2VDNL

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist eptifibatide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
214
structure length
213
Chain Sequence
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPRFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 213
sequence length 214
ec nomenclature
pdb deposition date 2007-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdnL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdnL01
3MRNB 4X6EB 2FYYB 5IHBA 2CJUH 2DQHL 3VRLF 4S1RH 4QXTB 3HE6C 2GJ6D 2X1PA 4FQXD 3VXUE 2RGSA 4YXHL 4Z78A 2YC1B 1I9IH 1P9MC 1YEIL 3P4OA 1CXEA 2BHYA 3SPVA 4HKXB 3QNZB 4NO3A 3OGCB 5IB2A 5EPMA 4M5ZH 3LOWA 4A6YA 3OX8B 1NCNA 3MBXH 4JM4L 1XF2B 1Z5LB 2EDTA 2VXTH 3HLAA 3SDYH 1DQJA 5TF1H 2UWEE 3WJLA 1T21A 5HI5D 2FEDD 4GKOA 2VLKB 3ULSB 1PLGL 2L0DA 4DKFL 4GKSB 4U6VL 1W2KT 3RGHA 4TTGA 4IMKC 5EUKA 2VKWA 5F1SA 5B39B 2P4AB 1B0RA 3QWOB 4JPVH 5DEZA 1H3PH 2PO6B 3MA9L 4LLQA 4DOHE 2EE6A 2H9GA 4F7EA 2FHFA 3LDBB 4JKKA 4QYOA 3GO1L 3EJJX 4XCEA 3QAZC 4LP5A 2P5WB 3DXAB 4FN0A 2BMKB 1T7XA 5CINL 3VXSA 3KJ6H 4KUZL 3TT3H 1U3JA 5TPWL 4QHLB 4K9EH 2MTPA 4D0BA 3MACH 5HHPA 3SKOB 1MFCL 2ITDB 4DVBB 4ZS6D 1JGEA 5EO9A 3V52H 3FN9A 4LHUA 4ONGH 3HNSL 1EBAA 2BNRE 1I1YB 4MA3B 2L7JA 4JZOB 4CL7A 2VZUA 2BFVL 1WZ1H 3HG1E 3P11H 3NFSL 4NDMB 4OI7A 1MIMH 2BJML 3WJLC 2AJYH 2YPLE 3QQ4B 5GISL 2OMNA 3DURA 1YDPA 4YDIH 4J4PC 4PJ7F 2VSCA 1DE4A 2FNBA 2YD6A 4HJJL 5AZEL 4JHBA 1QZ1A 5B3JE 1BLNA 1XGTB 3SN6N 4NKQB 1ZHBB 2DQDL 4WW2A 3H9HA 1U8KA 1DANU 1X7QB 2YZ1A 1D5ZB 4WIQA 4H1LH 4P5TB 1J11A 3FN3A 5I19L 4QY8A 2DWEA 4YK4C 2X4PB 4GAYB 1UA6H 4YHKH 2Y4SA 1NUGA 3HA0A 4RFEB 1FORH 3DTXA 4Y8DC 2W92A 5DK0B 1G7LA 2ICEA 3LEYH 1FFNA 4YFLF 4FXGA 3NAAL 4N9OB 4OFPA 