1RV6X

Crystal structure of plgf in complex with domain 2 of vegfr1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
RPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/growth factor/receptor
molecule keywords placenta growth factor (PlGF)
publication title The crystal structure of placental growth factor in complex with domain 2 of vascular endothelial growth factor receptor-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 92
sequence length 92
chains with identical sequence Y
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2003-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rv6X00
3JVGA 1R24A 1G7JA 4HH8A 2GJZB 3V2AR 2WQRA 4G6JH 3LKNB 5CFHA 4K7PH 4N0RA 2VN4A 2DICA 3S36H 5DJ6B 1RZJH 3SE8L 5I1AA 4QRQB 3EYOA 4KFZC 4X7TA 4N1EA 2KBGA 3IFOA 1WIUA 4FFVC 1JZ4A 5GRVL 4LVOB 4Q9RL 5C0NC 2VDQH 4X9IA 4FFWC 4PRPE 1I3GH 1E28B 3QCTH 4NO2A 2YD4A 1L7TL 1MREL 1KC5H 3DJ9A 4ZUSA 3CZFA 4Q7DA 4WDIA 3L3OB 1OGAD 3QO0A 3AM8A 1AO7A 4XX1G 1F6AA 1MFBH 3TT3L 1BLNA 5E99L 3SE9L 4YBLC 4QKXB 1SY6H 3DIFA 4LLQB 4QGYA 4G9FE 3MLPA 4BFIA 1C08B 3TVMD 2NY4C 3ROLB 3EFFB 2DM3A 2R1XA 2CUHA 3HAEH 4YHMH 4QRRD 5GS3A 4POZD 1I8IB 4FQXA 4OFYD 2D31B 3HFML 5KS9A 1G0YR 2H8PA 5E2UL 3HUJB 2B8OT 4HKZB 1XF2A 3MRNB 2H41A 5EB9A 5F9JA 3ALPA 1OQXA 2HJFA 3DHMA 4P3WA 4WU5A 4ONOA 1T1WB 2VXUL 1YMMB 3EOTL 3TBYA 1T21B 4WI9A 5T1LA 5GS0D 2IANA 4YQXH 3WS6C 1M05A 5E9DB 1HILB 4WEBL 3DVGA 2WW8A 1N2RA 5JW5A 5IBUG 3EHBD 3N1GC 3KJ6H 4KAQL 2H9GB 3DX7A 1JTOA 2BOCA 3BE1L 4NO0D 3GNML 1JF1B 4I2XA 1F4WL 1BQHB 3HE7D 4KQ4L 2PO6B 4JPWL 3UC0H 2EDRA 2KH2B 1UWXH 2AQ2A 3GMNB 4NT6A 1LO5A 4JEGB 4OM1H 3WN5A 4AH2B 4F7CB 4Y4HA 2MQCA 5CP7A 1I7TB 5DRZB 4P57B 1MUJB 2IH1B 1X5JA 1NBYA 3WMSA 3CMOH 2OR8A 1KSRA 3P0VL 5ETUB 5I0DA 2I5YL 4P2OA 5IBTL 1S3KH 4PJ7A 1KCUL 1T1ZA 3V6ZA 3SJVB 4LNVA 2X1XR 4YDIL 3L7FA 5E6IB 4JJ5B 2EEDA 4G7VL 5I8EB 3FB6A 2AW2A 1KCVH 1J8HA 4OAWA 2ZUTA 3FRPG 2ORBH 1WCBA 1RJCA 3HZMB 2OQJB 4MXVF 4P4KA 5HDLA 5TPWL 3P3YA 2Y6SD 5CEZE 3WHXA 4DEPC 3BN3B 2UYLB 3NCJL 5JPMA 2YD8A 1QRND 2CUIA 3VWKB 2R2EA 4JO4H 5DD3H 2Y07H 2BCKA 3HA0A 5JZ7D 4U1NB 2VAAB 2P7TB 4PJEF 3G5ZA 3DV4A 1UADC 4PGZA 4JRYD 4LSQL 4Y16A 4O4YH 3MLSH 5EU4B 5HYJA 5MEOB 1AGEB 5DEFA 2GAZA 4ENEC 4RMTA 5HDQL 5DSCB 4POUB 1PGRB 3AU1A 5HHMD 1K5NB 3B2UC 2VDPL 3IXTB 5I1LA 4G6JL 3SDXE 4K7PL 2PCPB 4LLUA 5EA0H 4KJYB 1HHHB 4JFDE 3E6FA 1MCFA 5BS0B 2CPCA 1A0QH 4MMZC 1AGBB 4X83A 2HLFC 1JGDB 1Z6JT 2CGRL 5D2LA 4O00A 1QVOA 3QJFA 2VDQL 4JB9H 1U3HC 2DQHH 3RAJH 4Z5RB 1I3GL 3B9EA 4WUKH 3QCTL 4PR5B 2A6JA 1NGWB 1KC5L 1HOCB 4PG9B 1A7RH 4EI6B 3L7EB 5E94A 3UTTD 3PDGA 3ZDXF 3PHQA 1CR9H 5HBBA 1MFBL 5FUZL 4N68A 5D5MA 4HLZG 4YGVB 3V4PL 3GSXA 4PTTB 3WL9A 4WI5A 1T0PB 3FO9B 1WWBX 3X11B 2WBKA 4KTDH 3QULA 3ZKXB 2BVQA 3GJFB 3QPXH 4YHML 4MB5A 1AKJA 5FDWB 5ID0A 5AZ2H 4U6TA 4YHYC 4L4TA 1N6UA 2DAVA 4P48A 3IDGB 4KKAC 1V3JA 3QEQD 4HS3B 3RVXD 1UB6B 2LU4A 3G5VB 4AQOA 2FHCA 3H9SD 3OB0K 1WT5C 4NM4H 2DM7A 1LVEA 3KPPB 2HJLB 4N8CH 5DURB 1L4IA 3U0WH 1QFOA 4O58H 3L6FA 1NANI 3WS6A 4RAVA 4YQXL 4MQXD 3RL1B 4NCC1 1DQQB 4WI2A 1IAMA 3C5ZB 2DBJA 3NA4A 1ZK9A 1YYLH 3KJ6L 2C3HA 4X4ME 4PBVC 43C9A 3O3BB 4GO6B 5C0BB 4KGJA 5FHAH 2AJVH 1R3LB 4CRPA 5CZKA 3BQUC 2I60H 2VR4A 2XNAA 3PGCA 5FYJU 3MV9A 3UC0L 4NQCB 4ZAKB 3BH9B 5CBAB 3HHRB 3MMEA 4D9QD 2BDNH 2WBJC 2ZUQB 2W9LA 4OM1L 3TM6A 1RHFA 2GJ6A 4OFVA 4MSWA 3U4EB 1ZEAH 5HHNB 1A3QA 1RUKH 4KVCH 1KCKA 1JPGB 3CMOL 4BZ2H 4M7JH 3O81A 3ULUH 1DSFL 1IC1A 1S3KL 1IGYB 4X6CA 5TE7H 1ZLVK 3BH8B 1PKQE 3O11B 1KXTB 3R06A 4MAUH 1HKFA 1IZJA 1KCVL 1DQLH 3O41B 4PRNA 4EUPA 2IQAA 4LPTA 3O45A 2PTVA 5LAXB 4MJ5A 2NW3A 4K7PY 3RWDA 2AK4E 5DUMH 4XVSH 2Q7YA 3B9KC 4JO4L 5DD3L 2Y07L 1CTNA 1MFEH 3TWCH 5IEKB 5JLZA 3HLAB 1TTFA 3HS0A 4AIZA 4KI5D 3MLSL 5DD5H 4TUOA 4MXWH 2HT3D 3BIAX 1QQDB 2GSGB 4JKLA 3BO8A 4NQED 1N3NB 3ARWA 4XZUA 2FDBP 4WFGD 1HNFA 2ZUSA 3GEWB 4KMLB 4GKZB 2IPUG 4C56A 5EA0L 1U8LA 4UTAH 3VXTB 4OLXH 5JORB 1A0QL 1AP2B 5EPMB 3UAJD 1BBDH 2X4PB 4ODUA 2HN7B 1TQBB 3K74B 1BAFH 3LV3A 3NFSH 5DQ9A 3OWEA 1U3HA 1KACB 2M8XA 3OR7A 2DQHL 3RAJL 3PNWA 4WUKL 1FNHA 5GGRB 1J0JA 1NLBH 5SWZA 3MROB 5IMLA 5L2KD 4ONFH 1A7RL 5EC1B 4R97C 3VXMD 3ZYOA 4NRZA 1CR9L 1JCKA 4BUGA 4ZUWA 2YPLB 4J23A 2ZPKH 4Z0XA 5DO2C 1FAIH 4XP4H 1NUFA 3K0WA 4KTDL 3QPXL 3SDDC 5IMMB 5AZ2L 1LE5B 1VEMA 4GBXB 2C3XA 5IW6A 4LVEA 2K1MA 4RFEB 2GI7A 3G9AB 3QYCA 4LASH 1WT5A 2ZNXA 3IDUA 4R7NB 3VXPB 4NM4L 5HD8D 2R23B 1SJHB 3EYFB 5FA3B 3PIQA 1CK0H 3U0WL 4O58L 4FQ2H 1EUUA 4J12A 3GI9H 3GSUA 2P46B 1S5HB 3BP4B 2APXA 2EE9A 2FIKA 4G9FA 4LFHD 4LNRB 5ACMA 2DI9A 4HUXA 3WYRA 4ELMB 5I1EH 2HMID 2AJXH 1FL6B 4F7TB 4M48H 5I8CB 1DEEB 1QFUH 2XQYG 5FHAL 3BQUA 2AJVL 1QLFA 4HWBA 3RWEB 2I60L 1OP5K 1SYVA 3OKKB 4UAOB 3WNMA 3IDNB 3QUMA 2WBJA 2MJWA 2BDNL 4FQPA 4NKQB 5DTFB 3WE6B 1KIUA 3H3PH 4JRXB 2UWEE 3J7HA 3BRGC 5IBLC 2D9CA 3L9RA 2ARJQ 1ZEAL 4N1HB 5IFJB 1RUKL 4KVCL 4XXDA 1JGUH 1QA9A 5BZWA 1L0QA 4BZ2L 4M7JL 3ULUL 4TPRH 3TPUA 3KHQA 5TE7L 3QFDB 4XI5C 3MGTA 4NQXA 5E1AA 3CPLA 4G8FB 2YBRA 2VMFA 3WLBB 4MAUL 1BFOA 4J6RH 5ITFB 3BAEH 4JFZH 1DQLL 3BW9B 1UFUA 3L3GA 4GMTH 4HUMB 5KS9F 1FL5A 