4LO9A

Human p53 core domain mutant n235k
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
194
structure length
194
Chain Sequence
b'SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
molecule tags Apoptosis
source organism Homo sapiens
publication title Structures of oncogenic, suppressor and rescued p53 core-domain variants: mechanisms of mutant p53 rescue.
pubmed doi rcsb
total genus 46
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4lo9A00
3US1A 4IBTA 5AOLA 4HJEA 3EXJA 1T4WA 2H1LM 4GUOA 2J6WA 2OCJA 2IOIA 2AHIA 3Q01A 5AOKA 2GEQA 1CMOA 2XWRA 4G83A 4IBYA 2ADYA 2YBGA 2MEJB 4G82A 2BIQA 5G4MA 1CO1A 3KZ8A 4MZRA 1UOLA 4L0ZA 3WTWA 3IGLA 2FEJA 1HJCA 2XWCA 3VD1A 4KVPA 3D07A 2J1WA 5LGYA 3D08A 5AOMA 3US0A 3D0AA 3VD2A 2J21A 4L18A 2IOOA 4IBUA 2RMNA 4LO9A 4IBWA 3WU1A 3KMDA 2BIOA 4AGOA 5BUAA 3Q05A 2X0UA 1TSRA 3TS8A 1H9DA 3EXLA 3QYNA 2ATAA 2WGXA 2PCXA 3WTXA 4GUQA 4AGMA 1TUPA 2IOMA 2J1XA 4IBSA 5AOJA 4IBZA 1HJBC 1EANA 5AB9A 4LOFA 3WTYA 3D06A 3QYMA 5KBDA 4XR8C 4AGNA 3ZMEA 4AGQA 1GZHC 1LJMA 1IO4C 5ECGA 3Q06A 4QO1B 5A7BA 3VD0A 4AGPA 5LAPA 1YCSA 4IBQA 4L0YA 5ABAA 2J1ZA 3WTVA 1GZHA 4MZIA 4IJTA 2X0WA 2VUKA 3IGKA 2J20A 1KZYA 2BIMA 3D09A 3WTSA 1E50A 1EAOA 5G4NA 3D05A 2X0VA 4LOEA 2BINA 2P52A 5AOIA 4AGLA 1EAQA 3WTUA 5G4OA 1HU8A 2J1YA 3WTTA 4A63A 4IBVA 2BIPA 2AC0A
chains in the Genus database with same CATH superfamily
3GWJA 4B9YA 3UEZA 4JRFA 2AKRA 2V2XA 3QS3A 4JE4B 4JFDA 2ZUVA 4RA0C 4Z7VE 5CEZD 1QBMH 2X12A 3IJ9A 1URLA 1AZNA 3UIYA 4Z7IA 1C5DA 1HIMH 3LNIA 1XXFC 3A4FA 2PWFA 4BKLA 4U7SA 4XP4L 2NQDA 4NN6B 1K3IA 1RXLA 2ZIDA 3IF1A 3LNDA 1WH0A 3UBXB 5FXCH 5M94B 4RH4A 3J8F7 3WDJA 3QEQA 1NFIA 2AK4A 3VI3A 3AJ7A 2GIXA 3T71A 5HDRA 1UURA 1JZEA 1N7MH 2YPLA 2EO1A 2YIHA 4LLQA 3S5LB 3C5SB 4P2RB 4L1DA 3A67H 1ASOA 4C56B 5L8LB 3TOPA 4OLZL 3ZO0A 3V9FA 3VRLF 1RL1A 2MQ3A 4GJTB 4JHBA 4N2LA 4V33A 5GIRA 2O6EA 1LWJA 4HU8A 4QNPE 4YDVA 2NTFA 4IOSD 1X5YA 3E1ZA 3BVNB 1IKNA 4JM2D 3CQPA 3BDXA 3H7LA 5I0VA 4PJIE 4BHUI 1F90L 1FYTA 2ZCHL 4Q6IA 4JKNA 2BOCB 1MHEB 1GHFH 4RAVB 2WGXA 3UGUA 3QUZD 4HJJL 3EYOB 4J3OF 1H3VA 5I1KL 1P6AB 2F5AL 1HTYA 4MS8C 5EUKB 3IGFA 2AVGA 3UPRB 3DGGA 4EOWH 2XN0A 3QZOA 5AYUL 1ESOA 1DTUA 3NA9H 4M7LT 3U79A 2EP6A 3G5ZB 3Q5OA 1YMHB 5HDBF 5LKNA 5H4YA 1E7VA 3B9KB 3C6LC 4BV1A 3BP5B 2NX5B 1M9SA 2CD0A 5F9OL 3WE6B 4I9WD 2XTJD 3X3GH 1I1RA 4PJFE 1TEFA 3QDGA 4O2CB 1C08A 2CH8A 3T9WA 5ICYB 3LEYL 2R1WA 3B7UX 1NMBH 4H0LC 4W4OA 2E9WA 2F6AA 4A38A 2ZXWB 1PU0A 1QSED 3BWUC 1UWGH 4JO3H 4HCGA 4GINA 2XVGA 2DTML 2DLEA 3KPNA 1M1XA 4R7DA 1IKOP 5EPMA 1NGPH 3T0XA 3QFJD 1TITA 1DZ0A 3HKFA 4JJOA 5EU6D 2SEBB 1O9VA 1IGYA 3RZCD 1IL1B 2EVIA 3OF6D 4JO4H 1TCRA 3EGSA 4XNQA 1JZ6A 2OCFD 2P7TB 3BESR 1TTBA 3P40A 4EI5C 4F2EA 4AVHA 5DMIH 2FO4B 2IWGA 1N6QL 1X4YA 4WO4B 5KANG 5I6OA 1JPSL 3ARYA 5C70A 4L1BA 5T33L 1CO1A 2NXYD 2C9PA 1P7QA 3UZVB 2Y07H 1WAPA 4CC4A 3QUXA 2JCCE 3RAJL 5IW1A 1MJJB 4XX1E 2EIZA 4FQPA 3ULVL 1QTYT 5H8DA 2DQTL 3WGVB 2VDOL 4I2XB 4OZIB 3ZHLA 3MRQA 1YNKH 3HE6B 4YIQB 4F27A 3OMAB 3MV8E 1BJ1J 3GDBA 2R1YA 4YNYB 5JHLA 3FK3A 3SBQA 4G5ZH 3QQNA 1CFVH 2HJFB 1L9SA 4OLUL 4CW1B 4IBWA 3FUMA 1ZK9A 1KMGA 1O75A 5L4JA 5AVQB 1MJUL 3RWEA 1U95A 2FX9L 3QZBA 2B14A 2Q7AA 2VH5H 5D1QA 2NY4C 3RNKA 1NGZA 4L3CB 4Y19E 1ES0B 1UFGA 3GXDA 3LPWA 5LN4A 3GBML 1NLDH 2VITB 4X8CA 1FO0A 1DBJL 1CICA 1H5BB 3RVUD 1N68A 1E5UI 2ZKMX 4KZEL 4GRLD 1PVHA 3PWJA 3EG9A 4OJEH 3Q8CA 4IKKA 3BWAA 5FCUH 3U2SB 3VFGH 4FI6A 1V5JA 1ETZB 5E4EB 4DO4A 1NAKL 4R8WL 3MACL 4GW1B 4NDMA 3P0VH 2LABA 4AT6B 4AENA 5FOBA 1ED3B 1DUZB 1RMFH 4Z18A 4NIYE 4AEFA 4E2OA 5I8OL 4KJQD 4OJCA 1TYJA 2H2PD 5DWUL 3MR9A 3UC0H 3A4AA 3CFDA 2VL4A 1LE9B 1BYNA 5ANMA 1OGAD 1JL8A 2ZUSA 1HXMA 3TPUA 2CK2A 4KJPD 3HBPA 4PJFA 2DQIH 1Z9LA 1A1OA 2IGFL 2MMXA 4PI2A 4U0RB 4HWNA 1FORH 4QHLB 2Z7UA 2GIMA 3PWVA 1JWSB 4Y5XA 1J0ZA 1JK9B 1NDTA 2Y25A 4NM8H 1ACYL 2VZUA 3ZE1E 1AD9B 1Q38A 4A68A 4K7PL 4ZT1A 2X05A 3CFDB 1LE9A 4QXGL 3HC4H 3ZHFA 3EJPA 3ZTJH 4P23A 3V0AC 2R1WB 3B56A 3F05A 3DX1A 4XHJC 3SKOA 2A74B 4L9LC 1MCRA 5EC1A 4K71C 4Z3EA 5IREA 5I8CB 4KO5A 2OMUA 2PW1A 4DEUA 1YC8A 1OAJA 4NGHH 5FYLL 1HE8A 3LRLA 1PDKB 2F7RA 3HHMA 1G7PA 4P23C 5C9JB 1X5AA 2VW4A 1RSFA 3Q44A 3VI3F 2C9QA 4DP7X 2ALAA 2E7CA 1F6FB 3QCVL 4CMHB 2ZKYA 4LEOB 4FTVA 2IVFC 4U6VL 2IMMA 5IQ7L 1B2WL 3CXDL 5IT2L 2VSMB 2EDDA 4JMXA 4XWOC 4ZS7H 1S3KH 1UA3A 4ZDHA 4HUWA 5D55A 4DTGH 3GYRA 4TPRL 2YK1L 5JXEA 4ERSH 4ABQA 3SD5A 2B4CL 5EMYA 4PIBA 1JVLA 5DS8A 3HEIB 1KT2A 3BAKA 2Y1YA 1EZVX 4Z8FL 4OZGF 5DC9B 2YAMA 1YRKA 4E41B 4IRSC 3AWGA 5D71L 3HN8A 2GJ6A 3Q43A 1PZ2A 4WGVB 3ZE2E 4N0CD 5K69A 1DQLH 5HDBB 4ZQKB 4GUQA 5JQHC 2AJYH 3FW6A 2NNRA 3SGJA 2CRYA 4AIZA 3MGAA 4PGJA 4NCC1 4FLQA 1AY1L 1QASA 2MQCA 4ZNCD 1UWYA 1ULVA 2VRQA 4LLQB 3WNNA 3NT0A 5C6WH 3O6KL 1INDH 1HFUA 5C08A 4J3OD 1Z2KA 1C7TA 2WXRA 2Z92B 4PMEA 4EBQL 1NQBA 2H9GA 4ZMPA 5LXGH 1DFXA 3RNQA 3ZK0A 5FECB 1NSNL 2WO4A 3KPRD 3D2UA 4NUMA 3SQBB 5TDOB 4UTAA 5H37H 1QEWB 4I18B 2Q5BA 3U6RA 4L9LB 4NZFA 2ICEA 4DGVH 4DN4H 1KACB 4PREB 4UT9A 4AK2A 5I1AB 2EC9U 2JCCF 5FR3A 5J1SC 1UYWL 3H9SD 5E6RB 2X70A 2E4FA 1O7DC 