4F8QA

Crystal structure of the human btn3a2 ectodomain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
215
structure length
208
Chain Sequence
LQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNNIPAVEAPVVADGVGLYEVAASVIMRGEGVSCIIRNSLLGLEKTASISIADHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Butyrophilin subfamily 3 member A2
publication title The molecular basis for modulation of human V(gamma)9V(delta)2 T cell responses by CD277/Butyrophilin-3 (BTN3A)-specific antibodies
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 208
sequence length 215
ec nomenclature
pdb deposition date 2012-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f8qA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f8qA02
1MVUB 4OKVA 1LEIA 3QCVL 4OF7A 1EO7A 1GC1L 2OP4H 1ZHNB 1UJ3C 3HPLB 4JO2H 3VRJB 2F53A 3MCG1 2MPAL 4HZAA 3WIHA 5C92A 3VFSB 1P9MC 4HAGA 4Y0GA 1D9KD 4KZEL 1EZVY 4LVNB 3O6FD 4XRCA 3OKDB 2B39A 1R3LB 2KQMA 4JAMA 5C0ND 3OGCA 4L3CB 2X4PB 1WIPA 2BY1A 2EYTB 3FL7A 4NHUA 3ULSA 2ADIB 2OCFD 2VLKA 3UPRB 1FL6A 2VXUL 2AJ3B 4UAOB 2EKSA 1HN1A 3UBXG 3K1DA 4NQDD 4FABL 3E6HA 2J12B 5KW9H 5GGUB 3DXAA 1NGZA 4N8VB 2GFBA 4HWEL 5CJBA 1BP3B 5DYOB 5BMFH 4X7TB 5ADPH 1UQSB 4XCEA 2HFTA 2Z92A 1FO0H 4XPTH 2ZSWA 1IGIL 4OM0H 4J3OC 3K4ZA 3LS5H 2CXKA 5DD1L 3LN4B 2OLDA 3QUXC 1I85A 1N4XL 1BD2D 3RQ3A 4FQXA 1ACYH 1OGAE 5ICYB 5KVFL 4PJGA 2YKLL 3SGKC 1KJ2H 4PYHA 3TA3A 5SWSD 2W60B 4PG9B 4PGBA 4L8SB 4E5XA 3K8LA 4MD0B 1T5WA 4U1JA 3RGVD 1QHPA 4KH2A 2IBBA 4GAGH 1S7VB 5CWSA 4LEOB 1QRNB 3GJEB 3TBTB 4PJCE 5H37H 1CFQB 1CGWA 5T3ZH 2B4CL 4I0CC 2ZSVB 4WW2F 1NBVH 5IOPA 4NKDA 1H3UA 3U4AA 3BD4A 4XTRD 1KIPA 3P0VH 1KPVB 2Z31C 3S36L 1S9VA 5LGJB 5D1QA 5KAQF 3LKRA 25C8L 4A6YA 1MJ7H 4P3WA 2ADFH 4RRPA 4WI5A 3FOLB 4NCDA 2RGSA 2ESVD 4JRYA 4NKOA 5TDPB 4U1MB 2C4FU 2LQRA 4R97C 1J1OL 4LCWD 3HUJB 1BQLL 1DBKH 3FRUA 3MACH 4XP4L 1RZIB 4JM2F 3MYJA 4ODBD 2XTJD 2X4NA 2QSQA 2IALB 2VSDA 1A9BA 1LMKA 1KV3A 1U8JB 5E99H 5C09E 1YN7B 3ZKXB 3UTPD 3INUL 3MLSL 5F9OL 5F88A 5KSBF 4PLNC 3QPQC 3IU3A 4YXLH 3O2WL 5FDWA 3PABA 3EYOA 2A6JB 1RY7B 4JKPH 4PJ7F 2VAAB 1D5XB 4F8QA 1OGAA 1YMME 4KUZL 2R56L 4HKBB 5HI5C 3QFJE 3U0PB 5D5ME 2O26U 2BSTA 1M6OB 3KPMA 4ERSH 2P7TA 2OS7A 2AJZA 4HKZB 4KKBD 5D96B 2R1WB 4C57C 4JRXE 1T0NA 4WCYL 2XQBH 1FIGH 2PETA 5KSAC 1VADB 4PP1D 1FZMA 5DSCB 2IGFL 1WQVT 5EOQL 2HJLB 2VKWA 4UINH 5TE6L 3GI9L 3HZMA 4YBHA 5JZ7C 3MNWA 1E4XH 2KPNA 4U1NA 1CFSA 3KS0J 3V5KB 3UJTH 1OD7A 5IFJA 4RGNE 4HS3A 4L4JA 2VL5B 1G6RA 3RAJL 3LN5A 3QXVA 5KVGL 4NT6A 2R8SH 4JFDD 3MOQA 3V0VA 2UUDH 5CJ8A 1NBZA 2EEDA 1B9ZA 4Z77B 3X11A 1RURL 1IAKA 4QRPD 2OR7A 4LPCA 2DQIL 3N06B 1T5XA 3AFLA 4E0RB 1JGDB 4WHTA 2UVEA 5HGBA 1A6TA 4HH9A 1OP5H 3BO8A 4HF5L 3DX7B 1ZLVK 1HILB 2ADJB 4LMQI 1KEGH 5IBLC 3BE1L 7CGTA 5H35B 1U92B 1NGPL 4UV4L 4UT7H 3IJSA 1EEYB 2PO6B 5HHQA 5I17A 4ZO7A 4ZOAA 1SY6L 5FUOH 4X9FA 2W65A 2IPUK 4XCCL 1R0AL 3LHPL 5D5MA 1OAXH 1HSBB 4NQCA 4PJEF 5FYLH 5FO8B 4P4RA 3GMNB 4AT6B 4W4NA 4ZS6C 3T04D 4F7EB 3RNQA 1T2QH 4N1CA 2PXYA 3OR6A 4NO3B 4I0KA 3SY0B 3LV3A 4AMKH 4J3VA 3GM0A 5JW4Q 2R2EA 3HRPA 4O2FA 3S3JA 2DQHL 2X4UB 2A9ML 3GSQA 3QRFM 3MBEA 1AXSB 3LN9A 3VCLB 3BZFB 5EOCJ 1D7FA 3VFTB 5KSUA 5CFHA 4KRPB 4Z8FH 1F4HA 1YYLL 5C0BA 3DVFA 1LO4L 2GK0B 4JFZH 1F2XK 3TFKC 3CDYA 1CLCA 4KPHH 1B0GB 3EKCA 4J1UA 2D4DA 4MQSB 1MRFL 1EPFA 5BVJB 1Z9OA 3MV7D 4P2CG 1WGOA 3ME0A 3CAFA 1MJ8L 1YEFH 4MCYB 2MTPA 4GT7A 1TNMA 3GFUA 4QXUL 1YEHH 5CKGA 1FH5H 4JRWA 4YHKL 4MHHG 4G6FB 4X8JB 4P57B 4ODUB 4PJ7B 2OYPA 2OL3L 4QF1B 5HJ3B 5DS8A 2VXQL 4HW6A 2ZUVA 5DD5L 5LVEA 3QO1A 4LNVA 3M07A 4MJIA 5L0QC 3QNYA 3P9LB 4XH2A 3WMSA 3OKNB 5LWYL 3BPNB 3ILQC 4ENED 1ZLUK 2IMMA 3GHEH 5DVOA 4DKEL 3MRHA 2D03L 1KPRB 4QRRD 5DFTA 3GUTB 2UV3A 4K7PH 4XAKE 3NFPB 4NSKB 4JCLA 1RUML 2JK5B 3MNVB 4P2RB 1MAMH 2NW2A 4JZJB 2RAMA 4D94A 3GM8A 5H2BB 4MJ6A 1OAUH 2ITCB 5MEQB 3MLWH 2VOTA 4H0GA 4TYUA 5DMIH 4NHCH 4ETQB 5FKPA 3DYMA 3OZ9L 5EH1A 3I2CH 1H3XA 3BAEL 3GSUA 1A6VH 4G5ZH 5J56B 2A6DA 4JKMA 2VLLA 3RHWK 1UB6B 4ZUVA 3JBG7 1NCWL 2IQAA 3C8KB 2AJUL 4PJDE 1QHOA 4JQIL 4XI5D 3EYQD 2VXTH 4UIMB 4NDMB 1U2HA 4QRSA 4TVPH 2DICA 4NNPL 5ACZA 1UADC 3VXTB 3P4MB 4GXUN 2APTA 4NQTA 5L2KE 3DIFA 5F71A 3A6CL 4G80B 2N7BA 3ABZA 4FQHB 2NY4D 3DUSB 3GSNL 4R7NA 5EU4A 5D2NB 3PDOA 3C09B 4S1SL 4U1SA 3QWRA 5EZOH 4OCWL 5EC2A 4B7IA 1CBVL 1NEZG 1NCBL 4TULL 4K71B 3VFUB 4PGDB 5F3HA 2EYSB 4ZAKC 4YWGH 4YXKH 1A9EB 1G0XA 4I3GA 3VW3H 1S9WB 43C9B 4MQ7B 3LD8C 4OZ4B 4PJEB 4ZMAT 2WINB 1FNLA 1Q9OB 4Q9RH 5I8CA 2C9AA 1SM3L 5FUZH 1U95A 2OR9L 4DN4H 4HXBH 4OLVH 1VACB 3TZVB 1V5JA 3L7FA 2ZCKL 2Q76A 3MNZA 2ZKHH 2J7LA 5E2JA 1OB1A 1IAIM 3FTGB 4XPHH 2HFEB 3IDJA 4P59L 5ALCH 3IU4H 4JY6B 5DD0L 1HQRA 3MFFB 1F3DJ 5K59F 1A0QL 1A6PA 1ZSDB 4RQQB 3V4PH 1BAFL 1CU4L 1P4IH 4G6JH 1A1NB 2FH8A 4JLRA 3IKKA 5MI0C 4LKCB 2NY1D 1G1YA 1WZLA 5DRNB 5FB8A 5FK9B 1C12A 1HXYB 5SX5H 4BH8B 4M6ML 3QXUA 2BNQD 3LPWA 4HK0A 1UA6L 1SEQH 2DD8L 3OKKB 3MRKA 4CJ1A 4IS6A 4N9GB 5EU6D 4QYOB 1XZ0B 2GI7A 2EE3A 4ZXBD 2DYPA 5JDSA 3GDBA 4LPWA 3P9MA 1NGWB 2AERT 2DAVA 4GKSB 5L2KA 3ULVL 4MA1B 5JW5B 1MFBH 3G9VA 2MWCA 4LLMA 3SDCD 5JPNA 