human p53 core domain mutant n235k
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
194
structure length
194
Chain Sequence
b'SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Structures of oncogenic, suppressor and rescued p53 core-domain variants: mechanisms of mutant p53 rescue.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 46
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4lo9A00
4IBZA 4IBTA 2H1LM 1YCSA 4AGMA 4IJTA 3WTWA 2YBGA 4AGQA 4MZRA 3EXLA 2VUKA 1EAOA 4IBQA 5AOKA 3VD1A 4IBVA 5G4OA 2OCJA 2MEJB 1IO4C 2RMNA 1CMOA 2P52A 4G82A 2BIMA 3US0A 5AOJA 3QYNA 2J1YA 4QO1B 3D05A 3D09A 3D06A 4AGLA 4G83A 3VD2A 1HU8A 5AOMA 3WTYA 3WU1A 2ATAA 1T4WA 5LAPA 4L18A 1GZHA 1HJCA 2J20A 2BINA 2GEQA 3QYMA 4GUQA 4L0YA 2IOOA 5KBDA 2WGXA 1HJBC 2XWRA 2PCXA 1TUPA 5BUAA 1CO1A 1EAQA 3WTUA 4IBSA 2J1ZA 3Q01A 1E50A 3IGKA 3US1A 2FEJA 2BIOA 4AGNA 2AC0A 3WTVA 1KZYA 2IOMA 4IBWA 4L0ZA 3IGLA 3D0AA 3EXJA 4LOEA 3TS8A 5AOLA 2X0VA 4AGOA 1EANA 2ADYA 4IBUA 3D08A 5A7BA 2X0UA 3WTSA 4AGPA 3VD0A 1LJMA 2J1WA 1GZHC 4IBYA 2J21A 2X0WA 4KVPA 2J6WA 3WTXA 2IOIA 3ZMEA 3Q06A 4MZIA 4XR8C 2J1XA 4HJEA 2AHIA 5ECGA 3D07A 2BIQA 5G4MA 5LGYA 3WTTA 1TSRA 3KMDA 4GUOA 5AOIA 5ABAA 3KZ8A 1H9DA 4A63A 2BIPA 3Q05A 2XWCA 5G4NA 5AB9A 4LOFA 1UOLA 4LO9A
chains in the Genus database with same CATH superfamily
3HB3D 5GRJH 4N22A 4Q58C 1GYCA 4HZ1A 3QEQA 5AW9B 1OLZA 2VLKB 4CMMA 3AC0A 4NQEA 5ESQA 2ADGB 1DJWA 1GY1A 2NXYD 5JYMA 1F11A 1RUAH 4NPJA 3SYCA 1RMFH 4O4YH 5A16A 1A4AA 3MRFA 4PD4J 3SDCC 2WQUA 3VFTB 5JQHC 4AKPA 4DKDC 3SKNB 4N87A 4HWZB 1F6LL 4NZUH 4G7YH 4KHTL 2WOYA 3QS3A 3V4LA 2VCOA 3QIWB 1RZKC 1OB1A 4BUQA 1ODAA 1QA9B 2DBLL 3NJMA 5CEXA 4WGWB 2APBA 4NRYA 3REVA 5C3IA 3GJFK 2QKIB 4PV8A 4DN3L 5FLVA 2EAEA 4APQC 4CN1A 2WIIA 4HETA 4XMVA 3WIHA 1A5FL 1CYGA 3M1BB 4MD5A 2A9DA 1J1OH 5BUGA 2DIAA 2VXUH 3LEYH 2CBTA 4PJ7B 4UM9D 1GRWA 1ZEAH 1T1WB 4GEIA 1NGPL 4YBQD 4M6OH 3PCYA 4MNQA 2ZX8A 2OMVB 2VDPB 1HIML 1JS4A 3F7RA 1HK6A 3LPFA 1F4XL 3L1GA 4YLBA 3ZPDA 3GB7A 3U2SB 4EPSA 4ZXBD 1N4XH 3K6SA 1ONQA 3DTUB 5E99L 5DJCA 3QULA 2B9AA 4ZO7A 3FT9A 3ZO0A 1C5DB 3VI3E 4WCYH 4YO0A 2F8VA 3BFWA 2WIMA 1CXIA 1P7HL 2ZOTA 2X6CA 3D4YA 3W0WE 3SOBL 1G9NC 4YC2C 5CBEB 3BWUF 1LE9B 3DX7B 1ZHBA 2Y7OA 3MRHA 1U2YA 1A4BA 3H3PH 5DMGC 1YMHA 3ZKXC 2WBKA 4MZIA 5HD8D 3QWOB 1D7CA 2G4EA 3KVPA 4JG0L 1ADQL 1MDTA 2OMBA 1JD7A 4YMPA 4M5YL 1WWWX 5H37H 3N06B 4O9HH 2XA8H 1KGCE 2AJUL 3BEVA 3D8MA 5E94A 3C60A 2X38A 3E3QC 4JN1H 2FBRA 4Q0XL 5E2UH 3V10A 3NJIA 2C4FT 4G59C 4IU3A 3VFPB 1ILUA 4PGZA 2Z7YA 1UHVA 3VB9A 3TF7C 4WSKA 4ZMOA 2WBWB 5EN2B 4CDGC 1JGEA 3CZEA 1OWRM 2DTMH 1PLGH 3ROOB 1X5KA 1Z3RA 2VZ1A 1QKZL 1XH3A 2A9ML 1SUJA 2D0HA 2FGWH 4HKZB 4I9XA 5CUSL 1NEZB 3CCHA 3S35L 2Q76B 2Z4TA 1ACXA 5HGDB 3AS0A 1U6AL 1VDGA 2NR6C 2E4TA 3SKJH 4ODUB 4YVUA 4HQQH 3P54A 3B6SB 1IC0A 4TSBL 1WAPA 1CTNA 3QH3A 2BX5A 4KC3B 5IF0B 3NFPA 3P3SA 3QI9D 2BXYA 5E4OA 1UKSA 1E9PA 2VDPH 2HT4D 4GO6B 5IROA 5LGHH 3FU6A 3WFHB 4AGLA 4K23H 5CD5D 1YYMH 2WXNA 1J18A 4BK8A 1QNZH 3QZWA 4XODA 3CFUA 3RNQB 1XO8A 2R0WH 1DTUA 1HEZA 4HKBA 5L4IA 4CC1A 1KBWA 2JKXA 2XPYA 3QWNA 3FQ2A 1O5DT 5FECA 2E8ZA 2AV1A 4ELKB 1AZZC 5BV7B 3RUGA 4KOBA 4PJ5A 2JI2A 3EYQD 4QTHA 5GGRA 1MI5B 1LDSA 3GMNB 4XMPH 1G1YA 1ET7A 3P3TA 4EI6A 2V9QA 5D7JC 1OO2A 5SX5H 1TEFA 2DQDH 5I1AB 1RERA 3N40P 3CHQA 1AYOA 2N7BA 5M95B 3MO1A 4AL8H 3VTAA 1PLAA 5D1XD 3EYUL 3PHQB 5AYQA 2HKFL 2OS7A 3BWSA 3LDBC 5L4MA 1YY9C 2OMXA 3TTYA 1N70A 1ZHNB 1P5UA 3LOWA 2V2TA 4RISL 5AKRA 3SPHA 4A2DA 2XQYG 1KDIA 5DJ0A 5DA4A 4LBEB 1JPFB 4KO7A 4LCWE 5IQLA 1KJMB 5CJQL 3K1DA 4NUGH 3F7QA 2XTSA 4DN4H 4PRNA 1JK9B 1IGCH 1GOGA 3OB8A 1VPOL 4LOUD 4RFNB 5L2KB 3KJ4C 2IOIA 3IU3A 4FFYA 1ZWIA 4PP2B 4W6WB 4F9LA 5IP4A 2AJXL 4WV1A 5GRVK 1OD7A 3BZ4A 4N0CC 3GXMA 4PGJA 3ABMB 1ZTMA 1EEYB 2ICEC 4KJQC 4LVOC 4XMTA 3ALWA 4X80H 3CVDA 4FMFA 3GKWL 3KLAB 4G6AD 1RK0B 1MRCH 1T5KA 1RLBA 2IQ9L 2JCCA 5JXEC 3QJFA 2IBGA 2Z6FA 2CXGA 6FABH 2ISDA 1UADC 4KK6D 2Y1YA 4CVWA 4TULH 3ZOAA 4KKNA 5E1GA 5ICYB 3GSQA 3F01A 2K45A 5E2VH 3UTPD 2NNRA 2YBGA 3U2JA 1IX2A 3LB6D 5JORA 1WZ1L 2EILB 3V8CA 4KKBC 3O4LD 1X5YA 2IQAA 2NQ3A 3FB5A 2PCFA 1V5JA 2P5ED 3FCGA 4JW3A 5I76B 2CLZA 2PP8A 5MEOB 2W9EL 3DXAB 3QDMB 4WEBL 5B7FA 2APTA 1RHHB 2PXYB 3OB0H 4HHAA 5BW7C 2MQ0A 3CZSA 2OFQA 4DK5A 1CLYH 3DJSA 4PM1A 3QDGB 4QHLB 1QAWA 2J6EL 1KGXA 1T4KB 1L5GB 5I1GH 4KZEH 2G60H 3O8XB 5D72L 2F61A 3I02A 1F02I 5EU4A 2L04A 4HBCL 5K9OB 2Y3NA 4Z3IA 2OTWA 3W39A 4Q8BA 1W9XA 4GI8A 1J5DA 3KL5A 1KF9B 1NPNA 4WFHE 4YOKA 4L8BB 5BJTA 5C0IA 3I2CL 5GGUA 3IDGB 4JRYB 1KBGL 5C86A 3FT2A 1LO2L 1INEH 4ELDA 2GK2A 3QNXA 2Y7NA 2KBGA 3RPIB 3ZDZB 4UOJA 3LKQB 2UZYA 5D7LB 3U9WA 4HOMA 1QRKA 4XCNB 1BAFL 2DL9A 4L2YA 5E9DB 4BCXA 2R69A 3Q6FB 3L1FA 4GP4B 4AMXA 2Y25A 4Z7WB 1A47A 2DM7A 1UQSB 3QNYB 3WBDA 1E5ZA 1E3XA 1MRDH 1OSPH 2B1AL 3EOAA 3T6VA 1S7SA 4E42B 4OF5A 5AVRB 4AQ8A 3D4ZA 4LLWA 1JMXA 3V4VB 1AHWA 5IQMA 2ODHA 2FNWA 4UQDA 5I8EA 3UEQA 1WP6A 4PW4A 4Y2DB 1KPVA 4G6FB 1PZDA 2AK4D 1HL8A 3C5XA 1D5BA 2CKBA 1MCRA 1MCJA 5IEKB 4H8VA 2J8OA 1ZLUH 5DVKA 1XF3A 3MRKB 1HHHB 2C3VB 1KYUA 3WTXA 