1RV6X

Crystal structure of plgf in complex with domain 2 of vegfr1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
RPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords placenta growth factor (PlGF)
publication title The crystal structure of placental growth factor in complex with domain 2 of vascular endothelial growth factor receptor-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor/receptor
total genus 16
structure length 92
sequence length 92
chains with identical sequence Y
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2003-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rv6X00
1MI5D 5DRWA 5JLZB 2HKFH 3NCJH 2HN7A 4H0GA 2R0LL 3RJQB 2YRZA 5CSBA 1JPST 4FFWC 3DURA 1CK0H 4R2GB 3HE6C 3IRZA 3B5TA 4QWWC 4DK6A 2DMCA 1BQUA 1GC1C 3C6LA 4YLQT 2D2OA 2XKUA 4OCXH 3MLRH 5E95B 5GGQL 3UZQA 4U6YB 1HHKA 1Q1JH 2NY2B 5FB8A 4YH6A 1KB5B 3RRQA 4S1QH 4YIQB 4O5LH 1LO2H 4KKLD 3B6SA 3HNVL 4MJ5A 3T0DA 3RWCA 2CR6A 3PL6A 4FQ1L 2V2TA 3ZDZF 3QJFB 3HZVB 4WHYG 1SBSL 2BNRE 1CG9A 2E27L 4K55A 2K9UA 4CDGC 2M1KA 4PB0H 4WI9A 5T5FH 1YNKH 4P2RA 2WWKT 2R1XA 3DSFH 3QXAA 4LEXH 1YQVL 4TPRH 1RUAL 2HWZH 3H9SE 2QSCH 4KPHL 5JNYA 3DROA 5HD8D 1NUFA 4ZNEA 5C07A 4K9EH 5E94B 5DVLA 5E6YA 2V17H 2CMRL 3UDWA 3O2VH 5F3BA 4JM2B 5JW4Q 1G7JB 3HAEH 1P2CB 2RJMA 4HKBB 5GGRB 3T65A 3TBSA 4ZXBB 3GKWH 4JANA 4JZJC 4D94A 1YEIH 3E3QE 3E1F1 5KG9B 1TZGL 2RR3A 1DVFD 3TYGL 1ZSDA 3VD9A 1OTTC 2N1KA 1X5YA 2FH8A 4IEFB 1Q9OB 3VWJC 2OP4H 3BKJL 2CLVA 3G6DH 4Y5YC 2H1PH 4HEPG 1CZ8L 2E7HA 1MREL 3T2NL 2N7AA 3VXRD 5JOFA 5DZLA 1MAML 1QBAA 2RHEA 1T5XB 4XAWL 3VG0L 4KVCL 3UC0H 2YWZA 2X7LA 3VFMA 1VACA 4Q9RH 1XF5B 1IFHL 3DRQB 1C7TA 2XXMB 4DN3H 5I1JH 3TT3H 1MCWW 3VI4E 3KXFA 3HUJB 5EU6A 5IF0B 1JGDA 4UIMA 1Q38A 3MLWH 2X10A 1F13A 1BP3B 3HNTH 4HIXH 1SJHB 1XGTB 2BY0A 4YWGH 3TN0C 3QA3B 5D2NE 5E9DA 2F74A 4JE4B 3U30B 2HJLA 3L7EB 3PWJA 4PJBB 4QXTB 5BQ7B 2NX5E 3KJ4C 4ZQKB 1IGYB 2RGSA 4MD5A 1LK3L 5HYSG 2NY4C 4PY8J 2ICWA 1KTRL 1QFWI 4O9HH 3KAAA 2P7TB 4GRLB 4PV9A 4Y16C 3QWOB 1GIGL 3SE3A 3FMGL 3QJHA 3VRLF 1NFDB 3LOWA 3MV11 1KGCD 2DJSA 4X99A 3SGKA 4M5ZH 4NKIH 4LPTA 1QHOA 4TTDD 4G8EB 5EPMA 3U0PB 3AGVA 1A9EB 2FDBP 4F7MB 1I8LC 4JPIA 1A6TA 3CIQA 4LCIH 4MD0B 5D1ZA 3F7VA 3M8OL 2AXJA 3VFPB 3FT2A 2DI8A 2BSTB 4X9IA 2CIKA 3ZL4H 5JORB 4DKFL 1TENA 5E70A 2FBOJ 3KPQA 1YN7B 2OZ4A 1ZT4A 1C1EH 2I26N 3W0WD 5I6XB 4NBYB 3W5MA 2ADJB 3BIBX 5IROC 5DRNB 4D9QE 5J6GA 4C59B 1MCSA 3TVMA 2NW2B 4OCLC 4F8QA 1L0XA 3VI3F 1YDPB 5JW5A 1GC1H 3MJ6A 1YY9D 1KIRA 2WBJA 5KAQG 5FUOL 4XC1L 3OKOB 1AGDA 1KJMB 5E03A 4JPVH 4GRWF 1LEGB 4Y1AA 4YDJA 4X6CF 2R39A 3C8KA 4L29B 4LHJB 5GGVL 5T1LA 1I1CA 5J12B 5A43C 5E6IA 2YUWA 3ARGB 3WD5H 1BF8A 1PSKH 2JELH 5C6TL 5BVPL 4MAYB 4YC2B 1XF2B 2FX8H 3C60B 2B39A 4GW1A 1UWGL 3KPRE 4JFEE 4YHNB 4Y2DB 4QRRA 4J6RL 3D9AH 1U93B 1NEUA 3K0WA 2BK8A 2DL9A 1UZ8B 3FTGA 4ZUVA 2GK0A 2CK0L 1DANU 4GW4B 2VDNL 4X5WA 5HYJB 2J8UB 2XG5A 3TH2T 4MJIE 2X4PA 5KJRL 4H25B 1O5DT 3ESVF 3GGWA 1EUTA 3QIWC 3BQUA 3QEUA 1NAML 3FQUA 2R0ZH 3IJHA 4XNXH 3PJSA 3VRJA 4TOYH 3E3QC 1X4XA 4K3GA 5FM4A 5D96B 4UILL 1XCTB 3QDAA 4EKXA 2CDGB 5KSVB 2VITB 2XY2A 4FQ2L 4PJ9D 3QFDA 3QNYB 5FM5M 1Z9LA 3TT1L 4HGWA 2PNDA 5H35B 3QFJA 4WRLA 1OD9A 4HWEH 2Z8VC 3PNWB 2NY0D 1NMBH 1T2JA 2F54D 2W59A 3I6LD 1DN0B 3LH2L 1QR1B 5SX4H 4UT7H 4N9GA 43CAA 3VD5A 2VDPL 4N1HB 1DUZB 1QZ1A 5IHBA 4PRPD 1FYTA 2DLFH 4LASL 4OFKA 1CU4H 1YMHB 1UM5H 2QEJA 4NSKB 4HPOH 1JP5A 4P2QE 4M93B 5KS9E 4BUHA 2X2YA 1UYWL 3HRZB 1IEBA 1G1CA 4M7LT 5ENWB 3WXVL 1OOAA 2BVQA 1P4LB 3GIZH 3EJYD 4FXLA 4JY4B 5I66A 1OTSD 4LHQB 3FB6A 4IOIA 4QRTA 2CIIA 4O2CA 5CHNA 5D2NC 3NACL 2X4TA 1XF3A 5L8JB 3OXRA 4JGUA 1KACB 5DRZB 3LKPA 2D4FA 2W9DH 1D5MA 1JGEA 2WUCH 4KQ3H 1JPFA 2C4FT 3MLVL 3MMEA 1HQRA 5DJ0B 3D39B 3GMOA 2H6PA 2EXYC 1FP5A 3KLAB 4QRQB 2PCPA 3LN5B 5K9KB 3UPAA 5HHME 4NZJA 1FFOB 4WGVB 1JYVA 3E2HC 2HVKA 4XCYA 2R69L 1QSED 2ED9A 3X3GL 4U6HB 2JKXA 1PKOA 3T77B 2AJVL 2WV3A 3PHSA 1X4ZA 4P99A 1E4KA 2PW1A 1U42A 5K9OB 1SM3H 2XZQH 3NN8B 3MRJA 4TVSa 3QDGA 2X4SB 4GKNB 4LDOB 2A9MH 1DBJH 2VL5B 4G6FD 1PKQB 3EFDL 5IB3B 2HLFC 2IAMA 4PTUB 3RDTB 4PY8I 3SDYH 3LQZB 5FV1L 3HE6A 1VFAB 5FCUL 3PG2A 3PWVA 5SWQB 1ZXQA 2ZPKH 4G9DA 4I5BA 1PZ5B 4Z0XA 2A6KB 1F3JB 1SJEB 1CICD 4JRYE 5HVHC 3MODL 2DWDB 1MWAB 3V5KA 3FO0H 4R0LC 4DZ8B 2GUOA 5CBAB 4I0PA 1LHZA 3T2PA 4POZC 1SY6H 4EUPB 4OZIB 5FECB 1NCDL 4LHUD 4OZHE 5FIEA 3B9VA 2IC2A 5HYEA 4MCZB 4G8GD 4BA8A 1R3HA 5GJTH 3NIGF 2ZCKH 4LIQH 3RPIB 3C6SA 5FM8A 4QTIL 3Q6GL 4I13B 3RHWF 3WIHL 1LE9A 4X9HA 2ZUQC 2ERJC 2GSIB 2IADA 1TCRB 2QADD 2D7TL 3HC4L 1F58H 3TM6A 4X98A 3SY0A 1JNNH 3P0YL 5I1EL 3AXLB 1ZT7B 2CJUL 3MRQA 5CZKA 3NFNA 3MJ7A 3KYNB 4HJ0D 4QTHB 3ZZ1A 4P48A 1F4XL 5HVGB 1VEMA 2ZNWA 1YN6B 4GG8A 1IARB 1G6VK 1V3MA 5C0JB 2V7HB 1VFOA 3X12A 1EJOH 3ARWA 3L5XL 3PP4L 4UV7H 3G5ZA 3VW3H 3QDJA 3ZYZA 1YC8A 2X4RA 2XFXA 2LU7A 2GJ6B 3O3UN 2XN9A 5HY9A 3BEWA 3LS5H 4FXGA 3VI3E 4Z0BH 3E6HB 4NQTA 4MS8D 4QRUA 3OAZK 4EI5B 5CZXC 1FL3B 3ZE1F 2O5XL 2R2HA 5ICZB 1FAKT 4QEGA 1ORSA 3WL9A 3BEVB 1QFOA 3K1KC 1EO5A 2WQRA 4EVNB 5DEZA 4GRWE 4KHXH 3F6IA 3HC0B 5TQ0L 4X9GA 5ESQB 