3KPLB 5C2UB 2J5LC 3OJDA 5EBMA 3DRTB 4XBEH 5C0NC 4XPBL 1MREL 3TO2B 3OXSB 1DQJB 3D0VA 1BWWA 2XPGB 3FQXB 1PSKL 1LEGB 3MPCA 3MYZA 4TRPL 5I1LB 2EDFA 4RWHA 1KUMA 1XGUB 5HYJD 4JG1H 5HGGS 2V2WB 1UXSB 1QYGH 1DE4B 1VFAA 1T1WA 4XNXH 1JVKA 5BS0E 5FO7A 5IB1B 2GHWB 5MEOB 3RWHB 3B5TA 4PLJD 5MP6L 2NY7L 4RISL 2RHEA 5LGKA 1Y0LB 3FT2A 5FA4A 1GGIL 2NY0D 4KFZC 1DLHA 4PS4H 2H32H 3RDTB 1L7TL 4XXCA 3BH9B 4L4VB 4DUWA 3RUGE 2H8PA 5J7CC 4YDIH 2XG5A 1J1XL 4RFOH 2AEIT 1HHJB 3VXMB 4JGMA 4OFDA 2F9BT 5DUPL 3SO5A 4Z95L 3QPXH 4PGCA 5GS2D 3VXSD 4HPYH 4AEHH 2M2DA 2D7OA 4AK1A 2YWYA 4BZ2L 2FL5A 5IBUG 2PW1A 5EUOF 1PZUB 2G9HB 1VHPA 5CINH 3CUPB 1MCOL 5J6HB 4CW1B 4HIXH 5KVEL 1WBZB 3KJ4C 1AC0A 2BP3A 1L0YA 2VN4A 3QFDB 3F7YA 3VG9C 4DFIA 3BP5A 4S1DD 4NRXA 3FO0H 2DQUL 4LHQB 1NC2A 4YBLB 5C7XL 4BUHA 4XT1C 4XTRC 5F7LB 4S0SD 2VZOA 3OG4B 2BVTA 5DEFA 1YPZF 5ICXB 5IR1B 3VWJA 2LAGB 4HUVB 1FAIL 2FJFA 3Q1SL 2YZ8A 1BFOB 2GUOA 2IPKB 2FJHA 2HJFB 1ZHBA 4OGXL 2XN9D 3UTPE 1QZ1A 2E9BA 5BS0A 3ARBD 4NZDA 1N64L 5KTEH 4JQXA 1LQSR 4X6DF 4DKAA 2XTJC 5C86A 3KHOA 1DVFD 1UC6A 2DQEH 4U6VL 3GHBH 5IMKA 5MERB 5IROC 1WTLA 3D6GA 3I3DA 5L8KB 2WIMA 3QQ3A 3H42L 1YQVL 4LKXA 4KWUA 1IM9D 1LE5B 3HNTL 1IAMA 4PTTB 1G7QB 5KN5A 2IFFH 3PUCA 2QSCL 1L7IH 1WT5C 4LGPB 2MQ0A 5HHOD 1A6UL 3VFWB 1A7QL 3S37L 4PP1C 5D7JD 3QEQB 1P84K 5E6YA 1BQHB 4M5YH 4Z76B 5J12B 1PKOA 3BKYH 3ARDA 1ZAGA 2BOCB 1JE6A 4G43B 3O9WA 5GRUH 4K94L 4HZLA 1IKFL 1D6VL 3ULUE 2AVGA 1ZK9A 2EDXA 5T1KD 4H20H 3O6LL 5JQHC 4ONHA 5CAYB 2WP3O 4XPAL 3MCKB 4YAQB 1GGCL 2ZOLB 2DQJH 3HG1B 2PUQT 4BUGA 1MLBB 3VFNA 3H9ZA 4QTIL 4JREC 3GJFA 2LTQB 5E6ZA 3TBVA 4MA8H 2O5YL 4AIOA 5L6YH 3MOAH 3QDMA 4OKDA 3BMVA 5HI3D 4S1QL 4BSVA 3KPQB 4DZBA 1DDHB 1MI5B 3HC4H 4X6CE 1JV5A 3IFNH 3BEWA 4TTGA 3VDAA 4OZHE 3RL1A 3ARQA 3BD3A 1U41A 3BDYL 2Y9RT 1OAZH 1U42A 3P0GB 5A2FA 3NA9L 3QIUC 3QJFA 4KZDL 2ATPB 4PRAA 2E6JA 3SE9L 5SWQB 3HNVL 3D69B 3UZEA 3X12B 4JFOB 2F5BH 5CSBA 1QSEE 2V9RA 3IDIA 2XZAL 3K7UA 2JTDA 1QR1A 4W70A 3CFIC 1GIGL 2LU7A 3T0XA 5TE7L 1HKLL 1RK0B 5D93C 4X4XB 4E42A 1F8TH 3I75A 1JWUB 3HI6L 5JR1H 1MPAL 4L4TB 2OTUA 4TQEL 4V1DB 1U6AL 5GGSY 3O6KL 4IM8A 5BJTA 1BQSA 2W0FB 4FQ2L 4RA3A 3WFHB 3KPNB 4OGYH 4RAUA 4MDJA 3MGOA 3TT1L 1VSCA 1RZJH 1YPZB 3I02B 5E94A 2NW3A 3P3YA 1R3JA 3QUYB 1TITA 3P73A 4KKNA 3LS4H 1MFAH 4JZOB 3KYNA 4M00A 3U4BL 5ITFA 2VNCA 1BECA 4QCIB 1FFRA 5D7IE 1IEBA 4YDVA 4UIKH 4EDXA 2VXSH 5DJXA 4X6DB 2X7LB 1E6OL 3GIVB 5GISL 3MV8D 4LIQH 2X9YA 1J8HA 2XWJA 3EDDA 1RIUH 4C59B 4QNPE 5FGBA 4IIQC 4ZOCA 3QIBA 5DGQA 1CXFA 3RZCA 4NM4L 1KIRB 1JNJA 1VKXA 3L3DA 2NYYD 4X6CA 2FR4B 3PNWA 5D7KD 5E2WH 3ZYJA 3X14A 1I9IL 1AIFA 1FZKB 5DJAB 2HFGH 2VDPH 4R4FL 3W39A 2D31A 4R8WH 2EIEA 4L8BB 4L8CA 1WZKA 5C2BL 3ARFD 1UH4A 5IJVA 1NFIA 4HJGB 2B4CC 3BVNA 5HGDA 3QWOA 4HIJB 3PQYE 4LLYA 4PJXF 3DROA 4XMKL 3QXDB 3DARA 2FIKB 3S88L 1BBDH 2ARJQ 1A6WL 5IF0B 1FL5B 4ENEC 3N9GL 3OX8B 5E6IC 1Q9KB 1Q0YH 3EFFB 4ELMF 2LABA 3IRZA 4KMTL 3MUHL 5SV4A 5A40E 1UZ6E 3WYRA 1CICD 3BN9D 3SBWC 3DMMD 1AKJD 3P4OB 3VXRD 3ARSA 1AY1L 1HINL 2A77H 2LU4A 4MWFB 5CBAB 2ZCLL 3K1KC 3RI5F 5IHUH 1QLRB 2FEDD 1IZJA 3ZKQD 2PCPA 2EZ0D 1CGXA 3FO9A 4LAQH 4FZEH 5EIVA 2W9LA 1L9NA 1AFVH 3CFEB 4MAUL 4YFDB 3C60D 4ALAL 5HBBA 1EBPA 4JPWL 4MQTB 3H0TA 3RGHA 4D0DA 3WXVH 4NWUL 5EBGA 1MIEH 4MD5A 4Z7WF 2O61B 4XI5C 3EYQC 3MROA 4GBXB 5I8KL 3S96A 1YJDL 1M7XA 2ARJA 3DV4B 3ZE0E 4FTVB 3B9VA 3BXNA 1AGDA 4K7PX 4G8FA 1N2RB 4JJ5B 5FECB 1XR8B 2NY4C 5DRXA 1BVKA 4LSQH 2D4FA 1RIHL 4FQLL 2YC1A 3GKZA 3FN9A 3NCJL 4FQIH 1YYML 3RIAF 5T33H 5EZIL 1ZS8A 3JV6B 1NDMB 4CU8A 3Q2CA 3QAZB 1ONQA 5ERWB 4KGLA 2WMPA 5EA0H 3SDYH 1U93A 3PQYA 1CG9A 1ES0B 1I9EA 4HIIA 2YUWA 5IB4A 3S35L 3OJMB 1TZGL 1DBBL 4WIQA 2F8VA 3G6JF 2YBRB 1W8OA 2HLAB 3FHQA 4YUEL 5JOPE 4NBYB 4LLQA 3PL6D 2MPAH 3CXDL 4UU9B 3UTSE 1ED3A 3WFCL 1XH3B 4KZEH 4Q0XH 4POZD 2BNRA 2XFXB 5HPMA 5E00B 3U7YH 4YIQA 3GSWB 1CQYA 1IGJB 4NYLA 3AM8C 3D0LA 5D1ZD 4OCSL 1T6WA 3P40A 1F6AB 1ZA6A 2NY1C 3RZWA 1UB5B 1NC4A 5MENE 4NQEA 1OT1A 5DRZA 2A9NL 3ARPA 2VZTA 3GSXA 1GHFL 4QY8B 5J0BA 4ODTH 4QHLB 3MR9A 3LDBC 4ZXBC 4W6YB 3TNMA 1SEBA 1M71B 5J06A 3BIAX 1Y6KR 5BV7C 3LKOB 4XNQB 4NWTH 1IGIH 3SDCC 1AQKL 3I3BA 4LHUD 5I8EB 4MB4A 3GBLA 4P9HL 1SJEA 5DD1H 4APQA 3LKQB 3V6FB 5IB2B 5HHPA 2YUVA 3VXQB 5KVFH 1JBJA 4D0BB 4MDIB 2YKLH 5GGTA 3C5ZA 2GIYA 4C83A 5MEPA 1IVLA 1UJTA 2R0LL 4ELMB 3RWCA 5TF0A 2IG2H 5HDLA 4ZFZB 3H9SD 3D39D 1QSFB 1VFOA 2A6KA 2AJVH 1BJ8A 1S7SA 4WDIA 2ERJB 3MLXH 2DTMH 3QIWC 4Z7UF 4PLJC 1A7NH 1G9NL 2F15A 4Z0XB 3OTTA 4OZIA 4XVSL 3BZ4B 3CDGA 4Z7VF 5B39A 3FFCB 2X4RB 2GJJA 2NY0C 3I6LE 3QZWA 3UTSA 2B4CH 4E41D 3OWEA 3DWTA 5GGSB 3FAXA 4JDTH 2VLRD 2XRAL 3NH7L 4QWWD 3P9WB 4ZFGL 1Q9LB 3BEVA 3KPRA 4WWKD 3ZHDA 3FQUA 2SEBA 4GLRI 5HYQA 1S7XB 3ZMRA 5D7LD 5JDJA 1S78C 1AH1A 1DUZA 3D2UA 4WRLA 25C8H 3RWGA 1JWMA 1SBBA 1XIWA 4LOUD 5F8QC 1K8DA 4BELD 2ICWB 4R4BA 1J1OH 5AG9A 3KYMA 3UYRL 3T4YA 5IQ9A 3SDXF 3DO7A 3W81A 4UDTB 1CZ8L 1XGQA 2ZUXA 4RMSA 1TFHA 1WITA 1CQKA 4XPFH 4S1DC 5JW3L 4Q9QH 1CXEA 3INUH 3O4OB 5F9OH 5HHVL 2LVEA 2CH8A 2NY5L 4NO0D 4BQCA 5ABDE 2XN9E 4KUZH 3VRLE 3WN5C 2YMXH 3TYFB 3MXWH 4MS8D 5E4EC 2Z0BA 4LCCB 