1JWUA 3IRCA 3MUGA 4IGBD 4F27A 4P5TB 1IMHC 1DBML 2IGLA 1CTOA 3AT9A 3DVNA 4HEPG 4BFOA 2GUYA 2O5NA 2J1XA 1SXSA 3U9UA 4LSPL 5EMYA 4ZOBA 1OAYL 4CGTA 1MVFA 5EUKA 4GIAA 4HCRH 3K2MC 4ZNEA 4YAQB 5T3ZL 1SN2A 3T3ME 5J12B 5HHVH 3RWCB 5IJVA 2H3NB 4U33A 3SD2A 4J8RB 4PB9L 3S37L 1NGYB 5AD0B 3CHSA 4QOKA 4XC3H 2HVKB 1S7UB 3GJFB 3AUVA 4OZFH 4Q9BA 4ZSOE 3H0TA 4IW4C 3VWKC 5I1DA 4DP9X 1DVQA 2YD9A 5AZEL 5F7UA 5DDHB 1UB6B 3U0TB 5IW6B 2NY0D 3Q3GA 3VXUD 4K5PA 2P42B 5GGVL 2EEAA 2AJZA 1AC6A 4R7VA 3O6MH 3FQWA 4KKCD 3VFNB 3O41B 3FRPB 4WDIB 4F8QA 3IETB 3II2A 1RURH 3OWEA 3BZEB 3GIVA 3K8MA 4M1CD 3BQUD 3QFJE 5F7WC 4N6RA 2GITB 2H9GA 2MWCA 5DMKB 4HUNB 3SD5A 2QADD 2IGTA 3V4VH 5AB2A 5AOMA 4PLJD 3IF1A 1I7RB 3BEWA 4JLRB 5DD0L 3DO7B 1UXWB 3LQAC 4NQVA 3QXDA 2YOAA 1GIGL 3Q7JA 4HUMB 1D5ZA 2BJMH 3MLSH 4OR1A 1CGYA 3PWPE 5LG6A 4NC1C 4ISVB 3RDJA 4HP5A 1UD6A 3H85A 4HGWA 4QRQB 3RTQB 1N2RA 4HK0A 4Y5YC 5FUOL 3OMIB 5J9PB 3PP3K 4CU8A 4I5BA 2J1ZA 4ACPA 1YDPA 2HLFC 3RUGF 1QLEL 3NABH 1KYOJ 1A02N 5J4MA 2PTVA 3T4AB 1XR8A 5F97E 5EEYA 2WNXA 4BK5C 2NSXA 5E03A 2D2OA 1RUPH 1KIQA 2WXIA 2LU4A 4BSVB 1JZ7A 1N6VA 1DQKA 3KW8A 4HS6B 3EOBB 3SDDA 3NIDB 4NI6A 1FPTL 4OZIA 4ANVA 3SKOA 5DHVB 2OR9H 3VVVA 3QIUB 4H40A 3VG9B 2V37A 3TN0A 1EZSA 3DOSB 9CGTA 2X7LA 3U6XA 3GJFH 4QXGL 2DQTH 2OMUA 2AXHA 4XB7A 1D5IL 3ARRA 5HYIA 1L9OA 4ORGA 1URIA 3PUCA 1NPUA 3C5ZC 5T5NG 1BZQK 5MERA 1CFMA 2OM5A 1ZKAA 5IB4A 5IT2H 2WLZA 4DO6A 3AXIA 4L4TA 4TRPH 5BZWB 4J3SA 1F0LA 2OP4H 1CLVA 2CIIB 4ONHB 4UZUA 4GT0A 3ZE2B 3F64A 4K3DL 3QUGA 4V1DE 5T8IA 2FHFA 1XZ0A 4MJID 1W72B 3JV6B 2K4WA 5IMLA 3MRNB 3R4RA 4QHKJ 1YY8A 5D2LA 1OCRB 4P4KC 5GQBA 4UWQB 1FFOB 1R33A 1IC4H 3HC3L 1DLFH 2JCCF 2CCWA 2XPGA 3BPOB 1CU4H 4HW6A 1OB0A 5JHLH 2ZP0T 1J9CT 4HMCA 4RBPK 4PHZA 4XBPA 1F4WL 4FJZA 1QRND 2ICWA 3MN8A 2RFXB 4IRZH 4KY1H 3JVFC 1RQ5A 2LFGA 3MV9D 4BSWA 2C9PA 2QHRL 3SBWC 2VZTA 3WO3B 4JMNA 3FO9A 5TGBB 3CVBA 3SJVB 2GJ6E 4X9FA 3HN5A 3VE0B 2P80D 4J2QA 5HDBB 4XCYA 3UBXG 1FZMA 1X5AA 1J48A 3N2JA 1CICC 4QRSB 1JDAA 2Z9TA 3OKMB 3VWJC 4KJYA 2J1YA 4MJHA 2B77A 4NM8L 1K8IA 2HX9A 4IRJB 4PP1D 4OI9A 5ID1B 3JBG7 4O2EA 4OM0H 2R9HD 3VRLE 3JWNG 1V7MH 2M26A 5TFSH 1IBBA 2YEZA 2VAJA 3GBDA 4X8JB 4EOWH 2MH4A 2X87A 4Z7NE 1A6TB 3KBEA 4Y5XA 4DOHB 1TETH 2XC8A 4YDJB 1CBVL 3OAUH 3DWTA 2ICES 1S4IA 1C16A 4Y1AA 1HH9A 1S7WA 3B2UD 3OLIA 1J1XL 2J8UA 5DC9B 5ANHA 1QATA 4IHOA 2DIBA 3MC0A 4HIHA 1T0NA 4EKJA 3GJEA 4PRIA 4KGLA 1ROCA 2ZOKB 4PS4L 3H2QA 2YXFA 3MCLH 4O02A 1UT2A 2D3NA 4S1SL 2C34A 4JQXC 4AI7A 4B0MM 4ZTPL 1R0AL 3WFBH 1NFIA 3LS5H 5A7BA 1IBGH 3IMUA 3L48A 3TVMB 4U1LA 4ONGH 4PJIE 2FR4B 2WAHA 4R90H 3IFLH 4FNUA 3P9MA 4J6RL 3U7WL 1P7QB 1JDDA 3TO4B 5I16A 3D3VA 1J5OH 1VACB 2JKJA 3ZTJG 1W80A 5IM7B 4L3ED 5JLZB 1KIRA 2FL5B 4S0HA 2A74C 4AIZB 1YNTB 3H3KA 4GB9A 5TDPA 5T1KB 5EZIL 4KNQA 2BNQA 5ADPL 2WWKO 1WGVA 3QUZB 3EFDH 3ZE0B 1BW8A 2ZYSA 4LPXA 5MHSD 3TEYA 4IDJL 2VLJA 3TOPA 2CUIA 1ZT4A 3FB7A 1BQHB 1TTRA 1ZHLB 2JK5A 3QRBA 5KBMA 3VFOB 4AEHH 1AIFA 2YEQA 4PMFA 3MLPA 5C0AB 2IANB 2X4SA 1ID5I 3UERA 3QJZA 4J1UB 3SKMB 5I5IA 5L4FA 2PETA 1I8MB 1X5HA 4LLUB 4WWKC 4Q6IA 2VITA 1PGRB 3B9DA 4TNWF 5HHNB 1IZKA 5CCKL 3WNMA 3NVQA 4JO4L 3SPJA 2JB6B 5KEZA 3MV8D 4XZUA 3IGAB 4LB8A 1IUZA 2F1EA 3VYOA 5BVJA 3P0VH 3UPCA 1KNOA 4GFTB 3GIZL 2VXVL 1U21A 3Q43A 4HXBL 2JVUA 3DGGA 4PWKA 3GK8H 3DIVA 4M61A 1HL5A 1JZ2A 3MZGB 5EZLB 1EJOH 1IL1B 3B2XA 3HG1D 2FH8A 3E80A 3QEGL 1TCRA 1K6QH 4LSQL 3DTXB 2YD0A 1P7KB 2VISB 2X09A 1AR1D 1AYRA 4MNGE 5D4IA 1NMAL 4B96A 1E8WA 2IEPA 2ZE0A 3F2LA 1I3RA 2FATL 2ZWZA 4E41B 5DEFB 3FO2B 1P4UA 2QFPA 3MJ8B 4QTFA 2WUCH 4GXVL 4MASA 4HWEH 1D5XA 2WQ8A 3CZNA 1F41A 2ZOWA 1PZSA 4TL5A 3UPAA 1O7VA 1DO5A 2VGLM 4MDIB 4R2GB 4EDXB 2FX9H 5HHPA 1SVBA 2VXQH 4GG8A 5EZOL 1DBKH 3Q44A 5EO1A 3FUFA 3CSTA 4GBXD 4ES9A 1AI1H 5IQ9A 4CADA 1SJEA 1WHOA 4FNQA 2F8XC 1ZT1B 4U6XB 4CVXA 4W6YB 2FLBT 3IPFA 5E8DH 2K1MA 2FX8L 4Y2LA 2IIJA 5DHYA 1EHLH 3VXSE 4OZIF 1AO7D 2WCSA 4L4VD 1DZ0A 1R3IH 2C9AA 1MCOH 1A4CA 2VM4A 3LVEA 4NWTL 5MP6L 2WWOA 3DHPA 1OGAE 1ZA3A 5DK2B 4XH2A 4MZ3A 2OW7A 1EZLA 1PKQE 2VW6A 3GMOA 5B1KA 4LASL 4FLRA 4H88L 1P4BL 2CRMA 3GMPB 5CZRA 1GSKA 2YAOA 4ZUWB 1C08B 4R97B 3VSUA 3EBHA 3N9GL 4JM4L 2O5YH 4JPWH 5C0CD 2EEFA 4JCWA 4B9ZA 1RZIB 3FCUB 4TUOA 2K0RA 3MRJB 4M3KB 1HSAB 3DTDA 1NC4A 2EABA 4M9PA 3WSQL 5D2LF 2ESVE 3L4UA 2H1LM 1BZ7A 1K72A 1BBDL 4OSUH 4PRDA 1HOCA 3D52A 4GRMB 2ZCKH 4N2EA 5F7BA 3ML9A 1MW0A 2Q7YB 4NO3B 5GS1A 1MVYA 2FQGA 3C9NA 5FKAA 4YZFE 4FHBD 2QQLL 1DANT 2CDFB 2DQIL 3MPCA 2ERJC 4D7PA 3VD1A 4FD0A 2ED7A 5I66A 1MREH 4K71B 2DYPB 1K4DA 3RY4A 3ESOA 1GW6A 3VFGH 2UZXB 3BVDB 5ITFA 3X12A 4R7DB 2R51A 4YSOA 5DTFB 5FYJU 4B6ZA 1F58L 4DFHA 1XGTB 3PP4L 3TZVB 4G83A 1S3KH 5IVZA 3L5JA 4U6HB 1SY6A 3RWEA 1NQBA 4YDVB 5CLTA 3ATFA 3NACH 2QTEA 2UZIL 4D8OA 3N43B 1WWAX 3WYRA 2WNKA 3W2DH 2HCZX 4ZUSB 5JUEL 1OF2A 3MNWB 2AW2A 3HMXA 5T1LD 4OY9A 2P5WE 4ZS6D 5EPMA 2Y7SA 4HYTB 4LU5H 3QE5A 4EZMA 5E2WH 4W4OC 4JBSA 3SQBB 4AENB 1PYWB 2EXSA 3F5WA 2BVOB 2OZ4H 3RY6C 1ZGLP 1IEBA 1M7DA 1T0PB 2N4IA 4JRXA 4P2OA 4ADGA 4CJ1A 2BOLA 4MQXC 5L9DH 3D69A 3I50L 3O6LL 1OCWL 2VLRD 