2ZUWA 3M8OH 2DLFH 5GHWH 3WO4B 1ZWIB 2FATH 1YNTB 5TDNB 2D2OA 1CBVH 3B9AA 1WIPA 4PLKD 5DUML 3B9KA 4KI1A 4XVSL 2DQEH 2RHEA 4CU6A 2Q6WA 3B5GA 1KGCD 3VRLE 1YEFH 3NFNB 3TWCL 3D18A 1A1NB 1P1ZA 2FGZA 5DD5L 1PG7W 5HI3C 4MXWL 5FHBH 5GIRB 4Z6AT 4UQ2B 1ZVSB 5IFHH 4M6NH 4HUWB 1TZHB 1MVUA 4MJID 5AG8A 3ULUF 3ARDB 4P5MA 4N9GA 2FLRT 4UTAL 1P4LA 2OYPA 1TJHH 4OLXL 3PHOA 5FB8B 3GFUA 2RB8A 3DXAE 2QQNH 4NBZB 4CW1A 1BBDL 1D9KD 1ZS8A 3EDDA 3NA9L 1BAFL 1EEYB 2XWTA 1J1XH 2P8LB 3L5WA 4NQSA 4DKFH 4XBEH 3TO2A 1NLBL 3MXVH 2X7LA 2L0DA 4ONFL 1U8JB 4PJ7F 4PLOB 1LEIA 3V5DA 3QFJD 5KSAC 1ZLSH 3IJHB 3GGWA 1OB1B 5J9PB 2I07A 7FABH 4X6BB 5EN2B 2ADFH 3D5OF 2VZ3A 3MV8E 3EYVB 1CFTA 2ZPKL 4NM8L 4YFDB 4JREB 4MD0B 4APQC 4XP4L 3SDDA 3CC5B 4X9BA 1PG7X 5E00A 2LU7A 3GK8H 4RMSA 4BK4A 4J3TA 4HDIA 3CUPA 1FFOB 4LASL 3BPCA 4NPYB 4XNZB 3WXWL 4JFFB 2B1AH 4YZFE 3FAXA 1GXEA 1DBBH 5E1HB 4OF7A 1CK0L 1XH3B 4FQ2L 1X5KA 3ZKNC 1ODAA 3GI9L 1G6RB 5I2IA 3OKEA 1GOFA 2AJSH 3NVQA 5I1EL 4N8VG 3VWJC 5F96H 3MBXH 3DMMD 2AJXL 4H26A 4XNYH 4RGND 5GJTH 5A16A 4M48L 4JY4B 3SDCD 3MUGA 1UJ3C 4IRSC 1KCLA 3UO1H 5ADPH 3P77A 3T77B 1F2QA 4L9DA 2LU3A 3OX8B 4OLWH 5DJ0B 2AKRB 3H3PL 5EOTB 1IGFH 1Q9OA 3GMOA 2D4DA 3MRRA 1BD2D 1ZHBA 5CZXC 4FNLH 5D5MF 3SGEH 4QXTA 5GRYA 2X4RB 2YD3A 4EXPX 1P7HL 3D39D 4NQDE 3BKCL 4YNYB 1JGUL 1REIA 4HWBH 2XN9E 3G5YA 4TPRL 4X4MA 3D3VE 3NIGE 2CK2A 4P3DA 3UTPD 1FZOA 3QUMH 1FV1B 2FHBA 5TQ0H 2HFEA 5C0JB 4U1MB 4J6RL 1QTYT 5BRZD 2ZOKB 2ARWA 5DDHA 3BAEL 3PXHA 1IGMH 2OX5A 4JFZL 4WHDA 4PV9A 4MZ3A 4Y2DD 3FQTA 3M8OL 1T66D 2DLFL 5GHWL 2XKSA 2FATL 5K9OB 1PDKA 3OQ3B 2W92A 4S10A 3ARED 5FF6B 1T83A 1CBVL 4Z18A 2GY7B 3QJHB 2DQEL 5CSBA 5GSRA 1WBXB 1J0ZA 4P99A 3V4UH 1YEFL 3TCLA 2CIIB 1EEZB 1U3YA 4KKLD 3U2SB 2NY1D 4XNUH 1I1FB 4LLWA 5FHBL 1PKQA 1QEWA 2G5BB 3IJSA 5DRNB 4XP6H 5IFHL 4M6NL 1S5IH 2CR6A 2XG5A 5HGAB 4TNWK 2AJYH 5HHOD 4X8JA 5J7CC 2KZWA 1KIRB 4ZSOE 1TJHL 3LB6C 2AK4A 3EO1B 4S2SB 3LEXA 5C71A 4ALAH 2MWCA 4DVRH 5ERWA 3HG1D 1LQSR 2ED7A 4V2BA 4PTUB 2CDFA 5I74B 5L7XH 2VLLB 1J1XL 3MRBB 4GQPH 1BJ8A 3QCVH 4DKFL 4CUCA 2EIEA 4XBEL 2H3NB 4RIRB 3NCBB 3MXVL 2E27L 1PQZA 2R1YA 4X6CF 5H2BB 5KSAA 1ZT1B 4DCQA 4GS7B 1ZLSL 3N0PB 4TNVF 4RRPA 4N5UA 4LCWD 3KPSE 4IHOB 4JM2C 5EG6C 7FABL 3X13B 1SBSH 1GGCH 2ADFL 5ID1B 5SWQA 4APQA 5FUOH 1I3UA 1YUHA 2H2PC 4NJ9H 3D2UA 4QRPD 2K7PA 2DKUA 3OXSB 4QYOA 5EC2B 1GZPA 1X4YA 1DBML 3GK8L 3C2AH 4Z76A 1MCRA 5IW1B 4QRRB 4NFCA 5DUBB 3MLTB 2NX5B 1CYGA 1V3LA 3TN0D 1M6OA 1M7IB 3LMJH 1MNUH 4F37F 2NY7H 3I6LD 4PYGA 4HCRA 2B1AL 1IZKA 3CXDH 3WEXA 3KG5A 3UTOA 1DBBL 4R4ND 3GJEB 1CFQA 3HC0B 3BZ4A 4XRCB 1RUQH 3ELAT 4PRHD 4LKCB 5GJSL 2AJSL 32C2B 3LEVH 1KELH 4OZFH 3VWJA 1WFTA 4X4ZA 3KPNB 4WCYH 5I18H 5F96L 3MBXL 4NBXB 1ZGLB 2DLHA 1JPFA 1EHXA 2WINB 4XNYL 5GJTL 3I6KA 2MKLC 5SX5H 1UJ3A 4IRSA 3RJQB 5MI0B 3LN5B 1XF4A 3UO1L 1IKNC 4NO0B 4UT6H 2ITDA 3FFCB 4AMKH 5ADPL 5CLTA 1F90H 5DD1H 2JKXA 1UH4A 4NNYA 1PFCA 4OLWL 1IGFL 5D6CA 2HVKA 2H32A 4FNLL 1E6JH 5F71A 2MHAB 3EOBB 3SPVA 3IKKA 3VJ6B 3CGTA 1AFVH 4HH9B 1HHGB 1R5VA 2J8UE 2ADIA 4O2FA 3QIWD 4HWBL 1XIWD 3C5SA 1SVCP 4H25A 3IAPA 1AI1H 1UH3A 3QUML 1CG9B 5TQ0L 1TVBA 1GC1C 1IGML 5IHZB 1AQKH 1I8MA 1G7PA 1F5WA 4PRBB 5A1AA 3RVVC 2GUOA 4GQ9H 2NXZD 1NGYB 2DMKA 3TH4T 4R26H 2UWEA 2G2RB 1ZA3B 4JKWA 1ZGLM 4L4JA 3QIBD 4OTXH 3G04B 4P4RA 3HC4H 4DK3A 3V4UL 2F58H 4U1IB 3T0EB 4YAQA 4XNUL 3QUYC 2OL3B 3N50A 4JRYB 3BP6B 2AAVA 1BX2B 1NJ9B 3PHSA 1S5IL 4JY6B 4R3SB 1QHOA 3ORJA 2AJYL 4YK4B 4G6FB 2XZQL 3RNQA 4KK5D 5KBNC 1BPVA 3RKDC 1QSFE 4ALAL 3VGHA 4DVRL 4Y8DC 2X1WL 3DROB 3C08H 3UBXB 3QCVL 4C54A 4J8RB 2BXYA 2P49B 4MA8H 4R96A 2E3VA 2LFGA 3LZFH 4BQ9A 5C09B 5CZVH 1G7LA 4JM2A 4HXAH 1A3RH 1ERNA 1U8KB 5KVMC 2D03H 5T1KB 5F93C 1AR1D 1MRCL 1SBSL 3TBWA 1RK1B 4N0UE 4RZCA 5C7XH 4G42B 3DXAA 5FUOL 5ENWA 3MA7A 4NJ9L 2P44B 1RUPH 4BSVA 4L3EA 3KS0J 3GSWB 4JFEA 4HJGB 1S7VB 5F7KC 3C2AL 3N1MC 4JCLA 2JJTC 2NW2B 4IOIA 2ENSA 3SDAB 4E41D 3QEQB 5J13C 2G9HB 2ZUVA 4FFYH 3LMJL 4LQFH 4L3CA 5E5RB 3DVNB 2NY7L 3H9SB 5E4EB 5EIVA 3KXFD 1XT5A 3CXDL 2H45A 3OKLB 2KUTA 4ZFZA 5T1DH 3QR2A 4WGWB 1BQSA 2W07A 3LRSB 3MV8A 4TULH 1T6WA 1RUQL 5I76A 2QADD 4Y88A 1Q9KB 3LEVL 4GAJH 1KELL 3RWFB 3GSNB 1F2XK 4FTVD 4DZBB 5I18L 3HB3C 5E8EB 1YN7A 1WEJH 3MNWB 1IJ9A 2IPUK 1YMHB 4HCRH 2EKJA 2NZ9C 1ZT7A 2YR3A 1IKNA 5FGRA 5CEYA 3WFEH 3ZT5A 4UT6L 4AMKL 4GOSA 4YDVA 4L8CA 2AXJA 2PO6C 4Z7OE 1F90L 5DD1L 4JO3H 2R1WA 5J1TC 2FJGB 4HMEA 4ODWB 1CICC 5K9JH 2A6KB 3CVHB 4OQTA 2H6PA 3P73A 1QBLH 3X3FH 1GGUA 1D6EB 4PREB 3MRGA 3VFTA 4K7FB 4B5EA 5GZNC 1AFVL 4PJGA 1HN1A 4XMLH 2GT9A 3FZUC 4OI9A 4M8QA 2F54D 4UU9A 4LKXB 3BN9D 1AI1L 4HJ0C 1NC2D 3SO5A 7CGTA 4DWHA 2E6JA 3FMGH 5HYSG 4WWKD 5DJ2B 2R2HB 4U05A 1AQKL 2NR6C 3TNNA 3GDBA 4LCCC 2H32H 2R0ZH 5D7KD 2JB6A 5CHNA 1CF8H 4GQ9L 3DO7B 3MCKA 4R26L 1AIFB 5LG1A 4UDUA 4OUUA 2RAMA 5CINL 4XBPB 2BVOA 4OTXL 3L95A 1XCTA 3HC4L 4NQDA 1FZKB 1IL1A 1S78C 2DIJA 4I9WD 2XN9A 2F58L 5DI8A 3QUYA 4N5EC 3D3VA 1P84J 1YNKH 3LSOA 4NZUH 1RZFH 1LP9F 4YHPA 4E0RB 5C0AE 2WAHA 2VLRE 2XKNA 3CH1A 5DK2A 5F7WC 3ULSB 5T5FH 2DWEB 3I3BA 3B6SB 2VTFA 3HRZB 4OKDA 1MCWW 3TFKD 1AO7D 4G8IB 