2VDNL

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist eptifibatide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
214
structure length
213
Chain Sequence
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPRFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 54
structure length 213
sequence length 214
ec nomenclature
pdb deposition date 2007-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdnL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdnL01
1RY7B 2HFTA 4F15C 3KPSD 4DJMA 3FCTB 4M02A 4M6MH 2XV6B 3HG1B 4OLYL 3EFFB 4J4PD 1AQKL 3TC9A 2NTFB 3GIVA 1S7UB 5ALCH 1FORH 2P5EB 4QHNB 2FZ3A 1VB9A 4Q9QL 1Q38A 4MZ2A 5JW5B 1VGEH 4R2GD 4PJEB 1A9BA 3KXFA 3RIAF 3U0WH 3VFRA 3OKKA 4NQCD 3ESVF 4Y19D 2B2XH 1YEFL 3EYUL 1ZK9A 3HNVH 2CO7B 3LAFA 1OCWH 2C26A 4X9FA 3GMRA 1LE9B 3NIGF 1RVFL 4ODWB 3E2HC 3ZKQD 3HNTL 3I9GH 4YHZH 2ZUVA 4N0FB 5EFIB 3MNWB 1SYVB 2ARJB 1NFDA 3OKOA 1D9KD 5E0QA 4FQ2H 1MAKA 4MB5A 5BS0B 3ARPA 3D39D 3LCYA 2FEEI 3X12A 3OAZH 1KBGL 3WN5C 2DQEL 5AD0A 1MH5A 1D5IH 1DTUA 1G6RB 1NDGA 1ZHKA 1SMAA 3K81A 2VAJA 1K8DB 3HI6H 4LDEB 2DLFL 4ZAKD 3N9GL 4RFOH 1U8QA 4JRXE 5CUSH 3C5ZD 2IBGA 4N0UE 1SEBA 4DCQB 5LQBL 5KW9L 4KV5F 5D1XB 5DHYA 5I18H 2AABH 2BY2A 3PF2A 4HCRL 4LVNB 3SKUD 3JWNC 1ADQH 4YHLH 3SKNB 4LKXB 1O7SA 5DJCB 1NUFA 2UYLA 4RRPG 5ANMB 2KUTA 1FPTL 4L3EA 2X4QB 3BRGC 3UX9B 3GK8H 4O5LL 2F53A 3MJ6A 2EKSB 2HG5B 3MRQB 5GHWL 5JOFB 4BH7B 4ODVL 3MUGB 3EYFA 2KL6A 3VXMB 4KTDL 3GJFA 4L3CB 3WS3B 1DANU 1Z5LA 3QEUA 5CJBA 5F1IB 3ABZA 2BVQB 43CAB 5HHQA 4UQ3B 4MNHB 6FABL 3C5JB 5GZND 5F70A 3MRGA 1GC1H 1T0NB 1QVOB 4PGBB 2CKBH 2X41A 2J2ZA 3V9FA 1KCUH 4Y16B 1YYLL 1RZGB 4LEXL 2NR6D 1HHGB 5HD8C 5D2NC 1MY5A 3QYCA 4GRWB 3RWIB 5I1DB 4Q0XL 4TUJB 2DQUL 4MZ3A 2EDOA 4J8RB 4HK0B 2VSDA 4W4NA 4G43A 4PJBA 3AXLA 4M1CC 3QDJB 4R90H 2GY7B 5ACZB 1J1XL 1N0XL 5IVXE 4V1DE 5ISZE 4EOWL 4MLSA 4LCIH 5K93A 4MDJB 4GG6B 3K46A 2FX8L 1G7QB 1QG3A 3QCTL 4JLRB 4LSQH 4XC1H 1XR8A 2LU7A 2JJVA 1Y0LA 4F9PC 1FAIH 3ILPB 3WFDL 1NMBL 2NY0D 4PRPD 4R9HA 4C56A 5CZXD 1N8ZB 4NRZB 1ZLWK 3VA6A 4BK4A 4GW5A 1FZJA 1JNNH 4XZUA 4BKLB 4K7PY 1OAZL 4HEME 3L9RA 2FJHA 4DK3A 2MQ0A 3MFFA 5IB1A 3OAYK 4ONFL 1Q0XH 1X6LA 2CO6B 3ARZA 2QADB 5CEZE 3U0PA 3MMEA 3SE3A 2N4IA 5D7JA 2NMSA 4JDTH 2NXYD 5DGQA 3RGVD 5L0QC 3RL1B 3S37X 5IMLB 3HS0B 2X89D 5DFWH 3S37H 3LHPH 4PTTB 5E8OB 5KVFH 5GS0H 4JPIA 4XBEL 1F58H 1DZBA 4NQEB 5DO2D 4FQIL 5C0CB 4IDLA 3FFDB 1DBBH 3MSPA 2Q20A 2XXMB 5JXAL 4HKXA 1HOCB 3EFFA 2ZUQB 2FGWH 5SWQB 3MGOA 3T2OA 2BMKB 2P5EA 4X7SH 1MHHB 1IE5A 3T2NL 1VFUA 2BC4B 5C0AB 4IRSD 1OAUH 5JW5A 3AM8C 1YN7B 3L3KA 2PXYD 1XF3B 4GW1B 4NQUA 4P99A 5BW7C 4QKXB 3WIIL 3BKYL 1KN4H 4M1GL 4MAUH 3O8XD 5D5ME 3TBVB 4B0MM 5BRZB 4XVUC 2AV7A 4G6ML 2JB6B 4UILL 3BKJH 3QWQB 1WF5A 3CFJA 3MNWA 1SYVA 5MEND 3IXAB 2UVEA 3NIFF 2VLKE 1DVFB 1CD9B 1JGDA 3W0WA 1XGUB 1S9WA 4MA8H 5FA3A 1HDMA 5DVNA 3BMVA 3SGDH 4LHQB 1WBZB 3DSFL 4HQQL 3LQAC 4PJAF 5IBTH 1QFWI 1BVLA 1A47A 5JW4R 1K8DA 3TZVB 3GMNB 1C16A 4Z7NF 3DPBA 2ZPKH 4NQDA 5TE7H 5F9OH 3L5IA 2XQYK 2ZOLB 4DCQA 3VFGH 4F7EA 5B8CC 5GS1B 3I3DA 3BWAA 5JIKA 4ELMF 1S8DA 1WEJH 4Y5VB 3NABL 4P4RA 3O81A 2J8UF 2ADFL 4HIHB 1UA6L 2ZJSL 3SKNA 3UYOD 4U1IA 5I2IA 3P30H 3GI9H 2AXHA 5M95B 4QHKJ 3PQYA 1CIUA 1U8KA 5E8DH 4F37K 2X4QA 4EDWH 4R4FL 4R0LA 5EZJB 4NQTA 1NCDL 1QR4A 4N5ED 1LNUA 3KPSE 3VGGA 3ARSA 3MUGA 1UQSA 4WI9A 3VXMA 5F8RC 3WUWG 2IAMC 5C0GB 1HI6B 5JDSB 1QSVA 1MJ7H 2A83A 3MOQA 3S88L 2BVQA 1HXYB 3W2DL 3I6GA 4XBPB 1WFTA 1UYWH 3HZKA 4FQJH 4QHKI 4X4MA 3C5JA 5CINL 2YUWA 1QQDA 3BW9B 1YEGL 3O2DA 3DTXA 1T0NA 1Q9WA 1U8NB 1R24B 4PGBA 1V3KA 1TZGL 4L8CB 1JHTB 4NQCE 1RZGA 3ARVA 4PJ8C 5B3JF 4Y19E 2NY3B 5GGSB 1HHGA 1G84A 5C7XH 4LSRH 5KSVA 3MRRB 3PGDB 4RMUA 5JLZA 2IPUK 5I1DA 5LAXA 3NGBB 3Q0HA 4J8RA 5CP7A 3V5HA 4HK0A 1M6OB 2R0ZH 2BSED 3QHFL 3VRLF 1U0QA 5F8QC 2AKRA 3SDCC 5ADOL 3X13B 4WU5B 4CNIB 3GB7B 1VFAB 3D39E 4J3OC 5DFVD 1N0LA 5GISH 4MDJA 5D96C 1J86A 2QHRH 1MSPA 1X5YA 3D0VA 2CLZA 4U7MA 5T5FH 2X2YA 3EHBD 3QUKB 4Q9RL 3CDYA 5EUOE 2AXFA 2DQGL 2DL9A 3U4EA 1LP9B 4UAOB 1N8ZA 1BD2D 2HTLD 5T1LD 4DKFL 2Y36H 3CIQA 1UWEL 1KJ2B 1A2YB 3TVMC 4ACPA 4WHDA 1VFBB 3QAZC 2GFBB 4JQXA 2PTTB 5E2WH 2NY7L 2MTPA 1U41A 1VSCA 1MCHA 1BLNB 3H9HA 4TUOA 2FECI 2OL3B 3LKPA 2PO6A 2YWZA 1BF2A 3RL1A 5IMLA 2CDGB 4O51A 5T1DH 4CAGA 1CE1H 1CFNB 1H15B 5E8OA 4CMMA 3L3DB 5C0CA 1E28B 4PJIA 3QEQB 1CQYA 3UROR 3MLXL 4FZ8L 1TJIL 4CVZB 1NAMH 4LCYB 2E7LA 4KTEL 4WTZG 1T5WB 4ODXB 4WVRA 2QHLA 2BC4A 2R2EB 1A7OH 1AO7B 1NMAH 5C0AA 2AEWA 1SVZA 1YN7A 3QWOA 4OD3L 1XF3A 2R0WL 2GTWA 3EOYG 4M48H 5IB2A 5FF6B 4MNGA 4ZSOB 3VXPB 3PP3K 3IVKA 4V2BA 3C2AL 4NUJB 4O2CA 2EEAA 4DN4H 3IJYB 2HT4C 4G3YL 3ULUD 4PJ9C 3QHZH 5BRZA 1JGUH 1HHIB 1INQB 4UNTA 3IXAA 1AD0A 2LFGA 4OZGA 2EC8A 4HS3B 3V0VB 4OKVB 1DVFA 2R9HC 1QTYT 3P77B 1F2XK 1XGUA 4W6YB 4YHKH 1MNUH 2EDKA 2Z4QA 4KVNH 4FMKA 3JUYA 3ZE1E 4D0BB 4PRPE 4PLKC 2HKFL 4OD2B 1REIA 3L6FB 3BP7A 5J6GA 3D85A 3T8XB 4GQ9L 2YXMA 1G7PB 1HXMA 5K9QI 1T20B 2ZOLA 5ERWB 1A6UL 2HJFA 3VD3A 3GBLA 4NFDA 3V5DB 4D0DA 1RUKL 2Q7NA 4HFUL 4Z77B 4HIHA 4QHUB 3C09B 4X6BB 2CRMA 