3VH8B 1IGFL 5K93A 4F5CE 2J8UF 3MRGB 7PCYA 1WWBX 3QUYD 1ACYH 4ONOA 3HAEB 3SQOL 3T6WA 3FBKA 1CXEA 5CGYD 3BUTA 5EDXA 1VCAA 3P4NA 4G3YH 3INUH 2ARWA 3OXRB 5HHME 5ESAA 4F8NA 1EAPA 3HFML 1VZIA 1F45A 1SDDA 3C6LD 4NPKA 5HVHC 2YGPA 4GAYB 3D51A 1N6UA 3PP3H 2EO7A 2NY2C 1NOAA 1NM9A 4EUPH 3P9LA 5D1QB 4PRPA 4AJVA 1A6VH 2NNCA 2YLHA 4FA8A 2A0LD 3QO0B 2XQBL 2WBJC 3UIYA 3SBPA 4BRVA 1CCZA 4X0NA 1JGLL 1XIWD 1A1OA 1EDYA 3NJJA 1S5HB 4OCWL 5JPMC 5HJBA 5I0DA 3P77A 5LQBL 1ZT7A 1N3NB 4MD4A 3G5VA 2N0KA 3LNEA 2Y6TE 2XKNB 3A6BL 5ABAA 4OFYA 4P3CH 5E8PB 2BOBB 2E9GA 5EO0A 3BJLA 2EINB 2IBBA 1CFTA 4LP4A 4XPBL 2XN9D 4AC4A 3A67H 1ZK9A 3L1OH 4PJDA 2R1WB 3HZYA 3VXME 2XHNA 5JDSB 4A7UA 1H3PH 1YMME 1Y18B 3BP6A 4QNPF 1OTTC 4MVBC 4ZMPA 5KG9A 3NA4A 3C8KB 1A7QL 1EPFA 5FM8A 1FO0B 1EAOA 3QUKA 3KLHD 1YEKL 3HNTL 4JZJB 4P46A 4CC4A 3GHEL 1SYVA 3PJNA 4U6TA 4DCQA 2GJRA 3JTBA 3BDBA 4XPFL 1CQYA 3MV7A 4PJ8B 4GW4B 3BVWA 2FHCA 2LLGA 4WUUE 1OAUL 3LKSA 1R75A 5FR3A 1QFWL 5H35B 3MJ7A 3QP3A 3RWIB 2EH8L 1O9WA 1DEEB 4R6UA 4KK5C 3SY6A 1MFBL 8FABA 5DJ2B 1SDAB 3HAEH 3O2DA 5EBWA 2E9JA 5FM4A 1JZ6A 2W65A 1S5IH 1JWSB 4QAWA 5ADOL 1KEGH 4L37B 1U8LB 4RCAA 5JDJA 1FNEB 1Q0XH 1U8PA 4RBPH 5GGQL 3QEUB 3UTTA 3NCJL 2ZCLH 2BPBA 5C0BD 5GRWA 4G8AC 2BSEA 3L54A 3ZE1B 1KEMH 3A6CL 4X6CB 4PRAA 1NBZA 5JO5B 3H9SD 5E00B 1JK8A 4JY6B 1XSJA 3QQXA 3F7PC 4R5XA 4GRWB 1DO6A 3UCRA 1DDHB 3ZL1A 1KTLB 3N44B 2AVFA 1HKFA 4O5LH 4HWBL 1WZKA 1I9JL 2F54D 3S34L 1J05B 1QFWI 2I7SA 2IO5A 5AVTB 5F96L 5DD1H 4MJ2A 4Y7MA 2E86A 4RGNB 4APXB 2WGNB 2HH0L 2DB8A 2QVTA 1CXFA 4GI9A 4L3FA 1UC6A 4G1MA 1JIBA 4PJGE 1PLBA 4N90D 2KS0A 1OF0A 1KB5B 4ZFFA 2P24B 1ZV5A 4NQCA 3CDZB 3F85A 2DW5A 3L4CA 5IQNA 3HN3A 3TJPA 4HIEA 4KFZC 1H6EA 2GY7B 2VQ4A 4IOSA 4UM8A 3ZTDC 2C3WA 5CCGE 4Z95H 5CN3A 1ZA6B 3OKDB 5LN4A 5SWZB 4JPIB 3ROLB 1VSCA 3AACA 5BOZG 5IJCC 1FO0H 1I4FB 2EIBA 3OJDB 3OGCA 3EJQA 4MAUL 2WD0A 4HISA 4YXHL 3ARGB 4JDEA 3UC0H 3SE4A 4MBRA 5D70H 2OCFD 5DZVA 1EUUA 1D9KB 1LD9B 3D07A 2KL6A 2G2PA 4W1TA 2UWEA 4HOWA 2VE6A 3MBEB 1C12A 3EYSH 3G5YB 2AXGB 1TQVA 3UTQA 1J5IA 5CN2A 4JO8A 1E4XL 3SDXB 2R0KH 3VFWA 1MCFA 1C8PA 1H15A 4XBGA 4LPVA 4PUBH 2PPCA 3K5SA 4MJJA 3VXRA 4CW1B 1G1CA 3DGDA 4N2GA 3WD5L 4MQ7A 5KN5A 2XI9A 3KYOB 3OVUB 1QP1A 1YUHA 4M5ZL 4RAUA 4NKIL 2V2WB 2EVIA 3TCTA 2K8QA 1B0WA 5CEZH 4GKSA 1NSNH 2YSSA 2ED8A 3LNIA 5D7SL 3VI3A 5J1TC 5IKCA 2XDHA 2YLKA 3FULA 3HC0B 4GKNA 4GRWH 1UOVA 2EIDA 4KUZH 1RH8A 4RMRA 3EHBC 3VFVA 4FXTA 3BD3A 4E0RB 2P52A 3F7YB 4WJG3 5EOCL 4WO4D 3JWNE 1UM5L 2HFFA 3SCMA 3H7LA 4ZUUB 3NCWA 3ARBC 1AS6A 2DDQL 1E4XI 2HLEB 1RUAL 2JMRA 3AW5A 3EJRA 3L7FA 3LSOB 4HKJA 4ZUTB 1XB8A 4KPHH 1RMFL 1ZLWH 3MYJB 2PTTA 4TVPH 5FO8A 1SMOA 4KXZH 5C9JB 4KOCA 2EKJA 1V10A 2WLLB 1F3JA 1TOXA 1YNKL 3D0LB 3SGDI 2NZ9C 1T1ZB 2XVKA 3GS0A 2EDYA 2VMFA 3RY5A 1Z3GH 3BW9B 4O2FB 5AL8A 2FAUA 4LRIA 1P4LB 4Z3TA 1QO3A 3TEUA 2F53D 3JYBA 2GC7C 3S88H 1CGXA 1BQ5A 2EDEA 3ZKND 4C56B 4XNQB 4HVBA 2EXYD 4LVNC 3BGMB 3T0EA 1UWGL 3VQ2C 4YEEA 4NNXB 4NP4H 1J1OL 2WTOA 2VXUL 1EDHA 1WZAA 3LEYL 5K59F 2C9UA 1S2EA 3O3BB 3OHXC 4MA3A 2KLTA 1O6TA 1UA3A 5AB1A 3W81A 4KAQL 1I53A 2WN3A 4TQIA 4Y5VA 2A73B 4AK2A 3HS0B 4LSSL 3HR5A 5D5ME 4I2XA 4Q4EA 3N1FC 3MBXH 4JFFB 5JQ6H 4RDQF 3TBTB 1ODUA 5C07B 4GAGH 1Q9LB 3HOGA 4OIBA 3C5SB 1FNGA 4TM9A 3C5JB 2ZXQA 3MX0B 1JF6A 1UT1A 5I73B 1YPZA 5B22A 5KVFH 1KLGA 5CEZE 2MHAB 3AQZA 1NC2D 1G7PB 1W8NA 1DVFC 1GGYA 1YVLA 1MKFA 3PE9A 2BIQA 3ILQC 5E5RB 4AG4H 1VGEL 2C26A 3TEZA 2IC2A 5L8LB 1ZSDB 4MRBA 1FYTB 3ZKMD 4YNYB 2YAFA 3ZKSD 1PZBA 3B9KA 1I1FB 3F05A 5KUKA 4ZFOA 3NJXA 1AS7A 3UL4A 3T71A 1RIHH 3V9CA 1JGUH 4PU2A 3DROB 4FQCH 5B38B 1XQ4A 1SYSB 1KMGA 1MQKH 1WD8A 5E2UL 5KYWA 3BDXA 4U4BA 4TVPE 5C0GB 1OANA 2R23B 4NKDA 4HUUA 5FWQA 2DJ4A 3G3LA 5B4MD 4PJDF 2X6AA 4RX4A 3SE6A 2NY3D 3ZHLA 5C8JB 2OCJA 1THAA 3NQIA 5FB8A 4XOAA 4AQ1C 2DD8H 3OZ9H 4O2CB 2E7DA 3NEXA 2WQSA 3FZUD 3D1MC 3L17A 4C83B 2P28B 2DTML 1PLGL 2NOYA 3MR9B 1OHZA 1QHPA 3CFJA 5GGTL 4ZO9A 3RWFA 3ZXAC 4AQAA 2BNRD 4P23B 3B56A 3HUJA 4NIKB 4J28A 5E95B 5DI8B 3STBA 1JBJA 1GKEA 2WZAA 1R19A 3ZL2A 1MFNA 2VR7A 1HWWA 4NRXB 3Q1SH 4EI5C 1DR9A 4JFHD 4RNRB 2GBUA 4NB7A 3SKJL 2NTFB 2XY1A 3LX9A 4G8EA 4HQQL 5K33A 1KUMA 3FF7A 1B2WH 3L3OA 3UCQA 3EZ8A 3SDCD 1P4IH 2X3AA 2DMBA 1MLBA 2VDPL 1GH7A 3DJZA 4QY8A 2EIZA 3AADB 4WTZG 4R3SB 5IJDC 5JHDA 1QNZL 3MRIA 5BUAA 1FE8L 4X42A 5KVEH 5FDWB 3FQNA 1CE6B 3CXDH 4HLZH 2I32A 3IGKA 2JKIS 4IU2B 4MNHB 1J0KA 1VENA 3D2UB 4U2YA 3UZVA 1HHJB 1JYNA 5T5FA 1Y07A 4N6QA 3K6FA 1JSYA 1KOAA 4KFMA 3MJGX 2LU7A 4UQ3B 1CL7H 3FT4B 3X14B 3HZ3A 4AGOA 4Z78B 1ZLEA 5KVFE 3UTSD 1FL5B 4JO3H 1MJJA 4ZK8A 2WZPD 2YRBA 5FA3A 2NLJA 5I74B 1YEGH 3RDTB 5BRZA 1J8RA 2AGJH 4IMLA 1CE1L 1WF5A 3WDIA 4AL8L 4HS8H 2FRGP 4N2LA 4NQDA 3PGFH 3JVGC 4KVPA 4KVCH 1WQVT 4JKLA 5B3SB 1PX3A 4W9KC 3S5YA 4K9EH 4M9OA 2HJFB 5HGBB 3BGAA 1QEWB 4JREC 1E65A 3WHE1 2IDUA 4Y4HC 2FLMA 1RZ8A 3NEEA 2FIKA 1SOQA 2FO4A 1FZJB 1EMTH 2R59A 3LIZA 3NSYA 5DQJA 4GG6E 2EDNA 4G8IB 5DRWB 5C92A 4Y4KA 3IBOA 1RUQH 2QHLA 2XTJE 5CHNA 3QUXD 5IG7B 3T5WA 1QUPA 2C3XA 2EKSA 4KI5F 5LNDA 5D2NB 2WTPA 4PREA 1S9YA 2UWEF 1NL0H 