4NN5C 5CCKH 3TH4T 3RJDA 1DQML 3F7QA 3SDDB 1P69B 5I66A 3AS2A 5HY9B 2HJKB 4V2CB 1I1AB 3QISA 4NFDA 2C26A 2IGFH 1DVFC 2OK0L 5EOQH 4KJYA 2VZ1A 3GMPB 2EO1A 1D5BB 2BDNL 4PJ5A 5F1NA 2A74B 3TH2T 2G5BA 2OL3A 3D9AH 2JIXA 5DUBA 2BCKA 5KVGH 3F12A 3L5HA 1FVEB 2IAMD 5BZWB 4OLYL 4RX4D 5DHYB 4DEPB 3CLEL 1QRND 4MA7H 2JCCB 5DQJA 1AGCA 4Y4HA 1NMCC 1JK8A 1RURH 4LHUG 5DVMA 3ZLQC 4QXTB 1TJHL 2V9QA 4DKFL 2DQIH 4HUKB 1H3VA 4LGRB 4YE4L 5D7JC 4IRSB 3B43A 3O4LA 3R1GH 4HF5H 4JZNB 2XWBB 1MQKL 1EAJA 3RKPA 1S7QB 3AAZA 5E9DD 1UM5L 1JNHB 1YC7A 3U82B 3EJYD 5GSVB 3FOMB 5E8PA 3QUMH 2FRGP 4GUPB 3QDGD 1UVQB 5ID0A 3RTQA 2AEPH 3BGAA 1RZ7L 5ACMA 3WS3B 3BP6A 5BV7H 4LU5L 4Z7UB 4XCCH 1OAYL 1R0AH 4ZO8A 1S7WA 3LHPH 4I0PB 4OD2A 3QHTC 2AK4D 2KKQA 2FO4A 4Z7VB 2Q7YB 2YPLD 3QI9B 4QRQB 2Y4SA 4HKXB 1IAIL 1VESA 2Z91A 2BXZA 3H7LA 4KDWA 5I76B 1KB5A 2C1OB 2DWDA 4BSWB 3CFCL 5HI3C 1U8IA 2XYCA 3ULVE 2C4XA 3FB8B 1DN0B 3C6LC 2ZP0T 2XY2A 1MJUH 3MRMA 2CLVA 4UT6H 3V5DA 1UM6L 3AU1B 3HE6B 3NIGF 1ZT1A 4PV8A 5CGMA 3MFGB 2DQHH 2E5EA 3C6SB 2A9MH 4EVNB 3VE0A 2NY2B 4XNZC 4DUXA 2E9JA 4XP6L 2OJEB 5IMMA 4OSUL 3MQIA 3B2UD 2O5XL 2F8OA 1YYLH 4P2QE 1T6VN 4PRNA 3EHBD 3S7GA 5IIEB 3AMKA 1LO4H 1BM3H 3LKSA 3GGWB 5GRVK 1OWWA 3L3IA 4GRWH 2WWKO 4EBQL 2YWZA 4BZYA 1MJ8H 5B38A 4GAJL 3WUZA 3NIDF 4N8VG 5F9JB 4R7DB 4WO4A 2E7BA 3UP1A 4YHKH 3VI3F 1LO2L 3VH8A 2VABB 5GS2H 2R1XB 1P9MA 4JGUA 1YEKL 2VXQH 4I5BB 5ENWA 1T03L 3HKFA 2OMBA 4NCC2 5DD5H 1XR9B 4N1HB 1AO7B 3REWA 4Y2DB 1G7JB 1OCWH 1VDGA 1FVCA 3C08H 4HT1L 2D3VA 5IB5B 5LWYH 3LIZL 3G6DL 3WHXA 5EO9A 2D03H 1FRGH 4J8RA 2QEJA 4TPRL 4AM0B 4I1NB 5GGVY 4PJGF 1NAMA 4JO3H 4QHUB 3V79C 1RUAL 1OSZA 2WIIA 3RWDB 3JVGC 4XXDB 1BZ9B 3G5VA 1LDSA 3PXJA 2P8PA 2NYYC 4WI2A 1JNNH 2DBJA 4OZFG 5DR5L 4NUGL 4DN3L 3U9UB 3JTTB 1RD6A 3OZ9H 3ARFC 2J8UE 3BAEH 3PHOA 4PJ8D 4Y4KB 4Z9KB 1NCDL 3C5SB 3BRDA 1QSVA 1NCWH 4JFXA 4GKZA 2J1KA 1LHZA 1E4WH 3WFDL 1FG2B 4K23L 4QEGA 4JQIH 2YD2A 5CD3A 3EUUA 4NNXB 5DD6A 1U8OB 3MUGB 4V2BA 1EBAA 4S10A 3MV01 1A7RL 4BFIA 3U46B 1CICC 3IGAA 3A6CH 3JWNC 1CFNB 4KUCF 5ESVA 3DMMC 5E8EB 4CKVX 4G8GA 1YECL 2BSRB 3QRGH 2NY6B 4KRPD 3ZT6A 2FEDC 1NCBH 1F02I 4JFEB 4TULH 1RJYA 4NC2B 3L7EA 5SX5K 3B6SB 4JM2D 4RMTA 2I07B 2H9GB 4G6KL 3O6MH 5IJKC 1T89A 1H15B 5DWUL 3PWPD 3VFGH 2OR9H 2Z31A 4GXVL 3NBNA 1C5DA 4LNRA 4H88L 2ZCKH 2BY2A 1T4KB 1RUPL 3BX7C 2IANE 1UGNA 4U6YB 4G6FD 5DRWB 2CLRA 2AK1L 1S7TA 2X2YA 4OQ1A 3WD5L 3WO4C 2J6EL 2F53B 2ZUYA 5EUKB 4HLZG 1A0QH 3BIBX 1IQWL 4U3XA 1CU4H 4X7SH 3PGFH 4XC1L 5F8RC 4FFZL 5HYEA 3CFBB 2VDRH 3HZVA 5CEZD 4WNQA 4XRCB 1XCQA 3ARED 3OGCB 4HS6A 2VUOA 4NHUB 4M6MH 3ULSB 2P44B 2VLKB 5J1SC 4OFPA 1H0DA 1FL6B 5IGXH 1HIMH 5T1LD 2DD8H 1HH9A 3FQNA 4J3TA 2VDOL 3R0NA 1ADQL 2OTWA 2QJDA 4P2RD 4TNWF 3SKMB 2YN5A 5EB9A 3E6HB 1NFDE 2W9DL 4F9LC 5A43C 3WJLA 2UY6A 4XPGL 4U3HA 1Q0XH 2C3VA 2IJ0C 4FA8A 4MLSA 1JPSL 2Z92B 4RIRA 1P1ZB 4AQOA 1BGXL 4ZUTB 4XPBH 1B0WA 3MUZ1 4Y1AB 5KSAA 1MREH 2FECI 4AL8L 2GT9A 4M1GH 5D1ZC 3ZYZA 1QPXA 1FNGA 1X5KA 3RX8A 1LILA 4KXZH 3NZHL 1G7HB 3JV5A 4WJ5A 1VEOA 2CDFA 4NM8L 2VJXA 4PJGB 3D18A 3TA3B 3U9PL 3TYGL 1KT2B 4GW1B 2CR6A 4E5XB 4HV8A 1T5WB 1PW3A 2CKBB 1A4JA 4R6UA 4RISH 4BK5A 3EZJB 1JZ5A 4LEXL 4U1JB 3MLPA 3T65B 1WSST 4I18C 1RULH 2EC9T 1ZEAL 3B3IA 4OQTL 1I7TA 2X70A 4Z7QF 5CWSB 1HI6A 2IBGA 4M8QA 5D5MF 4HQQL 1QBLL 1YZZA 2UWEE 1PD6A 3CH1B 4M3JA 1MCNA 1GJIA 5EN2A 1EJOL 3VMOA 4OJFL 1RHHA 4NKDB 1KF9B 2CK0H 1T1XB 1KIPB 4JFHE 5KAQG 5DUPH 4D8PB 4GJTB 4P5TD 1T2XA 4A6YB 3U6RA 2ZCHL 3T0ED 5CIPH 4PBVC 1W72H 4KI5F 5IW1A 3TNNA 5IV2A 1I8KA 1VEMA 2NX5D 4PP2A 4JRYB 4NKOB 3BIKA 1AXTL 1KN4H 5DVNA 1NFDA 3NCYS 3U79A 4JHZA 4QWWC 2X4NB 2DQUH 4K3EL 1A9BB 1RZKL 4WWKC 4C56A 5KZCB 4IEFB 2WLZA 4K9EL 4F7TB 2V2TB 1OTTD 4OLZL 3V8OA 4OTXL 4LRIA 2R0KL 5F88B 4CRPA 4GKNA 4HFUL 4F57L 1JUFA 5IMOB 2F54A 2OJZL 1DL7H 2E7MA 1AP2B 3BGMB 1MCEA 4NO2A 1OGAB 3MJ9A 4U0RC 4LOUC 4OGXH 1YEJH 3O3BA 2BSSA 2BSTB 2ORBH 4HX1A 2A6IA 3RWFA 1QLFA 2P7TB 1X5GA 2G5RA 2AJZB 2X42A 3FB5A 2Z93A 2YD4A 1Y18A 1R3IL 4P2OA 5HVFB 3WDJA 4JHWH 1FL3A 1VENA 3U36B 4X5WA 1FZMB 2IQ9L 2Y36L 3CGTA 4E9LA 2UWEA 3H42H 4P49A 5KVDL 3WO3B 2P48B 2VQUA 3HZMB 3MNWB 4U1NB 3T4AA 1R5WB 4PB0L 4ONFL 1JI2A 4WI6A 4J12A 5IFJB 4G9FD 1INQA 3MRJB 4HS3B 3SGEI 4LARL 1G6RB 4MS8C 3OKOA 4R3SB 3LN5B 3FO1A 2H32A 2QSCH 3F8UB 3RDTD 2X4SB 1QTYT 3DSFL 5HDQL 1NBZB 4Q97A 5BVPL 4L4VD 1A7QH 1E4JA 3X11B 3HMXA 3S37H 5EIIA 3B9AA 1GOFA 1ZT7A 3SCMA 5I1JL 1T5XB 5IFHH 1J88A 4NGHL 1GCFA 4UBDD 4P9ML 4WHTB 5FGRA 1QRNE 2QQLL 1ZHNA 4MJ2A 3VRJA 4HH9B 4K94H 3P4LA 1IKFH 1P6FA 4BJLA 3BO8B 4ESKA 1G9ML 1IC4L 2NQCA 1X4XA 3IJSB 3HAEH 3OKDA 5HHQB 2IAMC 2YD9A 1GGCH 4L3CA 2X4PA 3EOTL 1K85A 2E6QA 2ADIA 3P30H 3RVWD 3BKCH 4QTIH 5I15L 3TJEL 4ZTPH 2AJ3A 3W2DL 4LBEA 2XA8L 2RBLA 2BJMH 1IC5L 4NQCB 5EOCL 3KVQA 3EDJA 4G3YL 2VZSA 1F45A 4FZ8H 3EBAA 5KANG 4DGIL 4KTEL 3RNQB 1KB9K 1LK3H 5F96H 3OR6B 2GY7B 5LGHL 4PUBH 2UVFA 4PG2A 4YXHH 1UQSA 1ZT4A 3LV3B 3D3VD 4JN2B 2R2EB 5DMGD 3SGDI 2FX7H 2C1PA 3F7VB 3SE9H 3P4NA 3HLAB 3EJYC 4EUPG 3QXAB 3DRQB 5DK0A 3GSQB 3MBEB 4NRZA 3V95A 1BIHA 1HWGB 1DQDH 3JZ7A 5FCUH 4LSUH 5KSUB 2XKUA 4ZAKA 1GIGH 1OAQL 3AY4C 