1PEWA

High resolution crystal structure of jto2, a mutant of the non-amyloidogenic lamba6 light chain, jto
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
109
structure length
108
Chain Sequence
NFMLNQPHSVSESPGKTVTISCTRSSGNIASNYVQWYQQSAPITVIYEDNQRPSGVPDRFAGSIDRSSNSASLTISGLKTEDEADYYCQSYDARNVVFGGGTRLTVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Jto2, a LAMBDA-6 TYPE IMMUNOGLOBULIN LIGHT CHAIN, VARIABLE D
publication title Structural basis of light chain amyloidogenicity: comparison of the thermodynamic properties, fibrillogenic potential and tertiary structural features of four V(lambda)6 proteins
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 108
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pewA00
3R06A 4JRXE 1VFOA 4Y8DC 5EPMA 2N1KA 3UBXI 1JHLL 1HCFX 2VERN 1ZOXA 2WP3O 3MFGB 4NRXB 5GS0L 3EYVA 5EOQL 2NY3B 1BBJB 3U6RA 4BH7B 4ZUSA 4OI9A 3ARDD 3NCEB 1NDMA 3MRHB 4DN3L 1BVZA 4L8BB 3BMWA 3R8QA 5D1QC 5IT2H 1SM3H 4HUMB 4WCYH 1CVRA 1D6EB 3T0AA 4IMKC 4J1UB 4BH8B 1Q1JL 3PL6A 5DLML 4J4PA 3GMQB 1YMHA 4XC1L 3MRDA 2DMCA 1YNKH 2HYMA 1KCSL 4OCMC 1RZ8A 1VDGA 2V9TA 4G80B 4HKZB 2OP4H 2X10A 3PP4H 4P5TB 3TPKA 4A6YB 5SX5K 4GRWF 4H1LB 3U4BH 3K80A 5D6DC 4LCWA 1A7BA 4B53A 1I7ZA 4MA3B 4DEPB 5LGHH 1QFWM 1BF8A 3OKDA 1F2QA 5T1LA 5E9DE 4XBGA 4LOUD 5FV1L 4ACPA 5B38B 1CG9A 1Q0YH 4IDJH 4X6EA 3ZHLA 1ZLSL 4MSWA 5C2BH 4CADB 2UZYB 4ZO6A 2XQYG 3HG1B 2PTTA 3HR6A 3PP3H 1MIMH 5T1KA 1NFDB 1NCAL 4GRMB 4LRIA 3BXNA 3I9GL 5D7SH 3RKDD 4WO4C 1QR1B 2YUVA 3HI1B 4FQ1L 2VN4A 3OKEB 3D1MC 3QEGL 3NIGE 3KPOA 3OX8B 1INEH 2D4FA 4U1JB 2GFBB 3QUZB 4JO1L 3V4PL 5L0QC 4UV7L 2OTWA 3QDAA 5I1JL 5I1KL 4ZSOA 4NZTH 5DI8B 1KIQB 4CKVX 2D9QB 1KB9J 4F3FA 4AG4H 2AV1B 5GJTL 2AK1L 4WY7H 4R26L 3DJ9A 1M7DA 3Q0HA 5GGTH 3WNNA 3WFZA 1G7PA 1J5OL 1B0WA 1L9NA 1PY9A 1RUML 4HK0B 4F7PA 1B6UA 1ORSA 4TULL 3VD4A 1DR9A 3H0TA 4TNVK 3I85A 2Z8VC 2FLBT 1T1WB 3O2DA 5DD3H 2DKSA 1H15B 2HTKC 2X7LB 2PW1B 4M7KH 5AYUH 2ZSWB 3EKCA 4KRPC 3JWNC 3KJ4C 4CGTA 3IDJA 5EBWA 3DI3B 3DROA 4RIRB 4YAQA 1T0PB 4PRIE 4QTIL 2QV2A 3SOBH 3LEYL 4PJ7E 5GS0D 3BDYL 2FLRT 3REWB 5CZVH 3U0TA 5TF0A 3WIIL 1WZ1H 5EO9A 2W1NA 4F58L 4N8VB 3CMGA 1JTPA 4XTRD 4H0HB 3H9SE 4X4XA 5I1IL 1DBKH 1UWEH 2A83A 2HN7B 4Y0GA 5EH1A 3TM6A 1Z0NA 1QO3A 5FGSA 4FQJL 1U93B 5DXWA 5E6ID 5HVFB 4K23L 5TDPB 2B8OT 5E2UH 3D0LA 5KTEH 4LHUB 1A7RL 5DRNB 4NFBA 2JK5A 3LS5L 3P11H 1A21A 4HWEL 1GGIH 2UZIL 4HKXA 2A9ML 2FX9H 3QSKB 3FO9A 2Y36H 3SO3B 4EOWH 1TETH 5EBLA 3MRCA 1I3GH 3GO1H 3FB5A 5C0GB 3GIZL 2XWBA 1N5YL 2IMMA 4X8JA 2RQ8A 1U3HD 4GRLD 3WSQH 2VXUH 43CAA 2XTJD 1KFAL 3EO1B 4OGYH 5HDOA 2IQAB 2YPKB 4GKOA 4WDIA 3BPCB 5FECB 3PWVB 3JTSA 2G2RA 2D0FA 2XICA 1U36A 4KRNA 5ADPL 2IAND 5CP7B 4UOJA 4LSRH 1RZFL 1AJ7L 4WHCA 2J8UE 4GXUN 3PWUA 1CDCA 3OAUH 15C8H 3KJ6H 5C0CE 5TJWK 2C3WA 3N9GL 2W0FB 3KPRB 3FOMB 1IFHL 1CGXA 3WUWB 1CXFA 1AGCA 2R0WL 4M1CD 2BOCB 3EW3B 4KV5F 5MHSE 3BP6B 3CFJA 4G6KL 3UZEA 3M17A 2BNQE 1UJTA 3WBDA 5K9QG 3CSYB 2KZWA 2ZG2A 1GOHA 4LLQB 3VRLE 2L4OA 3JV6A 1EJOL 1B4JH 5KOMC 4U6TA 1TZGL 3DGGB 4MA7L 2OTUA 2AJXH 3WUZA 3QUMA 4NYLA 3Q2CA 3BIKB 3MRLB 3BQUC 4LQFL 1ZGLM 1WEJL 3P0VH 4S1SL 3ZE1E 4U1MA 5D96B 1LK3L 2EE3A 1FV1B 3ABZA 5I1LB 1A7NL 1IGYB 5F70A 4HBCL 5IJVB 4PUBL 4RAUA 4OZFH 3MOBL 1UA6H 2ICWA 4HIJB 4I2XA 4LQ1A 4RFOH 3VXUD 2IQ9H 3T77B 2UVEA 1BOGB 1TVDA 1WBZB 4G6FB 4NHCL 5BOPA 4B5EA 5JQ6H 1R5IA 5MI0B 1NBZB 4TUJB 5BCAA 1JRHI 1JF6A 4RDQF 4ELMB 3MRIB 4P2RB 4PRDA 3GGWB 2GYSA 1JZ4A 1ZTXL 4N0RA 4HUWA 1MWAH 1QP1A 2W9EL 4KHXL 1G9EA 3OF6D 4IRSC 2DN7A 3O4LD 5CKGA 5ACMA 1WT5C 5AD0A 4LIQL 3VDCA 1U3JA 4HUNB 4XNZB 1T5XB 1KEML 4Y5XB 4QXGL 4IM8A 5DD0L 3LMJH 1AFVH 3TFKD 3JSSA 2Q8AL 3QPQD 2M8XA 5F7EH 4H20L 4RISH 3B8SA 4Q58C 2V9RA 4PTUB 1J8HB 2B4CC 1TZIA 3WHE1 2YK1L 4XX1E 1ZLUH 2CR3A 2D7PA 2VDRL 4XB8A 1S9YA 5IEKA 4EDXA 3N85H 3VXMD 2BVYA 3GI8L 4ZS7H 1YEGH 1X5LA 5JW3L 3ILPB 4OFYA 3BJLA 1NCUA 2NX5D 1FIEA 1CVSC 3REVA 2AK4B 5BV7L 4L4TB 2ESVE 4P5KB 4XVTL 1EBAA 1IARB 3AAZA 4E41D 4RGND 3VGEA 1CK0L 3HNTH 2X1XR 3DETD 4QRSA 3SE9H 5DSCB 3MO1B 3G5ZA 2XG4A 4Q0XL 3GBNH 4DGYH 1J05B 4I0PC 1V7NL 1K8IB 4JFPB 4DZ8B 4MQXC 4BQ8A 4WVRA 1JMZA 4NRXA 4HW6A 1CE1L 1BBJA 3VFWA 2MKLC 4BH7A 4LSPH 5FUZH 4JKMA 4WENB 5I1EL 4L8BA 5SWQB 1I8IA 3CVHL 4JM2D 2NY0C 1D6EA 1VENA 2IG2H 4BH8A 2R0ZH 5DC4B 1FN4B 3JWDL 3GMQA 2MQ0A 3KDMB 5T3ZH 4G80A 2NW3B 4P5TA 4A6YA 4X9FA 1BJ1J 3BEWB 1U58B 1JYWA 4FQLH 1CDJA 4OFKA 2B7DT 1KJ2L 4MA3A 1U8OB 3RIAK 4FG6D 2WBJA 3QUYB 3RVWC 5I1GL 3GHEH 4Y88A 3C6LB 2ZUXA 3A67L 5BRZE 5B38A 3Q6FB 1X44A 3SKUD 4CADA 4M93C 5CP3H 4P4KC 1KCLA 4D3CH 5DUMH 1CQYA 1A3RH 4X83A 3WDIA 1NFDA 2V7NB 4ODTL 1AD0B 4GRMA 5I0ZA 4DK3A 5JIKA 5IROC 1BQHA 5E6ZA 1QR1A 3OBAA 3HI1A 1EHLL 3OKEA 3V52H 3TIEA 4BA8A 3OX8A 4FMFA 4BZYA 4U1JA 2GFBA 3ZMRA 4PJXB 2IAMB 3SKNB 5I66B 1JI2A 2VDNH 4K94L 3TF7C 2CK2A 1NCDL 5DI8A 1KIQA 4XPGL 1J1PL 3PP3K 4DGVH 5D8JL 3W0WD 4G43B 1IGJB 1JHTB 1TQCC 2ILLA 1JHKL 1CLOH 1KUMA 4DW2L 1SJHB 3P77A 4BFGA 1PQZB 4PJCE 4WEUD 2IWGA 3QNXA 1VESA 1OLZA 1XR8B 1PLGL 3RQ3A 4NJ9H 6CGTA 4EI5B 4PJ8C 4KKBC 4L3CA 3DHJA 2X4TB 3MOAL 2XKNB 2P8MA 3MGOB 1FC2D 