1PEWA

High resolution crystal structure of jto2, a mutant of the non-amyloidogenic lamba6 light chain, jto
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
109
structure length
108
Chain Sequence
b'NFMLNQPHSVSESPGKTVTISCTRSSGNIASNYVQWYQQSAPITVIYEDNQRPSGVPDRFAGSIDRSSNSASLTISGLKTEDEADYYCQSYDARNVVFGGGTRLTVLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Jto2, a LAMBDA-6 TYPE IMMUNOGLOBULIN LIGHT CHAIN, VARIABLE D
publication title Structural basis of light chain amyloidogenicity: comparison of the thermodynamic properties, fibrillogenic potential and tertiary structural features of four V(lambda)6 proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 22
structure length 108
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pewA00
2NY6C 4JVWA 3QNYB 3SDCA 5M95B 1SBBA 5DJDA 2R0KH 5EZJB 1DLHB 4I0CC 2VDKH 1IEAA 4J3UA 3BUYA 4M6AA 5E5MB 1MFBL 3GSXB 2DS4A 4F57H 1E6JL 2BY1A 5HHOD 1LK2B 2Y36L 4X9GA 1TENA 4ZAKB 5A40E 4L8SA 3A67H 3VXOB 1GHFL 2FLBT 3K4ZA 5CP7B 3GMRB 3O9WD 5T1DL 1JGUL 4U0RC 3OJ2C 4JRXA 1CD9B 3FO0L 4K55A 4D0CB 1T03H 1U8NB 4K8RH 4LGPB 4NJAL 4OD1L 5HHQB 5IHLB 3RDTA 1EERB 2WINA 4PJXB 4DKEL 5T1KD 2CKBL 1N5AB 2PW1A 4U6HA 2IH1A 3VXSD 1QA9A 3B9AA 4NHCH 3ARRA 5GS1B 4AEHL 1KV3A 3UC0H 3U4EB 1ND0B 1LD9B 2OL3B 4P23D 4JFFE 3PP3K 4OBSA 3GBLA 4X5LA 1TZHB 5I8OH 2LVCA 4IIQC 4PS4H 4F7TB 1OY3B 3WIHH 5HHOA 1AQDB 4GMTL 2XQBL 1XF1A 2D0HA 1DBKH 2X4UA 5C9JB 2Y6SC 3HZMA 4I3SL 3O9WA 2E7LC 4RBPH 1ACYH 2LU4A 2SEBB 3I3DA 4GH7B 1AO7B 5D2LA 1G6RB 4FFVC 3ZKND 2JE8A 3UPRB 1LHZA 2VABB 5IJKC 2Y06L 1BQHA 4LBEA 2GIYA 4FXGA 3KPNA 4UT7L 3UBXA 1PG7L 2J7LA 5E7FA 3MLRL 2A73B 4P23A 2BNRD 4XI5C 5IF0B 3AS1A 2WNGA 4TSAL 1LILA 2VDOL 1IQDB 3VFGL 3I75A 1YY8A 1RZ8A 1K4DA 4Y89A 1ZVSA 3R0MA 4MB3A 5ADOH 1OPGH 5D71H 3CPLA 1M7DA 1NUNB 1WICA 3BZ4B 5FCUL 4LF3A 3WUWG 4NQUA 1R5IB 1G9MC 3VRIB 2C3WA 1YQVH 2FATL 5DHVH 1BBJB 2Q7NA 4EN3B 1KB5H 3LKOB 4IOFC 1G7LA 3ARBC 3C09B 3PGCB 5GGSB 4HG4J 4YHOH 1RUQL 1CLYH 2C3GA 4O2CA 3HC4L 4P5TB 4F7EA 1FAKT 2F8XC 1YN7B 5EOTB 1E4WL 4P2RB 3WS6C 3LRHA 2AJZB 2GSGA 1MRFH 1ULVA 1IC5L 5DJ8B 5DXWA 4AL8H 2H8PB 5IB3A 1HH6A 1UZ8B 4LSSH 1RZJL 2KBGA 4IOIA 3PUCA 2CLZB 2ZUQB 3MNZB 2KL6A 3C5JB 2VLRE 1JHLL 4XP9L 2QQQA 1NFDB 5GZOD 5L2JB 4KJYB 4YO0A 4FFWC 2A6KA 2FIKB 1V7MH 4JB9L 5DJ6B 4C55A 7FABL 5DVLA 4F7MB 3QEQD 3VJ6A 4JQXC 3G6JB 5FUOH 3RWFB 3IVKA 5HI5D 3OR7B 1MHHA 3BKJL 4YPGB 1MIMH 2R39A 4ONFL 2ZCLL 4NDMA 4XMKH 3TT1H 1CDYA 3WIFA 3BH9A 1RMFL 3ES6A 4AQOA 4M02A 5JUEL 3KYKH 1CVRA 3CIQA 3SJVE 2BSSB 5CBAB 2X10A 1QO3A 1RY7B 1SYSA 2PETA 1NPUA 2WUCH 1IAKB 4U6YA 5FYKD 4B5EA 4EIZC 2A9ML 2FJGB 4JKKA 3O2WL 4MLIA 1VFBA 1REIA 5D7JC 1HOCA 4RMRA 4APQA 2BRRH 3C5SA 1M71B 4TSCH 1CXKA 1A6TA 1MCQA 4N5EC 2IAMC 3MR9A 2OBGA 3QEQA 1PY4A 1FLRH 4P99A 3KPMA 4Z7VB 4ELKA 1PGRB 3WUWA 4PJBB 5FO9B 2AK4B 2D2OA 4JFYB 3QO1A 4F33A 1P9MA 5JXED 1N26A 4Y16B 5JORB 2MKWA 3RIFK 2WWMD 3GM8A 4QT5A 3DO3A 4KHXH 3BPCB 1B0GB 3E6FA 2VLMD 4HD9A 1OF2B 3TVMC 4EVNA 3Q2CA 4PRIE 4TOYH 1WZMA 2PR4L 2FO4B 3BXNB 5EU6A 2I24N 2AJ3A 4WUKH 2GTZB 4YPJA 1MOEA 4XXCA 4MXQC 2YC1A 1PG7X 3MRJB 1JI2A 3QXAB 1OM3H 2Y4SA 4J3VA 3PJSB 2HWZH 1WCQA 2O93L 3RTQD 3UROR 1TJGH 2PTTB 4D0BA 1U8KA 5GRWA 4HV8A 5DD5H 2FD6L 1QFUL 2AJSH 5SWQA 4NWUL 2XZQL 1WZLA 4AIZA 5EBWB 4LNVA 4QHKI 3B8SA 5D6CA 5BO1H 2DMKA 2B4CH 2OZ4L 4PTTB 3EZJB 5EO1B 3TBSB 3OKMA 1JGDB 5AEAA 4QHNB 3FFDB 4CU6A 3FT2A 2ARJA 3IDGB 1JGLL 1QQDA 2G2RA 4U1LA 1F45A 1U3HD 1UG9A 3RDTC 5AZEH 3DMMB 1NCUA 1EO5A 3GNML 2NZ9C 3LAFA 1FZOA 2V9QA 4LHUG 3OJDA 1A8JH 5TE4L 2A74B 3RTQA 1TDQA 1G9MH 1N64L 5GQBA 4MJ5B 1S9WB 1R5WB 1MIEH 5CZXD 4FQPA 1GZPA 3UTSE 4N90E 1PYWA 1P1ZA 4J1UB 1CLOL 1DBBL 1GGIH 5EU5B 1FNSH 2ADGB 5F6IB 4YDKL 4BSVA 1VEPA 3O6FB 4X7TA 4GG8B 3UJTL 1EMTH 3K1DA 2HFGH 3P4MB 4N9GB 5FXCH 1U3HA 3EYSL 2YMXH 4N8CL 1V8HA 4YWGH 3OG4B 1QRNA 4HQQH 3GMMB 2EO1A 3K2UH 4U33A 3L6FA 1RV6X 3EOAA 4GMSL 4RZCA 2DTSA 2AERT 2I5YL 3GMLA 4PJ8A 2VNCA 2D31B 1T1YB 3BDYH 1UQSA 5E4EB 4JG0H 3MFFA 4EI5C 1IVLA 3VWKD 1A2YB 2J5LB 5B4MD 3FCTB 3MRPB 4KKAC 1AI1L 1R5VB 5ID1B 2F9BT 5EA0H 3BIKA 1C8PA 12E8H 4C83B 1UZ6F 5C07B 4P59H 4DQOH 3E1F1 3MV9B 2A77H 3TJHD 3U6RB 4KKCD 5J12C 3BE1H 5HY9A 3VFRA 4YHYB 1H3PL 3P4NB 4F7PB 4HFUH 3U30C 2DQDL 1ZGLP 4P2QD 3KVQA 1PY9A 4ZNCD 3LKSA 2FL5B 5F9WC 1H8OA 1TJHL 3AVEA 3MFGB 4M6NL 3FT4B 2Q6WB 4OZIF 2X05A 1F90H 4LCUB 1JFQL 4OSUH 3OPZL 3VCLB 1JF5A 1A0QL 3VXUB 2VH5L 3JV4A 2CLRB 3B6SA 2VZ3A 3ILQC 4LHUA 1FGVL 2VTFA 4ODWB 4I2XE 4UOW1 4UUJA 5GISL 43C9B 4P4RB 2DWDA 2K3TA 4H8WH 3MRRB 2NR6D 1ZS8B 4OZHF 3C6SB 3VGGA 3QA3A 4XWGL 4CJ1A 4YDVA 1DVFB 1G1CA 4TSBH 1PBYA 5F72S 1QG3A 5JNYA 5DD6A 4PJAB 4ONHB 4QXTB 1BM3L 2X4TA 5F7FA 1W0WB 1JK8A 3D2UB 3ZL4L 4IBLT 2F54D 2F74A 3QCVH 4FABH 2W65A 1F3RB 3E6HB 3LCYA 2O5ZH 4H1LG 1JZ6A 1RZJC 4X4ME 2H32A 1Q1JL 2KQNA 4Z7OE 3B9KB 4KMTL 1XGRA 5DQJB 5IV2B 5FO8A 4KVNL 4XP4L 4YNYA 2D4FA 3MRCA 4KAQL 1PSKH 4NKMB 5GJSH 5CBEB 5E2TL 3A6BL 1AD0A 3CLEL 4PRBA 5GGUB 5E8OB 3HAEG 3TLRA 3MUGA 5TH2B 5JOPD 1DN2A 4XX1G 4NZRL 1MCRA 2J4WL 4OGYL 4APQC 2XRAH 1UXWB 1A1OA 2UZIH 5EUOA 5F21B 4WEUD 1KJVA 4PTUB 3PWPB 5EZOL 3N1FC 