2J8UF 2APVA 1V7NL 1OT4A 4PWJA 1TZHA 3ZX1A 1KIPA 1RULH 2P5WA 3WY4A 3L4TA 4ZO7A 4AL8L 2BY3A 4O58L 1MCPL 4PRHA 1CIDA 2CLVB 4R2GB 3C8KB 2ICWB 1H3PH 2H9GB 5CFHA 4IOFC 5B38A 1BXAA 2AC0A 3MBED 3GD1C 2WYHA 3AY2A 5BRZD 5J6GB 2NY6C 2NZ9D 3WCYA 4QI3A 3ZHNA 2NXZB 4G43B 4WY7H 5A40E 1G6RL 2F54A 4DEPB 4H1LH 3FU0A 2YPVL 4D0DA 4XNDA 1LEKB 1MAJA 3C8KA 3DO4A 4F8TA 1TZIB 4O02B 5DHXB 1Q94A 4G83A 5AAWC 4Z7WF 3L9RA 4UOQA 4J4PC 1SDYA 3WFBL 4RZKA 4KNQA 2YWZA 1RERA 1IGTB 5I1EH 3VGEA 4V1DE 4ZX3A 4FQJL 3UMTA 2VTFA 2XQ0A 4APQA 5C0AE 2MFNA 2VLJB 4PJBB 3QG7H 2E9GA 4KKPA 1AVAA 1MCWM 4UM9B 4L05A 4KVPA 5FGSA 3NA9L 3QXDB 2A5UA 2EC8A 2V8LA 1JHLH 2CBPA 1QO3B 2HVKA 3VXOA 1LO0H 2VN5A 3L48A 5FO8A 5L4MA 2NY3C 2WBJC 3GLDA 3OKDB 3WJLA 4K71B 4JZJB 5KUKA 2B9BA 2F54D 3ZE2B 3RL1A 5GS0C 4KX8A 4OI9A 1VJSA 4C56A 4CN4A 5KSBB 4XNAA 3F64A 4FMVA 2EIJB 1BZ7B 2ERJC 1BOGB 5GJTH 3T6VA 3FFCD 4UT9H 4LCWA 3ARDB 3MGOA 3D34A 5GGQH 4PGEB 2FT7A 1J8HA 3AY4C 3KGRA 2VDRH 3FF7A 5C0CB 1MH5B 2YD2A 6CGTA 1QHQA 2ZE0A 2V8MA 3DV4B 4KK9D 1NCWL 1BQLH 1KCKA 3KDMA 3PFUA 4PI0A 3HLAA 4KTDH 4UAOB 1EJOH 1U8HB 3A6OA 3CN2A 3AXHA 3F01A 2JH2A 3PF2A 4P2OD 3GQFA 5KYNA 4LLUB 4OCWL 3RDTA 4LGSB 2KZBA 2PR4L 5FV2A 1CFSB 1TFHA 3GMRB 5D7IF 5GGTA 5EORH 3TEZA 3OKOA 5T5FA 1C8PA 1GY2A 3N85L 2N3JA 1HSBA 5EIIG 3IFOA 1CUOA 3K6IA 2O6CA 4XBPA 2Q7NA 4KJYA 5FUOH 2WUBH 4BFNA 1A4KA 4KHXL 1FVCA 2YWYA 3TWCL 3B34A 2J1ZA 4KC3B 3R0MA 1I9IL 4QTHB 3NK3A 2AJVH 4YUEL 3NSYA 1YNLL 3BWSA 1HL9A 3IJ8A 2H45A 4FTVB 2HMIC 1DUZA 5EA0L 4C8XA 3IN2A 1JK8B 3NSFA 4PG2C 3T09A 1HVXA 4H26B 5I82A 1YEFH 3VQ1C 5CJOH 4S1DC 1FFOB 5J8OA 2HTKD 3V6OA 2WTRA 4AM0A 2VE6B 3RPIB 1V54B 4TMPA 5E99L 2KKQA 2D3JA 5F3HA 2J88L 4PJDF 2F5BH 5KVGL 5T5NG 3CSYA 1QATA 3E7JA 2WXPA 3ARBB 4YDJB 1JTOA 2FJGA 2HFGH 3H9YA 5D6DC 4H8WC 1A6UL 5I74B 5DU7A 3MOQA 4JFOA 1N64H 1E2VA 3T8MA 2PP7A 3TA3C 2BVYA 3PGFL 2G3ZA 2HN7A 4B95C 1NAKH 4R8WH 3OPUA 1YVLA 4GQ9H 2CR0A 4ZO6A 1EZLA 3MUGB 4YLBA 1AGBA 1N67A 3AG4B 1HXMB 3VJ6B 5B1JC 4OV5B 3IKCB 3RPBA 1ACYH 1OHZA 5EOCL 1KCLA 2GITB 4M7KL 1ZDQA 3RE0A 4G8GD 15C8L 4G6KL 1E2ZA 5CHNA 3D0AA 5DZOA 1DBML 3QUXB 5PCYA 4BQBA 5BRZE 1YQVH 3C60C 4Y4KD 4UNIA 4HJ1A 3ILQC 2E56A 3WXWH 4Y5YC 1BWWA 2IH3A 3L4CA 3NFPB 3Q5YA 3O8XD 2X3AA 1H19A 5CCKL 2H0PA 1NOFA 1UM4L 2VDPB 4FOMA 4NERA 1FJ1B 3WN5A 3TYFB 3MUZ1 1MCOL 5I15H 3VH8G 3VMNA 2FHFA 4Y5YA 2FWOB 5KBPA 4OVVA 2NW3B 2F74B 1RUPL 2HT2D 3CIAA 3E3QC 4BCXA 2GK2A 3DHMA 1IUZA 4ICXA 5GGUB 2VZ1A 3LXCA 4XRCB 2EDQA 4Q89A 4KI5D 1ERNA 3GDCA 4GKZA 3TCTA 5B1KA 2ZSWB 4WWPA 1LMIA 4GXUM 3KS0H 3R18A 4E42B 3U83A 4NGHL 3BWUF 1QYGL 2D7PA 4TUKL 2V5SA 3S6CA 5I66B 2AAAA 1L3WA 3RWJA 3D3VA 2VDLL 2E9JA 4NBZB 3ECWA 1W0VB 4XZUA 1INQB 3R1GH 4KBPA 4OB5L 4WHDA 3UG3A 4PN6A 2IMNA 2FJHB 4HS6B 3VXMD 3E2HB 4YHZH 5CKAA 4DUVA 3BE1H 3C5JA 3D05A 4GXFA 4UB0L 1MEXL 1XB3A 1QFWH 4OY9A 1AP2A 3WMPA 4JJ5B 5FKAB 4ERSL 5GRYA 2ZUTA 3FCUB 1N8ZA 5BZDB 4GXUN 5D9SB 3CBKB 4MJHA 1XGYL 2AJYL 4NQDA 4P4KD 3VE0A 2FBOJ 2XQYG 2OR9L 3Q1EA 1N0LA 4E9VA 1OAQH 4H13C 2K4AA 4B9IA 4DESA 3ATEA 3U48A 5CBEA 1KCSL 4JFHE 2HFFA 2P24B 4LVHC 4A2HA 7PCYA 2APXA 1B9ZA 1E90A 3V9EA 1PMYA 3C8HA 2YD1A 3VFOB 1KFGA 5DO2D 3ZYIA 3VXRD 1UYWH 3TASA 3GSXB 3MREA 1UOLA 3ATBA 2DQFA 3ESMA 3PP4H 3AQZA 2MRYA 1E43A 3MRPA 4G80B 4X7TB 3X14A 2F7QA 1DEEB 2O5XH 2AXWA 2HG0A 3BKCH 2WVUA 3LQZB 5JO5B 1L6XA 3T0VA 2AI0H 2M1KA 4JRYB 2B59A 3QUYA 5CR1A 1GYUA 3ULUH 2X4NA 1MJ8H 4Q0XL 5F70A 4ABWA 5C0AA 2QADC 1GGUA 3QJHB 4UOW1 3J27A 3WEMA 3BPNB 1CICC 3UBXA 4UT7H 3R8QA 5IG7A 3QNXA 4KV5E 5D4QA 2BY1A 5EUKA 4PHZA 5BRZB 4OCLC 4NO0B 3KWXA 4ZUVA 2EDMA 2P44B 3O3BA 1M2VA 3QULB 5K59F 3K6DA 3MREB 3M45A 2ARJQ 3GJFH 4P2RD 2H32A 4N8VB 4AQEB 1RIUH 3ILPA 3C5ZB 3QQ9D 2Y36L 1FRGH 3OGCA 3UZEC 4FABL 3FH5A 1TKWA 1NEZB 5CBEB 3HZYA 4CN1A 4NHCL 3K8MA 2MPVA 1J5DA 3RWFB 3T65A 2NR6C 2F15A 1NCUA 1WGOA 1ZA3B 1ZHBB 2VZVA 2R4RL 1KLFB 3HC3H 3P54A 3MC0A 3O41A 3FPYA 5J3HC 2ODIA 4FNLL 4P3DB 1IC0A 3VXSE 3U7AA 3X1NA 1WBZB 2VC2L 3KEDA 4XP4H 3CFUA 3SPHA 3QEHA 4O02L 2O5XL 2A2QT 1JYNA 2EDLA 1HL8A 1OSZB 1MCKA 1IFHL 1UCTA 4P4RA 3FTUA 3GZQA 2F8VA 3S36L 5DWPA 2ROYA 2VXQH 3MMEB 3HAEB 1N8OE 1LO5B 5DMKA 3ETBJ 1YPZF 4DETA 3CDCA 1SLVA 1CURA 3N40F 4NO2B 3Q1SL 2WC7A 3T2LA 4GAAA 4TUUA 3RB5A 5CEZH 2CGRH 1U3NA 3P4MA 1G43A 3DJ9A 4KI5F 3QEUA 1K6QH 2FATH 1KXTB 3WXVH 4ZMAT 5T3ZE 1G9MH 1SLXA 1NCBL 3KL0A 1MJ7L 1QW8A 2ATKA 2NNAA 5EZJB 1M7IB 3CPLB 3MLWH 3FN0L 2A6IB 4I0PB 5E6IB 3P4LA 5DUPL 1EAPA 2JELH 5BVPL 1P6FA 2IFFH 3UJTH 4KK5C 2DQMA 3H0TB 5HHXH 3GFUA 3THML 3T5WA 2JSFA 1H8OA 1QI5A 5D1XE 1IILE 3T8VA 2WAHA 4DGUA 4MNQB 1FH5H 1RZKC 1SY6A 2Y2WA 3CH1A 4XRCA 1GYCA 3L3DA 4YHIA 4JM2F 5DR5H 3A0OA 2BRRH 3QIUA 2RQEA 5EG6C 2Z4TA 3IAPA 2CHWA 5D2LA 1L7TL 1PPIA 1G9NC 4PVBA 5HGAB 4EZLA 5F6HI 1U92B 2VLLB 2FEJA 4AVJA 3WUWG 3AABA 3MUUA 1KF9B 3BI9X 5DFVD 1GIGL 3PPSA 4XVJL 3QORA 5LBGA 1CGSH 3HS0A 1JJUA 1YUKB 1UWGL 3MRRB 5LGYA 1O6TA 2W9LA 2IPUK 1X5XA 1I3VA 1P5VB 1T66C 2ARWA 1M1SA 1C5BH 4YDIL 2DMKA 4LU5L 4YR6B 1QZ1A 2G75A 3D25B 1W6LA 2A9DA 4OLYL 3QUXD 4NZRH 4NKIH 3L3DB 3L8QA 1BMGA 2OMVB 2J71A 3BAIA 2Y5TA 3UX9B 3FRUB 4JN2B 