2D03H 4OW6A 4R84A 5DJAA 1ZHKA 3A21A 4OJCA 3MUHL 4PTTB 4QHPA 4X9GA 3HE6D 2ZJSH 5HYQB 3GUTA 4UAHA 5DZLA 4EBQL 1JFHA 3RWJB 1MOEA 5JTWA 1E4JA 4IJTA 5I0XA 4UT6H 2Z31D 4JAMA 2R56L 3T2PA 4S0SD 1FGVL 1RI8A 4JK0D 3CSBA 4AE1A 2G9HB 1UVQB 5CLXA 2JKSA 1MCWM 3WUZA 2R29L 5CSZA 3ZQ9A 2RALA 1KWGA 3SGEI 3ZT7A 2AEPL 4ZPTB 5GJSH 5BV7L 2ZP9A 4UIMB 2AJVL 1AGFB 2OXHA 3H9ZA 2X5PA 2OMTB 4P2RA 1DJSA 5FAAA 2CGRH 1G6VK 1LO4L 2D2CC 2V5MA 2Y3AA 3MLVH 2FH6A 1CFSA 1YJDH 2J20A 3PQYE 4UBDC 4W9EC 3L2LA 1PIGA 5HY9A 4DP8X 4TMPA 5I30H 3FQUB 3V6OE 1G7JB 1U2CA 2ZKYA 4GAAA 2XY2A 3GTVA 3IM1A 1U91B 4YHZL 4J3OF 3LEVH 3I85A 5GSRB 2G60L 3D30A 1HL4A 1SGKA 3VMNA 2AMGA 4XPHH 5C0RH 5EH1A 3RQ3A 3WEAA 1Z9MA 4N8VA 2UY6A 3BPNC 5AOZA 4YN3A 1PIFA 1QZ1A 1OWWA 3S5LA 5I0ZA 15C8H 3QIBC 4HF5L 1QBMH 5CO1A 1JZGA 5CWSA 3AAZA 4JHAH 1C8QA 1G0DA 2GJZB 4AVHA 3A3YB 2BP0A 3SDYH 4D0CB 2CBMA 2KHAA 5HBBA 4B9FA 4P9HL 5D7JD 3WTSA 3DO3A 3OJ2C 1TZHB 2GUOA 3A47A 4XBGB 1FORH 5C08E 2W94A 1BLNA 2XWJA 3ZDXF 1MRDL 2GSGA 1OSPL 3QEQB 4NLHA 5BNXD 3QAZB 3E2HC 4CMMB 5EEXA 4AT6A 3KAAA 5ESQB 3RNKA 5IHUH 4UUJA 3GRWH 5EC1A 4EF3A 2KPNA 1F11B 1YY9D 1U8JB 4LEEA 4CAGA 1PZ5A 2C9SA 4QMEA 1JHLL 5A16B 2CE6A 3MRFB 3VSTA 3AWEA 1ZLDA 3U1SH 1DJXA 1T83A 9PCYA 2HG0A 3MXWL 4JY5H 4MMYA 5BQDA 1N64L 4Z7VA 4RZCB 4PVNA 2PPFA 1K5NA 1ZPUA 4RMVA 1YPZF 4FZEH 4BZ2H 2QZQA 1OB1B 1IFHH 4TNWK 5DVOA 3S4SG 2F7RA 4NYLB 3S3PA 2Y06L 4YBLC 4Z76A 1KB9J 5TPWL 5CEXB 4N0CD 1KFAL 4NRYB 5CZXC 2DPKA 3P4OA 4M8RA 3REVB 5ACZA 1ZXQA 5DMIH 1A3RH 2NNXA 4PV8B 2DI8A 1B3JA 3CZFA 3HE7C 5JOPE 3MNDA 2WIIB 4ABWA 5HHVL 2WB7A 4MD5B 3NCMA 5JXED 5KW9H 2FEEL 1N5AA 3KVQA 5KVDE 3O2WH 4YSQA 3L4ZA 4BM7A 4UT7H 1IGJB 5CZVH 5A43C 4JFYA 4XMZA 2P8LA 1DQVA 5ALBH 3BKCH 4PBDA 2XUWA 5G55A 3WN5C 1MCIA 1U8OA 3RB7A 4FNSA 4LPYA 2JH2A 3GB7B 1G7MA 1L6ZA 3NRPA 4HHWA 1EJ6A 5AAPA 1P53A 3O6ML 5JR1H 3K6SB 3GZPA 5DJCB 3QULB 3UYPA 4XP4L 3HUJF 3ZGHA 4ZO6A 4YO0B 3KPSA 1RURL 4TS6A 4L18A 2W80C 1OP3K 1CFBA 3FO0H 5EBGA 4DP4X 3U30C 5BZDA 2WXQA 1X6LA 3U79A 5FFGA 4NJAH 1ZHBB 3MRHB 1AQHA 4GUPA 4R4FH 3V4VL 1YMHB 4MDRA 1IZJA 4RLDA 1U8QA 2ZUQB 3D9AH 1YA5A 5HHQA 4IBSA 3ZYZA 3DBSA 2I5YH 5LN8A 3B8YA 3MYZA 5GZOA 3ML8A 3BEVB 4ADIA 5E94B 1EBAA 1EUTA 3O6FB 3C60B 4JFDA 5E2JA 5EOQL 4P9ML 3D50A 4X9HA 1WUZA 3SDAC 4OZ4A 4M7JH 1WC7A 2E46A 4IU3B 5D1ZC 1QWNA 2Q10A 3QWRD 3LJ3A 4AK1A 1AIZA 5DWUH 5I24A 4HZLA 3NABL 5ACLA 5KSAA 4DH2A 3MLUH 4X99A 2PO6C 1RUPL 2EO1A 4P5MB 1XH3B 4Y8DC 2AAAA 4IBYA 4LBAA 3WIHH 2EP6A 2YK1H 3CCHB 4W9IC 3P2DA 1IT9H 3T77A 4HCFA 3LN4A 2JKNA 4ZT1A 3QH3B 1LO0H 2DQTL 1DDTA 3NFPB 2TAAA 1E9PB 1FRGL 4XP9H 4UANA 1XBDA 4LHUD 2ZX5A 1BQSA 4M02A 1G84A 2PYEA 3QZWB 1ZK5A 4KXBA 1Y6KR 4KO9A 2WTRA 5KSVA 1HEZB 2X4PA 3WEOA 5F8QC 5I5RA 2OL3H 1JGVL 5FECB 2AV1B 3RUGB 1JZJA 3PF2A 3VXNA 4AVKA 4PJ5B 1C7TA 3QZNA 4QTHB 5GGRB 5ISZA 2PLTA 3FTVA 4OJDH 3FHQA 4OKVA 2F19H 3CSGA 3ZU8A 3MJ9A 4ATWA 2DLIA 4QJ4B 1IC4L 5IB1A 4FFZH 3KDMA 3WOVA 3MO1B 4AJWA 1CU4L 4J39A 3GO1L 3RFZC 3Q2NA 3QR0A 4FMVA 2OMXB 5DYFA 4HIXH 4MA1C 1P5UB 2CD0A 4KY1L 4CUCA 2V2TB 5EO9A 3A24A 4UOQA 3LPGA 2OMWA 4NWUH 2Q5BA 4W9FC 3SOTA 2D7NA 2EIEA 3IU4L 5JMOC 1FUNA 4RFEA 5E4EC 3MGOA 3V5KB 3QFJB 5DJ0B 3WMSA 2PPEA 4M4RA 3OJVC 2DN7A 5MEPA 4ZXBA 4PRNB 1TFHA 3L3GA 4JL2A 4K7PX 5DEGB 4BA0A 3BWAA 3FSOA 1P9MA 1ZWIB 3DJRA 4CNIA 2DWEA 3OC5A 5A2JH 1CGSH 4WV1B 3B9EA 3BZ4B 2Z91A 3D39A 3PNWA 3HRZA 3RBGA 1BZ9A 4OM0L 3Q6GL 2APXA 4X4YA 3O9WC 4KH9A 5DQ9A 2ADFH 3X13A 4KI1A 2NY1B 5FYLL 4XNXL 3RVXC 1CWVA 4PWEA 35C8H 4G7QB 5GS2H 1EEZA 4JY4A 3JWNC 1VEOA 4O58H 4HPHA 4I18B 3UJTH 2NY6D 5LCVA 2JCCB 1L7IH 2A4ZA 2EC8A 3QJFB 4M48H 3SE3A 3KPQB 4MNQE 3GTTA 4U05A 1K3ZA 3D18A 5HVWA 2HLFD 3GSQB 2YXVA 4HWUA 3L4VA 3K46A 4Z7QE 5B7EA 5JORB 4Y4FC 5BZZA 3WLBB 3NTCH 4A2LA 4P3WA 2IQAB 1KTKE 1W72L 4H0LC 2YGQA 1RP8A 3FB5B 1J0JA 2PCFB 3MCLL 3UABA 1EXGA 4XOBA 4ZS7L 4G7RB 1KYAA 3EH2A 3HHMA 3LS5L 3WFBL 3SYQA 1IBYA 4QPEA 4LLQA 4HHAB 4CL7A 4HGKC 3ZQWA 3GI9H 4R90L 2VQUA 3WV0A 3NRQA 5HGHA 1NH6A 3SO3C 2RHEA 2HTLC 1WA1X 3H7BA 2VDQB 1DBBH 2C9QA 2GB2A 3AMLA 4ZAKD 1X9LA 4AY0A 5DC0A 4RA0C 4QRPD 3NQKA 2EDWA 2MCAA 2C3GA 2WKGA 3T0DA 1SZNA 3MLXH 1DN0A 1Q9KA 1Z9OA 3I02B 5EU4B 4DKEH 4XC1L 1JZFA 4JDTL 4Z7VF 1XCTA 2OTWB 1C5CH 3BUBA 1G6RH 3W39B 1MEXH 3ARTA 5F7DA 3TPUA 5C0IB 3F7KA 4JJHA 5GGUB 2BY2A 1DQML 3BT2L 3FT2B 5C7XH 4U1GC 4GRLA 3QNXB 2W0FA 3V0WH 4FKEA 4FFYH 4F37F 5E6IA 2UZYB 5GRYA 4U0QB 4P4KD 5KYUA 4DERA 4EMZA 4L3CA 5GRUH 5IUSA 2VO8A 4HPYH 4N5UA 3O11A 4ZOCA 4LEXL 5F7MC 1YYLH 4R5VA 4MCZA 3TIDA 1S7SB 5DJDA 4IJ3B 5F70A 2DS4A 3BAEL 4LLWB 1I3UA 2ZAHA 2PR4L 4BZ1A 1AHWB 3Q2LA 1A8JH 1RZFL 5I8EB 4F1SA 5GRVL 1N19A 5E1AA 1ZRUA 1E7UA 1KPVB 3FMGH 3B37A 3MACL 3P0VL 3K91A 5D1XA 1PDKA 2VSKB 3UBHA 1D5BB 2CKBB 1NWPA 3VD9A 2MCG1 5CJ8A 3HR6A 1XF3B 2GIYA 3U0WH 1CICD 1EJOL 5T3XH 3VWJD 1JWUB 3MUGB 3HJ0A 4NO2A 1BXVA 1F1DA 4TTDC 1JPTH 1U3HC 3DVNB 4KROC 4LLAA 4OZGE 3U9UB 4JM2D 3TL5A 1NOFA 3PGDA 2WYZA 2YD7A 4EDWH 5EUKB 1UWXH 1EEUA 1XL6A 1MCLA 1OCOB 1T2JA 4EXPX 2H3XC 4HWEL 1F4HA 3ULVF 1CG9A 4NNYA 1CFNA 1PZ3A 2AS5M 2I60H 5IJVB 3KWTA 4X7TB 2CDEA 2WKOA 1HSBA 