4Z78B 4X6CE 2HLAA 4L8DA 4CDHA 1DBBL 3MLTA 4XRCA 5BV7H 3QHZH 1PQZB 1AC6A 1QLRB 2NY7H 2FD6L 2OXHA 3SPVB 3QIBD 3NIDF 3FOLB 2CD0A 1EA9C 4OTXH 4WI2A 5HI3D 1GGCH 1DQJA 1W0VB 5IESH 2JIXB 4G6KL 3K2MC 4OLWH 3AU1B 4FQJH 3T2OA 3U4AA 3MTRA 3IDGA 1A7PH 5GIRA 4RCAA 1N59B 4X9BA 3RIAK 1QRNB 3GSVB 2XY1A 2NCMA 4PJ5D 5EB9A 3RGVB 4KZDL 5L2KE 5TFSH 3W39A 3QNXB 2PO6B 3KPMB 3QEHA 5DJ8A 1OCWL 4Y5VB 4K23L 4HLJA 4JKMA 3HG1E 5T1DL 3DMMC 5BO1L 5BZDB 3BWAA 1I9RH 5BRZD 3TZVC 1K4CB 1UVQA 1B4JH 3PIQA 4NBZB 1EZVY 2Q76B 3M17A 5C08B 5IG7A 4U1MA 1VFUA 4UBDC 1GGIH 3DTXB 2Q20A 1X7QA 5IIEA 1I7UB 4KJPC 5IROA 2N7BA 1EHLL 2Z93A 1G6RH 5TDPB 5EC1B 4L3AA 4RFNB 1MJ7H 3UTQA 3S34H 4BKLA 5HHQA 4P3WA 4XVTL 5LVEA 2AK4B 1LE5B 1G9NC 4LRNL 4BFGA 1RURH 4QOKA 1N0LA 4PJHB 5JO5B 4LSSH 2B4CL 2OR9H 4PLNC 1IZJA 1OPGH 4J3XA 2ENYA 4UQ3B 2UWEF 3V4PH 5KVEL 1KBGH 1R3IL 1CFQA 5MEND 2DQJL 1AD0B 2VLJA 4Z7VA 5SV3A 4ZMAT 2EH7L 1IL1B 1ONQB 3DV4B 4N1CA 4PFEA 3TA3D 3BYYA 2BNRA 1FDLH 3U1SH 1KJ2H 2VDMH 3V52H 1FIGH 3P4NB 3EUUA 1X6NA 3SKOA 4RGND 1YEGL 5HPMB 5AUMA 3SO3B 3WEXA 6FABH 5D6CB 3HZYA 3IFLL 4D3CH 4LLVA 1EMTL 3KYAA 2M8XA 1M4KA 1G7HB 2Q87A 4ZFFB 2ILLA 4M1CC 3QQ3B 2EECA 3P0VH 1NQBA 2NXZC 1B0GB 1CXKA 1P84K 2AEPL 5FFLA 3ALPA 4AM0A 2DDQL 5DJ6A 4HHAA 1I7RB 1G0XA 1W2KT 3VXUD 1HYSC 2QSVA 5C0IA 3F7PC 4RMVA 2W07A 3DUUB 3GJFA 3WUWA 1Q9LB 1S9WB 3X14A 1F4AA 4GQ9L 4UUJA 4S1DD 4IOSD 4BSWB 1S7SA 3AREB 1EZVX 3QUMA 1T20B 4OZFH 4Y4HD 5E2WL 4ZPTB 1MRCL 3TNMA 1WGOA 1E6OH 5AWNH 5TF1L 5IW3A 5DDHB 4OZGA 3U7YL 5IVNA 3LPWA 2GTWA 5FKAA 4BSVB 4JZOA 2DRUA 5I76B 1KEML 2XICA 1H3VA 4MSWA 4PRAA 3MLYH 1JRHI 4JREC 4PG2C 3IS0X 1R3KB 2NXYC 3B3IA 2HT4D 3PV6A 2JB5L 5D1XC 1IGJB 2EIZA 4RA0C 3S3JA 5KSUA 4O2EB 1YECH 3NIGE 3CPLA 4OFIA 3VGFA 2ZOLA 1PEWA 5EFIB 1CLZL 5HSFA 1S9YB 5IW6B 1N64L 4M48H 4MXVE 1XGUA 4XHJD 2K1MA 5E6ZA 1MFAH 2ZCLH 5GS1B 1RJLA 5IFHH 2YPLD 5GRUL 3T0EC 2IQAA 3EDEA 2EDEA 4HUWB 3UTPD 4PR5B 2YBRA 3GBLA 3I6KB 3V6FB 4LL9A 4R7DB 3WMSA 3QZWA 5TE7L 5I1HH 5JXAH 3P4MB 4KU1A 1A1OA 3ROOB 4XCEA 1MJUL 3S96A 1RIVL 1TNNA 1W8OA 3IDXL 4MAUL 3SKNA 2J6EH 4PJ8D 3VMPA 4IS6B 3WLBA 4ALAL 2FBJL 1QNZL 4C58B 4KROD 3FZUD 4L8CA 4R96A 2VDQH 1G9MH 4JVUA 4M61B 2RCSL 4DN4H 1PG7L 2DYPB 2FR4A 3ARFB 1S7VB 3RPKA 2H8PA 1NGXA 4LVOB 2GJZB 5IHUH 5DUMH 2YKLH 4MQXC 1A3RL 1HEZA 1ZHLB 5HTSA 1T22A 4WGWB 4ERSH 5IHZA 3RVXD 3I3DA 1I1FB 2I27N 5KSAB 1L9NA 4R7NB 4C56B 1MNUH 3MREA 5EO1A 2NY5H 4PJIE 3W81A 4XWOD 5AG9A 5J3HC 1CFNB 4RX4A 4XNZC 2Z31D 5TDOA 5D1QB 5T3ZD 2FCBA 1UFUA 2VC2L 3BPLB 1DBML 5LAXA 1IT9L 3VFRA 1A6ZA 2IANB 3DRTB 5JDSB 3CX5J 4KUCF 3BFOA 3ZE2F 4WI7A 5DHVA 2NW3B 4XMPH 3FT3A 1RJZB 3CVHH 1T0NB 3UJJH 4R4FH 2BSSB 2BRRL 3D87B 3KPRA 3SE9L 3OR7B 3LDBB 3WSQH 4OCSL 1JUFB 5GRYA 4HLZH 4CADA 5HI5C 1RK0B 1AGBA 4M7ZC 3HE7A 5DQ9B 2VSDA 3R1GH 2CGRH 1OAYH 4L9LC 3AS1A 4PJDB 4PGEA 1B3JA 4U49A 4YR6B 1QACA 4MJIA 4ZSOA 4PREA 5DD0L 5KVFL 4KJWD 5L6YH 1TZHB 1WCQA 5FA4B 4ODTL 5GSRA 2CPCA 4RMWA 2MJWA 2H32H 5IKCB 1I1AC 5J1AB 4HUXB 5EZLB 5FYKE 1OSZA 5FYJE 4P2OD 5EBLB 1ZA3B 1ETZA 4PPTA 5E8DH 3U36B 2YPKA 4JFXB 4ETQA 3IDMA 4BFIA 2PXYB 4G5ZL 2SEBB 3ME0A 1SYVA 5C0GB 1NL0L 1MHEB 4L4TE 4RBPH 4MA8H 4NO3B 4YDVB 2D0GA 3OR6A 2QR0A 5EBGA 2YD9A 4F15C 1UQSA 5EIQA 1OLZA 2V2XB 2NTSP 4KK6C 4YNYA 1ZVYA 2UWEE 4OLVL 1OP5H 1ZEAL 1U8OB 5SX5H 2R0KH 3W11C 4K7PH 1E28A 4P2QA 2P46B 5KS9A 1WTGT 4M43L 3PL6D 4YHLH 4PGDB 1T1ZA 3ARBC 2FGWL 2X4OB 5ID1A 3VJ6A 4LVNB 4PGZA 1DQLH 1LMKA 1VGEH 1JYXA 3ULVH 4Y4KA 1IC7L 1EVUA 4JO1H 4IJ3B 3CC5B 2BC4A 2P43B 3QXDB 2BVEA 4P2RD 1T5WA 4TSCH 3D18B 1WICA 3L9RB 4L3CB 3BRFA 4AG4L 2CDFA 1FO0A 5BW7C 1CIDA 1MRDH 2HTLD 3RWFB 5F1IA 1NMCC 1U58A 1BBDH 1FZMB 4PJ7F 5J11B 3C9NB 4EOWH 3VWKB 3TO2B 2OK0H 5J89A 4GAGL 1IAIL 4EUPG 3RVVC 4YPGB 4NOFA 4HKZB 2XPGB 2NY6D 3E8UL 1W72H 2WIIA 5MP6L 4LSUL 1XIWB 1QLFA 4PJEB 3T1WA 2GYSA 3EYQD 2L7UA 1CF8L 1FORH 2A38A 3QUYA 2AEIT 3CFBA 3VH8B 4CMMA 2ATPB 1WEJH 3C2SA 5DYOB 1A3LH 4Y19E 1RIHL 4G6MH 5SWZB 4E41D 1AP2A 1A2YA 2D31A 4K8RD 5DUPL 4ODXB 2VXTL 1TJHL 3A6OA 4WWKD 1CE1H 4ODUB 1Z9MA 2HFEA 5DHYA 1CDBA 5T3ZL 4JRYA 5IFAH 3LMJL 3VFOA 4U1JA 3U46B 5DJZA 1ACYH 1OAXL 2Z8RA 5EU6D 1DLHB 4MNQE 1NBQA 3MBEA 1Q9WB 3IF1B 3OPZL 2P8LA 1QUNA 5M7QA 3NGBC 5F89A 4OAWB 4KJYB 4OZHA 5ALBL 4BK4A 5E9DD 1DQML 4HCRA 2VXQL 4MD4B 4O00A 2J5LC 4NDMA 1D9KC 1R3LB 3HPLA 2J88H 4OFVA 4MQTB 5E08L 2YSSB 4ZAKA 1N0XH 1KXVC 4LQFL 4Y5XC 5IT2L 2H9GB 5CKAA 1QLEH 3NABL 1K85A 4TUJB 5JPMA 3HPJB 25C8H 5D7IB 5IJKC 3CMOH 5FAAA 2CLRA 1BJ8A 4RWYL 3VXOB 1S8DB 3QPXH 4FTVD 5JPNA 3MFGB 5D1ZD 1EFXB 3REWB 3DVNB 3T3MF 1B88A 1UM6L 5GJSH 1TVHB 2D03H 5DO2D 2V5SA 2FWOB 3CFJB 5C0AA 3GZKA 5I1LB 1K6QH 3DBXB 5L88H 2R8SL 1EAPA 2QQLH 1XGPB 3ARUA 4JFDB 5DQJB 2N4IA 3Q6FB 2A6DA 3RNKA 5I2IB 4GSDL 3L6FB 1BOGB 1KPRB 1NUDA 3FQNA 1T0MB 2N56A 1AGCA 5I8KH 1IM3A 1U6AH 2WBJD 3ARDC 4WJ5B 4UTAH 2ZUXA 5EOTA 3ILPB 5JTWA 5CEYB 5C70A 4XXDB 2DKMA 2A6IA 4U2ZA 1WT5C 4Y1AD 2BMKA 1QSFB 5DFTA 5HGHB 1U3HD 4X6CA 4P2CG 5T1LD 5B38A 5CEZD 3LN4A 5A2KH 1FFPB 5ETUB 1DQDL 3ZE2E 5IB2A 3CD4A 5ISZA 2ARJA 1AHWC 1FNLA 4G6AD 2QQQA 3S88L 3MR9A 1K2DA 3ZYOA 4S0SD 3HZMA 5E5RB 2G60H 5DJCA 