4XPHH 1DQJA 3WTXA 4NNPL 1LLAA 3MTXA 5FK9A 3L7FB 1MHHB 4QRRA 2CLRA 4U1MB 4IGBB 5B39A 5BVPH 2F5BL 1HWHB 4OCSH 3ES6A 4OFPA 4OGYH 4X8JA 3M6DA 4L3EE 3VXME 4J23A 1PLGH 3H4FA 2HFTA 2CUAA 4I77L 1MWAB 2AJZA 4MQXD 1YEEL 3VFSB 4P5KA 1GGCH 3P0YH 2Y0SA 3UTZA 1QLFB 3QXVA 4XNYL 1EHLL 2H2SC 5TQ0H 1U3YA 4ZOCA 2XT1B 5KAQF 5CSZB 3DUUB 1TVHA 2IPKA 1CICD 2F19L 4LVNB 4MZIA 2G5BA 3UGEA 3PWLA 2FL5B 2WQVA 5D6CA 4YBHA 2FWLB 4GO6B 1MJUH 1BLNA 2X4RB 3H3BC 5DZAA 4ZYKA 1XX9C 4F15C 5L9DH 2XKNB 1Z9SA 4J3XA 4NZ8A 4XMLL 3ULVH 3WFEL 1U3HA 2K9UA 3NIFF 3JTTB 3O3DB 5HI4D 5BZZA 4FQ2H 2JTYA 1JFQH 3VI4A 2ITCB 2YGNA 1ZE3C 1HHHA 3V4PH 3L7FA 4QF1A 3L3GA 3MJ7A 5D72H 2PO6A 4KDTC 4JDEB 5A16B 3V0WL 1G6VK 4R97C 2XWJA 1EO7A 1HEZB 3MCKA 4TNFA 5IROA 5HDQL 2FLRT 3AS1A 2HT3D 3CCHB 2H32B 3GPEA 3I6LD 4BH8A 1AXSA 1ODUA 1F3JB 4RGNC 4XPTL 1MF2H 2NLJB 1EFXB 4P4KC 2R0WL 3B5HA 1NDGA 1MOEA 3HJ0A 2P80A 1QQDA 3F12A 4UQAA 2XIDA 4UQ9A 1OSYA 1XZ0B 4M8VA 3VCLA 4AG4L 3IWUA 4YSSA 3UAJC 3BW9A 4ONGL 5KAQG 3BAEH 4F57L 2F19H 1B0GA 4X5RA 3IJ7A 5T1MB 3RI5F 4FNQA 3UAEA 5F7BA 4GQQA 3S2AA 1MEXH 1QVOB 4K7PH 2Z8RA 1D6VH 1NGWA 1AQMA 5DI8B 3ERXA 5HYSG 4XCNB 3QIWB 1M7XA 4YHNB 3GK8H 3TX4A 4NN5B 4OZ4A 5GRZA 1TQWA 2GK0A 4TUOA 3HNSL 2AEOA 4P8QA 4V2CB 5DD3H 3WKNA 5CF3A 4K5NA 1YEGH 3FB8B 4K07A 4WFFD 3DX7A 5C0RH 4MCMA 1G87A 1I53A 4PD4J 5JHLL 4KKLD 3P9WB 2BH0A 4XTRD 3N43B 3O0RH 1ANUA 5FYJE 1GXEA 1ZS2A 2ZAHA 1E28A 2E5EA 3GHBL 2FUQA 4FQCH 1KB5A 4WWKB 2AV1B 3FSZA 4AZ8B 3KAAA 1U6AL 5AB9A 5JW4M 1NC2B 2XOTA 1K4CA 1VEMA 4EI0A 2BSDA 3DSNB 5BRQA 2I7SA 1UZ6F 2NZIA 5JIIA 2HUHA 4HPYL 4A2DA 3Q13A 2YEQA 5CJBA 3U9UB 4NYLA 4PR5A 1ORSB 4TUJB 3JQOB 4M61A 4DERA 2XN9D 1BBDL 1EHKB 4BYHA 3B1TA 4RWYH 1GYAA 1N6UA 3EGDB 3GSQA 4J3OH 1ONQB 3S8FB 2WLYA 2G5RA 1DN0B 2UZPA 3ULAB 1ZANH 1VFUA 4L4TA 5L2KE 1WZMA 4U6VH 3ZKXC 3I9AA 4G6JL 4X7CC 3QDMD 4P57B 2QPUA 3IWVA 2Q3AA 1PF3A 1E50A 4LVOB 1SHWA 3RWGA 3ULUL 1N9PA 1CR9H 4ONHA 4JFXB 3ZQ9A 3QPXH 4UILL 3OXSB 4YDMA 5L7XL 2MQGA 3HNTH 3HI6L 1F02I 3ZT6A 1RZ7H 2PLTA 1Q0XH 3HFML 5MEPB 4LSTL 5SWQB 4OFYA 4U3XA 4K5LA 5FB8B 2XN9A 2RFXA 4LHJB 4OLXH 3U7YH 2LFGA 1DVYA 2FLMA 4JM2A 1DQLL 3HI1A 4L23A 3JT0A 1HI6A 3PXLA 1DQDH 2L8AA 4ANXA 3UFIA 5MEND 4GRMA 4JFFA 1U8OB 5FYLE 3NBNA 3RA7H 3NA4A 3SOBH 1YMME 3PABB 3PL6C 2NW2B 5HYFA 5KYXB 4JHWL 2VL5B 3CXHK 4MJ5B 5DZNA 3IGLA 2Q10A 2GPZA 2VDKL 4V1DD 2R23A 1RJCA 4OF0A 1L6ZA 3P4OA 2PCPA 5IBUB 4GMTH 4MA1B 2YKLL 5AW3B 2BSSB 4HC1H 5C0DA 4UT6L 4F58H 5FW7A 2FATL 5DD1H 5IMOA 1FO0L 5D4JA 3D52A 4LKCB 2UWEF 5CBAB 1QNIA 4HFUH 4FTVE 2ITFA 3CC1A 4X0NA 2P5EB 2MCAA 3VRIB 3WKQA 1E4WL 1E6JH 1MAML 3LVEA 1QA9B 3V6ZA 3HR5A 1DQTA 1RULL 4J39A 3T6XA 2CPCA 2OTUA 4E5XA 1NAML 5IEHB 5HGBA 3IDJA 3EO9L 2XTJC 1UCBL 3U7WH 2WHVA 3EO1B 5D96C 2QEJA 4X7EC 4HWBH 1KIUA 5BXFA 1JPGB 1QFWM 4H8QA 4JJ5A 4QDGA 4DPAX 1BD2B 2C9UA 3WAKA 1MCJA 3HS0C 1TJIH 3DROB 3FZUD 4UDTB 5IQ9A 4N90D 4EE2A 2YPLD 3AU1A 4QRSB 4QO1B 1BSIA 3WD5H 4WU5A 2IEPA 4ZUUB 5J56B 1WVZA 4W9IC 1Q90A 5I74C 3VXUA 5DQJB 2ARJA 2AJZB 4A7GF 1XGUA 3A21A 3FTSA 1DUYB 2KT6A 3PL6B 4L8SA 2OL3L 4HIPA 5DJZA 3D4GA 2Y2TA 2BVEA 1BVLB 1C5CL 1UT9A 2OR8A 2P46B 3BC9A 3MTRA 3O11A 5KSAA 3CC5A 1P5UC 4TNVK 1EAOA 2V3FA 3I6GB 5I5RA 4LLWB 1CLYH 4NKMB 1LP9B 4Q9RH 3U46B 2P9RA 2EXWC 1MVUB 4M8QB 1B0RA 2ESVB 2NY5C 3JTSA 4OLYH 1BQHA 4AH2B 3UZQA 2QVMA 3OAUL 4PJGB 4Y5YB 4RMRA 4S1QL 4LGRB 5HVFB 2IXQA 1V3MA 2BC4A 3EKCA 2CWRA 4QMEA 3MUJA 5E08L 2APTA 2PXYD 1BDYA 4TTGA 3BXNB 4YEFA 1EZSA 4OZIF 5AKRA 5GRXG 5KVDH 3D18B 4KI1A 4M5ZL 3F5WA 4OGXL 5DLMH 4LSUH 1MY5A 4EAEA 2JLPA 4FZ8L 4YXLH 3TTYA 1KIRB 1C1EL 1FZKB 3ARDA 3CDFA 1IGIL 4AJYV 3VB8A 4FRWA 3A23A 4GAFB 5G4MA 1J8KA 4LAJH 2V5RA 1UACH 3IGAB 3BJ91 3JTSB 4YHIB 5I6NA 2Y69B 3MXVH 3UC0L 4B9FA 2K8QA 2GT9A 2CXKA 1JHKL 4A2MA 4LP5A 4ACPA 1KJ3L 5D7LE 1A3ZA 1KYOK 5SX4H 1T22B 3UERA 1ZSHA 2WXNA 2BHYA 3GBDA 2GG1A 2A9MH 1Z9OA 3OX8A 1AOHA 1FGVH 5KYWB 2FHCA 3FHQA 2DV6A 3DC0A 3LEXA 1OPGL 1IGTA 3HZVA 1DLHB 2PYEE 4HHAB 3SB3A 3VGGA 4GQZA 3QJQB 4W9JC 5LQBH 3WEAA 3BAJA 4LL1A 2Z0BA 1M42A 4PJ5A 4WTZG 4BWTA 4BZ1H 4UDTA 1LO3H 4APQC 1TQCB 2FD6L 3OBAA 4GPVA 1U8CB 3IJYA 3LRSB 1ACCA 1CDYA 2BOBA 1JK8A 4FF9A 2OW7A 3S0PA 2B0SH 5E2VL 1NGYB 3FTGA 5KSUB 1OSZA 3W5MA 3EO1A 3A6BL 4U4IA 2Y1AA 1AE6L 1JMZA 2WBJA 3O2VH 3DGDA 4OD2B 2R2CA 1RZPA 3QUGA 5GRUL 1OZUA 1FL3A 3APMA 5L2KD 3KBHE 1KJMB 3QPKA 2VXVH 1XR8A 3NCWA 3QJOA 3NMEA 4XO4A 1OAZH 3SE3C 3WTVA 1XSIA 1F97A 1RZIB 3GMLA 2YAOA 4AL8C 1TZAA 5CNHA 3QJZA 1G7QA 5E5LA 1WBXB 3MRLA 1G7MB 1NAMB 1G1KA 2YMXH 3EYQD 5F9WC 2BP5M 1OF0A 1D6VL 4RLDA 4E5XG 3D2UB 3C87A 3RDTC 1FL6B 4FQXA 2W38A 3WNKA 2FJUB 4XP1L 1P6WA 3MV9B 1KENL 3U30C 4A2EA 4JDZB 2NPLX 3GO1H 1MIEL 3QFDA 1XHHA 2ADIA 3KLAA 1HOEA 1QLRB 5HHPB 4FP8H 4JKLA 1NGPL 3O4OC 5DHDA 5AAMC 5AZEL 2JJUA 4LASH 4M02A 3VQLA 3NEXA 2WWMD 3IK2A 3MOBL 1AHMA 5DXWA 4F7EB 1IZKA 3QORC 4FNUA 1OAXL 3MRPB 4G80A 2XN9B 2AQRA 4OD3L 5MI0C 3ZL4H 3EHBB 1L7IH 3RI5K 1S78D 2UXTA 5B1AB 3KZ8A 2RQ8A 3UYRH 1QRKA 1XR9A 4Y2DC 1IFRA 3QDAA 5FOJA 1YEDB 3CGTA 1P4IH 2XX1A 3G6JE 3A67L 2GYSA 4YHYB 1CVSC 5GGSA 3VO0A 1A6VL 3CD4A 1E2WA 3PHOB 4HXAH 