5D7LA 1F3DJ 1T1WA 2VXVL 1H15A 2X7LA 1QLRB 3C87A 1IKNA 1MQKL 2PW1A 4K2UH 2ZSWA 1FBIL 3EJYC 1N8ZB 1NUGA 5LJYH 5IEHB 4PJEF 5TDOB 3VD5A 2OSLB 5JIPA 4RCAA 4OCNC 4U6XB 3REWA 4EDWH 5D6CA 5E1AB 1G9NL 4XBPB 5D93B 4X4ME 3W5NA 4LHQB 2XZQH 1FZMB 4MXQD 1MCSA 3CPLA 4H88L 3O9WC 4F9PA 3D2UD 4LNRA 1C5CH 2HN7A 2A73B 1A47A 1U93A 2AJUH 3FO0H 3JWOH 5TDPA 2X05A 4XMLL 4JKPL 2C3GA 2JJWA 2YD8A 4LHUA 5I8EA 5DRNA 3OG4B 4OD3L 2A77H 1UQSA 3VA2C 5MERB 3TBTA 3BD5A 2BVEA 4R4FH 5D2LE 4JPWH 4KQ4H 4YHIA 5FCUL 5DYOB 2OR8A 4JM4H 5FYLE 5C0GA 2ADFH 4UT6H 4HS8H 1D6VH 3F7VB 5TQ2L 4GXVH 2JJTC 3IF1B 1MRCL 1C5BL 1PZ5B 1FCGA 4UV4L 4FXGB 1JRHL 3ULUE 1X7QA 2YEZB 1JNLL 3EO1A 4G42B 1G7HB 4C56E 3QDGE 2YPKA 3VFMB 2PETA 5FO8A 2MFNA 1MREL 2JCCB 3EFFB 3WFEL 4LAQL 5FECA 4F7TB 5C0RL 3V7AE 4DJMA 4YHLL 1AGEB 1ED3B 3S5LB 2IC2A 5CP7A 2AEQH 2K7QA 2WUCL 3DV6B 3S4SB 4FMKA 3ILQD 4LSVL 2FIRT 4HT1H 5DO2C 4ODHH 5EU6B 2WWMC 2C9AA 3B9KC 1MCNA 4Y5YC 1S9WB 5DTFB 4NNPH 3CSGA 4XPHL 1SJEB 4R4BA 3KPRA 2W0FA 3FOMA 1H5BC 2N56A 4JN1H 4JVPA 3WUWA 4FA8A 2BOCA 4MNGB 4NCC1 1NGZB 3BP6A 3P9LB 1D5ZA 3VD3A 2VDMH 4NWUH 2Z93B 3CSYA 4OI7A 4KDVA 2B0SH 3LKQA 5DS8B 3BT2L 4U49A 2O5ZH 2WBWB 5J11C 1QFUH 4LLQA 3RX7A 3IU4H 3RNKB 4Z7WE 3B4NA 1D9KD 4JO4L 1CICB 2HKHL 4UNTA 4X5WB 1FFOA 3MRLA 2CDFB 2AS5M 2PTUA 3EDEA 3FHQA 2DM2A 2XI9A 5MENB 1P7KB 4KROB 3ULVE 2Q3ZA 3TZVB 1FV1A 1DQJB 5I1LA 4ZPTB 1IGYA 4PRAB 3KGRA 5FOBA 3VFRB 1IM9B 3D3VD 3L1OH 5IJVA 2W92A 4HIJA 3TC9A 2F8VA 1UXWB 3MLUH 3THMH 5KSBE 3AMLA 1CLYH 3A6OA 4ZXBC 2CIIA 3T77A 1CDGA 1WBZA 2FDBP 2EKJA 3RZCB 4KJPD 3CU1A 2FB4H 4MXWH 1G7IB 4OZIA 1QFOA 1NBZA 3ARVA 4QT5B 4U05A 5ALCH 3QQNA 1AXIB 1CZ8L 3JTTB 3TCLB 4ELMA 3WKMH 3MRIA 2J6EL 3GGWA 1BQUA 3RWGB 4J6RH 1NMAL 4OCYL 2VKXA 1IGFL 1LILA 2MQCA 3CFIC 3CSBA 5GGQL 1J1OH 4K8RC 4TUKL 4X7DC 2ARJB 3WIHH 1GPOH 1T5XA 4Y5XA 5IHBA 4HXBL 5D1QB 2NY4B 3IRZA 3EBAA 4UIKL 5E9DD 2VLRE 4PTUA 1A3LH 1JI1A 1NC2B 1QBBA 3SY0B 4L9DA 2P8PB 2GTWB 2R29H 4P9MH 2EXWD 3ILPA 4KVNL 5HI3D 2H2SD 2X41A 4K9EL 5KVGH 1KC5L 5F7KC 4L4TA 1BP3B 1WISA 4MJIB 3S37L 4P5KA 4MD5B 4M5ZH 1W0YT 4OLYH 4X5XB 4BK4A 3LRHA 4NCC2 3HNSH 1X3DA 5E99L 2IPUG 3LAFA 4JY5H 4NFCA 2MCPL 4GBXC 1MCHA 5DSCA 3GJFH 5DZLA 3MO1A 1KB5H 4TQEH 5ESQB 1KF9B 1J05A 4PJHE 1TPXC 4JO2H 2YUXA 1AXTH 4WO4B 4Z7QF 3QXDB 4XP1H 1K8IA 3W11C 4JFPA 4DZ8A 2G75B 3VXRB 4HJJL 1E0OB 1I3VA 1QPXA 3DVIA 5JDJA 3NMEA 2XZAH 2EO9A 1INDL 1MWAB 4APQD 2RCSL 5L0QB 3P9WB 3EZJB 1R5VB 5ADOL 3A6CL 2F8OA 4XPFH 4JFDB 2DLFH 3ZYIA 3VXPA 2ATPB 4Z77B 1FN4A 2FX7H 1KLGB 3AXLB 4HFWB 3LPGA 3L3HB 3KDMA 5D1ZD 1OB1B 5LGJB 3MRGA 4IIQC 2NW3A 4W4OA 7FABH 3BEWA 3TWCH 1RULL 4LSTL 1A6UH 4NQDB 3PUCA 1KELH 1U58A 1K5NB 2EO1A 5A2KH 2R0LH 1U8OA 3QT2A 2QEJA 2LFGA 5DMGC 5INCB 3QUYA 3C6LA 3H7LA 4MNQE 2ENYA 4GRWB 1HILA 3MFFB 3Q6FA 4KGJA 4JZOB 3PGDB 3WHXB 1R24B 2IH1B 4F2MA 1I1AC 5GGVH 1U3YA 1OQXA 4KRPB 5D71H 3CFDB 3KJ4B 1MEXL 1I1FB 2DQUH 4O58H 5BVPH 4WFEE 2V7NA 5TGBA 3ZYZA 1KJ3H 1AD0A 2HH0H 3ARFC 3MRBA 1IAMA 4XRCA 2WUBL 3PG2A 5C2UB 5I30L 1T66C 4KFZC 5ERWB 1IT9H 1U95B 2GSIB 2FX8H 2IAMA 2NTSP 4PJXA 1YECH 2BY0A 3SKNA 5I66A 4NDMB 2QQKH 2KQNA 3HFML 2X70A 3PNWB 3QEHB 4E42A 2BHUA 1H3XA 3WL9B 5BJTB 2P5EE 4OQTL 5ICZB 1RU9H 1TDQA 3LN4B 4NQSB 5JIIA 3FQXA 4P46D 1OGAB 2EH8L 2DLEA 4YXKL 2ITDB 1OARH 4QEGA 2H2PD 3KPMB 4QHLB 4ZUWB 2DQDH 1DBMH 1SJHA 2VXTL 2ZOKB 2P4AB 5C0BA 5H2BB 2FCBA 2VXSL 1DBAH 1XR8A 5HGAB 1NBYA 5HHMB 5BZDA 1NPUA 4EI5A 3WFBL 2P24A 2J1KA 2X4TA 2XKNA 3MGOA 3UTZB 2BK8A 1YEJH 1T89A 1QLRA 1QHPA 4LPYA 5C0CD 4K7PY 4G9FB 3DV4B 3GI9L 5IEHA 3LS4L 3VXSE 3D6GA 4X7SH 2OSLA 4QHUB 3SE8H 4ZNEA 5MHSD 3VWJD 3RGVB 1EUTA 4U6XA 1X5AA 2BNQD 3GK8L 2OI9C 4YEFA 5E1AA 1JE6A 4XBPA 3JVGC 1RPQA 3VXQB 4X4YA 4PFEA 4XXDB 1FZMA 3FFCE 1HKLH 5B21A 4NRYB 4WTWA 4AT6B 1S7SB 4PTTB 1HSBB 3EZ8A 1EHNA 2QADD 1J0JA 4XH2B 2BMKB 4JFFB 4K3DH 2A73A 3T0XA 3TN0D 1JWUB 1T2XA 2D4DA 1LO3L 2WLYA 3OR7B 4WUUB 1IGIL 1MFCL 2VWEC 2DLTA 4O02H 2CO6B 4JE4B 5MERA 5GGTA 3WJLC 3OAZH 5D7JD 4PGJA 2Z8WC 3I50L 5E00B 4U4BA 3WJJC 4CW1B 5F8RC 4DKFL 5DYOA 1RJLA 4JFQB 3SGJA 1GYAA 1X9QA 4NKIL 4NIKB 5IF0A 3F7VA 5CGMA 3BQUB 3IF1A 4NZDA 2Y6SC 4FQIL 1PZ5A 4FXGA 4UAOC 5IB4B 1NAKH 4G42A 1G7HA 3VFMA 5IBLD 2YD4A 2Q7NA 2JCCA 3EFFA 3TV3H 1PAMA 2HVKB 2CSPA 5EORH 2UUDH 1T1ZA 1AGEA 1ED3A 4E0RA 1JGLH 3S5LA 3DMMD 4KH2A 4QOKE 4RWYL 1C7SA 2WQRA 3C5JB 3DV6A 4JFEE 5FUCE 2D03L 5KZCD 1KTKE 3KYOA 5EU6A 3RWCA 3RPIB 5J89A 3CDCA 5DTFA 4KI5F 1SJEA 5SWZD 3TA3D 1Z5LA 3CX5J 1HYSD 2F53E 3KYMB 4MNGA 5F21B 1U41A 3P9LA 3SKOB 5HYQB 3MXWL 4IRSB 2Z93A 3MR9A 5JZ7C 4M7LL 2FATH 3A0OA 4Y1AA 4HUKB 3RNKA 4NBZB 2ESVD 2EDJA 3C6SB 4K3GA 2WSKA 1K3IA 1CICA 4M62H 5H35B 1FDLL 4X5WA 2CDFA 1NMBL 5I1HL 5L8KB 5MENA 1WFNA 4KVCL 1P7KA 4XAWL 2DKUA 3TZVA 1DQJA 3M8OL 2WANA 4U7MA 4ZPTA 4O2FB 3O2WL 4PRAA 2I24N 1IM9A 5T1DH 1FNSL 4D9QE 2HT4D 1UXWA 4K3EL 2W07A 3PWLB 3SGKA 4KKCC 3FTGB 1OTSD 2BVTA 4X5LA 2YS4A 1E4KA 1P7QB 3D39B 1G7IA 1A9EB 4GW4B 4GJTB 2DMBA 5FGCE 5IM7B 4ODVH 4I0PB 5GQBA 5TF1H 5C07B 4QT5A 3ZKND 2NY1D 3JTTA 3TCLA 3QQ9C 3RY5A 1P1ZB 1LP9F 1OAYH 2QSCL 3RWGA 1ZEAH 5HGGS 3U36B 4G5ZH 1F00I 4KI5C 2VNCA 2DQHL 2EEDA 3BP7B 