3WO3B 1MHHB 3MRPB 1A6VH 1C5DB 1JGVH 2HKHH 5IB2B 1N5YH 4DVBB 1JTPA 4NO3B 4G6MH 4RCAA 3TZVC 3P4OA 4ZFFB 2DWDB 3ET9F 2OTUB 2RFXB 3RKPA 1F3DJ 1HSBB 1E28A 1O5DT 2DQJH 4MA8L 4FQXD 2A6IB 3LZFL 3MRDB 3L3OA 3MFGB 5CZVL 3TNMA 2X2YA 2IGFH 4HXAL 1A3RL 3T4AB 2E6PA 4I48B 2D03L 4OQ1A 4HBQA 1DUYA 3CVIH 2UVEA 5B4MC 3RTQC 3PP4H 1IARB 3QA3A 5JW3H 2J88H 2WWMD 4JZJC 1RUPL 4FMFA 5T1LD 3ROLA 4ZS6D 1GGYA 1KIQB 1VFMA 3ZKXC 2JJTA 4IDJH 2HVJA 2D7PA 4JFHE 2D31A 3IJYB 3VD5A 1JFQH 2YC1B 3SDYH 4FFYL 2UVFA 3FQUB 2FWOA 3TYFB 4LQFL 2FH8A 2YWYA 4WFED 4DFIA 1S9YB 1TJIH 2EO1A 3HI1A 3ULUD 3U4BH 4OZIE 2NY0D 4JRXE 1T21A 3O4LE 4WGVB 4UZGA 4GRWB 4WTXA 1XF3B 2CLZA 1HILA 4GAJL 3VFOB 4W4OC 4HAGA 1UA6H 3FHQA 4Y4HD 3BRDA 5JDSB 1K2DA 1WEJL 4S11A 5F72S 3SEPA 3G9VA 4EZMA 4P5TB 4MNHB 4OIBA 4HCRL 5B22A 1BWMA 2IFFL 3AMLA 3FONA 5ISZE 4P2OD 1JF1A 3RUGB 3WFEL 2YUZA 5ESQB 2PO6A 4KK6D 3GMNA 4ZAKC 1J8HD 1CICA 4NQVA 2PKDA 4WHCA 5K9JL 4JG1H 4AH2A 1E27A 5E8PA 5JOFB 4LRIC 4F7CA 1QBLL 4P4KD 3X3FL 3ARZA 1MUJA 2FNBA 1VFUA 2IH1A 2B7DT 1EXUA 1FE8L 4B53A 2IF7A 4R2GB 3VMNA 4XMLL 5DJZB 2EH7H 5KAQF 1K4DA 1N7ML 5ETUA 4GUPB 1JRHH 2VL4A 3NPSB 4HT1H 3SJVA 1D6VH 4Y16D 4JJ5A 3FMGL 3O3AB 5HYJD 4LLAA 3QDJE 1MCJA 4LCCA 3MOBH 4ZUTB 4OQTH 4OB5H 1EX0A 3HZMA 2OQJA 3ARSA 1CF8L 2E7CA 5F6IB 5M7QA 1K8IB 1QFWM 4CNIB 3O6LH 4F15B 1I7UB 1UC6A 1HH9B 1XGTB 1GC1H 4EVNA 2VAAA 2P7TA 1DJSA 5FKPB 2J8UA 4FFVD 1YNKL 3EOAA 5ALBH 5C0ND 1T1YB 4NZUL 3BRFA 3VFRA 1RZFL 4FFWD 4BQCA 4NN7C 3TLRA 4D9RD 1MAKA 1IC7H 3QWRA 1FL3A 3IXTA 3KLSA 4JN2A 4MJIB 4CVXB 2X70A 1F6FB 5T5FL 1VA9A 1FP5A 4KJYA 1P7QB 1HHHA 5FYLH 1UXWA 4PGEB 3HTLX 4ISVA 1A6VL 1JGVL 2HKHL 4U1JB 2VABA 3V4VH 1N5YL 3SCMC 1TQBC 4MD5B 3TZVA 1I9EA 5HHQB 1IQDB 2NY4D 4YJZL 2JB5H 1Z0NA 4G6ML 1LE9B 1KPVB 1HHKB 1AKJD 5C92A 2CRYA 4Y19E 2DQJL 1NGWA 4LARH 4UI2A 3RIFF 4F58H 3HN3A 3DRQB 1H3GA 1ITCA 1ACYH 2GSIB 2IGFL 4NGHH 3S4SG 5DEGB 2YRZA 3QFJB 1YC7A 3MV7E 4NKIH 1XGPA 4HS8H 4KJWC 1TJGL 3RTQA 1G0XA 4JZJA 1J0HA 1HSAB 3PP4L 3VH8A 5JW3L 2J88L 3WUWA 1NUDA 1T7YA 3QG7H 1OTUC 3FO9A 4RSVA 1QSFA 3IDMA 4ZO9A 1PBYA 3X11A 2UWEF 4J3WA 4AIOA 4X4XB 1OSZB 1DDHA 3DUSB 4OD2B 3V6OE 5FDYA 3IDGA 4IDJL 5F3BB 5EU3A 4KRPB 1A9BB 1UB6A 1K4CA 1JFQL 1S8DB 3SDYL 1MHEB 4HKXA 4FZEH 1CXEA 2Y25A 3K80A 3NABH 4IOSD 1B88A 3EO9H 2FX9L 3H9HA 3EYSH 1TJIL 1MJJB 1ND0A 4M1DH 3U4BL 1XGUA 2VNCA 5DJAA 5LKNA 3ZE1F 3QUKB 5CKAA 4N0UA 3RL1A 4W4OA 1DQQA 5FXCH 1WC7B 1X7QA 3DGGA 4G9DB 3DNKA 3NCEB 4GAYB 4GRMB 4XCNA 2GJ6D 3KWWB 5C0BA 3DSFH 3ARBB 3X12B 4QOKE 4RGNB 5ACLA 2EC9U 5FO9B 5EU5B 1EZVY 1MI5D 1R3LA 3SDCB 2BVPB 2DOCA 4Y5YB 4OZHB 4WI3A 3SKNA 2VL5B 3VFUB 3NBNA 1PEWA 4MQTB 2QQLL 4ZAKA 3BH9A 4QT5B 1LO4H 4HG4J 5CBAA 1YEGH 1V5JA 2CR3A 1WWCA 4JM2F 1J10A 4LRIA 4OJFH 4G80B 4JG1L 5EBWB 4YHNB 3QDGE 3ARTA 1BD2B 2J12B 4QHNB 5D70H 1KFAH 2EH7L 3D39B 1JRHL 1IGYA 4F7EA 2Z8VC 3X14B 4IJ3B 2VUYA 4HT1L 4XCYB 1CLYH 5I8KH 1D6VL 4ZFGH 5E8OA 1I1YB 4ENED 3P9MB 3MOBL 5BRZB 3BPOB 4OQTL 5I16B 2W38A 1WBYB 2ZOLB 4OB5L 3FOLB 1BJ1H 3B2UD 4Y2DB 3WO4C 5LAXA 3AREB 4K3HA 4LGPB 4M02A 4C56D 3JTSB 3C6LC 3O6FC 4HPOH 3R4DA 2EDWA 1OWRM 1GCFA 2HLFD 1GC1L 4MGXA 1HHIB 1TVDA 5IEKA 5KN5B 1VADA 5F9WB 3AY4C 3FT4B 4BH7B 3WDHA 5ALBL 2DQCH 4IS6A 1RURH 1U3HD 3OAYH 4DUXA 3BEWA 1B0GA 2VITB 1N3NA 3LY6A 4J3OC 5SWZD 1T22B 3W11C 2YMXH 3VGEA 5C0EB 1FC2D 3VXTA 4YZFF 5FYLL 5JORA 4ODXA 4TVSa 1AP2A 3NPZB 5EPMA 2R8SL 2ZCKH 4XPFH 3QQ3A 4NJAH 3SCMA 2HN7A 4DGVH 3MNVA 3V4VL 4RMRA 3HC3H 2VDNH 2NLJB 1A7PH 4BKLB 3UJTH 3GHBH 1OAXH 2VERN 2YPKA 4BFBD 5MENE 2NX5E 3KYAA 4PJGF 2A6DA 2PYEE 5AUMB 2F5BH 5DFVC 2WV3A 4KKAD 2XTJE 4LARL 3Q0HA 4OLVH 4F58L 1P5UA 5GGSB 4ZOBA 1ACYL 1PW3A 3BUYB 4NGHL 5C0AA 5C8JB 2DQUH 5F7LB 3GIZH 2MQ0A 4NKIL 4HS8L 1T4KA 1AQDB 4LSDA 2BSTB 3P9LA 5AEAA 4JFYB 1N64H 3QG7L 1E4WH 2HRLA 5MHSD 3VXQA 1HH6A 3WKNA 4PIRF 2W65A 5IMMA 3LS5H 4G9FD 3RVUC 3HMXA 3Q6FA 1WIOA 3C09C 4RFEA 3NIDE 5C2UB 4PJEB 4F2MB 2Y06H 1WWWX 3PWNB 3T2NL 2W60A 3NIGF 3TN0B 4FZEL 1EAPB 3NABL 5BW7C 3EO9L 1SJHA 3BQUD 3EYSL 1OY3B 4KH2A 5FA3A 3T0VA 1UZ6F 5C3TA 4M1DL 4S1DC 2VLJE 1YPZB 1T7XA 2VXVH 3BGAA 3GJFH 4ZMAT 2WBJD 4QTHB 5EBLB 3ZL4H 2X1OA 4LNRA 4PRHB 1A4JB 2P5WD 3CLFH 5FO7A 1GIGH 3F7RA 4XNMA 2AV7B 3VD9A 4KRNA 3DSFL 5MEPB 3GI8H 1DEEA 1NC4B 2VZUA 1A6ZA 3OKKA 5EBGA 1OGTB 1LO4L 1YEGL 3T0AA 3QISA 2R4RH 4OJFL 4JRXA 3O4LA 5IG7A 3FO2A 4L1DA 4J3SA 4HQQH 4S1RH 5HYQA 5DHVB 1E4XH 3QRGH 4QLRA 1I75A 4LMQI 4WVRA 3B9KD 4F33B 3UTZB 3IGAB 4Q0XH 4K71C 1MCLA 1KFAL 1DEDA 2R0LL 1FFNB 1INEH 3DWTA 1FG2B 3QFDA 2EDJA 4Q9BA 5AD0A 4HUUB 5ISZA 1I1CA 5F1SA 1CLYL 1UG9A 5I8KL 4ZFGL 3S3SA 3QZWG 5IF0B 3RGHA 1CGUA 3BW9A 1QLRB 3SKOB 5F7FA 3U4AA 1ZWIA 3C8KB 2BMKB 4GXUM 3ZTNH 1ZOXA 1IE5A 3C6LA 5DA0B 3O6FA 5HJ3A 5GQBA 3PF2A 4HPOL 1A6UH 4EKXA 1FVEB 4LPWA 5HVFB 3AY4A 1RVFH 1WZLA 3S7GA 3T3ME 4PRID 1LO2H 2DQCL 3D25A 1RURL 3JV6B 5C09E 1ZVSA 1RQ5A 3QDJA 1TZHA 4HUWA 1BQLL 3LPGA 3TBTA 1JP5A 2YMXL 2XWJB 3HAEB 4OLYH 1HZHH 2JJUA 5FB8A 1VFAB 2F19H 2DQIH 3E0GA 4QHLA 2ZCKL 4XPFL 4NJAL 4R7DB 4G43B 4DGVL 5IOPA 4DW2H 2AV1A 3NH7L 5DO2D 3HC3L 1MFDH 1BVLB 3DURB 2VDNL 3IB4A 3ILPB 1A7PL 3UJTL 3QT2A 3GHBL 