4C59B 4UTAA 3E8VA 4JM0A 4QOKB 4M6NL 1X5GA 2FX9L 3PGCA 3H0TB 5I1DB 1FLRL 3UAJC 1XXDC 1F42A 3CNKA 4GYBA 1E5CA 4WTQA 2FO8A 3Q8AA 4C4KO 1AFVH 3Q3GB 2F58H 5E0FA 3TFBA 5IEHA 4AQOA 3U4BH 5LBSA 3NYKA 4L0PB 4H1LG 2AJZB 1MWAH 1C7SA 5EOCJ 4FS0A 4PJCE 1L0QA 1B4LA 3FUNA 3FQWB 4JHWH 4U0RB 1WFIA 1JNNL 3M17A 4TLKA 5EU6E 1EHLL 4BGDA 3GIVB 1W8OA 4B9YA 1Q4NX 4FQXC 3KR3L 1J0HA 1R3IL 2H9GB 4JCLA 2PPDA 5CLYA 4AEEA 5FHAH 4D94A 3IF1B 3BEWB 4JGJA 3GLAA 1NBVH 3QXDB 4BCYA 5E56A 1D5ZB 2OJ1A 3ISRA 1VFAB 4PN6A 4HGWB 1HHGA 1SFHA 2JELH 1N2RB 3QCTL 4HK0B 4K2UH 1GXEA 1BEXA 3LPOA 4I5BB 4JPWL 3E8UH 2AQNA 1IC5H 1KCRH 1GS7A 1YDPB 1R3LB 3P0GB 5DFVC 1FNHA 4KV5E 1XR8B 1I8LC 4FTVE 4LCCA 3V7AE 1CDUA 4AYFA 4K9JA 1KIQB 3AG3B 4ONFH 4WWKD 3W0WD 4OSUL 4M93B 3N91A 1MHPH 3E7JA 3HC4H 4R0LC 3SDDB 3V0VA 2VKWA 2ZCKL 3CH1A 5FOBA 4K7PH 2XTJC 4OZIB 3SKOB 3HBGA 3UOAB 1CLOH 1ZIAA 5B21A 3TN0B 4UT9A 4PJXE 3WIAA 4EN3C 1MREL 1WBZA 1XEDA 2X7LB 5KANG 3AABA 5FGSA 3C6SA 4AM0Q 4ORGB 3O0RL 1R6VA 1UATA 4GUQA 4Z7IA 1S3KL 5MERB 2X28A 1OE2A 3TBBA 5IB4B 1RZJH 4KZDH 4L4TB 4F2FA 3W2DL 4AYSA 5E8OA 5LDSA 3HG4A 4NQSA 4F91B 2AEIT 1WFNA 2VNCA 4DUXA 1XZ0B 3DUUA 3QORC 1EXHA 3PL6C 4PRHD 4YFLI 5IMLB 3FSWA 3CN4A 5F7FA 3IDXH 2XLLA 1YY8B 5D2LB 4PGCB 3FTXA 3CLFH 4DKFH 2VW7A 3ZDYE 1FG2A 5AVZB 4P2QD 2XPGB 1PZUB 1KBKA 2AQTA 4PSPA 1OP3H 5ALCL 2TRHA 4ZMYA 2Q8AH 3V6OC 4D8PA 1FAKT 4XBPB 5C09E 1SMDA 1GGTA 5DZOA 4ELMA 5JIDA 2YPVL 2ICWB 4N9OB 3WFDH 1IKFH 2DY2A 2G9KA 4BSWB 4FHJA 1JAEA 3GSNA 3Q06A 3FO9B 2XJLA 4URTB 1I7UB 5FC9A 3INUL 2CA3A 5C2UB 1KGJA 4BHUI 4XCYB 1FZMB 5GRXG 1KCSH 4K9EC 4NXKA 1CDBA 3ARFA 3BMVA 4KJYB 4DESA 1EZVX 3CBRA 5L4JA 1DQJA 1K8IB 2FYVA 3AU1A 3FAWA 3U4EA 3VFMB 4L8SB 5TQ0H 4X6FA 3HPJA 1A6VL 3GMMA 2NW3A 1NCCL 3AB0B 4O2EB 1JN6A 5D1ZI 1J8HA 2DQHH 3ABKB 4GXFA 3UZEA 5JMRA 1OAXL 2YEZB 4PYHA 2CM6A 1UOLA 3NJFA 4AYMC 4ADJA 5BRPA 4Y5XB 4BD4A 2R39A 4PJ9C 1Z32X 3ARXA 3PABB 1HH6A 4PSRA 3BOVA 3GMLA 1C16B 2RACA 4Y1AB 1HH9B 4N1HB 1T0OA 3EDEA 4EZLA 2J8UB 5I75C 3IAGC 2ZF8A 3A67L 3L1OL 3P0YH 4IHOB 1S9KC 3DMMA 3OAZK 3KXFA 3VGAC 3GINA 1QSED 1SBSH 1T0NB 3OBAA 1WS8A 1E6OH 3GJEB 4NBYB 4PRIB 5CP3A 1NPJA 5IBUG 1MJ7L 3BLBA 4O02B 3BP5A 2IGFL 4MDJA 4Q14A 2Y5TA 3VFRA 1NFIB 2Q3ZA 4FZ8L 3UTPE 4U1LB 2CBQA 3CTTA 1INQA 3O4LE 3WEMA 2Z0BA 3P9MB 3VSQA 5IBLD 4LAQL 2VR4A 3WL9B 2GEQA 1NMBH 5I16B 1NDMA 2P5EE 3D3VB 2IAMA 3ZZSA 4MMXC 4PJFA 5J11C 1KIRB 4E9RA 2XOTA 3AZUA 1BM3H 1AANA 5AKVA 1SN0A 2AJYH 5TDPB 2BNQB 2R4SL 1QYGL 3G6JA 5I19H 1I85A 1KZYA 2VLJB 1DBJH 1GW0A 1ZT4B 1Q0XL 3FB7B 5AVSB 1J86A 2ZCLL 4OZHA 5F7HA 1A0QH 2JK5B 4FRWA 3V0HA 1MJUL 1KEML 2X4SB 3BE1H 3SGJC 3AM8C 4LZKA 3MMEA 2BFVH 2ZQKA 4Z18A 2XG4B 1AHMA 1BWWA 5ANMA 4RA3A 2BCKA 4I9WD 4O5LL 3ZW3A 4PJEA 2WKOF 5ITBH 4DHLA 4MQXD 4Q6IB 2VITB 2J1WA 2MPAH 2X4NA 4DEPB 4JKMA 1HZHH 5DD1L 4PIBA 4EEEA 3CHRA 2XBDA 2NSQA 4EZKA 4YLCA 4XZUB 2DKUA 5AG8A 4KRPB 5JPNC 2ITDA 2DQJL 4J8QA 1AXTH 3QRLA 2XJKA 2EXTA 5BVJB 2NYKA 2B5IB 3CFEA 1LL1A 5GS0H 3DGGB 4QLWA 4M61B 2W60A 1AXSA 4Z3JA 1UOWA 1TCRB 5BVPL 3WTTA 1FO0L 2EDLA 2NY2D 1V3MA 2P80A 3BSZH 4JRLA 3EYVB 2AK4E 1BQLL 2DYSB 1I9RL 4Y19D 4OD3H 5DT1L 3OMAB 4MAYA 3UC0L 3MRBA 1I3RB 5D70L 5JHAA 3LVTA 3CFCH 2G75A 4NN7B 3NAAH 1WEJH 5F7NC 1D5XB 3ZTCC 3EYSL 3P02A 4N2BA 3VD7A 3EXLA 4RIRA 3ZVVA 4N2IA 4E9XA 2R0KL 4H1LA 4ZW3A 4LSUH 2X4OA 4HMDA 3LH2L 4PUBL 1XSOA 5EO1B 4I8DA 1E5UI 3UYRL 5IQ9B 2ZG2A 5KSBA 3NJVA 4JGUA 4CADB 1OTTD 1SJEB 4GW5A 4MVBD 1E27A 1I8AA 5GHWL 4CVXB 4A1RA 2QVIA 3ZR6A 5T1DL 2IWGA 3VM7A 1TZGL 1U58A 2WCPA 1RSYA 4KDTA 4L2LA 5I1IL 1QSVA 4X5RA 4MCMA 3TA3C 5DHYB 5CIPA 1MI5D 4MXVF 2ZWKA 2BOCA 2X2HA 1KJ2A 4XNAA 3VXUE 3I3DA 1GS8A 4UINH 3O3UN 2FGZA 2CM5A 4WFED 4G7VL 4J4PA 2VQTA 4DGYL 4LEBA 2O6DA 4KK5D 4S11A 4XH2B 3RVTC 3UFIA 4H8PA 3F6IA 1AGBA 4LGSB 3TT3L 1KB5L 3GMOB 3KPTA 1QASA 3PAUA 4IRSC 1GMIA 3DIDA 4L3EA 4IOFC 5I6XB 1F4AA 2H6OA 4QRBA 3FU9A 2I9LA 4YDLC 2WXFA 1J88A 1Q94A 2J7LA 4I0PC 4UTBA 5E6UB 2ENJA 1FL6B 1YUKB 5TE6H 1WV7T 4TUOB 3MXVL 1EGJL 2D3JA 2ZICA 5L2KD 1NC4B 4OBSA 1I1AC 1TQCC 1BZ7B 4PRDB 4D9LH 1HOCB 2CMRH 4EKXA 5KTEH 1YEIH 3C9NB 5FKAB 1A4KA 1LWRA 1S78C 3R1GL 1ESOA 1DE4A 3WEBA 1AQKL 1WVZA 3NP4A 1E2WA 1IE4A 5I66B 4NQTA 4ELMF 2IV9A 1K4DB 3PWPD 1M4KA 3LZRA 3QRGH 4HH8A 3X12B 3MV8A 3PIQA 3QDJE 1LE9A 3MBXL 3DJ9A 2IG2L 2DMHA 3O3AA 4FQLH 5IVZB 4J3TA 1CD9B 4KRNA 2BVUA 4ETYA 1XBRA 2QLYA 2XIBA 5AOIA 4MS8D 4L1HA 1DN2A 2G2NA 1IQWH 1DLHB 1ZANL 2OI9B 1NUGA 3APCA 3S2AA 4IMKC 4RMBA 1OF2B 3HG1A 4Y2OA 4EQ3A 3QJVB 5D6DA 3QDMD 4AITA 5EPMB 4L1LA 3ULUF 1HC1A 2G0LA 2K70A 3UG4A 3QWQB 4YXLH 4ABQA 3NFNB 3IJSB 5DURB 5KVGE 3NA9H 3F5WB 2NDGA 1CYWA 3V6ZA 1IEBB 1M7DB 1WWCA 2V6HA 1M56B 4IBQA 4JRXB 4P2OB 1RIHL 1NBCA 1BWMA 1JGUL 4MJIE 3D69B 2CO3A 1MQKL 3ARDC 5F88A 5IOPA 1VFBA 1XCXA 4KXAA 4QD2E 1LEGA 3ZKQD 4WF7A 1DYZA 4NHCL 2HJKA 2Q76A 4ZFGH 2OX5A 4RAVA 2LTQC 4HJTA 5D7IA 3P4NB 3L9EA 2DD8L 3OZ9L 2WJ7A 5ESAB 3EHBD 4OGAC 4TYUA 4V1DD 1SDDB 3DOIA 5D7LD 3WE6B 1QRNE 1W0WA 2IOOA 3MV9E 3GQFA 3ARBD 4W9CC 1TNNA 3LS4H 3P9LB 4YK4B 2FE0A 4PRPB 4R4NC 4CSTA 1WFTA 2W1NA 1AP2A 4G72B 3V5DA 4N26A 1B2WL 1MIML 