4Z7UA 3IU4L 2A9ML 5DD1H 1C08A 3WN5A 4NWTH 1I1FA 3VMPA 2BVUA 3G6JB 4F2MB 1JF6A 3HPLA 5C3TA 1P2CA 3V4UH 2HRLA 5FO8B 4LSPH 1T03H 2OP4L 2DICA 1UACL 3IT8D 5GSVB 1NAKH 3IDUA 2UWEF 2VKWA 2EDBA 5A1AA 1HH6B 5J56B 5FV2A 2YUVA 1MRFH 1U8NA 3V6OE 1CBVL 4DGYL 1BJ1H 5DGRA 2YUZA 1X7QA 1ND0B 3C8KB 5I8EB 3EFDH 4JO2H 2CUMA 1JHTA 3U7YL 5I73C 3TF7C 3MV8D 2VIRB 2UY6A 4IS6B 1IC5L 1HH9B 2ATKB 5KANI 4HAGA 3T3MF 4U1GC 3UO1L 1A4JB 2I60H 3HN3A 4MJIB 1G7JB 2Q3AA 4QXUL 5C3LD 5MENE 1UADC 4I48B 2CIIA 2L7UA 5DJYA 4G8IB 3HZYA 1IBGL 3X13A 1VFAA 1TIUA 3QSKB 1W72L 5CJQH 4XNZC 3EGSB 4KPHH 4I9WD 5DLML 4O00A 5EC1B 3QUKA 1GZQA 3FT3B 1JN6A 3I2CL 2NXZC 3GMMB 1U8JB 3VXSD 4WNQA 4NM4L 4WW1B 2EDEA 4JDVA 5F7WC 4DQOL 1S9XA 3OSKA 1LP9A 4M61B 4RRPA 2H45A 5D2NA 3BN3B 4CVWA 4M1CD 1ZXQA 1YYML 3P4MB 1KJ2A 4PJHF 1R3LA 3PABA 3IGAB 2PTTA 2O5ZL 1J18A 4WEMB 4QRPA 5CBEB 3OJ2C 1UWXK 5GGRB 4EQ3A 2OL3A 3UYRL 4TULH 4MMZC 1XEDA 3QI9C 2Y5EA 5KBNC 3MLSH 3QO1B 1FCCA 2IPTH 1UKQA 3L3DA 1U95A 5LKNA 4Y4KC 4ZPVA 3UTTD 5GGTA 1N5AA 2P8MB 4X99A 1K4DA 5F3HB 2IGFH 4JM4H 2VABB 5JQ6H 3CZJA 1XAUA 4JJ5A 4NKMA 1FZMA 3RTQB 5I6XC 1I3GH 1BGXH 4NKIH 4HH9A 4ODXA 2ZSVA 1AO7A 3KPLA 5AZ2H 1PSKH 2DQIH 1JGVH 4S1QH 4O58H 1HHJA 4CN1A 2D7MA 3NCJH 4ZSOA 3VXPA 2X4PB 2E8YA 4NUJA 3VFSB 3WD5H 3TWCH 4I3SH 3V5KA 1MI5D 2V5TA 3MV01 1OD7A 1A64A 1HHIA 2CIKA 1MJJB 4NRYB 2VDNL 3EZJB 3QXAB 4P9HC 5DURD 1QFPA 3V0VA 3GRWH 4OKVA 1C5DB 1WTLA 3P3YA 3P77A 3WFEH 5CGMA 1K5NB 4HWNA 1UH2A 4NNYB 3UTZB 1CIDA 2L4OA 5TJWK 3AM8A 3DURB 3GM0A 1OOAA 3QXDB 1FNLA 5D7LA 1N4XL 1F3RB 1JWUB 2ZCLL 4OD2A 2O61B 3L6FA 4JRXB 1T7WA 4Y5XC 4JHAH 1BD2E 1A1NB 1F6FB 4K7FB 3VI4E 2VXVH 4N0UB 3T8XA 1G7PA 4KROC 3EUUA 5GRVL 2YR3A 5IFJB 1T20A 4XVUD 1NGYB 3BO8B 5FYKD 4H25A 2HJKB 4GFTB 4F7TA 1SM3L 1NH6A 4QHUA 3SBWA 3QPXH 3PJSB 5HYSG 5HHVL 1HQRB 2C7UA 3GBMH 5BZDB 3Q6GH 4YDKL 2AQ1A 5KTEL 1MHCB 3SOBL 1K8IA 4ELKA 1U8MA 2ICEA 4OM1L 1IFHH 2PTVA 2HH0L 2IALA 4P5KA 1INEH 3KPRB 2D0HA 5F7EL 1Q72L 3FRUB 4I0CC 5E4EC 3RAJL 2VXSL 5DJ2A 5HDQH 3N1GC 4LQFH 3RWHA 2Y4SA 4H8WC 3W11C 1A6WH 1F90H 3T0XA 5JW3L 5MHSD 1B6DA 2J7LA 3QUZC 3EJZC 1ND0A 1I9IH 2RGSA 3NIDF 5FM8A 3DJ9A 1NKOA 2PW2A 3PWPD 4IS6A 3DX7B 4OJFH 4I0PC 3RDTB 3ULUE 3A6OA 1YEJL 2IAMD 2XNAB 3CMOL 4MJIA 1JYNA 3QEHA 3G5YA 2VDLH 4M5ZL 1L9MA 1QNZL 4AQOA 4F7CB 4I48A 5D72L 3W39A 5IVXB 5MEOA 4V1DB 12E8H 5ISZB 3QIWC 1K6QL 2AJSH 3T0VA 1F4YH 4BQBA 1KV3A 5DMIH 1IGTA 1WVZA 1A7RH 4IMKC 4M4RA 1CU4H 3GFUA 2RIKA 3FT3A 4PJ8D 1L9NA 3GMMA 5HHPB 1UXWB 3MV7A 3OPZL 1CXEA 4P2OC 4LU5H 5E2JA 5DK0B 3MRHB 5F72S 1PFCA 1U42A 2V17L 4CU8A 3SPVA 1NMCC 2YPKA 4QOKE 3SDXE 2FBOJ 1F8TH 1YEKL 3F7VA 2E7MA 3P4MA 3QFJB 3O11A 3SDCD 2BXYA 3B8SA 5SWSA 5IV2A 1EGJA 3BZFB 2JJSC 3V4VH 3UMTA 3WUWA 5FGCB 5F1NB 3ZTNH 3OKEA 4C83B 1MCWM 3OKMB 1DL7L 4LMQI 2WLYA 3O3AA 4GMTL 1N7MH 5B39B 3C08H 1ZGLM 5EC2A 3LV3A 2J6EH 1PG7X 2PUQT 5FGSA 4JHBA 3IFNL 3NCFB 1S7SB 3LN5B 1T2XA 4IMLB 2NW3A 3RA7H 1CT8B 3FQTB 5H94B 4PJFB 1GGUA 5HGDA 3TVMD 1AD9A 5DHXB 2IH1B 3SCMC 4M8QA 3HUJA 4KTYA 5J1TC 3BEVB 3RTQA 2EDDA 5C08D 2BNUB 4JFHD 2EDTA 4PRBA 2VITB 3WUZA 1MEXH 3ULUH 2O93L 2F19H 1MCJA 1FFNB 4XPFL 4ZXBA 1GGIL 2OMBA 1VPOL 2OSLB 3MV8E 1F3DJ 1KELL 1I1AB 1PDKA 3PDOB 2X4PA 3FAWA 4U4BA 3MACH 2NNAA 4W6XB 2GJ6D 2OJEA 2VZTA 3ULSA 5ICYA 2P7TA 3BE1H 3WIHA 1U91A 1MJJA 2VH5H 4M1DL 2VLKB 4P2QA 1I8LA 2HLAB 3V79C 3HZMB 4I9WE 3VWJC 4Z76B 1ZAGA 4ESKA 4GRMA 4NM8H 1R0AL 4HJGB 2DKUA 3ZO0A 3VXSE 3MJ7B 3QXDA 4PGCA 2GI7A 2CRIA 1JWUA 5GXBB 1F4WL 2O61A 3DXAD 4YNYB 2V5MA 3ARFA 2YD9A 1IGJB 5DC4B 1KB5L 3QCUH 2J88H 5T5NG 4D0CA 4FFYH 5IFJA 4PJ9A 1N26A 4EUPG 4LLDA 1ZEAH 1MCOH 3IFPB 1KPVB 2CUIA 2R9HD 4JKPH 4AL8H 1WIPA 3UZQA 4K94C 5IHUL 3C9NA 4QRUB 4XP5L 3TN0C 4LPCA 4R97B 1KPRB 1OB1B 5BZDA 1ZOXA 4H26A 3I75B 5KVMC 1Z6JT 5EPMB 3KYOA 3QNZA 4WTZA 1EEZB 1MHCA 3KPSB 3NFPA 3C5SB 1OP3H 3UTTE 3PXHA 4MSWB 2ARWA 4Q9CA 5I1GH 5GRVK 3KPRA 3FRUA 5EZIL 3FQRB 4DWHA 4WO4C 5KN5B 4KZEH 2VC2L 2DM3A 4G9FD 4Z0BH 3L3HB 4R2GB 4NN6C 2VR4A 4KJYA 1QFHA 5GJSH 4LSTL 1S9KC 4XHJC 2AEPH 4PJCE 4Y19B 5LXGL 5KJRL 3B5GA 4HDIB 1NAMB 3FRPG 5IWLC 3CVIH 3AAZA 1RU9L 3DX7A 3QIUC 4M62H 4NUGH 3SE4C 1D6VL 4LLVA 4R7DB 3RDTA 1MI5E 4XXDA 5I75B 3N06B 2XNAA 4QRQA 1B88A 4M9OA 1D9KB 2CMRH 2BSRB 4TOYL 1CGYA 3ARBD 3IDMA 4KHTL 3D39B 4O4YL 5IT2L 3QDMD 1ORSB 4KKNA 3ZLQC 4TRPL 3OKLA 4I77H 1BIIA 5EO1B 4TSBH 3EYSH 2XTJD 4GUPB 1K2DB 4NKDB 2CDEB 2FEEL 4NFBA 1OW0C 4PJGB 4E42B 3DVFA 4ZAKB 1E6JH 5EUOB 2AK1H 3C5ZB 3BDXA 1H3GA 1UWGL 5IW6A 3CFCL 1KNOA 2ZG2A 4JR9H 4U6YB 1B9ZA 4M7LT 5FYKE 2NY5L 2QTEA 5KS9A 2DQJH 3M1BA 1S7WA 3QFJA 4UT6H 1RFDH 5AG9A 4NZJA 4LSSL 4PR5A 4F58L 2AV1A 3DV4A 4L5FL 3JWDC 4LGRB 4EN3C 5C09D 2YXFA 3U79A 4I3RH 4LLUB 4PV8B 3OKMA 3AMLA 3O6LH 4PG9A 3BZEA 3ZYIA 4FZEL 4ZOCA 2NXZD 3BN9C 5FO7B 2FR4B 4QYOB 5I19H 4HUXB 3MQIA 5IVOA 1TJHL 5I66B 3AC0A 5DEGB 1S7SA 3EDEA 2QLVB 1HN1A 4RGMC 4IMLA 2YBRA 3CNKA 2FATL 4PJFA 1HINH 1YEEH 4M6ML 4EDXB 2JJTC 1ZVYA 2BDNH 3BEVA 4ZG1A 2BNUA 4RX4A 1N2RB 2VITA 1HNFA 2IMNA 2BY3A 5MHSE 1U3JA 2HLFC 4G6KH 4OGXH 4YGVB 4S1SL 4G5ZH 1I1AA 4JE4B 3PDOA 3PWPE 3AB0B 3U0WL 4YAQB 3SDAC 