4WV1A 4EBQH 5KVGH 3FQTB 4PJGE 1PLGL 1ZLVK 2AV1B 4UV7L 3G6AB 4IRSB 1MAML 2I9LA 1SBSL 5KSUB 3T4AB 5C0AB 3NIGE 2K9UA 3KDMB 2BDNH 3QFDB 2QLVB 35C8L 4Y5XA 1ACZA 4PLKD 4TUOB 4YC2B 2DI7A 2AAVA 4HIXL 1GHFH 4GBXA 3PGDA 1UB5B 3RI5F 1NJ9B 2F5AL 2V5TA 4RGMB 4P46D 3FO0H 5FUCC 4NO2A 5I1GL 4KHTL 1A6AA 4OD1H 1T1ZB 2CRYA 1L7TL 4U1SA 2CKBH 2R1YA 5T33H 3LSOB 1P2CB 3ARXA 2H9GB 3QEGH 3GEWB 3SKNB 5F7WC 2BMKB 1E4XH 4OZHB 4Q74A 1MJUH 4H1LA 3GKZA 2NY7L 3JTSB 2ZKHL 4RGNB 2F53B 1U41A 5CILH 1XZ0A 5MENA 4OGZA 4NQSA 1SEBB 3BP5B 3T2NL 4G6MH 5BW7C 3E3QC 1JYNA 5DDHB 1A3QA 4I3SH 3GO1H 3HAEA 4Z95L 3RWCB 3A6OA 2BC4A 3SO3B 5KVDH 4KDWA 1XF5B 4P46A 4B7LA 5IR1A 3NTCL 4GRWH 2RCSL 1C08B 3QI9C 3QQ4A 2XN9B 1LP9B 3D39E 4OLZH 4UT7H 3GK8L 4QYOA 4PGZA 3JBG7 4PP2A 5HJ3A 4OCWH 1W2KT 4PREA 3U4AA 4QOKD 3WJJA 3OKYA 4IHOB 2JCCE 4JN1H 1BD2E 2VAAA 3EYQD 3EYUL 1MHEB 1MPAL 1U91B 1RIUH 4NN7C 1UXSA 4CVXA 2FSEA 3CD4A 3F7PC 4OM1L 4ELMB 3E2HC 3SCMD 4NRXA 4X7DC 1WBZA 2W60A 5DJXA 4MXWL 3CX5K 4WHYH 3MUY1 4RFNC 4FP8H 2QQNH 4NZTH 4PLNC 1KXTB 2RBLA 1KB9K 3EOBB 3HLAA 5L7XL 5IBTL 2I9TB 3QT2A 1MY5A 3ZDZF 3KPLA 5DD3H 4AY0A 2P7TB 3M17B 4N0CC 4MAYC 1WIPA 3HRPA 5DUPH 4TN9A 1UACL 1RUQH 1MFEL 4NBZB 1T21A 1DQJB 4QOKA 4RWYH 3W0WB 1XEDA 2JB6A 2PO6D 3NIDE 4OZFB 5SWZB 3WLWD 4OD3L 3U9UA 2PTUA 1IC5H 5SV4A 4TVPE 3IU3A 1MI5D 1NCDL 2ZSVA 3MPCA 1T83C 4BFIB 5C08E 1I75A 3HNSL 2VLJD 1BEYL 1K4CB 2A6DA 1F4YL 3VA2C 3S5LG 7FABH 3WFEH 4HCRA 1KLGB 3VFTB 4WHTA 3O2DL 2B2XL 2OMNA 2Y07L 5GGQH 3DSNA 3BP4B 5BS0E 5DC4B 4Q58C 1HHIA 4JZNB 1X9QA 3GGWA 5E9DB 1R3LB 1UVQA 4M61B 1X5FA 2XG5A 4JFFA 4RGOH 5JUEH 1BIIB 4LLVB 3F6IA 2ICWB 4WO4D 1BGXH 3ZHLA 4M1GL 4BSJA 3O2DA 2IJ0C 3LN5A 4OLUL 4L9LA 4LPYA 4FQXD 1JPSL 1CFNA 5EBMA 1J86A 4DKFL 2V6HA 2VLJA 1FGNH 1RD6A 3PWUB 4TPRH 5IVXA 5T5FL 5ALCL 5GZNC 5D1XA 3BW9A 1UB6A 3LH2L 4K8RD 3QUML 3B4NA 2DOCA 2G5BA 5D1QA 1D6EA 2A83B 5DLML 3ULVH 5ICYA 1KGCD 1RU9H 2EXYC 4GW4B 3EBAA 1J18A 2IFGA 5KAQG 5DSCA 4D8PA 2HFFA 3W9EB 3DX6A 3T08A 3T3PE 4WO4A 2GJZA 1ZTXL 2QADC 3OB0H 3OTTA 2GJJA 1FYTD 3MGAA 3GBML 1JE6A 2F19L 4FQXA 4QRPE 1JVKA 1DLFL 5BOZG 4R4FH 2PR4H 4KQ3L 1OTSD 1SY6L 3T77A 1FO0H 3IS0X 5L8LB 2JJVA 4R6UA 5IK3B 5MEQB 4M3KB 3FFCE 1NQBA 4X5WB 2WIIB 4QHMA 2HLFD 7CGTA 3MROA 4WU5B 3S5LA 1HILA 1WBXB 4NQVB 3PE9A 1NAMH 3EDJA 1CICD 4DKDC 3S34L 4TTDC 3BQUA 3V8OA 2BSED 3WO4C 4LIQE 2DWEA 3UTPE 4KK6D 4OGAD 2E7HA 2HLAB 5CSZA 1V3MA 5IB2A 4Z77A 2WUBH 1IEBA 2PNDA 1JTPA 2FD6H 1FYTA 5E2WH 3HC0A 3QFJB 3KAAA 2K7PA 1O7SA 2OQJA 4OFPA 5HYJB 4KVCH 1RK1B 4UNVA 4RBPK 2BNQE 2FJFA 1ZT7A 4MHHG 1KXQE 1P4IH 3CFKB 3OGCA 4GBXC 3RWJB 5HDOA 5FA4B 1GGUA 1KTLA 1E27A 3EDKA 2CIIA 1VGEH 5HYFA 3T0BA 3KJ6L 4RIRB 1TXKA 2D7PA 3I6KA 3N0PB 2IALA 3TIDA 4DUWA 4Q9QL 1B88A 1N4XH 1WWWX 1FNGA 2R0LH 1OLZA 1J10A 4PRHE 1S5IL 3MV7D 1X3DA 2FRGP 5D93C 2GI7A 4OTXL 2VXUH 3CU1A 3O4OB 5D5ME 4JFQA 1EGJL 2VWEE 1FVCB 1AGDA 1KEGL 5DVOA 1MWAH 4K3DL 3UAJD 4PGDA 3L5JA 1CR9H 3HB3C 5E8NA 1LO5B 4MCYA 1QR1A 4U1KB 1CCZA 2ADFL 4YDKH 4RWHA 4HWNA 3ZYIA 4R2GC 4Y4KC 3V4PL 5D6DC 5TFSL 5DA0B 1ZT1A 1H15B 3OKEA 3OAYH 5H94B 3UYRL 4FQLH 5A3ID 5DHVA 3HI1B 4DGIH 1EGJA 1QSFB 4I0PB 4P49A 2EH8L 1KB5A 2XKSA 5IBLC 1JPFB 4PV9B 1C16B 5KOMC 3DXAE 3WHE1 3I50H 4MB5A 2ICWJ 3QWOA 3N1MC 3MV7A 3R1GH 5GJTL 3C2AL 3LB6C 1F4WH 5FO7B 4Z6AT 1G7MB 1QSEE 3K8LA 4KRPD 3WJJC 4KUZL 4MJIB 2JJTC 3BEWB 1CE6B 5C0GB 3PGFL 1U93A 2D03H 4PRIA 3ARFC 4HUVB 1MJ8H 1Z0MA 4OBRA 4ZYKA 2AEPH 1HQRA 2JKXA 3QSKB 1QLFB 3BDXA 2FYYA 2F5BL 5K9JL 3QJHB 5DHYA 3ZT7A 5T3XL 5JPNB 4YAQB 4P3DB 1KIPA 3UP1A 4NO0B 4WJ5A 5IVZA 1EDQA 4R26H 1TJHH 2B5IC 4OB5H 2H2PD 4X6EA 5J9PA 5ILTH 3AU1B 2V7HB 3OPZH 1TPXC 1SJEB 1HNGA 2VH5H 4M7JH 1FGVH 3CLFL 4YBLB 5GISH 1OGAB 3UDWC 2NY2D 1U92A 5CEZE 2E8ZA 3KPRB 3TBTB 4O2EA 3SDXF 3UMTA 2DL9A 3V5KA 4NYLA 2KPNA 5J6HB 5T1KB 2PF6A 4EUPB 1II4E 2VDML 4U2YA 1I1AC 1CFBA 5IT2L 5CJ5A 1QVOB 3NA9H 4CGTA 3ZL4H 4ZFZB 3MBEA 3VD5A 4QLRA 3ARSA 3F12B 5L2KD 2Z35B 1YNLH 1GZQA 8FABA 4NCC1 5JQ6L 4DJMA 5EUKB 4ZTPL 4FFVD 2W9DL 4NZJA 3RVUD 4CL7A 4X7SL 1I1CA 3MV11 4JFDD 4HK0A 1JZ4A 3N85H 3RIFF 3TN0A 3UTSA 3A6BH 1NCCH 2HT2C 1ES0B 3HNVL 4GFTB 2ZUTA 1KCUL 4XI5D 2P5WB 4NSKA 4L9LC 5JHDE 2IGFH 3HZKA 1OAZL 3M8OL 1M1SA 1OAYL 2ADJA 3QPXH 1HI6B 3WS3B 2NY5L 5CP3H 3QEUB 1ORSB 2BNRB 4L8DA 4C58B 1N2RA 5T1LB 3MYZA 2BVYA 4G8GB 4M4PA 4BQCA 5I1AA 5L2KA 3G5YB 4GRLC 3IF1B 1A7PL 3K46A 5GS0H 1MRCH 4OI9A 4WW1A 4BYHA 3BGFC 1ORQA 4UQ3B 4M6OL 1PLGH 4PRNA 5I1IL 2B7DT 1LO3H 4UV7H 3C8DA 4D2NA 4S1RL 5EBLB 2HT4C 4Q97A 2VDLH 1Q9WA 1PG7W 5AAMA 3DBXA 5FHAH 3MXVL 1YMHA 3BD4A 1JIBA 5E6IC 5FB8A 4PGEA 1IL1A 2YD9A 3IRZA 1RZIA 3FAWA 1CE1L 4F7CA 1QZ1A 3B9EA 1S7TB 4R3SB 4KJPD 3G9AB 1W8NA 4X4YA 4Z5RA 4M1CD 4DN3H 2Z92A 4KQ4L 4XP6L 5ISZE 3I9GL 3IFLL 1B3JA 3SDXB 3SPVA 2R2EB 5DUML 1S8DA 2NY7H 5K59F 5F7DA 2BVTA 2GSIB 2ZCKL 2R0ZH 4I2XA 4LFHG 3WHXA 1YEFH 4K7FB 1NBVL 4HEME 2FR4A 1ZSDA 4HMEA 3MTRA 4MZ2A 2AQ2A 2HN7B 4AMKL 4PD4J 3PABB 5HI4C 1DL7L 3HFMH 1N7ML 3AXLA 3VFNA 2QKIB 4QHUA 4X8JB 2ILLA 2C7UB 2NXYC 3GK8H 2KZWA 1EHLH 4NKDA 4X4MA 3P0VL 1A6ZB 4DZBA 1IGIH 4ZMAT 2KZ1B 2YD7A 5D8JL 2LE9A 3DX9A 3QNXB 5D4QA 4MA7H 1NDGA 3G5XB 