4R4NC 7CGTA 1J12A 2ARJA 3EJJX 4LF3A 5D1QA 4NP4H 2ATKB 1L0QA 4WWID 4MZ2A 2NY0B 4IMKA 5BRZD 4GAGH 5CEZH 4PP1C 5KW9L 1NC2A 1RZ7L 5FYLL 3IGAB 5HI5D 1OSPL 4WI2A 4WFFD 4P2CG 2P8PA 3BWAA 2GTWA 5D6DA 1TJHL 1ZA6B 5FKAB 4KUZH 3RX8A 3ULUL 4GAYB 3D85D 3C2AL 2XKUA 1DDHB 2F19L 5D2NC 4WTZA 5GZND 4U0RC 4MMZC 4YHKL 1KV3A 4X5XA 1ZVYA 1S78D 3K7UA 4M93B 1NCCH 2DQEH 4Z7UE 2E7BA 4LP4A 4P4KB 3WV0A 3QWOB 4IEFB 5FCSH 3B8YA 4PLKD 4WO4A 3QXDA 2UWEF 2F54B 1KULA 2DWEB 2G75A 2Q6WB 2C1PB 3VXRA 4YX2L 4PB9L 1QNZH 1MWAA 2QSQA 1LVEA 3CDFA 1R3IL 3TJHD 1R5VA 2NZ9D 1WAAE 3UO1L 5EOCJ 1MHCB 3BZFB 1FH5H 2OQJB 2EC8A 3FB7A 2ATPA 4Z77A 1SBSL 3AXLA 4HFWA 1G7LB 5HDBF 3L3HA 5TDNB 3FQRB 2Q7YB 4CMMB 3BESR 5ISZB 1OB1A 1OAUH 1TQCB 2Y23A 5LGJA 5EIIA 1UB5B 4MJ4A 1J86A 4P2QD 1JTOA 4PJFE 2O61A 1F4HA 2Q8BL 1RZJC 1K5NA 1S7VB 1TCMA 3TO4C 3ULVL 3VFTB 4PJ8B 1EGJL 4PRPB 5HHOA 5INCA 1EEYA 2APBA 4MDIB 3MFFA 2EDNA 3PGDA 4JZOA 4XZUA 3WHXA 1R24A 1KACB 1G84A 3IU3B 1FO0H 1FZJB 3CFDA 3EYSH 5SX4H 3EDKA 4HGWB 5FO7B 3ESVF 2R2HB 5DA4A 4GW5B 3GJFB 4FTVE 2KPNA 4OD1H 4JZJC 1HQRB 4Y19A 3CFEB 4P2OA 2VE6B 3T4YB 4Z8FH 1EV2E 4Z76B 2F5BL 1N0LA 1QR4A 4UINH 3QI9A 1U95A 2GSIA 3WE6B 3EOAA 5I8CB 5DMIL 3VWKD 2YWZA 1R0AL 3UC0L 1BM3H 4NDMA 2KH2B 4M9OA 4YGAB 3O9WB 3QEHA 4S0SD 4IS6B 4MD0B 5BJTA 3IXTB 3MBXL 4KK8D 2JIXD 5ICZA 1XCQB 3DSNA 3B5TA 3LN4A 4NQSA 3TPUB 4YBQC 1OGAA 2R2BB 3FN3A 1MFBH 2ITDA 3B5HA 4MA1C 5FYJE 3ULUD 5F9AC 4LCUA 5KVEL 4QHLA 4BELD 3IJYB 4ZUWA 4C56D 3QDGD 4J3VA 4ETYA 2ZOKA 5F9DC 5HGAA 1UWGL 4KY1H 3QDHA 1AI1L 4RBPK 4DKEH 4DUWA 4KWUA 3T09A 4XC3L 3IFLH 3UTZA 1EHXA 2GSGA 2VQUA 4U1GC 1T4KB 2H32H 2VO5A 1YEIL 2FHCA 5AG8A 1I9IH 4O9HL 4XMPL 5IQ7L 4G9FA 3DV4A 4LLWA 3VFPB 3OWEA 4I4WB 3CNKA 4EN3C 1HZHH 4NQCD 3BGAA 2Z8RA 5E4IA 1E4XH 1PG7W 2VISB 2JB6A 4M43H 3D25A 3QFDA 5JIHA 1NJ9B 3KXFE 1JFQH 4PJEB 3VXQA 4ZS6D 5I15H 3B9KB 4XXDA 4GKZA 4Y5YB 2ZCHH 4NRYA 1SY6L 4YFDB 1OL0A 4AT6A 1S7SA 3MUZ1 4PTTA 1HSBA 4OZHE 1H5BB 1X5JA 3BOVA 4XH2A 3RDTC 1BEYL 4YHYC 3LCYA 5B22A 3IVKB 3NZHH 3UTQB 1JWUA 2C4XA 3OR7A 4DCQB 2Z31C 1YMMB 3I6GB 3KPPB 3B6SA 2NNAA 3FB8B 3ULVD 5J11B 3DXAB 3BN9D 1SM3L 1H3UA 3O3AB 5E00A 4I0KA 4AIZB 2ZUYA 3VMNA 2VZOA 5LBSH 4MA8H 4PJ5A 2E6JA 4LCCC 4LCYB 5F1KC 5H94B 3UBXG 2I9TA 2OP4L 1ZVSB 2XA3A 4XCNB 5JW4Q 3U4BL 4JGUA 4Z78B 3BQUA 2XN9E 3R8BB 4D0DB 5ILTH 5IB4A 4HAGA 1EFXA 4N8CH 3T3PE 2Y5EA 3CZJA 5DD6B 5J6HB 3P4MA 4KKNA 2R9HC 4NZRL 3D0VB 2HVKA 3QG6B 5CKAA 3LQAH 4IDJL 1AE6H 3C5JA 2AJVH 1N2RA 2BNRD 4WEBL 4ZXBB 1MIML 2BVPB 3ARDC 5EU7C 4U1LB 3Q1SH 3RPIA 1JNHB 5CGTA 2AXFA 3BZEA 3RPKA 2VLRD 3KYMA 4GAFB 3NIDE 4MJ5B 1ZWIB 3T04D 5HYQA 1MCWW 4IRSA 1FRGH 1WT5A 4Q6IA 4X6DE 5GSVB 4ESKA 1U8PA 3BHBB 4NZTL 4G3YH 2X42A 4OLVH 1OT2A 1WCQA 4AG4L 3C6SA 4M6OL 5H35A 4L8CB 1QSEA 1TLKA 3DYMA 1BZ7B 3U46B 4DVBA 3HC0B 3FQNB 4D9LL 4O5LL 4N9GB 1DLHB 2NMSA 2CKBL 2FBOJ 3RKDC 4O2FA 5ETUA 3SDYL 3TESA 4M7JH 5DD3L 1SYSB 5JOPE 1A7OL 2VN7A 4UI2A 4M8QB 5AYUL 1OCWL 4ZUUB 4HBQA 4XHJD 4JRYB 1Q9WA 1ZA3B 5HYIA 2PCPA 3OR6B 2CUHA 3ARGC 3VMOA 25C8H 1P7QA 4GBXB 3LQZB 3SOBL 3D39A 3LV3B 1A9EA 4GW4A 3JUZA 2YMXH 1O7VA 5IM7A 1TPXB 3PHOB 4I0PA 1OF2B 5C07A 4QGTA 4LASL 3NBNA 1BFSA 5KAQG 1P1ZA 5DHXB 2F9BT 3BUTA 3AGVA 3H2WA 3U36A 1FIGH 3SN6N 4ENEC 3ALXA 3CXDL 2GI7A 3RHWF 1MAMH 1RJYB 2DOCA 1DBKL 1UWEL 1KTRL 2YKLH 4TTGA 3BDBA 5J7CC 1K85A 4MNQD 4QHKI 5E2UL 5KTEL 4DQOH 4BJLA 3MBED 1YYMH 3IGAA 3P11L 1NCTA 2X4SB 4IIQB 4HIEB 2FX9L 5IIEB 1MJJA 2Y36L 1ZA6A 1TETL 5FKAA 4EOWL 4WFED 1I3GL 4GAYA 2VYRE 1DDHA 1T20B 3UDWC 5GS0C 3AU1A 2XWTA 5KN5B 2W91A 2APFA 2VXUL 1RUKL 1KCVH 1SBBA 3OKOB 2EDYA 1U6AH 3AUVA 3HAEG 1I1AB 4P4KA 3N1PC 2DAVA 2GCYB 4XTRC 5A3IC 1CLZH 3E3QC 3WO4C 3D69A 4JDTH 2W38A 1G6RH 1LO0H 2IGFH 3F58L 3NA9L 3ARFB 2R1XB 4PB0H 2P5ED 5IROA 4FFVD 4JKKA 2F54A 3RY6A 1G0XA 5E6IC 2DWEA 3EYUH 4LSRL 2Q6WA 2C1PA 4S0TD 5IBUG 2YPLB 2Q76B 1QACA 15C8L 1J0YA 3FB6A 3KJ6L 1H8SA 5FYKH 2EE2A 3FT3B 1T04B 3U7YL 1F6AB 1GGBL 1NCWH 3LHPH 2X4NB 1EVUA 4ONFH 1UH3A 2OQJA 3QB7C 1Y6KR 5C0JB 1U3HC 4GRLC 2E9JA 2WM0A 3V4VL 1G7LA 2Q7YA 5TDNA 2XTJC 5ISZA 3KPQA 1B90A 3NFSH 3E6FB 4W81A 2CKNA 1TCRB 4TOYL 4CDHA 1B4JL 4HWBA 3VXSD 3LB6D 4RMWA 3S34H 5F1NB 3SBWA 1S7VA 1KCRH 3HG1E 2AJXL 3VFTA 4PJ8A 1NC4B 1KGCE 4ZPVB 4YIQB 2G60L 3MZTA 3O6LH 2ZJSL 3P0VL 5K59F 4L29B 5FM5M 1I3RA 1FZJA 2P44B 3IU3A 4IJ3C 3FFCD 4OF0A 1FNEA 4HGWA 1JMXA 1UA6L 2R2HA 3GJFA 3C5SB 5CEXB 1BFOA 1EO8H 1MFAH 5KS9F 1HQRA 5KVDL 3CFEA 2IQ9L 2V5YA 2V7HA 4I3SL 3T4YA 2OI9B 4ALAH 5ENWA 4Z76A 1CT8B 2WK2A 1CGSH 1N7MH 2WLZA 5I8CA 4HZLB 3T3MF 1W72L 2DQIH 3UJIL 3O9WA 5GRJH 3VRIB 4IS6A 1NGPH 4MD0A 3IXTA 3FQWB 3RVUC 1LD9B 1XCQA 2DL9A 3WFDL 1NL0H 3CH1B 5IW6B 3MV01 3TPUA 1ZGLB 2R2BA 3TH4T 2BFVH 2QBWA 2I26N 3IJYA 1MLBB 3KS0J 1VPOH 4OQ1A 5F7EL 4RISL 1IEBB 5DFTA 5GISH 2DQGH 2HFGH 4HUVB 5FA4B 4QOKD 2VDLH 3N85L 2Z92B 3O0RH 1T4KA 1RURH 2JJTA 4ZS7L 5CBEB 1YEGL 5GRYA 2OBGA 4UAOB 4OZGE 3QRFM 3VFPA 1FO0B 2F53D 1ND0B 4CDGC 3PDGA 3Q5YA 2VDPH 1KJMB 1WIUA 2VISA 4JFHE 4UILH 5CWSB 3SE9L 5IGXL 1NJ9A 2DLGA 2P5WB 4PJEA 4FQCL 3GBNL 4DGYL 1V8HA 3B9KA 3TFKC 4Y5YA 3H9HB 1J18A 1H8NA 2VLJB 3QFJB 4P57A 4Y7MA 1H5BA 3CK0L 