5C0BB 3UO1H 4ACPA 5I73B 4EZMA 4ZPVA 2WWMD 1HKFA 2W60A 4TQEH 1U6AH 2A1WL 4MD0A 3O6KH 4OM1L 3G5YB 4KKCC 5DFVD 1K3ZA 2R1YA 1CDHA 3U2SA 3O2DH 4K55A 1S7VA 1QFWI 4LEOA 3TBTA 1X5ZA 1CFQA 3U4BH 2FATL 5IMLA 3W82A 4HBCL 5DS8B 1XF3A 3B2UC 3PGCB 4P9HC 3SKJL 2JJWA 4ODHL 3QO1B 3S3SA 2MKLC 2GJ6B 4MJIB 1S5IL 1OSPH 3ILPB 3QNYB 4Y19B 4XH2B 2R29L 1KPVA 3ALWA 2V6HA 4YFLI 5HI4C 1GSMA 5DQDL 1IKNC 1M7DB 2VERN 2W91A 3FOLA 4KHXL 3S4SG 3BZDA 3GRWL 4GG6B 4U1MA 1I9IH 5L2JB 4WY7L 2NW2B 1VGEH 4S1RL 4WI9A 4UNVA 5GRXG 2XXMB 2IALA 2Q7NA 1FE8L 1U8JA 3Q0HA 5FKPB 4XMKH 1F90L 2FLRT 3GSUB 1A6WH 2A6DB 4WV1C 4ZUVB 2IQAB 3BW9B 2A6JA 3UTTB 4KMTH 4NQDA 2VAAA 15C8H 4O9HL 4HKBA 3OG6B 3QXWA 1CLOH 2PTUA 1HNFA 4N0RA 4NJ9L 1M6OA 1NAKL 1KC5L 2D7TH 3Q48A 3MJ7A 4TVSa 1N5YL 4RSVA 5ACZB 1KLGA 4HKZA 1UG9A 2QQKL 2R1WA 2AV7B 2FSEB 2ZCLH 3MLUH 3STLA 5HVHC 3ECBB 5I1CH 3MRBB 4CDHA 5EU4B 1MHHB 3PDOB 5L88H 1J0IA 2BC4A 1BJ1H 1FPTL 2AV1A 4PJ8C 3D5OF 3AB0B 4JQVA 1JHKL 2O5ZH 3V5KA 1L9MA 4JPWH 4WW2C 2A0LD 1BD2A 5F7KC 2YZ1A 4NWUH 1LGVA 5E8DH 2VL5A 2UYLA 1MFEL 5D1XB 5EWIL 5I8CB 1OD9A 2FJGB 1U95B 3R06B 2X89D 5D6DA 4P4KD 4XX1G 4LSTL 3BGFB 4M5ZH 1LP9A 1FCCA 2Q76B 5EG6C 3MNZB 5IBTL 3L1OL 2XICA 4RAHA 1XFPA 4Z77A 4OZFH 4FQLH 1OB1B 5IVXA 4IRJD 1SMAA 4X4ZA 1IGFL 3IDJB 3JSSA 3NCJH 1HQRB 2JJSC 4KDTC 4X6BA 1U8NA 5FDYA 3BZEA 1EO8L 1JGDA 5AYQA 4JM2C 4FQCL 4WI4A 5K9KB 1AI1L 1CL7I 4PJ7E 4XP9L 1HILA 4JPVL 3W0WA 3T0AA 1AGEB 1C12B 3S35H 5H35A 1WFNA 3QHFH 1DBJL 1TZGH 3MREA 4HK0B 1CXIA 1EGJH 5T3XL 1BREA 1NGXB 2GITB 4IS6B 5FF6A 4OIAA 1G7MA 1B6DA 4M7KH 3CXDH 2Q3AA 2Q87A 3P9MB 2Z9TA 1HSBA 5FO8A 2EC8A 5HYSG 4Y4FD 3GMNA 3IDYC 5TQ0H 1H8NA 4CMHB 3SDAD 2D9QB 1JTOA 2FEEL 4P2RE 5C0EB 1D5MB 4M6NL 5EBMB 3AREC 3C9NA 4NO3A 1BQHG 1PG7L 3SY0A 2WANA 3D0VB 1TQCB 4YHIA 1GHFH 5ESQA 2A2QT 4M4PA 1DCLA 3MRIA 2R2BA 2X4UA 1KN2H 5CZVH 4X4ME 5JMRA 4F37F 4WUUD 3MTRA 1D5ZB 1U3JA 2V17L 3BZFA 3GBNH 3MUY1 5EOTB 1JGUH 5FO7B 3HC3L 4YFEA 2X6MA 4G7VL 4EOWH 2GK0A 1AQKH 4HLZH 1K5NA 2OSLB 3FT2B 4X7EC 4P9HH 1DLHB 3TCXA 3BI9X 2YD3A 1FAKT 3TWCH 4Q9CA 1YUHA 4LGSB 3KXFD 2NLJA 3PDDA 3GIZL 1FGNL 5D2NE 1V05A 3VWKD 2IH1A 4KY1H 1V7NH 2VN7A 2FB4L 4UNTA 4P57A 5JW4R 2MHAA 2VLJB 1OM3L 2GCYB 3OAZH 4QF1A 5HJ3A 2Z8SA 5FM8A 1RQ5A 4PJEE 4JFDA 1P7HL 1CD1A 1BMGA 5ECJE 2DQDL 4J23A 3P9LA 1KTLA 2IADA 1J9CT 2FL5B 4C54A 1BPVA 5SWZB 3TP4A 1IE5A 1KPRA 2XRAH 3EO0B 3RY4A 1ORSB 5BRZB 1DUYA 1GYAA 3CC5A 3F7YB 3BP5B 1RU9H 2JK5A 3MNVA 1QPPA 5F6IC 5H2BA 2ITCA 2G60H 5MEQA 4OIIL 3QIUA 2APXA 4HGKC 1WBXA 4P5TC 1XMWA 3OL2A 2GTWA 5A2JH 4EJ1C 3VWJB 2ZUQC 3MV9B 3BRGC 3T0EC 4X4MA 2GUOB 3E2HB 3DUUA 4KROD 2YRZA 3O8XC 5IEHB 1UB6A 3UYRH 2FJHB 1ZHBB 3BP7B 4NQSB 4JKWA 3T3PF 1TCRB 1I7ZA 3IF1B 3S5LG 3BDXA 3QB7C 3BKJH 2Y06L 5HHVH 3NCCB 3TIDA 4G8EA 3P4MA 1H3PH 4G80A 4FQHA 4OF3A 4UQ3A 1JGEB 4XVUC 3QQ3B 3DUSA 4X6CF 1YEGL 4LKXB 2R0ZL 1GZQA 2JB5H 1DQMH 5I2IA 1J0HA 3VFUA 2AGJL 3TVMB 5C6PB 3NABL 1B0RA 5HPOA 4GAFB 4L5FL 2WINA 3TESA 4D9QD 1Q9OA 1X5XA 1MWAL 3QCTL 1CD8A 4GRLB 4DW2L 3C2SA 5EZJB 1VACA 5D6CA 3KR3H 5D2LB 4Q9QL 2BDNH 4IJ3B 3WSQL 2CGRH 3EYFA 4PJ9D 4LQ1A 1TPXC 3ARDB 1QSFD 1ORQA 1XT5A 3UROR 3O9WB 5I1EH 1FDLL 12E8H 1X7QB 4HC1L 4HZLB 1L0XA 4L4VE 4RQQA 1YNKH 1ZSDA 4OLYH 1TQBC 1WZMA 4XMLL 5DJCB 2DLFL 3FFCD 1FQ9C 1WISA 2HKFH 1IQDA 4ONHB 5JHDD 3VXME 4LKCA 1TJHH 1HXYA 3IJYA 1U8PB 4DKFH 2EDQA 2NNAB 2NZ9D 2EKJA 5CSZB 4AY0A 4U6HB 5CEZH 3GJFB 2YRPA 5E6IA 4N9GA 2QHRH 1E4XI 1WICA 4QYOA 4YFLF 1XZ0A 1X5JA 3QDMB 5T3XD 3IAGC 4UBDC 4EXPX 4DZBB 1KGCE 4CBPA 1MQKH 2L4OA 1JV5B 1G7LA 4PB9L 1QFUH 3BEWB 5D72H 5L7XL 1CR9L 3BPOB 4GKSA 4QNPF 3HS0B 5CP3H 5EBWB 5J11B 1I3GL 5KG9B 4MX7B 4X99A 3QJFB 3DRTA 4PRAB 1RZFH 4LU5H 1GVIA 1OAYH 2P8LA 4H26A 2XPGA 4PR5B 3RVWC 2YD1A 5I1LA 1FNEA 3HC0A 5C0GB 1UM4H 1QR1B 4XX1E 1XGUA 2ENYA 3CFCH 1UXSA 2Z8VC 2COQA 4OCRH 1HZHL 3EGSA 3S37X 1A5FL 1ZVHA 3I75B 2OTUB 5MEOA 3RWHA 1N3NA 5K59E 3VXUA 5BJTB 4J3XA 5CHNA 2X10A 3RIFF 1Y0LA 4UI2A 4XP6H 4RAUB 4MDJB 5DMGC 1UZ6F 4PREB 2NW3B 4OSUH 3MCLL 3QP3A 4J2XA 1R3JB 2O5XH 2EC9U 1T7ZA 3KYNB 1C7SA 3UCRA 3LZFL 4LLDA 1IEBB 4YDVB 3L3GA 3VXMA 3ZL4H 3LEXA 3SE3A 1TJGL 3LSOB 5DA0B 1J8HB 4RAVA 2MNUA 4U6XA 3H3PH 4JFFD 4Q6IC 5DFVC 3QIBB 2Q3ZA 3RZCB 5DUML 5C0IB 3IAPA 1VKXB 3L3DB 2ARWA 4X6CB 1EHAA 1BX2A 1UENA 3CUPA 3PNWB 4M93B 5J6HA 3QEQE 4Z0BL 3D48R 3X14B 4CW1A 2BMKA 1AIFB 1EVUA 4EUPH 3UPAA 4MZ3A 4DVBB 4HT1H 4L8CB 3WIHL 1BEYL 5DQ9A 2YPVL 3F7RA 3G6DH 3QWOB 1B2WL 3B2VL 3MGTB 4OI9A 4LLYB 1MCBA 1WV7T 4DQOL 2BNQA 1GXEA 5FHBL 1JL8A 1I8IA 1RUAH 5E1HB 1X5YA 3DVGB 3Q5TA 2V7NA 4HUVA 4U1GC 5EU6A 3HG1E 2MMXA 2R69H 1BFOA 4JR9L 2G75A 1Z6JT 2IPKA 3BD5A 4HBQA 4PRPD 3L5IA 4ZXBA 1YA5A 4JFYB 3RP1A 1N8ZB 3QUMA 3VJ6B 5IW6B 5E2TH 3TGXA 1YN6B 1RSFA 1JPGA 3JWDL 2NXZD 1MI5E 4Z18A 2R4RL 1Q72L 5D8JL 4M6OL 3QEGL 3RKDD 2QADB 1NCDH 1MCDA 3N0PB 3QI9D 5JXAL 4JO1H 1N6QH 3MA7B 2PCPB 4N90D 3FO9B 3ARGD 3CSGA 2MCPL 1RZKC 3WFDH 1F4WH 1FLRL 5DJ0B 4K23H 1LE5A 1E0OB 3HE7D 1AD0A 1IL1A 5JIHA 1QRKA 2AQ3A 4AEIH 4W68A 5J6GB 4TUKL 4MD5B 4PY7A 3MROB 3QDJB 4Y2OA 3S96B 3E6FB 3RVUD 4KQ3L 4XMPH 3OJ2C 2RFXB 2VB5A 3QIWA 4ZO6A 3WJJC 1Q94B 3BXNB 2CKBL 