1J5OL 4QKTA 3A3YB 2IV9A 3FQWB 3QNYA 3PDGA 3QRLA 1YDPA 2BP3A 3BQVA 5IMLB 3DYMA 1ZHNA 3MLXL 1JPTL 2WYIA 4ZUWB 4PSRA 4PRDA 3QXTA 5E1QA 4JDZA 1ADQH 3RFZC 3LRSA 5J6GA 3RGHA 1NFIB 3QAQA 4B9CA 4PP2A 3LH8A 4ZRGA 5FGBA 5B1CA 1Y7VA 3E6FB 4P3CL 1WAEA 4HP5A 2L7UA 2VXTL 3MNVB 3W57A 2QGEA 1U3JA 3LN9A 2H2SD 1CS6A 3WSQH 1N0XL 5KWYC 2J8HA 1EVTC 3TCLA 1R34A 5KVDE 1UADC 4NSKB 2B77A 3CDYA 1MNNA 5F97E 4WK2B 3DHPA 2YMTA 2A83A 2G2PA 2YSSA 3LXBA 5E7FA 4GUPA 3MRHB 5TF1H 3I6KB 4HJSA 1FQ9C 1HINH 4Y5XB 3B2VH 1JGDA 1FFNB 4AWJC 2DWXA 1U41A 1C8QA 3QE5A 1DSFL 3GTNA 5BS0B 1L0PA 2COQA 2D31B 2GT9B 1CK0L 5BVJB 4YZFF 3AG3B 3EJZD 1KCBA 1X5LA 5EOTA 1QFWI 4MKMA 4PVLA 1BG9A 4PJ7B 3ZE0E 4IBLT 5IJKA 2OJ1A 3FQNB 4AJ0A 4ENED 1FORL 3GXNA 2G4GA 4LHQB 2CIKA 2P42B 5DJ6B 3AGWA 2F61A 2NDGA 4QOKB 1NBVH 3DOSA 1AIZA 3LNFA 3AU0A 5JTWA 4JB9L 5E8PB 4U0RC 5IEKA 1F56A 2FEEI 2V3DA 3D0VA 4ENEC 1XB6A 3U4BL 4KDWA 2PCFB 2YAEA 2P8PB 1THCA 1JGUL 5HHOA 2H2PC 3QQ3A 5E7BA 3ARFD 3MKGA 4O5LH 3ILDA 3G5YA 4TVPE 1CFTB 3DOHA 3MCLL 1IB5A 5IM7A 2J12B 2XWEA 5D1QB 1ADQA 2XIIA 1U95B 1T89C 1DHKA 3OSKA 4GQ9L 4NZUL 4F91B 5H94B 3OZ9H 2HVJA 2Y07L 1QKZH 4LLWA 1CGYA 4H44C 4MJID 4W9DC 5HYQA 1T2JA 3ULUD 1JWUA 2BVUA 3SBWA 2W81C 2AXGA 1JXKA 5LVEA 5LWYL 5AFAA 4NZTL 1JZJA 3UTQA 4LOVA 1EA9C 1LTXA 2ENPA 5FX3A 4Z3JA 3F7LA 2CGRL 3ET9F 5KEZA 1O7VA 2XKNA 1SYSA 2PNDA 3MBWB 3NPSB 4PY8J 2QKIC 2OJZH 5GS1A 1BPVA 2B4CC 1TQTA 3IDUA 3L95A 1NIAA 1F4YL 1BZOA 4Y16B 4NPYB 1C5CH 2AW2A 1EAJA 4UDUB 2OTPA 3P9MB 1OM3L 4A7GA 3WNLA 1E40A 1SY6H 3PWPD 1ZE3H 2WYZA 2GEEA 1RP8A 2D7TL 4I3RL 2CPUA 3PJLA 2BXZA 5HGBB 2E7BA 2VLRA 4DVRL 4Y1TA 2WUCL 2HRGA 4K9EH 1F0LA 1HKLL 2YC1B 2RCSL 3VRIA 5FO9A 2FYVA 2FR4B 2B3IA 2B2XH 3RZCC 2WZPD 3O6KH 3QJFA 2FH8A 3FSVA 2BDNH 4H0IA 4L8CB 4MA7H 1CQKA 4XVUD 1CD0A 4KZDH 2WN3A 2XV2A 3OHMB 4N8UA 3HPLB 4P4KB 4CC1A 1GA2A 5AVZB 5IB5A 1D7DA 1G1OA 5AG9A 2J4WH 2ZWLT 5DDHB 5C8JA 4DT2A 2FQGA 4B9JA 3J2PA 1QFUH 2F7PA 2VL5A 3QDME 5A2KH 5KYXA 4K7PX 3WLBA 4P5SA 3PWJB 2MSPA 3PV7A 3IBEA 1KTJA 4GRLA 4PJ8B 3VXRB 2IANE 5DF0A 4YLCA 3I85A 4GUCA 4JLRA 3BT0A 3MRCA 1AD0B 4HBCH 4APXA 3QZNA 1H0DA 2UZYA 3GMQB 4P2OA 1WV7T 4FZEH 3QPQC 5DVLA 4EUPH 1LQSR 2DB8A 2ZUWA 4ONOA 4ODXB 5GPRA 4MA8L 1J05A 1VF5C 2EVGA 2QPEB 1J0HA 2L7EA 5F1OB 4G3YL 3VNYA 5D1XD 2QMKA 1I8IA 1WZAA 2HVJB 3AT8A 3HMWH 4X6CA 1BQ5A 5FW6A 2I5YL 4MJIE 1QUPA 3BZ5A 1JN6B 5EF3A 2F2HA 1EXUA 1AGFA 1P1ZA 1AQDA 4I48B 4K9JA 1MI5E 4KXZI 1E65A 4JGJA 5JR1H 3NJMA 4WU7B 3U36B 4H8UA 3V7AE 5CD5D 2IDUA 2VXVL 1P7QB 1S7XA 4JDVB 1XGQA 4DCQB 2RH0A 5JOFA 4M6NL 4BINA 1T7ZA 4RGNB 4ECNA 3T4AC 1X4XA 3ZKQD 3RWIA 1BM3L 3E3QE 4N86A 1RIVL 4R97B 1NMAL 3ALXA 3LS4H 3C5XA 3IXAB 1QBAA 2WCGA 4G9DA 3MNWB 2V37A 4XO5A 1XF1A 1JRHI 2ID5A 2RFXB 3ARGD 2ZXEB 4PRHD 3CSPA 1L9QA 4NPKA 2H26A 2D31A 1XWVA 3BKYH 3P77B 2IQ9H 4U6YB 3V52H 3CUPB 2X4OB 1UTDA 3VAEA 5AYUH 4IBZA 1NCHA 3T65B 3LZPA 1E28B 2BOLA 2QV2A 4Q6IC 3PHAA 4AEHL 5M95B 1BMWA 1QLEH 3TBVB 2KI6A 3MOAL 1DL7L 4PREA 1KCVL 4LSSH 4XNZC 4ZS6D 2WCSA 2IQAA 5F89A 3QAZB 4PJHF 5E56A 3NH7H 3O0LA 4HAKA 1A6WH 3VFPB 3T1FA 2XHNA 1CC3A 1SXCA 3HUJB 4NQED 4F7TA 3H9SB 5A7BA 1QACA 1A6VH 3ZDZB 3VNZA 4DKFH 2VDNH 4YSPA 4AUYA 2OMYB 5ITBH 4X4ME 4GBXC 4P9HH 1TVBA 2E0PA 2X38A 4U1IA 1G0XA 5GZOD 5ICZB 3L2NA 4F37K 3GSQB 1P9MC 4MQ7A 3AXIA 3O81A 1V7NH 2NY6B 4W6XB 5DJXA 2ZG2A 4GSRA 1OK8A 4N26A 1IM3A 2PCYA 1G94A 3GMMA 1KB5H 2BS9A 3MRMB 4N87A 4NYLB 4PR5B 4U4BA 5IMLA 4WGWB 3VCLB 2C9XA 4OM0L 2OS7A 3JWOH 4WWKC 4M43H 3PDOA 3RUGF 4X7TA 2QSQA 3B2DC 5IVXE 5CMAA 2NLJA 2APFA 1QOKA 2FBJL 3EYOA 4PVNA 2XG4B 3GIZL 4X8XA 2VRKA 3E8UL 1J1XL 2L3BA 1TG8A 4JFHD 3JZYA 4PRBA 3RIFK 3WLWD 1J8HD 5IW6A 5B3NA 3OHXB 4ZPVA 4QLRA 2ZNXA 2NSMA 1J05B 4ENZA 1EEYB 2I24N 5IVXA 2OJEA 2E3VA 1WUZA 2WZ5A 2DWEA 5A2AA 3IMBA 5DEFA 5IHZB 4K3GA 1NIBA 1RUKH 5GZOC 3ARQA 1U58A 2COVD 5ID0A 5DJ0B 1KULA 3VXMA 2WANA 3CJJA 3PWLB 5JUEL 1ZHKA 5J1AB 2E7MA 4U1KA 1WP6A 4AXWA 4R90L 5I19L 2CUMA 3QZWA 1XZ0A 4K3JH 1CFMA 1VADB 5MENA 1WZ1H 5IB4A 3IETA 4FXTA 3DK0A 3D5OF 3DECA 1ZT4A 2V6HA 3QUZB 2J3SA 1P4BL 1W80A 1T1WB 1OWRM 2YPKB 4KK5D 1IQWH 2O61B 3LMJH 4NOBA 3IRPX 3JWOC 3JYBA 3BN9D 4P4KA 3V4LA 5EBMA 3VXTB 2QPDB 3MUY1 2EE0A 3SPJA 1FFPB 2VKXA 5KBKA 3G6AB 4LBEB 4R2GC 5DJDA 3WUWB 2MKWA 5FA3A 1J1XH 3PUUA 2ZSWA 5EZOH 3LRHA 4S10A 1XL6A 2X88A 2HMID 1PLGL 2WNKA 4Z95L 4YL9A 3VGAB 4CAGA 1YY9D 4PB0H 5F3FA 5BQ7B 5HHMD 1E9QA 2BVPB 3BQUB 5I16B 3NJFA 4HC1A 2D9CA 4RFEA 4B97A 1SMAA 4UTAL 4MAYA 2VISA 1CPUA 5E5RB 3MJ9H 4ALAH 3N55A 4PU2A 4FFWD 2BFVH 2GCYA 1OAKH 4UT6H 3TYFA 4DP0X 4F58L 2O93L 2FL5A 1T3FA 5D6CB 4ORGA 5DEGB 3ESUF 1MWAL 3I9PA 4M6OL 3QDJD 4IOIA 4KJWD 4LNRA 3MRDB 4A37A 4AI7A 1XH1A 5GS2D 5J3HD 4CU6A 4HIXL 1YEWA 1XGRB 2CCLA 1HZKA 5C0EB 3MLZH 4EXKA 1XTMA 1MPAL 4YE4H 1H5BA 2HT4C 4MBRA 1CICB 2ED6A 3L1OL 5CHNB 3ZQWA 3LN4B 4B7LA 5FFLA 2CJSA 1XF4A 1EIBA 3WIAA 2VDPL 1C5BL 1HQRB 1YNTB 3C60B 1OT1A 2RBLA 4PJ9D 1CDIA 5KOMC 1AO7E 5IWLC 2XXCB 3RNKB 1DVZA 4DQAA 2KHAA 3VJ6A 4X5XA 1FNEA 5D1ZD 1NL0H 1SOXA 2A99A 3ATFA 4RNRB 4W9FC 5E99H 3BZ4B 2NY1D 3VGDA 3M17B 3P2BA 3TFBA 5I73B 1DQJB 4G6MH 1DVFD 1EGJH 2Z7ZA 