1AY1H 4G8GB 5JPNB 3I6LE 4H26B 3QHZL 2XTLA 4U1HB 5GXBB 4N1HB 3IVKA 2HFFB 2O5YH 3UTQA 1I4FB 2XXCB 4DCQA 5FUZL 1MIEH 3LQMA 3I6GA 3FB8A 2F5AH 1N6UA 3DXAA 4CU7A 2X89D 1T2QH 1WBYB 3O3AA 4JB9H 4X6CF 5F8QC 4AIZA 4BFEA 2R0ZL 5F1IB 4D9QD 4MLSA 4LCYA 5T3ZL 5H94A 4RGNC 4YC2C 2ITCB 2YA1A 4N1EA 1ZVSA 4XCNA 1X6NA 4Z78A 1HI6B 3GSUB 2O5XH 1D5XB 4ODXB 1K2DB 4D0DA 3DHMA 4OZ4B 4D8PB 4MMXC 5DVLA 5DD6A 1JHLH 5HVWA 4LL9A 4DN4L 5J6HA 1FGNL 1UZ6F 3D0VA 3GHEL 4LDEB 1TNMA 1CGTA 5F89B 4DN3H 2Y9RT 4OFDA 4QCIB 3B3IB 5DURD 2OLDA 4PYGA 4ZXBA 4OLWL 1Q1JH 5CSZA 2BVPA 4XC1H 1DVFC 4U1LA 1M4KA 1KCSH 4EUPH 1JNHA 4RNRB 3T0ED 4F80A 5IVXA 1Q9OB 2NLJA 4YHNB 5EUOB 4MJ5A 3V52L 1ZWIA 4GG6F 1BAFH 2VDNL 2Z4QA 5GSVA 3BHBA 3VI4F 3HCVB 3MLRL 4WI4A 5FYJL 4NN7C 2BSRA 3RTQD 4FG6C 4DGVL 2QSTA 4KMTL 4PG9B 2DBLL 2R4RL 5TPWL 2MOVA 3TP4A 1CLOL 3I9GH 4PBVC 3QIBD 4MAUH 3U46A 1K8DB 1RHFA 5K9OB 3SEPA 1T5WB 4NJ9L 1DLHA 1E4JA 3IDXH 4I3RL 5KAQF 1WV7T 4GQ9L 3V4PH 4JO1H 5A16A 4UV7H 2QQLH 5D2NB 3RU8H 1A4KB 1RZKL 1SYSA 1P6FA 5HD8D 3GMPB 4U0RB 4H5SB 4M8QA 5DRWB 5F44A 2BVOB 4JRYA 4N0FB 4J4PD 4Z0XB 4P2RE 3EIFA 1SYVB 3U9UB 5GJTH 4BSWB 4GBXA 4D9RE 3T1WA 3LV3A 3B9DA 5E70A 2VLKA 2CGRL 3PHOA 2VLLA 1OF2A 4MWFA 3L3JA 5D70L 3MA7A 4XB7A 1R3HB 2D9CA 4PBXA 5KJRL 1TZHB 3RWIA 2XZQL 2HFEA 4G6MH 4NO0B 1J8HE 2BSTB 2VR9A 4JQXC 1FC1A 3GJEB 4HGKC 1LP9B 3RBSA 3A6BH 4ZO8A 2AJUL 3JWOL 2C26A 4GLRH 1O5DT 3KNBA 3ZTJG 2OL3B 1Z6JT 3DYPA 2AK4E 4QTIH 4NN5C 3CLFH 3FO2B 4NNYA 3FHAA 2A77L 3BKCL 5E2TL 1XGQA 2PYEB 3MV9B 2X4SA 3BDYH 1IKFH 4HIEA 5IIEA 4FQQB 5DJCA 2GJ6E 4KQ4L 5GRZA 3SJVA 4F58H 1ZHBB 4UT6L 3LRSB 3WFCL 3TO4B 5L8JB 4HS8L 1T20A 2EDBA 3BFOA 5JLZB 5KN5A 3C8KB 2YXMA 3OKOA 4DTGL 5I1IH 5DJYB 2GK0A 35C8H 3ARZA 2VTFA 3QXVA 1I1AA 4OT1H 2ADGA 3QEQA 3E1F1 3K8MA 3JWDC 1A7RH 1BZ9B 3UZQA 3ARFA 2R1XA 4HWEH 3GMNA 1LK2B 4JZJB 5F6IC 2R1WB 3UP1A 1H3GA 2YPLA 1AO7B 5FYJD 1A1NB 4NO3A 3GIZH 2DQJH 2ZNXA 1VACB 3FT3A 2UWEB 2CK0H 1F6AA 2NXYD 4JN1L 1RHHB 5L2KB 4WJ5B 2EIZB 3DX7B 4XX1G 1QLFA 1AKJB 1EBPA 4LLAA 2AABL 4NWUL 5AZ2H 3TGXA 2DM4A 1CXLA 5J8OA 2MCG1 1A22B 1GH7A 1QFUL 2JF1A 1D3CA 3E6FA 3MUY1 4MA1B 4WU5B 5DHVH 5K9QI 1AGBB 4YEEA 1TCRA 3RP1A 3ETBF 4ZOEA 4LGPB 1RZFH 1VA9A 5F1NA 1QKZH 1DUYB 2DQFB 1NC4A 4RMRA 1EZVX 2Q86B 2FL5B 4ZPVA 4U1GB 1IFHH 3ILQC 4K94C 4Q74A 4JHWL 2V5SA 2WBKA 3BH8B 4UTBH 4L29A 4G6KH 1CFSA 2AXGB 1MCBA 2X4UA 4XVSH 1YC7A 3L1OL 3P40A 4KAQL 5CSBA 2PXYD 1BQHG 3THML 5CEXA 4EN3B 1CLYL 2QQNL 1EJOH 2JB5H 4M5YL 1CIUA 1TZGH 5I76B 4MA7H 4YHZL 1QG3A 1CT8A 1G7JB 2BY2A 5K33A 3JVGA 4MXWL 4MS8D 2ZUTA 1HE7A 4HZLA 1T0NB 1JNNH 4KTDH 5FO9B 5IWLC 5C86A 1K9TA 4LQFH 3VRIA 1PYWB 5DDHB 4HF5L 5TH2B 3EO0B 1LK3H 4J6RL 3RDTB 4YHYB 1LD9A 1A7NH 1J1OL 3KPSB 5IW6A 1O7SA 4TPRH 1CL7L 3RAJH 4HBCH 1IQWH 2Z31B 3MOBH 1GPOL 1IAKB 3WIHL 2B5IB 4OIIH 1MLBA 1XF2A 3WJLA 4YDVB 1F90H 3WJJA 1CD1B 4LRIC 4HUVA 1G9NC 1A3LL 2X9WA 5FA4A 5IB5B 5IHLB 2GEEA 4LCCB 3U83A 4CMHC 2GIYA 2Z92A 2BCKB 3RFZC 2R29L 5CBEA 2CLVB 5EWIH 2V6HA 3BKYL 1BD2B 1ZTXH 3FFDA 1R5WB 3RWFB 4KHXH 3AB0C 1YEEL 4ZFOL 1FO0A 3TJEL 4OLYL 3GRWL 5DD0H 1U8KB 3VMPA 1VGEL 2KQMA 1KJMA 3LIZH 3HNSL 3SQOL 2EECA 4HCRA 4Y4KC 2Q8AH 4JY5L 5CWSA 1TTUA 4XVUC 2P5WA 4KKLD 3ARDB 1KB5L 4TQEL 2B20A 2BOBB 2YK1H 2ZUVA 4JO2L 1OAZL 1AXTL 3H9HA 3KHQA 3G08B 2WIIB 3U0WH 3GI8H 4WI8A 1I1RA 4G8GA 1S7UB 5JPNA 4ODWB 2VSCA 4PIRF 4H26A 5GZOD 2XZAL 2HFFA 5BV7H 1I4FA 3SE3C 1IZJA 2NW2B 4JN2B 3GSQA 2EXWC 5L7XH 4XPFL 5L2JB 5BS0B 2DLFL 3S6CA 1WBYA 3DX8B 2MQ3A 5AWNL 3FQUA 1TVBB 1PJ9A 5F1IA 2FX7L 3MLYL 2J88H 5L8LB 5JOPD 2JJUA 1A4JB 7FABL 4Z7VB 4I0CC 5C0FB 1HI6A 3GSUA 2NPLX 1A6UL 1D5XA 4M4PA 4ODXA 1KELL 4OZ4A 4D8PA 1RJZB 1G7QB 1LHZA 4ZTPL 5I8OH 2R0LL 1ZLVH 1QUNA 4NKDB 4U3HA 4UDUB 3RI5F 5MEQB 3CXHJ 5F89A 5I1EH 4XI5D 4RQQB 4QCIA 3T0VA 2VZ3A 4L3EE 5GGVL 5BMFH 3NH7L 1BQLL 5D71L 2XFXB 3QUKB 4XT1C 3G5YB 4MNGE 2DQUL 5BVPL 1MSPA 3TEUA 3ARGB 1A7PL 1D5BB 4LK4A 3ZT5A 4HG4J 2F8XC 2FNBA 2HH0L 3S3JA 5I1CL 4LPCA 4RNRA 1AR1C 3IFNL 3EOTL 4MQ7B 1MLCA 1Q9OA 3QZWG 4M61B 4YHNA 3OSKA 5EUOA 1KJ2H 3P2TA 3WS3B 1T6VN 1TTGA 2FX8L 1BLNB 5TE4L 1VEPA 2R56L 3A67H 3L3KB 5DEFB 3HCVA 4FFZH 5E95B 4LVEA 5J06A 1RUQH 1QBMH 4S1QH 5E94B 4CN4A 4PG9A 1F3RB 1OARL 3CCHB 4ODTH 4HJ0C 5FYKU 3H3PL 2DQDL 3VG0L 1K8DA 1L6XA 5I6XC 5K9OA 2NY3D 1CFBA 2R39A 4M7ZC 2VH5L 1G0DA 2H26B 1A4KA 5F7YC 3F7RA 4X0KB 2CDGA 3GMPA 5KVFL 5DRWA 4JEGB 2BVOA 4N0FA 4Z0XA 3O45A 1SYVA 4BSWA 2EE9A 3WO4B 1HHIB 3ELAT 4P5TD 1JHKH 3ZE1F 3SE8L 1XF4B 3HI5H 4B7LA 5IMMB 2FZ3B 2OJZL 3OAYH 1FORH 3BD4A 1YNLL 5E6IB 5H37G 4P46C 4TSAL 4QNPE 1R3HA 1S3KH 4KQ3L 2HJLB 3BN3B 1TZHA 1W8OA 4GW1B 3MOAH 3STLA 4NO0A 3P73A 2BSTA 4UB0H 5F3BB 1M7IB 4J3OC 1J7VR 5ECJE 2X9XA 2W9LA 3HG1D 4ZTOL 5IK3B 4K3DL 1LP9A 5EU5A 1FBIH 3DUSB 4PJAE 5SX4I 1B2WL 2OL3A 1U3HB 2DDQH 4GRLB 4Y4FB 2DD8H 3QAZC 3FO2A 3HC4L 4MJIE 2XTJB 3RVTD 3ET9F 3GKZA 3L95B 4FQQA 1U91B 4JZNA 5DFVD 1HH6A 1G9NH 3H7BA 5C0AB 3T2QA 3QUZD 1A7QH 1I7RB 3NCMA 3LRSA 3TO4A 4IRZH 5JLZA 1U2CA 4KJWC 4YHMH 4PP2B 1A14L 3C8KA 4HC1L 1U8HB 5DJYA 1NAKL 4EVNB 1I75A 2X2YA 3QXTA 5EC2B 1XGRB 4IJ3B 4F15C 3TV3L 3PWPA 3K1KC 3SE4C 4KUCD 3B9VA 3NFNB 1BZ9A 