4QRRD 4ODWB 1GHFH 3WXWH 4M5YL 1AGEB 3VGBA 2OZ4H 2IALB 4GAYA 5F96H 2EDFA 4X5XA 2RQ8A 2Z0BA 3G08B 4NHUA 2AK1H 4LCCB 3QUZA 3O9WA 3D85A 5ESAA 5EULV 4I18C 3RWGB 1UB5A 3P4OB 4JVPA 1WIOA 2K7PA 4XVSH 3RL2A 1OB1B 3BISA 3HG1A 1NDMB 3OKYA 3HAEB 3PQYA 3UTSE 1BEYL 5I18L 1NCNA 5CJXA 2BNUB 1WZLA 2AAVA 4KTYA 1UKQA 3RZCD 4FZ8H 8FABA 2WNGA 3O45A 4F7TB 1J9CT 3QFJD 4MB3A 4X4YA 2AJSH 4OCMC 1MIMH 4ZTOH 5EO0B 2DLIA 4MNGA 4HX1B 1ZOXA 3SDCB 4AENA 1JRHH 4QHKI 4YUEL 1FVCB 2F8VA 4Z6AT 2P44B 1A4KA 4CW1B 4K8RL 5CWSB 4MB4A 3NCBB 5CJQL 4XZUA 2AJZA 2HA1A 5GS0C 5JHDE 3RUGA 4MLSA 1GCFA 4XBPA 1FSKC 5CJ8A 3PWPE 4YHKL 3T2QA 3GMQA 4YFDB 4M7KL 2VLRE 2F9BT 3V6OE 3DSNA 1MSPA 5C09B 5D7LE 1VFBA 4KUZL 4PJFB 5E8NB 2OL3B 4DTGH 1U91B 4GG6B 3DOSA 1M7XA 2OS7A 5DT1L 4BQBA 1UCBH 4N0CC 1HHIA 3KJ6H 4RFOL 5ITFA 3CK0H 3LHPH 1EUUA 3MRMA 3UEZA 1ZS8A 5EZJA 1IGML 3MA7A 4HC1L 5JIIA 2UZYB 4WENB 3OV6A 4Q0XH 4DJMA 1DVFB 2WINA 4TQEL 5JW3L 3UPRB 1RUMH 4BQ8A 3LEVL 4K3JL 4OFYD 2VLKE 2DQFB 5IOPA 1U8QA 1PG7W 4HFUL 1X5GA 4D8PB 4PJ7E 2BSRB 1G1YA 2AV7B 4L9LA 3OZ9L 3LZFH 5D5MA 1A7QL 5EA0L 1OAKL 3CFKB 4OJFH 3MRDA 5BJTA 1MLBB 4JHWL 4EQ2A 1P7QB 1F6FB 4WEBH 1ES0A 1I1AA 1OAQL 4Q6IC 2DIAA 3FFDA 3L3HB 3RWJB 1T83A 4NQDA 4U7KA 5I16B 4HUUA 4Q58C 2DTMH 3K4ZA 1MFCL 1MCCA 1RZKL 3IJYB 1ED3B 3P9LA 2HKFL 4YHZH 1LO4H 3OKKA 2IMMA 3MRGB 5IMOA 1CFSB 1N26A 1S7WB 2IAMD 3UAJC 3RIAF 4AH2B 5CCKH 5KVDH 5MHSE 4IRJB 2NQCA 5EU3A 1H15B 3HE6D 2FJFA 3QUKA 1LO0H 4HKJA 4QWWD 3VFTA 1HI6B 5FK9A 4K07A 4PD4K 2HJKB 2H26A 4X6DB 4Q9QL 2IJ0C 1OY3B 3IDYB 1JPTL 5GRJL 1J05B 1RULH 2G5BB 3A67H 4ONOA 4L4JA 2R23A 5IEHA 2DM3A 3LRSA 5SWSE 3HUJF 5DRXA 1JPSH 1FG2B 1AO7E 1OGTA 4I0KA 1CBVL 4P49A 5DMKA 5E8OB 3RWHA 5L9DH 1JNHB 4R90H 2VSCA 3LKOA 2IBBA 2BY2A 1MHHA 4UZGA 2KDGA 3SDAC 5F9JA 4K3HA 4NQEB 4PJBF 4HUNB 3CX2A 5IBTH 3CFEB 1MHPL 5T5FL 2XWBB 4Y7MA 5C2UB 1YNKL 3ZHDA 1NGYB 4WFHD 4KGJA 1NBZB 3LQAL 4M4PA 3BKMH 4ONHB 3E6FB 1ZVSB 2ZUUA 1NFDF 4J3OC 5D7KE 1WC7B 5FO9B 4WY7L 3DXAB 4G6JH 1JGLH 2QQKH 2R2EA 4F9PC 4QHMB 4JO3H 1JVKA 4G8FA 2AGJL 4WHYH 1BFVH 3MZTA 4EN3B 5B8CC 5DJ2A 4LNRB 5DJYB 4P3CH 2JTDA 4ORGB 3SDDC 1OTTD 1GPOL 1H5BA 4N0FB 4RAHA 1K8IB 2Q7NA 15C8L 1QEWA 3LEXA 3UYRH 1BQHG 5F7FA 4RWHA 4V1DD 3M45A 3V4UL 3MCKA 1XZ0A 4X7FC 1L7TH 3TIDA 4LLQB 2VXSL 4XNQA 2X09A 4OGYH 5I74B 1X44A 1WSST 1YMMD 3DGGB 4OKVB 4ZO6A 3S35X 4FQXB 4OZ4B 4NQSB 1WBYA 2Z92A 3MLSL 4PJIA 1HIMH 1YNTB 3V6ZA 1YNLL 4IMLA 4HIJB 3DX8B 5J6HA 4P46C 3MCLH 2Y7QA 1KEGH 3BKYH 4HSQA 3F5WB 3V6OC 1LP9A 1F3DJ 5FOJA 5ITBH 4FMKA 4U0QB 4QY8A 1O7VA 2EE2A 4FRWA 3BP7B 2GFBA 4KRPC 1BD2A 3MLWL 3KJ4B 5C0ND 1K5NA 2BOBB 3TN0D 4LMQI 5HJ3B 2R4SH 3KS0H 4Y16B 1JF1A 2NY4D 5JOPD 2DWEA 4O4YH 1VFMA 4BFBD 1X5ZA 2VKXA 4FQIH 1R0AH 3DVIA 2J8UF 4WFFE 3CH8A 1S9VB 4NJ9H 4Y5XA 3KVQA 1X6LA 1KCSH 1DLFL 1M7IA 2ZSWB 5KVGH 3L7FB 4G8IB 2CKBB 3LSOA 4P9HL 4KHTH 1BM3L 2AABH 5T1KD 4F57H 3P11H 1CL7H 3QDMB 3DVGA 4QRSA 2WM0A 1Q72H 5HHOD 4QHUB 1KFAL 5I0ZA 3O4OB 1JTPA 3WBDA 5ADOL 5C1MB 3U0WH 1T1YA 2PR4L 2P42B 4X6BB 1HH6B 5AZ2H 3S5LA 4QT5A 4AMKL 1C5CL 2DAVA 3CSYB 4MA3B 1I7ZB 5A2JH 1U8NA 5DUBA 4C83A 1BZ9B 5DEGB 4JR9H 4EXKA 1GC1L 3CLFH 1JGUL 5F9AC 2CRYA 3GMLA 3IXTA 7FABL 1GH7A 3EZJB 3S35H 4ZODA 1U8MA 2QHLA 3O2WL 3EYSL 4O58H 3L3GA 2FECL 2QKIB 4P5KB 2FLRT 2GJJA 3NFPA 2V7NB 2W9EH 3RY6C 2FYYA 4YHYB 4M6NH 4N0YL 1T04A 5L7XH 1XMWA 1TQCB 2EE6A 3B5GA 1J1XH 2V5YA 2BNRD 5I8OH 3U0TB 2R4RH 1MLCA 3VH8G 2W60B 4UT6H 4DCQB 4J7RA 2BX5A 2FX8L 4WV1A 3EIFA 3OGOE 4RRPG 2W65B 1S9KC 4OBSA 3UROR 3H9SD 5C7XH 5I1KH 4NM4H 3MXVH 1EEZB 4XB7A 1N2RA 1F4YH 5IBUB 2PTVA 3UTZB 3QIWB 4ZYKB 4LLDB 5DZOA 3SQOH 4OBRA 2RIKA 2UYLA 2XTLA 1JNJA 5B39B 1HZHH 3OJDB 2GTZA 4QF1B 4N1EA 3KLSA 5C8JA 3I2CH 1M6OB 1KELL 2IGFL 4UV4L 3I6GB 5A2LH 4KVNH 5HGDA 1DTUA 2JCCB 4P4KA 1UACL 2V5RA 3OF6A 2NLJA 2Q8AH 4G80B 2FX9H 3MV7D 1CFTA 3FB7A 3KYOA 1FH5H 3MRCA 4AEIL 5I73B 2ATKA 3IDIA 4ZOBA 3NAAL 4H8WH 3TCLB 2D3VA 1A6PA 5MERA 1T2QH 4NFCA 2WSKA 2W38A 1Q0YL 1HKLL 4GBXB 3KLHD 2AJ3A 5D8JH 1BX2A 3PXJA 4EI6B 1XT5A 2X5PA 1IM9A 1BFSA 1HKFA 4PRDA 4YDKL 4NPYB 3X17A 1QQDA 2GHWB 1T21A 3HUJE 1UM5L 2F5AL 5BV7B 4OZIF 4HPOL 2C3XA 1KCVL 2YD7A 5DJXB 2HYMA 4XPFL 5CEXB 1RUPL 1QVOB 3B9KC 4PJBE 1BQLL 4OM1H 3RNQB 4NKOB 2OX5A 1RZJC 4L4VB 4K3DL 2NX5D 3CXDL 5J13B 5DVKA 5TGBB 1NEZB 1YZZA 4MWFA 2Q7YB 3O6FA 4BH8B 4A2MA 3Q5YA 3SKMB 4J3UA 2EXYD 3GJFH 2A83A 4YO0B 2YPVL 3CU1A 3TBYA 3FQTB 2VISB 2EYSA 1M05B 4IDLA 4JFFB 3E2HB 4IMKC 3QUMH 2PTUA 4PGJA 1Q9KB 4BZYA 3GBNH 1EXUA 3MFFA 5DJDB 3UXFA 4PLJC 4TSBH 3OKNB 1JFQL 3L95A 2VABB 2NY1C 1FGNH 4XCFL 4Q2ZB 4MCYB 2KQMA 2HT3C 1QA9A 2EDHA 4NIKB 3FQWB 5GGVY 2EYTA 4Q6IA 4YHOH 3VFWA 4CMHB 3UO1H 4X80L 1X5JA 4R2GC 5LGJB 2AJXL 1U8PA 2FZ3B 2XZQL 2G75B 5ID0A 1J0YA 1N8ZB 2APFA 4IOFC 4CVWA 3VXMB 1KF9B 3PABB 5DA0B 5T3XE 2HLFD 1G6RB 4UOJA 1ACZA 3ZKSD 3IETA 1IC4H 3GSXA 3CFIC 3WS6C 2NY2C 5BS0B 2YD8A 1YJDC 1WWCA 2WK2A 2H2PC 3O8XA 1D6VL 1CXIA 1TFHA 1LEKA 1G7IA 2LVEA 5FYLE 3DX6A 2XWJA 3CAFA 3HAEG 3WE6A 3U6RB 1P4BH 5H8DA 3HFML 3H7LA 4WHDA 2YUZA 3FO0L 4POZD 3ES6B 4KTDH 3LY6A 4FOMA 3EYVA 3OX8A 4XH2B 2D7MA 1SY6L 2ESVE 4OD2A 3HS0A 4WUUB 1XCQB 