3M07A 3SDDD 1OAXL 2OZ4L 4UUJA 4OV5B 3W2DL 3WJLC 4WTZG 4OLVL 5I66A 1JNNH 3PV7A 4RDQG 1NQBA 4GS7C 5DLMH 3AS0A 2DQUL 1ZLUK 3T2OA 3GIZL 1OB1A 1LDSA 3BZFB 5J9PA 1JJUA 1DUZB 5F1KC 1FH5H 2V6HA 3SY0B 2NY6B 2CDEA 2CLRB 1N64L 3BI9X 4MA3B 4KUCF 1E4WL 2L7UA 1EVTC 5IK3B 2I9TA 1G7HB 3CC5A 5GS2D 3EO0B 4JM4H 3LS5L 3CDGB 2B2XH 1NFDE 2DRUA 3TA3B 4X6EB 2AXFB 5HGHB 1GGTA 1Z9LA 2Y06L 2J8UF 1FFOA 3TIEB 4NN6B 3ALXA 4Y19A 4AEHH 2E8ZA 4E41B 3AS3A 5DZOA 4JFFA 4BSWB 5DQJB 4XCFH 1CDYA 4GSDH 3MV7A 1JZ3A 2VXVL 4H0GA 3HMXH 1CGTA 3ZL4L 6CGTA 1EK3A 1BFVH 2I9LA 1X6LA 5IBLD 2QADB 1KPUA 5E7FA 3CLFL 1GIGL 4LOUC 3W39A 2F53E 1OP3H 4UT9L 1FCGA 4FTVB 1NEZA 2OR9H 5IVOA 5GRJH 2BVTA 4JY4A 3GI8L 3MCG1 4Y1AE 3TIDA 4XI5D 3BKMH 3ZTJH 1GPOH 1VERA 1IM3A 4IIQB 1FJ1A 1UQSB 1KPRB 2CJUH 3OX8A 5DJ0A 3DI2B 2R4RL 2AKRA 5LGJB 4U1HB 4J3UA 3HCVB 4HQQL 1KEGH 4L5FH 4S1RL 3NFPB 1E4XL 4XNQB 5DHYB 4PBXA 4Q0XL 2Q8AH 1UVQA 1MCIA 1A1MA 4YHOH 1JZ8A 1INEL 5J56B 3P2TA 1ZTXH 4LU5H 2QKIA 3H7BB 4QOKA 5C0JA 2ZOKA 1NC2B 5HI3D 3BFOA 1D5IH 1BP3B 3TT1H 2G60H 4WWKB 1FG9C 4OCRH 1X5XA 4UT7L 4X7DC 4D2NA 3ZTNL 4MS8D 1R24B 1P84K 5I6XC 4NYLA 1KEMH 3IF1B 1A6UL 3QDGA 1FIEA 4B0MM 2DQGH 3LRHA 5I1AB 2CIIA 2ENYA 3EYOB 5TE4L 4XVTH 4X7TB 3DTXB 2PR4H 1LO2L 1I1FA 3T0EC 1U42A 3IFOB 1RSFA 3VDBA 1A7BA 1BVKA 1F02I 2UZYB 2LVEA 3BD3A 4NO2B 5KSAD 4HF5L 3GBLA 4ODBD 4OLYL 4X5XA 4ZUSB 3LKRA 2EYSA 3UPRA 4WDIB 4YK4C 2F19L 5GRVK 3VCLA 5GRZA 3QO0B 2DQIL 4S2SA 1AO7B 1Q9LA 1F6AB 1BLNB 4ONHB 3RA7H 2GIYA 5CJ8A 4DW2L 1FSKC 4APQD 1MFDL 1T3FA 1IEHA 3AS1A 5EUOE 5EFIA 4AIXA 4BFIB 3WJLA 1RHHA 2H3NA 1KB5A 5IMKB 5H2BA 1JNNL 4NOBA 3GSOA 3RPIA 4ELKA 1RI8A 4FQXB 3V5HA 5DLML 2Z35B 5KS9B 1TETH 1JWMB 2H8PB 3UCRA 4TSCH 1FH5L 2CH8A 1F8TH 4Z7OF 1KF9B 1KB9J 2N56A 4P2QE 4JO1H 3ZKND 3WJJC 3TPKA 5GRXG 3W0WE 2B2XL 2IANB 2Q86A 1XF5A 5CS7A 3VWJD 5IW1A 4OCNC 2JIXA 5CD5C 1AC0A 3MLTA 5MENA 2NX5A 1E6OH 2PYEA 1M7XA 4NBYB 4AEHL 1BF8A 3RUGE 3SDAC 4IRSD 1HQRB 5DK0A 4PJHB 1JUFB 2J7LA 2DLIA 1FRGH 3BPNB 5LXGH 4XCFL 1QSEE 2BOCB 1EERB 4GSDL 3GJEA 1ZHLB 5EIQA 2EZ0C 1JGLH 2VE6A 5C08E 2NY0B 2W9EH 3HMXL 5KVEH 1BFVL 3CSYA 4NT6B 4KMTH 1LO5B 1EFQA 5CZXD 3KPNA 2ERJC 3WN5B 3C6SB 3DUUB 4U6XA 5GRJL 4NZDA 2ADGA 2HFFA 2YWZA 4NWUH 1OCWL 4E5XB 3IVKA 4M43L 1NBYB 1ZSDA 4JY5H 3BMWA 3BKML 3FFCA 4X6FA 3VI3E 4P2OB 3UXFA 5IKCA 4PJ7B 1TENA 1GPOL 3V6ZB 4PV8A 1FNSH 2CJUL 1U2HA 2VLJA 1TLKA 3M1BA 1IBGH 1JHTA 2FCBA 4K3EH 1KEGL 4L5FL 3EOBA 1J11A 4P4KB 5CLWA 1HHGA 5J3HC 3WHXB 2Q8AL 3JWNC 3DECA 3HR5B 4OFIA 4XB7A 4YHOL 2OTWA 1ZTXL 2R2EB 4LU5L 5IHUH 2FGWH 2QEJA 4PY8J 3S97C 1XZ0A 3AVEA 3TESA 3IS0X 2VLKE 3DV4B 1D5IL 3FL7A 3LQMA 3Q5OA 5IHZA 3S96A 2Q3ZA 2G60L 4OCRL 1WITA 5DEFB 2LVCA 1CXKA 2GAZB 4NNXB 5IR1A 4HGKC 4XP9H 3AU1B 3KHOA 4F57H 1GOGA 3GMRA 2CRZA 1UCTA 4HWUA 1KEML 5I1LB 3LB6D 4HV8B 2XG4A 1LK2A 3ZYZA 3W9EA 5K9KA 3MREA 2EDDA 4LDLB 1CN4A 2DQGL 2OBGA 3K1DA 3P30H 3PWJB 4NKMB 2PR4L 2OL3A 5D2LB 2DJSA 2E9IA 3BDXA 3K46A 4GMSH 1JYVA 3ISWA 1U36A 2KQMA 4DOHE 3BGMB 5CJQH 5HDBE 2A6JB 3OMZA 2Q20A 3PWLA 3QWOA 4JM2D 2N7BA 5F8QC 1RJYA 1TZGH 4M5YH 2YSSA 3EDJA 3MJ9A 5TGBA 3G6JE 1MCOL 5K59E 3RA7L 5D5MB 2H2PD 4XT1C 4YBLB 1MRFH 3DXAD 2PXYD 5GGRY 5ICYA 3GSXB 3WL9B 3UBXA 4LAQH 4L3ED 4JFED 2H1PH 2J6EA 3VXRE 3TYGH 4X7CC 2ID5A 3QULB 2BVQB 5ID0B 3CU1A 5C09A 4L4TB 3FO0H 1TDQA 5C0CB 1TETL 5T1KA 4TSCL 1R3IH 4YFEA 4PRDA 1F8TL 3OJDA 2XXMB 4G42A 3W9DA 3WJJA 2AK1H 2APVA 1ZAGA 1BZ7A 2BNQB 4S1SH 1UGNA 3MV8D 2QQQA 4LLMB 5GS1A 4RAVB 1ADQA 4LPUA 4LSSH 1UB5A 3VFNA 2NW2A 5KSVA 1B90A 1E6OL 3SDAA 4IRJC 2G9HA 5FYKL 2FIRT 43C9B 1RUAH 1FRGL 5LXGL 3RX7A 2AJUH 2AJZA 3M17A 4PJ5D 3PWUA 1JGLL 3PGCB 5DVLA 5D7LE 3MV9B 2W9EL 5KVEL 4U7SA 1J5OH 4UOW0 3MMEB 4KMTL 5E8EA 3MNWA 2GJ6B 3NCYP 4HG4K 4UIMA 3KLHC 4XX1E 3HZKA 2C4FU 4MSWB 4N9OB 1ZA6B 4NWUL 1QLEH 4P5TC 3VFPB 5DMJB 1UWXK 4JY5L 1X6NA 4FRWA 5AWNH 5E95B 4OFDA 2PW2B 1BQUA 4X6CB 5FOJA 3L5XH 1NUNB 3R06B 1FNSL 2FJGA 2V17H 1IEAA 4UNUA 5GGUA 1Q8MA 1IBGL 4PRNB 1T0NA 4Z77A 1O0VA 4EUPB 3RVVD 3GM0A 4K3EL 2DI8A 1X5HA 3O45B 4PREA 1C12A 3ME0A 4MJ5B 1WJ3A 3D69A 1KJ2B 2NW3B 5E4IA 4DEPB 5JMRA 4R2GC 5EBMA 2Q7YB 3REWA 3ARYA 4NQDD 5FYLD 5IHUL 2EIZA 2NNAA 4Y1AA 5ICXB 2XN9D 1F3JB 3QUYD 3D3VD 5JLZB 5EZOH 4K8RC 3HS0B 4KXZH 4AIZB 3C87A 4MCZB 2VJXA 4XP9L 5HSFA 4W70A 1S9KC 4F57L 1BBJA 1AIFA 4HFWB 4XZUB 2D7OA 2FEEL 2HRPH 3R1GL 4WHYH 2P45B 5C9JA 4XBPA 5I19H 4U4BA 4C56B 3RKDD 1EV2E 1U8LB 4F15C 5ILTH 3JTTB 3O3DA 5C86A 5INDB 4UBDC 4OZFG 3P30L 1KG0A 4KKCC 4ODUB 1OD7A 1WBZB 2FSEA 4YIQA 3EDKA 5GGQH 4MVBC 3LV3B 5DQ9B 4NKDA 1U3HB 2ESVB 4X99A 4GMSL 4TSBH 3OR7B 5BCAA 4ORGB 5E08H 5CJQL 4XCEB 4Z95H 3B6SA 3S35X 1TZGL 3CSPA 4G8IA 4M5YL 3MRCB 1MHHA 2QSCH 3MRPA 4NRZB 4PJAB 1C5DA 4ZUWB 5HDOA 3T8XA 5D96C 2OL3H 4DVBA 1MRFL 2YHGA 2ATKA 4YX2H 4Z0XB 3KYKH 1T20A 3TYGL 2F74B 2XICA 4YHYB 1T04B 3FO0L 5FIEA 5IWLC 3MJ9H 4PRPB 5KVDH 3S37X 1DTUA 3BYTA 1R3IL 4HIXH 3WFZA 1DN2A 3ECBB 1IGIH 1A3LH 1YN6A 2J6EH 3PIQB 4S1SL 3VG9B 4I1NB 1W2KT 3M45A 3GSUB 4JDVB 2JF1A 3MRHA 1T5WA 4LSSL 3HB3D 5I1KH 1FIGH 4G9FB 4GAFB 5EUOA 5C0FA 4HUXB 5DYOA 4IRJA 4KRPC 4K9EL 2NZ9D 4Y8AA 2E9BA 2VSCA 4OFPA 