2O26U 1KCVL 4MNHA 1U3ZA 1U36A 3QHZL 1QFWI 2CUIA 2W1NA 4PRHB 5M7QA 4Y19A 3X11A 4LNRA 4JRXB 2FD6L 4DWHA 5L0QC 3MOAH 4LPUA 4AEHH 4NCC2 3VFTB 4FG6C 5DT1H 2D3VA 2P43B 2HWZH 4EUPA 2B0SH 3BAEH 1LEKB 4WFHD 1C8PA 2DJUA 4R0LA 1RULH 2FJFA 2RFXA 4RMRA 3NZHH 1Q9KB 5BZWA 3ZDYF 1S3KL 4LSQL 5GGSB 1YMMB 4HS8L 5DSCB 4MSWA 5C0RL 5IJVB 4I0PA 4XMLH 5L2KA 4WW2C 1AQDA 1H3UA 5GGTH 2YRPA 1R5VB 1E4JA 2HKHL 4W6WB 4NSKA 5FYLE 1A1MA 5IWLA 4PBXA 5E8EA 5DQ9B 4DQOH 2BVYA 1MI5D 5DD3H 5IVXB 4MJ2A 1G6RH 4Z7WB 5L2KD 5TDOB 3I02B 3VXTB 5ALBL 4GMSH 4X7SL 4RSVA 3F5WB 1ZLSH 2E7CA 1T0MB 3BQUB 3F65A 4PLOB 1ETZB 4TNVK 5HD8D 4Z0BL 2DWDA 3OKLA 1FL5A 1U95A 5EBGA 4OV6F 3N85H 4P2OA 1T0NA 5K9KB 1OAXL 1R3HA 3AU1B 3RWCB 4OLXH 1LNUA 3UROR 4POYA 3RNKA 1JJUA 1LO3L 3CCHB 1J9CT 4NZJA 1PG7H 1JN6B 4YE4H 2Z31A 5E9DB 3VXNA 5EBWB 3ZE1E 2IAMA 1ZKAA 4J3TA 4KU1A 5FUOL 4PUBH 3ZKQD 5IVNA 4I0PC 4P59H 1ITBB 5EWIL 2C7UB 3DGCR 3PHOA 4QNPF 4HJGB 2DQFA 4Z7OE 1CE1H 4N1HB 2B4CC 1PJ9A 5DD5L 1JGUL 2EDEA 1FIGL 2Q3ZA 1B88A 4BFGA 1P4BL 3GSRB 5AUMA 4D0CB 4X6CB 4F15B 1NGZA 2IAMD 3QO1A 4OFVA 5FFLA 5C08D 3IGAB 3RVVD 2BY0A 1LK3H 4LU5L 3RKDD 3GSUA 1RMFH 1U93B 4YHML 3OB0H 4Y7MA 5TF0A 5D96B 4AIXA 3LSOB 3T08A 1Z9LA 3J7HA 4KDVA 3O3BB 1QRNB 3BKYL 3VFOB 2CKBH 3MA7A 3RX7A 4UB0H 2AEPH 2XN9B 5GRJH 5D8JL 1I9RH 2XKSA 1D5XA 4V1DB 4P2OC 4G8GB 3KPNB 3MRMA 5HGHB 5BOPA 2Z4QA 4R3SB 1S7WA 5I1CH 4JO2H 2VSDA 1DUYB 3L95A 3MRIB 3MR9A 2MPAL 1FL3A 4XC1H 4S2SA 2NY5L 2NW3B 3MV9E 5EO1A 1B3JA 1YYLL 5BRZB 2Z31C 1CU4H 3U7WH 4F3FB 3OGOE 3DX9A 4NQXA 5I0DA 3L3HA 5JW4N 4NQDD 1LP9A 5E5MA 4KROB 4LBEA 2LE9A 4JKPL 1Z9OA 1ZSDA 5KVEL 5H35A 1UWEH 5AYUH 2HMIC 4KZEL 3VFVB 4OZGA 1KV3A 1P84K 3HI1A 3RWGB 2R9HD 2F54A 5MEOB 1NCWH 1R5WA 4EDWL 3B3IA 4XHQA 3VXSE 5CZVL 3OKDB 