4G9FA 4IDJH 3STLA 3MC0A 2RBLA 3G9AB 3KPRD 4U1KA 4M03A 4JFED 2QHRH 1KJ2B 4W70A 3QIUB 5I1AB 5GS3A 1T7YA 4F7CA 5H2BB 2G5RA 1NLBH 2W0FA 1SJVA 5HYJE 5FF6A 2AQ3A 2J8UE 5E1AA 2X42A 3GHEL 1C8PA 5JXEA 3L3KA 1UM4H 4MJID 4X7DC 2AEWA 3WN5B 5I8EA 5K9QG 4JKPL 2JK5A 4X8XA 1JNNL 2D9QB 3VMNA 4ZXBC 1P5UA 1DDHB 3EJZC 5HXMA 4JRXB 3UTSA 5I17A 1K4DA 1FL6B 3T1FA 5B8CA 5E00B 5LGHH 2F54E 3GSNA 1BIHA 4KWUA 4GMTH 1RZGB 3AFLA 2VMFA 1VKXA 3DUHA 4JFPB 2GY7B 3NH7L 4LARH 4OQ1A 1A1NB 2FHBA 4UIKH 2C7UB 4L3EB 1U8LB 4X5LA 5DHVH 2A73A 2VAAA 4GRMA 1BLNA 1HILB 1IGCL 4OZFB 2DQDH 4NQCB 3GI8H 1B6UA 3EDKA 3WIIL 1U2HA 4E9LA 4PJHF 4PGBB 1WIUA 4GXVH 4Z8FL 2ITDA 2VDLH 3PWPA 4P2QD 1QBLL 1V7MH 2Y07H 2VLRA 4P46A 4D0BB 4XC3H 3V6OA 4XNUH 2HKHL 2JB6B 5EZOH 2WBWB 5IVXE 2HT2C 2NTFB 3U30C 4N9OB 1NBVL 3RA7H 3D3VA 3HCVB 4NRXB 3FB5B 2ZG1A 1JWMB 4UINH 2BERA 4QCIB 4UDUB 3D25B 3D0LB 2HAZA 3WFDH 3BO8A 5IESL 1SMAA 5EU4A 5DMIH 4KTEL 1IGTA 4NKDB 3ECBA 1UJ3B 1FG9C 1G7PA 1NCCL 3V2AR 1KUMA 5IBLD 3UZEA 2HFFB 3G6JE 2VLKA 5HHMD 2DF3A 3GNML 3ZDYE 4JFHE 4F3FA 2CUHA 4H26B 3PHQB 5EOCJ 3JWOC 1BZ7B 4HH8A 1T3FB 3V4VL 3RTQA 3ARRA 4WCYL 1DSFH 3DMMD 1I4FB 4HF5L 4X8JA 4HFWB 3TZVD 2V5TA 3C2AL 1JK8B 3FT4B 4HPYH 1JF6A 4U1LB 5MEQA 4DKDC 3TWCL 3F58H 1RZFL 4CBPA 4UBDD 3GEWB 1AKJB 4PTTB 1A9BA 1PKQE 3STZA 4F33A 1U92B 1I1YA 5EIIA 1MFBL 3T04D 4KJPD 2W92A 3EO9L 4WW2A 2P5WA 2E7CA 4CAGA 3HMXH 5F3HB 2ORBH 1KB5H 1H3PL 2UY6A 3BDXA 5AZEH 4PJCA 3P40A 4X6FB 1KCRL 1KPVA 5JW4M 3RU8L 3RVWD 4JRYD 2I60H 4XMKH 2H3NA 2VO5A 1A6WH 4R3SA 1T1XA 3NPSB 3UBXA 4OZIE 5J12C 5GS2D 2MTPA 4HWUA 1GZPA 1CDYA 3ARGC 1Y6NR 2EEAA 1YY8B 4MAYC 4YC2C 5ICXB 2ZG3A 3C60C 1HQ4B 4R4BB 1QFWL 1NCBH 1MFEL 2MPAH 4Y2DC 3CVHB 1NAKH 4GKZB 4LCWA 2BFVH 3NCMA 1TJIL 1ERNA 4Z7WB 3U1SL 1WCBA 5DS8B 3V52L 2PW2A 1WFNA 1ZV5A 4TUOA 5DD5H 2CXKA 3LKSB 4AYFA 1KLFA 4WFGE 4JPKL 3M1BA 2Y6SC 3B8SA 4X7TB 5MEPB 3RL1B 1IQDB 4HZLA 4M1CD 3ARTA 2NY3B 4LSRH 1FNSL 4X4MA 2NXZD 2C4FU 2EH8L 2PYEA 5FOBA 4FQQB 5D96C 2ADIB 2H32B 2J4WL 4APQA 3S36X 1DEEA 2B2XL 1S78C 1FFQA 1OAUH 3QI9B 1DFBH 1HYSD 3MACL 2GJ6E 4NO2B 5LG1A 4U31A 5KN5B 5INCA 1FFNA 4LSVL 1FLRL 4S1SH 1U8KB 3C5SB 3VFVB 1WBXA 4G42B 1TJGL 3U4EA 1D5XB 3VCLA 2DQHL 4ELKA 4LKCB 1W0YT 4TULH 2IH1A 4PRIB 1KJVB 3OAYH 4XVJL 4HCRH 4PD4J 2YC1B 3LKRB 4UOW0 2OQJB 1AFVH 5DEFA 4M7JH 4HDIA 4NWTH 4IRSB 4LKXA 2ZKHH 35C8L 5AWNL 4YXKH 4M93C 3PGFL 1HSAA 2NXYB 1CT8A 2GW5A 1I9IH 4HT1L 5JA9A 4QLRA 4TRPH 3IXAB 3MLYL 3LS4H 1HXMB 5GRZA 1VADB 3EYFA 1PFCA 4P5TB 5D1XD 5BZWA 1E0OB 5JUEH 2BRQA 4PUBH 4OV6F 3PDGA 3MUJA 5KANG 4H5SB 4ZPVB 3IFPA 4GS7B 3QO0A 4AT6A 3RVTC 1TDQA 3TNNB 4NQXB 5E2VL 3B9KA 3S37X 2D7OA 1S7QA 2E8YA 4ODVL 3UZVB 5F1NA 5TDNB 2WIMA 1FO0L 3T4AA 1F11A 1MQ8A 2EYRA 1QRNE 3VFGL 2BSED 1KNOA 3MA9L 5FCSH 2XKNA 3BAEL 3K4AA 2Y5EA 3ISWA 3P9MA 1WWAX 4R9HA 3DETC 3BDBA 4PJDF 5L2KD 4LVHB 1IILE 5CAYB 5E7FA 1NGPH 5BRZE 4HW6A 4KI5F 4YBHA 4WVRA 4IMKA 1MPAH 5GGTH 4P23C 5I1HL 4Q74A 3TBWA 2AKRA 4U33A 3C6LB 2XRAH 3BDYL 4P3DA 1MI5A 4ZFGH 1A6UL 5C08E 2EKJA 3IAPA 2GAZB 3BIKB 5E5MA 1JJUA 2ZCHH 5FB8B 4CJ0A 2DQIL 3T0WA 5F71A 2Q8BH 5FUZL 2XKSA 5AAMA 1IQWH 4HWBA 4MJ5B 3B6SB 5CSZA 3RWCB 3RDTC 5IMMA 4PRHB 2V2TB 1CG9B 1KG0A 3DI3B 5IBUG 2R1YA 2AK4E 1MCNA 4JY6A 1OF2A 4PJHE 3VFSA 1BJ1H 4P2RB 2R1XB 1G9NL 2VNCA 3QXAB 3RBGA 4ERSL 1UWEL 1AXTH 4W6XB 5J3HD 3X13A 3JSSA 4XPTH 2FATL 4M3JA 3BVNA 5JNYB 2BCKB 3BN9C 3DROB 4DGVL 4EBQL 1BAFL 5C07B 4MMZC 5D72H 3B8YA 1LK2A 2XZZA 5DTFB 5F3BB 5DD1L 2E6JA 4KKBC 2BDNL 1QKZL 1Z5LA 4KQ4L 1M1SA 3GRWL 3T65B 5LQBL 4OFDA 3REVB 4DFIA 1D7FA 4JANB 5KZCB 1BOYA 4TYUA 1ZSDB 1E4WH 4WTWA 4JO4H 5HI5D 3BWUC 3K2UH 4NKQB 1MCPH 4G7YH 1Y18A 3CVIL 1RJCA 5A1AA 4CKVX 1FGVL 1RMFH 4XVUC 4BELD 5HDQL 1J5OH 2CLVB 3R1GL 5E8EA 4NRZA 5AEAA 3DO7A 3O3EA 3BP5A 5IQ7H 1GGBH 4JM2A 1BPVA 2AJYL 2DQTH 3DX7A 3BI9X 1CGSH 4HKBA 4F58H 3S7GA 4NN5B 1G0YR 4ZXBA 1BGXL 1BFOA 1I1AD 3K8MA 2X7LB 3VFMB 2AS5M 2X05A 5IB4A 3BSZL 1V8HA 3QYCA 2F58H 4PJEF 4YX2H 1QTYT 3GI9H 1TQBB 2DLEA 1X5XA 4JJHA 4RMUA 4I77L 1KCUL 1MIEH 3KXFB 1Q9OA 2P5ED 4UIMB 4EI5C 2ZUTA 3VXRA 5DSCA 2AERT 1PW3A 3KHQA 4F15B 2AXFB 1CE6A 2F74B 4UNVA 4C4KT 2HJLB 5ALCL 3IU3B 4WNQB 5FV2A 4MD5B 4YFLI 2FHCA 2FHFA 5LWYL 4PV9B 4KK6D 2Z4QB 4ODHL 5J0BA 3QJHB 3LPFA 2R29L 1IKFH 3W11D 2MOVA 1TETH 2EDKA 5F7EH 4X99B 3GSOA 2R0KL 5EPMB 3BD4A 4ZDHB 3BP6A 1OP9A 3ARBD 1XGTA 1ITCA 1KTLA 1DZBA 5FUCE 4JPIB 5IMLA 1A6TB 1OP3H 5D1ZB 3F7VB 4PJBA 2Y06L 1DQLL 4ZQKA 1MVFA 1NGWA 4P5MB 3NBNA 2E7BA 3FT2B 4HXAH 4MJ4A 1I9JH 3ZKMD 4GRLA 2P7TA 5DQDL 2CIKB 2IF7A 1VENA 4HMDA 3RGVC 3MRKA 2C3HA 2OI9B 3KPQB 3ROLA 1ZT4B 4YQXL 5J6GB 4HUKB 4Y5VC 4U4BA 5D7IF 3TVMB 4OF5A 3H9YA 3ULUF 1MRDL 2NYYC 5DA4A 5JW5B 4Y4FB 1KIUA 1A9EA 2BHYA 3FKUS 1KIRB 1YYLL 3WV0A 4W68A 3DIFA 2WBJB 1UWXH 3ZDXF 5AG8A 5KTEL 3FN0H 4JJ5A 3Q2CA 3RVVD 1Z9OA 4HS6A 3MJ9H 5JORA 5MI0B 2C26A 3BD3A 1W72L 3T0VA 2DJ4A 1JN6B 3U7WH 4YFEA 5T33L 1EJ6A 4YDJB 3C8KB 2AJUH 4DKEH 4NCC1 1VSCA 4N90E 1MFDH 4FNLL 5E6IB 2WQ8A 2WZPD 4OUUA 4EQ3A 2HRLA 4RFNC 1LGVA 2XTJB 1MFNA 2YHGA 4GW1B 5TH2A 4ZFOB 1NC4B 1RUKH 2VLLA 3MLZH 2C3WA 5GGSY 1T7XA 1KN4H 4D9RE 5E4EB 3WFHB 1LDPH 