2P8MA 1RUAL 2C1OA 2EC8A 3RX5A 3BQUB 2AJUL 1QLFB 2PO6D 1JYNA 5C0DA 5J6GB 1F3RB 4PUBH 1XF3A 1ADQH 4JPKL 1CICD 2IALA 3MLXH 3QUMB 5B38G 1J5OL 2WBJB 5KTEH 1T5XA 3OKMA 1BFSA 4M03A 4X7FC 5DMKA 4Z7UE 5JDSA 5GZND 3O2VH 1CS6A 3QHFH 4P5TA 1U95A 3FZUD 3ZE0F 2VLMD 1GAFH 1QLEL 3E3QC 4XXDB 1S9VA 2EDYA 5AWNL 2FBJH 1QA9B 5BZWB 1EHNA 4CDHA 4HJ0D 3RUGA 4EDXA 3TJHC 4XC3H 3SJVD 4Y5YC 3MGTB 5E1AB 1FGVH 1J05B 3CPLB 4EQ3A 1QSEA 1XGYH 1J0IA 2NR6D 1BEYH 1BFOB 2V17L 2HAZA 3GSNH 5C08A 4ZODA 3L3JA 1BWWA 5DD6A 3O8XC 5DFTA 4MZ2A 1H3TA 4KUCD 2WANA 5I73C 4HWNA 1PZ5A 4JFXA 2XZZA 1QG3A 3UYOD 4DTGH 5CMAA 4MAYC 1BREA 3LEYH 1S78D 3KJ4B 2Q6WB 4U2ZA 4N5ED 3D18B 1P1ZB 5EZOL 1DN0A 4OGYH 4ZUTA 2GKIA 4PJBE 2NZIA 1YECH 3QWRD 1HXYB 4TRPH 1K9TA 3DHJA 3H9YA 1WLHA 2HRPL 4TTGA 3STZA 2BVYA 4YXHH 5I19L 4WFHE 3DV6A 1S7UA 4PB0H 2X1PA 4N9GB 1XGTA 1SJXA 4QO1A 1EBAA 5ILTL 2OMBA 3V8OA 4CW1B 1QYGH 4Y4KA 4WI6A 1UJTA 3TZVD 2O61A 1T1YA 5GGQL 4FA8A 4LDEB 3NIDF 1RIHH 3S5LG 5E5MA 2VLKA 3L5WB 4TSBL 4NQSB 5FAAA 2FYYB 1FGNH 4CJ0A 3TO2B 3H6JA 3PDDA 2VXSH 4CVXA 5E08L 3DPBA 2KQNA 4OIIH 2X7LB 1P7QA 4Z95L 4ZXBC 1LEIB 3V5DB 1JNLH 2QHLA 1NGXB 4PGEA 2QSCL 5B4MD 1LNUB 2V9TA 3EYUH 4X7EC 3RTQD 3GGWB 3SDXB 2I07B 2OL3L 1NPUA 1I9RH 4MD5A 4JFDB 2FBOJ 1IQDA 4J2XA 1QSFD 1CFTB 3AC0A 1LE9A 4YX2L 5JA8B 3KYKL 5JW4M 4K94C 4LHUG 3SDDB 2R69H 4ONGH 1U8OB 5E00B 2O26U 2XWBB 3KPLA 5IWLA 5KVGH 3DRQA 5ESAA 3F12A 3CUPB 3MJ9L 5DEGA 4FXGA 3H7LA 5KVDL 4OF3A 2QTEA 5D1ZC 2VXTH 4WENB 4B7LA 4ZTOL 4BK5A 3G6JA 1A3LL 5F88A 2J6EL 2ED8A 1GRWA 3FOMA 5MERA 4X4XA 5DXWA 4OD2A 5I2IB 4HIJB 5F3BA 5I1KL 5HHPA 1FIGL 4LVHC 1OPGH 3VXRA 4Z7QE 1HDMA 1MHEA 1TIUA 5C0BD 5JOEA 5DC0A 3VGFA 4H26B 4FP8H 4AYFA 5A16B 4A6YA 3CFJB 5AG9A 1MJJA 3MUGB 1MIMH 1I3RB 4PJCE 4U6YA 4ZAKD 3O6KH 4PUBL 4CN1A 2VH5H 1ADQL 3QQ4B 3VFSA 3P77B 4DUVA 3MLXL 1IGJA 4TVPE 5KTEL 1X5AA 4X5LA 5E56A 2W9DH 4MA7H 3VE0A 2NYYC 1Q9OB 3GMOB 3MRRB 3FHAA 2WIMA 3O2VL 2ICWI 4P2RE 5JQ6H 3QHFL 1GAFL 3S6CA 4MA1C 5FO9A 3T3MF 4ZFOB 1H8NA 4NHUA 2FBJL 4Y5YA 4OZHA 1M71A 3G5YB 4XC3L 2EDKA 5KW9H 1FZOB 1FGVL 1UT9A 5JO5A 4YPJA 4LF3B 1XGYL 4MWFA 4Q9QH 2HFEB 2X4QA 1BEYL 4P9HC 3U79A 4CU8A 3GSNL 3O8XA 1I1RA 4JO2L 4FXLA 4PV9B 3LKPA 5D7LA 4YHNA 3FQTB 5FCUH 4NNPL 2YUWA 3E2HB 3DX8A 4U1GC 4MAYA 1EH9A 3C60B 3V52H 5I1CH 4P9ML 3F5WA 3LEYL 3ZKSD 1NCTA 2D7MA 5GSRB 1ZGLP 8CGTA 3X14A 4OF5A 5D7IB 4XCYA 3TCLB 2MNUA 4OGYL 5I16A 3CLEH 3F62A 4K55A 4LLWB 4ZD3L 1PKQB 3RRQA 1QEWB 4U0RC 2G75A 4TRPL 4N0YH 1VFBA 4TNVK 5IIEB 3EUUA 3JTSA 5FM5M 2ZG1A 4YXHL 3OGOE 4FS0A 3WFBH 4F8QA 1FFPB 1VENA 4K8RH 2AK4B 5TF1H 3SCMD 3MX0A 3FT4A 1QYGL 3NIFE 1CGXA 3LEXB 5D2NB 4NC1E 5ERWB 2C4FT 5IESH 1FNGA 3T0BA 2I27N 3O9WB 4AK1A 1RIHL 1WZMA 3IDXH 2B5IC 1FGNL 1T22A 5IW3A 2VXSL 4ZXBA 3UEZA 2R1YB 1PQZB 4OIIL 4F37K 5D1XC 5C0AD 4M6MH 5KSAB 4DCQB 1JNLL 4KJWD 1JGEB 4PPTA 5IQ7H 5HY9A 3JSSA 3EYUL 4M3JA 1MLBA 1OTUD 1I9RL 2YPLD 2XZAH 3U46A 1N8ZA 3JWDL 3KS0H 5SWQB 1YUHB 2UZIH 3D2UB 4IMKC 3NCCB 1JI2A 1Z5LB 3BP7B 3V6FB 2R69L 4ONGL 1II4E 1KB9K 1GZPB 5GGSA 2E9JA 4WHTB 5KVGL 4Z76B 4RBPH 4Z7VE 5D1ZA 4M4RA 1EO8H 1M6OB 2VXTL 1WFUA 1I3VA 4XAKE 3ABZA 1HHJA 2NY6C 4UOW1 1A9EB 4PJXE 4HKBA 4EQ2A 4FHBD 1NL0H 5T3ZE 3C2SA 3BZ4B 4PJFE 3FRPA 3TA3C 1RIUH 4PJ8B 4CGTA 1OPGL 3VWJB 4EEEA 3PWNA 5KJRH 4MJ6B 1CDBA 4NN6C 5F7UA 1MFCH 4MMXC 4FP8L 4NWTH 3I6KB 1EO7A 3U7AA 4DJMA 1UJ3B 1MIML 1XF4B 1YPZA 2ZCHH 3GHEH 1ED3A 4D94A 4QHKI 2APTA 1KV3A 3O6KL 3D85A 1U8QA 3PG2A 4PLJC 2VH5L 1MJ8H 3VFVA 4YE4H 3AXLA 4JRXD 4NNYB 3WNKA 2W9DL 4MA7L 3FB5B 5D6CB 4CMHC 2IPTH 2HVKB 2AV7A 5JQ6L 3BD4A 4MB4A 3Q6GH 4OM0H 2WLYA 3SPVB 5MEPA 4A6YH 3KGRA 2COQA 1KBGL 1NC4A 2ADIB 4O2FB 2XACC 1I9IH 1MEXH 2WUCH 3C5SB 5ISZD 3UJJL 4H25B 5KW9L 4Q9QL 4OV6F 5A2FA 1TVBB 4IIQC 3A6BH 1QFWL 1E0OB 2IQ9H 3SO3B 1I8MB 4XH2B 1G7PB 1OT1A 1G7MA 5FCUL 1KTLB 3C6LD 4HFUH 2IAMB 1QR4A 1R5WA 3IGAA 4GAGH 3C8DA 4CADA 3NCMA 3V52L 5I1CL 2UWEB 4Z7UA 3S4SB 4YFLF 3MLZH 3WNLA 1IAKA 2VC2H 3H0TA 4P4RB 4HUUA 5EUOF 2A77H 2BZDA 4JFOA 3SKOA 4Y7MA 2YN3A 5JW4N 1OVZA 4Z7WE 43CAA 3CLEL 2ITCA 3BDYH 3C8KA 3QDJD 5I1HH 3W11D 5JHLH 4N0YL 1BJ1J 1RZIA 4I18A 4LMQE 1BZ9B 4KRMB 3O3EA 5HGBB 3W5MA 1WZ1H 2DQDL 3WFBL 1FN4B 2O5XH 4K8RL 3RNQB 3BGFB 4MJ4A 5KSUB 1QRNE 2DYPA 5E2JA 3S34L 3JV6A 3ROOA 5IESL 1WTLA 2PYFA 3H2WA 1Q0XH 1F3DH 5FGCE 5ACZA 5DFVD 4D8PA 2QQKH 3VFGH 4X4YA 4NIKB 3RUGF 4BA8A 5D1XA 3GMMA 4R96B 4PJBA 4M6ML 4ZO7A 1LILA 5HHME 1VFAA 2VDOH 4X6DE 1UM6H 4JM2B 5IQ7L 1T2JA 2GHWB 4M62H 4D0BA 4KVNH 1IGCH 4R7DA 3O4OC 4G43A 4WU7A 4WO4B 2HFGH 1BVLA 1I4FB 2XZAL 3FB8A 3DXAB 4IMKA 1YEKH 2UZIL 3RVUD 1U8IB 4BSVB 1KLGA 3MRMA 1BQHG 1U91A 4NC1C 4J4PC 1UENA 4BSJA 2DJUA 4Y19D 3MJ7A 3SKJH 4IOIB 3QUXC 3AUVA 4U3XA 3BZFA 5CGYC 1EO8L 3VI3F 1PJ9A 4JFFD 1A6WH 1UZ8A 1IFHH 4JFQA 4BFGA 3SY0A 3UTTE 4PRAB 4S1DD 4K94H 5FYJH 3H9ZA 3CJJA 3HR6A 4ZFZB 1G7HA 4EJ1C 1NL0L 3CDGA 5E2VH 4F7PA 3MV8B 3TA3A 4X6EA 1RJZA 5I76B 2AXFA 1FZMA 5BZDB 2C1PA 2V5TA 1RIUL 3TIEA 5F97E 1VCAA 2VRAA 5KJRL 4LSUH 4GH7B 4OCSH 1MFCL 5DRXB 4NWTL 1EPFA 1ZT7B 5DQJA 5H35A 2ZCHL 3GHEL 3U9UA 5JXEA 1H0DA 1Z9MA 4YHZH 4L8CB 3I85A 1ETZB 4YC2B 4DKAA 2RCSH 1OT2A 