4LO9A

Human p53 core domain mutant n235k
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
194
structure length
194
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of oncogenic, suppressor and rescued p53 core-domain variants: mechanisms of mutant p53 rescue.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Cellular tumor antigen p53
total genus 46
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4lo9A00
1LJMA 1YCSA 1EAOA 4IBZA 4IBYA 2AC0A 3Q06A 2RMNA 2J6WA 3VD1A 4G82A 4XR8C 2BINA 3QYMA 5BUAA 3WTVA 4IBTA 4A63A 2J1XA 3ZMEA 4L0YA 2FEJA 3D07A 4IBSA 4AGOA 3D09A 5ECGA 4GUQA 3EXLA 1CMOA 1HU8A 2BIQA 4IBUA 3WTUA 3Q01A 2BIPA 2GEQA 5AB9A 3IGKA 2P52A 4G83A 4LO9A 2ADYA 2IOIA 5G4NA 1H9DA 1E50A 3WTTA 1KZYA 3KMDA 2OCJA 4AGLA 4AGQA 2J21A 1UOLA 1HJCA 5LAPA 4IBWA 1TUPA 2WGXA 4LOFA 3D0AA 2J1YA 1T4WA 2J1ZA 4IJTA 3WTYA 2ATAA 1GZHC 2MEJB 5AOLA 5LGYA 5G4OA 4AGNA 3EXJA 2J1WA 5AOKA 3D06A 5AOIA 3Q05A 1TSRA 3WTSA 4QO1B 4MZRA 3VD2A 1EAQA 3WTWA 2BIOA 2X0UA 2XWCA 5KBDA 4HJEA 3QYNA 2VUKA 2H1LM 4IBVA 3WU1A 1CO1A 4IBQA 2BIMA 2IOOA 1IO4C 1EANA 2YBGA 3IGLA 2AHIA 5AOJA 3KZ8A 3VD0A 5G4MA 4MZIA 3TS8A 4L0ZA 2J20A 3D08A 3D05A 5AOMA 4L18A 4KVPA 5ABAA 1HJBC 5A7BA 4LOEA 1GZHA 2IOMA 4GUOA 2XWRA 2X0WA 4AGMA 2PCXA 3WTXA 2X0VA 4AGPA 3US1A 3US0A
chains in the Genus database with same CATH superfamily
1UC6A 4JLRB 3OBAA 2F0CA 2I60H 1LDPL 4RMRA 5I1IL 3OKLB 4DEWA 3C8KA 4KJWC 5HGBB 1R34A 4XMVA 3HVDA 4PAZA 5MP6L 3V5DB 4Q9QH 3F58H 1KXVA 2OX5A 4PRPD 1B4TA 3LDBB 4B96A 4E9TA 1GGYA 4R0LB 3BH9B 3S5ZA 3TN0C 2PYED 3GHPA 4TYUA 2VLKA 1YEKH 4X83A 1AKJA 3MRJB 5IROC 3IJ9A 4U3SB 1PLBA 3EFFB 4LCIL 3J07A 1IGMH 2FL5B 3C5SB 3ZRFC 1E50A 2ICWB 3MXWH 4PGCB 4N9GA 4XBEH 5DHEA 4L23A 4WY7H 4MXVF 1CL7L 3GS0A 1OD7A 3V6OE 4G1EA 4H40A 4U0QB 5AAMA 4AIZB 5L7XL 5JHBA 1XCXA 2KBGA 1AIFA 3PAVA 5MI0C 3BWUC 3NA4A 1KCKA 2X6UA 3L3IA 1IUZA 3N44F 5LGYA 4Z76A 2IDQA 3MGTB 4ZUTA 4W9JC 2GC4C 5DD0H 1DUYB 1FPTH 2H3NA 5C6WH 1U58B 4TVSa 3OR7A 1ACXA 3RVTD 1UEYA 2VKWA 4ZXBC 4WGVB 3S88L 4NWUH 1MRCH 3GZQA 5I1GL 1DE4B 1MZZA 1RPQA 4U3HA 3BUIA 2WB7A 2OFQA 4TUOA 4B9ZA 1YQVL 3QIBC 3H3KA 3SKOB 3VXUD 3MRMA 2CIKB 5DDHB 5BZZA 5C70A 3HJEA 3F7QA 4KXZI 5KN5B 3WFZA 4PJ5A 3WHXA 1WPCA 3PP3K 4L1SA 2APXA 3RX7A 1HDMA 3OAWA 1WWBX 2Z93A 4XPGH 4Y1AB 2NY5C 4IKNA 4XNUH 4KDWA 1S3KH 5CCGE 3HC2A 1LTXA 4PRAB 3HRZC 4CJ1A 3NPZB 3G5YB 4HIIA 2NXYB 4KITB 3SPHA 5H35A 4IGBD 1JZ3A 2CRMA 2V8LA 5A3ID 1PDKB 2I9TB 5ESQB 4LSSH 5AVRB 5EORH 2NR6C 3RIAF 3TC9A 3GMLB 3P3TA 4L1TA 4YDKH 5MENB 4MYWB 5AW9B 4LU5L 4WWOA 3GNML 1S9VB 1SOSA 2XWRA 1WBXB 4LNVA 3WIFB 3FQ1A 2K1MA 4JFYB 3RJOA 1HSBA 4HLZG 5ANMB 2F2HA 3V5DA 3S7GA 1E27B 4ZW7A 4PWJA 5D5ME 2DYPA 4S1DC 1LYQA 5IIEB 1EQWA 4FLQA 2V2TB 2AQ2A 2YBRB 1MHHA 2X7LB 2Z92A 3DO3A 2UWEB 1EAPA 4HJ0D 4EKJA 1RUMH 3QXAB 3HS0A 4FDWA 4RFEA 5C0GA 3QUXB 2ICEC 5LBGA 4UTAA 2VMJA 2UZIH 2HKFH 3IB4A 1JGDA 3GGWA 1HKFA 4XGZB 5IVXF 3D07A 4FQJH 4XNDA 5I18L 4XN9A 1U42A 3U6RA 2WZAA 4ERSH 4YHIB 2PWEA 3HR5A 5CGTA 3UTPE 1MJJA 3QQXA 4CSTA 1H6FA 4GXVL 5CCKH 5JA9A 2ENPA 4ZDHB 1AS7A 3UJIH 4ZNCD 3RG1C 4KDVA 1OCRB 4DKEL 4W1TA 1O6TA 3DPDA 4E9XA 3DO7B 4K7PY 5FO9A 5E2VL 2J57A 2JKJA 5ISZD 1JVOA 2YHGA 4IGBB 4XCCH 5AW2B 1BQHG 3BPNC 3IU3B 1FHNA 1IM9D 3LNGA 4JUSA 3IKCB 2J5LB 3PWPB 4PYGA 4R97C 5JDSB 2CK0H 3W39B 4OLZH 1HQRB 1WIUA 3KPSD 4IBWA 2NZ9D 2DMHA 1VFMA 2O4EA 2Z8VC 3Q2NA 4L4VE 3D25B 3CXDH 1SDAB 2B2XL 3U2SA 4OKVA 2B8OT 1LO5B 4JY5H 4LIQL 3ZQWA 4NOBA 1S7TA 1MJJB 2EEAA 3P69A 3QCTL 1SOQA 3MRQB 1SF3A 4YSTA 5MEQA 2XFXB 4HP5A 1L9MA 2BC4A 1QASA 1WSST 3HE6D 5BOPA 3MRMB 3NCBB 3QJHB 4HFUH 4A67A 4H88L 1H15A 3RTQB 3WS3A 1URLA 4XE0A 1KJMB 4KKBD 2ZXDA 1BVNT 4NQCD 5HXMA 1DVZA 4ZX4A 1DN0A 3KYMA 1RK0A 4NWTH 4NYLA 2BSCA 2IXQA 1R0AL 4P59H 5T1KD 2Q7YA 5I19L 4MQXD 4XP5H 4XNUL 5LN4A 3RIAK 1NCAH 4NO0A 4PG9B 4OM0H 3ECVA 4GI9A 2RIKA 4QHLB 5ESQA 1NWPA 1WAAE 5IQ9A 4CDHA 3MHZA 5DUPL 3A6OA 4ETQA 2CMRL 1I8LA 1AO7A 2Q20A 3TS8A 3UTSA 4OZIA 3IMBA 4J8QA 1MCEA 4MCZB 2ZSWA 1A6PA 3AREA 4ORZC 1IM3D 4XBPB 5F9OH 4AYDC 2TSBA 15C8L 2V7NB 4OLWL 5J1TC 3WJLA 3GKWL 1Z9SA 1ZVSA 4G6KH 2O6PA 1P7QA 1RPKA 1Z9NA 2RCSL 4YFDB 3US1A 3V4PB 3BZEB 4N28A 2FLBT 4YQXH 5D72L 4NZUL 4B9CA 4E42A 4EN3D 3ZHNA 3VD1A 2HH0H 4MD4A 3ULUE 2AEIT 4M8RA 3ARZA 4P59L 4EJ1C 5I16A 4X5XA 5FGCE 4OF3A 4RA0C 4YZFF 1F2XK 4R7VA 2HKHH 4FABL 4KQ4L 1T2JA 5I0XA 5IP4A 3HLAA 3TASA 2XQYA 1PZ5A 5GS1A 4G9DA 2MHAB 4D9QD 2R4SL 2VMFA 3OGCA 4JL1A 5CLXA 2J73A 3QEHA 1U3HD 2ZWNA 4FFYH 1AO7D 4AEHL 2CMRH 4KFZC 2CA4A 2N01B 1XB6A 5JUEH 2Q9OA 4B9YA 2ATPA 2H32A 2WWOA 4Q0XH 1IAIM 3CHSA 1GXEA 4GW1B 1XWVA 4WEEA 1F6LL 3LKSA 5FGSA 3LKRA 2IANA 2B1HL 3K2MC 3SCMC 4KTDH 2EC9T 2BNRB 1U8IA 4RDQF 3S5LB 3SBPA 2OR9L 1A0QL 4BKLA 5A40E 1U92B 1AGCA 1A7QH 3CG8A 1EHXA 3BP4B 1X7TA 3P0VL 4HUXA 3CFDB 1A4BA 4MAYC 4NOFA 1EK3A 1UHVA 4Y88A 1FFNB 2B14A 4P9HL 4JDEB 1FAKT 4UIKH 4JFFE 4Y16D 3T2PA 4V11A 1T0NB 2WLKA 3ARWA 4X9GA 3TIEA 1TVBA 4HUMB 4JBSA 4WNQA 1CLVA 1SUJA 4HKZA 4HC1L 4P2RE 3N0PB 2IQ9H 4NNYB 5L0QB 1K5WA 1XD0A 2DH2A 3FHAA 4DT2A 1MI5D 4MXVE 4OM0L 2DV6A 1SFHA 1VIWA 3CDYA 