2Y5TB 1E4XI 3HC4L 4Z7WE 2F7IA 3H2WA 2MHAA 2OCJA 2EIEA 4HZLB 1DJWA 2YARA 3KPQB 2YD4A 2VABB 1TU2A 2P47B 3B7YA 1K2DA 3TJEH 2H0JA 5HHOB 4GKNB 5KTEL 2WM0A 2QQQA 2OMTB 2OSXA 2HUEA 3T0WA 1KYDA 1JP5A 2D7MA 3D18A 2D3NA 5D1XB 2EYRB 2P43B 4XC1L 4NN7B 1EFXD 4LNRB 1JGVL 4PW3A 4B50A 4FQ1L 4HT1L 4M7JH 1MCNA 3VU2A 2WQXA 5I1LA 1HCVA 3SKNA 2BMKA 4Q9RL 3SYOA 3BEVA 1JDCA 4Y4FA 3D2TA 5D2LB 3OR6A 4LXFA 4XNMA 4UT6A 4Z7OE 3L1FA 4Y19A 1MUJA 1T0MB 1ZVHA 5F8QC 5AW1B 1GPOH 1E9QB 2JE8A 4JGNA 4XE0A 3SKMB 3WFHA 2HFEB 5F96L 5ACZB 4NKMA 2ZOKA 2KLRA 3HG1D 4UMSA 1ZA3A 2OXGA 3O3EA 4AMKH 3QHFL 1G84A 4GBXD 4PS8A 4QXTA 1O5PA 2ZXQA 4BCZA 1SDDB 3CSBA 3QDGD 2X6MA 2G9KA 4B53A 3GHBH 3ARWA 3QPQD 3LKNA 3C2AH 3CWGA 3LSOB 5EBMB 2A73A 2Z8WC 3QDMB 1HJBC 3MCYA 1N2RA 5LXGL 3VFVB 5ITFA 2MOVA 4KTEH 1U3HD 1MFCH 3RTQC 2ZP0T 1M2VB 2D2CC 2Q2EB 2TAAA 4PJHA 3N1MC 2WIMA 2AK4D 1OGTA 3UACA 3JV6A 3TJPA 1SLUA 1ID2A 3HRZB 4QRQA 1S7WB 4KGLA 3BGMB 4G11A 3SKJH 3UMNA 2MCG1 2XRAL 1DJZA 4ONGH 2MCPL 3MLTB 4LF3A 5FM4A 1XO8A 5ABAA 4OZGE 5F7UA 5IHZA 4HGWB 4XVTH 1GC1C 3DETC 1QRND 1ZLWH 3PIQA 1PNDA 1EUTA 4X6CF 5I73C 2FSDA 4JM4H 1H9VA 1DEEA 1TJXA 3DBXA 4N6QA 4ODWA 4RGND 3S88H 3OAYH 3LQAH 4L3FA 2YXFA 1QO3A 3D69B 4RMSA 2X4PA 4BZ1A 4KROB 4X5LA 2R0KL 4Z7WB 1A7QH 1Y6MR 3U0PA 1RZQA 2J6EL 1PGRB 1MHEA 3QUXC 2YD9A 4PJBA 4K0OA 4QGTA 3DSFL 2TSAA 2J6EA 3QWQB 3V5HB 4YL4A 4HJTA 1BBJB 5IB2A 3NESA 2BHFA 2XU9A 1G5AA 5E2VH 5ICXA 1CXKA 1LMKA 1XTLA 5HI4C 2E7HA 2R0LH 3MV01 1IEAA 2X4PB 3LHPH 4O9HL 4Y7MA 4ZUVB 2Z7YA 1WA1X 3FQ4A 3KCPA 3TN0B 1GKOA 4F7EA 3QA3B 1KIQB 2X89A 3C9NB 2OCCB 4M1CC 5EUOF 5DGRA 4NAQA 2ZTBA 5E1GA 5GRUH 2GB2A 5C0JB 1I7TB 4LAQH 1EQWA 1NKRA 2WLHA 5AW2B 1YMMD 4KXDA 4HKXA 4FQXD 1LL1A 2RTTA 1UH2A 1AP2B 4QHPA 1I1FB 4UV7L 1HI6B 4EZJA 1VACA 5ID1A 5CS7A 1UZGA 2MCPH 3IF1B 2ICWJ 2OLDA 3T8XB 4BGDA 4D9QD 3T2QA 1E6OL 3N0PB 3RWCB 3D9AH 2VN6A 4JEGB 4YSOA 4EDXB 1C5DB 4OLZH 1G6RB 1IIIA 2YOCA 5I9QB 4FFVD 2A6KA 1B4RA 2OQJA 4W68A 5IB1A 2DMBA 2EDNA 4ONHB 4HG4J 3OLIA 2WD0A 1AZBA 3NCYP 5FHAH 1XR8B 2EZ0C 4RAUB 4GG8B 4J7RA 5TDOA 3RLSA 3UBGA 2ZOKB 3LS5H 3VE0B 1PIGA 3TV3H 2XA8H 4UANA 3FB5A 3OAWA 3KYOA 3ZTEA 5B7MA 3HAEG 3BP7A 2VLMD 1ZWIB 1I9RL 2IWEA 1ONQA 1A4JA 2B1AL 4FG4A 5TD4A 3RUGA 3D06A 2X6UA 2DIJA 2FSEA 2GTWA 2YPLE 4C4BA 1X9QA 3IDIA 1NCOA 4LLYB 4HGKC 1UD6A 2FHBA 4RQQB 1BQLL 4H5SB 1VGKB 4FNLH 2BNRE 1R46A 4MNQE 3VD0A 5AZUA 1FP5A 4L4VD 3P0VL 3A6CH 5I6KA 1K4CB 1G7IB 4I89A 4L2LA 1FFQA 1SM3L 3IDXH 4QKXB 1EXGA 4S0SD 3PV6A 1MIMH 3RDJA 2OL3H 2CGYA 3QWNA 4Z7NB 2B1HH 3QJSB 3NSJA 2XZAH 4UOJA 2VDQH 3CFEB 4M8RA 4Q52A 4LARH 1PKQB 1WZ1L 1FNLA 2O6FA 4BWWA 2XA3A 4P2OC 4TSBH 2H0EA 3FRPB 3K72B 4NT6A 3HNVH 3ZE0B 4M6ML 1SNRA 3PL6D 3WL9B 1KCRH 1WCBB 5HI5D 4NKOA 4DJMA 2D03H 1PZ3A 5HGGS 5I9QC 1T1XB 4L8DB 1MJ7H 5GGTL 2WQ8A 3IJHB 4HWZA 4URKA 5KVFH 1I9JH 3BPNC 2ESVE 1MRCH 3L4ZA 4LEOA 3NIDB 2GY5A 1XGZA 1N64L 3G6DH 1IC5H 4NQXB 2Q86B 1NFDA 4GT0A 4GRLB 1SEBB 1KTDB 4JO1H 5IQMA 2J56A 2XX0A 1MRDL 3EUUA 3RX7A 4PPTA 2N7AA 5LHDA 2W5PA 5KVGH 3RAJH 3KLDA 2F9BT 3G6JB 2YO3A 4ORGB 1N18A 1Z3RA 1PZAA 1KXVA 3LDBC 4TYUA 5K39A 2IXQB 2AJXH 1R3KB 3ENEA 4P23B 1F41A 1ITCA 3GF8A 4G8IA 2VMEA 5FHBH 1UWFA 1EMTL 1FBIL 3HZMA 3KPSE 2VDPH 5AB0A 3A22A 4PS4H 4BFIB 4ALAL 5I18L 3MKKA 1RPUA 1JK9A 5F7WC 3AMKA 3QO1B 1WFTA 4ZODA 1ZIBA 3MLZL 2IAAC 2PW2B 5JXAL 1BVLA 3O11B 2VLRB 5KSAB 3Q6GL 3BFQG 5EFIA 5ABDE 3VXTA 4AVKA 1BVOA 1A3RH 4ZW6A 3FUKA 3QIBA 2CO6A 5BUAA 1NMCB 4PM1A 4UQBA 2WIIB 4LLAA 1VB9A 4ODVL 3WS3A 4HU2A 3T4YA 5DEZA 4X9YA 3QIWC 2I60L 1MCEA 3RIAK 5IOPA 1WA2X 1CLOL 5JHLH 4RGNE 3U2SA 5AW8B 3OMZA 5KVGE 3BIKA 2B0SL 1UWXH 3TM6A 4I77H 1INDL 1PZ5B 3K1KC 2N0MA 1CTNA 4ZZKA 5F7HA 1RU9H 4V2BA 3EFDL 3X12B 2ZOLA 4ORZC 3OJMB 4V1DA 1J5IA 2QTVA 5K93A 3GSOA 4XHQA 3K80A 5F9JB 1RMFL 4WNJA 3UBXI 4AYID 1G9NH 4YXKL 5EZPA 4PJGF 2W60A 3VG0H 1USQA 1RJZB 2O5NA 1QA9A 3VD5A 1JZGA 4HUCA 1RK1B 4PUBH 4N2NA 3QO1A 4ZPVB 5ESQA 4DKEH 2H0FA 1WGVA 1QKZL 3FRUA 3CFIC 4JN2A 1N5YH 4MNGB 3AXLA 5BQDA 3AW5A 4HV8A 2HT2C 2FGWL 3EO0B 4N6RA 4ZX4A 2WBWB 4QRRD 3HE6A 4YIQA 4K5MA 1FUNA 5G4NA 3C6LA 3UH8A 1UT1A 3MAWA 1IBGL 1QD0A 2WQUA 3UGXA 4NKDA 3IFLL 4FLSA 5AB1A 2WNWA 2HJLB 2LOEA 3GLAA 4MJ5A 3BLBA 2KC0A 5JHDA 1Y0LA 1NFDE 4MAUH 1F11A 5LDSA 2UXFA 4L37B 1U2YA 2YJQA 2X5PA 3DURA 3FQNA 4JFFB 4JQIL 4FA8A 4MCZB 1F13A 1BZ7A 5LN8A 1PLBA 1QBLL 2OP4H 5BV7C 4OT1H 1YG9A 2EDXA 3BHBB 3VWKA 2ICCA 3U7YL 2IG2L 3SO5A 4ZSOE 4N2KA 2C8NA 2YJLA 3Q48A 5HSFA 4G8GB 3UOAB 1UA6L 3IDMA 3G3LA 5TGBB 4C83A 4TF4A 1BWMA 1PG7W 4JCLA 4F9LA 3BO8B 2ENYA 3RDTD 2AZAA 4JVWA 2WXIA 2CJUL 2BSEA 4G8FB 3GUTA 1CD1A 1WK0A 2HB0A 2YXWA 2DZEA 4ANKA 1IBYA 4DAGL 4ZUSA 4WUUD 3DBSA 4WJKB 2ZX8A 5GHWH 1DP0A 3EZJB 4JPQA 4U1HB 3TH3T 1FYTE 1BFOA 1Q94B 1QWHA 1NC2D 3G5XA 4LLDB 2JJVA 1U91A 1G9MC 4MQTB 1DN0A 3BEWB 1XF2A 3TS8A 3FU5A 3VFTB 1M71B 3MMEA 1GZPB 5D7EA 4LAQL 1AR2A 1F1AA 2WMPB 4ZUWA 4EBQH 1BQKA 3TN0D 3FYEB 5DHVB 1HYSC 1I7TA 2W0LA 3UDWC 3PAYA 1MAKA 2R2EA 3LN5B 4FGMA 4ZQKA 5L6YH 1P4UA 4OFVA 4XCCL 2IAMC 3BGFB 1OQOA 2IG2H 2QBWA 4XVUC 4AYDC 5I1HH 4O02H 4APQD 5IOKA 1AGCB 1SN0A 2DDQL 2YLKA 4ZFFA 