5SX5K 5B8CA 4YE4L 3V5KA 2R1WB 4RQQA 1EHAA 3U7YH 3FB7A 1I85C 4U2YA 4OM0L 3OL2A 5IMOA 2I26N 1PX4A 1EEQA 4UILH 3MRGB 4A6YL 3RHWK 3O2DA 3TVMC 2HG5B 2GT9B 1ES0B 5F6HJ 1I9IL 1MEXL 5JIKA 4M8QB 2WUCL 4QOKD 4UU9B 2CKNA 4IIQA 1CGSH 1UQSA 3MBEB 4PJCA 3A6BL 2IQ9L 5IB5A 4JR9H 3TNNB 2BXZA 3OG4B 3KPQA 2JB6B 5CHNB 4HFUL 2OTPA 5DHYA 1SQ2N 5FUCE 3G6JF 3MCKB 3QDGD 5K59F 5DVOA 3GMLA 4OUUB 3VD3A 1J1PH 3MLZL 3NTCH 4P2RA 2BVOB 4CN6A 1IT9H 2VC2L 4X9FA 1XCTB 4QY8A 1MSPA 4NQDB 1IL1B 2ESVE 1F11A 2A77L 3RY6C 2XN9B 3QUYB 3D3VB 4Y5XB 4MNQB 1M1SA 3MOAH 3OXRB 5EOQH 1NH6A 5I1HL 4YUEH 5JHLL 4YHPB 3K1KC 5DK3A 4U3HA 1IM9B 3V7AG 3CH1B 2XKNB 5DK2B 3LD8B 3MLYH 4PJAE 3IF1A 1FORH 1J7VR 1WZ1L 4LSTH 5L8KB 3JV5A 3DLQR 3ZO0A 4HLZH 1NCCL 2VZ1A 3ILQC 2GTWA 4PGJA 1RY7B 3DTXA 1KYOJ 1CFSA 1VB9A 2EDLA 3P4OB 2QQKL 4KI5E 3RFZC 3VFGL 4YBHA 4OZHF 1F4AA 4NQEE 3ZYIA 2H2SC 4WW2C 2VDOL 3TNMB 4WFGE 4I0CC 4M62L 1CE6A 4C59B 1OHQA 4ONHA 4KVNL 1IGCL 5DMIH 1DUYB 2CKBA 2CMRH 3RZWA 4TOYH 2HFGL 4ZSOB 4OSUH 3X3GH 2WUBH 3QA3B 3HNTH 5B39G 3Q1SH 1YEKL 2AEIT 2BHZA 3ZLQC 2OK0H 1C7TA 4J4PA 5IMKA 3WHE0 1DQJA 2C3WA 3LOWA 3R8QA 2JIXD 5MEND 2NX5D 2HVJB 2PYED 3QUXA 1E4JA 3V7MA 4HS6B 1KXVC 5J13B 5JPNB 3GB7A 2Z35A 5HVGB 1JWMA 3UYPA 1A6WL 2FWOB 1IFHL 1KT2B 3VXME 3D6GA 3SGEI 3SHSA 2P5EE 4K94L 5FYJL 2ZUYA 2HA1A 1JHKH 3AFLA 3HI1B 3KPSB 4KU1A 3IETB 2YD6A 3V8CA 5DGQA 4BFEA 5E2VL 1A6AA 3QO1A 2CLZB 4LOUD 1GZQB 1UKQA 5EO1B 1L0YA 4LSUL 1Q1JH 2YXFA 4OCSL 5C0RH 1P7KA 1K2DB 1HQRA 4D9LH 4KDVA 4PJHA 1JUFA 2ZP0T 3IRPX 4Z7VA 3FONB 1EFXA 1ZHLA 3FFCD 2GW5A 4K7PX 3P40A 2Q76A 5T33L 5KVFH 2APBA 4TNWF 2RCSL 5DD0H 5CD3A 2VLJD 3GRWH 1CICB 4NQVB 4QF1A 3IKCA 3U7YL 4CL7A 1I85A 4ZOEA 3IFPB 1E27B 5E8PB 3C6SA 4PJFA 3DUUA 1ZXQA 5ESVA 5F7DA 1RZ7L 2VZOA 3KAAA 1EXUB 4UILL 3TVMA 4E5XA 3KYNA 2XYCA 4LCYA 4KZDH 4HXBH 1K4DB 5CCKH 1QUNA 1RZ8A 3OSKA 4CVUA 4KTEH 1CGSL 3JBG7 4U49A 2MCG1 4J1UB 2UUDH 4JAMA 5DGRA 3RVWC 4LCCB 3L3DA 4QGTA 4JR9L 1WFOA 1J0KA 3KYOA 2J4WH 1YY9C 4W81A 2WMPA 1XR8A 3O2DH 3HR5A 1P6FA 4G7YH 1J1PL 1IT9L 4EVNB 3RY6A 5T3XE 3HNVH 1CLCA 2J8UB 3T0ED 4FQHB 2HLAB 5HVHC 3EOAB 5SX4I 2XT1B 3MOAL 5EOQL 4NNXA 3VFRB 3RIFK 5E8DH 4YUEL 4PJDB 3HE7A 4O2CB 1TPXC 1FL3B 1IILE 1YPZF 3MLYL 4JN2B 1L6XA 1QD0A 1FORL 2X70B 4G6FD 4HV8A 1HKLH 2VZVA 4R9HA 5C9KA 4LSTL 2AEQH 2EYTA 1EDQA 3S36L 5IFAH 1RZJL 1UXWB 4CKVX 4ISVB 3ARGC 3PWJA 4NKMA 4HGMA 4QCIB 1CT8B 2VABB 3BXNB 3TZVB 1S7SB 3F6IA 4UB0H 4P23C 5D7JC 1IAIM 4RISH 3QNYB 3BGMA 2IPKA 5C09D 1W72A 4N8VA 1ORQB 4GW1A 3H3BC 2JLLA 3T2PA 4WW2A 3NN8A 1XCQA 2RIKA 4OLZH 2EYRB 3OAZH 5CWSA 5T1KD 1XGPB 5DMIL 1B4JH 2CMRL 3RTQB 4TOYL 2PTTB 3QPQC 4JZJB 4OSUL 3X3GL 5LGKA 1SY6L 2WUBL 3VH8B 3WUWB 3HNTL 1QRNA 3Q1SL 4WUUB 1QSFB 3IDMB 3RIAF 5GGSY 4P46B 2OK0L 5HHXH 4Z7UF 4KHXH 1DDHB 5CD5D 1DLFH 1EMTH 1Z3GH 4UV7H 5EU3B 3VRIA 3SDAD 1SM3H 1KNOB 3MLWH 1K4CB 5C0CA 3IU4H 4NFDA 4HKXB 2CKBH 3H9HB 2EZ0D 4X6DA 5JW4Q 4LK4A 4JKKA 4UTBH 1JHKL 1ND0B 4RAHA 2BNQA 1XGUB 2VKWA 3I2CH 5DJAB 2X10A 1P4BH 5TH2A 4LLMA 3VG9C 5CJ5A 1Y6MR 3AGVA 4N0UB 2ZSWB 1X7QB 4YO0A 3DGGB 5HGDB 4GJTB 1D5BA 1MJ7H 5J6HB 1WFNA 4XCNB 5TQ2H 1Q1JL 2EXWC 2HTKC 5C0RL 4JKMA 4D9LL 4MX7A 1DBAH 1FCCA 1IAOB 4U6HB 3Q5TA 2NTFB 1P53A 4NFBA 4NRYA 1B3JA 2VWEE 5FM5O 3SKNB 2V5RA 3UTTA 5KVFL 2DM4A 2KDGA 1HINH 3RDTC 3GRWL 5B3JF 1M7DA 3S98A 2XKUA 5J3HD 3SOBH 2W91A 1ZA6A 4RWHA 5D7IE 2AEWA 3VFPA 4KZDL 2HFTA 4HXBL 3G08A 1TMCB 5CCKL 2PW2A 2X09A 4Y1AD 4F7EB 4KTEL 5DJCA 5TF0A 4XWOC 3H3KA 3B83A 5E8OB 4OLEA 1JN6A 3V0VA 3CFCH 5T3ZH 3F58H 2OLDA 1U93A 2ORBL 4X7SH 1I9JH 4F80A 3QDME 2J4WL 1CLOH 3SGKC 1KJ2A 3O2DL 3WKMH 2VYRE 3NZ8B 3PV6B 4G7YL 3S35H 5D2NE 1DLHA 1JK8A 3KJ4C 2JCCE 5ICXA 4CBPA 1F3JA 1PY9A 3HNVL 1VADB 2KL6A 3MRJB 4O4YL 3SKMA 4MCZA 3GKWH 4IS6B 1CL7H 4NN7B 3JXAA 4U7KA 1NGQH 2FR4B 1ZHNA 5E8DL 3BEWB 4TQEH 1B0GB 1EVUA 3S88H 4HFWA 3W82A 1R6VA 4NUJA 3ZHKA 1HKLL 4JPIA 4FQJH 3JTTA 1CWVA 2V9RA 3MPCA 3S37H 3ARGA 5IFAL 5IVNA 1KJMA 4ODXB 5INDA 3RWJA 4HGWB 2V7NA 4EIZC 4QNPE 3QQ3B 1B6UA 3QSKB 4YDJB 1WBZA 3ARFB 3SCMB 3MNVB 1N26A 4N0CC 3UTSE 4DQOH 4P23A 2ESVA 5D7JA 3BEVA 4JB9L 3MC0A 4UB0L 4Z7QF 1Y18A 2VQ1A 2YPKB 1HI6A 4RISL 2A6DB 4ORGA 3ARRA 2X4UA 5DUPH 2HP4A 4XCEA 5A2KH 1BZQK 2Y4SA 4OLZL 1D5MB 3MRCA 5C0AB 1CGYA 4PJCF 2VLRB 4PJAA 1JWUA 5HHOE 1T4KB 1B4JL 1R3JB 4QHUA 3P9LB 1UWGH 3RWIB 3VXQB 1HH6B 2VQUA 2F74A 5HHXL 3HG1E 4KHXL 3MJ8B 5AAMA 1W72H 4KJQC 1DLFL 4M93B 1EMTL 2W65B 5MP6H 4UV7L 3Q6FB 1T04A 4IRJD 3F8UB 1SM3L 4MB3A 4WWID 5CILH 3MLWL 5E8NB 4PRPA 4X0KB 2W60B 5I1GH 3IU4L 3MLVH 2Z31C 2OSLA 4NQEA 4XP1H 1Q94A 3ECBA 4LCWE 3RP1A 2Z0BA 4UTBL 4N8CL 2E8YA 4K3DH 3T65B 4YHLH 3I2CL 2VZSA 3FQRA 2A73A 3Q2CA 1P4BL 5J0BA 2XOTA 4JDVA 4ZPTA 4H8WC 4QRPE 3GSVA 3BPLB 1CD1A 1MELA 1MJ7L 3UROR 2NY3B 3KLHD 5FO7B 5TQ2L 4P5TD 1YYLL 4KQ3H 3GUTB 4XNMB 1FYHB 1DBAL 2BHYA 4OZGE 4WI7A 5J6GA 3I6LE 4MQSB 1A6ZB 1QSED 2RJMA 2P5EA 3BWAB 1HINL 3RDTA 5IB3B 4FFZH 5C08D 1CIDA 3BWUC 1SMOA 4OZIB 3LPFA 4OD3H 3PDOA 3KDMA 3O4LB 5IG7B 3FO2B 4Q6IC 4R2GD 3SOBL 5HYQB 2FJHA 3CFIC 1K8DA 3U36A 1MWAA 1MIEH 3NIFF 4I5BA 4L4VE 4R6UA 1F00I 3MCLH 2FRGP 4H1LG 1UYWH 4K8RD 1J05A 4PD4J 