5EO9A 4GRMA 2Z31C 4MA3B 3W9DA 4HKZA 3QIBB 4OM1H 2YK1L 1YUHB 3MYJA 2ZUYA 1AD9A 3QUZB 5HHNB 4KK5D 5C0BB 4MXWH 3NGBB 3WFCL 5L8JB 1Z2KA 2WQ8A 5IBTH 1MJJB 4MNQE 4FMFA 4X99B 4XP5L 2HVJA 5DGQA 4HXBL 1EXUB 2DYPA 1OARL 2W0LA 3B3IB 3TPUA 4PG2C 4JQVA 4XH2B 5LGJB 2V5YA 3CVIH 4ODUB 1MFEH 1J1XL 4NBYB 3RWHA 2NMSA 2UV3A 4PBWD 3CSPA 1A6VL 1HKFA 5DK3A 2NY1C 4S1SL 1U42A 5C0DA 1ZAGA 3QWRD 1BZ7A 2XWJA 4LCWE 2XG4A 3H9ZA 3U79A 5TDPA 5LVEA 3BKMH 3DRQB 1LE5A 2ESVD 1TZGL 1TQBB 1ADQL 1S7QA 1I8LC 1BEYH 3P9WB 5IEHB 4XNQB 1T0NB 3LIZH 1F4YH 1FC1A 1CL7H 3C8KB 3EFDH 4ZSOE 4P2OB 3LS4H 2EZ0D 5D1ZB 3DV6B 4LEXL 4XCYA 1AHWB 3S88L 3WD5H 5IOPB 5HD8C 1ZHNB 4L29A 3H9YA 4LP4A 2YRPA 3VXNB 5KANI 3GB7A 2PXYA 4HS6B 3ARWA 1JF6A 1WFNA 2J8UB 1U8QA 2AXFB 4HBCL 3QWRA 2NZ9D 4QY8B 5C0JB 2VLKB 3MV8B 1JPSH 1ONQB 3X14B 4NQDE 2ESVA 1L6XA 2XNAA 3FB8A 4C56E 3TFKD 1ERNA 3RY6A 4DAGL 2DBJA 4F58L 3QUMH 3VW3H 4PJDA 2NTSP 3GSVB 1MHCA 4HKXA 3MCLH 1AXSB 4P3CL 3MBEC 1CDJA 1YEGL 5EUOF 2C3VB 5EC1B 4NPYB 5HGBA 4JANB 1GGCH 3G5VB 4KK8D 1MF2H 3Q5OA 5TE6L 1IZJA 3MRBB 4HX1B 1BD2A 5DFVC 3DHMA 1I1YA 4LASL 4DOHB 3C9NB 4HK3N 1FZMB 3BGAA 1ZTXH 3QDMB 1CDUA 4JCMA 3GBMH 1I8MA 1KPRA 3MUHL 4WHYG 3TN0C 1DLFH 4V1DE 1UA6L 1CGSH 5EOCH 4MA8L 5IROC 4J3TA 4R97B 2CDEB 3SE4A 4K7PL 4J8RA 1EEZA 4UOW0 3BZFB 3DGGB 2CPCA 4R0LA 4U1MB 2Q8AH 3BP7B 4U1IA 3O3UN 2DLIA 2QTEA 4KKAD 2CGRL 3S34H 2B39A 2A6IB 1JI1A 3WNLA 32C2A 2IQAB 4MD5A 1ZLUH 3WKNA 5B38B 3VWKB 2X1QA 2AQ1A 4NKOB 4CN6A 2N7AA 1CWVA 2P5EB 2NY5C 4NCC2 4BZ1L 4YHNB 5GRJH 4X7FC 2EEBA 2YUZA 4OFDA 2ICCA 4R7NB 4L4VD 3HE7A 3LOWA 1S7RA 3TO4C 1EA9C 3QDGD 3EDEA 1M7IB 5FHBH 1MY7A 1NUFA 3BP6B 1MJ7H 3ZTNH 5E1AB 4KI5C 2X44D 1LO2L 2FX9L 4Z78A 5BS0A 4X6CE 2MQ3A 2VLLA 2FZ3B 5GGRA 1CDCA 2ATKB 4GXUN 2VSDA 4E5XA 4C4KO 4OCMC 3CFDB 5EG6C 2YA2A 3KLDA 1MFCH 5C3LD 1D5XA 3UTTD 3VFOA 4EKXA 1I8KB 4BQ8A 4G7YH 5J1AA 2F54B 4K3DH 2H2SD 5I8KL 1UWGL 3VXPB 1DBAL 1EFXB 1I1RA 2MNUA 3P30H 5DF0A 1CVSC 1KLFA 2Q7YB 2CUHA 1CFSA 4LVEA 1KENL 3QDGA 5CHNB 3MQIA 4M00A 1VEOA 2NY3C 5HDBE 2GK2A 1FL5A 4E0RB 1JBJA 1OGTA 3FTGA 1T66D 2VL5A 3ARGB 1E4KC 2C4FT 1XGYH 4WEBL 2Y1VA 3ROOB 1NC4D 2OJZL 4Z7WB 1MFAL 4PPTA 2Z93A 3T65A 3TA3D 1T1WB 1MLCB 1RVFH 2V2XB 4XAKE 1QFWH 4XCCL 1CK0H 3C6LC 4ORGA 4UU9B 1YPZE 1A4KB 3UTTA 1W72H 3NN8A 3QAZC 1RHFA 3PGFH 1UEYA 2H3NB 4OCYL 4QTIH 4XNMA 3DI2B 1Q94B 2QHLA 3BD3A 3FFCA 5LG1A 4PYGA 2VISA 4ZFFA 1CXLA 1CGWA 2P8LB 2GY5A 3T0EE 1T6VN 5ETUB 2JK5B 1NBQA 1R24A 4M8QB 3X11B 3WNKA 3ULVD 3LKNA 5T3XH 1D5BB 4PJHB 3PL6B 3KWWB 2GJ6D 3F7QA 4RFEA 4D3CL 5EORH 1NC4A 4QHLB 4EDXB 1KNOA 4RFOL 1S3KL 5B8CC 1NC2D 3I6GB 3HMWL 4WY7H 4JKLA 1ZHKA 3EJYC 2YSSB 4UDTA 2IMNA 3IJSB 1JYXA 2BVUA 3IDXL 1KJMA 1NANH 5DMGD 5T3ZH 1UCBH 4NN6B 3DETD 1HHGA 1FZKA 4K7PX 2VDMH 4CMHC 1KN4H 4JRYD 1BBDH 5IVXF 2IADB 3D0LA 2YRLA 4EXPX 1B4RA 3MLTB 1DZBA 5DD1L 3DUUA 5JQ6H 2BZDA 4G8IA 3BUTA 2VQTA 3NH7L 2XYCA 4MS8D 5JMRA 2HG5A 4QCIB 1FORL 4ZFOA 2ZG2A 4YHIA 4WRLA 2AEIT 3OB0K 3VD4A 4FQQA 1NCAH 1WITA 3MRQA 4YHPB 1FQ9C 3HNVH 2EKJA 1BECA 3P77B 3PQYE 4ZODA 1KCUH 1CDIA 3O6ML 3OR6B 1DP0A 4YGVA 4N8VG 4NZUH 2XA3A 1BJ1J 2MKLC 1YMMB 3T4YB 1OAUL 4QNPE 1KUMA 2QJDA 5TQ2L 3IXTA 4OLWH 4JRYA 3JWNC 5ELIA 1NCTA 3P4OB 5IWLC 3QNZA 5EZIH 2NTFB 1PFCA 1S7XB 1DQQB 1U8PA 2IG2H 2YXMA 5A16B 3L3IB 3WE6A 5IQ7L 4LKXB 4ODSL 3DXAA 2LVEA 3QUYD 5GIRA 3O3DB 2R8SL 3JUZA 3FKUS 1DFBH 3OL2A 3MZGB 1QSEA 3L9RB 3PNWB 4U1HB 1JJUA 4HIJA 5JW4R 1XGTB 3MXVH 2ED8A 3SDAA 4Y19D 2GITA 2V5RA 3A6CH 4WFGE 4O9HH 4POZC 3O3AB 4UNTA 1BQSA 1CE1H 5DUBA 3WNNA 1XR8A 2OL3H 2MPAL 4LPWA 3IFOB 3O0RL 1FFPA 2PO6B 2ID5A 3SE4C 1HCVA 4N0FA 5BRZE 5CEZL 1R0AH 5JOEA 3DSFH 5TPWH 2C26A 1CD8A 3L3DB 4R0LC 3BVNA 1MI5B 3QUYA 3RUGE 3GSWB 1WAAF 3IFPA 4HHAB 1G7PB 1ZA6B 1G6RH 4RX4A 1PKOA 3K7UA 5KSVB 2ZCKH 3GKWL 4HF5L 3V0AC 5IB4A 2R0WL 3AREA 4XRCA 4TUKH 5KAQF 1JHTB 3SO5A 1BJMA 1JWMB 1MWAA 1YEDB 4UQ2A 3WSQH 1GXEA 1D5ZB 5DJZB 2HT3C 3SEPA 3CFEA 2Q76B 1WC7A 4ZUWA 3CDYA 3EO1A 1CBVL 4N8VA 4AMKH 4LEOA 3V6FA 2XICA 1RJYB 5I66B 1EEUA 1DL7H 3OAYK 4Y4HD 2OTWB 1N7MH 4NQCE 1SMOA 3BX7C 5I6XC 3U0WL 4OZGA 4G6KL 4Y2DC 3VFUB 4AENA 4UV4H 5GZND 5F6HJ 3L3GB 4GAGL 4OKVB 3P0VH 4H0HB 6FABL 2BOCB 5SX5H 2C9AA 2DM7A 4LKCB 4J3WA 4NKIL 3QBTB 4E41E 3UPCA 5KVFL 4HUXB 1UYWL 1P5UA 1INDL 2P8PA 3NFNB 4AH2A 4OIAA 4Z7UB 5D7IF 5C6TH 2QADD 4WW2A 5FECA 1FL6B 1CGTA 2G60H 1IAIH 3CC5B 3FQWB 5FM5O 4Y4HA 1DQML 4HJGB 4LARL 5C8JB 3TYFA 1OB1A 4HXBH 1IGTB 1QBLL 1P84J 2UVEA 5DFTA 1FHGA 5DJ0A 4NN5C 2EH7H 5BJTA 3NVQA 3WFBH 4PJIA 1P7QB 1K8IB 2W0FB 5HHVL 5F7EL 4PGCA 1JRHI 4WFFE 5E08L 4ZFGL 1KT2A 1YJDL 2ITDA 1G7IB 3FN0L 2EDNA 1YDPB 3CSYB 4UIMB 5L88L 4PJ9B 4WWID 5DEFA 5DQ9A 4TUJB 1XIWD 2AVGA 3D25B 4JM2A 1HK6A 3LMJH 3OAUL 4O4YL 2X2YA 4PJ7B 4OV6F 5EU7E 2V5MA 3QZWB 3IGAB 1U2HA 2DKSA 3OGOE 4I8DA 1U8IA 5IB5A 4J7RA 4LEXH 3RVVD 5GS0D 3PHQA 5ISZA 2HJKA 2XTLA 2QR0B 5F3BA 1V3JA 2NY0B 4QRSA 1TNMA 3U83A 3JSSA 1AKJD 4HUWB 3CFIC 2ICEB 3WIIL 1XAUA 2GFBA 2W9LA 4UI2A 2Z0BA 4HBCH 1CGUA 3H3PL 4N1EA 1XCQA 1L0QA 3V4VH 1CFTA 5ERWA 5I18L 3QIUB 4ZPTA 3AM8A 3PDOA 1IGYB 2VXSH 4XTRC 3O3BA 1U8MA 4KXZH 4P2RE 4HLZH 3UTQB 3LQAL 2WAHA 5LGHH 1PQZB 