5I6XC 4G8FB 3UXFA 4L4TE 1MRCL 4O4YL 4KVNL 3VFWA 1BVKB 4V1DE 4NPYB 1DBML 2YC1B 3RL2A 4Y16B 4B50A 1LO0L 1J86A 2HT4D 5HHXL 4G6KH 4CNIB 1EFXD 1YPZE 2A73B 3VFRB 4F7CB 2BOCA 4HCRA 2B1AH 1DBAL 2GEEA 5DWUH 2R0WH 1KCLA 5C0CB 1IMHC 2QSVA 1I8MB 2F74B 4YGAB 3GMRA 4HIIB 1NCTA 1JZ6A 4HUXB 1GL4B 1CGTA 3E0GA 4P4KC 2UZXB 3MCKA 4X6DE 5GGQL 4YAQA 5SX4H 1U3ZA 2ZOLA 5EU7C 4A6YL 4LLQB 4M48L 1AO7D 1RVFH 3EOYG 4IRJC 1ED3B 3REVA 3DX6A 4XC1H 3TT3L 3ZKND 1I1YB 4FFZH 5DMKB 3LQAL 2BNRB 1U58B 4ODXA 3ESVF 5HPMB 1RJLB 1KOAA 3KPQA 1MI5A 1KTDA 5J57B 4HS8L 2FGZA 4NYLB 4OF6A 3IFLL 4LQFL 1ZA6B 1T2JA 5CGYD 5FA3B 4NQEB 1U8LB 5DRZB 2ATPA 3GK8L 3CK0H 3ELAT 3GSXB 4P46B 2QLVB 2HLFC 1ZLVH 3WN5A 1QBML 3QXTA 4NKQB 1W8NA 3D69A 4JFOA 2W9DH 1F4YL 4M62L 4XPGH 3FMGL 2XACC 2WBJB 1OP3K 2HTKD 5ELIA 1JPSH 3LQMA 5ISZD 3S97C 4Y4FC 3SDAC 5ADOH 1CFVH 4AL8H 1JWUA 5CLTA 2MFNA 3OQ3B 4L4TA 3O3DB 1DVFA 2D9CA 4U7SA 1SJEB 4K3JL 3NZHH 1F3RB 1GH7A 4APQB 3D85D 4PGZA 2W0FA 3TBYA 3EJJX 1WTGT 1IM9A 3I02A 1CIUA 4LL9A 1KYOJ 3C5ZB 4C83B 3QUYA 5MEPB 3TYGH 3LEVH 1QO3A 3S35X 3RWCB 4MAYB 4WI3A 4QCIA 1G6RL 1MIML 4R0LC 1A3RL 1S7SB 4WDIB 3MXVL 1MCPL 3S34H 4XB7A 4JFED 2HKHH 3VRLF 1T66C 1ZEAH 2X7LA 5D70L 3GIVA 3MGAA 3TCLB 3VDBA 4OZIB 1QKZH 2E7HA 2P43B 5C07D 1QBLH 5LQBL 1PEZA 3PP4L 1X5HA 5B39B 1MRDL 2X4QB 1EJOH 4QOKA 4FTVE 5D7JA 4Z7NE 4U1HA 5GHWH 1LK2A 3OF6A 3BEVB 2FR4A 3KPRB 3VWKC 2BRRH 5HYQB 2SEBB 4ZNCD 3WIIL 4YDKL 1FZKA 3GNML 3D2UB 1R3HB 4L8BA 3RWGB 1JWMB 1QFPA 4HJGA 1M05A 3LPFA 3NN8B 2VR5A 3H2WA 3QXDA 1AXTH 4NC1C 1K8DB 2FIKA 1PLGH 2R4SL 4M43H 3CDFA 3KYMB 3MBXH 1JFQH 1Q9KA 3T4YB 1RAMA 4YPGA 2Y72A 3EFFA 2MKWA 3KLSA 3DO7B 4KTDH 5FOBB 1RZKH 3ARTA 2H3NB 1ZLUH 1XGQB 3C6LA 4D3CH 3L6FB 4K9EH 4C58B 4PRHB 3P4OA 5LCVH 3OKMB 3RY6A 4HFUH 4F57H 4IDJH 4MWFA 3DXAD 1AD9A 3WFEL 5CBAA 2OJZH 1QLRA 2P5WB 3X3GL 3B8SA 1IEHA 1M7IB 3KS0H 5I74C 3MRQA 4PJBA 1FO0B 4KROC 2R39A 2XG4A 4M9PA 3T3ME 2VITB 1I3RA 4I48B 1KJVB 3KPSA 4YK4B 3WS6C 1OTSD 4GBXA 2IQ9H 2Y36H 1FGVL 4J4PD 8FABB 3ARWA 4RBPH 4FQXD 4YDJA 3TO4B 4FTVA 5KVDH 5DT1L 1AJ7L 4I9WD 1KJ2B 2DB8A 4ONFH 3TA3D 4PJ5B 1N2RA 5AZEH 5HSFA 4JCMA 3ULVF 1MHCA 4JPKH 4PV9A 2JIXB 4LARH 5DUBB 2LV4A 1MUJB 5IG7A 1S3KH 2BCKB 4K7PY 4CN1A 5I71B 5J13C 1G7IB 3PF2A 1J18A 3JV6A 3DHMA 3F12B 3VD3A 2KUTA 3X3FH 1TXKA 1ITBB 5GRJL 3FQRA 4RFNB 2NR6D 1AGCB 4ELME 5L9DL 1TVDA 4Y4HB 5E8NB 1QSFE 1A21A 1ES0A 1IEAA 1NLDL 3GSRA 3MV8A 4DGVL 1B88A 4HHAB 5I1JH 3MRGB 3NA4A 4XWOD 2HLAA 1BBJB 5C9JA 3JVGA 1NKOA 3ARRA 4PJ9C 3O4LB 1T7YA 4UU9A 5D1QD 4XCFL 1XH3A 1J1PL 2WQRA 1MHPL 2DIAA 3TJHD 3IDMA 1W72A 2V5SA 1KULA 2XFXA 4KVCL 3AAZB 2I5YH 4R2GD 2DKSA 2Q8AL 2NXYB 3CX5J 4N0FA 2H45A 3GSWA 2VR9A 3ARFA 3EOTH 1IGJA 5E8PB 3RVTD 1VFMA 2J8HA 4YZFE 1KELL 3RTQB 3AXLB 4QT5A 3RBSA 3S3PA 5I15H 1ZGLB 3W2DH 2XA8H 5DZNA 4N0UB 1SJVA 1IC5H 1CE6A 1F97A 2NZ9C 3HCVA 1SVCP 1R5IB 2CUMA 5B3NA 5KZCD 3GKWL 4G9DB 2DDQH 1FBIL 3CSBA 2GTZA 2Z91B 4QHLA 3ZZ1A 4KTEH 2APVA 4I2XA 1U8IB 4PFEA 1I7UA 5LGHH 3JV0A 1CICA 2DQFB 4ZUUA 2CLVB 3V5DB 4DWHA 3P77B 3DMMA 1ZT1B 3LKOA 3S6CA 1OGAD 5CEYA 5A16A 4PV8B 4ZTOL 4WU5B 3WBDA 2WUBH 1X6LA 4M7ZC 1JI1A 4PRIB 5I8EA 3A67L 4XP5L 2E7CA 1HHGB 3NGBC 3V6FA 5IB2A 3L3OB 3NTCH 5CMAA 4PRNB 3VXQA 4MDIA 5IJKA 1SMOA 3LKSB 3RWJA 3FN0L 2A1WH 2XKNB 3HTLX 2GSIA 5DZOA 1KPUA 3VGFA 4KMQA 2MCG1 4NZUL 1ZGLM 5C0JA 5C08B 4Z0XA 4Y88A 2AKRB 3BZ4A 1UJ3B 5D7SH 5EULV 1KBGL 3CU1A 2ZUSA 5J1TC 3VH8B 1CLYL 4OT1H 1HK6A 1MFDL 2YA2A 5GGSA 3V6ZA 3QR2A 4HPOH 1T83C 1KG0A 1LO3H 2DQGL 3SKJH 1CN4A 4ODHH 1NUNB 3REWB 1Q9LA 4GG8B 1FVCB 1TZHA 4JVPA 4MVBD 3UJJL 4CU6A 4ODVL 2R29H 2C3GA 3WHXB 5AEAA 2JCCE 4D9LL 4OF5A 4J8RB 5IHZA 1QEWA 4KHXH 1CTNA 3E8UH 3GRWH 3K2UH 5DK2A 2OX5A 3G5VB 3HAEA 2P47B 2P8PB 4F9LA 2ICWA 1U3YA 2FYYA 3IRPX 4ODSL 4S1RH 2M8XA 2ZG1A 4UQ2B 4ZPTB 4UDTA 1C16B 1FE8H 4XNMA 2Y5TB 4BZ1L 1WWCA 1F90H 4G8IA 1UXWB 4NQCD 2DLEA 4L9DA 3QUXB 4AEFA 2I27N 3MC0A 2ADGB 4LLVA 2PXYD 1X6NA 1RUQL 4Z7UE 1PX3A 3QEHB 4PYGA 3TYFA 4X80H 2RQ8A 4WUKH 2VDQH 4LCCA 1RK1B 1KC5H 1N5YH 3GBMH 1BVLA 4BFIB 1ZANL 1S9YA 1G0YR 3IGAB 3AROA 3U1SL 5GSRA 1CVRA 2FCBA 5I75C 4G8GB 4MZ2A 4RGND 2NXZC 4I18A 4HGWA 1K2DB 1NFDF 4HUWA 5C0BD 4Y5YC 3Q6GH 1RJYB 3MRPA 3WKML 3ARGC 1IM3B 1F3DH 2BX5A 1PGRB 5F7HA 2YK1L 3VGAC 1MFEH 3HE7C 1U36A 5B3JE 1DZBA 4JY5L 3I50L 2Y7QA 3MMEB 1KENL 3O2DA 3H9SA 2DMKA 4LSTH 5DHYA 1C5DB 4M4RA 4GMSH 4LNRB 5FV2A 5HGAB 3VGHA 4LCIH 2JCCA 3RVUC 3NAAL 4MHHI 2EEAA 4ONOA 3ZYOA 2GQHA 4G7YL 5C0AA 1IGFH 1S7TB 3CZFB 1X5LA 3W5MA 4HUNB 1WFTA 3NACL 4R97B 3R8QA 3V4UH 3SKNA 4IRSA 2XXCB 4XBGA 2Q86A 4FQCH 3HZVB 2HT4C 1XF1A 4WNQB 4XP9H 1X5FA 1XCQB 4JZNA 2FECL 2XWBA 4WWKA 2XNAB 5CJOH 4U2ZA 5D7LA 2UWEF 1S7QA 1YY9C 2VWEE 2AI0L 1JNHA 5BO1L 5T3XH 5DC4B 5GSVA 3FQNB 5CJ5A 1UVQA 4YHYC 5ITBL 3WS3A 3K46A 1MF2H 2OQJA 4I0PA 5HXMA 5LBSH 1WZ1L 4MNQB 2Q7YA 4FQJL 5TE4L 4HKXA 3RBGA 3ZKNC 1MCHA 4YPJA 3VXPA 2QSTA 1OARL 1NMBH 2C1OA 4RIRB 1TIUA 1DEDA 4XCYB 3X13A 1TZIB 2Y23A 5E56A 2DKMA 1PG7H 5KSAB 4IRZH 3DLQR 5FYJE 3HE6A 4NCC1 2EEBA 3G04A 5C6TL 5CGYC 2M26A 4NO0A 2FGWH 3C6SA 4WTWA 4PD4J 1LEKA 4JDVB 2OJEA 4WJ5B 2V17H 2UZIL 4OFVA 3WNKA 3QSKB 1WF5A 3D18B 