3QI9A 3ZL4L 2B2XL 2MPAH 4OCRL 4Y4KD 4NO3B 3HNVL 1OCWL 2NCMA 3CH8A 4MJ6A 3AU1A 4WHTB 3I9GL 4YHZL 3OXSA 2QQNL 2HLAA 4OSUH 3QWRA 3ZKNC 2ITDA 1M7DA 4MNQD 1XGTA 5FYKH 3OGCA 3RNQA 2DQHH 4LCWD 2GEEA 4LAJH 2NY0B 1J1PL 4HJGA 4R26H 1YPZB 5HPMA 1URLA 2XWJA 3MRNA 4LASH 5CEXB 4YBHA 1FIEA 3OL2A 3VFPB 5JHLH 1RK1B 3QO0B 3BOVA 2YPVH 3RWGB 4WTXA 1KIPB 5GGQH 3WJJC 2FHBA 1IGMH 3JTTA 3LQAH 4HWZB 5CUSL 2MHAB 3L5WA 2A6IB 5IHZA 1UC6A 3KPPB 4AEIH 4IEFB 2AJUH 5IQ7H 1GOGA 2BX5A 2GCYB 2IH3A 4D8PA 3IFPA 1DBAL 1KPVA 1CDGA 2ED8A 1FVEB 2NXYB 1ADQL 2QQQA 4OQ1A 1JTTA 1ZT4A 3RGVB 4QT5B 1X5KA 2F74B 2GT9B 1E6OH 3HA0A 4LFHD 1KPRA 4UTBL 4MJ4A 5EPMA 4IRJD 4Z5RB 1PLGL 3C5SA 3PWUB 4KROD 4LCUA 4Y5XA 1N5YL 4KQ4L 3KPOB 4W6WB 3OV6A 2H41A 4ZODA 1A1OA 4LNVA 4JFHE 5BMFL 3OR7B 5KN5A 4PTUB 5JZ7D 2VDML 4IRSB 4UIKH 3L3HA 1U8IA 3MJ8B 1QKZH 2Y5TB 1ZV5A 4BELD 1GC1L 1R3HB 2XTLA 4HUWB 2CKBL 1DN0B 1AGDB 4HDIA 3O8XB 5JMRA 3BPLC 4PP2B 4MXQD 1RK0A 3VGDA 2QJDA 1AFVL 4F7PB 2GJ6E 1RZJH 4R7DA 3TYGH 4H88H 1T7VA 4F57L 1DQML 3MGTA 4G7YL 2BSRA 4MS8D 4P2RD 5KSAB 5K9KA 4KK9D 4P5TA 4HKZA 3DX6A 1ORSA 2C3WA 5CILH 1CF8H 5EO1A 2BZDA 2OTPA 3ROLA 3HI1A 5IUSA 4X6DF 3W11D 2AP2A 1EXUA 1BX2A 1KJMA 1K2DA 3QUZD 4NKDA 1FRGL 1XCQA 3WFBH 1Q0YH 3NPSC 4PJGA 4E42A 4I0PD 1CLZH 3DXAE 3U36A 2OK0L 2MQCA 1SY6L 1G7IB 1QFWL 4U6YA 1HNGA 5IB4A 5HYSA 4NBYB 4UIMA 4NWUH 3P9MB 4LVEA 4ZFOA 5A2KH 3DMMB 3QIWD 4M93C 4AK1A 4PG2C 3UJTL 2G60H 2R4RH 2OS7A 3MCLL 3BIBX 1Q0XL 2VZ3A 5TF1L 1T89A 2A0LC 4KDTC 3G6DH 1OTTC 2AQ2A 4IMKA 4P2OD 5CS7A 2NZIA 2W92A 4YXLL 1T2QH 4NKOB 5CSGA 1NBZA 3CDFA 5DEGA 3LHPL 4MJ5A 3S37L 5GS0L 1BQLH 4GKZB 3I6KB 1QBLL 4X5WB 2VLJA 4FXGA 4LCCC 2IADB 2ZWLT 5SX5K 3RZCC 2V5RA 3QCVH 1S7RB 4OFVA 4RBPK 4G9FE 1BZ9B 3KJ6L 1JPST 2AW2A 3IFLL 1HHHB 1JPTL 4KJPC 4LIQL 1SVCP 2BNQA 3BEWB 2E9WA 5JA9A 4LNRA 5LCVH 2EH8L 2JJSA 4YGVA 4OFPA 1AGBB 3DVNA 4XPBL 3TBTA 1CL7H 3G9AB 1TCRB 1OAUL 4FXKB 4DW2L 3E0GA 1JCKA 3RQ3A 5EB9A 3STLA 3NCBB 3K2UH 3ES6B 3C8HA 1Z3GH 4WI4A 1KN4L 5AAMA 5FGRA 3H7LA 4MAUL 2C1OB 3CSYB 5HYIA 4MQ7B 3KJ4B 1L4IA 1OGTA 1DQDH 5F7HA 5BQ7A 3KNBB 4WHTA 3SCMD 4IDJH 4DUXA 3VFMB 4J3UA 4M3JA 3B2UD 3F7PC 2XTJE 3O45B 4MD0B 5C6TH 3ZDYF 1BREA 1QEWB 1YPZA 5EH1A 4D3CL 4XHQA 4FN0A 1FJ1B 5E9DA 3VFPA 3EO1B 1BD2B 1RK1A 4G6AD 3VJ6A 5T1LB 1M05B 1DBJH 5CEZL 4YDJB 4OZHF 2H1PL 3BJ91 5IW1A 3MCKB 1XGYH 4IOIA 4JM2B 2A6IA 1FNFA 4Z18A 2DQCL 2GCYA 2H8PB 4PRHA 3VWJD 5I15L 1FVEA 2Z91A 4QT5A 3QFDB 4KXZH 3OAZK 4JCLA 2GT9A 3RX8A 5I1LA 1J0IA 3HC0B 5D2LF 4LK4A 5HYFA 5E8DL 2FECL 5KVEH 4EDWL 2W91A 2ZSWA 3BUYA 4P59H 4Z5RA 4L4VA 3O6ML 5DVLA 1IZKA 1NC2D 4QNPE 2X4SB 4HH8A 2YC1A 1RULH 2C3VB 3OR7A 5KSBB 4PTUA 2Q1EA 2MMXA 4IJ3C 4FQJL 5D6DA 1WSST 3NVQA 2Y5TA 3QG7H 3TN0D 5HDBF 3KLDA 1R3HA 3R1GH 3LQZB 4PP2A 4PJAA 4F7PA 5C7XL 2Q6WB 3V4PL 1OM3H 3DSNA 2BXZA 4Y1AB 2P24A 3RBGA 3D69B 4HGWA 3S3JA 1P4IL 4HS8L 5L88H 1IKNC 2MCG1 4HX1A 4S1RH 3NFNA 3RKPA 3D3VD 5KSAA 1NGPL 1KCVH 2ICCA 4WO4D 2R0ZL 4BQ9A 2NY6B 1AC0A 4MNQE 1X5XA 4N0RA 2Z8SA 5GISL 4U3XA 4LCWE 4MCYB 3WDJA 5T33L 3SGJA 5IJVB 5I1AB 3TIEA 4QHMA 1IJ9A 4EUPA 5T5FL 1KLUA 3UTOA 4XC3L 4Y4HC 4OLVL 3QIUD 4EXKA 5CD3B 1IM9A 3E2HB 1BBDL 4MHHG 1G7IA 3SDXB 1TVBB 1VACB 4Y8AA 3WE6B 3O4LA 2G5BB 4PGEB 5J11C 2Y36L 3BH8A 3DMMA 2R0KH 1DLHB 1FFRA 4WEBH 2BJMH 5JUEL 1EVUA 3RY4A 5MEQA 5E2WL 5HHOB 1MCPH 3C6LC 2QSVA 3OAUH 4KMLB 2BVOA 3UBXI 5TH2B 4DN3H 3VA2C 5CGTA 1QACA 3NIGE 1JZ7A 4AENB 4N8VB 4JPKH 1CLOL 2QSCL 3DRQA 5CWSB 4X8XA 3FRPA 2DRUA 4OT1H 2OJZH 1FZKB 1WITA 3PHOA 4NBZB 1NAML 4HHAA 4JJHA 3GSOB 3L5HA 4MX7B 1CI5A 3KLAA 3MXVH 4IM8A 1E4XH 1Z9LA 5E94B 4QGYA 4I1NB 3VGBA 1ITBB 3P4LA 4EN3A 3MV8B 1RZKL 1AGBA 1A7OL 5HVGB 1TCRA 2ZOKB 2QQLH 4FXKA 4WWKC 3BN9D 5M7QA 1WBYB 1A5FL 1OLZA 4OQTH 2DN7A 4L9LC 4M48L 4P9ML 2Z35B 3ES6A 4GAFB 3HMXL 5C0EB 3WS6C 2C1OA 3QULA 4KV5E 4P2RE 5FDWB 5ETUB 4YHYC 1JGUL 2HRPH 4XPTH 1FZOA 3VFMA 3LRGA 1EEYB 4RMTA 1JGEB 1KOAA 3VXNB 3I3BA 3BIKA 3MRBA 1FBIH 4XCEA 5TFSL 4OAWB 5TQ0H 2R8SL 3O45A 5ADPL 2HLFD 4LARH 3DX9A 4PLJD 4P9HH 1CGUA 4YHKL 3VXSB 1G9NL 5CJOH 4OF8A 1IAIM 3RJQB 2VXUL 1EAPB 3H3BC 2JB5L 1KIRB 3SDAA 1M05A 4LPTA 2PKDA 5HSFA 1JE6A 1S9YB 5I1KH 2EXYC 1NCCL 4JM2A 5EU4B 5DJ8A 2O5XH 4J6RH 3FQXA 4EI5C 3L3OA 2GSIA 1RZ7L 3ZKND 3TO4C 2XKNA 1G1CA 4HUUA 2YSSB 4ODTH 2ZG1A 3QFDA 4ZYKA 3M8OH 5EBWB 2VQ1A 4DVRL 5JHDA 4JGUA 5KOMC 3U4BH 1Y18B 1T21B 3SGEI 3BISA 3MV11 1R3JB 3RUGB 3H3PH 3FB7B 2VL5B 1OP5H 1NGZB 1YMMD 3UTTB 5H37H 1Q94A 3KS0J 1FSKC 4YPGA 3V4UL 2AJZB 4LSPL 1UB6A 1IAKB 3FJTA 4UU9B 5E4IA 1U8PB 4DOHE 5E24E 1D6EB 1WFUA 3ZDZF 4KK8C 1GGBH 4J2XA 2FD6L 1DE4B 3RHWK 5BJTB 4G8EB 5KSBA 4Q58C 2X70A 1NBYA 2XACC 5L0QB 2HN7B 4NP4H 4PJCB 4NJAH 1MRFL 1IZJA 1FG2A 5EG6C 4GOSA 3O3BB 5DJ0A 5CMAB 5C0RH 4J1UB 1WZLA 3WEXA 5CCKL 2Q6WA 3ZDXF 3DGGA 4Y1AA 4YHOH 3D69A 5FYJD 2J3SA 1DP0A 2I60L 1M4KA 1XF4A 1KCRH 3MRIB 1UG9A 3QZWB 3IJHA 1IEBB 3GEWB 4HIJB 4FP8H 2VRAA 5IJVA 4X83A 4OFYD 5E9DE 4KPHL 1P1ZB 3GSNH 2UZXB 1FYHB 2P49B 5E00A 3TH4T 4QHLA 5CD3A 5D70H 2Q86A 5TDOA 3JZ7A 5F7YC 1TVBA 5I71B 3MBEA 3FO0L 4OM0H 3DV6B 3ISWA 4WI3A 4PGEA 2WUCH 4JHWH 4S1DC 1CLCA 1IGFL 4PRDB 