2W38A 1QFUL 1S7TA 5EOCL 5SWSA 3T2NH 5C07E 4JRWA 1N5YL 3SOBH 1Z0NA 4WO4B 4GFTB 3B5TA 4KJYA 4OZ4A 2R39A 1QYGL 4XX1G 2HT2C 4PJFA 3WE6B 4N0CC 2BVEA 5JXAL 3CAFA 5GS0L 1INEL 2X7LB 2Q20A 1CXKA 5FYKD 1ZS8B 4NQCB 1INDH 1UZ6F 1J8HA 2EECA 3CH1A 4U31A 1IMHC 4OF7A 3ETBF 2OSLB 4XCFL 1OAUL 3OXSA 1NANI 1A1OA 3QEGL 1NGWA 1MHHB 2BVQB 3TYFA 3QUML 4ZUWB 1KC5H 3VWJD 4WY7L 5DJCB 3U0PB 1YPZB 4FABH 4G7YH 4WW1A 5IG7A 1RZJC 3BN9C 1KB5L 2PTUA 3O8XA 3QYCA 2FEEI 5JORA 3PJSA 4Z7UE 1JI2A 4Z0XA 4D9RD 5IFJA 2RCSH 5E4EC 3PQYB 1UWGL 1E6OH 3UCRA 4IHOB 3O8XD 3RAJL 1K3IA 2HJLA 5DVKA 2JIXD 3B8YA 3E6HB 4NNYB 4WWKB 3IDGA 2KKQA 3X14B 1JNNH 5HHQB 2X9YA 1FNGA 1T5WA 3BPCB 4ELMA 5T3XL 1A1NA 3O6FA 1F13A 1FO0L 4PJIF 5HYIA 3MUHL 3WXWH 2EYRB 5IM7A 4CVXB 1A7QH 2Y72A 4HUWA 3L1OL 5I8EA 4U6TA 1CXIA 2R0WL 5JPNB 1MCFA 4RBPH 2EDBA 1Q9OB 4ZOCA 5EORH 5EN2A 2VDLL 5FO7A 4GRMB 3LPGA 2YR3A 2YPVH 4ZMAT 4JVUA 2L7UA 1MJUL 3ARFB 5CD3B 1TZGL 1HKLL 1KJVA 2F15A 1J1PL 3VWKB 4HH9A 3FHQA 3B6SB 3C5SA 1RJYA 3EJYD 4GKZA 4AZ8A 5DYOA 1N64H 2HG5B 3O0RL 1QVOB 4O5LL 4JEGB 5FDWA 1N59B 1MF2L 3PL6B 4MZ3A 2VH5H 2BOCB 4JQXA 4NP4L 5F88A 1BF8A 3SDXB 5I16B 3TBSA 3PGFL 2E9IA 3OKMB 4TNVF 2XRAL 5BS0A 2ESVB 4QWWD 4MQTB 5EC1B 4LCIH 1N7ML 3HNVL 5I1GL 3FO9B 1GZPB 4BQCA 3MV11 2PN5A 3W9DB 5BQ7B 1AE6L 5CLWA 5DDHB 4Q9QL 2PYED 4H1LA 4M6NL 4XTRC 4I3SH 1CDHA 3QH3B 5DHYA 4I5BA 2F53A 1F11B 3HAEB 3VJ6A 5ICZA 2R1YA 3G5XB 1OTTD 3HZVB 5HDBF 3RVWC 5E1AA 2CIIB 4OZFH 1QSED 1C5DA 4XP5H 4PGDA 3W0WA 3QDME 1MIEH 2H26B 2XWBA 4K9EC 3MX0A 5F9OH 3WNMA 1S7UB 2MHAB 4MLIA 3DMMC 1YNTA 3NABH 3ZSTA 3A6BL 2NY4C 2Y06L 3ARDA 3RPKA 1QSFE 3WNOA 1KIRA 2AJUH 5GHWL 4WJ5A 2AKRA 3LQZB 3UBXB 4HX1A 3BJLA 5T1MA 4P2RE 1NMAH 1IAKA 4QTIL 4KTYA 3U9UB 4ZYKA 4R96B 2AI0L 3BPNB 