2PYFB 3BGMA 3FTGB 4ZUVB 5A2FA 5CD3A 4X5WB 4L29A 2IANE 3EOTH 5IFAL 1DJSA 1AXSA 2X4PB 5KOVC 2E9IA 5C9KA 1H3XA 3BQUB 1A3QA 1YEHL 2ESVA 4NO0B 1RHFA 5I8CA 3FB8A 3RWEB 3FQUB 3IJHB 3IT8D 2D7PA 3SO3C 4GLRI 3PJSB 4YHNA 3VRJB 5JDJA 4RGMB 3SQBA 2VDRL 3OAUH 3PHOB 1MF2H 3EOAB 3IU4L 3R06B 3HZKA 3TJEH 3MOAL 4XBGA 1FJ1A 4OZFG 4GW4A 3QFDB 5HYJA 2J88L 4PJDE 4HGWB 5JHLH 3DARA 1TZIA 3QFJB 4WO4C 4LAQH 4MXQD 2FB4H 5I1CL 3TBTB 2Z8WC 4M1GH 1MCQA 1ADQH 1J0IA 1P6FA 3STBA 1LO3H 1JZ6A 4M62L 1FYTB 5FYKD 3EW3B 4PJ9A 4OCYH 3WNOA 1U8JA 2PTTA 3FRPA 5FYJD 2D03L 4UMGA 4YHIB 1UH3A 5GPRA 1J1PH 3QUXC 2CDGA 5KSVA 1JYWA 3C87A 2F54A 4UI2A 2MWCA 1INDH 2NNAB 4LU5H 3AREC 4U0RB 3PNWA 5DC9B 3ARDB 2BVQB 4NJAH 5I66B 4JDZB 1KULA 4L4TD 4PRPA 1REIA 1MH5A 1X4YA 1NGZA 1GOFA 3FB6B 4QRTB 2CIIB 5F6HJ 2YWYA 3CFCL 5C86A 1JGVL 1T7ZA 2X4TB 1HCVA 3UBXI 1XF3B 3OXRB 3T0BA 3FO2A 4PS4H 4UTAL 1TMCB 3LKPB 1D5MB 3SBWA 1JGEB 3MUY1 1JPFB 3MMEB 1HQRB 4I3GA 3N85H 3GMOB 1KYOK 1WBZA 2YD6A 1Q0XL 4P59H 4I3SH 5CS7A 2IEPA 2Y5TA 4NHCL 2PCPB 2X4UA 3HRZA 1YUHB 1HXYA 2YK1L 5DK2B 4NM8H 3VXSB 3BPNB 3N1FC 3FFCD 4PJFF 1JF5A 1JHKL 3P30L 5IVXA 4GG6F 2HVKB 4YE4L 1JZ8A 2GCYA 5DK0A 1FPTL 4OLXL 5ACMA 2FX7L 4WEMB 5GS1C 1S7TB 1LO5A 2PN5A 4F9LC 1EBAA 3U48A 4DVRL 1HSBA 3G5VA 4OLUH 2PW1B 4F7EB 3EGSA 4QRQA 3MRJB 4RBPK 1F90L 1QP1A 2CKNA 4I18B 3QDGB 4K3EH 3G6JA 1CCZA 1L4IA 2OLDA 5JW4R 1QSEA 1RZ7L 1VPOH 3BE1H 4D9LH 1UB6A 4JVWA 3C5JA 1E6JL 2FIKA 3U79A 2IAMB 4O51A 1A7NL 2AVGA 4JFOB 1V3JA 2R56H 4L1HA 4P4KD 3PWVB 4G9DB 4I5BB 4XNMB 5DR5L 1DP0A 4XPAH 4Z0XB 4B50A 5CIPH 2Q3AA 3UTTD 2HRPH 3V5KB 2GUOB 1EGJL 3ZKNC 3ARFC 4I0PB 3K3QA 1I85C 4JN2A 4JFZL 1DBKH 2X4SA 4G3YH 4JB9L 4LVOC 5SWZE 3MBXH 1PKQA 2O61B 4Y19D 3CDYA 2OCFD 4HLZG 4PTUA 5KSAC 3LQZA 1VFAA 1CICA 3SOBL 3R8QA 3BHBA 4OKDA 4X6DF 2EO9A 5FGBA 4I3RH 4FFZL 1PAMA 2BVPA 1CLCA 3C6SB 5GS0D 5D1QC 5I30L 1SJEA 5BOZG 3K74B 3U9PL 2Y36H 1LE9B 2XQYK 3P4LA 3BPLC 2EDLA 5GSVA 3LIZL 3V7AE 1E27B 3Q0HA 4DQOL 1IMHC 4FZEH 2IADB 4LHUA 4HG4K 4MNQD 4X98B 1RUQH 3ZKXB 3SDXB 3MRQB 2P24B 3NFNB 3MJ7B 4G8GA 4CNIB 5F9DC 1RK1A 4KDTA 4HGKC 1XGQA 4JLRA 5FDWB 3NTCL 2P47B 3LDBC 4GG8B 4GXUN 3KR3L 2BNQB 3RPIA 4YXHH 2YD2A 3B2VH 2JJTA 3X12B 3MO1A 4P9ML 4HIIB 4H0IA 2A1WL 3G5ZB 2CUIA 3O6KH 3QDJB 5ERWA 2X4RB 4JHAL 2XN9B 4R26H 4N8VA 5D7IE 5HY9B 4KI5C 3BEWB 3ULUE 5HYIA 2R2BA 4RZCB 1ZT7A 2J2ZA 2E7MA 4QTHA 3ZDXE 4QRUB 1INQB 2FGZA 4U2YA 3GK8H 2ZP0T 2R2HB 4ZO8A 3MGTB 5EORL 3LZFL 4Z7OF 5FYKL 1ORSB 3WL9B 1I9EA 3WFEH 4CVZA 3K46A 4JFDE 5K9JL 4H1LA 5HYSB 1IGIH 2XACC 2HLAB 2PXYC 4L8DB 4UB0H 5GQBA 3MLTB 4QHLA 4XRCB 4E5XA 1IC5L 4PJGB 3CLEL 3L5HA 5LXGL 4FA8A 1N3NA 3QEGH 1T0PB 5INDA 5TQ2L 5EOCH 3KG5A 3UAJD 2I5YL 4TVPH 2BY1A 2ITCA 4CU7A 1DL7H 4HIEA 3UPCA 2CDEB 4EVNA 1D6EA 4NZTL 3HC0A 1QSFE 5E99L 1NC2B 1XEDA 5GIRB 2IQ9L 1H3UA 5I19L 3QIBA 4BH7B 3SO5A 4XHQA 4KUCD 4HJJL 4Y8DC 2EDJA 2VXVH 3W39B 3QEHB 1C5BH 4IJ3C 1U41A 3P73A 4LSTH 4JQVA 5D6DA 3RX7A 1FZKA 5DVNA 5CGYC 5L9DL 2IFFH 3QCVL 4I2XB 4R90L 3O3BB 3SDAD 1UVQB 2XA3A 4ZOCA 3PIQB 2VUYA 3ZYIA 4MXWH 5KW9H 3M17B 1K8DA 5HDBF 5IG7B 4MDIA 4CL7A 1N59A 1F8TH 1NSNH 4XGZA 4U1MB 3QXVA 1N6QH 1X7QB 5JIKA 5IIEB 3I9GL 4S11A 5IR1B 3TO4C 4PBXA 5J11C 3BX7C 3VWKC 2PO6A 2DIJA 4Y5VA 5BRZA 1F4WH 1ZANL 4N0UE 3HI1A 1FQ9C 1ROWA 1JGLL 2QQKL 1WAAF 2HG5B 3UTQB 3UTSD 1K4CA 4BKLB 5HHQB 2DQCH 4AEHL 1OSPH 3EYUL 1NGQL 1XIWC 4YDIL 5I1DA 4QOKB 2F53B 4JN1H 4OV5B 5T1MA 5C08A 4WI3A 1H8SA 3SDDD 1TITA 3DTXA 1CD8A 4BYHA 3H3KA 3RHWK 1CFQB 1A1MA 4FQLL 5C0BB 2R1WA 2VLJB 3DYPA 4JG1L 4Z7VB 5DD3L 2HH0H 2DQUL 2R9HC 4JQIH 5TDPA 2BNRB 4P4RB 1LE5A 2AK4A 4F2MB 5GS0L 3O6LL 3HHRB 3SKOB 5JHDD 4MQSB 3LB6C 2AI0H 1JI1A 3WEXB 3PWPD 3GJEB 3OG4B 5MENA 4OCWH 3HZYB 1A02N 1MRFL 1AD9A 4LLVB 4P46D 4ODSL 4Z7NF 5DD6A 5D7LD 4KRPB 3TA3A 3EOBB 1PLGL 1IL1A 5C0CB 1RI8A 1QBMH 4P57A 4LSQH 2DL2A 3L5IA 2EEDA 1LNUA 2B1HH 1I3RA 3F12A 1G0DA 5HPMA 4AM0B 4D0DB 2K3TA 2M26A 5DJ6B 4HHAB 5GGSA 5D6CA 4L8BA 5F9OL 2ARWA 2VL4A 4OF8A 4M6MH 5C0IB 4CN4A 3MLXL 1UA6H 4O4YL 2VLKD 1YEJL 3ULUC 5C92A 3GJFB 3WUWB 1G84A 3GM8A 5J1SC 1MEXH 3VG9B 2O5ZL 3OXSA 1J1OH 3CFDA 4GMSH 3QUMB 5IVZA 3TNMB 2CH8A 2L0DA 1MQKH 4XXCA 2AW2A 3VXUA 4OZGB 2GTWB 2VE6A 3BESR 5FKAB 4JZOB 2JCCF 3BKCH 4L5FH 1JZ3A 4MSWB 4PRAB 4F57L 3P11L 5IB1B 3AB0B 3Q5OA 3B3IB 2RFXB 1P5VA 2O5YH 4JDVA 3PV6B 1YPZA 4Y4HA 1F2QA 1BBJB 1R6VA 1SEQL 2Q6WB 3AREA 2EIZB 3U0WL 5MHSD 4NZRH 1T20A 3NPZB 4XPBH 4I0CC 5KSUB 3P3YA 4X6DE 3CPLB 4MGXA 4DAGL 5DDHA 1CFVH 5F6IB 4BSVA 4AK1A 3V79C 2RAMA 4WHTB 3S35L 4GLRH 4L1DA 1Z3GH 3QHTC 2IQAB 2YS4A 2I9TA 3JWDH 5CJOH 2YBRB 4ZO9A 5SWSD 1AO7D 1YEEH 1QSVA 3QZWB 3RIFK 2W9LA 5EZIH 3HR5A 1A1OB 2FJGB 1U95A 5C9JB 4O2EA 2XIDA 3VFUA 3RQ3A 1IRAY 3N06B 4MA7L 1SBBA 3S96B 4NQEE 5D7SL 2YRPA 1J0ZA 4XX1E 1TNMA 5EFIA 3K4DA 3QHFL 4FABH 3WLBB 2R0LH 4LCCC 4K7FB 3D1MC 1HOCA 5D7KD 3DXAE 4E42A 3I6KA 4K9EC 3V6FA 2A74A 2H8PB 1NGXB 2ZOKA 3GSUA 2IG2L 4PJ8A 1ZGLA 1EHNA 4Z7OE 3CDGB 4PB9L 5GGUA 5IHZB 3O2DA 5I75C 4APQD 5EG6C 1KN2H 3QWRD 4XCCL 3MREB 3GSNL 1J8HB 1QPPA 5C6PB 4HV8A 4KVNL 1HCFX 3HNVH 5TDOB 3TYFA 4YZFE 5SV4A 3SDCC 1F02I 4RNRA 4HXBL 1SEBB 1CR9L 