4CGTA 1DLHA 5I1IL 2P5WD 1VADB 1E4WL 2X7LA 1OARH 5HHOA 2BRRL 4RNRA 2X5PA 5AWNH 4GXUM 4AT6A 4DEPB 1DSFH 1HZHH 1OGAB 1PAMA 1J1OH 4YWGL 4P57B 1F11B 5DMJB 1YNKH 2NQCA 2UV3A 3MLSL 4TVPD 3W9EB 2IPTL 3T4AB 1JWMB 1RUML 1YUHB 5IKCB 3RIFF 2PYEB 3LN4B 5CWSA 2D03L 2R56H 4OF7A 3NIFE 4BQ6A 1FZKA 3KLHD 3MLUH 2ADJB 3C60A 4JGMA 1PKQA 1QRNB 4KDVA 1I3GL 3A6BH 1BOGB 4N9GB 3N1FC 4PJAE 4UB0L 1OTSC 2ZOKA 3MOAH 4S1QL 2HFGH 2IAMB 2AEQL 2DMBA 3S36H 3STZB 5C0EA 2EKJA 3BESR 5FUZH 3WD5L 3QQ3B 3D3VE 1PG7W 5TGBA 1B2WH 5C6PB 4ZOEA 2ZCHH 2B4CH 3M17B 4ELME 3RZCD 3ET9F 4LCCA 1S7XA 2DBLL 4W70A 2J8UE 5EU7E 1MWAL 4KJPD 4P46C 4PJHA 1EEYA 1UENA 1AR1D 1JGEA 5ITFB 5L2JB 3MREB 2D3VA 5FM5M 3VXUD 3QUXB 4OAWA 3WFEL 2AI0L 5I76B 4PJ8B 4NRXB 1GXEA 3VXOB 4F33A 1EJOH 1IVLA 4UTAH 1C8PA 1PD6A 4ISVB 4PBVC 5DD3L 4M7LL 4OLXH 5FUOH 3T0EA 2XA8H 2R23B 3HAEG 2EC9T 4NIKB 1CDHA 5DXWA 1KIRA 4TSAH 3CXHJ 3SDCB 4JHAL 2VXVL 4L4TD 1W8OA 5IMKB 3S3SA 3AS1A 4UOW0 1I3UA 1KG0B 3NA9L 1KCLA 4X7CC 5D96B 5E7BA 4XGZB 3V7AE 1NEZG 2LABA 1U36A 4PYHA 1KEML 2F54D 4HS6A 2BHUA 4E5XB 2Y7QA 4ODHL 3QPXL 4R3SB 3ALXA 4U1HA 5EBWA 3K80A 5B3JE 2WBKA 4M7ZB 1T66D 3ARRA 2N7AA 3MZTA 3W5NA 5E56A 2EIZB 3RUGA 2VL5A 4TN9A 4HG4J 4H1LH 4I0KA 1ZLWH 3RGHA 3K7UA 4YZFF 5DT1H 4YGAB 1IGYB 3U9PL 3VRLE 3PWLA 5I9QC 2VDRH 3S8WA 2DF3A 4UU9A 4XCCH 5C08B 3WXWL 1OY3B 1INEL 4TTGA 2JK5A 4G8EA 4XWGL 3N1MC 4J12A 3TBYB 1OAXL 2YA2A 4ZUUA 2CK2A 1ZVSA 1DUZB 1S5IL 5E8EB 4CJ0A 4UINH 2R1XA 1I9IL 4J1UA 4X6EA 2PTUA 2CD0A 4FG6C 3HRPA 3K74B 2VDLL 2VAAB 2EDYA 1FG9C 1NFDF 3V6BR 5F6IC 2R1WB 3KHQA 1AGEA 1ZGLB 5C0BA 12E8L 3S3PA 5EIIA 4PGDA 2WM0A 5IGXL 5DMIL 3MLTB 3O0RH 1P1ZA 3S34H 3IXTB 3O3EA 1U9KA 3SDDC 4QLRA 3F12B 2NY2C 3VFTB 4K23L 4KK6C 3I3EA 3WL9B 2P8PB 3O6KL 5ILTH 1WK0A 4PJXA 1Y6NR 5C86A 4OLYH 3S4SG 4MVBC 1IKNA 2VLRA 1RZIA 1CYGA 1VENA 4TTDC 1AQKH 5GRUH 4PRDA 4UQ2A 4TSCL 4U6HA 4U0RB 2MWCA 1I7RB 4Q9QH 1KC5H 3KPQB 2Q87A 1QSFD 1OGAA 1N7ML 4BFEA 1F11A 4Y4HD 1K4CB 3JWDH 2R15A 1OF2B 1PZUB 1YEFH 3EYUH 4YXHL 3T4AA 1PG7L 1OAQL 4A2MA 3HNTH 2PYEA 5IG7B 3RA7L 4JANA 2ZUWA 4NO0D 4G9FB 2EDHA 5K33A 4GJTB 3VDBA 1P4BL 4C55A 1WICA 4ZFFA 1LMKA 1CGSL 4RMWA 3C87A 1FO0B 1QRNA 1BOGA 4N9GA 2DQEH 3C6LD 4OLWL 4NT6B 1U3HC 3R8QA 2DLFH 4TQEH 3CSBA 5EO0B 5FYJE 3N9GH 3ZTJH 3ARBB 4PJBF 5LQBH 3QQ3A 2K7PA 3QDMB 3M17A 1OPGL 5I17B 2VN7A 2MNUA 1NGWB 1H0DB 1JZ5A 2VH5L 4HCRH 2EYRA 2XTJB 3BFOA 5ITFA 3VRIB 5L2JA 3MREA 3QUXA 2DLGA 5I73B 4NRXA 1D5BB 3VD9A 1FPTH 1AE6H 4JY5L 1ZMYA 4OBRA 4LHJB 5E6ID 3VXOA 3O6FC 5H35B 1Q8MA 4OLZL 4ISVA 4U1GB 5GHWH 1A14H 5GJTL 5HYQB 1I8MA 2R23A 4ODVH 4UT7L 1HYRC 2Q76B 2AAVA 2AXJA 3BD3A 4HMCA 4JDZA 3GHEL 1HCVA 4FQHA 4ZO6A 5IMKA 2V7NB 3QCUL 3PE9A 1T1WB 4PRID 4DFIA 3X14B 2UWEE 4XGZA 2P5WE 4XNZB 5C09B 6FABH 4WENB 5DYOB 1H8SA 1A7PL 3T4YB 4KUZL 4E5XA 5DHVH 4WUUD 1YYLH 1V5JA 4HZAA 4TVPE 5JNYB 3IS0X 4JFED 2EIZA 4TNVK 3T3ME 1Q9KA 2AXGB 2Z9TA 3QQ4B 4Q0XH 2DQUH 1NCNA 4UDTB 3G08A 3VFVB 1IGYA 1CICD 3Q3GA 1PKQE 5IK3A 5C08A 5I1GL 5IEHB 1J1XH 1N0XH 1XF5B 4ERSL 2P8LB 1P53A 4EI5A 4EOWH 5FYJH 5FO9A 3TT3L 3TO4D 4FFVC 4KZEL 4Z0BL 4OZFG 4U1KB 4LHUD 2FX8H 5GJSL 3QCTH 2CK0H 1S7QB 4EVNB 1CQKA 3GI8H 1NMBH 4Z7WE 3QUYB 4C57C 3MRCB 1AI1L 4Y4KB 1M1SA 2W38A 3BHBA 4H1LG 1WAAA 2EIEA 5EBMB 3DBXA 4OV5B 1DDHB 4U1LA 3H2WA 4DUVA 1OAZH 5IFHL 2VAAA 4KK8D 3JWOL 4OLUL 2WK2A 1XR9B 4ONFH 4HBCL 4MNQB 3MOBH 4HWBL 1XZ0B 1H8OA 3VXUE 4LCWB 2PYFB 4OIIL 3LKSB 4HJJL 3DETC 5BOZG 3P0VL 4I77L 3WDHA 4TSBL 5E8NB 3BT2H 5E03A 3RWCB 3IXTA 1FC2D 5CZVL 3X3GL 3RP1A 1E6JL 5GGUB 4XBEH 2AK1L 3WL9A 4FQIH 4X0KB 4P23B 4JR9L 1ZT1B 3OR6A 4TVPH 2DQJL 4P3DA 4R4BB 2GUOA 4X9GA 3WDIA 2F54E 2FIKA 2BCKA 3DRTB 1A3LL 1AKJA 2WANA 3R06A 3T2NH 4WDIB 3JV4A 3RU8H 1TPXB 3NCYS 2P45B 4M6AA 1R5IB 4NYLB 3B8YA 4I18C 2B7DT 1NPUA 2DWDB 1PY9A 4JG1L 4IRJB 3ZYZA 3P4OA 3BKYH 5GGVY 1K4CA 2YD1A 4KAQH 1FCGA 4M1GH 4KROB 5DI8B 3CVHA 1W0WB 3WSQL 1H5BC 4KI5D 5C0JA 4JFFB 2NX5D 2W0FA 4GRLD 4G6MH 4UILH 3QIBC 3OHXB 4X6FB 2YK1L 5CIPA 1MQ8A 4XCYA 1J0YA 1FO0A 5D93B 1VESA 1LE5A 5F9WC 1IC1A 1A6ZA 1L0YA 2GYSA 4OZIA 5E2VH 4NT6A 5GRYA 5F6HI 5DC9B 4G6KL 3DSFH 4OGXL 2EEDA 5DEZA 5DJ6B 1QLEL 1KIUA 4OGYH 4RMSA 5EO0A 1TNNA 1RJYA 3VH8B 1PVHA 4P2RB 5E4EB 3O9WD 3QDMA 4NZUL 3RL2B 1CDCA 1QRKA 2V2WA 5I17A 3L3JB 1S9VA 3NABH 3I50H 4JN2A 4LRIC 2ADFH 2VLLB 2Y06L 2ZJSH 4P3CH 3QUZB 5DRZA 1AGCA 4U1MA 2Z92B 4HT1H 4OSUL 5D4QA 3VRIA 3VG9C 4HXAL 3W9DB 3KYAA 1I85C 1L6XA 1OTSD 2DQHL 1JFQL 4R4FH 3CJJA 1UT9A 2EDRA 1NCDH 2VMFA 4BSVB 5HYJD 1G9EA 3OXRA 4LASL 4RCAA 1MCWW 3X3FL 5C2BH 3MODH 3B9KD 2BHZA 4LF3B 2GITB 8FABB 4YHPB 4ZUVA 5GGQL 3TNNB 1P4LA 2VISA 1IGML 4ZTOL 5ID1B 1B6UA 3GSNB 3T0AA 4FRWA 4Z95L 2I26N 1KIQA 5C09A 2H2PC 2FB4H 4P46A 5DYOA 4JVUA 1YEGH 1QSFE 1C12A 2WP3T 4L8BB 3MV9A 3HE6C 4P2OB 1TZGH 3NIDE 4QXGL 2NY1B 1K9TA 5EIQA 3RVXC 5EZOL 4GG8A 1NMCB 4Z6AT 5TPWH 2IPUG 2FJFA 5E7FA 4PJIF 3GMPB 2D7NA 4X9BA 2BOCA 4WW2C 4UDTA 4DOHB 3DO7B 3PL6B 3QHFH 5HHMB 5ADOH 1QFUL 1VFOA 3UTSD 5EN2A 5EUKB 1CTNA 3DHJA 2A6KA 1U3ZA 5D7IA 5C07D 1SJHA 1MCCA 2YD3A 3QRGL 1J7VR 1UWXH 2D4FA 4FMFA 2SEBA 2EO9A 3KHOA 4Q9RH 3SDYH 3QUYA 