4JG1L 4PJFF 2WWKT 3BH9A 1A6WL 5DSCA 4JUTA 5FGRA 1F2QA 1A1OB 32C2A 4JRWA 2DIEA 4Y2DD 2BP3A 3P77B 2WZ5A 2UY7A 4G6FD 1ZT7B 5LAXA 3NEOA 4PWFA 3G5VB 5KVEL 1RPKA 3G6JF 1N9PA 3ISWA 2P46B 1U3NA 2A6KA 4UCFA 4Y9CA 3HB3C 3SPVA 4TNGA 5KYXA 5EO0B 1PD0A 1CFTB 4WI0B 5FF6A 4OZHF 2H5UA 4LVHB 5EORL 4PJDB 4P5TD 3HZYB 3HMXH 3TASA 4FLOA 4PJHA 3FQXA 3BP6B 4OGYH 3VW3H 3MNVA 1CL7L 3BAYA 5AL0A 4JFQA 3ETBJ 2EDTA 5KG9B 5LXGH 2Z64C 3QUKB 4PJEF 2X1QA 3GT6A 2CO2A 4OF6A 3M1OA 4P46B 3U83A 4OIAA 1SYVB 2JLPA 3NESA 4F80A 1YEGL 3N1QC 1MJ8H 2VJ0A 2AGJL 4W6XB 2KUTA 2CGYA 1UYWH 1I1CA 4PG2A 3RTLA 2A38A 3LKSB 3PGFL 2ZP8A 3MJ7B 3BISA 4CBZA 5F0JB 5BXFA 3IJ7A 5F0MB 1CFQA 3RLSA 3UP6A 1MW3A 2CHDA 4B9GA 8FABB 1MNNA 4XN7A 1IAIL 3NSXA 2XVBA 2KZ1B 5EBWB 1C5BH 1WIPA 2F6AA 3JV4A 1IARB 3FTUA 3KLLA 4JQIA 1CL7I 5SV4A 3UTTB 1U8PB 2YUVA 4Z0XA 5J7CC 2KZBA 1Y0LA 2IPUK 2C8NA 1RUQL 2C4FU 4Y9FA 5TJWK 1BBJA 4PRAB 1NBZB 1JK8B 2O26U 5AAWC 5T1LA 4JG5A 2JQZA 4LARH 5C0FA 1CXKA 3U9PL 5MHSE 4MXQD 5G4OA 1CTMA 4LCIH 5KBNC 4LCUA 5E6YA 6TAAA 1AKJA 3IDJA 3LKOA 1ET8A 4AYEC 4Z3FA 4WJ5A 3BIAX 1U92B 5I8KL 3KBPA 3PHSA 5B8CA 3KH3A 3DRQA 4WSGA 4XRCA 3T0VA 4OFKA 4G1MB 1TQBC 4L1TA 1MNUH 2VLRA 3FSAA 2F8IA 4HJJL 4ZFFB 5ICZA 2UYLB 5KSBF 4NQCB 5FUZH 4A6YH 1T4WA 2VZUA 3MGTA 4JZNA 4HJGB 4HIEB 1QPPA 1KXVC 2WQWA 2ETWA 4F8OA 4BDVA 3K80A 5HD8C 3F12A 3K2IA 3O8XA 4XHJD 12E8L 2FJHA 3BX7C 3OGCB 4EI5D 1R4XA 5CGBA 5D7KD 4Z7AA 2E7LC 1A3QA 2IXQB 3C6LA 4G8GA 1P5VA 2VR8A 3GHBH 3BN9D 4JDEB 4HAGA 1YJDL 1JZ3A 1OARH 1OT4A 3MRMA 5GGSA 3QIUD 3QJQB 1F56A 1FV1A 3MI6A 3R18A 2WLKA 4WFGD 5DJXA 2UWEB 1GYUA 3JZ7A 2VE6B 4FABH 3WFEH 3QXTA 8PAZA 1C12B 4XVSH 3UTQB 5FYLD 2VH5H 1QSFA 2BWQA 1OCZB 2G2RA 2NUTA 3VFWB 3SPIA 1FCCA 4XPHL 1KIPA 2DEYX 1H15B 3ZJAA 3BZFA 3KNBA 4RSVA 2F15A 1HX0A 2EE6A 4XCEA 3S98A 3VXRB 5EEWA 4MQ7B 1E67A 1QBML 1GGUA 1YUHB 1UT9A 4DQOL 4RAUB 1WK0A 2XN9A 1IIIA 4GKSB 2YSSB 4QRFA 5IKCB 4OLZL 3QI9C 4MA7L 4GKNB 4PJBA 1FORL 2HT4C 1OTUD 3JZYA 3SZ6A 3QSKB 3VFVB 1EVUA 3TJEL 2G30A 2HFFB 3SCMB 4MJ6B 3IN2A 2X4QA 3G04A 3ABZA 4UV4L 3L7FB 4HKJB 2YA2A 1GJIA 3OPUA 3VGFA 5EZJA 3IFOA 4M43H 2PTTB 3E6HA 4AQ8C 2L7JA 5FO8B 4OV5A 1PNCA 4WHDA 1AO7E 3U1SL 1OE3A 3LKPA 1HINH 4A63A 4F37K 4L4VE 3WO4B 4J2XA 4XN9A 1F3JB 3FONA 3AQYA 3KPNA 2W0LA 4JY5L 1YQVH 1NCAL 4IBUA 2RGSA 4G9FE 3IJ9A 3DARA 3K6NA 4NSKA 1EO8L 1NGPH 4F15C 2HX7A 1AZVA 5I1JL 2IH3A 3H9YA 1QO3B 2GKIA 3MRRA 4DPCX 1H5BC 1A3RL 5C0BA 3KGRA 4CJ0A 3VXSD 1CLZH 3RGVA 1HIMH 4YUEH 3P3RA 4FXKA 4WI7A 3T0EB 4K3HA 3MBWA 3CDCA 1FF5A 4UNUA 1OPGL 1UG9A 5C0CE 1AMXA 2JF1A 1HYSC 3MODL 5KW9L 3ZDXB 2JJTC 4XO8A 1OGAD 5E99H 2C1PA 2F54A 3O2WL 4MA3B 2WXOA 4KKLD 1E4HA 4UT7L 1W0VA 5A2KH 4Y5VB 3CG8A 4Z7UE 4TQEH 4WU7A 1GMEA 1HTYA 1FSKB 4LOUC 4TN9A 3SOBH 3HR5B 3W82A 4I2XB 3LPPA 2XYBA 5D7IF 4A37A 3DLQR 4JLRA 2VTFA 4PQXA 4M7ZC 5DFAA 3FS9A 1FNGB 5JR1L 3RZCA 3ZYJA 2CO6B 4M5YH 1R47A 2AJUH 3MGAA 1YPZB 2ZUYA 4PS3A 2KDGA 3CFDA 4G6AC 4YZWA 3VXOA 3FO0L 4BINA 1KLGB 1RZJC 4Q0XH 2EH7L 2CNZA 1S7RA 3MDJA 4P5KA 2JIXA 3TVMD 2BK8A 3SE8L 4R4FL 1X7SA 1KCUH 5FLUA 4AOFA 3D9AL 2ZG1A 5EUOA 1XAKA 1DVUA 1DVYA 1P7QD 2XVGA 1RCYA 4KK9D 3B9KB 3PLYA 3I6GA 5FYKH 5KYYA 2VDKB 4J3OH 4ZFOB 4N3TA 2EC9T 2VDMB 4YEFA 4I13B 1QKZH 4N0UA 1N8ZA 4FJ6A 5KYWB 3VD0A 4NN6B 3G5ZB 4HEME 5CUSH 1T2QL 3QIBD 4NKDB 4HUUB 3BQVA 3PY9A 5T1KD 3S37X 3COOA 3FO1A 4F24A 3FFCD 2EDRA 2CR3A 1U6AH 1MXGA 4KY2A 4S10A 3HBQA 4PJHF 4TSBH 5GGRY 4XOEA 5FB8B 1CXHA 1OPOA 4HIQA 3D85D 5C0AD 1KGIA 3RWFB 2QVMA 3CFJB 4AQAB 5F0LB 2XWZA 5IIEB 1MFUA 3HUJB 3WIHL 4PJAA 2ZWLT 5AYTA 4MHHI 4XO9A 3OKNA 5DA0B 4LOVA 3RVVD 4NFDA 5BZWA 4G8EB 2X6VA 2WLIA 5DC2A 3L3OB 3FH8A 1A2YA 4WY7L 4XP9L 5EIIG 1HYRC 4QY8B 4BXSV 2VIRA 3MRIB 4FERA 2JKRM 3RWGA 1O7SA 3FQNB 3R06A 2ED6A 2D0FA 3UZVB 5CZXD 4YWGL 2D9CA 1WCBA 1LP9E 1KELH 3AQDA 3EYUH 2WLYA 2LT9A 3HE7D 4PGEA 2HKFH 4QTIL 5K5YA 4TNEA 3IDIA 2BIMA 2HFGL 4NFCA 4BWUA 4E41D 5HHOA 3H2PA 4RISH 2F53A 2BDNL 3D09A 1MJJB 5FA3B 2NLJB 2WHVA 2VDKH 5CKAA 5BRZB 4IMLB 2VDMH 3OKMA 5CJQH 1BDYA 1GZPA 2FWLB 3G9VA 4IGBC 2BW4A 4G5ZL 3PREA 4NQDB 3U6RA 4KQ3H 3V9EA 1FFPB 4HIXL 4R2GD 4X5LA 4KVNH 2AJXH 3FC8A 1FVEA 2IALA 1TUPA 4M3HA 2O6PA 5IW1B 4P2AA 4FA7B 1IU1A 4U6VL 3OV6A 2PPAA 2CPCA 1RZ8B 2PYFA 1BZOA 4P07A 2RJMA 3GKWH 3OM3B 2XT1B 2FO4B 3B2DC 3VXMD 4QLRA 1YMMD 5DQJB 1FH5H 4WHYG 5I8OH 3VQ1C 2DQMA 2VDLB 4U1JA 4Y4KB 2ZX9A 1CPUA 1OK0A 3PS6A 1IAMA 1H3VA 1QPKA 2O6FA 5DQDH 4B3EA 3FFDB 1OAKL 2EKSB 5SWSA 1CBJA 4PREB 1S9YB 4BV1A 1NC2A 2EEBA 2ADFL 4Z7OE 5DJAB 1ZHKB 2NY0C 4H5SA 5LLIC 2DWYA 4WUUD 4O00A 3NOIA 4O58L 4C8XA 3GUTB 1KCVH 3UJTL 2BVEA 3E1F1 4JAMB 1DJYA 1BD2A 2BVQB 3H9SE 2W9EH 4KKCC 4WEBH 5D1ZD 2PWFA 1D5MA 5HYJE 1A7RL 1U8MA 4M1CC 5CSZB 3BQUC 4F8PA 4X7FC 2JSFA 3TBWA 2NY5L 2UX6A 1TU2A 3OKLA 3NZ8B 2OXHB 4M29A 2CHWA 1O0VA 1REIA 5J1AA 2G3NA 5GS0C 4PJBF 1EWHA 1WO2A 2Q6WA 5D72H 3O81A 4P2RB 3QO1A 4JVUA 2BIHA 4QRAA 4HBCH 4HFUL 4F7MA 2NY4C 3KPLA 4JX0A 4CN4A 3QUZA 1J0ZA 2R2CA 4RMSA 2ITCA 4Z77A 1CFSB 3I2CH 4J3WA 4WJKB 1W91A 3AG4B 4IM8A 3L5XL 1KBGH 4BQ8A 4HUVA 1DBBL 4CSPA 4F7CA 2DYPD 1NICA 3SDCA 4KMTL 1BAFH 4Y1SA 