2WWMC 3L3IB 1FZOA 4Z77A 1A6ZB 1SBSH 5HGGS 2E27H 3G04A 4S2SA 2A9NL 1OW0A 5DHVB 5BMFL 4AIXA 5DWUL 4KZEL 4GUPA 5C0EB 2C3VA 3TPKA 2WWKO 1AQKL 1FN4B 1YQVH 1I3VA 1RUAH 3ARVA 4R7NA 1FLTX 3KPRB 4QXGL 4OIBA 4KPHH 1NCAH 1KC5L 5D7JB 3O6MH 1CFNA 5FEBA 1D5BA 5ADPL 4CADB 1RU9L 4MZ3A 1AGBB 3HE7B 4ZFZB 4JKKA 3MGOA 5ANMA 3EDDA 2CMRH 4PGEB 2IANA 3DRTA 2X9XA 4ZSOB 4PREB 1NCWL 3CU7A 1FNGA 2DM4A 1RJZA 1P6AB 4HH9B 2V5MA 3JV4A 5GISL 3B9KD 2E3VA 1JV5A 1TZGH 3TYGH 4R4ND 5HDBE 3PWUA 1DVFC 1A0QL 4X7SL 2MCPL 1N5YL 1HN1A 1JUFA 1OSZB 3IYLW 1ETZB 2JLLA 2CQVA 2VZVA 2LAAA 1QRKA 3BKJH 1AJ7L 1S5IL 4WFFD 1CZ8H 4BFIB 4ACPA 1MREH 3T2NH 1BVLA 1SYVB 1ZGLP 4M7LL 2W91A 1MAMH 3IDNA 3W9DA 4DVBA 1TZHA 4XAWH 1WAAE 3VG0H 4M8QA 3QISA 1G7MA 1UQSB 1IFHH 4PLJD 3FOMA 3QDME 2NY1D 4XCNA 4YNYB 3O4LE 1KPUA 3VU2A 4V2CB 2FO4A 2W0LA 1E28B 1B0RA 3O11A 3JV5A 5KS9B 4YBQC 3WJLC 4YHOL 1VGKA 4IRJC 5JR1L 1MHEA 4R2GD 3ZT7A 2BVYA 5ID1B 5I15L 4N8CL 4NO3A 5CGMA 4BSJA 1LK3H 2NZ9C 4Y4KB 2BC4B 3KPLA 4ZUTA 4ONFL 3IDYC 2V2XA 4JRWA 1T5WB 5LBSL 1GIGH 2NY2D 3FMGH 3K8LA 3ZYJA 2H2PD 2C1PA 2CDFB 4PG9A 4Z7NE 2EIBA 1GXEA 5F1IB 2I9LA 5LKNA 3QCUH 1U58B 5TPWL 2UUDH 3M8OH 4NN6B 2AXHA 3N1QC 4LIQE 2YEZA 1GOGA 2WIIB 2VKWA 1EEYA 2QHRL 4OLYL 1QLFB 4I48A 3KYMB 5IFJA 4GXUM 4YHML 1UXSB 3QUYB 4OIAA 3CFBB 4DW2L 5FUOH 2EDXA 4JM2D 4XC1H 3TJHC 1SHMA 4FQCL 1XR8A 3BH8A 4EN3C 1AP2B 1A2YB 2D31B 3MV7E 3MXWL 4NUJB 4ZXBD 3K1DA 4AQOA 5GRWA 4NZUL 2JCCE 3EJZD 1S7RA 1UZ6E 2DLGA 2HFEB 5DHYB 2VAJA 4JRYB 3VFOB 4U1JB 1U8HA 5DI8A 3ALWA 3RZWA 4GQPH 4X4XA 4E41A 1T4KB 2ATPA 4X0KA 5C6TH 2FNBA 5BOPA 3MBEB 5BVPH 3MV8B 2P8LB 5SWZA 1UWGH 1Z2KA 4BQ6A 1F97A 2PKDA 4OZHB 4LDEB 4WWKA 4J6RH 3FCTA 3MNVA 5I74C 1Y0LA 1FFRA 2AP2A 4FQXC 2HVJA 4XMLH 5CJBA 2B20A 1MUJA 2XNAA 4NDMB 1KYOJ 2CK0H 3HPLB 2VDNH 1EO8L 4A6YL 2OL3H 5JIHA 1GRWA 3PXHA 4ZAKB 5KJRH 3U46A 2HP4A 2X4NA 3EKCA 2DM7A 1LD9A 1ZHBA 3KNBA 4WHCA 1DLHA 3CX5K 1NAMH 3BPCA 1P7KB 4N0RA 5JPMB 5EC2A 4KRLB 4JQXA 4I8DA 4I1NB 1ZWIB 2CLRB 2VR5A 4KK9C 4NT6A 2X9WA 5JPNB 5EZOL 4L4VE 4MHHG 3GUTA 1NPUA 1ZLWH 5E0QA 3I84A 1RZJL 4QNPF 2DBLL 1JZ5A 5C0AB 3C08H 4UILH 2A77L 1EX0A 4HC1A 4GRLD 4FQ2H 5CINL 1MJ8L 2W0KA 4U1HA 4Z7WF 3TT1H 1IBGL 5ABDE 1M7DB 1JYNA 1XR9A 1A5FL 5DMIL 3RNKB 4QXUL 4JFFE 3HPJA 4FTVA 2VDPH 1AGCB 2ZJSL 1AIFB 5HHNA 4LASH 1A64A 2LTQB 5EOTB 3O41B 5I1LA 1B4RA 3OKLA 1XGRA 5EOQL 3L5JA 3O4OC 1UYWH 3WXVH 3Q6FA 4HWBL 5E4IA 1CGWA 4Q9BA 5BVJB 5ISZB 3NACH 2ARJB 3VXME 3U9UA 1E4XL 3GMPB 4G7VH 6CGTA 5ILTH 1K2DB 3HZMB 5T3XD 5DJCB 3MLVH 3MGAA 3DYOA 1HHJA 3VXQA 1P7HL 1NBYB 1U3HA 3HMXL 1FL5B 1YJDL 3GJFK 1KB5L 5DLML 1M71A 4XT1C 5AZEL 1QSFA 4HG4J 4LAJH 5FYLD 1ORQB 2G2RB 1RY7B 2ICES 4GAYB 4PY7A 4YHYC 1LEIA 3N1GC 4X5XB 4NHUB 1A6WL 3FO1A 5ETUA 1G7LB 3QUZB 4XP4L 1TQCC 2KZWA 3ARGD 3D85B 2R69H 3O9WB 3QPQC 5ESAB 3RKPA 2ESVD 4BQ9A 4W81A 1UB5B 2K7QA 3CSBA 4HEME 4WUUE 4MAYD 2DD8H 5CUSL 3RL2B 2AJVH 3HG1B 3ULVF 5EUOA 1RQ5A 2X1QA 3PQYB 3BH9A 4ODWA 2Z91A 1MAKA 1NCBL 3QQ9C 3H3BC 4LRIA 8FABB 2R0WL 3O45B 5HYJD 2IALA 3GSWA 2W0PA 3EFDH 3IAGC 4MNGB 3SE8H 3MROA 3VXPB 1RSFA 2Y6SD 1A4KB 3J7HA 2J3SA 4N0UA 4OIIL 2VJXA 3RZCA 1I7TA 1PX4A 4XZUB 2AJZB 2B0SL 1UGNA 1FAIL 4HS8L 2LQRA 3HI6L 1WK0A 2BNUA 3JTTA 1ZKAA 3RUGB 5I73C 4LLUB 4XBPB 2HMID 5L2JA 2UZIL 4NP4L 1S78D 2VIRA 4F7TA 1NCDH 3FQRB 1R5IA 4J12A 1OAUL 4Z7UA 4MNHA 4NN7B 2XZCL 2JJSC 4L3EE 1CTNA 1VFBB 4GBXC 4LCUA 1A4JB 4HMEA 3VXTA 1CN4A 2L4OA 4NQCE 4H88L 1HHIB 4QTIH 3Q6GH 1S7UA 4Z18A 3WUWG 3WIHH 2YN3A 3MRMB 2X1XR 1ZS8B 3N50A 5EZJB 3LCYA 3PWNA 2D7TH 5DZNA 3MA7B 5B22A 3ZDZE 5BV7C 5F8QC 4TNVK 2WINB 2QADC 3P0YH 5I1EH 2CJUH 4N5EC 2V2WA 5IOPB 1U8QB 1F4XH 2R2CA 3WO3B 1U91A 3LS4L 5D5MB 1CXHA 2CXGA 3BRDA 2F5BH 5L8LB 4L8SA 4B53A 5J13C 2BVUA 4D2NA 3SGJC 4DWHA 3PP4H 3WNMA 3MRDB 1HNGA 4YJZL 3BZEA 1ZT1B 1AC0A 1ES0B 5IV2A 2KL6A 4OFYA 3FFDB 3RY4A 3AAZA 1BQSA 4NQDB 1IAII 5HHXL 3SE4A 2CKBH 3HI5L 5D71L 3EO1B 2OSLA 5D93B 2ICWJ 4JFHD 3T09A 3P9LB 1CLYL 2O5XH 3JWOL 3OKKB 4P23B 1DBAH 5EU3B 4NNPL 2FJFB 2ZUVA 1QOKA 3QUKB 3MJ8A 4HKJB 3VFTB 5EO9A 5FK9B 5TQ0H 1IEAA 2H26B 2JF1A 1AE6H 1DBBH 3QZWG 3RWJA 1IZKA 2FD6H 3BD5A 4CMHC 5IEHB 3S36L 4KKCC 3LRSB 1RFDL 5DRXB 1OGTB 3MRGA 3TESA 5DMKB 4Y8AA 3RDTD 3RWIB 3PP3H 3RWHB 4AH2A 1P4IL 5T3XL 4G6KH 5EBWB 3H0TA 3LKOB 1CDHA 3PGDA 3ZTNL 2HJKA 3EDFA 5F9JB 9CGTA 3C5ZB 4RA3A 5FHBH 1C08A 5GZOC 1J05A 4LPVA 2OTUA 1BIIA 4OGAD 5FYLL 3PV7A 3AC0A 4KZDH 3WFBL 3A6BL 5IGXL 1AXTL 1AR2A 1OCWH 4NO5A 4WU7A 3BN9D 4K23H 3SKJL 5T1DH 5DXWA 5BO1H 5E8OA 5C0RL 4EEEA 2R2EB 5DMJB 1GGTA 3CCHB 4QNPE 3WYRA 1YYML 3QIUC 4G8FB 5J4MA 3VRLE 1S7XA 4KKBD 1JCKA 4Z7WE 5DJ2B 1MJJB 3RI5K 3CFEA 4XP5L 4KK5C 3IFNH 1NBZA 1QBBA 3S37L 1WITA 1Z9SA 1ZVSA 1H5BB 3WN5C 5DF0A 1EHLH 1KB9J 5FO9A 4JO4L 3DXAA 3LEXB 4WFGD 1MCPL 4XVUD 3LKNB 5AYUL 4XVTH 1RMFL 3MCKB 4LRNH 1XZ0B 3THML 3IDJB 3TIDB 4OF6A 2H2SC 2B4CH 4JZJA 4JKLA 4EN3A 3OL2A 5HPOA 3S8WA 1CYGA 3O0RL 1WBYB 2Z92B 5KVEH 1YEKL 1R3IH 4PJIB 3V6ZB 5EDXA 3EJJX 2DQJH 1UH4A 2GJ6D 2Y7QB 3P77A 3VWJA 1LP9B 2IPKA 4V1DA 4Y5YA 2X40A 4WW1B 4JG0L 4PRIE 3GI9L 4QY8B 3EFFA 4UNUA 4EI5D 3L3OA 4W4NA 4WDIA 3WHE1 1I8IA 2GFBB 4GAJH 