4YC2C 3CPLB 15C8H 4HSQA 4XP6L 3FQNB 3GMLA 3RWDB 4QO1A 2BSSA 3SCMB 5EBMA 5T1KA 4DKFH 2Y9RT 4H88L 4OV5A 1OP3K 3RWEA 4WHYG 1EO8L 1WJ3A 4N1HB 4R4ND 4OZGF 5TDPB 4G8GD 3JV6A 4PJ5B 1CXLA 3HAEA 1XZ0A 2PYFA 2NY7H 4YBQC 5FHBH 3REWB 32C2B 3VE0A 5C9JA 1TZIB 4N0CD 4WTWA 1EIBA 1DEDA 1CLYL 1EGJL 3BWUC 1NEZA 4PD4K 4YIQB 5CP3A 4K71C 2JCCB 4WU7B 2J12B 4UDUB 3REVB 2N1KA 4X0KA 2DAVA 3EDDA 4P23A 4F3FB 1OWRM 1ZT1A 3D9AL 4K3GA 3WNLA 4PRIE 3ZZ1A 4FZ8H 2HFEB 4NWUL 1A3RH 3PNWB 3VWJB 2VWEC 3QDGD 4Z7UF 1W0VB 1WT5C 4WDIA 2G60L 4KKAC 4WUUE 3RRQA 4XAWL 1X4YA 4OD3H 1IARB 1JF1A 3BPOC 5DUBB 1F4XL 2R0WH 1TQCC 4U1NA 3SDDD 4IRJA 4JFEE 1WV7T 2VZ1A 3ZE0E 4KK6D 1AHWB 4YHNA 1NC2B 1T2QL 3C2AH 2HJLA 3DUUA 5B21A 4BSWA 4D9LL 3L7FA 4G3YH 4Y4FB 4M6NL 4JFFA 4MVBD 1DQQB 5ESAA 1KT2B 2E6JA 3QP3A 4X6FA 3OF6D 3QCVL 1TVHB 2YOCA 3AS0A 4HMDA 1T4KB 4H1LB 4IOSD 2N7BA 3KLSA 3TO2B 5CHNB 4FXLA 1ZT7B 2GTZB 3ECBB 3SGKC 3CC5A 5DJ6A 5C2UB 2HKFH 4EKXA 3VMOA 1I1YA 3GKWH 1P7KB 2YEZA 3K2UL 1QSZA 3U46A 1Z3GL 3D3VB 4R96B 3EIFA 4KY1L 1NLDL 1A6UH 2P42B 3MCG1 2VE6A 2OQJB 2LU4A 4LEOA 4DZBA 1RUKH 1WCBB 4HFUH 4IDJL 5A3ID 3BSZH 3WLWC 2Z92A 3IU4H 1TJGH 1ETZB 4KVCH 1TVDA 2BRQA 4PJ7A 4U6VH 3QIUB 3FOMA 1JZ6A 3ZKMC 3B4NA 1L7IL 1U3HA 3QQNA 2OR9L 1LP9F 1UJ3C 3HHRB 4FFWD 1RHHB 1DBJL 2OP4H 1LD9B 3QG6B 5EORL 5LGHH 1UACH 1FYTB 1X5AA 3GSNA 2CLRB 5T3XD 1IM3B 4Z78B 5HY9A 3UPCA 1JI1A 3KYNB 4LPWA 4Q2ZA 4Z8FL 3BGMB 3VI3F 1CBVH 4DGYH 4X4ZA 4EZMA 3O6FD 2X4UB 4O2EB 5IEKA 3SJVD 1IC5H 5KVEL 3GSVA 1GZPB 4POUB 2NX5E 4WY7H 3UO1H 3FO1B 1E4KC 3CSPA 4QXUH 3DO7A 3MYJB 4J3TA 3PL6A 4S0TD 4E0RA 1IBGH 5J7CC 1Z0MA 1NUDA 1W72H 2DD8H 2DJ4A 1KTLA 2P46B 2ADIA 4FA8A 4CBPA 3VGEA 1Z9MA 2QR0B 3QT2A 3MR9A 3QXUA 4MHHI 4JG0L 5DLMH 4G80B 2AVGA 1OTUC 3CUPB 3I2CH 5HHXL 1EHXA 2OTWB 3NZ8B 3IJSB 4JQIL 1CR9L 3T1FA 4RGMB 5JXEC 1VGKA 3VXTA 4LPXA 4DQOH 1JZ2A 4OZ4B 1LO4L 4IOFD 1QHOA 5CGYC 4YK4B 4OZHA 3MA9H 5L88L 4S1RL 2JIXB 1FN4B 3E8UL 1KCVL 4PJ5A 5HVWA 4XMKH 4DKAA 2O5ZH 1AXSA 1R3KA 1A7QL 4JREC 4M00A 32C2A 3UYRH 5IOPA 5HYJE 2B1AL 2YPLD 2VXTH 4YHIB 4YBLB 2JCCA 5D2LA 5CBAB 4APQB 4WU7A 3REVA 4U6XA 4XTRD 3QEGL 3CLEL 4F3FA 2ICWA 1F4HA 5GS2H 1I4FA 3Q5OA 1CG9B 2A73B 3IKCA 3PNWA 4ZO8A 5JW4M 1KB9J 3RWFA 1W0VA 3DETD 4KRNA 4WEBL 4PB9L 1S5HB 1XIWC 2B8OT 4MAYC 4HIIA 1UJTA 2C5DC 5IESL 4AMKL 4LQ1A 1YMMB 3OAUL 3G6JF 1FNSL 35C8H 3O41B 4AEEA 3V95A 3B9EA 1FNEA 4OZFA 5DRXB 1GCFA 2IFGA 4Y4FA 5DHVB 5M94B 3CFIC 3UTSE 3DX8A 3FB8B 3F7QA 4JPKL 1KT2A 4K3JL 5L8KB 2APXA 1GOFA 1G9NC 2R1YB 4H1LA 3TO2A 3HC4H 2EE3A 5CHNA 3HE7C 3VFWA 1ZT7A 2GTZA 3ECBA 2CQVA 1I1CA 3S5LG 2QQLL 3TCXA 1N4XH 43C9B 4A6YH 4I2XA 2ZCLH 5FK9B 3LKRB 4OQTL 3QJFA 2ILLA 2VXQL 2ESVD 3ARQA 1FH5L 3DIFB 1PYWB 1AJ7H 4HGMA 3QIBD 4JKLA 4G8GE 2OQJA 1GPOL 5L2KA 1SM3H 2W65B 4XPTL 3EYQC 1WBXB 2JF1A 1ETZA 5TQ0L 2IAND 5HHVH 1ZS8B 4LSUL 1P9MC 1EH9A 4P9HL 3RPIB 1V7ML 1IL1B 3P4NA 4YDKH 2NZ9D 5IB5B 1KN2L 5KTEH 1JWSB 2FO1A 2ZNWA 4OM1H 5C70A 2HH0H 4LLAA 1QSED 1GHFH 3ETBF 3QG6A 3WLBB 1O5DT 1Q72H 5F9JB 5I1KL 1FYTA 2P43B 4KK5D 2UWEB 2CLRA 2P5WB 2VUYA 2O5XL 3D87B 3D2UD 3QDGE 3SE8L 1PW3A 2NW2A 5DEFA 2PR4H 3NPSB 3AMKA 3BQUC 1CFTB 4HW6A 3VFOB 1EDQA 5JW3H 4J7RA 4ODTL 2OBGA 3IRPX 2W07A 3RVUC 3HLAB 5C0IB 1NUGA 3PV6A 5J13B 1YEJH 1JVKA 3CMOH 4M5ZH 4M93B 5C6WH 4KMQA 1EEQA 4OGAD 1QNZH 1PX3A 3I85A 5D72H 2DQFB 3HUJF 4Y5YB 5KSUA 5E5RB 5EU5B 1K6QH 5ESVB 4ZNEE 2H2PD 4C4KT 5L7XL 4X6DE 4KUCF 4LDOB 3SE3C 1GJIA 5LJYH 5D7JC 4NGHH 3HE6D 1QR1B 4NP4L 4Z7WB 1F6AB 3RVXD 1FL3B 4AEFA 2OTWA 3NZ8A 3IJSA 3OPZH 5HVFB 1T0MB 2XZQL 1MFDL 3AS2A 1FGVH 5I8OL 5DSCB 4H8WL 3RZCB 1RIHL 3F7RA 4WCYL 4YHOL 5DA4A 1YEKH 4NHUB 4WW2A 5D6CA 4JFOB 5JO5B 1KXTB 3T09A 4JFXB 3VGAC 2JIXA 3PIQB 1X5FA 2VDOL 3CDGB 4QF1B 2FEDD 2VNCA 1MUJA 4WFED 2Z93A 4ZFOL 4AY0A 1DL7H 4GMTH 4FP8L 3JTSB 4CADB 2FHFA 4RDQF 3WFCL 4FNLL 5JOPE 1J5OL 4HCRA 3L3GB 4UNUA 2FSEB 4APQA 4L4TB 4MQTB 5FM5O 5GIRA 5ICXA 2VZUA 1RUPH 4LLMB 2D7TL 5T3XE 4ENED 2F54B 2APFA 2WUCL 3WJLC 1XGQB 5FYKU 1JK8A 4NNPH 5IFAH 4YBQD 3LPFA 3FO2A 5HTSA 5MP6L 2RAMA 3H9SA 1GGIH 2CH8A 2KH2B 4OFDA 1VPOH 4O2FB 3LEXA 7FABH 3PWVA 3SJVE 5AWNL 4JQVA 1A6TA 1YMMA 1J05A 1DEEB 1DSFL 1B0GA 4N8PA 1YEHH 4HUMB 2DTSA 3E6FB 3BP6B 4ZQKB 3UTPD 5DHVA 4RGOL 1EHAA 1I8KA 4ZUSA 1JV5B 1EFXB 3FB8A 5D1XC 1IEAA 2FWOB 2R56L 4LVNC 5FV1L 3UPRB 1KJ3L 3TA3A 3BPNB 2R1YA 3GDBA 4KKAD 4G8FB 3ZDYE 5I8KL 4PS4L 3HI5L 3MA7A 3T3PF 4X7TB 1R0AH 1FIGL 3FQUB 3QA3B 3WIFA 2D0FA 1Q9LB 4L8DA 4R0LC 3FB6A 4RFEA 3THML 4NSKB 4Y7MA 2GSGA 2YMXL 5FK9A 1J8KA 1F4WH 5GSRB 3CH1A 1KB5H 3FN3A 1AGFA 4Y2DA 2BNRB 1SEQH 1NKRA 1OD9A 1BWWA 3ARYA 5IVXF 1YNTB 2M1KA 2G2RA 1RI8A 1J88A 4L8SB 4IJ3B 2UUDK 2MOVA 4U49A 5IMMA 2W65A 4MQSB 4YPJA 4OFYA 4BQCA 2XICA 2AJVL 3JV0A 1YEDA 2HTKC 5IHUH 4AG4L 5SWZD 2IBBA 5D2LE 1J0JA 2YPLE 5T3XH 3IDIA 3AREB 2R4SL 1IL1A 3WO4C 4XMPL 3SKMA 1JWSA 1PZ5B 4GKNA 1CGTA 2VZVA 1VFMA 4JZNB 1FL6A 3PV7A 2XA8L 5KS9F 1YA5A 3GMOB 2YS4A 2EYSB 3WLBA 4Z7VA 1BZ7B 2AK4D 1Q1JL 4NN5B 2VC2H 2WIIB 5I16B 3BP4A 1QSFB 4BZ2L 4WUKL 3B83A 5HDBE 1LO0H 2X42A 4JRYD 1CFTA 5LBSL 2F5BL 4HZLA 3VFOA 4Y4HB 5KJRH 2WBJA 4PJDA 1F6LL 