3QIBD 1MCPL 5DO2C 2NY4D 3IK2A 4WSGA 1AO7B 2YBGA 1OCOB 2IV9A 3C8HA 2HMID 1S7SA 2JIXB 4PVMA 2IQAA 4F27A 1KIUB 1JNNL 3CFJB 4DGYL 2AHIA 2PPEA 3GXPA 3BP4A 1G0DA 3JWDL 3WHE1 3ELAT 4JPQA 2ICWI 5GXBB 1OQXA 4NENA 4O51A 1PX8A 1Y1DA 3QQNA 4PHZA 4QXTA 2Z31C 4NKIL 3JWNG 1KGYE 2WVSA 1SYVB 3JVFC 1ETJA 3CE1A 2AEWA 1GGCH 1TJHH 2V5TA 3AY2A 4Y2LA 3TBTB 2D9CA 5TE6L 2E9GA 1S7SB 4HJJH 2AV7B 4EI5C 5E6SB 1ET7A 5IQLA 4U1KB 4NHCL 4HWEH 5A1AA 5E0FA 4TULH 5FYKD 3FTGA 3UBGA 2A83B 5LUMA 4EUPA 1KJ2H 1M2VA 4HIQA 1M71B 3RDJA 2E7LA 4YXHH 2H9GB 2OMUB 2VMCA 3A4AA 4XNXL 3WTVA 4JVUA 1LK3H 4A7SA 4H8WL 3RWJB 1QUNA 3WKPA 1KTBA 1YJDL 3W5NA 5FGCB 1N7ML 1NOFA 3IJHA 1IGIH 3M8OH 4Y4FC 4BGLA 3LEYL 3B9KB 1EJ6A 3L4XA 3MRGB 4NQDA 2AK4B 1H3GA 1AHKA 3GUFA 4F33B 3SOTA 4PJHE 5MEPA 4N26A 3F7PC 2YPVA 1FVDB 3N50A 4J3OC 6CGTA 1MY7A 3CFCH 4PJHA 5LCVA 5AUMB 5CM1A 2C3VA 1O6SA 3L8QA 4PB0H 3VFOB 4J5VA 1MFEH 4NXKA 4DKFH 3QFJA 4M9OA 2A1WH 3HS8A 2X10A 4PV8A 3NESA 4IJTA 4I5BB 1BD2D 1GKEA 2F53A 3P4NB 2CCVA 1EXUB 4BEIA 5ABZA 2IAAC 4J3WA 3CN4A 4K9JA 3WNIA 3GI9L 4EKXA 4L37A 1R3KA 1JZ7A 2YSSB 2VSMB 3WO4B 4U05A 3OMNB 4IHOB 4UQ3B 3FONB 2IG2H 2IH3A 1UFGA 4HJSA 2VYRE 3EGSA 2EVIA 1D5MB 5JW4M 2XWBB 3EDJA 3LZFL 4TRPL 3GZKA 4KPHL 3SEPA 5DUJA 4RGMC 1MIEH 2DWEA 3FN0H 4XNYH 3W9DA 2GAZA 1TFHA 4N25A 2QZ5A 2VXQH 1JRHI 1C7SA 4JFDE 3Q0HA 4PGBA 1L5GB 3EJPA 3X12B 4M56A 1IAII 2YEZB 3MV11 2VJ8A 2YFNA 3QUYD 4OCLC 2YQBA 3VD5A 2FJHA 3D08A 3Q8FA 3X1GA 1Q1JL 4LSQH 4XI5D 4EE2A 4JKLA 3NP4A 4X6EA 4YSCA 3K2KA 1S8DB 2Q7AA 4HD9A 5IK3A 3VAEA 1XHHA 3JTTA 3TFKC 3TZVD 3IS0X 5D7IB 1AD0A 5FO8B 4GKZB 1NCCL 4GKLA 3CFQA 4ZO8A 2WJ5A 1OT1A 4BFRA 5FUZH 2DIAA 1RURL 1FAIH 1TTRA 2WP3T 1D7FA 2G5BA 3D6GA 5E6YA 1U6AH 5E4AA 4IBZA 2RBLA 3QZWA 3QFDB 1D9KA 4K7PL 1QKZL 3FU9A 4W9CC 1QO3A 3ZDZE 5JXAL 3BAJA 2JELH 3BKML 5ITFB 3VE0A 1M4KA 1CPUA 3JZ7A 4J4PA 2KLRA 3B8YA 3FN3A 3PDGA 3KNBB 4HXBH 5C3LD 3P0YL 3ZDXF 4AL8L 1UACL 1Z7JA 1OAKH 1D7CA 4XVSH 1NFDE 5CSBA 1WH0A 4OD1L 4UM9D 2D7TL 3SBWC 3L7EB 3K91A 5FO8A 4MSWB 2FB4H 4OD1H 1JGEB 1JF6A 1MFBL 3BVUA 4OF7A 5F2FA 3SQBA 5GS0D 3KYAA 3MU3A 4LO9A 1RLWA 1F56A 2XN9D 3HPJA 4QT5B 2Q1EA 4HAFA 3G04A 4B50A 3P11H 4NJ9L 1ZSHA 4UIMA 2OX5B 4O5LH 4E41D 2A9ML 3PGCA 1UENA 1T2XA 1UM5H 2ESVB 3UO1L 3FSWA 1MCWM 1K6QL 2DJUA 4LL9A 5IEKA 1E90A 3D2UA 5DJXB 2EP6A 4NT6A 1HEZA 3LRLA 1OGPA 3MA9L 3PWVB 1JPEA 4NKQB 3KDPB 4RAVA 2BP8B 4AKOA 4C4BA 2Z9TA 5IW6A 1GYVA 1QR4A 3PNRB 3SPJA 5AAPA 2CXGA 3BZ4B 3JWDC 3DJ9A 4LDLB 5C0FB 1MCQA 2Q10A 1CT8B 1K8IB 3WNMA 4PGCA 1U3ZA 4NDMA 4BXVA 1J0KA 5FECA 4DIXA 4Q56A 3PYCA 5KBDA 4FQHB 1X5IA 3UO8B 2D2OA 4AV5A 4P5MB 4TNVK 1Z9OA 1M1XA 4PJAA 4I48A 1IC5H 5K9JL 4UT6L 4GBXD 1LO4H 5ILTL 1USQA 4UQ9A 2CUIA 1FL6B 1MCBA 4YL4A 2LLNA 2X05A 2JFCA 1LM8V 1NLBH 3FCSA 3T4AB 1BVNP 4NQSA 1DBJH 1S8DA 4OIIH 4HU8A 1UH4A 2OTWA 4HUWB 5T1DL 1N26A 3WIHA 2BVYA 3VD0A 1KCBA 3S3BB 1A9BB 2CGRL 2BW4A 1UEMA 2A0LD 1OB1B 3M7FB 7PCYA 2E9IA 3OJVC 3EJJX 5L2JA 3D69A 2CKBL 5C0IB 4DK3A 3UYRL 3BP6B 4LGPB 4QOKB 5E8NB 3MLRL 2VDOH 4PG2A 4NRYA 2WBKA 3VVVA 1B0WA 5K69A 1JWUA 2A6JA 3DIFB 4M3HA 2P5EE 1I85A 1AYOA 1S7VB 2FSEA 1TQCB 3B43A 4L8SA 5DS2A 3VMOA 3UTQB 3FFCE 5DYOB 3TNNA 4XAWL 5I66A 2XBZA 2XA3A 3BE1H 3LOWA 4NAMA 5GSRA 3IWUA 5KBMA 1YAZA 3EFOB 3AQXA 2LU3A 2OMVA 1R5VB 5L9DL 1ZA3A 1OTSD 5T3ZL 3P30H 3L3GB 4PVLA 2JK5B 1RI8A 2WC7A 4WAFA 1RUPL 2JJVA 4NZDA 3WS6A 4A63A 1TYRA 2P47B 5JHDD 2YRPA 1S7XA 1JL8A 3R7RA 2K8MA 3X13A 1TF4A 3T4YA 1N8ZA 1PKQB 4ODSH 2BIQA 4W6XB 2A9NH 3EYFB 3QA3B 1IM9A 4HFWB 4I87A 3T1FA 5CSGA 4UWQB 4ZQKA 5GRXG 4YLBA 4ZW8A 2P5PA 5I1HH 2IAMD 4H5SA 2JTYA 2OP4H 2PP9A 2FEDC 3IRCA 5T5NG 4FXKC 1F4WH 4HHGA 2QV2A 2AJ3B 2J8OA 1G1OA 1A3ZA 1CGXA 1HOEA 1GYCA 5ENWA 3TA4D 5FYLD 1WK0A 4GUCA 4UYQA 5BQ7A 5FWQA 4QTHB 3MLPA 3SY0A 4PFEA 2WXGA 4JO3H 3G5VA 1RJZA 4L4VB 3SYAA 5IMKB 3IXTA 2I5YL 1IM9B 4PJDB 1JPFB 3GSNA 1OSZB 1N5AA 4JRYA 2H3XC 3VWKB 4AQ1A 1KLUA 3CU1A 1IEBA 3EBGA 2GB2A 2WN3A 4PJDF 3TBSA 4UINH 5GQBA 4GPVA 4IRSB 3T1WA 1W2KT 3UJTH 2XCMC 4Y4KB 2VUKA 3O9WB 5F9WB 5AKRA 3CFUA 1NGYA 2DMCA 3FRUA 4I3RH 3LQZB 3DXAA 4J3SA 3WN6A 2WSDA 5AQ0A 2H6PB 2J25A 3ECQA 4GMTH 2R15A 4XP6L 4UAOC 3RGVB 4UDUA 4GT7A 4FCAA 4AKQA 1IARB 5E23A 1FLRH 1UFUA 2BOLA 2EECA 8PAZA 4YDJB 2AKRA 3DGGB 1NGPH 3DMMA 2NLJB 3QO0A 2RFXA 5AWNH 4HSAC 4ZNEA 5F96L 2WYTA 1I1AA 2ED8A 4Z9KB 3QXWA 2BY0A 5HYJD 4GAGL 1JHTA 3DPBA 4N20A 1KXQE 1HEJC 4PJBA 2GK0B 3QPQC 3L1OL 4ZMLA 3IFOB 4NP9A 4HJTA 3CK0L 4F57H 1KCVL 4U7SA 1IGJB 4QKXB 2MNWA 3VXPA 1D2PA 2JK5A 1GW6A 4CN6A 5I1DA 2RHEA 3BEVA 4K3JL 1WG3A 4TSBH 5GJSL 1A9VA 3F7RA 5ISZA 3LZPA 2PXYD 4DO6A 1HK6A 1GHFH 5GJSH 4X4MA 4Y7OC 1B6DA 2X40A 1TYEB 3DMMB 4X7SH 3WFHB 4Z5RB 1ZLWH 1EIBA 3P3RA 1LMIA 3JV6B 4GG6B 4CDGC 3PQYA 4U31A 1NUDA 3HOGA 5FGBA 1Y1UA 1P4LA 4GQRA 1BZQK 3UZVB 3IDNB 4EIZC 1CLZH 1ZE3H 1XH0A 1NBVL 1CG9B 1HEHC 3KPPB 1HINH 1DCEA 2P42B 2X3AA 3QCUH 1TZHB 1D5RA 1YLBB 2IF7A 2JB6A 4MA7L 3V6OA 4BFIB 1BXUA 3B2XA 3Q6GL 2JI2A 3PP3H 3LY6A 3POCA 4L8DA 4JKPH 3WMQA 3MRGA 1FO0H 1L9RA 1EHNA 2HX9A 4PCYA 1N10A 1F6AB 2YPKB 3F7KA 3W57A 1GJWA 2D0FA 2P7TB 4G8AC 1QPKA 5K5YA 4LCUB 3IFPA 