5HI4C 1YMMA 1BD2B 3JVGC 1WFUA 3MRPA 1YEGH 3H3PH 1K5NB 4ZOEA 5DK3A 3U7AA 1NFKA 4RGNC 4FQXA 1T6VN 4OZ4A 3IFLH 1EMTH 3SKUD 4FXKB 2DWEB 5F70A 4HIJA 3CSGA 4L9DA 5D2LA 1FVEA 3F5WA 3TIEA 4J4PC 5FKPA 4LSDA 5HGBA 1JWSA 3Q48A 1U8IB 4HK3J 5AD0A 3TN0A 1BMGA 1HHGA 2AEPH 5F7EL 3ULVE 5C71A 2G9HA 3LSOB 4N68A 3OKEB 1NLDL 2DDQH 2JIXD 5IMKA 4WTXA 2MKLC 1JHTA 4Y16A 4U3CA 3QG7H 3T0EE 4H1LH 3EO0A 1UJ3C 1IGFL 3DVGB 4QRSB 3KPTA 4WI5A 1QRND 5F88B 3RGVD 4GQ9H 4Q7DA 4JHZA 3OAYK 2DMBA 4LBEA 1QG3A 2PO6D 4S1DC 5E2WH 3VMOA 1MRCH 3S5LB 2E7LC 1I8LA 3C8HA 5TF1H 1T89C 5T1KA 3U7YH 1U8NB 2X70A 4PP1C 5DUBB 4C83B 1WAAA 2GI7A 3IFOA 4WTZA 2EDBA 3GMLB 5HHOA 3RIFF 1GJIA 5C08D 3QDMA 5HHVL 1S3KL 1J0HA 3L3GB 2JB5H 4XBEL 5CIPB 1QO3A 1G9MC 4B7LA 3GHBL 3O4LA 3JTSA 2VDKL 5F7HA 2FYYB 1GAFL 3VFNA 4PRHE 2GITB 4LPXA 4LPYA 2AJUL 1I7ZA 1T04B 5I9QB 3SCMB 4HBCL 1E4JA 1MCKA 1CLZH 2AK4D 1MLCB 3KYKL 5I1IL 2NY5C 1MWAL 3WKMH 1AGFA 3NPSC 5GRUH 1XGYL 4WV1B 4X7CC 4P5KA 2ICWI 3RFZC 2EDYA 2V7NA 4ZNEE 1N2RB 5C07E 1KN4L 1CGTA 5TE7H 3L1OL 1SY6A 1P9MC 5DGRA 1U3YA 1KIPA 1IKNC 1MJUH 2UYLB 1RIVH 2YXMA 2WP3T 1KJ3H 4XNYL 1S5HA 3B5HA 4RISL 4MAUH 5EWIL 4BQCA 3KPPA 3TGXA 2QQNL 3NCYP 3ZHLA 4ALAH 2FBJH 1NKRA 1QNZH 5HGDB 1CD1A 3V0WL 3H9SA 4FP8L 4P4KB 2NLJB 4MJ6B 3P0GB 2RCSH 4KROC 1AQDA 3KYOB 3FB7B 4PP2B 3WJJC 1PG7H 3MRCB 1IAKA 1EEZA 3F7RA 2ATKB 3IDIB 4WO4B 1PD6A 3F7YB 4UTBL 1DQQA 3UTZA 3QIWA 4LLDA 1CGUA 5MERB 2MQ3A 5B39A 5JHLL 1A3RH 4JKWA 4RSVA 3ZMRA 2NY3C 2DOCA 3V5HA 2AJ3B 1JMZA 4OLZL 4ZD3L 5ESVA 1BX2B 5EU7C 5LCVL 3I6GA 1BVKA 3MV7A 3GMNA 1IC1A 3OJMB 3QI9C 3RX8A 1IM9B 3QUXB 4AL8L 2Z31C 4S1RL 4FQHB 4PRDB 3INUL 3DHMA 2P5EE 1QQDB 4IRZL 1DBMH 1IT9H 4XAKE 3SJVE 3KXFE 5CMAB 1UJTA 1AH1A 1D5IL 2WW8A 2BVOA 5L0QB 3ARED 3KS0J 1KLGA 2OJEA 3DO3A 4CVUA 1SJXA 2BRRH 4FN0A 3SE9H 4IRSC 1W8NA 1TPXB 3ZT5A 4Z5RA 4DGIL 4F7PB 3FONA 3DWTA 3SGDI 1B0WA 4FQPA 4XP9L 1UCTA 2APWA 2I07A 4PS4L 4MWFB 1IAOB 3O6FB 4DGYL 3W82A 4PRBA 3V8OA 4JY5L 4P5TC 3ARYA 3CUPB 4JZNA 2A83B 3N85L 1A14L 4U1SA 5DD0H 1FZJA 3G6AB 2EYSB 3OHXA 4ODTH 5D2NA 3SDXF 3KPSE 3ULVC 4GS7C 4U05A 1AR1C 1RIUL 2NX5A 3Q1SL 2DQEL 2DN7A 4G43A 3MFFB 3V5DA 3AROA 5B38G 1EHXA 2VXUL 2OTWA 3QO1A 1RD6A 2QL1A 1NEZA 2Q7YA 1QA9B 4RGOL 4ESKA 4G5ZH 2EYTB 4RAUA 4LVHC 1NL0H 1A7OL 1J87A 1M05A 4JFFA 5D9SA 1U8PB 5JZ7C 3WHXA 5ID0B 4AY0A 3C6LC 2A6JA 3X3FL 4OB5L 1VPOL 1BFTA 3NZHL 1CDJA 3OKNA 3IETB 4OLVH 1ZEAH 1WQVT 1QPXA 3MRRA 5CP7B 4U6XB 4QHNA 3O8XB 4M43H 1LEKB 4JPWL 4EIZC 3DX6B 5E2TL 3LRGA 4NYLB 3WE6B 3ZE1E 2DYPD 3ZKND 2FGWH 3ARFD 2HRPL 2Y25A 1T66C 3MYJA 4PJGF 4N90D 1U3JA 3OX8B 1IC7H 3DX9A 1JZ4A 2G75A 3T08A 1DBKL 2XTJE 4U1IB 4OD2B 3PABA 3VXMA 3HS0B 5JOEA 2P8MA 3STLB 3MBXL 4G9FB 5KSAD 2QJDA 4C56D 4K7PX 3TLRA 1FVDA 4AG4H 4YAQA 1NH6A 4R6UA 4R0LA 3FQXA 1FBIL 4F7CB 2W0FB 1VEOA 5D1QD 4D9RD 3NIDE 5HHPA 3HC3L 3OJVC 2OBGA 5E1AB 2HTLC 3LEYL 3LV3A 2IAND 3L3KB 3ESUF 4UT9L 1KOAA 1UWXK 3WLWC 4UQ2B 4FZEL 3UDWC 3I02A 3L3JB 4GAGH 5I8EB 1IAIH 1KTDA 4M6AA 2JK5B 4JFEA 4WUUA 4JEGB 3E8UH 1BQHB 2AEQH 2CLZB 4LSUH 3WCYA 1N6UA 3S4SA 5I17B 1K4DB 5ECJE 5KAQF 4PRNA 3T1FB 4OT1H 4YXHL 4HIHA 2EKSA 4OQTL 3QRGL 4KJQC 1VKXB 1I8KA 1RIHH 4U1GB 4JDTL 3O6KL 3WN5A 2VDOL 1NMAL 5DUPH 2VXTH 1TJHH 4LFHG 2VAAB 4NN5C 4OF0A 3VE0A 1BLNB 4GKSA 5T3ZH 3I75B 3IVKA 3LMJH 4NWUL 3K8KA 3H9HB 1OAXH 1MCDA 2ZZUT 5E00A 1TQBC 1ZTXL 2ITDB 1JTOA 5KBNC 2ZWLT 3QCTL 3GO1L 1A22B 4H0HB 3OPZH 2AXGA 2VLRB 4UB0L 1DQMH 1T6WA 4Z7VF 2C7UA 3D69B 4L3EA 1U8LA 5A40E 3WS3B 1UKTA 5DURB 1HILA 3D3VB 2EIDA 5EOCL 3MV9B 5E08H 3D2UA 4OF3A 2X89D 3V7MA 4IIQB 3BT2L 3BO8B 3VRIB 4LQFH 5IT2H 3SE3C 1XH3A 3AMKA 3NABH 1FHGA 3QEQB 1SYSA 2HTKD 3SGKC 3FFCE 1G7PB 1WZ1L 4RWYH 1JNLL 4YDLB 4D0BA 3GBMH 4GO6B 5CILL 3VXSE 2VLKB 2DB8A 4QHKJ 4F3FB 4WU5A 3VD7A 1UM6H 2NTFA 5D1ZC 3RTQB 3RAJL 2ED8A 2VXVL 1A6VL 4NRXA 2R8SH 4NGHL 2BOCA 4BZ1L 4X8JB 3EZ8A 5CGYD 4LSTL 5EU5B 1CLOL 1KLUB 3RJDA 3UMTA 1F5WA 5JMRA 2OI9C 2OJZL 2FRGP 4ONGL 4GSDH 4NKDA 3A6CL 1IAIM 1ZGLM 5MEQB 3N9GL 4LK4A 4M1DL 5J9PA 3TO4B 3QDGE 4F37K 3TVMC 3KPNB 3G5XB 1AY1H 4Y4FC 1A9BB 1BZ7A 3STZB 4DEPB 1I1YB 3DMMA 5EIIB 2WBJC 3EHBC 1WJ3A 2E7LA 1UEYA 3O2DL 3TZVA 4WW2B 5IEKA 2O93L 3IGAB 2P5WB 1I4FA 1T89A 2CK2A 3UTTE 3SEPA 3QAZB 1T03L 4OZGF 5MI0C 4PJCB 1KPVB 1OAZL 1XIWD 1R3JA 4CU6A 2H3NB 4R3SB 3FT4A 2DQCL 1OSPL 4RIRA 1DQDH 1T1XB 4GOSA 2ADFL 1I8MA 3UBXB 3ZSTA 3S88H 1CL7I 1GZPB 5E6IC 3GMRA 1AKJA 3U4BL 3VI4F 1U92A 4MHHI 2XTJC 4R8WH 5SWZD 4J1UB 5HGAA 5I1GL 3MRBA 2NMSA 2R9HD 5C2BL 3NA9L 1QYGH 4CGTA 4M5YH 1XAUA 2X41A 4LCWB 5E4EC 2HFGL 4LGSB 1QFUL 2PW2B 4TUOB 3DI2B 1V7NL 3CH1A 5EBMA 4KAQL 4NC0B 1ZHKB 3BQUC 3SDXE 4KXZI 3M1BB 1P9MA 7CGTA 5I18H 4KKNA 3DUSB 3GRWA 2ENSA 4HZLB 4KY1L 4RGMC 5TF0A 2BNQE 4FMFA 3MYZA 4XWGL 2PYEB 3IJSA 1DEEB 3QDJE 2DQGH 1N4XH 2KZ1B 5F97E 4XB8A 2V6HA 5C0DB 3U83A 3DECA 4JM4L 4YUEH 3MRLA 4HUVA 5INCB 4JO2L 1YEFL 3UJTL 1WBXB 3ULUD 3I50H 4K8RH 3U4EB 3VCLB 4Z95L 3CZJA 4ELKB 4NUGH 4TNVF 5CJQH 2IH1B 4FG6C 5IW1A 1KCLA 1EFXD 4WUKL 4B7IA 1RJYA 2MNUA 5DEFB 4HDIB 4LLYA 5F7LB 4YHKH 4O02L 1MCOL 4LKXB 4X9FA 4M7KH 4JFDD 4LLMA 3OGCA 4ELMB 1HSAB 5IHLB 1D5ZA 1CT8B 2IH3B 