3CUPB 5CP3A 4CADB 1JGVL 1EV2E 4DAGH 4LLQA 4DN4L 4RISH 4JLRB 1BFOA 1TVBA 5ID0B 4KFZC 1J1PL 2LTQC 5EU3A 4P3CH 2UWEF 1NFDE 3AFLA 5I76A 3R8BB 1FJ1B 1G7JB 1K6QL 2X7LA 3LD8C 4XNZC 3JUYA 1O7VA 3IJYA 5GS3A 1MAJA 3CH8A 3HCVB 1AJ7H 3SDDC 1JZ2A 2CK2A 4NM8L 5IBLD 3MMEA 4L3EE 5TE7H 2NPLX 4M7LL 5SWSE 2G75B 3RGHA 4DVBB 3TF7C 2VWEC 4MA8H 4ODVH 2N7BA 4WDIA 4JJ5A 2ZJSH 1PZ5A 1KPVB 4NWTL 1RJZB 4DEPC 4Q2ZA 4K7PH 1IGMH 5IVOA 3ARFD 5FM8A 3BWUC 4MNQA 1QBMH 4WNQB 5MERA 2NY6B 5I15H 3U0TB 2CGRH 1FCGA 1AY1L 4HJJH 4RNRB 3FL7A 3KYAA 1OD9A 4U6XB 4KGJA 1CG9B 1T80A 2BVQB 2EDLA 4UDUA 1A1NB 3VRJA 1EAPB 1F4HA 2C1PB 1NGXA 4GKNA 2BOBB 4Z7VE 4M6ML 4N0YL 4X6DA 1MCJA 5C09B 1I3RB 4BZ2L 5KSAC 4JFEB 4LCWA 1JNLL 3N06B 2XZCH 5I73C 2C1OA 3ZKMC 1HH9A 2AJYL 1A7RH 4U0RB 1ITCA 5HGGS 2UVFA 5J13C 3O8XD 3D85B 1F58H 3LKQA 2B1HL 3OF6D 5D72H 3KLAB 4S10A 1NCWL 3OSKA 5ACZA 4JFOA 1OCWL 1OTUC 3CXHJ 2HVKB 3EOTL 5KS9A 3FO2A 4Q6IC 1LO2H 2I60H 3O4LE 4U3HA 4YDIH 5AG8A 4JY4B 1KCLA 4HPOL 2MTPA 3HR6A 2DKMA 2WANA 4BFGA 4L8CA 2DLFL 5HHPA 1LDSA 4IIQB 1RZKH 5IFAH 2B0SH 1WFUA 4CBPA 2UYLA 3QH3A 4PGBA 5FKPA 3SDYH 3D3VE 2VXTL 4Z7NF 4K9EL 2P24A 5I8KH 1KPUB 2UWEB 3O8XA 5TJWK 4HS8L 4LDLB 5ENWB 4N1CA 3MRLB 5C0ND 5E6YA 4XXDB 5AUMB 1JNHB 2GYSA 4OUUB 3BIAX 5F1OB 3I6LD 2ZNWA 4PRPD 2X9XA 5I19L 4I48B 2VYRE 1J8HE 3S4SB 1MFAH 1CQYA 2QHRL 3JVGC 1MLBA 4XCCH 4JRWA 2ZPKH 1K5NB 4P5MB 4XHQA 3QXUA 2ITCB 1BHGA 3O45A 5FYKU 1MQKL 4XNYL 1XH3A 3JWOL 2IANB 4I77L 1YEHL 5I8EA 4NRZA 2X5PA 1NLBH 3H42L 4DZ8B 1A7NL 5FFLA 3ARBB 1INEL 3OJVC 3EGSA 3TZVA 4Y5VA 4D3CH 2JIXB 4G80B 2PYEE 3V8CA 2YBRB 2AJXH 4HIEA 4MQXD 5IHUL 3W5MA 4XBEL 4NBXB 1IT9L 4GKSA 3GIZL 1NFKA 3MXWH 1R3IL 4FOMA 2YRZA 4MYWB 2R23B 4ESKA 3RY4A 4NO5A 1T22A 4JM2C 3KYNB 4D9RD 2HTLC 3RZCD 1T7XA 4ONGL 1KFAH 4I18C 4PJDF 1NEZG 3NCEB 3CVHB 2WLYA 3FZUC 2VDPL 1YN6B 3U36A 1YJDC 3OZ9L 4HKJB 4YQXH 3WO3B 4GG6A 3REVA 3TBVB 5BQ7A 4HIIA 4M7ZC 5F7LB 3C5ZD 4LSTH 5FUZH 1OAXL 2W59A 2P42B 5I2IA 5C07E 4DK6A 1IGJA 3QO0B 2JJUA 2VJXA 3P73A 1Q72H 3NFSL 1AGBA 2RQ8A 4P4KC 5DMKB 4U49A 3TV3L 3O6MH 5GRUH 5D7JB 4UT6L 1J5OL 1YY9C 4M4RA 1A9EA 2VDNH 1TMCB 5TQ2H 4BZYA 2JB5H 2IAMB 1F6FB 1AXTH 1U58B 3FQNA 4ZOAA 3RZCA 4X5XB 1FFQA 4IRZL 4TULH 4DTGH 5C2UB 5D7LB 3DTXA 2Y7QB 3LEXA 4PRDA 3IETB 5CWSB 4G5ZH 1KCKA 1QRKA 1W0VA 4LSQL 3T8XB 3N1GC 3CK0L 3C5ZA 1ZLUK 1S9XA 1OSZA 4JEGB 4R90L 4NP4L 2P8MB 1A9BA 5LWYH 5A1AA 1B4JH 4AEIL 3GSRB 5INCB 5I1DB 3OXRB 3K8KA 5F9OL 1YPZA 3TVMB 1HIML 2FH6A 3LEYL 1UWXH 5LAXA 3C2SA 3L3KA 4JO3H 1LGVA 5JDJA 1KCRL 2G9HB 3VXRD 4MDIA 3VFPA 4XCEA 3MJGX 3IXAA 1ZT4A 4PJ5B 3QCUL 3VWJC 2FH8A 2WBJA 2IH3A 4GRWF 3AB0C 3O0RH 3RX8A 2EIZA 1OW0A 4QRQB 3CFBB 1I3GL 2BNUA 4HWBA 5D2NE 1T3FB 4LLUB 4OFIA 1L4IA 3FO9A 1NEZA 1J0IA 3GM0A 4KDTC 1GL4B 2D0GA 2EYRA 3VFSA 3GKWH 3MODL 1NH6A 1X5JA 4POUB 2A6JA 3WL9A 2XFXB 1HYRC 2R2HA 2FEEL 3DVIA 4WHCA 4ZUTA 5L9DL 1VADB 3VXRA 2BRQA 4X7EC 2WBWB 1UGNA 2CLVA 2H26A 2X42A 4Q9RL 1ODAA 4ENED 3MRFB 3LN9A 2R4SL 5C0AE 1UZ6E 2JJSA 4XVTH 3NA4A 1RHHA 5CFHA 1KCSL 2FBOJ 5T3XD 5DO2C 4MNGA 1MCKA 2HH0H 1EJOL 3RDTB 5DRXB 5F44A 3QUXA 4U6HB 4HULB 2CR3A 1AP2B 1QA9B 1X5HA 4KTEL 2DDQL 3EDDA 4OZIE 3OJMB 1FCCA 4GW1A 1K8DA 2DLGA 1JPGA 3TH4T 4ZQKA 4NOFA 1DDHB 2AXJA 4ALAL 5JW5B 3KYMA 5T3ZD 4OZHE 1E0OB 2BXZA 5DFVD 2KKQA 2DTML 5FGBA 1C12B 3ZLQC 2IBZX 1DUYB 1BFVH 4OZ4A 4RGNE 2F53E 4OZFH 4WFHE 5FM4A 3MUZ1 1AE6L 5EZLA 4NHUB 5E5UB 4YX2L 5D2LB 1N3NB 3CSGA 5IMLA 1I85A 3F6LA 5DRWB 3BAEL 3C60A 1BQHB 4LBEB 5TF1L 3WN5A 4ZD3L 1GC1H 4K9EC 1HQ4B 3UCRA 4H20H 2Q86A 5CS7A 3RNKA 3S3JA 2OXGA 3GSOB 4JDZA 2CUMA 4JKWA 3ZYZA 4ZFGH 3FN0H 3W82A 3I75B 1YY8B 4TNWK 4EI5B 3DYPA 3MJ7A 5L88H 1K4DB 1ZVSB 3ARVA 4GW5B 1LO0L 2O5XL 4HG4K 5CD3A 1EX0A 1FAIH 2ORBH 3VGAC 4FFYL 2VOTA 3IFNL 2XKUA 5J12B 3W2DH 5BRZA 3U30B 3ULVF 5EU4B 3MRMB 2D7NA 2V2WB 5F9WB 3CDGB 3HHRB 3OV6A 1GAFL 4UAOC 4HW6A 3RWDA 3ZZ1A 4XPGL 1GGTA 4KI5D 4HH9A 2J12B 3CU7A 1KULA 4N0RA 1HEZA 3JXAA 4O2CB 3WIIH 4Q7DA 4PY8I 1C1EH 3RL2B 2F58L 3HUJB 1RUML 2VXVL 3LEVH 3JWOC 1YECL 3V0WL 3QNYA 2YUWA 4KMQA 1MCPL 1TETH 4IOIB 5CIPB 5EZJA 1DLHA 3BKCH 5E5MA 3GSXA 3LQAH 4KU1A 1JGVH 3ULUH 2A6KB 4DN4H 1P69B 4I3RH 1LK2A 1GSMA 4HBQA 1BQLH 2MCPL 1F4AA 4ZAKA 2ZG1A 1IGFL 1DANT 4N1HB 1FFRA 5GXBB 3VXOA 5JW4M 5CP7A 1MHHB 1X6LA 4YHKH 1K6QH 3NABH 4XPBL 3DV4B 2MHAA 1JNNH 1AO7D 4NDMB 3GIVB 3MRGB 2DL2A 4D0CA 4F9LC 1U8NA 5HHQA 3DVNB 1DBMH 2GQHA 4PJXA 3ZHDA 1N5AA 4RRPG 4P9HH 4X83A 5GS1A 1H5BC 1KN2L 4QRRE 1SYSB 4H88L 3GBNL 4PG9A 1FNHA 1LD9A 4ODBD 5I1JL 4K3EH 4G9FD 4W6YB 3JV0A 3NCJH 1ZANL 1TZHA 4APQB 4F7TA 3BSZL 3HMXH 3C5SB 5I1EL 4BUGA 3PIQB 1F6LL 1A6TB 3MR9B 2DI9A 3KPMB 1OP3H 3V5DB 5C9JA 2YR3A 5DWUH 3SBWA 3VFVA 3S96B 5JLZB 2SEBA 3G6DL 4LGSB 1AO7A 3WYRA 5IQ9B 1G6RA 2BVOB 2Z8SA 3DVFA 1RI8A 1F4XL 2C4FU 2DQHL 2W9EL 3BN9C 3UPRA 2VABA 4LQFH 4JDTH 4N0YH 1KEMH 1CF8L 1SVZA 3NPSC 4QT5B 4BZ2H 2X4PB 5E70A 1U2CA 5BVPL 4RMWA 4RQQB 5GGSY 2NX5E 4ZXBC 3HI6L 1U95A 5MI0C 4NRYA 2A73A 1QFWM 2X70A 5E99L 1Y0LB 1TQCC 1EAJA 2GJ6B 5EU6B 2C5DC 2CK0H 1IQDA 2LAGB 1I9IH 4GSDL 2QQKL 4YE4L 4HKBB 3ZDZE 2BJML 2F15A 2J6EL 3T0EC 1MCOH 4OZGF 4D9QE 6CGTA 4O5LL 3F5WB 1YC7A 1HXYB 