4YPGA 1AGFA 5AD0B 5ISZB 1MHCA 3UPAA 2P47B 3FAWA 1CGVA 2D0FA 3CFCL 5T3ZL 2VWEC 3F58L 4X7SL 3ZDXE 4AEFA 1I9JL 1OW0C 2F15A 3SGKA 1JZ5A 4AT6A 3E2HC 3JV4B 3FQWA 4HK3N 1T83C 3C6LB 4XGZA 3O6FB 5HJ3B 3ZDYF 4BUHA 3C60C 3S35L 4P3CH 4UBDD 1MFEL 4KKCD 1GL4B 3CFDA 4MVBD 1OAKH 3RPKA 4EUPH 3D25B 1CL7L 1NMCB 2JK5A 2VLKD 4PJHF 1NGQL 1HXYA 4TQEL 1KJ2H 3S88L 3T4YA 3QDJB 4NSKA 5F3HB 3TBTB 5DVMA 1P7QD 2QSQA 4GKSA 4OCWH 1S7WA 3OAYK 3QB7C 2YZ1A 3TBVB 4QHLB 4ZDHA 4UNTA 2Y5TA 5IOPB 4PJFF 2AV1B 3WHE1 5D2NC 3NFSL 4WTWA 5I8OH 1I8KB 4DQOL 1IC5H 2YRLA 3O9WC 1S7XA 2OI9B 4JQVC 2FYYA 4UUJB 2GYSA 1KTDA 4Z78A 4FQQB 1CDJA 5I9QB 3OTTA 5DUPL 4GLRH 2H26A 3MRQB 5I66B 4KKBC 2BRRH 1NGXA 1F4YH 2VOTA 1C16A 1LNUA 1JPSH 2FECL 2VUOA 3SDXA 3FN0H 2QL1A 3VXNA 3FO1A 2VDLH 4JFDA 5IV2A 5FOBB 1V3KA 2MKWA 4AENB 2CDEB 5A3IC 1UWGL 1BHGA 4M7LH 1FAIL 2QHRH 5H37H 1B0RB 3BIBX 2I9TB 5FO8A 1U8OA 1ZE3C 2XWBA 3C09B 5MP6L 4KRPD 2LQRA 3GSRA 3GMQA 3VXRD 1KJVB 5F1NB 3FT2B 5CILL 4P0DA 4N90D 1AY1H 3HE6C 1O7VA 5I1GL 4Y19B 1JBJA 1MQ8A 2Z31A 3MLVL 4HW6A 3QG6A 4XP1L 4P5KB 3WS3A 1OAYH 3QBTB 1AHWB 2ZNWA 4XVUC 3MV7B 4K3DL 2V2TB 5D93B 4YHLL 4F7MA 4WHYG 4XVJH 5HYSA 3ARXA 4OCYH 4XPGH 4HIJA 2I9LB 3PQYE 4YDKH 5D1QC 1D9KA 1KPUB 4PJ8C 2DDQH 3W39B 4KQ3L 3CZJA 3ARBD 5D2LF 1NEZB 4LGSB 3GJFK 3TJHD 4FZ8H 3CFJA 1QFUL 4JDTH 2YK1H 3KYMA 1I3RA 5F1IA 3TIDB 3WUZA 3LIZH 1C7SA 2IBZY 3KXFE 4PLNC 3QQ4A 1IM3B 4WW2F 1FJ1B 2W59A 3MTRA 4FFZL 1VKXB 1D5XA 1N4XH 3LDBC 4OD3L 5D7LD 5I71C 4Q6IA 4FQ1H 4B41A 4MAYD 1HIMH 4K71B 1MIEL 4ZFOA 1MQKH 1UVQB 2JTDA 1A1MB 4MDJA 4E9LA 4G8EA 4MNQE 3GBMH 3MCLL 1UYWL 2CIKA 2QKIB 5IVZA 4QOKB 4LF3A 4ODSH 4QXUH 2ZG3A 3CXHK 4GMTL 3F65A 1OW0A 4DZ8A 3SO3C 3I9GH 1QSVA 2D0GA 4XP5H 3D9AH 3C60A 2IAMC 4ZQKA 1KTRL 4NYLB 4JQIH 3K4DA 3OKDA 3QDGB 3MYJB 1MFNA 4NZRH 5D7IA 2IFGA 1SVZA 4JZOB 3FQNB 2VDKH 3DMMA 3MR9A 1OAKL 2R29H 3IDIB 4FQCH 1OAQH 3CX2A 3K4AA 2R9HC 3D0VA 1BVKB 1KJ2L 5J1AA 3IFNH 5IIEA 4PP2B 4ZXBD 5TDOB 3VXSE 2N7AA 4M9OA 3QDMA 4OCWL 4X5XB 3LKRB 2EYSB 4NQUA 3UPRB 1FFPA 1AGDB 4I0KA 3VCLB 3H8NA 2QQNL 3BGFC 1Q9LB 5D2NA 3C5JB 2SEBA 2JCCA 5FYJD 5I8OL 1T3FB 3O9WA 1IC5L 4JQVA 5A2LH 4LCUA 4QXGH 2VAJA 5EFIB 1J9CT 3DSNA 1RHHB 2X4NB 1KB5B 3QHTC 3RU8H 5HPMA 3KLAB 3EGSA 3B3IB 3GSOB 2BRRL 3RPIB 4ELKB 3V5HB 5CEZH 1JGEA 3E6HA 1F4YL 5D1ZD 1JPSL 1NDMB 4XCCH 5CIPA 3FN0L 2VDLL 2Q8BH 4WO4C 5T3XH 3CFBB 4M7LL 4OZ4A 4JGUA 1Z5LA 2QHRL 3BP7A 3V6FA 1AC6A 2EXYC 1ZT4A 3OAUH 2ZG2A 3UTSA 2Q86B 1T7WA 4OGZA 1XF5B 4WHTA 3T09A 4HZAA 3HE6A 3STLB 2JIXB 5LBSH 5MENB 1RJLB 1WF5A 4PYHA 3GMPA 1AY1L 2PYEB 3P11H 2XTJB 2E7HA 3B5TA 4YBQC 5DK0B 1IMHC 1OAYL 1A9EA 4NRXB 5HHOA 3D85D 4XVJL 3NMEA 2VE6B 5L9DH 4XPGL 4OBSA 2NYYD 3CSYB 5D1QA 4PJ8A 5GSVA 4YDKL 4G8GE 3HG1A 4MJ6A 2DDQL 4O2EB 5KOVC 4FMKA 1DANT 2NY2C 4U6XB 2ADGB 2HFFB 1NC4D 1SMAA 4JDTL 3IVKB 5C07E 5L8JB 1CDGA 1ZSDB 1TNNA 4M6AA 3LIZL 4X6FB 1OP3K 5IKCB 3IT8D 4G6AC 4H8WH 5GS2H 4PV8B 4YC2C 1H8OA 2EO9A 2RBLA 2WP3T 2VLJB 5F89A 3M1BB 3FB5A 1N4XL 1JHTB 1CQYA 4PJAF 2MTPA 3VGBA 1CGWA 3EJYC 4AG4H 4DGIH 4RNRA 1INDH 2V5SA 4GG8A 5HXMA 1HIML 2FJFA 4MHHG 2GQHA 5I0ZA 2B0SH 3DYPA 1MQKL 1G7IA 2IC2A 3QRFM 1EJOH 2WIIA 2OTWB 4QWWC 4G3YH 3GBML 1OF2B 2V5MA 1H3PH 4OZGA 5AAWA 1CTOA 4ODSL 4QXUL 1NCBH 2XQBH 1XZ0B 4KPHH 5DC9B 2J1KA 3MBEC 4JN1H 1P2CA 4PJDE 3S96B 1Q72H 4XH2A 3VFMA 1JV5B 5IR1B 5J12B 1KTLA 1J8HE 2IAMA 4XP5L 5I6XB 4XPBH 3GMRB 5I17B 3PWPB 4LSVH 3CD4A 3NZHH 4L1HA 4JQIL 5SWSE 3S4SA 4EI5B 5L88H 1LK2B 5K9KB 4NZRL 3W9EB 3MREB 5CKGA 2DMCA 3QNZB 1F58H 2VDKL 1U8MA 5J57B 4L4VA 1U8PA 2R29L 3VFWB 1D7FA 4FQCL 3Q5YA 1OAQL 2K3TA 3BKYH 4Y5XC 5CSGA 5EUKB 4AZ8A 1FAKT 5EO9B 4ODTH 5KANG 5L0QC 5HYJE 4XP6L 4XXCC 5AYUH 4N8PA 4D0DA 5CSZA 5D1XD 5GRUH 1BZ9A 4M61A 5HGBA 2I24N 3LD8C 1WCQA 5FK9A 5BQ7B 3PWLB 1FN4A 3QWOB 4KZEH 1RJYB 3T3PE 2YSSB 2Z91A 5KSUA 4C55A 4WFHD 4WUUE 5CBEA 3RBSA 5TGBB 1CQKA 4V1DE 2XV6B 1FSKB 1U8HA 2C4XA 4X80H 1RAMA 4MXQC 4HC1A 4JHZA 3N9GH 2OJZH 5L7XL 5ICYB 1J1OH 1ONQA 4QXGL 4R0LC 1YA5A 4JJHA 1AD9A 4HEPG 3RU8L 1G7QA 2ZUUA 4JGMA 4OUOA 2D7QA 4LSPH 3CFKA 4M9PA 1UM4H 5T5NG 5CEZL 4DKDC 3LN4A 5FECA 4LFHG 4XCCL 5C2BH 2NY6D 4WO4A 1GGCL 4PRDB 1TTUA 3OJDB 4KV5E 1I4FA 5IVXE 2Q8BL 3HPJA 5T3XL 5L6YH 5I1DA 3W9DB 2NTSP 5D71H 3CMGA 5F6HI 1RV6X 1CD9B 1BZ7B 1U8IA 1GJIA 4MD4B 3OAUL 4G5ZH 3TA3D 2PW1B 3WD5H 1MCWM 5GS1B 1UB5B 3I75A 4XAWH 3VFNB 3RBGA 5LBSL 5KSVB 4HMCA 3P11L 4ZO8A 4PJIE 3SGDH 1PYWB 5CIPH 4Q9RH 5EU6E 1MNUL 2LV4A 3MA9H 4NHCH 4PRAA 1E4XI 3F7YA 3OR6A 1MREH 5EZLA 4PLJD 5M94B 2IMMA 2AJZB 3M17B 2V5YA 3PWUB 2P8PA 3TCXA 1IKFH 4U1KA 3LS4H 1X5ZA 1H5BB 4WFFE 5BZDA 2V9QA 3QXUA 1F13A 2ERJB 2ZKHH 4U6VH 4UNVA 4WCYL 5EOCH 4XMKH 3WLWC 5DRXA 1NFDB 1W0WA 4TYUA 4UIMB 4BJLA 3HZKB 4Y89A 5TE6H 3DYOA 3QI9B 1T0MA 1WWAX 1ETZA 5GRWA 3T0WA 1T2QH 1W8NA 4C58B 3UZQA 2BVUA 3MO1A 4NN5B 1PX3A 5LVEA 3NGBC 1IEAB 5GGUB 2VB5A 3VD7A 4Z77B 1T0NB 3VGAC 1NBZA 3SDXF 5F9DC 3LRGA 2QJDA 1E6JL 2VXUH 4AG4L 1INDL 5BV7C 1C12B 3PQYA 3ARQA 2B0SL 3D69B 2FEDC 2HG5A 2F53B 1EJOL 1ES0A 2WBWB 3EKCA 5EBMB 3REWB 3WIFA 4ZYKA 3PP3H 1H3PL 2DJ4A 2EIZB 2NNAB 3MBEA 4Y1AB 1MI5E 1NCBL 2XQBL 4KPHL 4JN1L 1JF6A 