1LK2A 1ZK9A 4JZJA 2BC4B 5EBGA 4C4KT 3QHFL 3G04A 2R1WA 4JFDE 5IQ9B 1AO7A 4YO0B 1A1NA 3QA3A 3U7AA 5IBTL 1GOGA 1CFNA 1NUDA 1VACA 3LOWA 3WYRA 1C5BH 5L2KA 1RHHA 4WJ5A 2EIZA 3DX7A 1AKJA 2YRPA 1JNLH 3T4AA 4NQDE 1RIUL 4JJHA 4QHMB 5IKCA 3ARBA 3L3IB 1DQMH 3WFEH 4Z7OF 1QBLH 2D0HA 2FATL 2NY5H 4YHLH 4WU5A 1E4XI 4OM0L 3GMLB 5IBLC 4O51B 1QVOB 2WUCH 1PKQA 4N0UB 5CHNB 2LTQC 3UTTB 1DUYA 3CSPA 4WU7B 4M62L 1EVTC 4GAJH 2DQFA 1M71B 3DMMC 3IB4A 2Q86A 2FL5A 4Y2OA 4PJ9D 4JFHD 1AHWC 3BP4B 3RRQA 2C5DC 4JY6B 3QR2A 3OB0K 1IZKA 4FQ2L 1J87A 1DN0A 2DM7A 1Q94B 2OZ4H 1HHJB 2YN3A 4WWKC 4FP8H 1YA5A 4NZUH 5T1DL 2KBGA 1HYSC 4JLRA 3I6LD 4EN3A 3DNKA 4ZAKD 5JW5B 4M00A 3O4LB 5IR1B 5CS7A 5I76A 3IT8D 1UXSA 2VMFA 3LKOA 3MRMB 2A1WH 4JO4H 3EFDH 3X12B 1T1YB 1T0NA 1T7XA 2D7TL 5KS9B 4ODVL 5CCKH 3QIUA 5TF1L 1AQKH 5EG6C 2XV6B 5DDHA 3ZHDA 1DQQB 5TH2A 1RIVH 1OAYL 2AQ3A 3UCRA 1ZEAL 2HJFB 3RDTA 2WBJC 3ZTNL 3KPSA 2PF6A 3MLZL 1IGMH 1IAKA 1D5MA 4NP4L 3L9RA 1M6OB 1VGKB 4XCEB 4YDVA 4KZEL 4BK5A 4XCYB 5HYEA 1CD1A 1N4XH 3O8XA 4ODUB 1NUFA 5J9PB 4GAGL 3BO8B 2HT4C 5DEGB 4E41B 1Z9LA 4LCCA 2EDWA 4RGNB 4YC2B 3KPRD 2BCKA 3IFPA 2NZIA 1OTSC 3IDUA 1CZ8H 3KPLB 1I9JL 1BD2A 1MF2L 5C7XL 1R5WA 3RWFA 3HLAA 5DJ6B 1NMAH 2BHYA 4OCYH 1IGFH 5GGQH 3ZL4H 1JYNA 1OP3K 3ZKNC 1OWWA 2NY1C 1U8KA 1U8LB 4HXBH 4P3CH 3ARQA 1NCCL 3W9EB 5DUPH 4OM1L 1HNGA 3MLSL 4JFFE 4LSQL 3RVVD 4HH9B 1NBVL 4YR6B 3ARDA 2BOBA 1DVFB 4HKJA 3BYYA 4WUUE 2UV3A 3MMEA 1EO5A 1KBGL 3G08A 3LY6A 4FQHA 2WIIA 3O6FD 4N68A 5DMJB 1S7UA 4LCIH 4ODWA 2PKDA 4K9EH 1QNZL 5AAWA 3S37H 2A6IA 2NW2A 3UBXB 4X7CC 3VI3E 3K0WA 5L2JA 5BS0A 1FH5L 4NN7B 3QWRA 3GB7A 1TVBA 1KEGL 4NJAL 2MCPH 4PGDB 4U1NB 5GZNC 3SDXE 1DL7L 1MI5B 3QIWD 4WW2C 1A4JA 4G8FB 2YUZA 5TE7L 1S78C 4OGXL 3QDJE 4Z7VA 5C0FA 3L6FB 4P2RD 4X6CB 1RJZA 1G7QA 3MYJB 3PV7A 1F8TH 4D9RD 5GRWA 1INDH 4P48A 4UDUA 5MEQA 2EDXA 5D2LF 5DVKA 1JZ5A 3A6CH 4RQQA 2ORBH 2BXZA 3UTPE 3H6JA 4QY8B 3QUKA 1J8HD 3G5YA 1OM3L 3TJHC 1A6WH 4OD1L 5IMLB 5CIPH 4MQ7A 1RULH 4LSTH 5ACZB 3MODL 4KK5D 2AK4D 3I3EA 4Z8FL 3WS3A 1ZLVK 4L4TD 4Y16C 4RMSA 1BLNA 1BJ1H 4CBPA 4ETQA 1I7TA 5DEFA 2GJ6D 1A3QA 5E94A 4DVRH 2IH3B 4GG6B 2J3SA 5DHYB 4JO3L 1MEXH 4M1GH 3AFLA 1I85C 3W82A 5C0EB 3CCHA 4MNHA 4NN5B 4QHKJ 4OZIF 4JDZB 5EUKB 3B9EA 3CH8A 4M6ML 4CUCA 4ELMF 5I30H 4AMKH 2BNUA 4DKEL 4W6XB 2GUOB 3MRNB 3UDWA 2J7LA 3QXWA 1P6AB 2H26A 2HP4A 5JHDB 3ZKXC 3HFMH 3ZT6A 5IUSA 3HMXL 4X0KA 1VB9A 1SEBB 4PY8I 1I9IL 2KKQA 2EYRB 3FL7A 2IANE 4ZFFB 3CVHB 4LKCB 4OQTH 4C58B 3BSZL 3VWKC 1BECA 2FJGB 4ELKB 4HMDA 3ALWA 1HHIA 2FO4B 1XR9B 4YXKH 3D2UB 4J3XA 1XF4A 3MJ9H 2FZ3A 4KK6D 5IMMA 5FFLA 2VXTH 1E4XL 2ZPKH 5F6IB 4M43L 5E6IA 1EIBA 2WAHA 3BAEH 2ZUSA 1KXVC 3MROB 2HJLA 1JFQL 3QUYD 3ULUC 5I15L 4GW1A 4KKAD 3PE9A 1P84J 2YC1B 5F3BA 2QR0B 3NCFB 4EIGB 3E2HC 4U7SA 5HHPB 4YE4H 5IK3A 3BKML 3IDMB 3QULB 4G8IB 1DBJH 3DUSA 2NTFB 4PY7B 2H8PB 2IPKB 1F3DH 1U3HA 4GRLA 2ZG1A 3HC3L 2NY6D 1KB9K 3OKKB 4M1DH 3OAYK 5JPMB 3HAEB 3SDAD 3GK8H 1U91A 3U82B 1AP2B 4QWWD 5FUOH 1I7RA 2V2WB 3IAPA 5E8NB 1IVLA 3PWJB 2EZ0D 4PP2A 4I48A 1ACYH 4OZFG 1MVFA 1U8HA 1RVFH 4HLZH 4HS6B 5ILTL 4NM8L 4EVNA 2PYFA 3TH3T 1T1XB 4OCLC 4ZS6C 5EC2A 5IBUB 1XGRA 3UJJH 4XCCH 3U6RB 3LQAL 5DD1L 3NFNA 2NCMA 4Q9BA 3B2VL 1AE6L 4OJFL 4N1CA 2BC4A 3I50H 2GK2A 4EI5D 1JN6B 4YO0A 1YMHB 3MRDB 3Q1SL 1HWGB 1RZ8B 3ULVC 3CDGB 4NKIH 2VZSA 5ISZE 2HMIC 4KTEH 4FQIH 1MCOL 4Q6YA 3ARED 4PJHF 3L3IA 2E3VA 4PRPE 4G3YL 4X6EB 3TNNB 3OV6A 4OLVL 3GMLA 4DKAA 2VSDA 1QVOA 2X4QB 4O51A 3VXME 3HA0A 4N0UA 1FL5A 5T1KB 2DIJA 3D3VB 1FVEB 4WU7A 4FHBD 4MQSB 1F02I 3QQ4A 4JRXB 2H45A 1M71A 3NIFF 1A9BB 4N8PA 4YHOH 3BP4A 1CDYA 3VXUA 4PD4J 4NPYB 5F9JB 3WKNA 1Q94A 3AB0B 1GGUA 2OTWB 2HT3C 1HHJA 5F6HI 1JPTH 4R7DB 4M7JL 4ZSOB 5TFSL 2X1PA 1IQDB 4F3FB 3OF6A 1FVCA 4Y4KB 3WS6C 1S9KC 3O4LA 5IR1A 4IOFC 1V3LA 3MRMA 3VGGA 4OLEA 3LVEA 4ISVB 1DBBH 1FDLH 5EA0H 2YMXL 3X12A 1T1YA 1NMBH 3HRPA 3UAJD 3OG6B 4F7PB 5I1HH 3CFCL 3S7GA 1NBQA 4XAWH 1DQQA 5BW7C 2HJFA 3H0TB 3VJ6B 3F7QA 3M8OH 4HXAL 1FG9C 3FKUS 2ID5A 4JDVB 3HRZA 1F13A 2YKLL 4K3EH 5F72S 5IMOA 2NX5A 1VGKA 5DHVA 4LP5A 4XCEA 3RUGA 4PGBB 4XCYA 3DROB 1A6VH 4ODUA 1W0VB 5GS3A 5J9PA 3NPSC 2FWOB 4I13B 3BO8A 5DEGA 4E41A 1UG9A 1YYML 1II4E 2ERJC 4L3ED 4AJ0A 4FABL 3VGAC 4XHJC 3U0TB 3EDJA 3EUUA 1JF5A 4P9HH 4TTDC 3KPLA 4XNUL 3PDDA 5IFJB 2QSCH 5DJ6A 4QKXB 2DQHH 1KCVL 3K8KA 2EDEA 3CC5B 3ZT7A 1U8LA 4UBDD 3MC0A 4LLUA 4NNXB 5C92A 3W9EA 4RFNC 1CICD 2OTPA 1NANH 3CJJA 4JDTL 4HH9A 4R7NB 1G6RL 4YR6A 2EICA 1LO0L 1RZ7H 2IGFL 5KW9H 1KOAA 4XMKL 1DUZB 4PB0L 3VRJA 1YMME 4KROD 4XNYL 1TJHH 4PR5B 4OB5L 3ULUH 2GKIA 1T2JA 1I9EA 3C2AH 4F57L 3QXAB 4A2MA 4X8JB 2WINB 1T21B 3UBXA 3W0WE 1VADB 1NCWL 4YHKH 4PV8B 5E24E 4PRIB 1H3PH 4ONFL 5FF6B 4G8EB 3RZCD 3UXFA 1EERB 1DFBH 3P0YL 3UPRA 4U1NA 2FEEL 3JTSB 3T8XA 5KG9A 1EHAA 4G8FA 4H8WL 2CQVA 3P3YA 2IBGA 1MJUL 5DVMA 3L6FA 2AEWA 1IEHA 5I6XB 3MYJA 2WW8A 1KCRL 2A6DB 3H9SB 4PB9H 4ZD3H 5DJZA 1QSFE 1NEZG 4M7ZB 5J13C 4CJ1A 1R3IH 3WNLA 4QHNB 3SDCC 4PJIF 4V1DE 2NY4D 5E5RB 5CJQL 4GLRI 4XAKE 4Q9QH 4QY8A 5C6TL 1TJGH 2P7TB 1NC2D 3N1QC 4ZQKB 4JFZH 3OPZH 1EO8L 1MFAL 5IMLA 1IAOB 2FGZA 2Q8BH 4MAYC 4ALAL 