1N0XL 1IGML 4WI8A 5IIEA 4G7VH 2BHUA 3QUZD 3QWRD 4L3EB 5E2VL 4EQ2A 3LQZA 2X4TB 2WNGA 4L29A 5DJZA 4W4OC 5A1AA 1A64A 3QQ9D 4DK6A 5EN2B 3JTSA 5F7MC 2VDML 3V7MA 5BZDB 2AJYL 2FB4H 5AWNL 2W59A 5I8OL 2R1XA 2P5EB 2DN7A 3IS0X 5GGRY 3U7WL 1BFVL 4JFPA 4Y2DA 2ICEA 4ZQKB 1GGUA 3SPVB 2VDKL 4XAKD 3U6RB 4U3CA 4IDLA 1NGYA 2DI7A 4M7LH 3TNNB 1UCBL 4GAYB 5IV2B 5JORB 2ZOKB 4PP2B 4M1DH 3BIKB 3OB0K 4OUUA 4OD3L 3H9YA 1VGKB 1CK0L 4N8CH 4QHUA 4KAQL 2IBZY 3QJHA 1CF8L 1EGJA 2F53E 1JMXA 4KJQD 4C56B 4WFFE 4BFEA 4PJAB 4GXUM 3WUWA 4ZUSB 4HD9A 3OAUL 3JTTA 1QACA 4GKNB 2DYPD 4HG4K 2KBGA 2F54B 2VLKE 2NCMA 4NO2B 4Y4KA 3C5SA 5L2KD 3QCUL 4JG0L 3MRFB 4WTZA 2CMRL 1CGYA 3O3BB 2BSSB 4HX1B 3ROOB 5T5FL 2A6IB 1FG2A 1QLFB 3AY4A 4NBZB 3BUYA 2Z93B 3EFDL 1Y18B 3MRNA 3NIDE 4LSVL 2GW5A 1U8OA 4WU7A 1JPFA 5E1AA 5T1MA 1A1MB 4IMLA 3OGOE 3U46A 1JYWA 4UTBL 4FFWD 4X5WB 3DTXA 1NH6A 1R3KB 4EDWL 2RCSL 3KG5A 4Y1AE 4TOYL 3T4AB 2R0ZH 5BOZG 2L0DA 5I1IH 1O7VA 4F2MA 1INQB 3UJIL 2AGJH 1ZKAA 3OKOB 2DQTH 3KJ6L 2H9GA 4L5FH 2H32B 1J8KA 5EZLA 5L0QB 5M7QA 1MWAH 3EO1A 4CVXB 4LK4A 1YMHB 2PF6A 5FXCH 1A7PL 1FYTE 1OTSC 1FSKC 5EIIB 3RU8L 4J4PC 4KK8D 3IVKB 3WSQH 1IKNA 2R9HD 1ZT7B 4FQXC 4ZS7H 4BQ9A 3UBXB 1N59B 3HI1A 1E6JH 5JLZB 4X7FC 4MB3A 1FDLH 1CDGA 1NPUA 2V7HB 5EUKA 5CZXC 1AE6H 1WC7B 4XMLH 3CFBA 4FNLL 1U9KA 1PKQA 1ACZA 4H1LH 2NR6C 4KI1A 4WEBL 1U3HD 5FGCB 3MLZL 4WV1A 4P0DA 3BISA 4LBEB 5ALBL 3SOBH 2DM7A 3SKMA 3LH2L 2BFVL 2DQCH 1NC2D 4XWOC 1AGBB 4JRYE 1CR9H 1DP0A 3LEYH 5D1QC 1WBYB 2QR0A 1YNTB 4RGOH 1HE7A 1LP9F 4Y5XC 3VWJD 1I3GH 1ZT4B 3IJHB 3PG2A 4M7JH 1P1ZA 5IVXF 4R2GC 2N56A 4ZUTA 1QFWL 5I19L 2C1PB 3OB8A 3P4NB 4Y1AA 1FZOB 3RVTC 3MLRL 3I84A 5DK0B 5BS0D 4NRZB 2ILLA 1EEZA 4P3DB 1MEXL 4WW2A 4ZAKB 1G7HA 2F58H 3LD8B 4P23D 3MLVL 4X4YB 4ZPVB 1QNZH 2HN7A 3B4NA 4EI5C 1KT2A 4GW1A 3VFVB 4YO0B 2VR4A 3TV3L 1FYTA 1P7KA 2CKBA 3T2PA 3ALPA 1PVHA 1LE9A 2YOCA 3FQTB 3RPIB 3SGJC 2R1YB 3G6AB 3U2SB 3T65A 4I77L 2ID5A 4X5XA 3KLAB 3LMJL 3CH1A 2AJXL 4KDTA 3LKPB 4XHQA 1MHEB 5IMLB 2YPKA 3PJSA 1RUKL 1XF3B 4JM2A 3WLBB 1T21B 2CUIA 3FCTA 4H8WC 4JO4H 2CJUL 5MI0B 2XQYG 2PYFA 1T1XA 4I4WA 2VMFA 1GZPA 4D8PA 3ARDD 4LSRL 2EXWD 1QFHA 1SJHA 1JGVL 3CXHK 1TMCB 4TSAH 3V5HA 3VGBA 4YDLC 1KCUL 1EV2E 1FFOA 2H1PL 1NSNH 2E3VA 4PGJA 2FZ3A 4TSCH 1BEYH 3NPSC 2J5LB 3WLWD 2YPVH 4NQVA 3AREA 3B2VH 4F7TA 2V2TA 4MVBC 1EAPB 1YEIL 3WE6B 2FX8L 3OKLA 5FHBH 1T7XA 1P4LB 5IMOA 5DVKA 2RR3A 1JNLH 1AP2A 3BGMA 4NQDB 4UDUA 3UEZA 3HZKB 5J4MA 2DL2A 1TVBA 4Z7QE 1TENA 4NQCE 4I3RL 1MCRA 3MJ7B 1I9RH 2EICA 5CSGA 2R4RH 4U1LB 3VG0L 4PTUB 5D8JH 1KLGB 3AGVA 1JCKA 3QEGH 5ESAA 3STLB 3M8OL 4YLQT 5IKCA 1QUNA 2N7AA 5HD8D 1RJCA 3U36A 2BC4B 3KLHC 2KZ1B 2MCPH 2AV1B 4ZG1A 1R5WA 3S8WA 4XNYH 5CJQH 1CL7L 1BD2B 5I16B 1JZ8A 3AC0A 2PXYC 4KI5E 3NFSH 3MRJA 4UV7H 4TUKH 2UYLB 4R3SA 5GGTL 3TBSB 4KQ3H 4L1DA 5SWSB 5C0BE 4U4BA 2NPLX 2X4SA 1LP9B 3V52L 1MRCH 4O4YH 4RGNC 4H25A 4LVHC 5IVXB 1DBMH 4RMUA 3ULUD 4JY4A 4NRYB 5EFIB 3KJ4B 4X6BB 1U8NB 2JF1A 3BZEB 1FORL 3VG9B 2AQ1A 3H9HA 5T5NF 1N0LA 3CLFH 3T09A 4KK9C 3V9FA 3W0WB 5JIKA 3QIBD 1XGRB 4ZFFB 5IUSA 1UKSA 4AENA 1L7IL 3MREB 5GGQH 2WP3T 1IGCL 2GJ6E 4MJIE 3SJVE 4Y19E 5CBEA 5GXBB 5FF6B 1UWEL 1G7MB 4JO2L 3IDXL 2RB8A 1A14L 4N5EC 4ZFOB 5INCA 3O8XA 5KJRL 2ESVB 4ISVB 3NFNB 5EO0B 2OMNA 4G6ML 2E6PA 3UYOD 3CX2A 4UOJA 1FYHB 4LCWB 4AIZA 4QHKJ 4GG6E 1OLZA 2XTJB 2X09A 1HYSD 3C9NB 1QSED 2P45B 3T08A 4YNYB 4QHKI 4IMKA 5F6HJ 1HEZA 4JN2A 4U1IA 3FONB 3GK8H 1U8QA 3F7VA 4YHIB 5ESQB 2F19H 3HLAA 3MRIB 2R2BB 3QXAA 3DRQA 4O5LH 4BYHA 4DGYL 2EDHA 1UACH 5F6HI 2DS4A 3EYSH 1F4YH 4M62H 5BMFL 1URLA 3K4DA 3EYUH 1CE1L 3UTTE 3DI2B 4YX2L 2AXGA 4XPTL 1TETH 3NVQA 2HP4A 1K5NB 1X5IA 1HHKA 4JPIA 4K3JH 3T2NH 3BH8A 3MRDA 3NOIA 3C2AH 3G5YA 4H8WH 1RFDH 1YUHB 3B5HA 2NLJB 1ACYL 1ZTXH 5I1KH 3EZ8A 2IH1B 3S4SA 2FNBA 3O41B 4NQUA 4G9FA 2MHAB 2DM3A 2Q8BL 1A3RH 5EBLB 3PGCA 1MCPH 4JFDB 1CD1B 5D70H 2GJ6A 3SJVA 4TUOA 3ILPA 3QUZC 4Y19A 1KTLB 2HAZA 2HWZL 2IADB 5LQBH 2OZ4H 4JN1H 4OCLC 2X41A 4FQ1H 4JREB 5T3ZL 2VSCA 2IPTL 4KXZI 5K33A 4WFHE 1AGFB 4QRPB 1M7DA 3QQ9C 4K8RL 1C7TA 3PQYD 4Z78A 1DUYB 4XBPA 2B5IC 3KAAA 4GG6A 3VU2A 3CC5B 4YDKH 5I1DB 1J0YA 3GNMH 5L2JA 3TN0C 2Q6WB 4DZ8A 3KNBA 4Q74A 1X5AA 3RA7H 3QIUB 5B4MC 1WBXB 4PLKD 3WFBL 1K4DB 2GTWB 4NNYB 4N1EA 3IKCA 4R26H 3T2OA 2BNRD 2R4SH 5F7EH 4H5SA 3DUUB 1QOKA 2Z8WC 2EIZB 3BW9A 3LAFA 3UTTA 1I7ZB 4RBPK 1OLLA 1Q1JH 5ANMA 5DMJB 1NC4D 5D93B 1RIVL 3TIDB 1NL0H 4G8EB 1KB5L 1ZVYA 4KJQC 4FN0A 2DIBA 4YHNB 3WFEH 2AV7A 2FSEA 3ECBA 2H41A 3MRBA 4UQ3B 4DOHB 1FNHA 3X3GH 1MHHA 3K81A 4X5LA 4EN3C 1GZQB 2VISA 2ED9A 2V5YA 1FG9C 5I2IB 1DFBL 1O5DT 3VXNB 4DJMA 1B0RB 4WFGE 3LPGA 5GIRB 1FIGL 5GS0L 3FKUS 2EDBA 2OTPA 5D1XA 3CVIL 1FGVH 2FJGA 1LO5B 5C0DB 4QTHB 3R06A 4UINL 2JB6A 5DT1H 5D6CB 5A3ID 1AJ7H 2JJUA 5CJXC 2VXVL 1E4XL 4IIQB 5DC9B 3MV7B 3C5ZD 3NCBB 2AEQH 3KDMB 3KWWA 1ND0B 3EYFB 5HDOA 3E3QE 5JW4N 3V7AE 2AJSH 1ORQB 3TBWA 2D7NA 4J6RL 2OI9C 2R8SL 3QDHA 5GRJH 5JOPD 4JM4L 1CCZA 4LSPH 4LASL 5K9KA 1MCWM 2VLJE 1IQDB 3UTSD 5JXEC 5KS9A 3O11A 3L3HB 4P2YA 1AGEA 1NLDH 5C3TA 3FRPA 3IJYB 4XXCC 3U0WL 4DGVH 3B9KD 5DK3A 1IILE 1H9VA 4PJHA 2I60H 1NGXA 