4X5PA 1JTPA 1AC6A 2VH5L 3VGGA 4NQTA 4P46C 3K1KC 1U4FA 3VFUB 2GI7A 2Z65C 5MHSE 2G2RB 2HB0A 2X4SB 4NN6C 1R0AH 5JW3H 1E30A 4I18C 1W80A 1MKFA 4HS6A 4JO2H 4KNSA 3DVGA 3S48A 3VG9B 1EEZA 4QAWA 4G7QB 3H9ZA 1WFIA 2AGJH 5G4OA 2PXYB 3L3HA 4XOBA 5TH2B 1NCUA 4P3WA 2ZQKA 5GS1C 2W65B 5CBEB 1HH6A 2VW7A 4PLKC 4HUVB 1SHXA 4DGYH 1J8KA 5DZJA 2HPOA 4OQTH 1YYLH 3KD4A 3SCMB 4KX8A 4X5LA 4LEBA 1O7VA 5F0MB 4F20A 1WV7T 5ICYA 3VMPA 1RUML 1U93B 2VR8A 4BKLB 1FO0L 2WXOA 2NLJA 3QO0B 1LEKB 4L3CA 4APXA 4HF5H 1EJOH 1HAWA 1QTYT 1QI4A 3H3PH 2HSIA 4NCC2 4WO4C 5HHOD 4GO9A 4Y16B 1SXNA 3AGVA 4HA1A 5DJ2A 1OP3H 3MLUL 3GMOA 1RUAH 2PXYA 1A6TB 1T2QL 3BT2L 3DDFA 4YGVB 5DRNB 5E2VH 5LWYH 1OARL 2KZWA 3RTQC 3KCPA 5IEHB 3C8KB 5HHOE 3MLZH 3TF4A 3NACL 5KSAD 1IBGH 5EOCJ 4M48H 3ET9F 1OSEA 3TNMB 3JWOC 4LARH 1KFAL 4UT9A 2JKIS 3C8DA 5EUOF 3RTLA 3KR3L 3KYOA 1WA1X 4X8JA 5E03A 3GSWB 5CD3B 4E9LA 1N3NA 4UOW1 2B16A 4JY5L 5E1GA 3FFDB 1AGEA 1QTPA 5HY9A 3UTZA 5IB1A 3L3KB 4IRJA 5I0ZA 4PREA 4IBYA 3NIDB 3V79C 4G6KL 1CDHA 1ZVYA 4ES9A 4P49A 9CGTA 5DFTA 2XYBA 1V3MA 3N5AA 5DRZB 3OKOB 1MNNA 2DIBA 3LV3A 1JGLH 1NBVH 1BYOA 4KBPA 5EEUA 1EMTH 3WNJA 3B3IB 3GIVA 1R3IH 2BSSB 4U33A 1E9PA 5GZOA 4KNQA 3OHXB 5I8OL 3NH7H 1KEML 2MQ3A 5DR5L 2YMXL 4QO1A 3L3IB 5FKPB 4WTQA 3ZXAC 4HIHA 3FB5A 2V2WA 3LKQA 4OLXL 3TEXA 2KQMA 3M1CA 1DQQA 4L29B 3REVA 4J6RH 1FL3A 5D7KD 1QBBA 3L17A 4XXDB 4JHZA 3UAJD 4CVWA 1ZWIB 2F8IA 3ZGHA 4H0IA 4AZUA 1RAMA 2E47A 1LILA 3QB7C 1B3IA 3V0IA 4MA8L 4EVNB 2NY6C 1N7MH 4PWHA 3O6LL 1YEIL 4L2LA 4CJ0A 1AZVA 3A47A 2HRHA 2CIKA 2VDNB 5DDHA 2ZPKL 3UEZA 4DEUA 3B9KA 4Y5YC 1MVUA 4NO2B 4KZEL 4HJ0C 3MBEA 4FFZA 1WEJH 1F90L 2DQFA 4AT6B 2EDFA 5DD5H 1RZ8A 4GRLD 3MNWA 2X9XA 4AMWA 3CSTA 2M8XA 1UURA 2CZNA 4GI8A 3F7LA 4TVPE 5BZDA 2ISDA 4JFHE 1HYSC 2UZXA 3OLEA 4QRRA 1ZWIA 5E8PA 5JLZB 2LGNA 3I74A 3O2VL 1SJEA 1AXIB 1GGIH 4UDTA 3EH1A 4QJ3B 5JHAA 4LKXA 4UQ2B 1HHIA 2R0WL 1T5WA 3FHEA 4KZDH 5FHAL 2PWHA 2YK1H 3QDJE 5DR5H 4HPYL 1CFVL 5FOBB 3HNSL 4WJ5B 3JWNE 3KCPB 4OQ1A 5IEHA 1PAMA 3GBEA 1PJ9A 4Y2DC 4DP4X 1M57B 1YEEL 4YVNA 2TSAA 4QRRD 3HLAB 4NQDE 1Q94A 2F19L 3KS0J 2F7IA 2XVBA 1RUQL 2BVPB 1CFNB 3BGMB 1WAPA 2CO4A 4G6MH 1P4UA 4ZUVA 5K1NA 3IGFA 4B9JA 2X7LA 2J2ZB 4JFDB 1KJVA 5HHQA 3CZGA 4CN4A 3QJTB 2Z0UA 3B2UD 4UM8B 4P3DB 1QRND 3Q9PA 5C0AD 4H4NA 2AVGA 2QELA 5A2KH 5IB1B 4HAKA 1PY9A 5A2BA 2E46A 1MFAH 4I4WA 5JW5B 5IVNA 2G60L 5T1MA 4BBWA 3TWCL 5DD6B 1AHWB 5FOBA 1WC7B 3TT3L 3AVEA 5MI0B 5SWZE 1V5JA 3BJLA 4FULA 2DWTA 4JPWL 3ULSA 4F58L 4HYTB 3R0NA 3BN9D 5D9SA 2DQHL 4L3EB 2CJUH 3RI5K 4BD4A 3RWDB 4CU7A 2DQHH 1EHAA 4G59C 4L05A 3N0AA 1DDHB 1AY1H 1OAQL 4CMMA 4XB8A 3NFPB 2YXMA 4G1EB 2VDPB 1ZV9A 1PIGA 4LHUA 4ABVA 2YPLA 5AALA 3V0HA 2V5MA 3DRQB 1VZGA 3FULA 3FU6A 4JFEB 5CSZA 1HNYA 4S1RL 2WYIA 1TETH 4I4WB 1JYVA 4FQQA 1BQSA 1IAIH 1A7NH 1RKRA 3DX9B 3MUZ1 1F45A 2YAEA 4TQPA 4G43A 1WRFA 2FLMA 3BGFB 4QLRA 4YXLH 4FFYL 1UXWA 4TQHA 2I24N 1UWGL 4TMPA 1JGUL 3S5LG 2G5UA 2MCPH 4M1GL 1YEHL 2C7UA 5AW3B 3ZTNL 1P5UB 2FTAA 4LMQI 1C16A 3THMH 1ZT4B 1KCSH 3BSGA 4EZMA 1JV2A 2JCCE 5D1QE 4F8LA 1RMFL 2LV4A 3G5WA 1JPGB 5JHDA 2TRHA 3G6JE 3HKZA 2Y5TB 3ILEA 3POHA 3UPAA 4RAUA 4OSUL 4E5XA 2HWZH 4QUOA 4EIBA 3FQTB 1LWHA 1KF9B 3HUJA 3HJ0A 1TIUA 5ALBL 1AZUA 4LL1A 1AQHA 1WT5A 5F7NC 3ZHKA 1UWXH 4OIIL 3WTSA 1TVHB 2AQTA 1KCRH 5H8DA 3PIQA 2BSED 1A7RH 2P5ED 1HYRC 3G5XA 3ZE1E 5DEZA 1PDKA 2CKBB 3BI9X 1KYDA 3P11L 2P48B 4XNXH 4LSTL 1HWGB 5L4JA 1S7RB 2QQKL 2NXYD 4MAYB 4E9QA 4ILDA 5FF6A 2BX5A 1PSKL 1I1RA 1A6AA 3EBHA 1F1DA 3MJ7B 4Q9RH 2Q3ZA 3GHBL 4WW1B 4XMXA 1UM6L 2VMEA 5GGTA 5GGRB 3SKJL 4FFYA 4PGEA 2VR3A 3ARYA 3OF6A 4NI6A 2CLZA 2MQCA 5DT1H 1UJ3C 2CKNA 3LIZL 1CF8L 1NCJA 2YBRA 3JUZA 5EFIA 1NANH 1J05B 3ZKSD 1FL5B 4MQTB 1AG0A 3RNQB 3ZKMD 1AQDA 3V7AE 2XRAH 4M93C 1NCDH 3G5XB 3CH1B 5EO0A 2DTML 3FYIB 3UIZA 3OR7B 1SLUA 3QUXD 3OR6B 4K15A 5DD1L 2J1KA 4BM7A 4AGMA 1QYGL 1PLAA 5TDOA 2Y6SD 2YD5A 3ILPB 3MRIB 2V3DA 4N2NA 4BIKA 1QFWM 1C8QA 5KYUB 2VZOA 4FI6A 4JG1H 4P2OD 3U30B 3MTXA 3FYEB 4IRZA 5CN2A 5EC1B 1N59A 4ENZA 4RBPK 4MRCA 2F7PA 1U8OB 5A6IA 4LVHB 4UILL 5F1OB 1NCHA 3GSUB 3NJJA 2EO1A 4ZTOH 5HI4C 1QSFA 3I6LD 3BPLB 2FIKB 1WP6A 3P0YH 1IBZA 1JTTA 3MDJA 4H25B 1JNJA 3D5OF 2DIJA 4OZGE 3WE6B 3MRCA 1RMFH 2XWBA 4KH9A 5LBVA 5I1CH 2VXQL 2C4XA 3CXHK 4UT7L 3RY6A 5AB9A 1F3RB 1FLTX 4D7BA 1CDCA 1MIEL 2UXFA 4ZMQA 3MXWL 3IE9A 3HBQA 4NBZB 1MQKH 4KUCF 4M93B 1QSVA 3NJGA 3IDYB 3SDYH 5IB4B 4G8EB 2CHDA 1EA9C 5IFAL 1UOWA 4PJCB 4QRRE 2JJSA 5CIPA 2UWEE 1G1CA 3S4SG 1MFBH 3MCKB 2F54A 4OF6A 1N5YL 2R59A 1MFMA 4M7ZB 4YWGL 3K71A 1E5ZA 2OXHA 4Y4FA 1LEIA 4WU7A 3TJHC 4OI7A 4UUJA 4I89A 3UBHA 3GSVB 2M83A 3NZ8B 3UJJL 4C4KT 1S7WB 3NPSC 2YLHA 5HYSG 5HYEA 1BFOB 2K6WA 1I3VA 2NZ1A 2OM5A 4WTZA 3U7WL 1JXJA 4TUOB 2IGTA 1YNTF 1BM3H 4G3YH 5G55A 4NNXB 3IU4L 3W9EA 4YL9A 5CN3A 2WMPA 3Q1SL 2QPSA 4TQEH 1MFCH 1BZOA 3HG0A 4CSSA 2D3LA 1WS8A 3KL0A 3K72A 2NY0C 5DWUH 1XDTT 1V54B 1YY8A 2XTLA 3H2PA 1E8XA 3PQYD 4R0LA 1AZCA 3MMEB 3LIZH 3PWUB 2XZQL 3N42F 1BQ5A 2MCMA 1W72A 2B59B 3OQRA 2W0FA 1F4XL 3FTXA 4V1DE 4K3GA 5H35B 3V4UL 4CC4C 2WZ5A 4GW5B 3MRHA 4MMZC 3ZX1A 3GMPA 2DYRB 