4M48H 3FO0H 1GYWA 2DD8L 3UDWA 3WS6C 3S34L 3ZL1A 1Z3GL 1K3ZA 1FWXA 3ZDYB 4AJWA 5T3XD 1CFQB 5IWLA 4DIXA 5KJRL 1CK0H 4OFKA 3QULA 4HUWB 1JNNH 2XBZA 3FB8A 3WIFA 4G9FD 2Z91B 2FIRT 2AXHA 3GK8L 3U4EB 3ZHDA 4HK3N 5D1ZC 4JQXC 1RUQL 5F2FA 1E8YA 4YHPA 3PAZA 4UNVA 1T03L 5D7KE 1VRSA 3L7EA 4HJ0D 3GNMH 5AWNL 2J1YA 4J12A 2WLLA 3X11B 5GZND 4XN1A 2JF1A 3JV0A 2CAKA 3KPRE 4IRSB 1F11B 4J1UB 3FO2A 3BW9B 4QT5A 1DL7H 2AFNA 5C0JA 2Q7YA 4HXBL 4IHOB 3EJYD 2Q87A 4Z77B 2E74C 3V0HA 1A21A 4FFZH 3PGDB 1DYZA 4N24A 3UG4A 3GI9L 5JZ7D 2G30A 2CNYA 2F8OA 5GRWA 1VEPA 5IBLC 1Q9KA 3ZTJG 3SODB 3W37A 1TEYA 1OB1B 4AQAB 5I0DA 4BWUA 1I7UB 2JJTA 5AYTA 3SDXA 5KYUB 1RZFL 4P9HC 1Z3GH 5C3TA 1R3HA 4KNSA 4QHLA 3Q2CA 3LB6C 2IBZX 2N4IA 1JPFB 1X9UA 2XG5A 4HIJB 3S96B 3FHAA 3SE9L 3PIQB 1L5GB 5J11B 3WV0A 2YA0A 1WCQA 2BK8A 1AAJA 3QISA 3EOBB 4Y4HD 1JZFA 2UY6B 5A43C 4JREB 1TO5A 1MW1A 3WY2A 4OU3A 4PEEA 5I71C 2VKWA 2P8MA 1A14L 5FFOA 5AW7B 3EG9B 4PS3A 3EO9H 5MP6H 1HNFA 3EFOB 1ZMYA 4DSYA 1DLHA 2CHNA 4ZS6C 3CFNA 1IC5L 1K2DB 4PJ9C 4DO5A 4HF5L 1HYRC 3REWB 3TH4T 3TA4D 2OSLB 3OZLA 3K6NA 1T5WA 4LSDA 4G1MB 3FQXB 1S9KC 1S9YA 2OSYA 3EHBC 4KHTL 4U05A 2RIKA 4AGQA 3F83A 3I6SA 5JPMC 2XPZA 3GSNL 3RKPA 3TZVC 2CLRB 5B39B 1X44A 2X40A 2Y7OA 4N8CL 4ZJ9A 1JZ5A 4PJ9A 3RY6C 3UL4A 2ZF8A 4U6HB 5H94A 1KFAL 3TZVB 4RDBA 3B2UC 4FFZA 5GGUA 4FKKA 3HVNA 3QIBC 1HHKB 3SCMC 1A6ZA 3BEVB 3SBPA 4XH2B 2DM2A 2KDYA 1C12B 1OP5H 4FJYA 4K3EL 1FZKA 2A9BA 3TGXA 2JKRM 3S3PA 4WV1C 5KSAD 2AK4E 3TN0C 4ES9A 1V7MH 4YSEA 4FXGA 3CMOL 2D0HA 4F2FA 3WN6A 1KTLB 3MRGB 4WRLA 4X7SH 3QIUD 4XCEB 3NN8A 3MV8B 4NEHB 5I6XB 2Q86A 5EWIH 2EH8L 4MXQD 1M57B 2VLLA 1A64A 3LZNA 3SIKA 2DRUA 2D7OA 4MD5A 1L0QA 1M3JA 1R47A 3HVDA 2OZ4H 4XC3L 5IV2B 2BSCA 2Z31B 5BZWB 2BHUA 4I3GA 4KXZH 1KJ2L 4KZCA 1RSYA 4XNXL 1YEHH 3FCBA 2HJFA 2BP8B 2QR0A 4R7DB 4ZG1A 2MEJB 1BFSA 2DQ6A 1ZIAA 3FTZA 3H0TA 3DKHA 4G6FD 4UF7C 4ABUA 4K9EL 1RU9L 1QHOA 5CZXD 4AJVA 2DWDA 1FFPA 5E2JA 3O4LE 1JSYA 3B2UD 2WNGA 4ZFOA 1JI2A 3EFFB 3VH8B 3H1ZA 4YHLL 4M29A 3OVUB 5DQJA 1A7RH 3QXAB 4YHKH 1U42A 3Q5TA 3VD1A 5JPMB 2VDOH 1REIA 3HRZC 3DVNB 4GEIA 4IDJL 1XGRA 2BNRD 3KPMA 4KMLB 3IE4A 4WO4A 4AUJA 3WY1A 4J6RH 2GAZA 1A2YB 3PCYA 4RQQA 3GS7A 5E00A 5DMKB 2RMNA 1RUAH 1CXHA 4NO3A 4RCAA 1YLBB 1AYOA 5I75B 1T3FB 3DV6B 2I85A 4Y7OC 1QRNE 3SYPA 3WELA 1TJGH 4I85A 4TQIA 4MMYA 1J5OH 4L5FH 2PYEB 4RMUA 3V4VL 5C09D 3GZOA 1IL1A 1Z7JA 5T3ZH 3MRNA 2BWDA 3UPRA 3TT1H 3V6ZB 2HJKA 4IBSA 2OZ4L 3AS2A 4UM8A 1MZZA 5DFTA 3OHXA 3KYMA 3VFMB 4KO7A 1F2QA 5EO0A 2DIEA 3TNMB 1ZGLP 2A9NH 5JIPA 4GRWH 3ARRA 3FHEA 1I9EA 3MN8A 1VZHA 4YXLL 1X4ZA 2A6KB 1U6AH 3PNRB 4JR9H 1BQRA 2HG5B 4J8RB 4F7MA 2QQLH 3FFOA 1RVFH 2KUTA 3K7UA 4L2YA 5CLZA 1S9XB 2YPKA 4FX5A 3ARUA 3ESPA 1UEMA 1P84K 3HLAB 3CQQA 2ZX9A 2V5YA 2VIRB 3VG9C 3QNXB 4M7LL 3PJSB 4XPFL 1MCLA 2V4LA 1YMHA 3MRMA 1J8HB 3H6JA 4NAJA 3EJRA 4Z76B 3RVUC 4FFYL 5F88A 2A4EA 3RVVC 4Z3IA 3K1DA 4Y16C 2AK4B 1OSEA 5GS0H 1FGNL 5F6IB 1CE1H 1ZLUH 4BQ8A 5G4OA 2A6DA 4L1LA 3ZT5A 2VN3A 1BHGA 1QBML 1YMMA 4L5FL 3WTTA 4UWQB 5HDWA 4OSUH 5B39G 3H9HA 2JKSA 3KCPB 3ZTNH 3FAXA 5E6ZA 4Y5VA 4Q7DA 4FQLH 1WF5A 3MDJA 4OFDA 3BDYH 3V5HA 4BJLA 1XSJA 2P24A 3B6SA 4NC1E 3QFJB 1EPFA 2DH2A 3BVNA 3T2NL 3OD3A 4NLAA 3RZCB 3CDGA 5BV7H 1N0LB 2UUDH 3KYKH 5F1KC 2EUVA 2GKIA 3ISYA 5JLZA 3PQYB 4U3CA 3NSCA 3K2KA 1NBZA 2VMJA 1GGBL 1HIML 2DMHA 3WEXB 1AKJD 2A77H 4P49A 4NAMA 1PD6A 1RHFA 1KGWA 2NMSA 3KNBB 3TT3H 2W59A 3RA7L 1CE6A 5J06A 1QFPA 1QG3A 3ARXA 5EIVA 1YY8B 2IADA 2J6EH 3BSZL 4EXPX 1H8NA 3RBSA 3QJVB 4FYSA 4PJEF 1N7ML 1RZ8A 1HZHL 3BGMA 1U91B 3QJXA 2HLAA 2IALB 4G7VL 1OQXA 4L1SA 4HBQA 4JM4L 4LCWE 3SE8H 1YEJL 5MEOB 2CQVA 4PJHB 2BIOA 4HQQH 5FLUA 5CN3A 3GTVA 4BK5A 2EIKB 2V17L 3CDGB 2B16A 4AZ8A 1U8LB 2AV1A 2HWZL 4HWBL 4G7SB 1MKFA 4RFNB 3S4SB 3QYNA 3TL5A 3V6BR 4XO3A 5CAYB 1FNHA 4Z7NE 1CDHA 1BZ9B 3APCA 1P53A 4NNPH 3STLA 1UJ3C 1XD0A 3K71A 4UT9L 2KZWA 2UYLB 1KPVA 2LVCA 4ZMYA 5C2UB 4X6CB 5HVHB 3FCTA 1I8IB 3SEPA 1I1CA 3WHE0 3WTYA 4PYGA 4F2MA 5F0MB 4OUUA 3OJ2C 4FEMA 1KBGL 1U36A 1N0XH 3ZKMD 5EEXA 2GBAA 1UASA 4P59H 1P69B 2WVVB 3HCVA 2X42A 2JB5L 3CLWA 4BSJA 1ZXQA 3B3IB 2G3NA 1I85A 2CA3A 2C1PA 4MD5B 1RZJL 5D2NB 3RX8A 1FL5A 4S0HA 2Q1EA 2MPAH 3MX0A 2HP4A 3M8OH 4N2FA 4L37A 3D4YA 5MI0B 1KBBA 3R4DA 4G42A 35C8L 3S36H 3RX5A 3VVVA 1R9FA 5E5MB 3N41B 1PSKL 1Q9OA 2VIRA 5JMRA 2WQAA 1ZSDA 3CFMA 4OLWL 3MNMA 3IGKA 1XEDA 1SZNA 4HXAL 4CILA 4OD1L 2NZ1A 2P52A 3I9GH 3VD3A 1XH0A 3SBWC 5CGYD 3I02A 4LGPB 2BIPA 3RKDD 5KSAC 2IAMD 2VXQA 3L5XL 1FAKT 3TBYA 2MH4A 3AXLB 1HH6A 3CN0A 3MNDA 1AGBB 3CAFA 3BUQA 4U6HA 3TZVA 1NM9A 2BXYA 2OAAA 4PJXF 3K4AA 3PNWA 2WW8A 3I6GA 1MHCA 4TOYH 4H25A 4AC2A 1M05A 4RNRA 2CMRL 2CU9A 2V9TA 5GGVY 4PWIA 3JTTA 1ORQA 3O3DA 3O4LD 3HHSB 2GVYA 3H56A 1IFGA 1YECL 4JRWA 3GMQA 4P2OB 4JK0D 1A3LL 2VC2B 4JM0A 1HQRA 3W56A 4Z3HA 4MMYB 4V1DB 4WENB 1BLNB 5FKPA 3IVKA 2LT9A 4JLRB 3X1BA 2Z31D 4WV1A 4GBXB 4MMXA 4ZO8A 3OLGA 4GI8A 4CVWA 4NOFA 4QY8B 1CFNB 1NINA 4PWHA 1ZGLB 3VWJA 4LSVL 2CDEA 4XP6H 4EI6B 2FQDA 5C3LD 1KXHA 3N5AA 4N8CH 1KCUL 2UY6A 4Q56A 2RGSA 5DMYA 3JV5A 3BWZA 2VSCA 1EUUA 4R26L 1IX2A 4PCTA 