4P46B 3ROOB 4UQ3A 5ACLA 3SGJC 1CGSL 4MJID 3V5DB 1N7ML 4M3KB 3ULVH 5KSAD 4NYLB 1Z0MA 2H3NB 4P99A 5HGDA 3LB6C 2FHBA 4JQXA 4K71C 1NGPL 4U1MB 3K1DA 4D0CA 4PS4L 2EDKA 2V9QA 5JA8B 5DHYA 4G6JH 4YZFE 5A40E 4YPGA 4HK3J 4RAUB 4PGCB 5C0EA 1FZOB 3QAZB 4JDZA 2M2DA 2E8ZA 1GRWA 3V6FB 3SGEH 5SV3A 1PDKA 3OKLB 3G6AB 5C0CB 1G9MH 5GISL 2HFGL 2F5BH 3VFNA 2AEIT 4KMLB 3VCLB 3S3PA 5DMIH 3MRNA 3O0RL 3UC0H 3OGOE 2BNQB 4N90E 4JFDD 4G7YL 1CTNA 2EYRA 5C0DB 3VGHA 4ZFFA 1RMFL 4OTXH 3CVHA 4LKCA 2EKSB 4UZGA 2MSPA 3BE1H 4F15B 2FJGA 4ELKA 2EIDA 1XR9A 4GKSA 1DE4B 3D2UA 3IETB 5JXED 1CGUA 5JO5B 4NQDD 5DMYA 3B43A 4B50A 4M3JA 4UILL 1JPGA 3TO2A 4JVUA 3MROA 1KJ2A 4XC3H 5E8PA 1S9YB 5GHWH 4JAMB 2QR0A 4GS7C 5F96H 5HTSA 4XVJL 5HHPA 5J1TC 4OKVA 2AXHA 1AY1L 3O6ML 4U3CA 5DD5H 4KRPD 3IDMA 1P4BL 3QULA 4G8IA 2NTFA 4PY7A 1WLHA 2H8PA 2IPKA 3GNMH 4XMPH 5IQ7H 4URTB 3GUTB 1J0ZA 1MIEL 3BP5B 2CJUH 5ICYB 3EO9L 5ANME 5JUEH 5C3TA 5JPMA 1T2QL 4JB9L 2EDOA 5IB2B 5GGSB 3HAEA 1ULVA 1EZVY 4XWOC 1ZV5A 1CGYA 2LTQB 5ESVB 2X1QA 3G5ZB 2W9DH 5E8NA 3PWJA 3DMMB 5CJXC 1JTTA 3BRFA 1KN4H 1S9XB 2O5XL 3RY4A 4HS6A 1AHWB 1BEYH 1T1XA 1R3JB 3VFWB 2R1YB 5I17B 4Q7DA 4WWKB 4OD2A 1I8IB 4Z7QE 2B39A 2ADJA 2ZNWA 4KZDH 2VDQH 4YXLL 1NGWA 1JN6A 2AKRA 3DRQA 2BZDA 3CDGA 1RUPL 3B9AA 5IWLA 4OV5B 1A5FL 2ESVB 1GL4B 5LAXB 3OTTA 1FNGA 1IMHC 5CFHA 1YQVL 2WBJB 4NZRH 1E6JL 1BAFL 3IJSA 3QG7L 5LKNA 3S35L 3RGVD 5EDXA 1PVHA 3TNNA 4MXVE 1BOYA 2QLVB 2X4QA 3VFSB 4WEBH 3BKJH 3D3VA 3VFUB 1FVEA 5D5ME 4JRXA 4YFEA 1A9BA 1KXTB 1YUHA 4MAUL 4PRHE 1BQHB 2HG5A 1RK1B 3MX0A 3N0PB 3HZYB 1RK0A 4U6VH 4JFFD 4ZDHB 4NPYA 3TIEB 5F9JA 2QKIB 3IDXL 1PEWA 2BDNH 2FR4B 5HJ3B 4WUUD 2EIBA 2QQLL 3RU8L 4R7DA 5DT1L 3W5MA 1UYWH 1MAKA 2B1HH 2IJ0C 1UKQA 2NY1B 1CI5A 5CGYD 1IQDA 3H42H 4Y4KA 1JYXA 3L5WA 4H0GA 3KYKL 4YHPB 1OVZA 3CZFA 4ISVA 4M6OH 3QO1B 4QLRA 3BQUD 1QTYT 3EYOB 3RTQC 1UFUA 3P77B 4D9LH 1YJDL 3HE6C 2VWEE 3QNXB 4O5LH 5BO1L 3SGDH 4TSCH 1GHFH 2YRZA 4L3CB 2CKBH 4NT6A 3VJ6A 1XGUB 3QIBC 4HKBB 4G6ML 3QDJD 4NGHL 12E8H 2P8MB 3SDYH 1JGUH 3AY4C 3SE3A 4JDVA 5D7LB 5C08E 1CF8L 4MB3A 5F1OB 5HVHC 5SWSB 1A7OH 1HWHB 1YYLL 1OCWH 3A6BL 3D85B 1I8MB 4PGBA 3G9AB 4NWTH 4XPTL 4X98A 2YOCA 1W0VA 4YPJA 2FWOA 4MCZB 5I2IB 3CLFL 4JQVA 5HGHB 5GGUB 4WW2B 4YLQT 1IKFL 3UTPD 1NCBH 1ZANL 4P2OC 4LASH 5D6CB 3IDYC 5IFJA 5D7IE 3QI9C 4IRSD 4HAFA 4YH6A 2BERA 2BY3A 2P5WE 1C16B 3CPLB 3CXDH 5MP6L 3CC5A 2RR3A 4NUJA 4LNRB 2VLJE 35C8L 5EZLA 1OTTC 4NNXA 3QFJE 3NCCB 3RWDB 3D48R 5INDB 4OT1L 4XHQA 2W65B 1MQ8A 2NY2D 4R7NA 4PJCB 4PJBE 5I8EB 2Y07L 1DUZA 1UQSB 3C5ZD 4OCXH 3TBTB 5IW3A 3GSNH 4LEXL 4NZJA 4PR5A 4UT7H 4YHIB 5D1ZA 2VABB 3QXAA 1CD8A 2DQJL 2IFFL 1T21A 1QRNE 2WINA 4Y16B 4GMSL 3JV0A 1VADA 1RUKH 2CK0L 3UJTL 4PV8A 3I6KA 4PRIA 1A0QL 1X7QB 1KCUH 3WHE0 5FF6A 4G8EA 5FO8B 1FLRH 5AZ2L 1P7QD 1SMOA 4X6FB 5F97E 1SQ2N 4OZHF 5E56A 3F58H 4I0PD 3NA9H 1KIRB 4MQXD 3VW3H 2AXJA 4DAGH 1QKZL 3K3QA 2A6DA 3H9SA 3LSOB 3MRJA 2J6EA 2YPVL 1ETZA 4UU9A 3U7YH 4R4BB 1MCPH 4QHNA 3ZKXB 1GGBH 3GZKA 3MNVB 3QZWB 4KDTC 5CD5D 4QRRB 4UTBL 1D5ZB 4XVSL 2P7TA 3VWKB 3R4DA 3V4VH 4ZQKA 3B2UD 1VFUA 3LKQB 1FG2B 5D2LB 1JPFB 3T3PF 2DTML 5EOCH 3JV4B 2YD6A 5B3JE 1IAOA 4RFEB 4TOYH 1LEKB 3EYFB 1SJXA 2JB5L 4P46A 3I84A 3ROOA 3VFGL 3V5DA 3V0WL 3RVWD 1FFOB 2ZWLT 1JNNL 1BF2A 4KTDL 2H3NA 3S36H 3QDGB 2G60H 3VXNB 3E2HB 2ZJSH 2EC9T 4P4KD 2HVJB 1QLEL 2HLFC 3D87B 5FOBB 4TPRL 3ZSTA 3RAJL 3EYQC 1IQWL 3VA6A 2AW2A 4PGCA 1FZOA 1FNHA 1CXIA 1NKOA 2J8UA 5D2NE 4OIIL 3V6FA 3DOSA 3OKLA 3G6AA 5KVDH 1IRAY 5GGRA 5C0CA 1LDPH 2CIIB 4I3SH 1F90L 3LKNB 3VE0A 4X6DF 1B3JA 2O93L 4OZIB 3VCLA 2AJYL 2IALA 1ZLWK 1W72H 4YNYB 4JHZA 2BNQA 3UJIH 4D0BB 5EWIL 3T2PA 2E7HA 2GITA 5C0DA 3KLAB 4MS8C 2EKSA 3WFDH 4CRPA 3JWOC 4Z7WB 1VHPA 4Q6IC 1MPAH 5ISZD 3RVXC 2PR4L 1F6LL 3SE4A 1DE4A 2ZUWA 3IETA 4HS3B 1AGDB 5JO5A 3LIZL 2DI7A 2DF3A 5M7QA 4YDJA 5SWZE 5CIPA 1JF1A 5B4MD 5CUSH 4PJ8D 3K46A 4PRPD 5I1AB 2K3TA 4JAMA 3LD8C 3U0WL 3AVEA 3MV9E 2PYEE 2RIKA 3BDXA 1NAMH 2YXFA 5F9WC 2WP3T 2C7UB 3GUTA 3KYAA 3BP5A 3MCLL 3W2DH 5JW4R 4YQXH 5ICYA 5L7XL 2ZUQC 1RQ5A 3RHWK 4QF1B 5IB2A 5GGSA 3MJ6A 3O3EB 5IGXH 5JW4N 5ESVA 2J88L 4OF7A 1VFBB 4BZ1L 2YUWA 4FQCH 2DB8A 4R90H 5CD3B 2KZ1B 3DMMA 2X4RB 5HYJE 1S9XA 4OAWA 1AHWA 2E7MA 3CK0H 2L7UA 5I8OL 4KKLC 3QHZH 1R3JA 4GO6B 4W4NA 4OQTA 2R1YA 5I17A 3GIVB 1CGWA 4BFBD 4WWKA 4NC1E 1PEZA 4CL7A 4YFLF 4Q2ZB 5E8OB 2VLRB 4OV6F 2UWEE 3QQ3B 5GZOC 5BMFL 4K8RL 1L4IA 1S7XB 4WRLA 3VXPB 3HPJB 1IC5H 3TT1H 4GMTH 5K9KB 1V3KA 5DJXA 4LPUA 3VGDA 3MRGB 4LSUH 5AG9A 1WBXA 4OV5A 4JKWA 1WSST 2ESVA 1KENL 4ZYKB 3DVGB 4EKXA 3TYGL 3PQYE 5LAXA 1TXKA 2EEAA 4X80H 4U6YA 4K7PH 4DN4H 3WXVH 1FGNH 4YBLC 5HDBE 1L0XA 1HILB 2L7JA 3BYTA 4FFZL 1RUQL 5FHAH 1QBML 4S1QL 4F2MB 2Y06L 2AVGA 3EDDA 4WFFE 4PJHB 3VFSA 1UB6A 2YR3A 4OLWH 5DO2D 3VFUA 1OSZB 5TGBB 2WWMD 3WXWH 3NPSB 4RA0C 1GIGH 1WUNT 1S7TA 3MRBB 1PFCA 2ERJB 2VRAA 3RY6C 4XRCB 1RK1A 3FCTB 3VXOA 4M02A 3HZYA 1WITA 3KWWA 3WD5L 2H6PB 2MKWA 4ZDHA 5J1SC 2QKIA 4ZOAA 3BPNC 2VIRB 3HUJE 2FR4A 4LAJH 2QHLA 5HJ3A 1YMMD 3UEZA 2PW2A 2ED9A 4LMQE 2X70B 3S3SA 4E42B 3MLRH 2F58H 5FYJH 2A9NH 1PG7H 3ZKMC 3O2DH 4KMTH 4MVBD 3ROLB 4RFNB 