3GGWA 3KYMA 4BFIB 2OMNA 4XNQB 3PWJA 1A7BA 1D6VH 2DQTL 4K94L 4M6OH 4NO0B 1T1XA 4AM0A 1I7UB 4JFDB 4PJFF 1L0QA 5JW4Q 1MRCH 5DT1L 3GUTB 4GBXD 3S5LB 5IMOB 3RIAK 1NDMB 3LKNB 4KHTH 1ZTXL 4O4YH 4B5EA 1NANI 1F02I 3FAXA 5E08L 5ESVA 4TRPH 1JZ4A 3O3UN 1QA9B 3C6LB 1F2QA 2K7QA 5DQDL 3GHBL 1JJUA 4E41A 5B3NA 1QR1A 5F7DB 1IGCH 4AIZB 2PO6C 1FL3A 1MVFA 2DTML 1Y6MR 2ESVE 4UINL 3O4OC 1UWGH 4NQXB 3CFCH 4L29B 3ARGA 1D5ZB 5L2KE 4NQVB 5I74B 5SX5H 1UM4L 1I9JL 1FL5A 4JFOA 1D5XB 2ZUQC 4JFXA 3PIQA 4XT1C 4QF1A 2E7LC 1OT1A 4LSSH 5AYQA 4F58H 2MSPA 4QRTB 3WHXB 4L5FH 4NZDA 5E6IB 2IANE 3TYFA 4CU6A 2YA1A 5CSZB 4NQSA 1OTUD 1LK2B 4FZEH 4CADA 5JPMB 2XZZA 4Z0XB 4MD4A 4ZS7L 1HEZB 1B0WA 5JXED 1KCSL 1I3RA 1TJHH 4NDMB 4QGTA 4JPVH 1QSEE 1CFQB 4L4TA 5K9OA 1T1ZA 5CGYD 5ILTL 4EQ2A 2FATH 4R7NB 1T7XA 2RBLA 1DVFC 2XPGB 5GRUL 3V7MA 3CFBA 3MRFB 1C1EL 4WUUB 2EE9A 4PUBL 4BUGA 1MFCL 3T2PA 1KC5L 4JFPA 3KXFD 4HUKB 4S1SH 2A74B 4JFEB 1T3FB 2DMKA 4YXKL 1DEEA 3ZL4H 4PRNB 3ZYOA 5L8JB 4DZ8A 3MLWL 5J1SC 3JWDL 4X98B 4OCRH 1CICB 1Z0NA 1MCFA 1R5VA 3LEYH 4U2ZA 1EFXA 1UH3A 2QQNH 1S78C 3OMZA 4LHUB 4X6CB 3UPRA 4MMXC 1F97A 4NPYB 2RHEA 2ICWJ 1U8LA 2BOBA 1CN4A 1WC7B 4JY4B 3BD5A 3UTQB 1J1PH 1YY9C 1XIWA 2B5IB 3FMGL 2HAZA 4MAYA 4NSKA 4YH6A 4FQXB 5DMGD 1FSKB 1W72B 1IT9H 4KRPC 3SY0B 3MC0A 2H9GA 5GRXG 4TQEL 1BJ8A 5EOCJ 4YX2L 4RQQA 4JZOB 4GSDH 2BNRA 1B0RB 1PGRB 2HP4A 1YNTA 4L8SA 1I9EA 4HC1L 2ICWI 5EU6A 3G6AB 4JO3L 4CVXB 1DBAH 4ZDHB 1N59B 3I02B 3TBSB 4WFEE 3P11L 4I5BB 4L3ED 4PJGF 1G0DA 4UTBH 1AE6L 3AREA 3HE7A 3L7EA 5EUOF 2VDQH 2NY3C 3U48A 2F53D 3MNZA 1X5GA 2CKNA 1A6PA 4J3XA 3WKML 1PLGH 4HG4K 1A14L 2CLVB 1W2KT 5I1EH 1ES0A 1BMGA 1N5YH 3NGBC 4KQ4H 3GMOA 2EYSA 3ZDZE 1BZ7A 3OKDB 2RFXB 1DUYB 4U2YA 5BMFH 1ZA3B 5HI3C 1FLRH 1O7VA 2VDMH 4HPOH 2WIIA 4JB9H 5FGBA 3UC0L 3EYQD 3RJDA 2HMIC 1U2HA 3GJEB 2VB5A 4HULB 2WWKT 3HMWL 2KZ1B 4QRSB 1P9MA 5SV4A 5DD5L 1AFVH 4G6JH 4LIQE 4XNQA 3ZDXE 2OZ4H 3JWOC 5EA0L 3S97C 3UTPE 1YJDC 4GRLB 4UAOC 1IAIL 4F57H 1DQMH 1U8HA 4G7YH 4U1SB 4JFDA 3RPKA 3GUTA 3BUTA 3S5LA 5IMOA 1EO7A 2DM2A 2VWEE 4NZTL 2GK2A 1R5WB 3D18B 3VWKA 1B4RA 2XN9E 3FONA 4OLEA 5FYJL 2DBJA 2DYPA 3VW3L 1BQHG 5BVPL 4YEEA 3FB5B 1FRGH 4G7VL 3BQUA 5T1MB 2CK0L 1ZWIB 3IDNA 1UGNA 4FTVA 4LBEB 3GI8L 3RVUD 4C56D 1KYOK 2OK0H 1SY6H 4NQXA 1CGWA 4QCIB 3BPCB 1QFWH 3O9WB 3IB4A 1BVKB 3F58H 4L29A 3LH2H 1D5ZA 1TZHB 3IS1X 3QXVA 5D8JL 5IP4A 2P48B 3OKNB 1NC4A 1D5XA 4M9PA 5DTFA 3BDYL 4A6YB 4XI5C 5DD0L 1KTDA 3EOAA 3UJTH 1CZ8L 1UZ8B 3MCLH 4QRTA 1JRHI 3WHXA 3MOBL 3FN9A 5D7JD 5TF1H 1JUFB 5E6IA 5SWZE 1JHLL 4GXUN 4QY8B 5CSZA 1ACZA 1YPZF 5HYJB 5IIEB 4OUUA 3BT2L 3C6SB 4FQLL 3DVGA 1LK2A 3WBDA 4MXVE 3MLRL 5DWUH 4EBQL 4YXLH 3SE9L 3B9KB 4NDMA 2IQAB 4WV1B 3BYYA 4YUEL 4ETQB 1QBLH 4GKSB 4JO4H 4BH8B 1U92B 2AK4E 3FCTA 5FA4B 4H20H 3FL7A 5SX4I 3KJ6H 3HG1A 4HEPG 3IFLH 4R7NA 1JPTH 3S6CA 4LIQH 1QLFB 4TVPL 2P5ED 2XPGA 2NTFA 3MRFA 1S7UA 4JRYE 4QHNA 2EH8H 4RFNB 4M3KB 3RU8L 2M8XA 4XPBH 1Q9OB 4DW2H 2HT3C 4PJEA 2K3TA 4GMSH 1FGNL 1DQJB 4F9LC 1YMHB 5I1HL 2I5YH 3KPTA 4KAQL 3S7GA 2HT2C 3UTSB 4PV9B 5JTWA 3EYOB 2AJYL 4GKOA 1LE9A 4ODWA 4YHML 5C07B 1IRAY 3HRZB 4MD5B 2VR9A 3WNOA 4N0FA 5EFIA 3D6GA 5IBLC 4X6CA 2ARJA 2IG2L 3C09C 3W0WD 3WJLA 3SBWC 5FYLL 5BS0A 4N5UA 1GIGL 2H2SC 1WFNA 3UTQA 2Z31B 5E2VL 4D3CH 1G6RA 3MJ9H 4FQXA 4ONOA 4OGYL 4NQDD 5I9QB 5CEZH 1XGRB 2H1PH 5FXCH 1X5IA 3U7WH 1HHKB 1B0RA 4G8GB 4ONHB 3VXRB 2IPKB 3DROB 1DQLL 2DQCH 5D1XA 4EJ1C 3TPKA 4CVXA 2ENSA 1MRDH 4ZDHA 3I50L 4M43L 3TBSA 3IF1B 5I15H 4MGXA 5T5NF 5T3ZE 4P3CL 3C8DA 4LKXA 4HT1L 3PQYD 5DJCA 5ANMA 1OT2A 2A77L 2KDGA 3MRQA 2EKSA 2HG5A 1FQ9C 3O6MH 5JOFA 3WFHB 4BH7A 3VXMD 5C2BL 3PHQB 3ARDB 3MODL 4L3CA 3WS3A 2CSPA 2FL5B 2HA1A 5F1IA 1DUYA 43CAA 3QBTB 4UQ3A 4MNHA 2FB4L 4XMLL 3GJEA 1J8HB 5MEPB 3KXFE 2HTKD 4MLIA 3SDDB 1V7NH 2B0SH 2WINB 2UZIL 5IBUB 1QVOA 2VN4A 3D48R 2AJXL 3GSRB 2HVKB 4Y16A 3OBAA 1WZKA 3V4PH 5GZOC 4WI6A 5EU3B 2FDBP 4GRLA 5TPWL 3P73B 1P4IH 4HS8H 2PF6A 3RWIA 4TUJA 4XCFL 3TV3L 1NFDE 2V2XB 1ZHLB 1NGPH 1P6FA 3QDJA 4JFQB 1R5WA 5ACZA 3D18A 1RAMA 5FHAL 4GG6A 5T33H 4M5YL 3D25B 4BJLA 3KPNB 1CXKA 4JZJB 2A1WH 3ZKSD 1G7QA 4JLRA 4HK3N 1ZWIA 4XC3H 3I6LD 3ILPA 4OLVH 4GXVL 3SDYL 15C8L 1BBDH 4B7LA 3BPCA 1BVKA 4AIOA 2FO4B 4NRZA 2A6JB 4BKLA 3OKNA 1M7IB 3RTQC 3V6ZB 3EOBB 4RDQG 5JUEH 1HILB 5BO1H 2JELL 1KB5B 4L3EE 3VFNB 4ZXBC 1UXSB 3UAJC 4FQQB 5FHBL 1XF2B 2F53E 2PO6D 3CK0L 1NL0L 4QEGA 1YC8A 2IQAA 3HS0A 4LLQB 4PTTA 4U1JB 5C0CD 5E2UH 4ETQA 4NQEA 4JM2F 3FFDA 5EO9B 1CLOH 2QSCH 4PY7B 1PQZB 5ID0B 1HOCA 5EULV 1I8LC 2APVA 5CLWA 3N85L 1A3RL 4LSVL 5SWQA 2BMKA 3O6FB 1DBML 5C0DB 5C0AD 4RISL 3DNKA 3C2SA 1MHHA 1RZKH 1INDH 3SJVB 5DJDB 1NCAL 3F62A 1A5FH 4IHOB 2EEBA 5TE6H 4GW1A 1ZKAA 4RGNC 5FAAA 1DQJA 2DDQH 5JORB 3UP1A 4P9MH 2OYPA 3HB3D 1BQHB 3ARFC 3HMXH 5I30L 4PJBE 3TBVA 3L3IB 1DBKL 4XVTL 3EYOA 2VUOA 3TM6A 1CD0A 5C07A 1BFOB 3H0TB 2JB6A 4QRRB 5KSBF 4MD5A 1DVFD 4LVOB 2DOCA 2OX5A 3RY6A 5TFSH 2R8SH 5HDOA 5ADPH 2LAAA 3EBAA 2Z31A 1G9NH 3DO3A 1WBZA 4RIRB 4C56E 2VXUH 3ULUF 2JB5H 2AS5M 2H32H 3NTCL 4XX1E 3TZVA 3GMNA 3D85D 4OFKA 4LRNH 4ZUWB 5C8JB 1N6VA 3GKWL 