3BZ4A 1VEMA 5SX5K 2E3VA 2FDBP 3QXWA 1WIOA 2YZ8A 1CXHA 1ZVHA 3HE6A 4PP1C 3VRIA 1RIVH 4D0BB 4EN3A 1FRGL 3PGCA 1CL7I 4RRPA 2W1NA 5GGSA 5TF0A 4HLZG 2ERJC 1GIGL 4K9EH 4OT1L 2X4NB 4P5TA 3HG1B 4AIZB 1YN7A 5EOTA 1HINL 4P2RA 2AJZA 3IDMB 4WW2F 2FLRT 4HS8H 2H8PA 5C0CE 1UZ8A 3QI9B 3WFDH 3KNBB 1YEEL 3MNZA 4KROC 4X9BA 2JJSC 1INQB 1NFDA 5L2JA 4KJYA 3TPKA 5IHZB 2EDFA 2MCG1 4U6VL 5DJ6A 5I30H 1L7IL 4NN7B 4F7MA 3SE9L 1KC5L 4PJIF 3V79C 3AGVA 2AK4D 5CJOH 1KYOK 5EFIB 4YPGA 3E2HB 5MEOB 4QGYA 2VDQL 3V6ZB 5KSBB 1PYWB 2WWKO 1PX4A 3MLWL 4JG1H 4RFNB 1YEKH 4GKZB 4XNYH 1FZJB 1QLEH 1H3GA 2BSSA 5KJRH 4PLOB 1IC7H 2EDQA 5IFHL 4I77H 4BK5A 4BSVB 4ZS6C 3J7HA 4POZD 2FJGA 3H42H 4BQ9A 4MAYB 1A7NH 1SJVA 1INEH 1GGYA 4I4WB 4L5FH 1I85C 4M5ZH 3C60C 3ME0A 1M71A 1JWUA 3MRDB 4XVUD 4WCYL 2FEDD 4Z7VA 5AYUH 4PJBA 5FO9A 4FQCL 1AIFA 1HE7A 4JFZH 4JFYA 3EOAB 3TCLB 5JHLL 1PVHA 4RSVA 2XA8L 3ARQA 3GMNB 4Y16A 1R3IH 3MFFB 4MJ6A 1NKOA 5F9DC 3WKMH 4JDVB 4RAVB 5HI3D 3ZSTA 3U1SH 3BPCA 3HR5B 4MJIE 1B0GA 5MP6H 2FX7L 1RZGB 3ARDC 5GPRA 1NFIB 4ONGH 2FO4A 1N6VA 3FOMA 3D0VB 4D94A 1C7SA 4BM7A 4QF1A 2GTZA 1S7VA 4Y2DD 4POYA 3MRJA 1B90A 3DVGB 5IFJA 4BSWB 2YEZB 3DMMD 3PJSA 5DC0A 3D3VA 4G6AC 5HHOE 3TV3H 3QQNA 1J7VR 3PV6B 2GT9B 5ICXB 4JO4L 3ZYJA 3H9SD 4YDVB 3NAAL 4IMKC 1JN6A 1UH2A 3I2CH 5DD6B 1LK3L 5FYLL 1ITBB 1BAFL 3B8YA 3BYYA 4WWKC 5CKAA 4JKPH 1QFHA 1JK8B 1WF5A 1MH5B 2F74B 2DD8L 1FNEA 1X5ZA 1OWRM 2APWA 2VE6A 3VXSE 2Q1EA 3CK0H 4AZ8A 1HHKB 3ZSSA 3O6FD 5EO1A 3TBSA 4R90H 3LS5H 1JGDA 3EYVB 5FO8B 3ROLB 4QHNA 3FFDA 4YZFF 2QADB 1BMGA 3IDGA 4JZOB 5CGYC 1KIQB 5F9OH 5TDOA 4X6DF 3MRCB 2BY0A 3ELAT 4OCXH 3DMMA 4XB8A 3BMVA 5E2VH 4YHZL 3RKPA 1U8LA 1V3LA 1MCWW 3QEHA 4S1QL 3DUSB 4PB9L 3S35H 3TO2A 2A74A 4JZJA 3SGDH 4Y4FC 2DQEL 1WTGT 2DLHA 1HZHL 2XPGA 3EAKA 1S9WA 3QCUH 1MEXL 1DTUA 5FA3B 2DJSA 3L5WA 1I3GH 4FQ2L 1NGYB 1IAIM 4XGZB 1QFWI 2ADGA 5KS9F 1D6VL 2XWBA 5C6PB 1NGQL 3WO4B 1HN1A 5DQDH 3SBWC 1RUAL 4QXWA 2V17L 3BRDA 4TNVK 1N6QH 2BNRE 2PYEA 3MV9D 3P4MA 5H8DA 5LCVH 5I8CB 3IJHB 2I9LB 4N9GA 2XWTB 4LK4A 5L9DH 1PEZA 2EICA 4GUPB 2DI8A 3GMMA 4GBXB 3VXUD 3GRWL 1FG9C 2AABL 3FB6B 1WBYA 2R4SH 4NFCA 2F8OA 2ZCHL 1UJ3A 4W6WB 4YBQC 5ITBL 2D31A 1T1YA 3SQOL 4NO2B 1KCSH 2EDYA 5DMIH 1DVFD 4NJ9L 1EJOH 3N50A 1A2YA 1ZLSH 4U1SB 4HS3B 3FCTA 3MRPA 3V6OA 2X1PA 1QR4A 1R5VA 5ID1A 1NANI 5D93B 4C83A 1AQKL 3GRWA 3D2UD 5C07A 3RRQA 1QACA 3MV9A 4BFBD 1DBJL 2YWZA 4ALAH 3HE6C 4MCZB 1N0XL 1KCVL 4RDQF 3SDXE 4NQSB 1YZZA 3V7MA 4KJQC 4LCUA 2ENYA 3TYGH 4R2GB 3VCLA 4Y4KB 5JMOC 3VXUA 4ODWA 2CLRA 3RA7H 3IDJB 4MXVF 3D9AL 1ZS8A 3C6SA 3QEQE 4PJEF 4BQ6A 1DVFA 4BH8B 3HZVA 4Y1AB 3OXSB 5DEGB 5EN2B 1RURH 4QYOB 2E6JA 4OUOA 4PP2B 4PJAA 4ONHA 2YPLB 5HYQA 4RMQA 4PREB 5I71C 4MGXA 5B39B 3HZYA 2VAAB 1JPST 3E6HA 4CVXB 1HHJB 3PWPD 3QUKB 3ARFB 3B9KA 1F3DH 5FYKE 3QCTL 1J1OL 5DQJA 4NRXB 3WFHA 5B3JF 2O5XH 2CXKA 5DJXB 5KSAD 2YPVH 4NKMA 5CBEA 1IC4H 1K85A 2O5YL 4JPWL 4FNLH 4G6JL 1JF1B 4KC3B 5GGUA 5E8OA 4LU5L 3QQ3B 5TH2A 5ESQB 1NMAL 3PXJA 1FE8H 4X6FB 3RGVC 2B5IB 4EI6A 1X7QA 3FN3A 4QXGH 1WQVT 3QJFB 3DO7A 4GG6F 3GSNL 1OTUD 1TPXB 3RPIB 4LRIC 3RBGA 1UXWA 1MREH 3MGOB 5J6GB 2OP4H 4WFED 3GJFB 3SGKC 4KK9C 1RUMH 2VXVH 2FWOB 3V0WH 4PTUA 1X44A 2E27H 3PWPA 4WI9A 2VLME 1K9TA 2QL1A 3IU3B 2DQGL 3THMH 4BELD 1BJ8A 1MCPH 2ZSVB 3S9DB 3FQTA 1T1XB 2MWCA 1OLLA 5IM7B 3KLSA 1RUKH 2EDJA 3G6AA 2CXGA 3DNKA 3B2UD 4IRSA 3R4DA 1I1AB 4NN6C 1CFVH 1AR2A 2O61B 2XTJC 2WW8A 4XHJC 5C0AA 3KDMA 3QFDA 2MCPH 1M6OB 3L95B 4TUOA 1BWMA 2YXFA 4YEFA 5L8KB 1UB5A 2NW3B 1NJ9A 2VDRL 1CD0A 5GRYA 2CKNA 4ODTL 4GAFB 5K59E 4OZIA 5D7SL 1T1ZA 2E6PA 1QBBA 2XN9D 3LSOA 1UWXK 2H9GA 3SKNA 2BMKA 4OZHA 1YPZF 3GBNH 4L9LB 4OZFG 4PJEB 5ABDE 5I1JH 1SHMA 5CSBA 4XZUB 5E1HB 3JTSA 5D96C 4HC1H 2F53A 4JREC 2J8UE 3AUVA 4XAWH 3EYFB 5GHWL 1WEJL 2FNBA 4LCYB 1UB6B 2ATPB 3EHBD 3BP5A 4GRLB 2APXA 1NAKL 3FRUA 4CNIB 5FGCE 3VXTB 2VZVA 5E2UL 1S9YB 3BGFB 3G6DH 3RWCA 1Q9OB 5ICYB 1WFOA 3LZFL 3VDBA 1L9NA 5DGRA 2W9EH 2Q8BL 1C08A 1KELL 2BHZA 5CKGA 2XN9A 5IIEA 1CF8H 2IPKB 3QUMB 2BSTA 4LRNL 1CZ8L 1UKTA 3OAZK 4ZO8A 3PHOA 3V9FA 4RMVA 5E6IB 1YEIL 3T1FB 1T2JA 5A43C 4QO1A 3W0WD 3GHBH 1IKNA 4IHOA 3GJEB 5SWZD 1MHEA 1U91A 4F3FB 3Q3GB 1LEKB 4WENB 4JZJC 3JWDL 4XMLH 2EXWC 5CINL 4ELMA 4YE4H 4R96B 4NIKB 4P48A 3MBXL 2J6EH 2P48B 1HILB 5AD0B 3MLYL 4GXVL 4ZOCA 5EB9A 2VC2L 3U2SA 1U36A 3EOBA 2I9TA 3O6LL 4HGWB 5EH1A 1OQXA 2DWEB 5C86A 4F2MB 2P7TA 4CW1B 3M17A 1FRGH 3H3BC 4MQTB 4OIIH 4RMUA 3HC0B 3CX5J 3ET9F 4O58L 5F7KC 3RFZC 3W0WA 1DQJA 2OQJB 5DJ2B 1Q0XL 2VLRB 3P9MB 5E9DD 4OZFA 1E28B 4CDHA 5SWZA 2VAJA 1KB9J 5FGSA 4HWEH 5C7XH 5JXAL 2V7NA 2LFGA 1FYHB 2VXQL 4AYFA 4PB0L 3S8WA 3SY0B 3DX8B 5J89A 1YEEH 3H8NA 1YY9D 2NXYB 1UJ3C 4BFIA 4WHDA 1Z0NA 1K4CA 4RAUB 2IBBA 5ESVA 4P2QE 3MOQA 4U6VH 3HNTL 3L3JB 4GS7C 3WBDA 4M03A 1ETZB 4JVUA 1KLGA 2Z31B 1ED3B 2KH2B 3SJVB 3RWIA 3BP4A 4DGVL 5K93A 1A7BA 3HPJB 4TNWF 4UTAL 4CJ0A 2WV3A 1JWSB 1J87A 2VDQH 4JZNA 1R3LA 4M61A 2IPTL 2V5SA 4ZUSB 1BIIA 4LLVA 4M93B 3ULUD 3FQUB 1TCRB 2FB4L 1U0QA 4K2UL 3FMGL 4X9HA 2F54E 4EIGB 5HGAB 1FPTL 1LDPH 5EUOE 3VWJD 1S78D 3PWUA 1TITA 3QWOB 2X1OA 2A83A 2NY1B 1Q9LA 3DARA 4XP1H 