5CJOH 5H4YA 2R69H 2HLFC 4P06A 4QKTA 2Z91A 1ACYH 2OSXA 4NNXA 5GZND 3A21A 5DFAA 2W0PA 5JPMC 2G5RA 4Z7UE 1VB9A 3CN2A 2H6PA 4OFYA 5IFHH 1ADQA 3GMRB 1VGEH 3HZMA 4WV1A 3LSOB 1K8DB 5E2TH 4YXKL 4DKDC 1BREA 5E1AA 3OX8B 4NT6B 1QI3A 1VENA 2EO7A 4BSJA 2ICEB 1ILSA 5DWUL 3DSFH 5I5JA 5IF0A 1RZKL 2P1YA 3FZUC 4HWZB 5J11B 5KS9E 2ZKMX 5AW0B 2JNZA 2F8VA 1UM4H 4ZFFB 2X4UB 1SXBA 3DXAD 4IBSA 5L7XH 2OTPA 3F7VB 3SE3C 2VM9A 1YNKH 3VGHA 4WY7L 1JHKL 3RZCB 3GINA 3PL6C 5AVQB 3RZCC 5E99L 1XVSA 4P2CG 3QDGA 4OCYH 1EXUA 4L48A 3U0TB 3V4PL 3MBWB 3HN5A 2XUWA 4I77H 1RZ7L 2AEQH 5C07B 2AXFA 2DLHA 5JW4Q 1JK9A 4Y5VB 2HN7A 2ZAIA 2QHRH 3TOPA 3WIIH 5LB1A 1GMIA 5KVGH 3TA3B 3CX5K 2B2XH 2WQAA 2WSPA 5AKVA 1GHFL 2BNQB 4RMBA 4LPTA 4XP6H 4OZ4A 1T1YB 2K7QA 4EDXA 5D7SH 4F2MB 1G5AA 1FBIL 2OTUB 3HC3L 4JN2A 2F58H 4I88A 4IKIA 2N0MA 2JJTA 3T6QC 4DQAA 3P2TA 1WCQA 5EDSA 2VQ4A 1CG9A 3C09C 1QLFA 5CNHA 3M17A 1MJ7H 1A4KB 5INCA 3QIBB 5F3BA 1QATA 4JFYA 1H9VA 4AQAB 3CSGA 2BSBA 1OP4A 3NIFE 4RH4A 1RIHH 1U8MA 1A4AA 1ORSB 5DMKA 3UJIL 2P7TA 5TE7L 4HOZA 3DBXA 3GJFK 3P77B 2H7WA 2QDWA 4QRUA 5EU7C 1ID5I 1A6VH 5AVYB 2X4NB 4L8CA 2VLRD 2KS0A 5IK3B 4EDWL 4E9SA 2AJXL 4LCWA 4JDTL 1R47A 1R5VA 1ET8A 4N8VA 5E8PB 2QT6A 1IEAA 3I75B 1YHPA 4KVCL 3MRHB 2QKSA 1UJTA 4X9YA 4WI0B 4JY4B 3DX2A 3MKGA 4J12A 3SB3A 5M94B 3N04A 4YHOH 4LQFL 5HYQB 4Y5YB 4HIXL 3IETB 4WEMB 5J9PB 4H0HB 3SYPA 4QRSB 2J4WL 2DQUH 3COOA 4XAKD 1TNMA 2ZUXA 1SM3H 3RGHA 1S7UA 4W9DC 2H0FA 5DFWH 4HUUA 4OV6F 2J88L 5AL8A 3OZ9H 2CKBH 3RL1B 3AQYA 4GRWH 3DWTA 2EC8A 3NCCB 2N4IA 4WUUE 3FQWA 3PHQA 4M7ZC 1FVEA 2IADA 3GBLA 4R90H 2GTZB 1D5BA 2CBQA 4TSCL 4M6OH 2EYSB 3MLWL 4NPJA 1SFDA 3BD4A 4BHUI 1JUFA 4XP9L 1AGBB 3LX9A 1UXSB 1ZY9A 3EUDA 1A6UH 3QZBA 5FO7A 3SJVB 5IY5B 1AIFB 3GI8L 4FKEA 3W0WB 1NIAA 4O2FA 3AZUA 2C4FT 2C1PA 2FEJA 4XB3A 5I15H 3ZYOA 3T0ED 2IIJA 2XOTA 2NY3B 1TEFA 1VA9A 3BUYB 1O6VA 1BA9A 5GIRB 4IBUA 1NGYB 1XQ4A 2WKLA 4WLCA 5EOTB 2WXMA 1AJ7L 1MREL 2YXVA 4FC3E 2JQZA 4F2MA 5DJ0B 4N8CL 2E9WA 4FQQB 4HIEA 2A74A 2C9AA 1R3KB 2HTKC 2WQ8A 4TNVF 5GRJL 3HG1D 2YWYA 2BOBB 2EEDA 1J5IA 1VLXA 3MYZA 3TBBA 2DAVA 1HC1A 5AKTA 5ALCL 1CC3A 5DHMC 4CNIA 1NBZB 4MLIA 2HTKD 3S2AA 5KUMA 4JRYE 4EUPB 1MQ8A 4LLYB 2YD7A 4HIHB 3DTDA 5C0AA 3T5WA 2F7RA 1FZMA 4H1LH 5KS9A 5DC2A 2ZOTA 2WSKA 3TV3H 3N1GC 1J5OL 4HS8L 2B1OA 3UTSD 4B3EA 1BEYH 4XN8A 5FO2A 4LF3A 4OZGF 2X28A 3VG0L 1GGBL 3Q05A 2BFGA 2R2BB 2BSTA 2X44D 1T4KA 3SDXA 1DL7L 2EKSB 1NCAL 3LAFA 1KSRA 1QNIA 3S34L 5I2IA 4PLJD 4M43L 2J6EL 1G43A 4N5ED 3BP6A 1AOZA 4JAMB 2AJUL 3SKNB 3QYNA 2A73B 3AM8A 2I07B 3DJTA 4K73A 2VDPL 2P46B 4S1QL 1RPUA 1V10A 2X1OA 3SO3C 1JWUB 4QRSA 4Z95H 5I0VA 5LGJB 5CJ5A 3TH3T 5F9OL 2YC1A 3K6SA 1FC1A 2G5BB 2XV3A 1KLGA 3C9NA 1AQ8A 3QEGL 1OAUL 5HGBA 3NGBC 4APQD 1ADWA 4LVHC 2QSQA 1EZSA 3ZDYB 4RWYH 3RU8H 2EH7L 3AB0C 2W1NA 3JZYA 1E5UI 2V33A 5IVZB 1G87A 5HHPB 1H3UA 4KVNL 3VCLB 1N8ZB 1WLHA 2B9BA 2EIZB 5DQDL 4AW7A 5DO8A 2XY2A 3KDMB 4HEPA 2H5UA 2JSFA 3CH1A 4IKJA 3RKPA 3U9PH 6FABL 2PWFA 1D5MA 3QJFA 5TTRA 3NJVA 4MD0A 5DD3H 3R1GH 2J2ZA 1BCIA 4JFDA 2GC7C 1EAJA 4PJ7E 1UWGH 1PNCA 3BUDA 2IDSA 2I25N 2YAQA 1AXTL 3MGAA 3X12A 2QGEA 5AAWA 4KKCC 4ZS6C 2G60H 2R2CA 1UVQB 3O4LD 3BVNA 4RISH 1WIPA 4Z3GA 5C0JA 1H3VA 3SO5A 2GT9B 5HHPA 4KH2A 5I9QC 4Z7VB 2PR4L 5IMLB 1HL8A 1KPRA 1TZAA 2YAPA 4ONGH 5AAMC 3S0PA 3VGEA 1KT2B 1J5OH 2W60B 4C56B 5DMGC 1IEBB 3CFMA 1C7TA 4G7VH 4YBLB 1G9NC 4NB7A 4OZHA 4B5ZA 2APBA 3MACL 5C6TL 1HKLH 4MZ3A 5CLWA 4M6AA 4GP5B 3D2UD 4QRPB 1HI6A 4LHUB 3MJ8B 4OZHF 1E28B 2V2XA 4RRPA 3U4AA 3X11B 1PG7X 1CFVH 4OVUA 3CLFH 5IB4A 2ZF8A 2WNKA 4NPYA 2QR0A 4Y9BA 1AHWC 1ES0A 1EVTC 2G3ZA 3MV8A 2AJUH 3MX0A 3PAYA 5B21A 1BAFL 2OV0A 3SGEI 2DF3A 1AI1L 5AVUB 1Y7VA 2ZX7A 1BAFH 4JB9H 2IPTH 3B1TA 3G08B 4JVPA 1XIWD 1G7HB 5D2LB 3NJFA 3T2OA 4X5WB 4FTVD 5BMFL 3K7UA 3QEQB 2C7UB 1A4CA 3BJ91 3KYNA 4UBDC 5FUOH 4LEEA 1F90H 3M8OL 3BH8B 3D4ZA 3FPYA 1JHLH 5F7YC 3U9UA 1JZ6A 3VFTB 1P5UC 1NAML 5EU5B 1JGIA 5IOPA 2GUYA 4ELDA 1H6TA 25C8H 2DQCL 1GOHA 2DTMH 4NS0A 2VSKB 1VADA 2GITA 2Y23A 5FHAH 4ORGA 1KIRA 1SJMA 5D93C 4GSQA 2ZF9A 1GGIL 2HH0L 3NABH 2OMTA 1OGTA 4XPHH 4C54A 3VFPA 5IW1A 3CQFA 4PRDB 4ODWA 5T5FL 3VQMA 1FVDA 3GF8A 1TLKA 1MXGA 2V7HB 1VFOA 3BFWA 3FO9B 5HGAB 2EDQA 4GBXA 2YQ3A 1JV5A 5H37G 4WHYG 3CPUA 5IMOB 4NDMB 2V0AA 4JANB 4HK0A 3DARA 3PABB 5DQ9B 1KENL 4U6HA 4JS7A 3VI3F 5D7KE 3NUKA 5G5DA 2DQMA 5K39B 2CDEB 1CIDA 1PD6A 3BW9B 3C5ZB 2PR9A 3BH9A 2OMTB 3GMQA 2YSSA 2R9HC 3CFCL 3FH8A 4J8RB 5IW1B 2DN7A 1TXKA 1JJUA 5L6YH 1U9KA 4HLJA 1FYTB 1W0VA 3VXSD 4R2GD 1KYAA 4PW4A 5LQBH 1A7PH 1FVCA 1OOWA 1NMCC 2ORBL 3OR6A 1SZNA 3NSFA 4P2OB 1E4JA 1MNUH 3V6ZA 3O0RH 5J13C 1IKNC 4I9WE 1SF5A 2NXZC 5JPMB 4K94H 1IGFL 5HVWA 4HIJA 4PG2C 5LLIC 1MOEA 3RFRA 1IGFH 4DUXA 1XV8A 4WNQB 3EOTL 4XBGB 5B7MA 4DTGL 4W9KC 3FFCB 1QZ1A 2BZCA 4U1HB 5IVXB 4TULL 4MCYA 3SY6A 4BZ1L 4Y5VA 1WE5A 4L2YA 3AWGA 1OCCB 3LKOA 4FHKA 5EA0L 3OL2A 1HVXA 4BK4A 3QJVB 3HA0A 1DBAH 2AK1L 3AC0A 3UYPB 4F7CA 3T65B 4R3SB 2DEWX 3CSPA 3O6KH 4M00A 3P3UA 4GKNB 4OCWL 5IHHA 4IU3B 4ZSOB 3MV9D 1WTLA 4X80L 1AHWA 5DMJB 3HZVB 4TPRL 3QZOA 1JWMB 1A21A 4JM2C 