2V9RA 4KK8C 1FIEA 5JIKA 3TNMA 3C8KB 4JQXC 3ARDD 3JWOL 1IKNA 3GSQA 3BH8B 3FQTB 3DETC 4R26L 3DV4B 5D2LA 3H9SA 4P3CL 3WHE0 3ZDZF 4XVUC 2R56H 3CPLB 1OQOA 4PLJC 5F44A 5HVGB 4OD2B 1OHQA 4N8PA 4ONFL 1T6WA 5GGTA 3RWIA 3O9WB 4BA8A 2VLJB 2Z35B 4ZODA 3VXQA 3CFCL 1ZHKB 4GW5A 2CLRB 4HS3B 3QUXA 4JCMA 1G6RA 1KIQA 2VABA 2VDPL 3CC5A 3GM8A 5CBEB 4PJCB 3S36X 1DL7L 1L7TH 4OZGE 3C2AH 4LGPB 4NHUA 4OKVA 4POZC 3C8HA 1U91B 2F54E 3UTQB 1XH3B 3QUXD 1CFNA 3I2CL 1MWAL 2DF3A 3SO3B 4QRRE 1NDMB 2JJWA 3UTSB 3HB3D 4C56D 5J9PB 2DL9A 4U0RC 4JLRB 5DVLA 4MJ5B 3CX5J 1UGNA 5FGRA 1CT8A 5CILH 5KSUA 3QZWB 4LCWD 1RJLA 4FQ2H 3RFZC 2Q7YA 2IG2L 3VGBA 5T33H 3NMEA 5JNYB 4NRZB 2JTDA 2V6HA 2NY3C 2IADA 2J7LA 5IMOB 5IW6A 3OKYA 1LEGA 1JMZA 2YXFA 2MMXA 3EYVB 3EYSL 5EC2B 3IVKA 2P5EB 1R3KB 3BO8A 2A6JB 1V3KA 3CUPB 3PGCB 3C5ZA 4BZYA 2Q6WA 2X4QB 3PWNA 1S5IL 3B9KB 3BYYA 1ND0A 4R4BB 1PW3A 5EZLB 1HH9A 4R90L 3ZKMD 1ACYL 4QHKI 4KKAD 1Z9SA 4S1SH 5IT2L 2BNQB 4GBXB 5I1EL 2IH3B 5CD5C 4ZQKB 1UJ3A 4F7MB 3M07A 4NFBA 4D0DA 4H0GA 1U92A 4Z95L 4LSUL 1G84A 4NCC1 3V0WL 1TETL 2ATPA 3TH2T 4NN6B 3X3GH 1OY3B 5DMKA 1MREL 3NN8B 1HHHB 5IB5B 4ELME 5DGRA 4YO0A 2BNUB 1GGBL 1CGVA 2D9QB 2GTWB 2GJ6B 1ZT7B 2ZUXA 1ORSA 1A7RL 1KCRH 5C3TA 2BSRA 4FQXB 1B2WH 3M1BB 2DD8H 4PJHF 3QAZB 5KVGH 1YEKL 3T2OA 1CF8H 4CU8A 1J1XL 3FQXA 4S11A 1DQLH 3E1F1 2CH8A 4PB9L 3RWJB 4Q9CA 4MA7H 5TH2B 3TBWA 3S9DB 5CEZD 1ORQA 1KJ2A 1I7ZA 4JFOA 3SPVB 4NO3B 1EFQA 3HUJE 5EPMB 4A6YB 4ORZC 2VO5A 3HLAB 5A2IH 3VXMD 3WJJC 2DIAA 3SO5A 1AH1A 1DQJB 5JIHA 4XP1L 2OK0L 1T21B 3C60D 5E6YA 2DQJL 4XNYL 3MLYL 3V7AE 5HYJA 1AQKH 3O4OC 1VFAA 4K2UL 2RR3A 4K7PX 1U8HA 2I60H 5EUKB 4OD3H 4D9LH 1E27B 1MCEA 2ADGB 3DX7A 4HGWB 1B0RB 3MC0A 1ZLVK 4ZG1A 1HQRA 5BS0E 2FO4A 2CSPA 1WBZA 2Q87A 