4U0RC 3GSRA 3LRHA 4KUZH 4YXLL 4PJGE 3H42L 4D0CA 1WZKA 3C5SA 4G42A 5E8PA 1NANI 5DGQA 5IK3A 1IAMA 3EYFB 5DT1H 5BZWB 4RFOH 3WIFA 3H7BA 4NNXA 1ND0A 2YC1A 2XG4A 2MCG1 4TSAL 1B2WL 3QO0B 4AT6B 4MA1B 4NZRL 1IGMH 4XPBL 4UDTB 5JW3H 3S5LG 1S7QB 2XA8L 1KENL 4TQEH 5F1NB 1J18A 4PG2A 1QSFD 3T4AB 4K3JH 2EYRB 3ZLQC 3ULSA 4HFUH 1KNOB 1VERA 3GM0A 5D1XA 2XKNB 5EUKA 3P9MB 1HXMA 3OZ9H 3ETBF 3BPNC 3T8XA 1O7SA 1A7QH 5EA0H 4JGJA 1OAKH 1EFQA 1XF1A 4BZ2L 3PE9A 3FRUA 1RZIA 1TTUA 4ZS7L 2J8OA 3RWDA 4ZPVA 4JHWH 5IJVB 4I2XE 2LU4A 5EZIL 3TBWB 1JBJA 1OAQH 4DOHB 3NMEA 1E4KC 3RX5A 4P3DB 3B9EA 1MI5B 4MX7A 1MFCH 3GMMA 3LKQB 3T0EA 3MLUL 5E5MB 2LV4A 1RZKH 5L2KA 4FABL 4K2UL 1JHLL 3MV01 4N5UA 5F7DA 2C3GA 5A16B 3EYOA 2XQBL 1J86A 5KSBB 3OMZA 3W2DL 5CSZB 2IAMC 5IMMB 4RFEA 3MOBL 2EDRA 4Q9QH 5I75B 4DUVA 2H41A 1KG0B 1MCHA 1JPTH 2R1YB 3Q3GB 5GRJH 4JY6B 1OF2B 3ABZA 4QOKE 4O2FA 3VFSB 5DJAA 2F53E 2VQUA 3HB3C 5CEZH 1W72A 2GAZA 3BIKA 4UAOB 4I0PC 1KN2L 2IPTL 1RVFL 3X13B 4MVBC 1CBVH 5JQHC 1OGAE 3SGDH 3BVNB 2CRIA 5C0BE 2VLJE 3RI5F 3SDCD 4Z7VE 5KS9F 2WWMD 1FC1A 3BZ4A 4OM0L 4PRHA 2AQ2A 3O3AA 4XP1L 3LQMA 1LK2B 4HK0A 2UVEA 2F19L 1MHPH 1Z5LB 4LGRB 4QRPE 2FL5B 3B9AA 2DM2A 5DMYA 1EV2E 3LQAH 1VA9A 5EN2A 3L3DB 4BM7A 5DFVD 4WY7H 1NCAL 3ZKXC 3O6ML 5C09D 2BCKA 1Y18B 2GT9B 2PF6A 1NAMB 2P4AB 1YQ2A 4JAMA 5AYQA 1AI1L 5C0CE 5E8EB 4NRZB 2AGJH 3DO7B 3O3EB 3ARXA 1F42A 1XFPA 2E8ZA 3BP5B 5DTFA 3WNPA 4NKMA 3ZT6A 3DX7B 3NFSL 5FHAL 2XZAL 4RAVB 3REVA 1BFOB 1GPOH 4LSPL 3JV6A 1ZLSL 5IB4B 3G9VA 2DMKA 15C8H 4RQQA 3ULUL 3V4UH 1CDCA 2VB5A 4HAFA 4OD3L 3VXRB 2VXSH 2VH5L 1WVZA 4UU9A 1Q94A 5DSCB 1OTUC 2Y72A 1N7ML 1CE6B 4OZGE 3BZFA 3MLSH 3UJIL 1P7QD 1YNLH 4NNYA 4HKXA 4OUOA 4M6OH 2P5EA 3NCJL 4FFWD 3MRIB 4ZUSB 3SJVA 5D70H 3S6CA 4GW5A 3GSOB 1CK0L 4YBQD 3TBVA 4IRJD 3BP6B 3MRNA 4HJGA 2AXFA 1GZQA 5C0NC 1KTLB 4OZHF 4FFVC 5IMLB 2NZ9D 4OCXL 2YMXH 3MLRL 3IU3A 4OLEA 4WNQA 1NGWB 1UG9A 1Q1JL 2Z4QA 4S1QL 3VGGA 3MRKB 3MUZ1 4KC3B 4O5LL 2FJHA 3N1PC 1LO2L 3ROLB 2APBA 3HMWH 1DLFH 3ARBA 4Y88A 4P9HH 4ZDHA 1BM3H 4OCNC 5C0FA 3KPSA 4NOBA 3QCUL 3DIFB 4PB0L 1N6VA 4NQED 4JJ5B 3T4YB 3DSFL 4LEXL 4P5MA 1HHHA 4TPRL 1ZVHA 1KFAH 2HWZL 3TPUB 4HS6B 3W0WB 5BW7A 5ADOH 2QSCL 1MCRA 1A7RH 2PR4H 4U1NB 4AMKH 1C5CH 2A0LC 4WI8A 3X11A 4LEOA 2OM5A 3T3ME 2C5DC 3DXAD 2CO6B 1JWUA 4K9EL 2VWEE 1BJ1J 1ZA6B 2V17L 5K33A 43C9A 2X44D 4Y4FA 3O2VL 1HDMB 1NUNB 2EC8A 1JGUH 4OUUB 4PJAB 4JCLA 3TJHD 1Y6KR 7FABH 1H3GA 4EN3D 1H0DA 3O2WH 3EYSH 5TH2B 3GKWL 1YEIL 1J8HE 2Z9TA 1CXEA 2VLLB 1EGJA 3R0NA 5E2UH 3TH4T 3VWJD 1JN6A 3BGMB 4W6YB 4HWZB 5CD3B 3LAFA 4N0YH 1MCBA 4H8WC 1R24A 2EIEA 2OP4L 1AXSB 3N0PB 3G6DL 2H1PL 4NRYB 3MQIA 5F7MC 2ESVB 5I8CB 5H94A 3FB8B 4KDVA 4LF3A 4Z9KB 1MY7A 4BFEA 4FQXD 3UC0L 4ZFOA 2EC9T 2YA1A 1NC4A 4LPCA 2DKUA 4Q9RL 4XMLL 3F8UB 3HZKB 3WFHA 4DN3L 5BXFB 2PYFA 5I1JL 4XBGB 1FJ1B 3TT3L 1KT2A 1U36A 2DICA 2OL3L 1TZIB 4ZSOE 4PV8B 1BWWA 1KELH 3HNTL 1X9QA 4HIXL 4YWGL 4IBLT 2IGFH 4NO0A 4HBQA 4PJXB 4UV4H 3VDAA 3RWEA 3PGCA 4KK9D 4ZUWA 1UACH 1D9KA 2MHAA 2LVCA 4Y16D 5ELIA 4AEIH 4O9HL 3PHOA 4PJ9B 1U8JB 2PTTB 3EOAA 3NAAH 3R06A 3FN3A 3C08L 4NCDA 3JBG7 1L0YA 3UYOD 2NY0B 5CD5C 2F54B 3VG9C 2P8PA 1Q0YH 1HKLH 5IJKA 1JPGB 4M5ZL 4NKIL 5ICYB 1WFOA 3TBTA 3OKDA 2X9YA 4NQVB 3KLHC 4PRPB 1MH5B 4LCIL 2P48B 1NGZB 3DV6A 2VQ1A 4MDJA 5E24E 4YDKH 4HS3A 3FO2B 4CVXA 3QDMD 3ZL4L 4E0RA 3RUGF 1UENA 3ZTJG 3AB0C 4YHIA 2F5AH 4LP5A 3O4LD 1C1EL 1WBZB 1KCVH 3OB0H 2NNAA 4L4TA 2Y5TB 2X4UB 4N8PA 4XPFH 1RUPH 3ARDA 3KDMA 1HXYB 4JDZA 1UXWA 1BQLH 4K3DH 5IVXB 1MCFA 3CXDH 3QNZB 5J7CC 2ADGA 5F6IC 2X1OA 2GCYB 5DK0B 4G7VL 4KXZH 5ILTL 2UWEA 1L7IH 1WT5A 3OKMB 4JPVL 4OGZA 1WWBX 1LO5B 3OSKA 3HLAA 3LPGA 3O81A 4LLWA 2YPVH 1HSBB 3G5VB 3MUGB 3EGSB 4LMQE 2FEDC 1AHWA 1OHQA 3FFCA 1YUHA 3G6JB 5DK2A 3VXSA 3WD5L 1QSEB 1PSKL 3QPQD 2JELL 1D3CA 1UB6B 2ARJQ 3C5JB 1JFQH 2FIKB 5D5MF 4XCFH 4O51B 3UBXG 4B41A 4MLIA 2DD8L 3D9AL 1S7TA 5A2IH 3QQ9D 4A2LA 3D0VA 3ELAT 4X80H 4F7EA 3WUZA 1FE8H 2AJXH 3QIWD 4G6FB 2VWEC 4JN2B 4I18A 3U2SA 2EICA 2XWTA 2GQHA 3OTTA 1CQYA 2R0ZL 3B2UC 4ZUUA 3SE8L 3OJ2C 3L5WB 3V0AC 4I9WE 4XNXL 2B8OT 4TOYL 4JFOA 1NANH 1F6AA 4RMSA 1CICB 3UTTA 1D6VH 1CS6A 3BHBB 4S0TD 3EBAA 4XNMA 2BVPB 2D7QA 2BJMH 3GSQB 3HFMH 5GSVB 4ENEC 4PGCA 3CJJA 4HWEL 2P1YA 4LHUB 4Y19A 1EBPA 2UUDK 1NMBL 3MV8E 5IM7A 2Y9RT 2O61A 4UT7L 2DIBA 4GBXD 1DR9A 4G8GB 4C55A 4EDXA 1RK1B 4P2YA 3BP4B 1XGQB 4JLRB 2DLFL 3QXUA 3CDFA 1NDGA 5D7JC 4J23A 2OTPA 3IKCA 1CU4L 5GZNC 3GHEH 3MO1B 2QADB 4MNQA 3HE7C 2EEBA 4YBLB 4MXVF 2YD5A 3FN9A 4Z7QF 1E27A 5ERWB 5FA3B 1UH2A 3KWWB 4JKPH 4N5ED 4N8VB 1XF4B 3GIZL 1FV1A 4Y0GA 3VGDA 5FO8A 2R2BB 3SDXA 2P24A 3J8F7 4CNIA 3IDUA 5FDWA 4I4WB 2X4QA 4L4VD 2CUMA 5C0AE 2APTA 2W9DL 2BNQA 2WUCL 4KQ3L 1NFDE 2F5BL 3NOIA 4CVZB 4HIIA 5FO7A 4H1LB 2UZXB 3NH7H 1C5DA 2VOTA 5ACZB 4E5XB 4QHLB 4M4RA 3ILQC 2FIRT 4JFFD 3BUYA 1BHGA 4RZCA 1IGCH 2CKBL 1N3NB 1ZHNA 4XTRC 1OWRM 1INQA 4DUXA 5INDB 4ETYA 3LVEA 32C2B 4AIZA 3HR6A 3WIIH 3MGTA 1DBAL 2ITCB 3QDHA 4Z8FH 5DVOA 4Y89A 4HIEB 3ZE0F 1QBLH 1D6EB 5HYSA 2BXYA 1EEUA 1SM3L 4PJIF 4M8VA 2B5IB 1AE6L 2ZUYA 1EERB 2HKHH 4FFYH 2WLYA 4M02A 3QIBB 2A9ML