1QSZA 3V52L 1WVZA 2YGNA 5DS8B 5DD1H 1I75A 2PPCA 4HJEA 2GABA 4JGUA 4UB0L 2ICWJ 1XB8A 3FRPA 2DRUA 2NTFA 5GGTH 1IL1A 1E0OB 3KYKL 4MWFB 4NZFA 1T20B 4KOCA 1RJCA 1P7QB 4H20L 4GW4A 3FNKA 4EOWL 5EBLB 2FQEA 2C9PA 3BZEA 1J0YA 4MAYD 3L3KA 2X2YA 4IRJB 1G4RA 1CFSA 2N7BA 4L1DA 1J1XL 4M1CD 3QR0A 1SXAA 1JMXA 4QMEA 4X5XB 1WAAA 5KSUA 4JFHD 3TBVB 4MNGB 1SQMA 3D85B 3MR9B 4LNRA 2EYRB 1D5XA 5INDB 4KAQH 5E08H 1LK3L 2K3HA 5J9PA 4FMKA 2LLLA 3SDAD 4JFFB 1EHLL 5HGGS 2CM6A 5AZ2L 3B2VH 4XH2B 5EU3A 2AITA 4M3KB 5FB8A 5IV2A 2E7MA 2EXYC 1DSFL 3RX8A 4JHVA 1XD1A 3MRNA 1UCTA 2XRAL 4I1PA 4QNPF 4I18B 1RHHA 2BVQA 3S96A 2OXGA 4XWOC 1A2YA 5KZCD 2DQJL 3I02A 5E00A 1CE6B 4TUKH 3UC2A 2YARA 3RTQD 3JWOH 4XN1A 1ZS2A 4B9KC 4OV5B 4Z7IA 2VDKB 3JXAA 2AV1A 5DURD 5KVGL 2IANB 3HI6L 5F93C 4IRZL 1URZA 4NM4L 1RXLA 2F6AA 2WXLA 1SLXA 5KVDE 1M7IA 3DROA 2QQKH 3LN4A 4XMTA 1PX4A 3ZRCC 2E6JA 3D9AL 2DQFB 3S4SA 5BRPA 4XPAH 4MHHI 3FL7A 4H26A 5ICXA 2V17H 3U0WL 4WO4B 5IBTL 3WJJC 3VSUA 3GUTA 5I6OA 3FONA 1FF5A 4PYHA 3O6KL 4G6FB 1LEGA 4HULB 3FU3A 4X8CA 4BA0A 4FZ8L 5E8DL 4X6DB 3WCYA 4LFHG 4IU3A 4N85A 1W16A 4R5VA 1KYOJ 4YHKH 1N4XL 5E94A 4Z7OF 4L4VA 2CDFB 1FL5A 4WJ5A 4H7VA 1KFGA 3AMLA 4UB0H 5DEGB 1UB6A 2J55A 1VESA 4NHUB 3AXLA 5DS1A 2C7FA 4EQ3A 2FSEB 2YR3A 1KXQA 3CN1A 4XXCC 2UYLA 4HIXH 4N9GB 5GRVL 1BIIA 3TA3A 1AGDA 1I9RH 1MFDH 1HXYB 3MRDA 1H6UA 1ZHBB 1BZ7B 4OFIA 2X0UA 3M88A 1OWWA 2E8ZA 2WXFA 1TJIH 1TJMA 3VD4A 5TGBB 2AQ3A 2ZYRA 4NN7C 5E56A 2HJKB 2IWFA 2VITB 1JDCA 1D5IH 3HE6C 2QVTA 5CWSB 3RGVC 4P99A 3IJ7A 2G2PA 3VRJB 1KULA 1TO5A 4HGMA 2QPUA 4XPAL 4HQQH 3LS4L 3ARDD 5KSBB 3AREB 4G9FB 1KN2H 1A9EB 1G7LA 4K9EC 5J0BA 5KBNC 4Z78B 3PUUA 2VKXA 3MBEC 1TJXA 1FI8C 1HZLA 3ZE0F 1NM9A 3BRFA 4NLHA 3KPNA 2X89A 1IC0A 1P6FA 1UM4L 5CCHE 3D0LB 1JWSA 2D9QB 5DHYB 4MMXA 1ONQA 3AU0A 3EYSH 3QPQD 4LVOB 3ZHLA 3VI3A 2B0SH 3FO0L 3JWOL 4PP2B 5CZRA 4XMLH 2XXGA 3UTSE 4XOCA 4PBWD 3EGDB 3GZOA 1FRGL 4G70B 5J12C 4Y4FB 2D7PA 5F88A 1LEIB 5IFHL 1SN0A 2CDGB 3QXVA 5DJZB 2VDLH 2VABA 1ITCA 1QQDA 4OCXH 5EOCH 4U4IA 1DVTA 2CWRA 3FQXB 4F3FA 5DHXB 2GCYA 5DZAA 2AP2A 1U8LB 3U7YL 3QP3A 2WLNA 4JVWA 1CTMA 1YECL 4WW2C 2ZXWB 2YOCA 3B34A 4KQ3H 4EI5B 2ATPB 2H32B 4HG4K 4L8DB 3M07A 2XX0A 3BUPA 3MJ9L 5C09A 1GC1H 3FQTA 3LKNA 2A9AA 2XZZA 5I18H 1QFPA 2N1TE 3TIDA 1KELL 3IAGC 3L3OA 4YHNA 2FATH 2XWEA 4NFBA 1BPVA 4HISA 4MX7B 4X4KA 3H8NA 3L4UA 1FFOA 3MV01 1FIEA 4XOAA 4PRIB 3GGWB 4XGZA 3LZOA 3E3QE 1COBA 2EYTB 3KPOB 3CFDA 5T1KA 3OJDA 4QXGL 2GCYB 2X6CA 3UZQB 4UT6H 3H7BA 2OMNA 4LOFA 3UG3A 3BMVA 2VDKL 2ATKA 1T4WA 4DZBA 3DLQR 5EUKB 3GS4A 1BVLB 1VGKA 1Y18B 2H2SD 3FW6A 2UXTA 3ERXA 5HI5C 1MDAA 3TL5A 2OTWB 3AITA 3T3PF 2ED9A 2VT0A 3CZUB 1EEUA 5IJVA 2WGNB 3C12A 3QCTH 5AOKA 1V7NH 2GIXA 5HHMD 3R8BB 1GOGA 1PFCA 1NLDL 3HZMB 4LIQH 4WV1B 4M7JL 5A2CA 5HI3D 5KTEL 3FQNA 3UC0L 4N8CH 4X7EC 4NN7B 3REWB 4XCNA 4QLWA 2BIOA 3UGXA 5CMAB 4QY8B 5E8NA 5DWPA 5E2UH 3D3VB 2MIZA 1NCBL 4PY7A 3NA9H 5CF3A 3MLYL 3T08A 3UCQA 1CICB 4KQ3L 1P7HL 2Q8BL 3KPSA 5A6MA 1X5MA 3IXAA 3MLTB 1WGOA 4RGNB 2VQTA 1A6TA 3TO2A 1FORL 1K3ZA 1RK1B 2VDQH 4JJHA 1BJ1J 5FYKH 2XTSA 1T2QH 4J28A 1E5BA 6FABH 3D0VB 5AZEL 4UYPA 3MVSA 4HH9A 4NO2A 1RVFH 1Z5HA 5EC1A 2EUWA 3N6YA 4NO5B 4ZFOB 4AYFB 3HLKA 3EYOA 4MYPA 1CDUA 4JRXD 4KVCH 1EJFA 2ZNWA 4Z3TA 5MEND 3SKNA 4L18A 4YS4A 1UZ6F 3ABGA 5KSAC 3CXDL 3EO1A 1M3JA 4A2HA 3LTVA 1QLEL 4YUEH 2Y3AA 2BVOB 3GMMB 5D5MA 3T8VA 4AENA 2EO9A 2OS7A 1WAEA 2CBTA 3IXAB 3WY1A 4H5SB 4ZNEE 3D2TA 4JFWA 1T5WB 1M9WA 4W70A 1BWWA 1RK1A 1DE4A 3QZNA 1Y6MR 3H9SB 4RSVA 4V1DD 4H88H 4W6WB 2D7NA 3BLPX 3RGVD 2GBTA 5JDJA 3ZZLA 2XWJB 4GNKB 7CGTA 4QXUL 4HH9B 3MLUH 2JQAA 3OM3B 3NA9L 3ALPA 4PLKD 1Z3GH 3BIKB 3MV8E 2R0ZL 3AY4A 3TVMA 3EFDH 1MFUA 1Q8MA 4HMCA 3ULVD 1JPFA 1TNNA 3FT3A 4PJ5E 1MLBB 3VG0H 2XA8L 3LQMA 4V2BA 4NPKA 3OJDB 4KC3B 4QNPE 5HDBF 3IF1B 4XPBL 3WV0A 1IIIA 1Z9MA 1MHCA 4JO4L 2ATKB 2NX5B 4BELD 2PWGA 3Q1EA 1SLVA 2VDKH 1CXKA 5I8CA 1ND0A 1SNRA 3ARFB 3K0YA 4LLVB 5A7EA 2K8QA 2E86A 1TYJA 1E4XL 3MNMA 4IOFD 3CFKA 4S1QH 4L9DA 4KFMA 3UTTD 2OL3L 3MPCA 4JG5A 4KGLA 4Q6KA 2W92A 3G6AA 1MHHB 2Z92B 2FQFA 2HJFA 5F9DC 1KGWA 3GXNA 1D6VL 1W72B 2B59A 5ECJE 1PKQE 1F6FB 3CMOL 3HVNA 3L3DB 4JEGB 2R69A 2IV8A 2ZOKA 1OF2B 1T66C 2AXWA 3VFVA 2EXSA 4Y2NA 2WINA 4JKPL 1BFVH 5CHNB 3NCYP 4JM2F 2HUHA 5C09E 3SIKA 1MUJA 1FZOA 5T1JA 1A64A 4XVUD 3QH3A 3ARQA 5AZEH 1AQKH 1V3LA 5CLZA 5K9OA 3WU1A 5J89A 3A6CH 3NIDF 4ZBJA 5B38A 1HHKB 3MCYA 3AT8A 2PXYC 3MV7A 3KM1A 3KLQA 1XIWB 4FG6C 5ITBH 4C57C 4RGMB 5BO1L 5K9KB 1TOXA 3NZSA 3WKMH 1CICC 1IAMA 1T6BX 2XN9B 4AITA 4HETA 3FF7A 1A14L 1M7DA 1SEQL 4DGUA 3ALXA 5DJ6A 4HX1B 3WFHA 3MYJA 4WEUD 5IJKA 2EXYD 3FB6B 3H3BC 4GKZA 1UUNA 3CFTA 4JFOB 4P46B 3ESPA 1LO5A 4RISL 5AG9A 5BVJB 4BJLA 2EABA 3HE7C 4NUGH 5K1VA 4J2QA 1BD2A 1PYWB 3GSNH 4YC2B 4GP8B 4FNSA 4XMZA 1KXTB 3VI3E 2OL3H 3WMPA 5C9JA 2I7SA 1WC7A 2E6QA 4A2EA 5I8KL 4PJEE 4AW4A 2WWKT 4Z3FA 3RZCA 3T2QA 2ZONA 3RUGA 3H0TB 3DV4A 1BAWA 1QP1A 3QI9B 4AGPA 5EU3B 4WFGD 1IFHL 4XXCA 1CTOA 1T0PB 2L0DA 3SDXE 4CMMB 4HPOL 2MCAA 2N0KA 5DQDH 5EB9A 1ADQH 4P23D 4MDJB 1HCFX 3H9SE 4Z18A 1NIFA 4ZUWA 4JGJA 3RDTA 