3NCJL 1FNSH 3HFML 1VACA 3JZ7A 2AGJL 3MYZA 3UC0H 1A7NH 3HRPA 3BOVA 2F53E 2R4SL 4GXVL 3IDNB 3QXDB 4XCEB 1NBVH 1V5JA 5GRXG 4HDIA 2WWMD 1DQMH 4ZTPL 4C58B 2F5BH 2ENYA 3QP3A 3CLFH 3S34H 4D0BB 5HHPB 2YUXA 2DI9A 1KIPA 5DJ0B 3CXHK 3CVHH 5I2IA 3NOIA 4LQFH 2AXJA 3DPBA 5GS2D 4JR9L 4LHUB 4PRPE 5E99H 3RVXD 4L3ED 4JFZH 4BQBA 4PJXA 5FKAB 1NQBA 3CFKA 3GSXA 1A4KA 5D71L 2AV7A 4PGEB 4XNUH 2EC8A 3GMRB 3GJEB 2D7OA 1E4WL 4HQQH 3DURB 1YDPB 3RGVD 3ZL4H 1HILA 1EEQA 3IU3A 3WKMH 4YFDB 1W72A 1DE4B 4HIIB 1ONQA 4JZNB 1HZHH 2O5XL 4PLKD 1F8TL 4YXLL 3VFPA 1O5DT 2EICA 4JM2F 5ITBL 4Y4KA 4C83A 2PW1A 3LKNB 4OLYL 2MQ0A 1FRGH 2JLLA 2XWJB 1KN2L 1EHXA 1F42A 4WW2B 3H9HB 1U8KB 4DVRL 4FQJL 1Y18A 5D72H 1DN0B 4K8RL 2XTJC 1FZJA 4QY8B 1B0GB 5E1HB 3PWPD 3AROA 4LMQE 5KS9F 3U7YL 5EZOL 3RNQB 3DYMA 3WNLA 5DI8A 4Z77A 3EGSA 3T3PE 4X99A 3DTXB 3U36B 4AG4H 4Y5VA 3HKFA 5JIPA 2DQEL 2ICEB 3EHBC 3OKKA 5LXGL 4FXGB 4LSPH 5EB9A 1WITA 3HC4L 5I8CB 3Q5YA 1NAKL 2H8PB 2P44B 1Z2KA 4WI2A 3GSNL 1V3JA 3U0WH 4HPOL 3NGBC 1NMCC 5KAQF 3F12A 4Y19B 4LNRB 1MLBA 4WU7A 4GO6B 5EUOA 1DBML 3L5HA 1S7VA 4OFYA 4PLNC 4OF8A 2MFNA 1U8IA 3O11A 4NQTA 3RVTD 2F8OA 4PV8B 4RMWA 5DRXA 5KANI 5T1DL 4R0LB 1U8LA 3UBXI 3UJJL 2FJFB 1EA9C 4DEPB 3NACL 1IGIH 1AP2A 4MZ2A 4JCLA 1KNOA 1DBKH 3VI4F 4MSWB 4Y4KC 4YHYB 1MI5B 1A6WH 4DGVL 5L2KB 3E6FA 5TGBA 1VKXA 3ULUF 4L3AA 1LGVA 4LCUA 4JAMA 3N06B 1ZWIA 1AHWA 1BM3H 1HINH 4ZFFA 4N0FA 3QEQE 4HCRH 4NSKB 4GH7B 5FO8A 4QHMB 4DN3H 3EBAA 4MA1B 2UY6A 1NCUA 1YYMH 2OZ4L 4LLMA 4U1KB 1WVZA 3QSKB 4MVBD 3I6LD 5L6YH 1NSNH 1TPXB 3P73A 1I7RA 1J88A 5DD6A 2DWDB 3OKLB 1U95B 1T0NB 4FFVD 3MNWA 2ORBH 3SKMB 1R3HB 2DQIH 2AEQH 4PTTA 4RX4A 3RNKB 4YHNA 5FA3A 5FKPA 3T2PA 2C4XA 1I1FA 4HUVB 1RZ8B 1SYVB 2Z31B 3IRZA 5JR1H 3F7VB 5B8CA 