2VISB 1ZT1B 4LPWA 5SV3A 1UD3A 4WI7A 2LLGA 4S1SH 3QXWA 2M8XA 2XXGA 3ZDXB 1F8TH 3CHXA 2EVHA 3HHSA 3O4LA 5C0CE 1BGXH 4IGBA 4BSWB 1B3IA 3RIFF 4XNXH 1RZKL 3MRBB 3HN3A 1GL4B 1E4XL 5CBAA 3F85A 1QRNB 2Z31A 2G2RA 4W81A 3GI8H 4R83A 1S7VA 3HZ3A 2FX9H 4G8EB 4UNTA 1N59A 2VERN 3HZKB 5CJQL 3WS6A 2J55A 4TV3A 1DJIA 4X6BA 4WVRA 4KPHL 1BP3B 1RCYA 1XGTA 1KPRA 5HXMA 3IETB 3TXAA 4R4BA 2R9HD 3DV4A 3LH2H 1KGYE 2QMJA 3CHSA 3SGKC 2NW2A 3JWDL 4G42B 3UZEA 3L95B 1DFBH 3TLRA 3QRGH 1NFDB 2IWKA 1DBBH 2JKTM 2X44D 4DNLA 3NZ8B 4NENB 1WWAX 1UKTA 3HI1B 4PJ7A 1ZA6A 3R1GL 4HWZB 2VUKA 2X9YA 1L9NA 2CRZA 3FC8A 4O2FA 3RL1B 4P9HL 4N0YH 5DYOA 4HMEA 4K94L 2X0VA 4KNTA 2PWHA 1F1DA 1CBJA 4OCYL 3OXRA 4NS0A 4DKDC 1G7LA 4QOKE 3BVTA 5ADOH 1JYXA 4ADIA 3ZKXB 1TTRA 1FVEB 2QKIB 3GSRB 4IJ3C 4KKAD 3CLFL 3HC0B 1DVQA 4MJIA 1OPOA 1NA8A 1JNHB 4LSTH 3O6FD 1ET8A 3NACL 3S4SA 3I75A 4NJ9L 4U7KA 3F7QA 3ZTDC 2QZ5A 3FTVA 5DJAB 3QK0A 4H7VA 4JFED 5DURD 4HOXA 5J12C 3WO4C 2DLGA 4X9GA 1DSYA 2NY2C 3EOYG 3L45A 4WF7A 5IHUH 3B9VA 1LEKA 5EDXA 1IE5A 2OR9H 4LCUA 2H6PB 9CGTA 4RGMB 5KW9L 3Q2VA 4AV5A 4KK6C 1MRFH 4PRDB 2IDCA 3CZNA 3VW3L 1UEYA 1N5YL 3BGFC 5DUBB 4YDKH 3MNZB 4FNRA 4KZDL 3TO2B 1J9RA 3Q2LA 3IYLW 2RHEA 3ILQD 5GS0L 3TBWB 2YBRB 3LNHA 2HX7A 5BS0A 4HCIA 3RURA 2VERA 3BFWA 1EK3A 4UYPA 2C4XA 4JUTA 3QRBA 1RIVH 3GRGA 1CD1B 2VQTA 3WKYA 1DJSA 1U2HA 4HAGA 2G60H 5SX4I 3VYNA 4A6YB 4DKEL 3V0VA 1NMCC 4WCYL 5HDBE 3S2CA 2NY0D 2IF7A 2EAEA 5ALCL 4GMSH 4L5FE 3TCLB 4YQXL 4Y5VB 2GY7B 4TSCL 3WJJC 3VXSB 1T0NA 5EBGA 3ARGA 1JHTA 1FLRL 3U0WL 5EN2B 3JWNG 1UOKA 3BVWA 2P8LB 1J1OL 1UFUA 3BZEA 5FA4B 1O0VA 3QJHA 2L7JA 3ALPA 5HHNA 2OMWA 4M3KB 3TFKC 1U4EA 1AY1H 2VYRE 3RWIB 5DZVA 4Q2ZA 3ZGIA 1JZ7A 1KBWA 2PXYA 4YDKL 4JUSA 3PAVA 5JHDB 1IBDA 1OGSA 1YDPB 4KK8C 2X89D 5HD8D 3SDYL 4ZMOA 3QA3A 2AK1L 3WIFB 4RIRA 3TN0A 2R1XA 4Z7QF 4PJAF 5BOPA 2ISDA 3GSVA 4G6JH 2IPTH 1IFHH 1YEJH 2WKLA 5IB2B 3O9WB 4HKJB 1OSPH 3UC2A 3HI6H 4A55A 3NSXA 4MCNA 3BVUA 3BVDB 1ZLVH 4J4PD 2L0DA 2VQ1B 2XWJB 1UM5H 1XF3A 5CZVL 1RZIA 1Q72H 4MYWB 2UV3A 3Q1SH 5IVZA 1NBYA 1WFNA 3BSZH 1ZT7A 1HHGA 2F0CA 3T4AB 2KQNA 4LCIL 3CFKB 4RRPG 1DE4A 2AEQL 4XAWL 1INEL 3DDGA 1DQKA 1NUGA 3LKPB 1S7UA 1T83A 4HK3J 4HZAA 5E8NB 3UYPA 2C34A 4G7RB 4PJEA 3WFBH 4BRVA 1U4FA 3MLTA 4X8GA 5JIQA 2FWSA 4GKSB 2OI9B 1LNUB 3OKMA 3Q01A 3MBXL 3DV6A 4AEEA 1I4FA 3BUTA 1BD2D 4KY1L 3DRQA 1HNYA 3WEBA 3HI5H 1U8CA 4PD4K 1GJWA 4IEFB 1GGYA 4HUNB 3MV7D 3G5XB 4LLDA 1P7KB 4N2BA 2IGLA 3DOIA 4TLKA 2JELL 2GSIA 4N3TA 1IEBA 1HHIB 1HSAA 3EDKA 3N44F 4YGVA 4GFXA 4I0CC 4Q58C 4EN3D 1PSKH 4AQ1B 4U1LA 1I1YA 1KBGH 5F93C 3ZW3A 1KJVB 1TTAA 2GIYA 4ZUTA 1P1VA 5JDSB 3KGUA 3M8OL 2JB6A 1U30A 2AI0L 3Q6FB 4PLOB 2FE0A 4H20H 4R7LA 1NEZG 3GMLB 4HWEH 1E4JA 2C3HA 3P3UA 4U33A 3DI2B 3QXUA 5DLLA 4LARL 2DJ4A 2JCWA 3QG7L 3ZHKA 2ZOUA 2CKBL 4LU5H 1FL3B 3FAWA 3IAQA 3KVPA 4HMDA 1HX0A 1UM6H 4Y19B 5IW3A 3BHBA 1SQMA 4GIOA 2NW3A 4Z0XB 3UBXG 4DP9X 1OPGH 1K72A 5HY9B 3F8UB 1EEUA 1YY9C 5T8IA 1N19A 1A3LH 1IGJA 3S5LG 1I8KA 4KKQA 3AG1B 3KCWA 5F7KC 4CC4C 3F5WB 2EUXA 2C3VB 2H3NB 1M6OA 4X6DA 1T1YA 3RWHB 4LEEA 2BPBA 3NCEB 4GKNA 5EU4A 2Z4QB 3N06B 3T2PA 3GMPA 2VITA 3FUHA 3T04D 1A6ZB 1KUMA 4C47A 4PRAA 3UZQB 3VG0L 5LG1A 4ZS7L 1MDAA 1UD4A 4TM9A 5TFSH 3R0NA 2CCVA 3RWEB 3TO4C 4JS7A 1DQVA 3IJSA 4XB3A 4PJ9B 4ZW8A 4UZSA 2AP2A 1HHJB 1DR9A 2VWEC 2ZPKH 2R69H 4YNYA 1PZSA 5GS0D 1RJZA 2DTMH 3GBEA 3GHPA 5DHMC 2DYPA 1DVSA 2A6IA 3K74B 2YA2A 3PYCA 1DUYA 2NY1B 2VWEE 4L8SB 1E4XH 5GGVL 1KCUH 4N90E 3SPVA 4GY4A 2D7NA 1OE3A 3K6SA 3HB3D 4AYBA 3INUL 5D93C 1OF2A 2NUPB 5B3JF 2R27A 3OKYA 4WU5B 1AQKH 4AQ1A 2PCFA 2ZOTA 5C0GB 3KPSB 1I8AA 1EEZA 3TBTA 4OFQA 1F58H 1NEUA 1UB5A 3EYFA 2H3NA 1QR4A 1W0WB 2JIXD 4IEFA 3DOSB 1MWOA 3L4UA 1CLOH 3LRKA 3TU6A 2FYYB 5EBLA 3THMH 2B8OT 2VR8A 4NBYB 1EVUA 1XD1A 2BC4B 4NWUL 2DL9A 5MP6L 3W5NA 1SVBA 4GKSA 3GI8L 4FZEL 2CO6B 3L2LA 5CP3H 5GGRA 3HFFA 3QB7C 4W6WB 3WGUB 4P5TC 1WHOA 2H8PA 4YC2C 5IJVA 5LGHH 2OTUB 4E5XB 5IEHA 1YPZE 5GISH 4HKZA 3QUKB 4K23H 2EXTA 2Y5QA 4XCFL 4Z7VB 1IGFH 3ROOA 3PJNA 3QGVA 1PLCA 2XZQL 2X2IA 3UTOA 4DN4L 1HT6A 1OCZB 2YGVA 3WUWA 2OTWA 5DJCB 4DTGL 1JOIA 4JW3A 1DQQB 5FUCC 5DJYA 3PL6A 4ODUB 1XGUB 3ILPB 1TTCA 8CGTA 1CU4H 4RAHA 3ZN6A 1BEYH 1KYAA 4E41E 2FO8A 3W9DA 3PWPB 4O2CA 4R96A 3RDTB 1MY7A 3G6JF 5EEYA 4GSDL 2OZ4A 2JXMB 3CFJA 3R19A 4WW1A 3BFOA 3P4OB 4RIRB 1TVDA 4AQ8A 4N85A 1DBMH 3OQRA 5DS1A 4MKTA 5DRXB 4YVNA 5IQ9B 3NAAL 1G1YA 3TBSA 1ECYA 4CSPA 3O3UN 4Q2ZB 5CIPA 1ZHKB 4JRXE 3CN3A 3CN1A 5JIDA 5ADOL 1A1MA 1HZLA 5EC2B 3V95A 3IDYC 4W9ZA 3Q2NA 5I6MA 2BNRB 3GGWB 1ZHNB 1PQZB 2XSKA 4WW2C 1YYCA 2YGQA 5F0PB 1OAYH 4BZ2L 7TAAA 4S1RH 4GI9A 4H4NA 4TS6A 3ZMEA 4KGJA 1SXBA 1DE4B 5IHUL 4GAJL 4MZ3A 1FSKC 1PJ9A 1ZTXL 2IIJA 4PP1D 1A8JH 3W82A 2YRLA 1FNAA 5T5FL 4LKCA 3S8WA 2W0FB 2PYED 4ZFGL 5L88L 1VEOA 3MA9L 3QJTB 3RVXD 4APQB 4KROD 1WC7A 5DK2A 2ED7A 4HT1H 5H2BB 4Z7AA 1TIUA 2XKUA 1E8ZA 3QFJE 3S35H 4NNXB 4U7MA 1VFAB 1F4WH 1T89A 3MYJB 4YQXH 1NICA 3QVAA 3P3RA 1EFQA 3QEQE 2WLZA 1VGKA 3FT9A 4NIKB 5GRJL 4PTTA 3GJEB 3EJZC 1TFPA 2Q76A 3DO7B 5MEQA 4IBVA 3QHFH 1USZA 1XIWC 2AXFB 3MU3A 5JQ6L 2R8SH 1A4CA 