3Q3GA 4G6AD 3QNZA 5E6IB 2GITA 4KK8C 4QRRB 2A83B 2R9HC 5SWZE 1P2CB 3L5JA 3N50A 1CDBA 1GAFH 2YD6A 1JPTL 3N85H 4RDQF 1MHPH 1G7LB 5MEND 1NAML 4UILH 4ZO9A 1XIWD 4KVCH 4MA3B 5BRZE 2Q8AH 1D9KC 2MSPA 2H2PD 3O6FC 2K7PA 3P11H 4X99B 1D5MA 5C0EA 5GS3A 5FUOL 4FRWA 3GI8H 1PG7W 4ZDHA 1AHWC 4M03A 2P8LB 4NN6C 4H26B 3O3AA 1U3HC 5FYLL 1ODAA 4GRWF 4P3CL 1FNEB 2BVUA 3GKWH 3F62A 1FBIH 2ICES 3HC0B 3MV9E 3STBA 1BZ7A 4Z7OF 1T2QL 2QBWA 5JUEL 1OHQA 1D5ZA 5EOTA 3GMQA 2ICWJ 3EGSB 2AP2A 4AQ1B 4AMKL 1CLZH 1N3NB 4ZTOH 3VXUB 3WJJA 2ICWI 3PP3H 4TSBL 5CHNB 3A67H 4LPVA 2NY4B 2OSLA 2FEEI 2YUXA 4L9LC 1Z3GL 3KPPA 2GAZA 4LSSH 4NZTH 5IBUB 4YHPB 4RGMC 3L5WA 2CRYA 4QXGL 1IGTA 3GZKA 2VC2H 4JFZL 4KPHL 4LLDB 2XT1B 4P23C 3FN0H 2VLJA 1QBAA 3I6LD 3L3GB 2GCYA 2HFFB 3LEXB 3W9DA 1U8HA 2VKXA 5I0DA 2X89A 1RZJC 4NZUH 4RAVB 1YEFL 4P4KA 4U6XB 4NOFA 4JKKA 1UH2A 3ZT7A 1FH5L 3F7PC 5SWZA 2IH3B 3RGVC 5ETUB 4LLWB 1CLYH 1MFDH 5D2LE 1BX2B 3GMMB 5FYKE 2JELL 1RHFA 1FNSL 3QHZH 2DQGH 3EO0A 4OFYD 2BMKB 4GW5A 1D5IH 1OP9A 4Y4HD 1ORSA 5BRZA 2Q20A 4CVUA 3BQUD 4MXQD 4K8RD 5JMOC 5TGBB 5DQ9B 2V2XB 1T22A 6FABH 2NY1B 4O51A 1GRWA 4D9LH 3UTZB 2BNQB 4ZSOA 1B4JL 3ZE2E 3SKOB 2EXWC 1I8IB 4K7PL 2JJTA 3VGGA 2EIDA 2ZUWA 2V7NB 3MV9A 5EU6B 2G75B 3LDBB 4ZXBB 5IEHA 1JGLL 3QUMB 2IMNA 3BP7A 4NQSA 3MLWL 1TCRA 3HI5H 3LY6A 1BZQK 3IF1A 3QDME 2H6PA 5BV7B 1JZ2A 2EECA 4Y4FA 1JPGB 3DSNA 2ED8A 1IJ9A 4BZ1H 3I2CL 3SDCB 4DTGL 3QZWG 1A6VL 1G6VK 4G5ZL 3WLWC 3CVHH 4KRMB 3JXAA 4MJ4A 4ORZC 4KQ4H 4K3DL 1JGEA 5GZOD 2P49B 1RUQH 1MY5A 1AD0B 2VXTL 1IL1B 2LFGA 2ZWLT 5HYJB 4EXKA 4LLAA 1ZANH 3TVMA 4PY7B 2IF7A 1GPOH 2WSKA 3RI5K 3UDWC 3QIWB 4KKBC 4HDIB 5EZOL 1MSPA 4GRLA 5EZJA 5GS0D 2NY0B 3LB6D 2NY3D 5HD8C 2GJZA 5D2LA 1REIA 3RL2B 2XTLA 4YWGL 4YXKL 3VW3L 3KXFA 5E95B 2DWEB 4HJJH 4GRWB 4L8DA 1HHHA 2OR8A 3VWKA 4JY5H 2PTVA 5FUZL 1KENH 5J1AB 4DN4L 1X7QA 4OLVL 5TH2A 1PDKA 1B6UA 2DJ4A 3HN3A 2P8MB 3NMEA 4UT9H 2BVOA 4WO4D 3ISWA 3GMRB 5DJCA 3T3PE 2ZKHL 3NAAH 4LVOC 5TF1H 2EH8L 3VXSB 4XPHL 1XF4A 1D6EA 1VFBA 4PJBF 4O2EA 3IU4L 1NBYB 1U8PA 4HWBA 1TJIH 3BESR 1J8HE 3RIAK 2NNAA 1YEEH 3NACH 5CSZA 2B0SH 4U6HA 3ULUC 3UX9B 3REVB 3V4PL 3DX6B 5E5RB 4ODXB 4LPYA 1FC2D 1KTDB 4FFYL 4YGVB 3C5JA 1KIQA 4CGTA 2DLHA 5CGTA 5BO1H 1GC1C 5FGBC 3HS0A 2CLZB 3DHJA 5CUSL 4Z7NF 5EBWA 5KG9A 4MX7A 1P7QA 1AQDA 3NPZB 5ITBH 2R23B 3ULVD 1R24B 1F11B 3WN5B 4MB5A 5E4EB 4QGTA 5T1DL 4PR5A 4D0CA 5F1KC 3LRSA 4NN5B 1WZ1H 4FQJH 4MLIA 1H3GA 3QO0A 3MJ9L 5C0GA 3CJJA 1MFBL 5FYLD 4OLUH 1OARH 3BT2L 1MY7A 3ARBB 5HHMB 4XBEL 5IM7B 3WS6A 1XGYH 2HH0H 1OGTB 2X9WA 3PV7A 4P2QD 1DVFB 3MRRB 4NBXB 5C6TH 1EH9A 1WEJH 4F15C 3TBYB 2NTFB 1UZ8A 4R90H 6CGTA 4PREA 1IM9B 4MQXD 1FLTX 1DLFH 1QO3B 1N0XH 4KK6D 5KOVC 3BP4A 4WW1B 5IT2H 1NMAH 1NLBH 4K3HA 4PJIA 1Z9MA 1JHLH 1NMCB 1Q38A 1VERA 5DJYB 2FD6H 2FBJH 1KJMA 2WWKT 3QDJE 5HHOB 4LP5A 5E5MB 3LSOA 4QOKB 1GGYA 3T3MF 2FBOJ 3HMXL 2VDMH 5D7JB 5KSVB 4U1HB 4X83A 5C0IA 2Z31D 5AWNH 5I8OH 1LK2B 3FB7A 4QRUB 4YEEA 4PRBB 1BFVH 3LCYA 2QKIA 3L9RA 3DYPA 4HKJA 5ILTL 3HHRB 1CVSC 4DVBA 3DX9A 2IWGA 3VDCA 4B7LA 1M05B 5LXGH 1OAKL 1UCBH 5C0CE 3M1BA 5JHDA 3MGTA 3OJVC 2BRQA 1OQXA 1V3MA 4OD3H 2VZVA 1CK0H 3OSKA 5CILL 3UYPA 4KAQH 3DVGA 5LAXA 4WI7A 1KEML 3DOSA 4YPGB 3FO0L 1CF8H 4K3GA 4JFYA 4ONGH 3C6LB 1INDL 1N8ZA 3VJ6A 5IW6A 5DVLA 1JTPA 5B38G 1WVZA 1YN6A 2BNRE 3IXAB 4QLRA 4BH7A 3KPOB 2J4WH 2VIRB 1AD9B 2EH7H 4XNZB 3QCUH 3MA7A 3ESUF 4HXAL 3MRQB 2CMRH 4PJBB 4NQEE 5DJ0A 5KTEL 1FV1A 1RI8A 2DIJA 3EFDH 4LSVH 4OCYH 1I3RB 4YZFF 3QBTB 5DJ2A 5J6GA 3KPSB 4UTBH 5L8JB 4YHOH 2ATKB 3QDJA 1FVDB 3CNKA 5DHXB 3E6FA 2RFXA 3GSOB 4YDJB 1A47A 4WENB 2E8YA 3DO3A 1Q94A 3BPCA 1FJ1B 1N5AB 4FG6D 5B21A 1MFCL 4NPYA 1MHCB 4PV9B 5TFSL 1EHLL 4U31A 5IG7B 3L3JA 4Y16A 1T83A 3KJ6H 2IAND 2IFFL 4CNIA 4EIGB 2XA3A 2A73A 3VFRA 4F7CA 1FFPB 2ED7A 1DQLL 3ULUH 1C1EH 3FQRB 2NMSA 5GZND 5C0CA 1A7PH 3M45A 4OD1H 3BWAB 1IEAB 3RU8H 2F74A 3GSRB 4XGZA 5B8CC 1I8MA 3MV8B 5IQ7L 1V7MH 5I1AA 4M5YL 4HUXA 3BKYL 5A3IC 2P42B 3QCVH 2XI9A 4JFFA 1GC1H 5E5UB 1VA9A 4OZIE 5C9JB 5DJ8B 2ZNWA 3KYOA 4MJ5A 3I6KA 2EDTA 5CIPB 3IDMB 1I1YA 1W72B 5DMKA 1EJ6A 5TDNB 1JZ4A 4H20L 1U58A 1RJLA 4RZCB 3KPRE 1M1SA 4N0FB 1BOGB 3ARFB 3MODL 4WEBH 2XV6B 1A6AA 3MLZH 4QT5B 2QTEA 2VXUH 3W9EB 3BHBA 5FA3A 5ALBH 5DURD 3B9KC 5L6YL 1IC1A 4PJFA 1CE6B 1U8LA 3CU7A 4FABH 3HCVB 4P46A 4G6AC 1KFAL 2GTZB 1A7BA 1J10A 1ZLWK 4I2XB 4KTYA 4HWEH 1I7UB 3MRCA 1CICB 2KL6A 2WBJA 4ZUUB 1OAZL 2JCCF 1XIWC 3DMMB 3VXRB 1QFWH 5CEYB 5A16B 1MOEA 4PRHE 2DJSA 2F5AL 2H2PC 4OZGB 43CAB 3O3DA 4OLEA 4Y5YA 5I1GL 4FQQB 2V5RA 1BHGA 1N4XH 4P2OD 5CMAB 2P5WE 1WAAE 4MXVE 2X1WL 5CP7B 4F8TA 3HE7A 1F8TL 5FO9A 5JR1L 3RWJB 4O58L 1I9JL 1PY4A 4MAYA 3JWOL 4ZUWA 2GSIB 4RA0C 1KPUB 1OOAA 3ZTJG 1WFOA 5C0JB 5D4QA 3PV6A 3TCLA 4JFHD 3LMJH 1F00I 3WO4B 4ZODA 3LS4L 2X9XA 1JRHI 2X4QA 1RUKH 3V6ZB 1BIIA 1KG0B 4PJ5E 4TNVF 4UIKL 3K3QA 3ZE1E 1KXVC 2CJUH 1LDPL 1TZHB 4LIQL 3RWEB 1MFNA 2FDBP 1X9QA 3S36H 3SCMD 4YQXL 4LSRH 1R3HA 5IHZB 5SV3A 9CGTA 1QEWB 3NN8A 5T3ZE 2P1YA 5B3JF 5E2WL 2FHCA 5DK2B 3HAEB 2D7QA 2VDPL 2VDNL 1BQLH 1TNNA 4HJ0D 2FYYB 4R8WL 4XP4H 1QG3A 4H1LA 2K9UA 4MSWA 3OKYA 3O4LE 5FOBA 4ELKA 