4CAGA 1DQLL 1BPVA 1QBAA 2XI9A 3R0NA 4N9OB 3WXVL 1NLDL 2CDFA 3MJ9H 2XA8H 4GW4A 3QIWA 2D0FA 3TC9A 3W9EA 5JOPE 3ZKXC 1H3TA 2ZNXA 3TWCH 1LEIB 2FX7H 5ICZB 1DEEB 3QFJD 3RVXC 3CZJA 2VERN 4G42B 5HYJD 3DOSA 1WIUA 4UILL 4WUUD 3FAXA 4LLDB 3ARZA 3U0PB 5D2NC 4WJ5B 3IS1X 3G04B 1Q38A 4X5WA 3F7VA 2WIIA 5JW3L 4X6EB 4JPVH 1CIUA 4NNPL 4WU5A 1WBXA 5EIQA 8CGTA 4PJXF 4JHWH 2C3XA 4LSRL 2NY4C 3ZE0F 1N59A 4JO4H 4WU7A 4O2EB 2EEAA 2X89D 3INUL 3T0WA 1FNLA 2HLAA 5J3HC 1IM9B 1S5HA 2JELL 4IRJC 3CFCH 2EYTB 1MRDL 5CZKA 3MRHB 1Z9SA 5FYLH 1BAFH 1EJ6A 3JV6A 2NYYD 1A6WL 1OP3K 3MBEB 1HKLH 2DLTA 3O41A 3Q6GH 1RK1A 1TJIL 5FYJL 1KJ2L 1GZQB 3SE3C 3ZDYF 4M62L 3N1QC 2A1WL 3RWJA 1CXIA 5FA4A 1H3WM 1WZKA 25C8L 3K2MC 4TQEH 5K9OA 1C5CL 4HK0B 2Q20A 1QSFD 4I0PD 2RR3A 4RIRA 3FB5B 1AGCB 1B2WH 1MCWM 4X6BB 5FOJA 3TN0B 5J11C 4YHZH 2MJWA 3ZMRA 1KJ2A 1D5IL 4XPTH 4U1JB 3DROA 2X89A 5I1LB 2A9NL 1HZHH 1A02N 4F8QA 5ALBL 4S2SB 4OGXL 1JNJA 4EUPG 1F3JA 4L8DB 4L4TD 1NBYA 4U1KA 4UINH 4FZEL 4WW1B 1H15A 5H94A 4QOKE 3X3GL 3HI1A 5FV1L 4I0PA 4X98A 1IM3B 2BXYA 4NO0D 4PV9A 1C16A 1Q9WB 1MNUH 1I9JL 5EPMA 5GGTH 4CN4A 2AV7B 3DBXB 1U8HA 4OI7A 4M8VA 2QSQA 5FB8B 3TO4B 1G7MA 1W8OA 1IKNC 3TIEB 4MJIA 1CE6A 1OGAD 5C0GA 3ISWA 4P57B 3KPRD 1QHOA 2EDKA 4HUVA 4NNXA 3IDNA 1NFDF 4X4YB 2Z92B 2M2DA 2VZOA 1QLFA 1J0HA 4UT9H 3EW3B 5E03A 1VA9A 1KJ3H 1Z5LB 3F8UB 2RFXB 3G6JF 5L6YH 5JPNA 4YAQA 4P3DA 2DQUH 1D7FA 3JWDC 1NMCC 4NO0A 3ULSB 4I2XB 1IC1A 1MI5E 3BPOC 1D9KC 3WHXB 3HI5H 1DQDL 1RFDL 3RU8H 1V3KA 1TTFA 1YNTB 4CN1A 3AU1A 2V7HA 2A0LD 2QSCL 4OD2A 1SJEA 2VLJE 5LQBL 5IVXE 2NY3B 1OGAA 3IDUA 4AT6B 1Q9KB 3KPRA 3AXLB 3TBTA 3BD5A 2P5WD 3RVTC 4H25B 4JO1L 1JTOA 5J6HA 5T1KA 3X12A 4ODXB 4EUPA 3VXSA 1FBIL 1I8IB 1EIBA 2W07A 1DANU 2JF1A 1QVOA 4FG6D 4WI5A 4ZFZA 1XCTB 4G9FB 3C6LB 1CLZH 2M1KA 5T1LD 4Z7VF 4G8GD 1CGXA 3JV5A 3F12A 3V95A 4PJBF 2Z35A 3QAZB 3R06B 4KKLC 5EO9B 4HPYH 2B1AL 3EJJX 4K23L 4RA0C 2HKFL 2AK1L 1F13A 3TGXA 2EDTA 4Z7QF 3MOBH 3NCBB 4X0KB 3KXFD 2O5YH 4LLMB 2CQVA 2D9QB 2XY1A 4ZNEE 1ES0A 4YDJB 2QBWA 4LU5H 4QXUL 2CO7B 5DK0B 2OK0L 5IGXH 1NKRA 3VA6A 4KKBC 1CI5A 1KGCE 3H7BB 3VG0L 5H2BA 5DRNB 1AFVH 3U9PH 4YLQT 5B8CB 1HI6A 3C8HA 4PJGB 1I9RH 1ORSA 2BNRA 4PR5B 2EDWA 4G8GA 3QQ9C 1RZFH 3G5YA 3IF1A 5FDYA 5GRVK 1FYTE 3Q1SL 3LKPB 3RZWA 3SGJA 1U8JB 1BZ7B 2XWJB 4ODHH 4UQ3A 4HWZB 4LSUH 4OCLC 3RX7A 5EC2B 3QIWC 1A6UL 1RZ7H 4TRPL 4WTZG 4CMHB 1LE5B 1IQWL 2NNAA 1S7QB 2MSPA 5EBLA 4FXLA 5E5RB 5CMAB 1MCCA 4DW2H 4JPKL 4OQTL 3GSQB 2VQ1A 2VDRH 5D70L 1S7TA 4UNUA 5GSRB 1WAAE 5F97E 1A5FH 4R3SA 4JVPA 4L29B 5CZVL 3LV3B 4V2CB 5MHSD 4JFXA 5GRXG 2X4RB 4KPHH 3GB7B 5M94B 3ILPB 4WI2A 2DJ4A 4D0DB 1A1MB 4OQTA 5F7UA 1U3JA 1M05B 3SDXA 3RWGA 2H6PB 4Z8FH 4L9DA 3AC0A 3K0WA 1Q0YL 2HTKD 3Q48A 4M43H 3QIBD 4K7FA 3S37L 5I1HH 4CVWA 4M48H 1NAKH 1OHQA 3D39B 3QB7C 3QUZD 5F96L 5FYKL 4A6YA 1IJ9A 5C0BD 2GEEA 2HN7A 5E2UH 1ZHBB 3PABA 1FIGH 1EO7A 1YNKL 2QKIA 3MV7E 4TNVF 2JCCB 3L3OB 4HXAL 4OM0H 1I1YB 2C7UA 2HKHH 5EBGA 3SOBH 3IT8D 3GHEL 4YUEH 1A6ZA 1I8MB 1KPRB 1PKQE 5D7IE 2GTWB 3QNXA 5I1KL 3G5XA 3EO9L 1JHKH 4DFIA 4MA3A 1OTTD 5J06A 2AXGB 3QIBA 2X4OB 5KZCD 3SKUD 1EEZB 1YUHA 4Y88A 4OLYL 4YHLL 4R0LB 5HHNA 4UTBL 5C0BA 1U6AL 4GXVH 3GUTA 5I1CL 5JXEA 1CU4L 3ARDD 3D5OF 3MACH 4P2YA 1Z6JT 5FAAA 3BOVA 2DQIL 5JO5B 3SDCC 3PWLB 4X99A 5D9SA 4P2OD 3FQRB 5D1ZD 1EXUA 1CGVA 1EFQA 3GI8H 5HGHB 2HMID 3B3IA 3EYOB 1K2DB 3NBNA 2ICWI 3CAFA 4XH2A 3BPNC 5LGJA 2AJUH 4ODUA 4LLYB 2ICES 3EKCA 1Q0XH 4W4OA 5ITFA 5C08B 1EBPA 1Z3GH 5JXAH 4L8SC 1WCBB 2X09A 4PB0H 1A3LL 5JPMA 3FB7B 5FKAA 5I6XB 4Y2DB 2VLKD 3MV8D 2VR5A 1VERA 1CIDA 3DRQA 1V5JA 2YUVA 3STZB 5BXFB 3WCYA 4XNQA 2R4RL 3Q6FA 4Z78B 4XNUL 1T0NA 5BS0B 5DJAB 2VLLB 5EIIB 3VXQA 4PJAF 3HNTH 4NQED 4G6FB 5GGRB 3H9SB 1EK3A 1MCBA 1MFDH 1F8TL 4P2OA 5D1ZA 2KQMA 5GS2H 2DQTL 4UTAH 1AHWA 5B38G 2QQLL 1ZHNA 4P9ML 4LLWB 1X5XA 3L5XH 3MOAH 4HS6A 3L1OH 1F5WA 5F1SA 2OR9L 2J8UA 5LKNA 3QDMD 1CFSB 2CO6B 4MVBC 4BKLB 3NACH 3O9WC 5C0JA 3FMGH 2VLKA 3NZHL 1ONQA 4Y4FD 4TTGA 2UWEE 1OGTB 4NN5B 5L2KE 1A14L 3MO1B 2LU3A 3KYOA 3ABZA 3BH8B 3MLUH 2AJVL 4JFDE 3RAJL 2Z93B 4HT1H 3FOLA 1MQ8A 4P23C 1I3VA 3QDHA 3WXVH 3CVHH 4NPYA 4ORGB 4JANA 3G5VA 3NN8B 4QRPB 1T5XB 3MRBA 4HX1A 2NW2B 3U48A 3C9NA 3IKCB 4PIRF 3EOYG 5KVEH 3QDMA 2PCPB 4NO3B 3DHJA 3HC3L 3FFCB 3EIFA 2P5ED 3SE8L 4LPUA 3W11D 2Y5EA 1WGOA 3ZKNC 4JY5L 5H35B 2YD8A 4YBQD 2I07A 4RFEB 4XBPA 4KZDL 4QEGA 3RX5A 1NGPH 1J88A 3BZFA 5E0QA 3KPPB 4U1MA 5DVNA 3UO1L 3BP7A 5DRZA 4Z0BH 4EOWL 3S7GA 2XV6B 1X6NA 4XNXH 4UDTB 4FN0A 1SM3L 4I9WD 5E00B 1RJLB 2IQAA 4XPHL 4P3WA 3P11H 4HC1A 5B38A 3VWKA 3SGJC 3INUH 2BNQB 4NKOA 4FTVD 3P0YL 3CNKA 3LDBC 2LTQB 4YHNA 3VMNA 4XNZB 3LD8B 4R7NA 1QD0A 1TJIH 5FYJH 3U7YH 1EFXD 2NCMA 1T7VA 4P2QA 4UIKL 1M7IA 3G08B 4PRHB 3SDDB 3KS0J 3BP6A 3VFWB 1N8ZB 1C5CH 5E1AA 3MLZH 5D7KD 4F8TA 5ADPL 1HWHB 1LP9F 3ARGD 4KUCD 3QDJD 4FRWA 5D5MB 2CJUH 1BX2B 4FFZL 3RQ3A 2OTUB 2FZ3A 3MZTA 4Z7NE 2AGJH 2C4XA 2ATKA 5IMKB 2BK8A 3HRZB 5CSGA 1IMHC 5E56A 5JZ7D 3CFDA 4DEPB 4NUGL 4QGTA 1IE5A 5GZOC 2D7TH 1JRHH 1T20A 5AG9A 1I8KA 5ALBH 5GGVY 2F54A 4ELMF 1IBGL 3DIFB 4JKMA 3VXPA 1YYML 2BFVH 1EFXA 1IKFL 4YXHL 4O02H 