4N8VB 2UY6B 1IAOA 4GQRA 3TZVD 1OD9A 3ARUA 3ZLQC 1U8IA 2B1AH 4HX1A 3S5LB 2JB5L 2PN5A 3LIZH 2JB6A 3MLZH 3BUIA 2VDLH 5CWSB 1M2VB 4J23A 3AAZB 3V0WL 1ACCA 3ECWA 3MCYA 4FFYL 3AJ7A 5EIVA 3IGAA 2BP0B 1X7TA 2K7QA 4H8UA 1NLBL 5GRUL 4LHUG 2AERT 1GY2A 2NQDA 4K7PY 5KBLA 4KDWA 5F9OH 4APQA 2GUOB 4KHXH 2I9TA 1TVHA 1YYLL 2ATPA 1BLNB 2XWJB 3DI3B 2GSGB 4ODXB 2X9WA 4DKTA 4UILH 4B5EA 1MF2L 1UGKA 3UTSA 4AMKL 3RNKB 4AT6B 4F9PC 2FWSA 4UUJB 5EC1B 1RP9A 2IMNA 2E5EA 1DBMH 3HG5A 3L4YA 4X98A 5TDNA 2WZPA 5EFIA 4JUSA 3A4DA 1CR9H 1PZ5B 1TTAA 2QT6A 2FVNA 4YPGA 3FMGL 4LL4A 1OAYH 4PFEA 3IDYB 5DEFA 1NKGA 3FO2A 3UADA 4PMEA 4M3JA 5T3ZH 2ZKHL 3WNKA 4Z7VB 1BX2B 1NAMA 4MMYB 2IOMA 5T3XL 3ZYOA 4RVBA 1NBYA 2ZKWA 1K5NB 1FNLA 4RGMC 3TTSA 4B9PA 4JFEE 3S37H 3PAVA 1JPTL 2X88A 4XTRD 1MN4A 4Z76B 4YXKL 5ESVA 4LT7A 3CZUB 5M7QA 1ZS8A 1WSST 3H55A 5EF0A 1CF1A 3P4OB 4UOW0 4N2HA 5ACZB 4IEFA 4EDWL 4A2FA 5AZEH 1NFAA 2XZAL 3BAKA 3CZFB 3M8OL 1FIGL 1PG7L 2D7OA 4URKA 2O4EA 5EUOF 5D1QD 2VDQL 4I3RL 2LHAA 5GGVH 4DPAX 4HD9A 3WMQA 2BZ7A 1AZCA 3D5OF 1N0LA 1N5AB 4N3UA 1FAIL 4QRRE 5GS3A 2ITFA 1JYWA 4DJMA 1EJ8A 4HC1A 2DQUH 1D5RA 5SX4H 2P8LB 2DQEL 3S0PA 2Z1PA 2E7CA 1XH0A 4Y4FD 4HS3A 4YIQA 5EU7E 3ZMNA 3AGVA 1JD9A 4K73A 1U8OB 1AAJA 3L13A 4UAOC 1AC0A 3M7OA 2R9HC 3EJJX 3L5HA 4DPBX 1E5YA 1FP5A 1A3ZA 1SM3H 3UYPB 2R69L 4PJAF 3KPSB 3TH3T 1Q90A 2YD5A 3NCYP 4NOFA 1KFGA 3AREC 3VQLA 5BZDB 1T66D 1BF8A 4BQ6A 3NCEB 4LO9A 4QKXB 3R19A 5FHAL 2WQRA 4GUPB 4AJYV 3HG3A 2NR6A 4LQFL 1YCSA 3T8MA 1U8QB 4PJ8D 4X4KA 1QLEH 1NGXA 4FP8H 4PI0A 3TA4D 1XGYL 4WI2A 4JPKH 1C1EL 1YN6A 3EF4A 5HHXH 3AG2B 4JFDB 4K2UL 4I3GA 3PHAA 4XN1A 2I26N 1FPTH 5ABDE 4OZ4B 1E0OB 3E8UL 5AVXB 1IC5L 3LXCA 1X4ZA 5T3ZE 4GSDL 3VD2A 4HZLB 4BH7A 1HQ4A 5KSAB 4BSVA 4X99B 1B4JL 2UZXA 1MHPL 3HC4L 1ZVSA 3EJZC 4X0KA 3ZBMA 3BP7A 1CLOL 2GW5A 2IDCA 4YDVA 5T1MA 5F3FA 3JSSA 3T77B 4PW3A 1DQQA 3WKMH 1JPSL 1MG2C 3LN4B 3LKRA 2AJ3A 4TQ8A 1BMWA 2OJEA 1A22B 5GS1C 1UOKA 4D7BA 4K3DH 2B4CH 2NXYB 2YJLA 4K8RL 4KX8A 3HNSH 2YPKA 2PYEB 5DXWA 1JJUA 1D3CA 2EZ0D 2WTRB 1NANI 4TTDD 5KSVB 4OLYL 4HULB 2X4PB 2DLEA 4JHBA 1JZIA 5L6YL 3FU3A 1UJTA 1FI8C 3NDZE 1TF4A 3CVHA 1N5YL 5SWZD 5LWYL 2VXSL 5TF1H 1QTPA 3VXNB 4BXVA 1XF1A 1ERNA 1LJMA 1JF1A 5BCAA 4GS7B 1HT6A 5ISZB 3ARGD 3FQYA 1JERA 4J27A 2QHRH 2ICEA 3CLFL 1NUFA 4OKVB 1TIUA 5BO1L 1ZCRA 5D8JH 1D9KD 3ZR5A 3B1UA 4ODBD 3CHXA 2DZEA 5KZCB 3U82B 5IB1B 3MBED 1CD0A 3KDMB 2WQVA 2DQFA 3CX2A 5JXEA 1PU0A 4GAYA 4NM8H 2HLAA 5FPIA 3ZUCA 1KPRA 3VRIA 5DD3H 3WFDL 1IKFL 2WUBH 2P8MA 5EO9B 3RURA 2OMWB 1QQDA 2UXTA 5HJGA 1BA9A 4H8WC 3B9AA 4RFEB 1Q9WA 3MGOB 5BZXA 4M4RB 1NCDL 2A6DA 1BFOA 4FQHA 3NH7L 5MEPB 4ZXBB 2D4FA 1R9FA 3L3GB 4ZODA 2Q0ZX 1IC7L 1N3NA 1RJZA 3BWAB 3GBLA 2CGZA 4DNLA 2VN7A 4AYGA 4CNIB 2DWEB 4JJ5A 4XMWA 4BFNA 5BW7A 3CIQA 2Z91B 3D39B 3SB3A 1J1XH 2ENQA 3HRZB 3PNWB 1BZ9B 1MCNA 4X4YB 3DUHA 3GF8A 1HWGB 5DQ9B 2DQHL 3X13B 2R1WA 4GBXC 1CQKA 2PWEA 1AOHA 1EEZB 1Y18A 4Y0GA 4F2MA 5H2BA 2HKAA 2CK2A 4G82A 4ZPVA 2IDQA 4ZTPH 4ZFQA 3IMRA 1R0AH 3RIAF 1T5WA 3ZRSA 4AUUA 3ZQXA 1DANU 1IJ9A 3J8F7 3WMPA 5HI4C 1CT8B 3P0YL 4GW4A 4M7KL 2XETA 5I9QC 3L5IA 1EH9A 3QWRA 2XBZA 4FFWD 1O7DE 3RWIA 1DEEA 1N8OE 4FQ2L 2F0CA 1OGPA 1D6VH 4ETQA 2A7BA 2XTJD 2ZD0A 1I7ZA 4NAMA 5IB3A 3CZGA 2GQHA 3IS1X 2BNUA 2WV3A 5EEVA 5EZIH 4LLQB 4YVNA 5ADPH 2COQA 2WSKA 4X6EA 4EN3D 1A66A 1Z66A 2IWKA 1EJFA 3EBAA 1U8LA 4RESB 1FNEA 5HGHB 1NMBL 5I1EL 4CMHC 2H0EA 2AV7A 2JKTM 1F4YH 2FBOJ 4KTGA 4XPGL 1ZXKA 4YX2H 1DJGA 1NCWH 4NNPL 1DN0B 1Q9KB 2AJYL 5AW8B 3OSKA 1LDPH 3RX7A 3ULAB 4JFFD 1F8TL 4LK4A 2Y72A 5F7DB 5C07D 3TPUB 5CCKH 3KPRA 1VJSA 2CJTA 4KXCA 3QORD 3PL6D 4OCSH 1S6NA 1BEYL 2NXZB 4GRLB 5LDUA 2W0FB 4X6DE 2Y1VA 3ECVA 3WXWH 2H32H 2XWEA 2BFVL 3N1PC 5KYUB 4H0IA 4L3CB 1L4IA 3V4PA 4B95C 2ZPKH 3GIZH 5IOKA 1JZEA 1KTDA 2VXVH 3O11B 2RH0A 3BVXA 4HXBH 2GAZA 5ITBL 3PJLA 4E9LA 4MCZB 2WY3B 5F6IB 3TIDB 4DP0X 4TLUA 1FYTD 5DJDB 1IAKA 2ICWI 3OKDA 2E74C 2PABA 3FAXA 2QTVA 4UV7L 3NZSA 2YQGA 1NLDL 2NZ1A 5E1AB 1AXTL 3VWKA 2VR5A 3LAFA 1NMAH 3GYRA 3WKQA 3S4SB 5D1XB 2FATH 1PDKB 5JIKA 3WS3A 5ES4B 2DICA 2XRAL 3BPLC 1LD9A 5L0QB 4JGMA 4WK2B 1TQUA 4BKLA 3QQ3A 5HI5C 4NO2B 4O02L 3UAFA 3SDXA 3S97C 1AD9A 2HZHA 1VFUA 1GC1L 2RCSH 1U8HA 3PGDB 5EZOH 1A7PH 2FSEA 2YMOA 1Z7JA 3S96A 2NYYC 3CWGA 3CFCL 1J9TA 2Y7QB 4YFEA 1CG9B 1A9EA 3KYOA 4NNYB 1CFNB 2X4TA 3QUYC 1WEJL 2ITEA 3APMA 2CO4A 2WZ0A 3CLEH 2CDEB 4NM4L 3MCKA 4A7TA 1U8KB 1H3TA 1HSBB 3GZOA 4HOXA 2XN0A 4LSUL 3UBFA 1MAKA 3KLDA 4OFVA 3PGCB 1YEJL 5DZ9A 3PXLA 3U46A 1NCIA 3IWVA 4Y5YA 3TEWA 2ATAA 4L8CA 1GZHA 4ZUUA 2FNBA 5IEHB 3BD5A 5MP6H 3D2UD 3P2BA 3NJKA 1VHPA 1NCJA 4U1HA 1T7VA 4BK5A 2V5TA 3O4LB 4A7VA 3M17B 4JFOA 2EUZA 2V9UA 5H37G 3QPKA 2WLLA 4UOZA 1G7LA 1P4BH 5MI0C 4KUCF 2H6PA 1T1ZA 2B14A 4UINL 5E24E 3UJIL 1TPXB 1TENA 3N9GH 5H4YA 2W07A 4BZ1H 1UZ8A 1P4LA 5DUPL 2Q86A 2BSBA 5BS0A 4XPAL 1RL1A 3WSQH 1T04A 2D8KA 5H94A 3S2CA 1XVSA 1QUNB 1I75A 4LLYA 1BBDH 3LIUA 1TQSA 1HHGB 2X9ZA 1E8XA 3C5ZA 4U7MA 4NNXA 2ORBL 3IGUA 4ES8A 4J3OC 4FI7A 2E7MA 1Z0NA 3GLZA 2QQLH 2HG5A 2DQIH 4JRFA 1MHHB 3EH5B 4TQPA 3PDDA 1EV2E 3V5HA 1DHKA 4FNRA 