1Q72L 5EWIH 5JTWA 3ZHLA 4ZFOL 4ZNEE 3LVEA 1NCAH 4LSVL 1BBJB 4Y5VC 2IJ0C 5FEBA 3NZHL 1YEHH 5C9JB 5L88L 4LGRB 1AH1A 5L2JA 1EAJA 5CJBA 1LEKB 1F58L 3O3DB 5A40E 2DS4A 3RL2B 1KG0B 4MNQA 4Y5XA 1C5CH 3MACH 2CD0A 3BKYL 3OXRA 2FSEB 3CCHA 1SEQH 3MV01 4HK0B 2ATPA 4YIQB 3CFEA 3P0VH 4ODTL 2YEZB 2GITA 4NKDB 4XXCA 2A9MH 5F7EH 4X99B 5M95B 1HE7A 1CFVH 4PY7A 5AYUL 1IM9A 5GRUL 1OQOA 4N0FA 5CJOH 2WQ8A 3BISA 2AI0H 4KZEL 2ICWA 1I1AC 1JZ2A 4BZYA 1T80A 1MCNA 3T8XB 4X80L 3NCJH 2OJZL 2ATKB 1J1OL 3C08L 4R0LA 2AEPH 1T20B 4J4PD 1NFIB 4MNGE 3V0AC 1MCPH 3QUXD 4LSPL 5CGYD 1UM4L 1DVFB 5SWZE 4G6KH 3VXSA 5C2BL 2VDPH 4HC1H 4ZSOA 2ZSVA 2DIBA 5C7XL 5L6YL 4KY1H 5D71L 2YS4A 1YN6B 5DJDA 2Y36H 2BSRA 3QH3A 2IAND 4G5ZL 4P46C 1EZVX 3WD5L 1BJMA 2MOVA 3MRHB 1T5WB 4M00A 4XAWL 2CGRH 3CDYA 5D7IF 5EUOB 2GK2A 5C0FB 4HS6A 5DYOB 5JPNA 4IRJB 2QR0A 1KT2A 3MA9L 1CIUA 4NHCL 2P8MB 3MSPA 3L3KA 1EFXD 2W0PA 4R90H 2C1OB 3MGOB 3DUHA 3KPSA 5T1DL 5B21A 3IETA 5C0DB 4XAKD 3NACH 3QZWA 1IKFL 5IM7B 2WP3O 3LS4L 4TULL 5FUZH 2IALB 4P2QB 2HWZH 3KPTA 3QHZH 2WM0A 5MHSE 1GZQA 3V4PH 5EO1A 1T5XB 3OKMB 1MAJA 2ZKHL 4U6VL 5BMFH 5T3ZD 1I7RA 3W0WB 5EOCL 5DMKB 4XMKL 3EIFA 2JCCF 1U95B 4RWYH 1IGTA 5BVJA 1I7ZA 1S9VB 5TE6L 4JZNB 3V0WH 4K2UH 4EDXB 3ARPA 5J11B 4HX1A 1CFBA 1FNFA 1T2QL 3ZYJA 1QSEB 2O5YH 4JO3L 3VI4E 5F7HA 2N4IA 5C08B 3IFPA 3L3JB 1QACA 1YEJH 4PD4K 5DD6B 1KLUA 2ADJA 1LMKA 3KNBA 1JZ6A 1PZ5B 2P5WE 4G8GA 4HSQA 4JFXB 5C3LD 4GKOA 1WSST 4QNPF 4CVWA 5BOPA 1XGQB 5CMAB 2CO6B 2GFBA 2X4TA 4R8WH 2APFA 2JELH 2NXYC 2AGJH 3NCYS 5C07A 3QNXB 4J1UA 5J8OA 3EDEA 1DN0B 2YA0A 5EWIL 2VZTA 3MUY1 1J8KA 2MCPH 2R0ZL 2BNUA 2J2ZA 5JOPE 4OIAA 4WTZA 4Y5VA 1S7RA 3A6CH 1NCAL 3BVNA 1YEHL 3TV3H 3STZB 2Z4QB 5JW4R 3DV6B 3ILQD 1S7UB 2X9XA 5H8DA 1RULH 3WIIH 2V7HA 5MEQB 4FQHA 4Q97A 3CDFA 1U9KA 2R2BA 2HLAA 1C5CL 2Z9TA 3MACL 4Y4KB 2O61B 1SEQL 5I30H 3OGCA 3RI5F 1EIBA 2A9ML 5FM4A 2AVGA 2EDBA 5F7EL 5E5MB 3VXUE 1DSFH 1T1XA 2P42B 4PJDA 1TCRA 2VLKB 1CFVL 1SHMA 4O2CA 1H3XA 4L9LC 4HKJB 3U83A 5I1IH 2H2SD 4XB8A 5CJOL 1WAAE 1I1AA 1OP9A 5F7MC 2AI0L 2BOBB 1IEBB 4Y4FC 2GJJA 4F3FB 4CVZA 3C9NA 4PS4H 5SWSA 5D96B 5DVNA 2VN7A 4QCIA 1CT8A 3BXNA 3WDJA 4EN3C 3ARFC 3EZ8A 1S7SA 4WNQB 5K9QG 2AEPL 4PJ9C 4PRIE 1QPXA 3QNYA 3ZSSA 4L4TD 1OL0A 2R0WH 1ORQA 4YHIA 2DBLH 4ZO6A 3KPLB 1MCPL 4OZGF 2EYRA 5ESAB 3F12B 2JJVA 5C0CD 1H8SA 4DOHB 4FXGB 4G6KL 3CVIL 2PTTA 4HC1L 1PZUB 4KY1L 1X4XA 1A2YB 2BNQD 2RR3A 3MRLA 4WUUA 3PJSA 3G6JB 5F88B 4V1DA 3MFFB 4P46A 1YYMH 2Y36L 5MERB 3FOMB 5F8RC 2BY1A 4M93C 2AQ3A 5HHPB 1P5VA 4Y2OA 1KNOA 1NCWH 3VXRB 1HDMB 2R4SH 2DL2A 3UX9B 4BH8A 4U7MA 2FHFA 1K6QH 2C7UA 4R90L 3RWCB 4DN3H 4A6YB 1N6QH 1QSZA 2X42A 2PN5A 4CJ1A 4U6YB 2FL5B 3MV9D 3NACL 5IVXA 5DS8B 2ZSWA 2APWA 2VQTA 3AS2A 3VFSB 2HWZL 3QHZL 1IGJB 2E7BA 5HGDA 1UA6L 5J6HA 5BMFL 3BPLC 3VE0B 4BZ1H 2NY3C 2A83A 1LWRA 3DVFA 1NLDH 3VRLF 4RWYL 3P4MB 1IAOA 1WGOA 3SGJC 4U6HA 2NTFA 4PJIA 4NHUB 4HIHA 3VGGA 3CNKA 5EU6A 4K2UL 3BYYA 3V0WL 1M71B 1U6AH 2FEEI 1LP9E 1MHPH 1R3HA 4CN4A 5JO5B 3RVWD 3JUZA 2O5YL 4MWFB 2X4QB 5J1SC 2FX7H 2GY5A 1YY9D 3O8XB 1NGZA 1YEJL 2DMBA 3LKPB 5D7LB 5E2WH 5I73B 3DX8B 3A6OA 1L7IH 4MAYB 1JMXA 3MZTA 3F5WB 3L5IA 4HULB 3HAEG 4R8WL 2JELL 4NZJA 2AGJL 2GTZA 2FH6A 5B39B 5BV7H 2MCPL 2LTQB 4LP5A 2G75B 1CLZH 3TO4B 4WEMB 2EKSA 3A6CL 2YUVA 4DKEH 3MJ6A 3RGVB 1VFBB 2DB8A 4IEFB 3NZ8A 4WI4A 3PV6A 3WNPA 3TV3L 5ICZA 3O6LL 5DRWB 5LJYH 3ARGD 1RULL 5DR5H 2VIRA 5C6PB 4LBEB 3WIIL 1IAIH 2V2XA 3MRJA 5BO1H 1QBBA 1LD9A 2EDQA 3G6DH 4AEEA 4P23D 2ESVD 5D7JD 5I30L 1FNGB 3QEHB 3RZCB 1NMCC 4ODVH 4I3GA 1MI5A 2FR4A 3UP1A 3BZEB 4L9LA 1ZLWH 1IC7L 5DJXB 1DR9A 3Q48A 1FLTX 5I1IL 5DHXB 4ZXBB 2XRAH 4Y4FA 4RAUB 5IBUB 1INQA 4ZNEA 5IJVB 4PP1C 1K85A 2ICEA 4HGWA 4PS4L 5C70A 1ZVYA 5HY9B 3QPQD 4IM8A 1MLBB 4EN3A 4YDJA 3ARFA 4ZUVB 1A7QH 4URTB 5F7YC 3U46B 1N8ZB 1JVKA 2JB5L 4PJ9A 3QXWA 1DL7H 2EICA 1OTSC 2OI9C 2Z92A 4XPAH 5IEHA 2F9BT 2R0WL 2DBLL 5INCA 1CDHA 5I75C 5I9QC 3QQ9C 5E6ZA 1D5MA 4PRPD 3LH2H 1OSPH 3ZT6A 3QXDA 2VLRA 2YPVH 5D1ZB 3TGXA 1ZHKA 2AS5M 3DGCR 1R3JA 2JJSC 1WZKA 4UIKH 3FFDA 3PL6B 3RWIA 2BNRE 1HHJB 3UJIH 1AE6H 1YYML 4HKBB 4U31A 3MJ8A 4RA0C 3T0DA 4GT7A 3HZYB 4LVHB 1NMAH 2A2QT 2EXWD 2HTKD 3NA9H 4GRLC 1NCWL 1YDPA 5E8NA 4MNGA 4Z0BH 2R4SL 3FTGB 1MCEA 4X0KA 3BJ91 1K6QL 4JQXC 5FGSA 4DN3L 2B4CC 3WFDH 1N6QL 3HZVA 1AHWC 4GW5A 3T65A 3OKNA 3VMOA 1ED3B 2DQTH 5LWYH 4I77H 5D93C 2P5ED 3RDTD 15C8H 3D85B 1U8QB 3KPMB 1CZ8H 4Q2ZB 3VFVB 5TDPA 3AXLB 4NZTH 4PB9H 3H42H 1FPTH 1X5FA 4XMPH 4BZ1L 4KXZI 4QHMB 4NM8H 3GUTA 4NP4H 4Q6YA 1NLDL 3SGJA 3V6OC 3SE3C 4MA1B 1Q9WB 3I3DA 3TJEH 4NDMB 4RFNB 3HPLB 4JGJA 1U6AL 4XWOD 1MHPL 3OV6A 1CI5A 3BWAA 5IB3A 2E7MA 3D0LA 1JPTH 1OD9A 2FX7L 3WXWH 4OZIA 1SYSB 3LQAC 3PWPE 3RWHA 2DTMH 1HWGB 2J5LB 4UDTB 3KPOB 5E2WL 3OKOA 1AGCA 1G7MB 4U1GB 1CE1H 1SEBA 5KSBE 1R5WB 2EE2A 4HPYH 4CADB 1L7IL 5D70L 1H3WM 4UMGA 4Z7UB 2A74B 2CLVB 4PGDA 1IAKB 3H0TB 5HYIA 1QR1A 5F1OB 4L29A 3R8BB 4JFOB 1GSMA 3G6AA 4S1QH 3OF6A 4LEXH 43CAB 5BV7L 4U0RB 2ITCB 2GEEA 6FABH 4PGBA 3EZJB 1CLZL 3OKYA 4OF8A 3JV4A 4DKEL 3K8KA 1RZIB 2YKLH 5JMOC 4KROB 2WWKT 4I18B 1Z9OA 3O3EB 1E4KC 1NMBH 4CMMB