3NCFB 2Q7YA 5HI5C 4AG4L 5CHNA 3ZO0A 2Z91B 3DXAB 3PWJB 3MC0A 1P9MC 5JTWA 4E0RA 2VIRA 5GGVL 1MFBH 1QSEB 3ARGA 5KSAB 5BZDA 3PL6D 4PBVC 1E6JH 5I73B 1XMWA 2VQUA 2IFFL 2Y36H 4MJ4A 3ROOA 5CEXA 3CMOL 4Z7WA 3OKKB 4Z76B 1GGBL 5J13B 1T1WA 4KK9D 1MLCA 3RHWK 2Q3AA 2V2XA 4LNRB 4MAUL 5T1DH 1JGUH 5IJVB 5FOBB 4UU9A 1A4KA 1BZ9A 1CT8B 5IVNA 4Q6IB 2H3NA 4NJAH 2V9RA 3X13A 4XXCC 4DKEH 5AAWA 1Q94A 4I5BB 4QWWD 1VPOL 2XTJD 1LEGA 5C1MB 4AEHH 5CD5D 3KPSD 5FGRA 2LABA 1MHPL 4ZO9A 2FECL 5ETUA 5JXEC 2JK5A 2AQ3A 3X11A 1T5WB 5DR5L 4JFHD 4RCAA 1J05A 1D5BA 4J4PD 4PJHA 3PL6A 3T0AA 3KWWA 4NFDA 5DK2A 4GMTH 4UQ2B 1DQDH 2XQBH 2OI9C 4QHLA 4L3CA 5JW4N 3I6GA 2ESVE 2QSCH 3BYTA 3EO1B 2YSSA 3V6FB 1BVLB 3IJSA 4BQBA 1EHAA 3EZ8A 4ISVB 4PJDE 2Y06H 1YMMD 3HS0B 1PG7H 3IRPX 1S9VB 5DJCB 1PZUB 3AY4A 2I27N 3MLRH 3V0VB 3ZDXF 5F89A 5CJQL 4FQIL 4TSAH 3MJ8A 3MJ9A 1EEYB 2VDOH 3RTQC 5IEKB 3VFGH 4YXKL 3UEZA 2HKFH 1J0YA 4G9DB 1QNZL 3EUUA 5JHDB 4B50A 5FYLD 4OJFL 5FECB 3D48R 3ULUF 2YOCA 4YR6A 3F58L 3DYMA 1NMBL 5FCUH 4YHPA 1WSST 3P77A 4QXUH 5FK9B 4JY6B 3TYFB 5C92A 2FATH 1PAMA 3OWEA 5CIPH 1T2QL 5E8DL 5KW9L 5E94B 2FGZA 2DMCA 3LKRA 3P4OA 1U3HC 3B2VL 5DD0L 3HC4H 3WJLA 3SGDI 1E4WH 1S7XA 1DQQA 2HFEB 5TQ0L 4HCRL 2GK0B 5KANG 5A16A 4LKXA 4MDJA 3Q1SH 3B5HA 1RZJH 3O3DA 3SCMA 3SKOB 5CZXC 1TCMA 5JR1L 1JHLH 2H45A 4XP9H 4PJ8C 1A6UH 3K1KC 4JN2B 1OAQL 4TRPH 4JHBA 1WT5A 3L9RA 3PNWA 4JM2B 5DHXB 4U1HA 2H1PL 1XGTA 4GRWE 4JB9H 4FQHB 4IMLB 4I18B 5LXGL 2HYMA 3O2VL 4KZEL 1KLUB 3O3AA 1I4FA 4FQ1L 3BKJH 4M7ZB 2V2TB 5ISZB 2DICA 3BHBB 5IW1B 4ONFH 2ZCLH 2HJKB 3IFOA 4AIOA 3MLXL 5F3BB 4NM4L 4QRSB 1RMFH 2PO6A 3KR3L 1OT2A 2YS4A 4RA3A 2R69L 4P4KB 1MI5A 3VE0B 1XCQB 2DQCL 2YD4A 1CFTB 2A9MH 3O2WH 1G7PA 4ZPTB 3PDOB 1ZA6A 3KLHD 2R0KL 2I26N 5KSVA 4L4VE 5CJXA 2VDKL 5L0QC 1T7YA 1OT1A 4XCFL 3QDGE 1JHTA 4P2CG 1G84A 1YEDA 4H26B 5T1MA 4F57L 1K3ZA 5B4MC 3KJ4C 1D5ZA 4LVOC 4R4NC 2Q76A 1TVBB 1CDBA 3BN3B 3NFPB 3A67L 4ETYA 3QZWG 4YXLL 4KKCC 1RJYA 1KIRB 2OTWA 2ZOLB 1T03L 4HXAH 3VFUA 4DCQA 2AKRA 4O51A 1NSNL 4MNHB 2VITA 1LE9A 5GGTA 3TNMB 3L3GA 4OKVA 3UTTE 4NHCL 2BOCA 2R2CA 4YK4C 2NR6C 1CTOA 3BO8B 1P7QD 2OJEB 3MA7B 1ZEAL 1URLA 3VWJB 3ARUA 4DGYL 1I7ZB 1PZ5B 4KJWD 3AB0B 4R8WL 3RVWD 4ZNEA 4PS4L 4AK1A 3PDDA 4HUXA 4PJ9D 3NFNA 4Z7UA 1JTTA 2DQJL 2LV4A 3T0XA 1FL6A 1QP1A 3D87B 3CC5A 4OFYD 2AI0L 1ACYL 3RVXD 4A2MA 4HJGA 5C8JA 5FM5M 1BP3B 3P3YA 4WV1C 1B0WA 3RL1A 1IGTA 3WIHA 1I7TB 1A22B 2RGSA 1QFUH 4IDJL 1T0MB 1QEWB 2YHGA 4NWUH 2XZQH 3CXHK 4E42B 3CFJB 1NGWB 1VGKA 3IDYC 4F9PA 2NY0D 2C1OB 1P7QA 1K8IA 4WUUB 2W0FA 4Y5XC 2K7QA 2P4AB 4GQ9L 2OZ4H 3LKQB 1ZV5A 3CSYA 4ZSOB 3TBYB 2R9HC 3V6BR 3QIUD 4JFOB 3LHPL 3ULVE 4OKDA 1JGLH 4TUJA 3FO2B 3D25A 3T2PA 3PWNB 5ADOL 4R7DB 4PJ7A 1CICA 4XNUH 2GJ6E 3GNMH 1WAAA 1HXMB 4WIQA 1U9KA 3QZWA 2FJHB 4LMQE 5HYIA 5TE4H 2NQCA 1N64H 3L3HB 3CH1A 1YQVL 4FMKA 3VXMD 2QR0A 1KB5L 2X4QB 4NGHL 2UYLB 1T89A 5FKPB 1R3KB 2EE2A 4AEEA 5I74C 3MRNA 4LCCA 1CLOH 1DBBH 2X1XR 4HUWA 4JR9L 4NQDB 3RNQB 5MEPA 2ICEA 4PLKC 5HGDB 4ETQB 4C56B 5HDLA 2VMFA 3UYOD 4JRYE 1F02I 4AL8L 3QPQD 1BFTA 2L0DA 3JTTB 4LSSL 3UJTH 3QIUA 4XCNB 1EH9A 4P46C 5EOQL 9CGTA 1IGYA 5DT1L 4Z0XB 1A14H 4K71C 5GSVB 3EYSH 1RSFA 4GOSA 3UTQA 2GAZB 4CADA 1PQZA 3CUPA 4N8CH 3OX8B 1V7ML 4WI7A 2AJVH 3V2AR 5ID0A 5EWIL 4HFWA 1MLBB 2NY6D 1FJ1A 1G7JA 1Q8MA 4GMSH 3DURA 2I5YH 4CKVX 1WLHA 1MIML 1PKQA 2FHBA 2LAAA 3TT1L 3HCVA 4V1DB 5D7IA 2XY2A 2VN4A 4JGUA 4L4TB 1MCEA 4QTHB 3VGAB 1R3HB 5C09D 5J57B 1AI1H 2G75A 4JFED 2WUCL 4FXKA 3MLSL 1XF4B 1H3PH 2ZSWB 4UAOB 5EO0B 1KPVA 1RJZA 2DQDH 3D85D 5F1IB 2DM3A 2BRRL 2CDGB 4HGKC 3FT3B 3DRTB 3ECBA 4UZGA 4LL9A 4M6NH 4WNQA 1JFQH 1QFPA 5F1KC 4GKOA 1FLRL 1A0QH 3U0TA 4RNRA 3S4SG 3RY5A 2CUIA 3BMWA 3VFMA 4U6XA 4GKSB 4Y19E 1C5DA 4XWGH 3PF2A 1A1NA 1EAPA 2C1PA 3SCMC 2BOBA 3ALPA 1BVKB 1SVCP 4PV8B 1DN0B 1D9KD 5C09A 1I3RA 1LNUB 1DSFL 4KHXL 3V5HB 4NO5B 1BM3H 4JFEA 2XKNA 1DEDA 2Y6SD 4OZGE 4TOYL 1ZA3B 3ZHKA 2ZWLT 4CU7A 5BMFL 4X6CB 3MRKB 1Q1JH 3REVB 1GVIA 4KMTH 4HIIB 4LOUC 4WUKL 3L7FB 4KVNH 2HVKA 1EZVY 5ADPH 4XP4H 1H5BB 4KAQH 2IBGA 4PJFF 4H0GA 5E2TH 4FFZH 3CLEH 1OM3L 4JY4A 2XZAL 5I9QC 2E9BA 3UJIL 2HWZL 1RK0B 1H8SA 1A64A 4G3YL 3PV7A 4IIQA 1TJGL 1H0DB 4K3JL 4NZRH 5DD5L 2J4WH 4DVRL 4OGYH 2AJSL 2BVPA 2OCFD 1IBGH 1KPUA 1Y6KR 2UWEA 5D1XC 3S97C 1YYMH 3QULB 1IKFH 3LEXB 5D1QC 1CGYA 2FX8L 4KY1L 5EZOH 5DYOB 4OLXL 3L5HA 1XF3A 2B4CL 1ZGLB 5ENWA 2IAND 3MRLA 3FRPG 1S9XB 1UFUA 4JFDA 4XXDA 5AUMA 4PJIE 5GS2D 3NPSB 4C4KT 4KKBD 1MAMH 4OUUA 5F6HI 4IOFD 4XBGA 3ARBD 2DB8A 1SBSH 3KXFB 1H8NA 1VENA 4KV5F 4W4NA 4ZXBB 5AZEL 5MI0B 4WO4C 5LAXB 3S4SA 2JIXD 35C8H 1RAMA 1TQCB 4HIXH 4FQXC 4XCEB 3VFPB 1S7WB 5BVJB 1FVDB 4L3AA 1RULL 4MAUH 1X5KA 3BGMB 3QRGL 2F5AH 1MIEL 2P1YA 1K5NA 2WBJB 4P5MA 5IBUB 3T0EB 4KHTH 5I1GH 4DUVA 5C3TA 4ZPVB 2W91A 2ITCA 1EBAA 1L7TH 2Y25A 4FFWD 1FNSL 3T2QA 4X4ZA 2HJFB 5F88B 1NEZB 15C8L 2IANA 3NCYP 5IG7B 3MRIB 1A21A 3B5GA 3BQUC 4DZ8A 1EMTL 5DR5H 2ZKHH 1CTNA 3ARBA 1JP5A 4MB4A 2R1XB 2ERJB 3QXDA 3HTLX 1E6OL 1SEQL 2JIXA 2YMXL 3T2NH 3LRSA 4YWGL 3AROA 3WS6A 1NGZB 4HQQL 4F9PC 2YBRA 1B0RB 3K2UL 5C0FB 3EJZC 1UWEL 1OTSC 4Z95H 2J8UF 3NTCH 3WLBB 4KROB 