3FQWB 3GSUB 4PPTA 1NCCH 1DLFH 1CDUA 3GZKA 2IPKA 5F88B 3DROA 3VXRA 3V8CA 4QOKD 5GS1A 1RZ7H 2ICES 1S78D 4FS0A 2O5YL 4Y5VA 3GJFH 3T65B 4P49A 3IF1A 3P9LB 3BSZL 3PHSA 2ORBL 2G9HB 2YPLB 4ODBD 1TJGL 1YY9D 5FOJA 3H7BB 1L0XA 4DVRH 1MLBB 4KVCL 3GSWB 3HKFA 4U6VL 5JPNB 5EZJA 3MLZL 4KRPD 3SDXF 3RDTC 2VQUA 3M07A 4PLNC 3D1MC 3FFCB 3NZHH 3ARDA 5GGSY 2VTFA 5MI0B 5C0GA 1HI6A 3KPMB 4UBDC 4Y0GA 5EOTB 5HBBA 2MFNA 5LGHL 2FL5A 5JDSA 2P5EE 2FD6H 2DKMA 5B39G 3EAKA 1HXYA 5CKGA 4XBPA 3QUML 4DVBB 2JJWA 1J8HA 4I4WB 3BW9A 4XP1L 1RURL 2C4FT 2WINA 2XXCB 1R24A 3X11B 1QYGH 4XPHL 2NY3D 3TT1L 4L8CA 2DIBA 3AGVA 5GGSA 5BV7C 5CCKH 1XGPB 1LEKB 3MRRA 1LK3L 3PGDA 3ARXA 1MCRA 1MLCB 2E27L 2OCFD 4WY7L 5E6YA 3MX0A 5ALBL 2V2XA 2V9RA 1ZHLA 2WQRA 3SN6N 3GMQB 1ULVA 1M6OA 4JKWA 4JFQA 2W9EL 5HI3D 3W0WE 3MLYL 3QDAA 5AYUL 4WU5A 4CNIA 3GB7A 3VRJB 4I18B 3DHMA 5I1JL 1KXQE 3GNMH 2DD8L 1TTUA 3WO3B 3D25A 5J3HC 4EIGB 4JZJA 1MQKL 2NYYC 2DI8A 3RNKB 2ESVB 1YQVH 5FKPB 4ZPTB 4NQDE 1BHGA 4GAYB 5HD8D 3PWNB 5IHBA 1IC4L 3B2VH 4G9DB 3QIBB 3EO0B 4BYHA 3FO0H 3V0WL 4NHCL 4OGZA 4LVHC 3MA9L 4K7PX 1PEZA 3T77B 1IGFH 4K7PH 5EBLB 1A2YA 3ULVF 2GJJA 3Q1SL 3V6ZA 5I1IH 1VFBA 1ZLSL 2IANB 2GFBA 4QRPD 1E4WH 1KB5A 3LB6C 3PQYE 4XMKL 2BRRH 1BLNA 2PW1B 4FQQA 2QKIB 1XF2A 3MO1B 3IETB 1I1AC 1NEUA 2ZUYA 1V3LA 2ERJC 4YWGH 4RAUB 3MTRA 2VXTL 2CDGA 2EH7L 3VXQB 3VXME 1CFNA 1H15A 1A4KB 2PCPB 3RWJB 1RUMH 8CGTA 1E28A 3D2UB 3QEQA 3U9UB 5HHNB 5E5MB 2D03H 4PY7A 4X4ME 3BYTA 1PQZA 5DR5H 3CVHL 4XI5D 4LMQE 4CVZA 4N8CL 3VG9B 1FFPB 1TQBC 4LCYA 1AO7D 1T5WA 3CX2A 5C0DA 4JFZH 3GBNL 4LPVA 5ACMA 1GVIA 2R2EA 1PKOA 4UB0H 4UT9H 5CAYB 5F7FA 1EHLL 4IHOA 4DAGL 5F93C 1G9MC 3RUGF 4NJ9L 2AEQH 3MRDB 35C8L 5FCUH 5FF6A 1BQHA 2BVPB 4WGVB 5JR1H 4U0QB 3L3IA 3MRMB 3IJYA 2CKBB 3BKML 4GQPH 1HSAB 1H8NA 4PREB 1BFOA 2DBLH 2V7HB 2FRGP 1INQA 3QNXB 1MWAH 4QRRA 4K2UL 2C4FU 1ORQB 4HS3A 4FOMA 2D7PA 2AI0H 4PJCF 4RMRA 3LIZL 2F8XC 2HT3D 3HC4L 5D1QB 3I6LE 4R97C 1ONQB 2G5RA 2Y25A 5D7LD 5DD3H 3F7YB 4M7LH 5LGJB 4HV8B 5DRWB 3BAEH 1RUQH 3DUHA 4D0BA 5B38G 4A6YL 4F9LA 1YQ2A 4RZCB 4ZUWA 1BM3L 4PYGA 4XB8A 3U83A 1V8HA 3IAQA 4H5SB 4BK5A 3NA9H 2JE8A 1AJ7L 5ERWA 4TNWF 3U30B 5IBLD 2E6QA 1KEMH 1MCLA 1ZA6B 3V5DA 4EI6B 3T65A 5MERB 4Z77A 5I8CB 3LVEA 4X6BA 2CDFB 4AYFA 4ODHH 4C59B 4P4KB 2DL2A 3RI5F 4YDLC 3JVGA 3O2DH 1K3IA 2XWTB 5JPNA 3P2TA 3LMJL 3Q48A 4R8WH 5C0CE 4PJIE 1MFNA 2OLDA 3G6JA 3ZYJA 4F2MA 5F7LB 5I75C 4PJXF 3FFCA 4NC1C 3U9PH 5FO8A 1GHFL 1D9KC 3K8LA 3WXWH 5D9SB 3CMGA 3AROA 4P5TC 1S3KL 5GQBA 4XWGH 2X9XA 5GSVA 4ETYA 2YRLA 1HYSC 1LEIB 5C0AE 4DVBA 1OAXH 1ZSDB 2PR4L 1HH6A 5C9KA 4K71B 1S5IH 4OCSL 4MNGE 4Q7DA 4MXWL 3C8KA 5I8EA 4IIQB 3C5ZC 4MWFB 2VIRA 1XGPA 4BFBD 1P7HL 1HH9A 5BRZE 2ATKA 4MB4A 5AEAA 1A4JA 1G7JA 4OZGE 3GMQA 4G8IA 3MYZA 3VRJA 2P47B 1KJVB 1BVZA 3BPOB 1TQCB 1T89C 4TUKH 1F3DH 4NGHL 3EGSA 5IGXH 3N1PC 5EC1A 2MKWA 5DD6B 1UM5L 3MV7D 4FHBD 3RNKA 2ATPB 5TF0A 1U8JA 4K23H 5GZOD 1MREH 2GAZB 5GGRY 3PWNA 1NCBL 3O6KH 3BJLA 4WW1A 1FGVL 4M61A 3FT2B 1BBJB 3HR6A 5C0FB 1EBPA 4OB5H 3TP4A 5SWSD 1KB9K 5EBLA 3STBA 3B6SB 4TSCH 3R8BB 4Z7UE 3MRPB 4C58B 3S96B 2ZCKL 3NMEA 4OI8A 3IGAA 3LSOB 5CBEA 3TNMB 1B4JH 1C7SA 5GGRA 1RUAL 5E1AB 4RAUA 1FNAA 4N9OB 3QO1A 4YE4L 3VXQA 1SYSB 4YXHH 1ADQA 4HUVB 3T04D 4RSVA 1A4KA 1UM6L 1PG7H 3RWJA 1OAQH 3NAAH 2IFFL 1SJEB 5CEYB 2FBJH 3UJIH 1RUPL 2OTUB 5HHNA 1KTKE 2P8MA 1P4BH 3RTQD 1P7QB 5F3HA 1CGSH 2HKHL 3V2AR 1FFPA 1YDPB 2VABA 2A6DB 2EDQA 2WW8A 4JRYB 1FV1B 4KUCD 4NNPL 4ZXBD 2RCSL 3MRKB 3UAJD 5IFAL 4OLWH 5HGAB 1BP3B 2KPNA 4NNXB 1UJ3B 7FABL 1QLRB 2H6PB 1JPGB 1ACYL 5TE4L 3MUY1 3TCLB 3WHE0 3MRDA 1KUMA 4HUNB 1CFBA 5D5MB 1JZ8A 1YEHL 1YEIL 4PRAB 4GBXB 3OJDB 3VFSA 2CKBA 1OPGH 4O9HH 4PREA 4YLQT 2EYTB 4P2QD 3QNXA 4JPWH 4NRYA 3QXAA 1G7HB 2NXYC 1JI2A 1X44A 1C5DA 2J5LB 3E6HB 3GSQB 4JY5H 1S7TB 1K5NA 4NO2B 4NNYA 3UTZA 2X09A 5D1QA 4OLZH 3JUZA 5TQ2H 3D5OF 4HFWB 4RGND 4KQ3L 3DURA 3F7YA 2XI9A 5DO2C 5LGJA 1LP9E 2DLIA 5GJTH 4UT7H 5D2NE 3ARFD 1WAAF 3NCEB 4U7SA 5E6ZA 4JRXA 4ZD3L 1A1NA 1QOKA 4K7FA 3GHEH 2HT4D 4N0UA 1OL0A 4PJ9D 1SEQL 5I1CH 1EA9C 3HPJB 4OUOA 1NGYA 3BO8A 5D1ZB 4HMEA 2HJKA 4IRSC 4QRPE 1ZA6A 4EI6A 3VI3E 5D6DC 2I9TB 2FYYB 5MERA 3V6OC 1A7PH 4JO1H 5I8CA 4KUZH 2CDFA 1QZ1A 4P4KA 3PJSA 5FDYA 2Q7YB 1OSZB 5T3XL 3T1WA 1HQRA 2I27N 2XWTA 2ID5A 3KR3H 3QPQC 4PLKD 1JPSH 4L9DA 2MCPL 3EJJX 3GIVB 2E9BA 2VDKL 5KSAC 2FZ3B 4ERSH 3CXDL 4JREB 3TT3H 1AO7E 1JP5A 4Z7QF 1LEIA 3PDDA 1A9BB 3KXFB 3SGJC 3LRHA 1ZSDA 3OKKB 3S9DB 1LO0L 1QHPA 4MB3A 4NQCB 4ZSOE 3TEUA 4KHXH 1AI1H 4Y8DC 4MWFA 4TVSa 4BZYA 2WIMA 1NFDB 3OKOB 4M6OL 1G6VK 4JHZA 3BKCL 4UBDD 5IFHH 1MRCL 5E1HB 3JWOH 4OLUH 3DMMC 1MCDA 3X12B 3OB8A 5IVXA 4F7CA 4HBCH 4Q97A 5B38B 1TFHA 2A2QT 4HWBH 4V1DA 5ISZA 4N90E 4OIIH 5F1OB 4HJJH 1NDGB 1ZHKB 3P0VH 4NBXB 4NN7C 5K9JH 4OZIF 3HR5B 3U4AA 4TYUA 5D7LE 1NQBA 4JKMA 4N5EC 1N6QL 4QTHB 1U8QB 1IGCL 5CZVH 2ATPA 2XZCH 3X3GH 5HHPA 1UXWA 3S35X 4B53A 1SEBB 4UZGA 5DK0A 3MRHA 5DHYB 1U93B 5F1SA 3QFJD 1SMOA 5JW4N 2E7HA 3B6SA 1GGCL 2UYLB 2Z8VC 1A3LH 2H32B 3S96A 4OI7A 1J9CT 4L3EB 4S10A 3BZFA 5J3HD 3LSOA 3TNMA 4YDIH 5F1NA 4C83A 2NYYD 4JG1H 