1QUNA 1NEPA 2R7EB 1AKJA 4AV0A 3F65A 1UG9A 3F7YB 4PLKD 3VFTA 1TYEB 4BUGA 3C5JB 4GUOA 1NJ9B 4KVNL 1FVDB 3DETD 1E8WA 4MMXC 3FB5B 5F9WB 2WYTA 2CLVA 3DX8A 4U1HA 3GI9H 1VFMA 2E47A 3NZUA 4KKRA 1ZEAL 3T1FB 3VWJC 5C09A 4LEBA 1TZHB 1BYOA 1OD7A 2EXYC 3PWPA 4M7LH 2XJLA 5D8JH 3JYCA 3LXUX 5FF6A 4KWUA 3QZPA 2C4FT 4WHYG 3V0VB 4AKQA 3LCYA 3GSRA 4ELKA 3HG1A 3BIAX 4PY7B 3D8MA 3CZLA 2DMCA 2H5UA 1KJ2B 3DX7B 2BFGA 4LPCA 4JR9L 1YHPA 1UM5L 4JL2A 3UADA 3VM7A 4ZMNA 3WY3A 2J1WA 5L2KA 3CNKA 4HKZB 3SKMA 3WFHB 1H8LA 1BCIA 1XCXA 3O9WD 4PQXA 1CT8B 1FVDA 3ZYZA 3AG2B 4HJUA 4L18A 3EDEA 5H37G 1N12A 5C92A 2X4UB 2NY7H 4X4KA 3EGDA 2EYTA 3MLXH 1J48A 4WFGE 5E8OA 1OTUD 3PQYD 1X5HA 4DEWA 5C09E 4HSCX 2NY5H 3HPJB 4DGIH 1HAWA 1KLUB 4R4FL 3SYCA 1S7XB 1KIQA 1EEZB 3C9NA 4JO4L 3B3BA 5ADPL 3GIVA 5DC0A 4HVBA 4UQCA 3SGKA 4G8GE 1BXXA 4NNXA 1RZGB 1TU2B 5LLIC 1RIHL 1RK0A 3HI5L 4HA1A 4Y2OA 4F15B 3PGFH 1GZHC 2YFNA 3EBAA 1OV8A 1LGVA 2W0FA 3WI9A 4HEPA 1UH4A 3FH8A 2C7UB 2DAVA 4L3AA 3DJSA 4PJBE 4AM0Q 4EN3B 4H1LG 5ESQB 3DTDA 5D7IA 1IBFA 3CMGA 2VDNB 3QHTC 2Y23A 4ATTA 2APBA 1Y6NR 3OR7A 3VQMA 4YHNA 2ZCLH 1XSKA 5F9OH 1GGBH 4XCNA 3WMQA 4DGWC 5AL8A 1S9WB 1MREL 3AAZA 5EZIL 4PJ5E 2UZIL 2VDMH 5D70L 5AVVB 4PJ5D 4JVUA 2HRPL 5T1LB 2X1PA 4FNPA 4L8BB 4QYAA 4B5EA 2W88A 1QTPA 5FO7A 1CLYL 2VW6A 2XIBA 1R24B 3WTUA 5H4ZA 2NY5L 2G0LA 4MNGE 4CSTA 5KVFE 3CQFA 4XPAH 5L0QB 1I8KB 2F53D 2BZ7A 2VR3A 5HHVL 2XBDA 3HZKA 1EDYA 2OL3B 3ZR5A 3HPLA 2A73B 3IPEA 5IHBA 2DLHA 3I9IA 3SE6A 3MV8D 2YUXA 4BDVB 3NPZB 4Y2DA 3BD3A 3N1QC 3I2CL 3ES6B 1VA9A 2YAQA 3A24A 2WZPA 3UG5A 4K8RL 5J1TC 1E5CA 1M05B 2V7NA 2FLBT 3N9GH 3PWVB 2ZKXA 2YR3A 3E9UA 4QHNB 3UIZA 5JW3H 3AZUA 2J43A 1T1ZA 4ZSOB 1T0MA 1JWMA 3GXMA 1PY4A 3MR9B 4OGAD 2WKGA 3WJMB 5I1CL 4M4RB 3D25A 5TFSL 2OMZB 2OX5B 4PIRF 4NUJB 4U49A 4PS7A 4X6DF 4Z7OF 5DQ9A 4JZNB 3G6JA 3CVHB 5SWZD 4RSYA 3INUH 3KDMB 2WSPA 2CDEB 1YA5A 1ZGLA 1W0WA 2E76C 4R7XA 4DZBB 3F58H 3RFZA 1LO2L 3BWAB 4AXWB 4MB3A 2R4SH 1WA0X 4EUPB 4WFHE 4PRPA 4GBXA 3MYZA 3FSAA 3QIWD 3FULA 2W8CA 4FJ6A 4MMXB 1NCWH 4R0LC 3VFRB 5HPMB 1FO0B 1U58B 4OCMC 3VFSA 3IMRA 4ZD3H 4L3EA 5E8NA 3D87B 4DUXA 3DX9B 1VPOL 3VFUA 5FO8B 5B1JA 2QSVA 4LOFA 4H25B 3H9ZA 1D9KD 3EJSA 1ZT7B 4OVUA 3WFCH 1NBYB 3R4RA 1ZGLM 4TQEL 4ZTOL 4WI9A 5K9JL 1DN2A 1ZV9A 4JBSA 4E0RA 3TEXA 5IESH 1CXFA 3C60A 1R6VA 3NQIA 2ED9A 3ELQA 3EF7A 2I9LA 1CLCA 2XG4A 3BH4A 2KBGA 5EU4B 4HK0B 3C12A 5BOJA 1BJ1H 5I76B 5L4FA 3FTYA 4PY8I 4WFFE 3T0AA 1O7SA 1Z5YD 1TZIA 4O02A 1KB9K 5HYJA 4Y4HA 5IKCB 4WO0A 2A4ZA 1XCWA 3MRDA 1RZ8B 4YFDB 5E2TL 4IOIB 3CVIH 3LH9A 4R5TA 3CK0H 2CJTA 3M1BB 3T6WA 2ADFH 3SCMD 1CTMA 5AOIA 5I71B 3BOVA 1U8KA 4RGOH 3TVMC 1EHAA 3MGTB 2CALA 4MA8H 3KBEA 1MW2A 3WEXA 2M2DA 1CWVA 2NYYC 5LB1A 1RPKA 1T03H 3FUJA 2P5WB 1W72L 4C56D 1QHPA 3I6KA 3RBGA 1NCCH 5EIQA 2ZCKL 4JG1H 2QADD 3OGCB 5IB1B 3MRFB 1EJFA 3CSGA 4LASL 2R0LL 4NSKA 5JDJA 1N26A 3ME0B 4L1HA 5ICYA 1LD9A 1RJLB 4X83A 2IH1B 2AV7B 3L9EA 4FXLA 1JZHA 1QEWA 4MMZB 4OKVA 4TVPL 4OTXL 3SO3B 4JHVA 4L0ZA 3VSQA 4F24A 5LBVA 2NX5A 5AVYB 4HOMA 4BZ2H 1R4XA 4HWUA 4JAMA 3HBZA 4DGVL 1UD2A 2XWCA 5GS1C 2JMRA 4UUJB 2NNFA 2YD7A 5C07A 1T2QL 3CZKA 4PWEA 1F3DJ 5DUBA 2R7EA 3D08A 8PAZA 4P4RB 4KJPC 1ZS8A 1CQYA 2NYKA 2WZ0A 2DLIA 5JOPE 4Z76A 4PTTB 3O6LL 1HILB 3EJJX 2DH3A 3MQIA 4X5QA 2NUTA 3CZEA 3S3SA 4JPWL 2XWZA 3WXVL 5E9DD 4P46D 5DUMH 3D50A 3U1QA 1HC1A 2EE9A 1G9HA 8FABA 4E41A 4XODA 5EU3B 2IQ9L 4NLHA 4KKBD 3W1ZA 4PGBB 2HG5A 4ETQA 2YOAA 2AXJA 4KMTL 3TONA 4M1GL 4CSZA 1WC7B 4MASA 1F42A 4BEIA 4JGUA 5DS8B 1DCEA 2ODHA 1AJ7H 4JKPH 5BMFH 3QYMA 3IT8D 3RYMA 1DQML 4NC1C 4O2EA 5D5MB 1FZOA 2ZWYA 3H9HB 4XVSH 4GP8B 4OBRA 1S46A 3TV8A 2IBGA 2XZCH 4CKVX 5IK3B 3LPOA 3LX9A 5BV7B 3HIZA 2XZAL 1LE5B 5G5DB 3APNA 3FUEA 3FBQA 3BMVA 4U2YA 1QVOA 4ZX5A 4A67A 2YPLB 1OAZL 5E6YA 2AQ2A 4Z7QE 2C9SA 4DQOL 4L29A 4JRYA 4IJTA 2XVKA 1OE2A 2P8LA 4U1IB 2K45A 1TVBB 3EYUL 1IC4L 1KPUA 4MDRA 3FFCA 3P3YA 5ERWB 2HTKC 1RP9A 4KFMA 4QRTA 1F4HA 4DAGH 4DZ8B 3UBHA 2LAGB 1INQA 4JFSA 5CU5A 1EFXA 2AF2A 1JZDC 2O5ZL 2L04A 1MCWW 4R96B 1RJLA 2J72A 2ZT9C 3MLUL 3VFOA 3SZKC 4NKIL 3L5XH 1I82A 3BVVA 2HWZH 1I7ZA 2G2RB 1LK3H 4KMTH 3QJFB 3CVDA 5FYJL 4R5XA 3JWNC 4ILDA 4QF1B 1YYLL 2D03L 4RMQA 1VZIA 4Z7VA 3SYAA 1COBA 2HFEA 5ACZA 1A1OB 4ZQTA 2YD6A 2R59A 4PJFB 4AQOA 5IY5B 3L6FB 4KKNA 1N5AB 4JZJC 2XETA 4GS7B 2NY3B 2WBJB 1QBBA 3NFSL 4G9DB 4ZAKC 4Q97A 3OG4B 4Y4FB 1IGMH 6FABL 4FXKB 3T77A 2DQIL 5FOBB 1OANA 3GXFA 3IMVA 5JA8B 3QAZC 4ONFH 1S7SB 4FXKC 2W07B 3NZSA 4TQHA 1RIHH 5EBLB 5LUMA 4Q9CA 2GC4C 3S34H 3BSZA 5JXAH 1OP9A 1I1AC 1A3QA 4GIAA 3KPSA 3KR3L 2ZONA 1FAIL 3UTSD 1W0VA 1MREH 1TQCC 4KRNA 4UU9B 2Y7QB 5JPMA 4NWTL 5DJAA 1XBDA 2J21A 3LEXB 2FQFA 1ML0A 2Z93A 1NC4D 4OD1H 2I9LB 6TAAA 1CLZH 4L3CA 2Q8AH 5AAMA 1VLXA 4NQQA 1FVEA 1DBAH 5D2LE 3NTCH 3B43A 1HH9A 5D1ZB 3U4KA 1E9PA 1HDMA 4YDLC 1E67A 1I3GH 3CHRA 4Z6AT 1I75A 5F21B 2HN7B 4F20A 2JFCA 4AGMA 4ODXA 2D0GA 4MA3B 5IB3A 1NPJA 4B0MM 1EERB 3ZBMA 1YSOA 4PB0L 4DW2H 1ZA6B 5FAAA 5FYJU 3BZDA 3V5DB 3EOTH 3I02B 4XGZB 4Z3TA 1MXDA 3I2CH 3QQ3B 4U3HA 1WTGT 2OW6A 3NN8B 4UU9A 1P5VA 3IMTA 1T1YB 4IRZL 2VCOA 3X1EA