2H3NA 4XNMB 1E28B 3L6FA 2L7UA 3BQUC 1YEIH 3JV4B 4G8IB 4PRHA 3STZB 1K8IA 3MLSH 1BBDL 3OKMA 5D1ZB 5J9PB 1FFNA 3ROLB 4NJAL 3O2WH 5KANI 1Q0YL 1WUNT 2P5WA 1I7RA 2CKNA 4LLVB 5FUCE 3IETB 1WAAA 1R6VA 1WJ3A 2R56H 1M7IA 3PWNB 4HH8A 4LDEB 4N0UE 4JDZB 1FO0A 5E03A 4I3RH 4JJHA 4X7CC 1BVLB 1S9YB 2A77L 2VITA 1B90A 4I48A 5GSRB 3ARBC 5IHUL 4WCYH 4JANA 1KJVA 4I18B 2VUYA 1JHTB 4HGWB 5DJ6A 3KGRA 4HUWB 8FABA 4FZEL 3TO4A 3RX5A 5TE6H 3GI9H 2EE2A 3MRPB 1KJ2A 3D85A 3PXHA 1CL7H 4PRIE 2WLYA 1MUJA 2W0LA 4WFED 3AS3A 2CIKA 5AAMA 3RAJH 5GGTH 2Y7QB 4FMKA 2DBLL 1G7IA 3PHQB 3H9SB 3D39B 3SQBA 4YHLL 1TLKA 4OCXL 1LNUA 2PYEA 5E8NA 2W9EL 5C0AB 3HA0A 1BF8A 5K9OB 3T1FB 4HHAA 5LKNA 5GS0C 3MRGA 3LB6C 2NY3C 5C08E 1BBJA 3SKNB 3U30C 1A02N 4K2UL 1SJXA 1G84A 4XBGB 2Q86B 2VLRB 5F7DB 3SDYL 2BZDA 4WWKB 5I9QC 3BE1H 5D7LB 2CD0A 3VXOB 1NGPH 4UV4H 1F5WA 2YEZA 1S8DA 1IGCH 2OBGA 4WO4C 4N9OB 2WW8A 3O3EB 1UWEH 1NBQA 5IFAL 1SY6H 3IDXH 3AXLA 1G9EA 1A14H 1ZGLA 5KJRH 1QBBA 1MLCB 4U0RB 2OQJB 4Q0XL 4N0UA 4G6MH 1R5IA 1UFUA 3TC9A 3U7YL 3ZDZE 4LCYB 1HHIB 4G9DA 3D25A 3HFML 1L6ZA 3RWIA 3VXPB 1JWSA 4QHMB 3X13B 1NJ9B 1SVZA 2DQFA 4C4KO 2Z4QA 3P77A 4KK5D 1OT2A 2H26A 1SQ2N 3G04B 3C87A 1J0ZA 2PTTB 1HH6B 4TNWK 1K4CA 4NO0B 4ODTL 4WU5A 3EO9L 4DGYH 1LEKB 5FYLE 5SX4I 3HB3D 4J3UA 4PRIA 1MJJB 5BCAA 3ULVC 4WEUD 5GS1C 3SO3C 2APBA 4KDVA 1HHGA 1CE1H 3L3OA 3O45A 3JUYA 4YX2H 3U83A 4NWTL 1CDCA 3IB4A 3THML 3T2QA 3LQZB 1MRFH 2XKNA 4NFCA 4L29B 4KV5E 5DJZB 4J4PA 1CFTA 1HWHB 2G2RB 2K1MA 5F3BA 4G8GE 5HHNB 3OXRB 3JTSB 5K93A 5C08A 3O0RL 4QXUH 2AKRA 1UJ3A 2IG2L 2OL3H 1IFHL 2Q8BH 2AJVL 4MQXC 4LPUA 4OZFB 3MLXL 4JFPB 2DTML 4KK6C 2ICEB 1A7NL 2IAMB 4GG8A 4PRDB 2HWZH 1U2CA 1NGYB 1UWXK 4AG4L 3LOWA 2AABL 2IBZX 4DKEH 2IPTH 5F7YC 4JDTL 1XF2A 4OUUB 5DF0A 4K8RH 3W0WD 3VD4A 5HDBE 1T89C 1MCCA 5F1IB 1RUMH 4UOW1 3BMWA 3QJHB 4K7FA 2PO6D 1T3FB 1Z5LA 4M61B 4AH2A 4Y5XA 1N6VA 4UQ2A 2NZIA 4ZPTA 1WIUA 3DURA 5E9DB 3WUWB 1I1FB 4NN7C 3OKEA 1C16A 3WFBH 2Y5TA 1UXWA 2VTFA 3QDGB 3QT2A 3WXWL 3CZJA 1P53A 2ZZUT 3QUXA 2W38A 5GRZA 1I4FA 2AJUH 4DKDC 3V2AR 1G7PB 5DTFB 2KH2B 4DAGL 2ADGA 2AK4B 2YPLB 3QEHA 3BUYB 3MRNB 3FHAA 3SGKA 1Z9SA 4XPFL 1NKRA 1RIVH 3IAQA 4ZD3L 1RK1A 4JHAL 1JPFB 4WU7B 5E1AB 4MNQE 5T1MB 3RRQA 4EI5A 1KB5H 4NNPH 4IMLB 3BN9C 3SGJA 3DTXB 3PIQB 5DJDA 1B3JA 3GSNH 3DGGA 2YMXL 4F33A 3MXWL 1K2DA 4S1SH 4OCWH 2VO5A 2B2XL 1CBVH 5CCKL 3Q5OA 3WJLC 4F2MB 1J05A 1DFBH 5C6WH 1DJSA 2EZ0C 1G0DA 5IB3A 2UZYB 4TVPE 1IM3A 1QQDA 4OUOA 2BK8A 1DSFL 2ITDA 3ARYA 5EZLB 5GS0H 2EYRA 3C60C 1TCMA 3CVIH 1SM3H 3EO1B 3MMEA 4PJCA 4YC2C 5LG1A 4MNGE 5BOPA 4AJ0A 2VXVH 4FMFA 1LD9A 2VL4A 5FHAL 5FOJA 5HGAA 4F3FA 4L3EE 5C0RL 3D9AL 3QA3A 3HI1B 2BXYA 3CZFA 4PBWD 4P59H 5DD0H 4FG6C 4J6RH 3B5GA 1BAFH 1DTUA 2OZ4A 1F42A 4MA7L 2DKUA 4JM4H 4LASH 1NDGA 2O93L 1PKQB 3VI4E 2XNAA 3MLYL 2P5EE 3SN6N 2HVKB 2YR3A 1KCSL 3U0WH 4XC3L 5GZNC 3W11D 4MNHB 3BSZL 1UA6H 3TPKA 4WV1B 4Y5VC 4BFGA 3PWJA 4K94C 3IFOB 3ZDYE 3R1GL 1JPTH 5I18L 5C09A 1QFOA 5IHBA 3G9AB 3PP3K 1NAMH 3SE8L 3DI3B 3PL6C 3QIUD 4MNQA 2QR0B 3ULVH 3QUML 4POZC 1U0QA 5HVHB 2AEPL 1YMMA 4XCYA 1TZIA 5BV7L 4C56E 3QFJA 1T04B 4PJAE 3VFOA 1PSKH 3WHE1 4P3CH 4PJ8B 4QRTA 4TRPH 3F5WA 3WDIA 1EEZB 3BPLC 1JF1B 4WW2B 2F54E 4JRXA 4GQ9L 4QHNB 4JDVA 5JUEH 3DVNA 3PWUB 1JYXA 1MJUL 4UT6L 2HN7B 4LCUB 4LRIC 4MNGA 1C5BL 1H5BC 3TF7C 1BJMA 1FYTB 1IBGL 1P7KB 4HWNA 5MP6H 1EA9C 1LE9B 2NY7H 2WBWB 4L3EA 4TSBH 1IAOA 2X4TA 1GGIH 1Z3GH 2UY7A 4X5XB 4LLUA 4IOIA 1FZJA 1PQZB 3EW3B 5DA4A 1OP3H 1L7TH 3WCYA 1HXMA 1CGVA 4QXGH 2YPKB 5FM5O 3PJSB 3HR6A 5H94B 2YSSB 1BM3L 5BZDA 4JM2B 1J1XH 4P2OC 5JNYA 4LHJB 4N68A 3FCTB 3TZVD 1N7ML 2L7JA 2P5EA 1Z0NA 2VLME 1VCAA 2PYFB 4I4WB 4F9PC 4HCRL 3PWPB 4Z95H 1GZPB 4ZQKA 3SPVA 2BVEA 4Z5RB 5KSBB 2JKXA 3VGEA 1SJHB 4GS7C 4BZ2H 4LFHD 3DV6B 3VFMB 3KYKL 3NZ8B 2CQVA 4GAYA 5JORA 3L5XL 2ZOKA 2VQ1A 1N6UA 3V5HB 1MCOH 2JELH 1FNSH 3FJTA 4UUJB 1S5HB 5KVEH 1OY3B 2EDWA 1FFOB 1VGKA 1ZV5A 1OCWL 1FHGA 2BHZA 3IDYB 3C08L 1ZLSL 2FZ3B 2XQYK 4NQVB 3AREB 5C7XH 2GYSA 4XCNA 4GSDL 1FRGL 4KHTL 5E6ID 4PJAA 1UYWL 1F6FB 4ZUSA 3SCMC 1B4JH 2EDOA 3OKLB 4P5KA 2B1HL 5T1LB 4JO3L 4IOFD 1FAIH 3Q1SH 4RMWA 1WLHA 5FGCE 4UDUB 1JF6A 1JGLH 3MRFA 4PLOB 3RNKB 1JNNL 1TVBB 5GRYA 1PFCA 3ZTJH 1QVOB 3ZDXE 4LVNC 3ROOA 4DUVA 4TUJB 1N64H 3RPKA 2E7LC 1S9XB 4HJ0C 5ESAB 1YC8A 4DTGH 4ZYKA 4BFBD 5IKCB 2AXFA 1XEDA 1A1MA 1XGPA 4WGVB 4KMLB 4BQBA 4U6VH 4UAOC 1GOGA 1T1YA 4K3DH 1E4WL 1R3KA 1YQVH 4GG6F 3HNTH 4LPTA 3T0DA 5IK3B 4KRNA 2XWTA 4PPTA 3S36X 3VXUD 4PG2C 2PW2B 2BNUB 1W0VB 3EJZD 3F6LA 1G1CA 5JOEA 4Q2ZA 3QRGL 4WHYG 1F4XL 1A6UH 3QUZA 1RZ8A 4CVXA 4OI8A 1YMHA 5AUMA 2CRIA 4H25B 4IOSD 4NO5B 4WFEE 1XGTB 2X5PA 1K3IA 3IVKA 4JY4B 1KIUA 3UBXA 3O6ML 1N59A 3VXMD 1YJDC 5T5NG 5JLZA 5DHVH 3V4VL 3H9HB 3VFGL 2V7HA 4L8SC 3TN0A 1D6VH 1JP5A 5F6IB 3FZUD 1WC7A 1F58L 4BKLA 1FN4B 3O6LH 4AENB 2EH8H 4HK3J 1A4KA 4P5TB 4XPAH 1KGCD 3CFDA 3WDHA 5ICZA 2WBKA 2W1NA 5CBEB 2ZUQB 3T77A 3T0EB 5GPRA 1T1ZB 4EUPB 5C1MB 1U91A 1VB9A 3O8XB 5INCB 2NX5B 4X7SL 3PGFL 3DX8B 2O5YH 1INEL 2LE9A 2WZPD 2VDRL 2ZUUA 1H8OA 2HMID 4S1QH 1AGBA 2I25N 5F1OB 4AIZB 4FFYH 4XZUA 5GJSL 2DOCA 1WBYA 5IGXL 1HIML