5JW5A 4E36A 1S9VA 4LCCB 4AYFB 1ADWA 2QDVA 2VERN 3NPSB 3V0VB 5L2JA 4P4KA 3CH1B 5FOBB 1YEIL 5TTRA 3CFNA 1KY6A 2HX8A 3DNKA 3C5JA 4UTAH 4QXUL 3ZZ1A 2BWDA 3VI4E 1LO5A 1L9SA 4NOBA 1WBZB 5EA0H 4U1MA 3HI6L 3QQ9D 5JUEH 3B7YA 2OULB 4HSAC 2WLJA 1JV2A 4NZJA 4D9RE 3C6SB 4WVRA 2OPCA 4ZW5A 3QT2A 1CI3M 1JFQL 1P69B 4FQLL 4FG4A 5LBSH 3N5AA 4A2HA 1HCVA 4I85A 2BS9A 4IBZA 1TFPA 4OU3A 3KJ6L 4K5NA 1IGIL 1UM4L 1T2XA 4UZSA 4HK3J 3S8GB 1VAHA 1XXFC 3W38A 1WJ3A 3NGBC 1NFDA 5HP5A 1CICA 5JQIB 3VWJA 2F2HA 3X11A 5E8OB 3O6LH 4NQSB 1OCWH 1ZDQA 3OMZA 3DUUB 2XFGB 1TTUA 2HFTA 1VFOA 5D71L 1BOGA 4ZI8A 1E6JL 3SQOH 3NA9L 1O6VA 1OM3H 2P9RA 1FG2B 1GZQA 4H2CA 1E9QB 1J5HA 5CXPA 4TL4A 3B7UX 2Z8RA 3HFMH 3QXVA 5CFHA 4P23A 2AABH 2P4AB 4D8PB 4HXAL 1I1YA 5DJ6B 2WO2B 2WZ6A 1H19A 1HQRA 4ELMB 1BYNA 4NRXA 1NEZG 4I89A 1S9WA 4NXSA 2KQNA 3GM0A 3GSNB 4MMZC 1DQDH 2ZUUA 4AEIL 2XQBH 1FDLL 3S8FB 3I9IA 1ML0A 1YEHH 1A1MA 3KPMA 5E7FA 2GCYA 5MENE 3ARFB 1AZRA 3CBKB 2L3BA 5LQBH 1DQJB 4OLXL 3AU1B 2W38A 3U4EB 3VYNA 3A6BH 3WUWA 5TH2A 1ZD6A 4OLWL 4X6FB 3HPJB 4S1QH 1T3FA 4Q97A 2NW3B 3GMMB 3P40A 4JFSA 5E5LA 2VLLA 2VC2B 1JN6B 3T8VA 1J8HB 4NQED 3ILDA 1C9SA 2BHZA 3ASOB 1G9ML 2QADB 1WH0A 1IBDA 3X3FL 3WEXA 4YSDA 3CSFA 1MDAA 2BSTA 2A74A 1RKRA 3LHPH 4KO5A 3RBSA 1HH6B 5HJ3A 4I0PD 4U3CA 3RILA 1SY6L 3GMLB 3HNTH 4FCHA 3QQDA 4N2NA 5AUMA 4MS6A 3RDTA 3FHEA 2E9WA 1QSZA 2XX0A 4Y1TA 4HUXA 3VACA 3WHXB 5K9KA 3DMMB 4WO4C 3HMXL 3KXFB 1OAUH 4JE0A 5JNYA 4QXTA 4OGYL 4N25A 1NGWA 3GXPA 2EH8H 4RFOL 2V5YA 5GPRA 3L4XA 4LDLB 1CN4A 1E4KC 3BP5B 4LIQH 1WAEA 3Q8EA 4MDJB 5DHDA 3KS0J 5AVUB 2Y5TB 5EU3A 3VFRB 4DP5X 1A6ZA 4XB8A 3FCSA 4WWKA 3FT3A 3W0WA 3PHOA 1MJ8L 5F9WC 1INQB 3RVWC 4OTXL 3KZ8A 1UYWL 1GTNA 4H8QA 2Z7ZA 2HWZL 5GGQH 2DF3A 4G8IA 3NCJH 2IAMB 4XP6L 4PJFB 3T3PF 4U3XA 3FT0A 1ZGLM 3NIFF 4MNQD 5A2AA 2TSAA 3HZKA 3FN9A 3JYCA 3ZKNC 1I9JH 3S34H 3G6JB 2Y1AA 4YE0A 1P1VA 5EU7C 5F96H 3SDXF 3U4KA 1CF8H 5TE7L 4OZHB 4QRPE 4LCYA 4OGZA 3R0NA 4JE4B 5FV1L 1GVIA 1KTBA 4X8GA 4JR9L 1U93A 2BWIA 1GYWA 2EDOA 3CVIH 3MMEB 1KCWA 2V7HA 4LARL 3ULUH 3KLQA 5ANMB 1FCGA 1A9VA 2VAAA 1V3LA 2BCKB 3AU0A 2B2XL 5JW4N 2FSDA 3ZZLA 2X4NB 3ET9F 1NKOA 3K8LA 2WLHA 3HBZA 4C4KT 2YR3A 1EEQA 1BFVL 2V9RA 3PWVA 5IY5B 3N41F 5G2NA 4EZJA 5A1AA 5CP7A 5HDOA 2G4GA 4YXHH 4MAUH 2ITDB 4TSAH 1SEBA 3C8HA 2WSDA 1RUKL 3C60D 4JPSA 4XVUD 3T1FA 1MNUL 2MMXA 3CFEB 1LE5A 2AANA 2V0AA 2JJSC 4JQVA 3US1A 2W60B 1OZUA 1SHWA 1AXSB 4OGAD 4OQ1A 4FADA 3KYKL 4XN8A 4I88A 1M57B 5GSRA 3SYOA 2Y24A 5E6SB 4E9WA 5AFAA 3KYMA 2OTUA 2EVGA 1E4XH 5HYSA 1B0IA 1UEYA 2EE9A 4PLNC 3W11D 2MKLC 4R4ND 5KS9E 4MJ5A 4MAYB 3GHBL 4YHPA 3MRBB 5IHZB 1L0PA 1A3LL 1PG7W 4AMWA 3D25A 2G75B 3WD5H 5B4MC 4M5ZH 2EUVA 3ASWA 2BRQA 3HTLX 3WS6C 4FABL 4NKIH 4Z3EA 1B4RA 4XVSL 3ULSA 1R5IA 1OOAA 4RIRB 2NY3C 2FECL 2VH5L 5D7SH 5GS2D 4H1LB 3GSRA 4X7CC 3O2DL 4HLEA 3QUMB 4P06A 1XZWA 1I31A 2X4OB 3FZUC 5IROD 1D7DA 5EG6C 5I1HL 1QZNA 3O4OB 3ZL4H 2O61A 4EN2A 4PY7A 4L9LC 5EOCH 4K5OA 3K3QA 5EN3A 1UM5H 4YS4A 4QGYA 1TR7A 3Q2CA 2IFFH 3IJYA 5KSBB 5AENA 1MUJA 3O3EA 4GW5B 2DDQH 1E27B 1U8JA 2F1BA 2NX5E 3TBYA 3CX5K 4POZD 1NGZA 1U58B 1NUDA 4HIJA 5D4JA 3U2IA 4LCWA 1TSRA 4C54A 1JYVA 4EVNB 4P2CG 5CIPB 2OJZH 1U8NA 1YNKH 1UB5A 2WXMA 1HCFX 2BOCB 2VZVA 4ALAL 1KJ2B 4PTUA 4RZCA 2MQGA 2VMEA 3WNJA 2CNYA 4YE4L 2FECI 2V7NA 3X1GA 2J5LC 1IB5A 4NYLA 4JN2A 1WIOA 3G5XA 3JV5A 4WHCA 4DP2X 4M43L 4POUB 1AGBB 3BXNA 3PWNA 4XNZB 1HINL 3UG3A 3RFRA 2X70A 1TZIA 4L3EB 1UWGH 1YQVL 1ORSA 2I9LB 4XX5A 1NFDF 1Q94B 4NFBA 1XHHA 3HNVL 2PCPA 4TNVF 4HUCA 4AW4A 3GLDA 1IGJA 4FGMA 4KAQH 4LDCA 2WMPA 2EYRA 3TWCH 1AMYA 5EU6D 3KM2A 2ZOUA 1FVDA 1CLZL 4LSSH 5E7BA 2G5UA 4YUEL 5E2TH 2G5RA 2C9XA 4BE6A 4LGRB 4X6BA 5AQ0A 4G8FA 2N1KA 1TTFA 1A4KB 3RY6A 5IESL 4S1RH 2WGXA 2WP3O 1DE4B 2V5RA 3FRPG 1HAWA 4M56A 2ZNXA 4KXDA 4TQEL 4WI3A 5DZAA 1U95B 2DBJA 3MV8B 3PIQB 3VDAA 2B20A 1BCIA 3B34A 3QUXC 5I26A 3EFFA 3O3AB 1M1SA 1H8NA 1VGEH 2B4CC 4F58H 2WB1A 1KSRA 3NIGE 4FXGC 4W9GC 2MRYA 5T3XD 1EANA 4FTVD 3HE6C 3J27A 5CIPH 2M2DA 3HG1B 3O6FA 4Y2OB 4WWOA 2Z31C 1O7DC 3FTZA 1AR1B 2VM9A 1KCUL 2J43A 2FJSA 2YPLE 1BJ1J 4UNTA 3EO9L 4F7TA 1UKQA 4JFXB 3V6ZB 2WBJA 5HSFA 1QX1A 3EO0A 5FYKL 1YEFL 5DR5H 4E68A 5F1NA 5JPMA 4OJYA 1XB3A 5GGTH 3KCPA 3MLTA 4P5MA 4PRHE 4V2BA 4ZOEA 2MCMA 5F88B 5IOPB 1VFBB 2WN2A 4EAEA 1LEGB 4QRUA 2HJKB 1GCFA 2OSYA 4UTBH 1KLFA 2OX5B 3UGXA 4WW2C 4RAVB 1UWEL 3NJNA 3BGFB 4P2QE 1HE8A 5D7IB 1IGMH 2X05A 2O5ZH 4QCIB 3N42F 3FYIB 3VI3F 5CJOL 3LH8A 2AP2A 5DUML 4HH9A 1RJYA 2ZAIA 1W0WB 1MFCL 1FE8H 1JMZA 4BGLA 4PBWD 1SHXA 4XB3A 4WNSA 1JI2A 4ANXA 1AP2B 2IH1A 1SF5A 3V5DB 3T4YA 4AUJA 3BH9B 5DSCB 4JFTA 3BRGC 1F5WA 4GLRH 2ZYIA 32C2B 3DV6A 4LRNL 4OQTA 4FHKA 3S3CB 3Q9PA 5C09D 2R27A 3QPQC 2UY7B 5LAXB 1JHTA 3SE9L 5IBUB 4BQ9A 5KBPA 4ZSOA 5B39A 1A7NH 2VLKE 2A6KB 1S7QA 3SPVB 5KYXB 3ESMA 1ZSHA 3K6OA 5FF6B 4CVZA 4FYRA 1CE1H 4NQXB 4HUWA 2OYMA 1Z5LA 3IMSA 1QI3A 1KELL 3G6DL 1IM3D 1G43A 4PJHB 3FQXB 3BAIA 3MNVB 2DH3A 4B3VA 4JFQB 3LZLA 2YA1A 4XO5A 1E43A 4DF9A 1ZGLB 1HYSD 3T08A 2Z1KA 1OT1A 4AH2A 3V5KA 2VDKL 3QFJA 4ZFOL 5F1SA 1QSEE 2VDML 3FTSA 4BUHA 2H2SC