5I1LB 1OV8A 4ZFGL 2NPLX 2D4FA 3QPKA 3L9RA 3S37X 2IBZY 5D1XE 3VXOB 2DBJA 1E4XH 5I0YA 3TXAA 5ADPH 4OZFH 1SEBA 2Z34A 1NCNA 4MCZA 5FLUA 4NGHH 4QYOA 1SYSA 4A2MA 3TBSB 4PW3A 3FB7A 1YEHH 3ZTNH 3B4NA 2AERT 1BZ8A 2VN5A 4BCXA 2WO3B 4OGAD 4DVRL 4HMDA 2P49B 1EJOL 2B1HH 1KCLA 2NXYC 4XODA 2YUWA 3L9BA 3QNFA 2A4CA 2PR4H 3OB8A 3ETBJ 4UOJA 5E8EB 2W9DH 3A4EA 1EVUA 3CZKA 2R7EA 4R6UA 1WT5C 1TCRA 4MD4B 4DPBX 5F3HA 1GJUA 1QABA 1BYPA 5C9KA 2WLIA 2GEEA 5DYFA 1QHPA 5DUML 1FQ9C 1D3CA 4M5YH 2ZKYA 2CLVA 3QJZA 5GHWH 4PJFB 3GBNL 5J6HA 1O6SB 3ETTA 2BXZA 3FFCA 1I9JL 3HG1E 4YN3A 4M5SA 4J3OH 4AYEC 2BWQA 4WFFD 5JXEC 2WYZA 3HMXH 4A6YB 5ESVA 5EZPA 4X6CE 4YEFA 1KTDA 3M1BB 4K9EH 2CALA 5E8EA 3KPMA 2WW8A 2CLRB 4AIEA 1YEDB 1LO2H 1KXTA 2I69A 4M5ZH 5L0QC 3IVKA 5DD5L 5EUOA 3NH7L 1J8SA 4NX0A 4DH2A 4JG0H 2DQCH 1MRDL 3BO8B 4D8PB 3EW3B 3QUMH 1MDTA 3P4MB 5F9JB 1U8NB 2RR3A 3WLWD 2WIMA 2F54D 3A5VA 2AEPH 2V2WB 3CC5A 3LKQB 4JRFA 4LE8A 1NCOA 2GAZB 3OLGA 1A7RL 3H42H 3BP5A 1UZGA 1ZA6A 1WDAA 5LDUA 1DVFC 5TE6H 3VWKD 3NCJH 3SOBH 5L4FA 5LDSA 5EOQL 4LHUG 3MBWA 4XO4A 4DW2L 3K8KA 3MX0B 32C2B 1CS6A 5B8CB 1V8HA 2XKUA 4R7DB 5D7JB 5B1JC 3FU0A 4LSUH 4Z0BL 2MCG1 5IJDC 5BO0D 1UWFA 3O9WD 3QUHA 4JO5A 4NQDD 5LBSA 3C5ZD 4WWKD 3GRWL 5KVDL 4OJFH 4HMEA 4TL4A 1T1YA 3TO4A 1WEJL 4OUOA 4Q9RL 1ZS8A 2GW5A 4O02H 5HJGA 1ZEAL 5HI4D 2ADFL 4N6QA 5AZ2H 1QRNB 1TQCC 3KPQA 3F5WA 5C0AB 3TTSA 3EDEA 3KLSA 4OLVH 3OKLA 4GB9A 2Q2LA 1YN7A 3M86A 3TJEH 5ID1A 1A4KA 3TP4A 3VXTA 1G6RL 1CU4L 3KEDA 2X1PA 4QIRA 3DSNB 3U0PB 1OZTG 1UD4A 3CXFA 5CD5D 5JLZA 2VR7A 5C0CB 1E7VA 1UWYA 2BHZA 2FB4L 2DH3A 4O00A 5FM8A 5I30L 3DBXB 2A4EA 4GRWE 2YJQA 5HDLA 1HDMB 4KX9A 4UOZA 2DQGL 1B4JH 3IXTB 2FO4A 2FECI 3OAYK 4XN2A 5KVEL 3T4AC 3OVUB 4G6JH 5DZNA 3T6VA 3V4VA 2EUXA 1H8LA 4POUB 3EOTH 4BRJA 3DX7B 4HOXA 4O5LL 4W9EC 4AGNA 2I32A 4CL7A 1BVKB 1QKZH 3ZQ9A 3L5IA 1KTKE 3F85A 4FP8H 4UV7H 1YN7B 3SO3B 4ELKB 3CHPA 5T3XL 1SJHA 3G04B 1XF3A 4H0GA 2C4FU 5JIDA 3PWLB 3MLXL 5ACLA 3VXRE 3QC5X 1BXAA 4GLRI 4WTWA 3ZQXA 4YE4L 4U6VL 1MWOA 1OPOA 4RZKA 1X44A 4IBVA 3GMQB 4FXKA 2NDFA 5EUOB 1K4DB 1PMYA 4KY1L 2VDML 4NERA 5TDPA 3SDYL 5C0CD 3ZMRA 4N2HA 4Z3JA 3EH3B 2WTOA 3FO1A 4PRPE 4X5RA 2VL4A 3NZHH 4MD5A 2BNUB 5DRZA 3VFWB 3ARFC 2IPKB 3IDGA 1Q9OA 5TE4L 3NIFB 4YBQD 4DAGL 2P80A 2OMZA 2X6BA 4G8GB 4Y4HD 3VXPB 1TTAA 1RZJC 3UYRH 1VF5C 4HBCL 2IBBA 3EYOB 1ZT7B 3O45B 5E6ID 4GSDL 1IAOA 2X2HA 1AZBA 3QS2A 3CSYA 1AZZC 1UA6L 4AJWA 1GY2A 4TLKA 3CVHB 5CLYA 4G11A 3P73A 4F7MA 1KPRB 2F1BA 1I9IH 3BVTA 4JDZA 1H0DB 3ZJAA 2AS5M 4KRLB 4LEXH 3OQ3B 4XAWH 2FK9A 3EJZD 5LCVH 3QXDB 3F7VA 3H9SA 4PJ9D 4YSEA 5AG8A 2AABL 2DLIA 4FJZA 4Q6YA 4RESB 3MCLL 2HFEB 1NCDL 2OZ4H 2NNAA 1MEXH 3KL5A 1AIZA 1F4XH 1MAJA 4G6AD 2J8UE 5J56B 2FYYB 2ORBH 2NTFB 3G9AB 4YHYC 4K94C 4LB8A 1RK0B 5ALBH 1G7IB 4AQ8A 1NSNL 2BIPA 4MB1A 1N0XH 3T0WA 3C6EA 4KKNA 3OC5A 3ULVH 1NSNH 4BSVB 5KSAB 5KUKA 1NLDH 4P4KC 4YXKH 4ZFQA 5HJDA 2FT7A 2R23B 1AOHA 1BQRA 3MOQA 3WLBA 2V17L 3U0WH 2BCKA 2XZCL 4ODXA 3U4EB 4CKVX 5C97A 2AQRA 5TH2A 4G80A 2VR4A 4ZPVB 3RWIB 5CBEA 2RAMA 3D9AH 3SJVE 3QA3A 1BMWA 2G9KA 4KHTH 5I71B 5LGKA 5E08L 4M6MH 3BAEL 2ZP9A 4YDIH 1EJ8A 1CVSC 3E9UA 2MEJB 2O5NA 5A2FA 4E0RB 4KK8D 5ID0B 4DSYA 1K8DA 3Q43A 2WVVA 3K1DA 2Y06L 3MUUA 4YSDA 2XXMB 2ICEA 4PU2A 3FO0H 1HNFA 5GRWA 3MRJA 4TSBL 3ZO0A 1DLFL 2OMWA 4WGKA 4PJEA 1MUJB 3G5VB 3UP6A 4MXWH 1RZPA 2JCCB 2P44B 3VB8A 1NM4A 3B9DA 4WHCA 3SGDH 2J4WH 4PLOB 5FKAB 3C08H 4PJ7A 1CDBA 5IOKA 4PWIA 5BJTB 3FQUB 4AZ8B 5CBAA 4DPAX 5IBUB 5EUOE 4EN3A 3EO9L 5MEPB 2VDLL 2EDWA 2JIXD 2Z31D 3FT4A 1KB5H 2D73A 4U1SA 4ZTOL 3KYMB 2X4OB 4PUBH 2K4AA 3EF7A 1I9IL 4GG8A 5FYLH 4ZT1A 4PIRF 3EYVA 3QQDB 6PCYA 5KVEE 3HCVA 3EZJB 3P73B 4YNYB 3UACA 4WKXA 4F8NA 2WXHA 2KDYA 3MUY1 3DX6A 1EXHA 2HMIC 3BE1L 1B6UA 3VI4E 1B4RA 3QDMB 1FDLL 5A3IC 3MUGA 4KJPC 4WW2B 1NC2B 3TBYA 2C26A 3CVCA 4M4RB 5FKAA 5INCB 1OKEA 1S9YA 3WYRA 2NSXA 2XKNA 2XLLA 3HPLB 1LNUB 1J5HA 2M26A 3FT4B 2CRYA 3MCKA 4LQFH 2JKRM 5CLTA 5FYJD 1ZLUH 2BY3A 5J11C 4RRPM 3C9NB 1Z32X 2XWTA 1G9NH 4OM1H 1ZK5A 4BWTA 5J12B 1JI2A 3FCTB 4XVJL 4K3HA 2QMJA 1IEAB 5T1DH 3MV8B 5KTEH 1XMWA 2D3VA 5DK2B 4M02A 1OSPL 2XFXA 1V7NL 4PUBL 4XC3H 1A7OH 1E65A 1WWAX 4WHTB 3ILQD 3WSQH 4JFDD 3RVTC 4F9LC 4G80B 4NQUA 4ZPVA 1EV2E 3IGKA 4GLRH 2FX9H 1UCBH 3MLSH 1MF2L 2H6OA 3GRGA 3PIQB 5TF1L 4X5WA 4BDVA 4UTBL 2VWEC 2RACA 1PZ5B 2IFFL 3HB3D 2OJZL 1J8HD 1DVUA 1V05A 4GEJA 4GG6F 1FORH 2O5YL 3BIKA 4MMZB 3VRLE 9PCYA 3W2DL 1FFPA 1MAKA 3L4VA 3TPUA 1LE5A 2TRYA 3AQZA 1DJWA 4XNMA 1VZHA 5F7WC 4FG6D 4KUCD 4M3JA 1MH5B 3SQOL 2AF2A 4MA1B 3S36L 4RCAA 3P30L 4NCDA 1X7QA 1H8SA 3W5MA 1SEQH 4GQQA 4YDZA 1QLRB 4IRSD 4NC2B 4DVBA 1GL4B 3BYTA 5IROD 1NLBL 2EVHA 4JR9H 2AMGA 4MNQA 4PJFA 1N64H 3C2AL 1EO8H 2OBGA 2GY7B 3EO9H 3UBFA 3BCDA 2GBUA 3W0WA 2R83A 4M7KL 1MELA 3MRLA 2BS71 1M2VB 1XGUB 1EEZB 2DD8H 1IT9H 2Z35A 2BNQD 3KW8A 1VFBA 3ZZQA 1BQHB 4PB9H 1CIUA 2P8LB 4A2FA 2OXGB 4NC1E 3WEXA 1G94A 3B5HA 5I9QB 3L95A 4MJ6B 1A1NA 3KPMB 3CMOH 1BBJB 2FATL 3LEXB 1SOXA 2XN9E 2NQCA 5G4MA 5JW5A 1QACA 4FHBD 3SY0B 5GZNC 1GC1L 4PJIA 3KGTA 3WS6C 2Y2WA 4DKTA 3JV5A 1FG2A 1NC2A 4F57L 