3FQXB 3FAWA 4J3SA 2DBLH 1I7UB 2R4RH 4YHPA 1EXUB 1ADQL 3QDME 5TPWH 3QO1A 2XNAA 4M4RA 1C12B 4J12A 3SKMB 3HI5L 3EYOA 5T5NG 3DX9B 2X44D 1FORL 4X99B 1IC7L 2FIKB 5C0BB 3SBWC 1NBYB 4AENB 1S3KL 1BX2B 5BZDB 5BRZA 4I9WE 4I3RH 2P24B 4GQ9H 1XGUA 4HKBA 5E08H 3CX5K 5GRVK 4UB0L 2MPAL 1RZKH 1ZHKA 5SWSA 2VB5A 2YWYA 4OLUH 3W39B 3D85A 4P2QE 1QSFD 4D2NA 3G6JE 1I8MA 1BMGA 2E9IA 2DDQL 4UOW0 2DD8L 4MCZA 4RAVB 5I2IA 4V1DD 3L7EA 5HGHA 2HLAA 2XIDA 5GGUA 4WW2A 4E5XB 2CGRH 4XAKD 1MCKA 1CR9L 5IB3B 5D70H 4L8DA 1A7QL 5F88B 1G6VK 3K4AA 2DYPD 4IOIB 5KJRH 4IRZL 4X4YB 4K8RD 4YHML 1C16A 5EU7E 3TVMD 3UTSE 5J13B 1AXSB 2UVFA 1T7YA 3SDCB 4Z0BH 3BUYB 1P4LB 2VITA 3RWDA 5TQ0H 5INDA 3MQIA 4HEPG 2FYYA 2W65A 4HIHB 1A6PA 3DGCR 1KNOA 2EDQA 3DVNB 4PJCA 3RIFK 3Q5TA 4BZ2L 3BKCH 5E2TH 3LPFA 2OMBA 4TN9A 1UT9A 4OZGF 1P53A 4PBWD 5I71C 4KRLB 4EEEA 2X5PA 5BS0E 3RWEB 1G0YR 4MAYB 1RJLB 4KJQD 2VABA 1FSKB 3RVTC 3WFCH 1ZSDB 4Y16A 5IF0B 3BRDA 6FABH 2VOTA 4XP5L 1GC1H 4DTGH 5FGBC 4K71B 8CGTA 5E1HB 1DQML 5CMAB 4X6FA 1WC7A 5E7BA 4BKLB 4DGIH 1QBLL 4N90D 1I85A 2NY5L 1T1ZB 2EDTA 4HEME 4E0RB 5HYSG 5IVXF 1CDUA 1KIRA 4X4MA 1P2CB 5DA0B 1UC6A 4KTYA 1XZ0A 4P3WA 4GAJL 5AYQA 3LSOA 3KYOB 4QRPE 3RWCB 1JUFB 3NAAH 1X5XA 4LGSB 4P23C 1UM4H 3TLRA 3S8WA 1Z5LB 1OTUD 2ED8A 3MNVA 4NKQB 3QZWA 5FGRA 4QRRA 4PY8J 4PGEB 4HDIB 5HPMB 3HB3C 2APXA 4NQCE 2OZ4L 2AABH 3MR9B 2XG5A 3VWKA 4FXKA 1I9RL 3DI2B 4I18C 5F7UA 4FP8L 4NZUL 5IJKC 1FG2A 5D2LA 1JPFA 1EDQA 4PJIB 4Y1AB 1BGXL 3JV4A 4RFEA 3EYFA 1LEKA 4CU6A 3EGSB 2A1WL 3EFDL 5DMGD 1P7HL 3ZE0E 3E0GA 4RMVA 2V17H 4C56A 3QDGA 4K7FB 2I07B 5CCKL 1AQKL 4UOW1 1WWWX 4GS7B 1Q72H 3U1SL 3VXNA 4JHWH 1NDGB 1RIVL 1T83C 2HVJA 2D7OA 5F71A 2N7BA 1OAKH 3MV7E 1U8MB 4N5UA 4QOKB 4TRPL 4OIAA 2EXYD 4JFEB 4KAQH 4PJ9C 1IGML 4K55A 2QL1A 1VCAA 3ARFD 1QHOA 1PKOA 2NQCA 1JP5A 3P9MA 1JGDB 5GRUL 2QQNH 3CU7A 1T66D 3LKNA 4M8VA 1N4XL 4M5YH 2APWA 4YHZH 4CAGA 3R0NA 3OGCB 5CINH 1AQDB 4ZAKC 4YNYA 1KTDB 4P59L 1MY7A 4N5ED 4NM4H 4D0BA 2CD0A 3BWUC 4HF5H 3KLAA 1KLUB 5IOPA 1A2YB 2BNRE 4Z7WA 1IE5A 1CL7H 3ZL4L 5C09E 1CE6B 3NA4A 2ARJQ 3L5JA 4H25B 4HS3A 4LF3B 1AGDA 4P3CL 3IDIB 1ES0A 4LVHC 5DUPL 4OSUH 4RRPG 1AIFB 5I1AA 1EMTH 2D7NA 1EGJA 3FOLA 3BWAB 2WZPD 1JZ3A 4LCIL 1MRFH 2HJKB 3EOBB 3BKYH 2OCFD 1YEEH 2C7UA 4PRHD 5C0AE 1HSAB 3QH3B 4KI1A 4M9PA 1Q38A 1IGTA 4XPAL 3TJEH 4NO5B 3V6BR 1AD9A 1W0WB 3GRWH 4OZFB 3C60C 1VGEH 4QF1A 3SQOH 3T08A 4WNQA 3O3EA 5FGCB 5D1XD 1FQ9C 5GS2H 4POYA 1QBAA 2Q1EA 3C08L 1DQLH 1VFBA 5CD3A 1OAZH 2X4RA 3BEVB 1EX0A 1CFVH 1W72B 1G1CA 2EYTB 2I27N 3RVVC 3UYPA 1F8TL 4A6YH 4BUHA 2FJFB 4H1LH 4LKXA 2EC9U 2O26U 3GIVA 2X6MA 3O6FC 4YWGH 3L3DB 1BVLB 1MCIA 5F6HJ 4PLNC 5E8OA 4Q2ZA 3LN5B 2VLRA 2ORBL 3QQ3A 4XNQA 4KK9C 5AWNH 1S7XA 3U7WL 3FB7B 3Q3GB 3WS6A 3HPJA 5C08D 1A6WL 1W8NA 3MLYH 1AGFA 4U6HB 5K9KA 5EIIB 4F33B 3QPXH 1UVQB 2IPTL 3HHRB 2O61B 3IS1X 3HE6B 4ZYKA 2CIKB 2DIAA 2EDFA 3DVGA 4ZTPH 1D5IH 3QIWC 5BW7A 4EI6B 4N0UE 3MRPB 5HHOB 1IGCH 3UTTE 1UH4A 3QIBB 3ORJA 3DIFA 1EEYB 3ZO0A 4MYWB 4RX4D 5EZOL 3RZWA 4XZUB 3VU2A 5HVHB 3D9AL 4DVRL 3NH7H 1BQLH 1NANI 1NLBH 4PJHA 2N4IA 2P5WD 3VFVA 3DUUA 4M1GL 4OIBA 4P0DA 5CJOL 1OSZA 4ONHB 1A7PH 5KSUA 2VLJD 5I1CH 3PF2A 2AJSL 3SDDC 3QFJD 3FCTA 3EOTH 3ME0A 3IFNH 4Y19B 3QUXD 5FM4A 5T5NF 4Z5RB 4P2OB 1OQOA 1SY6A 2H6PA 5K59E 1HYRC 3IDYB 4AMKL 1T7WA 2VIRA 3GDBA 3QI9B 1NMCC 3QNYB 4RBPH 3EOAB 1NLDL 4ERSL 5BXFB 1UACL 1H9VA 5HDQH 4OGAC 4HIXL 5TE4H 1FZKB 2R56H 3KR3L 5KS9E 1RSFA 4HGMA 1UWXH 1QRND 3ROLA 4WUKH 1I7UA 4NSKA 1EXUA 1WFOA 4RSVA 3M07A 3QXUA 1C12A 4LCUB 3SKMA 3MJ9L 3T3ME 3H3PH 4LFHD 3VG0H 3UPAA 3DX9A 4X99A 2FIKA 2ZPKL 4AENA 3BAEL 1BX2A 5F7DB 4Z95L 4OCRH 4R2GD 4WI3A 2Z35A 3CDYA 1MRDL 2VH5H 2GSGB 3RKPA 2D31B 4L9LC 2XT1B 5JR1H 4YE4L 5KVFH 3W39A 4C59B 1DBJL 4FTVB 1ZHNB 2RFXB 4LLWB 3ARUA 4RAVA 4OLXH 4M1DL 3MA9H 2PO6D 2AI0L 1HQ4B 1C7TA 5HI4C 4MDJB 3IYLW 2OJZH 4E5XA 1KIPB 2P49B 5IB3A 1YNLH 2JB6B 3D25B 3QQ9D 3QFDB 5FUOL 2LAAA 4TSAH 3IJHB 4KQ3H 5F88A 4IOIA 1DEEB 4GKZB 3Q5OA 4R4ND 5A2JH 1ACYL 2P5EA 1AXSA 1XIWD 1RVFL 5KBNC 4V2BA 4RMQA 2FH8A 3SDCA 1KSRA 4ZTOH 3BUYA 1P4LA 1LEIB 4HHAB 3UJJL 4KKAC 4XCCL 4XP6L 2R69L 1B2WH 4HIHA 3ZE2E 3DVNA 3HC4H 3SGEI 3B6SB 2K1MA 2NNAB 3TT3L 1EEZB 1K4CA 1YC8A 5LCVH 3PHSA 4PJDE 3RWEA 2NY6C 4MAYA 4PJ5B 1SVZA 2J4WH 1F2XK 1FFQA 1ZSDA 2I9TB 2CKBA 3G9VA 5EU3B 1MI5E 4KMQA 3SDAC 4KTEL 1A14H 1LMKA 5LXGH 4HC1H 3VXSA 1EFXB 5I19H 4FNLH 4KRMB 2J8HA 4R96B 4U1KA 5AEAA 4X6CE 4HX1A 3P4MB 3IFOB 4X7EC 1WK0A 5I74C 3RWJB 3FONB 2EZ0C 5CMAA 4BKLA 2HA1A 2X1WL 3LKRB 1NEZB 1TQBC 1XH3B 2GJZA 2XPGB 5DVOA 3KXFB 1X4ZA 4L1HA 1P2CA 3FFCA 3QHFH 4JPVL 1N2RB 4R3SA 5EUOF 1T7VA 5E2WH 1YPZE 1RZGB 4NO0D 4OZHB 1JUFA 1UZ6E 2VJXA 5IBTH 4YHOL 2AXFB 4HSQA 4NKOB 2K9UA 1N5AA 1X5ZA 3BZEB 3ZDYF 2ZCKH 4DFIA 5T33H 1JPSH 5CBAA 1Z9MA 5C0IB 4PGEA 4HDIA 3QCUH 1RIUH 5HPMA 2X09A 5F1SA 5E0QA 1JPTL 4Q6IB 3MV9D 2PYED 4I1NB 2ZUUA 1U8PB 2CDEA 2E5EA 4PJIA 3HI6H 2I60H 4OM0H 1FYTE 3AREC 4BM7A 5IG7B 1NSNH 2XN9B 3TO4D 2F74B 2J2ZA 3EGSA 4GG6E 1DBBL 5EA0L 5FB8B 1B9ZA 1QSEB 4GXUM 2CPCA 4K7FA 2I07A 4DVBB 2FEDD 4GFTB 3LD8B 5A2LH 1NDGA 4NQEE 4FQ2H 2CXKA 5F9WB 1A1MA 1U8MA 4QOKA 