3VGEA 2RCSH 4JG0L 1RHHB 4LAQL 5D7JD 4WI4A 5CLWA 5DZLA 4PJFB 2HLFC 5BV7L 2R23A 2CRMA 4N5ED 2IAMD 3KYNA 4PRAB 1CICC 12E8L 1H9VA 3EYUH 4FQIH 5D7LD 1MPAH 4P59L 3FRPA 3CVHA 1SYVA 1YN6A 1K8DB 4KK6C 4EDWL 3BE1L 4YXKH 4HKJA 1FSKC 3TBVA 3PQYB 4G7VL 1QNZH 4NNYB 3OHXA 4BH7B 1F90L 4LCCC 4OSUL 4CVZB 4ERSL 4OZ4B 3QO0A 4CU8A 3GJFH 3UX9B 4M93C 3TVMD 1VDGA 3I3EA 5EZLB 5L7XH 4H8WL 3LY6A 5FYJD 3O3EB 5D7JA 3QRFM 5F3HA 3TM6A 3NIFF 5C0EB 5IMLB 4TSBL 1RPQA 3C60B 4PJ5D 1T2QH 5E95B 4J3OC 5HHMD 1UACH 1U58A 4MXQD 5E8EA 4X5XA 3VG9C 3H2WA 4YZFE 4HZAA 4KDVA 4OD3H 3PWVB 2IWGA 5EOCJ 3QCVL 5CWSA 4X6DE 4HCRH 4FABL 2J2ZA 3T8XA 1NCDH 5KZCB 2O5ZL 1FP5A 1HSBB 2P8MA 4ONOA 3HNSH 3GSRA 5J0BA 5INCA 5I1DA 3OXRA 3ARDB 4HDIB 4MQ7A 4MX7B 5GJSL 3FQXB 5H37H 5LXGH 2G9HA 4QRTA 2ZUWA 4KRLB 3O2DH 2B2XH 2PYFA 2YPKB 5KS9E 2Y07H 5A3IC 2P43B 5DI8A 3RWEB 3RUGB 3MLXH 4JRXD 2DQFB 1BQHG 3BPLC 2BHUA 4O2FB 4QRQA 5DJYB 2UZIL 3CFBA 3DGCR 3FJTA 4LLUA 3RDTD 1P7KB 5I16B 3QG6A 4J6RL 4M1GH 4OLUH 4KRPC 4W6XB 2ED9A 3FONB 2DQCH 4EBQL 5KVGL 4DKFH 1NBZB 1QLRB 4WWKB 4XCFH 5T5FH 5ALCH 2ENSA 3LH2H 2XFXA 4NQEB 1OSPL 4NQCB 1VADA 5HXMA 2BDNL 1ZXQA 2HAZA 5DLMH 1HWGB 5C9KA 4MVBD 4L8BB 4YXLH 3MRFA 3SN6N 2MHAB 4NQXA 1NDMB 2P44B 5DURD 2H2PC 1NSNH 5DRXA 4YDLC 5T33L 3DX7B 4KUCF 5JOFB 1AP2A 3ZT6A 2F19H 5KN5A 3QEGL 4E41B 1E4XL 4Y4FB 4PG9B 1MJUL 3ESUF 2NY2C 4KQ3H 1SY6H 4Z7WF 1HHHB 1VSCA 1ZEAH 2QV2A 3RHWF 5FF6B 3GMQB 4NFBA 4DGYH 4F15C 1DDHA 4R8WH 5CILL 5JW5A 2Z4QA 4MXVE 1JGEB 4I13B 4EI5D 1JUFA 4JGMA 4PJEE 2CKBA 4TVPL 3U7AA 2ZUSA 5C6WH 3AS3A 2DQJH 1SJHA 1C12A 4G6ML 4JAMA 3I6LE 1DUYA 4PRPE 4B41A 3GO1L 3NZ8B 3VFVB 1F6AB 2AI0H 4NHUA 5KVDL 1A4JB 1N3NA 3RVUC 5DRWA 4OLZL 4IDJH 4PJHF 3REWB 4URTB 1HQ4A 4OCWL 5J56B 3F7YB 5B3JE 3D69B 1U95B 4NRYB 2X70B 3ILQD 4KTDL 3GSOA 4JN1L 2EE9A 5JIPA 4GQ9H 1T4KA 1RIUL 3ESVF 2B4CC 1KXVC 4EI5A 4J3SA 3LHPH 5I0DA 4JPIB 3KJ6H 4GW5A 4Q9QH 2L7UA 4GG6E 4PLJC 4FP8L 2QQNL 4NZTL 2EDRA 1S5IH 3S6CA 2N56A 4Q9CA 1XR9B 4RMTA 4OTXH 4FTVB 5EU4A 3MRMA 3HE6B 5DD3L 1EGJH 2V2WA 1WWCA 4NGHH 3CDGA 5DUPL 1XF2B 3PG2A 1KEGH 3H6JA 4RWYL 4JR9H 2A2QT 2E9JA 4R4BB 2ADFH 4L4VA 3RL2A 1Y18B 3HUJA 3VH8B 2OM5A 2PN5A 3V4PH 5TFSH 4D9RE 4Y5YA 3UYRH 2XZZA 2MFNA 1GJIA 1G7HA 5EOQH 5DT1H 2EH8H 4HH8A 5CIPA 3STLB 4KJPC 3QDJB 1D5MB 1JMZA 4OF7A 4APQD 4M1CC 5DMJB 5I71B 2BSRB 1I7RB 5GJTH 3C2AH 3WFEL 5EWIH 1MCSA 1G7QB 4KUZH 1J8KA 4L3EB 5GGQL 3MGTB 3OKLA 3DV4A 5SWSB 3H9HA 2WMPA 3GIVA 3S36L 3MRGA 2K1MA 3N9GL 2PW2B 3DVNA 3M07A 3SKMA 3W81A 4RGOL 5BV7C 2PKDA 4LIQL 2CRIA 1UENA 4YIQB 43CAB 1BGXL 1XGQB 2FHFA 2F5BH 3MLSH 1I1FB 5K9JH 3RGVB 3WXWL 5F1NA 5EULV 2VRAA 1FGNL 4K94L 2W92A 5EU6D 1H3XA 3ARYA 4TPRL 3PIQA 3TA3A 4JQVC 1F11B 3BEVA 1JWUB 3M1BB 3V5DA 3ALWA 1WISA 1VKXA 2CIKB 3CLFH 1MVUA 1AIFB 1UM5L 3S96A 3DLQR 5JLZA 3ULVL 1IRAY 1TNNA 4HUKB 1RU9L 4H8WC 5IQ9A 1JMXA 2BVOA 3VXRE 1MUJB 3V7AG 1FFOB 4MJ6B 2GCYB 2XTJB 4GAYB 4ZFOL 4KK5C 1MCFA 1DSFH 5IT2H 2X4PA 3EFFA 4YEEA 3KPSB 4RQQA 3MCKB 4R4FL 3HG1D 4MNGE 1Y0LA 1B6DA 3O4LB 1FO0L 4PFEA 1TZIB 5BMFH 3DI3B 2GJ6A 2X4SB 3FOMB 4ZTPH 2W9DH 4QF1B 4X7SH 2WP3O 3QI9D 4P5KB 3GMPB 4HKBA 1S7VB 1NC2A 3HPLB 4J12A 1ZMYA 5IFJB 3F5WA 2PXYC 3BIBX 1XGPA 1NAML 1HXYA 2XZAH 3D3VB 1FO0A 3UJIH 5D96B 5INDB 4G3YH 4JREB 1X5YA 5CGMA 1JN6B 1OAZH 3MLPA 4K3JH 2M8XA 3M8OH 2WUBL 5CEYB 1OAYH 5E2WL 4DVRH 2NY5H 5BW7A 5T3XE 2X4NA 3RY6C 3HG1A 1NAMA 4H5SB 4KVCL 4Z7UF 1FNEB 2FX8H 5IMMA 4KY1H 1A7PH 2EZ0C 3IDMA 1Y6MR 2VE6B 4OLXH 4D9LL 1P4IL 1J8HB 3QI9A 4M6OH 5I1IH 3KNBA 4LP5A 1FFNB 1VGEL 1DUZB 4G8FB 4N0CD 4MAYD 1INQA 4S1RH 5IHZA 4ZUVB 2R15A 5TDOB 5T3ZE 1N4XL 2R0LL 4S0TD 1U8LB 1HSAB 3QEHB 1FL3A 3TO2B 1QRND 4JZJB 1RULH 2WM0A 4YH6A 2VXUL 2OZ4A 1TVHB 2XPGB 3QRGH 1IAOB 4HUUB 5EFIA 5MEOA 4PJ8D 3TFKC 3V6ZA 1IGCL 1T04B 3I02B 5KSBA 1MWAL 3L5WB 1CR9L 3K4AA 4GKZA 3R8QA 4KQ4H 1A47A 1FZJA 4IM8A 4XP6H 1S7SB 2XWBB 3I9GH 3IFLH 1AGEA 4PJ7F 15C8H 2RIKA 5DUMH 4NUJA 1KYOJ 4L4JA 1QHPA 4KK8C 1LQSR 4FQLL 4DGIL 2PYEB 4MAYA 2DM2A 5F71A 4I4WA 3S36X 3VI4F 1E6OH 1YEJL 1SEQH 4Y19A 3I50L 1NBVH 3MRDA 3R1GL 4XC3L 3P0GB 1F4WL 1BWWA 1CLCA 1UWEH 1P4LB 2FHCA 4LHUD 3TCLA 1WBYB 3GMNA 1T83A 1IARB 1UJ3B 3MNWB 3HE7C 4LAQH 2APFA 3GMOA 2D03L 2DJUA 2ZP0T 3TEUA 5BV7H 4JDVA 1MJ8L 4RAVA 2AEPL 5LGKA 3HR5A 4GS7B 4OF5A 3H0TB 4R4ND 1ZHLB 3VI3F 1RZGA 1NFIA 5D8JH 2GUOB 4KI5E 5IMOA 5F8QC 1GCFA 2AW2A 4PJXE 2EXYD 3OKOA 5DTFB 4EDWH 3D0VA 4GLRI 1CDHA 2YK1H 4G8EB 4R26L 3ZE0E 4G7VH 4OB5L 5K9KB 2EDEA 5CGTA 5ILTL 4EQ3A 1FG2B 4ERSH 1KG0B 3DVGA 5HPMA 4BSWA 2Y23A 1LVEA 4M7JL 5F7NC 3WFCH 2YEZA 1FN4B 1MCDA 3PV6A 2GT9A 5ICXA 3W39B 3TT3L 4XP5H 4Y5YC 3HZVB 1OARH 5F9JA 3D18B 3ZDYE 4PY7A 3LQZB 1AO7E 1J1XH 5HYQB 3NA9L 1J12A 1BF2A 3LN4B 1BF8A 1MH5A 4OV5B 3TESA 1UC6A 1A6VH 2MQCA 3HZYB 4S1SH 4ZDHB 4TTDD 5M7QA 5JA9A 1YNLL 1HHKA 2CRZA 3UTZB 1GRWA 5BZWB 3EYVA 3CZFB 3ROLA 1TZGH 1YYLL 4Y2OA 1ADQH 4G9FE 2ZOKB 3WFHB 2Y9RT 3ZKXB 2EDDA 2H2SC 4JZOA 5DS8B 1KIQA 3N85L 2BCKA 5IB1B 5IKCB 2BY2A 1Z9LA 3DUHA 1NCCL 3U46B 3DUSA 4B53A 5D2NB 2IGFL 4GBXD 4HJ0C 3VGBA 1T66C 4EI6B 1X7QB 5KTEL 3S88H 2R9HD 3DO7B 1CD1A 3QPXL 5J1SC 5FA3A 1BZQK 1NGYA 3TA3C 4XGZA 4J6RH 4HEPG