4A7TA 3EJYD 1E2ZA 3P1VA 4M48L 4RDBA 5EC2B 5HPOA 2IQAB 3QJHA 4H25A 3OPUA 2CRZA 3ME0A 2H6UA 3D30A 4RQQB 2BP0A 5FUCE 2IH1B 4LOUC 4LLQB 3MOAL 2FWLB 3R4RA 3FH5A 3N1PC 5AB1A 5C3IA 5T3XE 4LCCA 4HJGA 4ZO9A 2LQRA 5F70A 5BUPA 3U46A 5EU6B 2GJ6D 5JORA 1DQML 4Z7QF 1P69B 2D03H 4Z7NF 1TQWA 4J3VA 3SDXB 1JZGA 4IW4C 3LEXA 3EADA 4V1DB 5SV3A 5IQ9B 1T21A 1FCGA 3ZZSA 5FCUH 2NNXA 1AH1A 1DHKA 4ZUUA 2UV3A 5I0DA 1KBGL 4YHZL 3NGBB 1KZQA 1U91B 4J3XA 4WSJA 5CJ8A 3ATEA 2APSA 3S36X 1KT2A 4LP8A 2VGLM 4KKZA 5TPWL 4UM9B 1JHTB 3DPBB 1A1MB 4YVUA 5EU7E 3WNKA 4N2AA 2EC9U 3P0VH 1OAXH 3IN0A 4BH7A 3DETC 3UEQA 1DSYA 1B0GB 1KBPA 1INEL 1T0NA 1KZYA 1L0PA 4GH7B 2FH8A 4GAAA 5E2JA 5T1LB 1SMDA 3JVGA 5PCYA 3L4ZA 4M43H 1QFUL 4I8DA 3KWXA 4FZEH 4ODVH 4ZFGH 3ENEA 5EZOL 3QXAA 4FL4C 4HLEA 1LD9B 1ORQB 1MRFL 2B1AL 3LD8C 1FL3B 4JRXA 3KL3A 4HJIA 5E6RB 2OL3A 4J4PD 3FUJA 5E9DD 1EFXD 1QFOA 1I8MB 1PZ2A 3FQRA 5KYYB 2X4TA 1G7PA 5T8IA 3U2JA 1HINL 2V9TA 4WI4A 2X09A 2FEEL 1P4IL 5C08E 3BHBB 2ITCB 4PJFE 5CZVL 1NJ9B 2QKIC 2MJWA 5E9DE 5CIPH 5E6IC 5LXGL 5FO9B 5ELIA 1E4WH 2AJVL 3ARGC 3B7RL 3P4NA 3I50H 1B2WL 4GXVH 1F4HA 2Z4QA 1CURA 1EGJL 1M9SA 1PZCA 3NJIA 4HF5L 5DF0A 4A7QA 4ERSL 1L0YA 1XZ0B 3K4ZA 3DUSA 4KVNH 1TEYA 2Y5EA 3AUVA 1UXLA 2LABA 2NR6D 3BLBA 5AYTA 4PD4K 4WFFE 4ALAL 3BPOC 5EOQH 3C60A 2IQ9L 3C87A 5HDRA 2QADB 5IF0B 4XPTL 4R97B 4PD4J 4OV5A 5KANI 5EULV 5HHNA 3T04D 2FJGA 4G8IB 4K5NA 5AKSA 3DK0A 2GFBB 2WAQA 4IGBC 1JPTL 3ILPA 4YXHL 1NJ9A 4QRPA 1JZ8A 4A04A 4IS6A 4JM2A 4JGNA 3L7FA 4LRNL 1PIFA 5BXFA 5GGSY 2PCXA 3F04A 4DKAA 1ASPA 2R0LL 4KTDL 2NT0A 3D52A 4NUPA 4B9PA 3MA7B 1HT6A 4Y19A 4YQXL 4F2EA 4FN0A 4ZXBD 2B39A 2FWSA 2FIKA 1DBMH 4HZAA 1EGJH 5DHVH 3TA3C 1JZEA 4KXBA 3FDWA 1CFSB 3KPOA 1MCCA 3QFJB 3RURA 3TFKD 5E7FA 3WIAA 5D1QC 3T3PE 5D1ZI 5DD6A 3IMVA 4QHKJ 4X8GA 3BT2H 4MCMA 4N2IA 4RA3A 5ITFA 1W0WA 5DJYA 5K9OB 1Q9LB 1ZTXH 2NY1B 4YO0B 1BZEA 2Q86A 1BM7A 3LVEA 2FGWH 4G72B 4ZAKC 5AW1B 4FQXA 4J27A 2R51A 2DQTL 2VAAA 5D55A 2QTEA 1A3RH 3MRDB 3VFPB 3KJ6L 3MBED 4OU3A 4DFHA 1CDGA 1CD9B 2YPLB 2EIJB 2OL3B 4YE4H 4ZMPA 5B39B 4FQXC 1AXTH 4DEPC 1YYLL 3M45A 1M71A 4J6IA 1I85C 2Q3AA 3L81A 4F7EA 5CO1A 1M05B 3D4GA 3WTYA 3JVGC 2DM7A 1I53A 2LHAA 4ZX5A 2GVYA 5I28A 2CJUL 1W0YT 4PGBB 2R29H 4U6HB 5DFVD 5KSBA 1JGLL 2NW3A 1DUZA 4HZ1A 3WFCL 2A6JB 3DIFA 1A0QH 5ISZE 1MNUL 1P5UA 4JG0L 5J6GB 3KPRE 1J0HA 3DVNA 3AMKA 1A7PL 4FQXB 1B4JL 1AANA 5F7LB 3LNEA 4GS7C 5HSFA 3D0LA 4WO4A 3MRRB 3QUXA 1VACB 2FNBA 3IBEA 3VXRB 4EIUA 1SY6A 5FGRA 3PJSA 2F7QA 4OUUA 2FGWL 1BQLH 1FVCB 1NFIB 4G5ZL 4PGDB 1UWXK 5C08D 1S7XB 2EKJA 1ZTXL 4ZOBA 4WI6A 3LKRB 4KO7A 5HJBA 1YPZE 1R6VA 1WCBA 3AACA 2C9RA 3TA3D 1OCZB 2DYPD 1WUNT 5FO7B 3SJVA 4FP8L 3D34A 5CEZH 1E6JH 2Y6TE 4R5XA 5E9DA 4K7PH 3CVHL 4M6NL 1KXHA 2CCWA 2YJLA 3BLKA 3MSPA 4L4TA 1W9XA 2NY6B 4YBLC 4Y4FD 3O6ML 1QHQA 1F86A 1H8NA 3LKOB 1RQ5A 3H2QA 2X4OA 1XBRA 1DBML 2BVQB 2E59A 1AGDB 5ACZB 2FCBA 3GDBA 4IEFB 3PV6B 5D4IA 4B7IA 5A2JH 1GYWA 1I1AD 3RVUD 2HJKA 2IDTA 3VXUB 5L2JB 1GGUA 1K5NB 4EI5D 3CUPA 3KVPA 4UV4H 2IPKA 3OHXC 4HT1L 4LAQH 1A6WH 3OGOE 4X8XA 3X11A 1RP9A 2L04A 4LSTH 5J6HB 1G9EA 4HOMA 4YE0A 4GRLC 1IKNA 4JQVC 4PP1D 2BOCB 2HFFA 1W8NA 2GBVA 3T0AA 1HYSD 2GTWA 3LRSA 4JFZL 3NG5A 3VI4F 3BQVA 4Z7OB 5ACZA 5EEWA 4GW4B 3P9WB 4A6YA 2QJDA 3FRUB 3IS1X 4JB9L 4UILH 2IG2L 2J8UB 4C55A 3IEAA 3QUYA 4CVUA 3B3BA 3L9YA 2DMBA 5DK2A 4KKRA 4H8WC 3AWFA 5E4OA 2DQDH 5IM7B 2Y4SA 2APFA 3X13B 3ARGB 4J4PC 4MNHB 1U8OA 3MOBL 4ZPTA 3VFMA 3VXNB 2GQHA 4LQ1A 3UAFA 2QKIB 1A1OB 3CLEL 1DJSA 1QQDB 5ADOL 1E8YA 1QYGH 2J1YA 3EDFA 2A1WL 1AAJA 1M7XA 2ZXEB 4WWKA 4G71B 4HT1H 1FYTD 2WCSA 3LZQA 4NZJA 1KGXA 4YSRA 4DHLA 3C5XA 5IHZA 3EXJA 1JBJA 1FYHB 1RHHB 3IJSB 4MJIA 2MRYA 3LD8B 4ZMAT 3IFOA 2UX7A 1ACZA 2Y6SC 2W0LA 4F24A 2W81C 3BDYH 4MQ7A 1T03H 4JFEA 2F74B 4JMXA 3RA7H 2HTLC 1DLHA 4MDIB 2M1KA 2CGRH 1G7MB 5ISZB 1MCOH 3L3OB 4YHNB 1FIGL 3TBWA 5D7LA 3MAWA 5JPNC 5KVFL 3V5KA 4HV8B 3WIFA 3OKYA 3HTLX 3JV4B 1VJSA 5CJQL 1GH7A 1IO4C 5GS1B 4G3YL 1MJ8H 4NQVA 2JELL 2MHAA 3DYPA 8CGTA 4UT7H 4BZ2H 1U8CB 2EDEA 5DK0B 3Q3GB 4DQOH 2AVFA 1GVIA 5EZJA 5HYSA 5IHZB 3KBEA 2P24A 3QIUB 4RFEB 5C0ND 5KS9F 1HEZB 1QWNA 1I3GL 1P2CB 4Y2DA 3RJQB 3TWCH 4AUYA 2I27N 4EXPX 4L5FH 1ROCA 2MOVA 3CHRA 4Y9FA 1JF1B 4N87A 2CO2A 1T5XA 4PJFF 3LKSB 1JDAA 2HRLA 2LAGB 3UG4A 2DJSA 3GFUA 3GXIA 3PRZA 4ZMTA 4IKKA 2MFNA 4PJAE 3VU2A 4WO4D 3HG2A 2AKRB 3DC0A 3U30C 4NAJA 2NY7L 3FTYA 3DGCR 1JGDB 1UM5L 1ZHNA 3CVIL 3QO1A 1QW9A 4XRCA 1M3IA 4NHUA 1U2HA 2RA1A 2VNCA 3IMWA 2WD0A 5MEOA 5DJ8B 4AQEB 3KLHD 1MJ7L 1DO5A 1YSOA 1Y0LA 2BHYA 3MLRH 1P2CA 1F41A 4HZLA 1L5GA 2CG9X 3V9CA 5LAXB 3QDMD 4GKOA 2WAHA 2YUZA 4UNUA 3QDJD 4N2LA 4EBQH 5ECGA 5IZ7A 1YUHA 3ZHFA 4WW2F 1G9MH 5CWSA 2PTVA 2CO7B 2QV4A 2WJ7A 3UBXA 2WBJC 1CZ8L 3EO1B 2JI3A 4PJEF 4ZX6A 2V5SA 1AQDB 2Q8AL 2QKIA 1I3GH 3RTQA 4GSRA 3WS3B 5E6UB 4D94A 5AEAA 2NYYD 3QSKB 1F4AA 5E99H 2ZCZA 2I9LB 3H7BB 5KZCB 4QGTA 1OANA 3NTCL 1ICTA 3UROR 1N64L 5H94B 3IJSA 4MJIB 4WJKB 4P9HC 3IGUA 2HT3C 1R24B 5EBLA 3EFOA 4HGWB 2D2CC 4WVRA 4ODSL 3KNBA 3MV7B 4GQ9H 2ZKXA 4W68A 5H2BB 3OKMA 1MCOL 2ATAA 3NAAH 2IALA 2YD0A 