3V52L 5E1AA 1NSNH 5B39A 3EYFB 3UPAA 5IVZB 3GJFB 5EOCL 4HPYL 1SYSA 3QEUB 4HUVA 3WSQH 4JPVL 3ME0A 3DWTA 4K55A 5E2TL 3KJ4C 3LN5A 5L6YH 4H0HB 1SJEA 3MXWH 1CT8A 3FQTA 5H94A 1BPVA 3MRGB 5IB3B 3PGCB 2I07B 2YK1H 1P7QA 3CD4A 2IH1A 5HJ3B 4RX4D 2D9QB 2A6DA 2LAGB 2XQBL 1TXKA 1FFNA 3QR2A 1I1AD 2IEPA 3DI3B 2OSLA 1QLRA 1DCLA 1QLEH 3QI9D 3WYRA 2VKXA 2Q3ZA 1ED3B 4MJIE 1TTFA 1VCAA 3AXLB 4PJBB 4TPRL 4PRAA 2AQ3A 4GAGL 4NZUH 4JM2C 1T7ZA 3LEYL 5D7IF 4OIAA 3QWRD 5DVKA 2VLKA 2Y06H 4WFHD 1XR8B 1Y0LB 4Q6IB 3HZMA 3E6HA 4HXAH 4WWID 1JYXA 4Z76A 3MV7E 1JFQH 4C56B 4HFWA 4PRPB 3MJ7A 1RQ5A 4XZUB 3X3FH 4OCYL 1IT9L 4YNYA 3MFFB 1IGJA 4ZTOH 4GSDL 3J8F7 2D31B 5SWSE 5J9PB 1CDBA 4Z95H 3OG6B 4AIXA 1HWGB 1UCTA 5D1ZA 2ZUTA 5DA0B 2BY0A 1LO2L 5GPRA 2FYYA 1JRHL 4CRPA 4QXGH 2Q7YA 4QRUA 5J8OA 4JPIB 5EZOH 1OB1A 2VDQL 3I75A 1Z2KA 3ULUC 1D7FA 4HKXB 1EEZA 3KPSA 4LGSB 3VGAB 5I1EL 4MSWA 3MGOB 3HUJE 1QFUH 4J4PA 1R6VA 4D94A 5IW3A 2NY6C 3ALPA 3FQRA 1TLKA 3L3KB 1FLRL 5HGHB 3O2WH 4HPOL 4JB9L 3QRGH 4K3DL 2PXYB 1SBSL 3LS5L 1SJXA 4XAKD 4AH2B 3DYPA 4N8VG 1XT5A 4PB0H 2WNGA 4NQCA 2G75B 4Y19A 5IROA 2DQDL 1NAMA 4XP6H 2L0DA 1H9VA 1KF9B 2AV7B 4G6JL 2OZ4L 3MBEC 4NKQB 3CFJB 3BI9X 4ZNCD 4CDHA 1UKSA 1EO8H 4S2SB 4P2QE 5MENB 2X1QA 1JGDB 1D9KA 4P5TD 3QHTC 2F5AL 1S9WB 4XVJL 3W0WB 5FA3B 5B38A 1HDMB 2QV2A 3D39A 1HYSD 4JAMB 3HMXA 1DQTA 2LQRA 1N6UA 1BVLB 5F96H 3HR5A 4GUPA 1C16B 4RGNE 1UH4A 1GH7A 3EJZD 1RMFL 1CLYH 2CDEA 1EGJH 3RKDC 1MWAB 2CGRH 2I25N 4NQDB 4QTHA 5E99L 4OD1L 2IWGA 4ZAKA 4HWEH 1IQDB 5EUOA 4QWWC 1CS6A 4F7EB 4RWHA 3C5ZA 1UKTA 3BWAB 1H3TA 3LQMA 4KH2A 1U93A 1S8DB 1AH1A 2BK8A 5IF0B 3D9AH 3F58L 4P4RB 3LH2L 4HF5H 5DUML 1C5BL 1EHNA 3OTTA 1N64H 1NGQL 3T0BA 4U1IB 5I2IB 3C60C 2H32A 3PQYB 1U8KB 1GOHA 1UEYA 1JNHB 25C8L 4R0LB 4PJ7F 4XAWH 3TPUB 1B90A 1F4XH 4LLUA 1LNUB 4PV8A 4ZS6C 5FO7A 2FR4A 1UQSB 5DWUL 4QYOA 5IVZA 4HUXA 1RZFL 1CGXA 3EZ8A 4D9LH 5I66A 2QL1A 4XNMB 2A83B 1JF5A 2VLJD 3KPRE 3TJEL 4M6NH 3I6GB 3H3KA 3HZKB 1HWHB 1IC7H 3EOTL 1QQDB 4JO4L 3BGFC 5IB3A 4HIEB 3PGCA 4H20L 2I07A 2Z0BA 1Q9WB 3DTXB 4EDXA 3ULVC 1LDPL 5HJ3A 2BNQD 2UZYB 4OF0A 3T3PE 1G7LB 1N2RA 3WIHH 1DN2A 3WO4B 5KSVB 4K9EL 5L9DL 1CK0H 5JLZB 2ZKHL 2LV4A 3OB0H 3ZKXB 5LAXB 4GMSL 1MCNA 3T0EC 5CP7B 3V5HB 4YAQA 4WJ5B 1ED3A 2DLEA 2I5YL 4NOBA 2AKRB 1CVRA 3KYKL 5DZOA 4S11A 4KY1H 1NLDH 2YHGA 5IQ9B 4NO3A 2E9IA 5B4MC 2XA3A 3D0VB 3ZT7A 2CLZB 1EUUA 2X05A 1HKLL 3BRDA 1F45A 4Q6IA 3ZHKA 2AXFB 2A9NL 4KKLC 3U4EB 5CKAA 3LDBC 5FFLA 1L7IH 4PRPA 4UOW1 5E9DD 2OR9H 5CEXA 3MJ9L 5KS9E 3A6CL 3QZWG 1JTPA 2C3GA 3QO0A 3RWGA 5EORH 2YN5A 4P3WA 3SQOL 3QFJE 1KIPA 5DK2B 5IJKA 1QUNA 2D31A 2EIBA 3U7WL 4HWZA 5J9PA 2MHAA 4XP4L 2L7JA 3KPPA 3H9HB 1MJUL 3FHQA 1J0HA 4TUOB 1BIHA 4PRHD 5FGCE 1LDSA 4Z8FH 1MRDL 3LKPB 2PO6B 4O51B 2LVEA 3RGVA 1GGYA 4CMMB 1CD8A 2F74A 3O4OB 2X89A 5DQJB 2JCCF 4PJIB 2XY2A 4L4VD 1FNHA 2NY4C 4PJFE 5D71H 5BOPA 3PWUA 2K1MA 2JJUA 3KPOA 1E4JA 3LD8B 4XRCB 4U3CA 3QWOB 5HGHA 4IRSA 2GTWB 3LN9A 4CKVX 4JG0H 3V6OA 3MJ8A 2PXYA 2EECA 5IB2B 4MNGB 4AH2A 1V7NL 2B0SL 2LTQB 3U1SL 3V8OA 5HHXH 3IVKB 2G75A 4HUWA 1ROWA 4JQIH 1CR9H 4O2CB 1DN0A 1AGDA 4R6UA 3O8XA 3QPQD 4F15B 5KVGH 1T7YA 5I71C 2IQ9L 5A43C 1LO4H 1AD0B 4OZGB 3O3DB 4J3SA 4S2SA 5KSAD 5MENA 4W68A 5BV7H 2C1PB 3E8UH 3MBXL 4WFHE 4Y2OA 4JAMA 2Z4QB 1A7QH 5FEBA 1U2CA 4G6FD 2DB8A 3BH9B 4DEPC 3LPGA 3BP7B 4XHJD 3BP5B 1KFAH 2A1WL 2B1AH 1TETL 4YDVB 1MWAA 1IQWL 5J6GB 4XXCA 3D85B 3UJJL 1IM9D 1OQXA 3E1F1 1HXMB 1IQDA 2AERT 5A2JH 3GRWA 1UCBL 2HJFB 3QEGH 2Y1VA 1BWMA 3CLEH 4QOKB 3DI2B 5T3ZL 4D0DB 5IF0A 3O4LD 3DMMD 4Z7UB 1FDLL 3P9MA 4V2CB 1X5ZA 1NCWH 1H3WM 4X7FC 1CXHA 1C08B 3WN5B 2W9DH 5HGBB 4OCXL 4PB9H 5BO1L 1JNHA 1I1FB 3TPUA 3BD4A 2XKSA 3Q2CA 5IESH 1ZHBB 4KRPB 3D0LB 3HPLB 1P2CB 3SHSA 4AMKH 1FNSH 4DUWA 4M7KL 4NKOA 4XNMA 3SGEH 1PBYA 2OI9C 3DYMA 3K0WA 2E9JA 4GKZA 3I6KA 4X5WA 1NCUA 5E2UL 4H0IA 2IADA 2UUDH 2BVTA 4HIEA 1VEOA 2GW5A 4K3JH 1S7RA 3S98A 1BZ9A 1H3PL 1RZJC 3ZE2F 1HHHA 1X7QB 1G7LA 3QUXC 3BEWA 1A6VL 4XAKE 4DKEL 4EN3D 2JLLA 1BF8A 1INDL 1JMXA 5TE6L 4CL7A 3KS0H 3VMNA 2X44D 2DDQL 4WJ5A 4NC1E 2VXQH 4KGLA 2CIIB 5DJYB 1FH5H 3HZYB 2YD6A 1G9MH 3CSYA 3RBSA 4MQ7A 5IQ9A 1GPOH 3KNBA 1UB5B 3SGDI 1A0QL 4AZ8A 3EW3B 5DUPL 1GZQB 5DJXB 1YN6B 4XNUL 1JN6B 1L7TL 4PJGE 1ZANL 1X3DA 4WNQB 4MD0A 3MROB 4LSUH 3B5HA 4JDVB 1V7MH 4M7ZC 2MJWA 1R3IL 1S9XB 1QEWA 3T0WA 1KN2H 3QRFM 5D2NB 5LWYH 2OM5A 3SDAD 4GAJL 1FJ1A 3EO1A 1BD2A 3RVWC 1KCKA 5T1LA 1R3LB 4WW2F 4YDJA 1CDJA 4LRNL 4F37F 5J06A 4JM2D 2XOTA 5EDXA 5DK2A 3MCKA 1DLFL 1VERA 3PABB 3MZGB 3EDFA 4QRPB 4WEUD 3SE8H 4OTXL 4B7IA 5JA8B 2BHYA 1KEGL 2H8PA 2V2TB 4CW1B 5JHDD 5J6HB 2XWBB 1U95B 5DQJA 3HC0A 4JGJA 4ZPVB 2QBWA 2VLJE 4XNXH 1N5AB 4X99B 1K4DB 1JGLL 4UMGA 1IAMA 4JJ5B 4NKMB 1FZMB 3NZHL 5DMYA 2X4SA 5BCAA 2H3NB 4HH9B 4X7EC 2BNQE 2ZSVB 4KFZC 4XRCA 3KPLB 2Q8AH 3IRZA 5L7XH 2J6EA 4L1DA 2C3VA 3CCHB 4ALAH 1HHJB 1JPFB 3WFZA 3RIFK 5E70A 4OBSA 3L5XL 3OZ9H 4KMTL 1QYGL 2XZQH 3V5KB 3U6RB 2EDWA 1MFDH 3LQZA 5I8OH 1MFAL 4Y1AD 4H8WH 4KRLB 4K3HA 3UBXG 1MI5B 1OHQA 1H3XA 1WZMA 2CIKB 1RIHH 2HVJB 4WCYH 2X9YA 3O3DA 5DURB 1JHKL 2C1PA 2NY6D 2VDOH