5ETUB 5HYJD 2EE6A 4KXZH 4OI8A 5CJ8A 1Z9SA 4JFEA 1JZ6A 5HSFA 4HPOL 3V6OE 4GG8B 3P30H 5JHDE 2ZUQB 1S9VB 4XP4H 1JGDA 4I8DA 1Q9WB 5DJDA 5J1AB 2VKWA 1A6VL 2PCPB 1LO5A 4R97C 5FDWB 3MREB 3OGCA 3MCKB 1AQDA 4F8TA 5JHLL 2D7TH 5L2KD 3SCMD 1KTDA 5CJXA 2BRQA 1AKJD 4Y89A 4P9HL 3RA7H 5J4MA 1ZKAA 3K2MC 1XGYH 4X6DB 1KLUA 4LEOB 3ZTNH 1A2YA 3PV6A 3UAJC 5J12C 3MLZH 4PJGF 3MV8E 1CE6A 4H25A 4CU8A 3PQYD 4EUPG 3FQTB 3IDIA 2ICEB 3T0EE 4YGVB 4OCWH 4KZEH 1AIFA 3KG5A 3F8UB 5A1AA 3GHBH 4M03A 1BFTA 5JXAH 3LEVL 1MJJB 3NGBC 4WFGE 3RJQB 1KYOJ 5FYJU 4UUJA 2HJKA 1I9JH 3EOBA 1MF2H 5C7XH 5I0DA 3BI9X 5GGRY 3AU1B 2XWTB 1Q0XH 1HSAA 3QH3A 1UZ8A 4BSVA 4X7TB 4NO5A 4YBLB 1WWAX 4EN3D 5HBBA 3LQAC 1X5FA 3MLVL 1W0WA 1H3PL 4OZFA 1V5JA 1HHGB 3AS2A 1S7WA 3M45A 4JY4B 4OM1H 1DFBL 3MLSH 1MJ8L 4LSQH 3D69B 1UEYA 1NBVH 5J6GB 1HXYB 3INUH 1JPST 3DTXB 4UBDC 1KBGH 4PJAF 4NFDA 3BEVA 3SGDI 5F7HA 4HZAA 1W72A 2DJSA 1EUUA 2EYTA 3RDTD 4TSBL 3QDMD 4NQVB 3M1BB 2FJFA 3FB6B 5EU4B 4ZD3L 3BPNB 3FJTA 5EO0A 2Z31D 1J9CT 4P49A 4RDQG 3L3DA 1BVLA 2ZKHL 3LN5A 4F7EA 1MHPL 4I9WD 3TBWA 4XWGL 4LCWE 4Q9QL 1TJGL 1KEGH 1RAMA 4OF3A 3Q3GA 4NJAH 4POUB 4FFYH 5I18H 3EDFA 1DL7H 4U6HA 5AAMA 3KPQB 1F4XH 4JFZL 1NCNA 4OBRA 4F33A 3OPZL 3DRTB 2HAZA 1UVQA 2Y1VA 4OGXH 5TE7H 3RTQA 3RZCC 2AJZA 1EA9C 1GSMA 3HE6A 2CIKA 2P1YA 4EI6A 3ZSSA 4S1DC 1AC0A 5GGSY 3MRPA 9CGTA 3QIBA 4G9DA 4Z7UA 4ZFOB 3AY4A 4GOSA 3K2UH 4FOMA 3N06B 3S88L 4JFXB 1TJIH 5KVMC 1I3RB 2X4OB 3K74B 5CILH 4G6JL 3PIQB 1DSFH 1FNEB 1OM3H 3UTSD 1OW0C 4ONHA 2NY4C 4ZMAT 1MFDH 3GSXB 2BRRL 1BFOB 1KB5B 4ZSOE 5IFHH 1WWCA 4WEMB 2A74A 1OWRM 4Z5RA 2V7HB 1G9ML 1GXEA 3MODH 1KXQE 4GKNB 5ENWB 1TFHA 2X1OA 4JKLA 3QNYA 5BXFA 3OB8A 1WAAA 5IFAH 1FZKA 5BS0D 1X4XA 3QWRD 3KHOA 1OD7A 1S5IL 3C9NB 2CLZA 4OTXL 4EQ3A 5KSAC 2LE9A 3ARBC 2ZSVB 4JO3H 3U9PH 3BE1L 4R9HA 5MEPA 4PJFA 1MFNA 5EFIB 3SPVA 1FFRA 1XEDA 4JCLA 2DLIA 4QGYA 4HWNA 1CD0A 4M6MH 4IRJD 5C8JB 1MH5B 5I71B 5F7DA 4FS0A 3AS0A 2DQCL 3LZFL 4KU1A 5GHWL 3O81A 2D31A 1E4WL 5F96L 4F37K 5I1DB 1CBVH 3HMXH 5DD5L 3K81A 5F93C 1UWXK 4QRPD 5D7KE 1BREA 1MCEA 3GNML 5CP3A 4FTVA 3BSZH 1ZHNA 1PX4A 3ARGD 2RFXA 2YBRB 2CJUL 2E6QA 1HQ4A 5JUEL 4MDJA 5DK0B 4QYOA 1KIPA 5H8DA 2WV3A 3P0GB 2WWKO 2YN5A 3FZUC 2EDDA 3IJHA 4ENED 4HJGB 2W9DL 5JXEC 1DEEA 1LEGB 3QIUC 1U8JB 1KN4L 4P23B 3T1FA 4P57B 3V7MA 1B4RA 4KDTA 1A6ZB 3VXTB 4JFOB 3BKMH 1LEIA 4HHAA 2YA0A 1I1YB 3HC3H 5FV2A 1F11A 4I18B 2P8LB 5GSRB 4Z7VF 1EEZA 4H8WC 1FCCA 4KZDL 2VDQL 2OS7A 3MV7D 3O8XC 4I77L 5CZXD 5I75C 3OQ3B 4DZBB 1JBJA 1WF5A 3NABH 5EU3A 4OZGB 3G5XB 3CGTA 1OT1A 4NM8H 3L5HA 1WQVT 4CN1A 5ICXB 4R96A 3IFOA 5A3ID 3RWJA 3FONA 5DQDH 2W0KA 4JG0L 3LKRA 1NEZA 3MTRA 2XKSA 1XH3A 4PJ9B 5DD1H 4ZFGL 2XPGA 3MNWB 2E9BA 3HE7D 2IMNA 3B2VH 4WI9A 3KXFA 4K3HA 4OJFH 2VDOH 3BKJL 3C8HA 5CSZB 5C09D 3VI3F 1RZGA 1YEKL 2PXYA 4OZHA 4X9GA 3KPNA 3BMVA 4NKOA 5IVXB 4ZAKB 1DCLA 3V4UL 1YEDA 2NLJB 2CLRB 1MCOH 4U6VL 3SDXF 4S11A 2P47B 5F7LB 5C0IA 1FFPB 2BDNL 4Y4FD 1RZIB 2Z4QB 5GRVL 1UYWL 5BVJA 4LBEB 2B1HL 3CAFA 3ALPA 1F97A 5HDLA 3FMGH 2BSRB 3H42L 1N59B 1UADC 3RNQA 1MVUB 2E6PA 5C0AD 5IG7A 4LVHB 1P9MC 3X3FH 2OM5A 4OF5A 2XN9A 4LOUC 2F74A 3QJHA 3RGVC 4QTHB 5D72H 5FB8A 1RUAH 4I2XE 4HUUB 4HFUH 4TSCL 1GHFL 1Z3GH 5DQ9B 5A16B 1V3MA 12E8L 1JGUL 3QRGL 3RL2B 4LDLB 1F3JA 4GG8A 5TFSH 1EAJA 2X9YA 1PZUB 1S9VA 3C60B 5J1AA 4NWTL 1OPGL 1MELA 1GGYA 5FDWA 3ZHKA 3MREA 1L0YA 4JFYB 5CGYC 3MCKA 2VLKB 2VLLB 1NCBL 4LARH 4MWFB 3CFCH 3L3JB 1JGEB 1JWMA 3OKNB 1F4YL 3MA7B 2GAZA 2OR7A 4X6DA 2VR5A 3RVUD 4LEOA 4L4VB 1ZS8B 1NGYB 3ZDZE 3RWIB 4HXAH 2HFEB 2OMNA 4UNVA 2OXGA 4W68A 4B41A 3O6FB 4TVPH 4IHOB 3FQTA 1BWWA 1HKFA 5EZJA 2ICEA 3PDOB 4YGVA 2Q20A 3UYRL 3UTTD 4OLZL 1ACZA 3KNBB 4KPHH 4HUXA 2ICCA 5JNYA 4F7MB 4NNYB 2AV7B 5IW1B 1NKRA 1XGQB 4OCXL 4QRQA 4FABH 3QEUB 4JJ5A 1V7ML 2Z91A 4J8RB 1UJ3C 5DC0A 3GSNL 4GSDH 5DJCB 3CFBB 4UT7L 3SJVB 1KJVA 4XNUH 4G6AD 3QIWB 3X11B 2P48B 4X7TA 4NO2B 1CS6A 1EEUA 3N50A 1KCUL 2GK0B 1HHGA 1FLRL 4NHUB 4JY4A 1F58H 2ADGB 1IC4L 1CXKA 3QEQB 2YRLA 5J6GA 1XF5B 1HXYA 4XMKH 3DTXA 1IJ9A 3E8UH 3W9DB 3PGFH 3SDDB 3RWHB 3GMNB 4YK4C 3GSRB 3VW3L 4XNYH 1FNFA 4DAGL 2NY2C 4NQVA 4OB5H 3M1BA 2MNUA 3WDJA 4FQXD 4NO3B 5EU4A 4F57H 2R8SL 3C5ZC 1NMCB 4G7VL 3ES6B 1MCPL 3NTCL 4TNWK 1WIOA 1K3ZA 3WIHA 1QLFB 4HMEA 2B1AH 4ODBD 1BJ8A 5HHQB 4GRWH 4RGOH 5F7MC 3QYCA 1OAQL 4ZG1A 4Y4HD 3P0YH 1CYGA 1E27A 4M6NH 1DTUA 2GJ6B 3MJ7B 5EIVA 5EOCL 3L7FB 3DRTA 4H8WH 3EAKA 3HNVL 5GJSH 5DR5H 5E4EC 1MJUH 3WDHA 4Y2DD 2C3VB 2DL2A 4C83B 1LO2H 1UCTA 1NFDE 3S36L 1JWSA 4ZFOA 4Z7OE 1XCTB 4WGWB 1IEAB 4L9LB 3OL2A 1MJ7H 4U33A 5CJQH 2VQTA 4JFXA 3GRWA 5T5FH 1CFSB 2X4OA 5C6TH 2X4UB 4OUUB 3PIQA 1DVFD 3MRHA 5C9KA 4M1CC 1U8IB 3GSXA 5CD5C 1KB5A 4J1UA 4QXTB 1LDPL 1YJDC 4GKNA 3B2UC 1CD9B 2XZCH 4HKZA 4U31A 4H1LA 3KLHD 4O00A 2JLLA 3N1FC 5C9JB 4JQIH 1FGVL 4JANB 4XNXL 3C9NA 2OXHA 4PS4H 3RUGF 3VD9A 2XYCA 3CXHK 2ZSVA 1MI5D 1MPAL 4MX7B 5EFIA 2HRPH 3LKPB 3HG1A 5D7LE 1XF2B 1T0MB 2WIMA 3C2SA 1MH5A 5C8JA 4HG4K 5SWSE 1WGOA 2PNDA 3G5VB 5CUSL 2WWKT 1BJMA 2NY6B 2JJVA 1LQSR 3BIBX 5I1DA 3SDAB 2RJMA 1NAML 5C71A 5FGBA 4G7YH 1MCJA 3QUZA 3FFDB 5K9JH 1RMFH 4DOHB 1IAIH 4ONGH