3BWUF 3KWUA 5A6LA 5ESAA 1NDGB 5F89A 1SMOA 3TBTA 1XF1A 4QY8A 1GSMA 5HYFA 5DJDB 2XQYK 1AZNA 3G5ZA 2YKLL 3OKEB 4K5PA 5CEXA 2GK2A 1MHEA 3HAEA 4BDVB 2H3NB 3SDCC 3MNVB 3BPCA 1G7PB 4BFOA 2N1KA 4XH2A 3OSKA 3BAEH 3B2VL 3WN5C 2AABH 3V6BR 4LBEB 3OKOA 1YY9C 3TVMD 4AYMC 2C5DC 3QQ9D 3VFSA 1QLFB 4TQ8A 1XCQA 4NRXB 4LOVA 5HI3C 1GZQB 4Y2DB 1OE2A 3BT0A 4TNWK 4J39A 4D0CB 4FQIH 4HGWA 1PG7H 2VZSA 3HNVH 4JFQB 3HMXA 4C56D 1VHPA 4QHPA 1SVBA 1IBDA 3CGTA 4I0PA 3LNFA 4BKSC 3EZ8A 1K2DB 3D2UB 5DJXA 4MDJA 1NKRA 2LE9A 4XVJH 2WXPA 4DP7X 4AJVA 1GKOA 5BW7A 1DBJL 2MH4A 3B9KD 1ZHNB 2CJSA 2OMYA 3MV7D 3PY9A 5LBSH 4QGYA 3JTSA 3IMSA 3KPLA 2A9MH 4LCWD 4AEFA 3U7YH 5JNYB 3PWJB 3BKYH 2L3BA 4CADB 1BJMA 5HGDA 1U95A 2VRKA 2BSDA 2H2PC 2EINB 2Y5QA 4AKPA 3WEXB 4PJAB 3AS0A 5LAXA 3US0A 2WMPB 2E9JA 1F5WA 2WLHA 1CJYA 4FA8A 1A3LH 4WTXA 3ZVVA 2NSQA 5IB2B 5CCJA 4JFVA 1K2DA 3FQNB 1DR9A 3M46A 1X5ZA 4B27A 1G9ML 4YDJA 4IDJL 1KJ3L 4HUKB 2AZAA 5DJ6B 2J1XA 3QUMB 5IJKC 3S36H 2W8CA 4ZK8A 5BV7H 3ME0B 1BF5A 3UXFA 4GUQA 5KJRL 3ULAB 3CHOA 3BESR 1JNHB 2EDHA 3CQPA 1JPSL 3LRGA 4PJEB 2VLMD 3MXVL 1JXKA 4FQCH 4UINL 5D2NE 4KMTH 3VJ6A 5I1IH 1YMHB 1I7UB 1I7RB 1PW3A 3MXVH 4FQCL 1S78D 2R4RH 3TIEB 3NSYA 5B3JE 4WUUD 1CFNA 3BGMA 3UJJH 4NZ8A 1FBIH 3HC3H 1F4YH 3EG9A 1LMKA 4RMWA 4ABQA 1G9HA 4NN5C 4X6EB 4OGQC 3LPOA 1IGCL 1TUPA 1CFMA 3UC0H 4WU5B 2OMVB 4R90L 4ICXA 4WUKH 1YQ2A 1CGSL 1MCWW 4GP4B 4PS4H 4ODTH 4YIQA 4JY6A 3HI1A 1FC2D 4WUUA 3ARDC 3W11C 3U9UB 2ZTBA 4HS8H 4X4YB 5D4HA 4RAHA 3KPSE 5CKAA 3A22A 4LCWE 5AVXB 3W3BA 2ZX5A 1I1YB 1T83A 5J1AB 2P28B 2VDQL 3FO2A 1K3IA 2KT6A 3TF7C 1OARH 1TLMA 2ZOLA 4ZQKB 1AR1B 4Z7NB 5DXWA 4YDKL 5CGMA 2H1LM 1W8EA 2NY5L 1WICA 2P5EB 1BPLB 1OGAE 4JDVB 3LN5A 4X7SL 3ZSTA 3CAFA 4P3CL 3HHMA 1QOKA 4LP4A 5E8OA 4W4OC 3L4CA 4W9FC 1AJ7H 2X4SA 4F7MB 1DQJA 4GQZA 4PG9A 4M7JH 2OMYB 4ODUB 3DIVA 1BD2B 1DQMH 1PYWA 5E9NA 5LJYH 1CLOH 3N43F 4PB9L 4TUJA 5JNYA 2ZKHL 1RULL 1ZIAA 1RIHL 1TZIA 2PPFA 4Y5XC 3EOYG 2D4DA 1R5WA 3KCWA 2IWKA 3ARFA 3JYBA 4LLVA 2DWDB 2OYLA 5KW9H 1QFHA 4ZD3H 2CCLA 3LQAH 1TZGH 3X1NA 2IOMA 3Q2VA 1HZHL 5I82A 1XGPB 3F64A 4FQPA 1KLGB 3HRPA 3CZFB 5JW3L 2X6VA 1QBLH 4PCTA 2BP8A 4P3DA 4ZUWB 5DZOA 2VE6A 1S3KL 4A2GA 2IH9A 2DL2A 3I75A 3CC1A 5F1IB 3LPFA 3W81A 2DQTH 5E1IA 5EF2A 4RGOH 1TPXB 1YEDA 4BA8A 4MJHA 1LP9A 3BUTA 4Q6IA 1P53A 2BXYA 3DXAE 1M56B 5HYQA 3UJTL 3O4LA 2V6HA 1MI5A 2ZWSA 1KPUB 3FUNA 3ALWA 1L9NA 4POZD 1I1FA 3VXMA 2BVTA 2ENYA 2NNRA 4HCIA 4MNQD 4PVBA 1Q4NX 3H55A 2OCCB 3A24A 3JWNH 1IIKA 3CZFA 3N9GL 1A7OL 5CMAA 1BZ7A 2VDRB 4FNPA 5F7KC 2BWDA 2UZXB 1PLGL 5FYKE 2VQ1B 3LPGA 5JOPD 1IILE 1E3XA 3VRLF 3FBKA 2OCJA 4HBQA 4M5TA 3RIFF 3U6RB 3V0AC 4GW1A 1PQZA 2DYSB 3B2MA 3VYPA 2BIIA 4YPGB 3VD3A 3HAEG 3FU5A 1IBBA 5JIQA 3D39E 1H3WM 1UXWB 1XR9B 4R26L 1FNSH 2WWKO 2BVPA 4ZRGA 4QEGA 1JPTH 4AM0B 2C3WA 3F5WB 2R1WB 2XVGA 4I1NB 2ZOUA 4LSPH 2A6KB 4XPBH 1A25A 4J3TA 4QR7A 1FUNA 4QRBA 3PLYA 3IDXH 4I9WD 4BUHA 3APFA 3KPRB 3M1OA 4E5XB 3QNZA 4JM4H 1N68A 4JM2D 4XNQA 1XF5A 2B5IC 1KPVB 3DO4A 3SDAA 4XP4L 1AHMA 3CSYB 3T4YB 3BXNB 5DGQA 3UDWA 1Q9WB 1INQB 2IVFC 3DIDA 3E6FA 3H2WA 4P23B 3OZ9L 5FOJA 4CN1A 1B2WH 2PO6C 4R4FL 5HDQH 1J5DA 1CWVA 4B6ZA 5KEZA 3O9WC 3KZ8A 5LXGH 1ILUA 4F3FB 1AS6A 1OAXL 4WTZG 5I1EH 4J23A 1CLYL 1LNUA 1OM9A 3RL2A 5LWYL 1E8WA 2FR4B 3CC5B 1B4LA 4K94L 4MAYA 1DANU 2Z1KA 1QNZL 3QZWB 3BAKA 3BX7C 4JHWH 3KWWA 3X17A 5EU4B 5D7HA 4RFOH 1TSHA 3PWLA 4UCFA 1QVOB 2JCWA 1QR1B 2WIIA 3BN3B 1KPVA 1NOLA 4BFFA 1S5IL 3TT1H 4J7RA 2Q5BA 1DVFB 1PLCA 4KTGA 1Q9WA 4P23A 4WEBL 3WKML 4NAQA 5TFSH 4NO3A 4L4JA 4FXKB 2V7HA 3LRKA 1MPAH 2CSPA 3GBMH 2HJLA 1KLUB 3SHSA 1SMAA 4D0BB 4I3SL 1RD6A 3NJNA 3GMOB 4F2FA 4ZW5A 2IC2A 1ZEAH 2NTSP 3VXQA 3K6FA 1SN2A 3PABA 3PWVA 4XMPH 2JXMB 3QFJD 4PB0L 5D6DC 5EO1B 1KB5A 3DXAB 2H0PA 4MBRA 3BZ4A 5C8JA 3L13A 1ANUA 1EUTA 4NBYB 4UQCA 2QQNH 2ZWYA 1LK2A 3O11A 4NZUH 4UAOB 5K9QI 4X9HA 1Q0XH 1GTNA 1N3NB 2EEFA 3P9LA 5I1JH 1G1KA 3NCJL 4NWTL 4PEEA 3SOBL 2NY1D 2QVFB 1LO3H 2EIKB 3ES6A 3QDGE 4RIRB 3ZE2F 1FYTA 2WLJA 4JZNA 5J3HC 3S98A 5F9WC 3T3MF 2W59A 4A7UA 4AJ0A 5LNGA 1L6XA 4K3DL 3SPVB 1TTUA 4G8FB 3MNZB 4PJ7F 1YEGH 4D0BA 5B3JF 5E2WH 1YDPA 3BFOA 5GGSB 2XV6B 3TO2B 1FE8L 1YEFH 3K5RA 3QI9C 2BY2A 2PF6A 1JOIA 2ZX6A 2ZAHA 4AL8C 5H4ZA 2L8AA 1UZ8B 3TYGH 1MPAL 4HCRA 4KMQA 1JCKA 4ELME 3KVDD 3O6LH 4RFNB 4N68A 3SQRA 1E9PB 3FUEA 4OCWH 3A23A 1IGJA 4MQSB 3BKJL 3GMRA 2B5IB 1D9KD 3L2LA 4U1HA 4QO1B 3O2DH 3P2DA 3OPZH 3VB9A 1J9CT 1NKGA 1WD9A 1QEXA 2E5EA 2YUXA 4PTUA 4UZGA 4TUKL 3QK0A 3V0DA 3LZLA 1JDDA 3O8XA 4PJGE 3I9GH 3TLRA 5DVLA 1NGXB 4M1DH 2EDXA 3QJOA 4PSRA 5FYKU 1R17A 2VLLB 4NQQA 1LLAA 4FGMA 2VZVA 4B9IA 3AJ7A 2A0LC 5I1EL 1EEYB 2CO6A 2EAEA 4LSVL 4R8WH 2VXUH 1HI6B 3MJ6A 5DK3A 4MAZA 1VDGA 3ZKXB 5AOJA 1ZA3B 5I1LA 1AKJD 4NJAL 1C9SA 3SDDA 5D1QA 5IJCC 2F7OA 3BWSA 1U36A 4PM1A 5C0CA 1A7NL 1GYAA 4X98A 2WQRA 1NFDB 3QORB 1O0VA 5D1XC 3UTQA 4F15B 1R3HB 2ZYHA 3MO1B 3WEOA 1KGUA 1DVFA 1BOGB 1EZUA 3CVHA 1ZXKA 4N0CD 1CUOA 3WKNA 4ZG1A 5DMGD 3B5GA 3APCA 3MFFA 1AVAA 1NGQL 1O9VA 2VDRL 3S35X 1FZJB 2GYSA 4PY8J 5D5MF 4YMPA 2KLTA 3KPLB 2IWEA 5B1AB 4KWUA 4F7TA 4F93B 3LMJH