4WTZA 3VXNB 2E6QA 2H1PL 4U1NA 2IAMB 1YNKL 4XCNB 3INUH 3H7LA 1N8ZB 3SE3A 3AY4A 5JHDA 3QJFB 5T1LD 4J1UA 4PR5A 1DVFD 4QRUA 1UB6A 2D4DA 3TESA 1RHHA 1RPQA 2ZCKH 4XWOC 4QTHA 4JB9H 3IU4H 2BNRD 1JPSH 4OTXH 1NFIA 1NJ9A 4DW2L 1G7PA 3BW9A 3HG1D 1NGZB 4K23L 4JFPA 3QO1B 3RY6C 2FB4L 3QUZA 4RA0C 4LVOC 1NGXA 3BWAB 3L5XH 4EDXB 4MNGE 1UKQA 5GS1A 4Q6IC 2DDQL 2EIEA 3LS4H 1BX2A 5HY9A 4RWYH 1H8SA 3V4UL 1SJEB 4IDLA 3G6JE 5A3ID 1KPRA 4Z9KB 1XGRA 2UZIL 3MA7B 4NIKB 3DRTA 3RPIA 2AJVL 3QUZD 1YEGH 5D1XD 4GJTB 5I1AA 4PGCB 1IC5H 4YZFF 4YR6A 5FEBA 3BD3A 2IGFL 2ZUQC 2IBZX 2Z4QB 4NQDB 5D70H 1S7WB 4JRYA 1F2XK 1PKOA 1ZOXA 3TBVB 4NM8L 3L95B 1RURH 3MR9B 1FL3B 3SDAD 1I1AA 3PWLB 3WNNA 2WBWB 4FOMA 1AR1C 1BOYA 2BRQA 3RX5A 3BEWA 4OZHE 3FRUB 4K3GA 4WCYH 1LP9B 5DO2D 2V17H 1MFAH 2FGWL 3AY4C 5DWUL 2NTFB 2R1XA 4MCZA 2MCPH 2XTJE 1MCJA 1J0YA 1T3FA 5A16A 4CRPA 3TM6A 2ZSVA 5LWYL 1AGBB 1GHFL 4XH2A 1FPTH 4K7PL 4Y4HA 2OS7A 1NMBH 3HI1B 4ZOBA 3PHQB 4PRIA 1QFPA 1R5WB 3QR2A 5KSAC 1OB1B 4MQSB 5IK3A 3IKCB 1S7TB 3ABZA 5SWSB 1JFQL 2KZWA 5E7FA 4YQXL 3VG9B 1OAYL 3N1GC 4KJYB 4OZ4B 3ZSSA 5C0IA 1CXHA 4PJXE 4TSCH 3IDMB 4I3RH 5JOEA 3O6ML 4MD5A 2NY0C 2QHRL 4S1QL 1L0QA 1RUAL 1N4XL 3MROA 3T09A 3W11C 2J4WL 1J8HB 1CLYH 2EO9A 4PTUA 1JYWA 1JZ8A 1IQWH 1VPOL 2W0FB 3VWJB 1CFSB 1I1AC 2HJFA 4X6FA 3OXSB 1DBAH 4KMLB 1SMOA 3FRPA 4WENB 3TYFB 1DQQA 1FVDA 1ADQL 2PXYC 3O3EA 1OM3H 4BZ1H 3P40A 1NBYA 2NXZD 3N50A 1M05A 1I8LA 1QA9A 5IG7B 2YA0A 1SBBA 4WHCA 4Y4HC 1OCWL 2IQ9L 1JV5B 2X1QA 3O8XB 1KT2A 5D5MF 2JIXB 5JORB 1T1YA 5C70A 5KSBB 3WS6A 4LPXA 4O2CA 5C0AD 1IGMH 5IFJB 4FZEL 3UZQA 5F9DC 3CJJA 3SEPA 5IJKA 5I8OH 3HI6H 1FNGB 1T5WB 4XPHH 4IJ3B 4GQ9L 4HWBH 1I8KA 1B0WA 1R3IL 3O6FB 3EOBB 1AGEA 2HRLA 4XVJH 1RZKH 2D03H 3BIKA 3K8LA 4HG4K 5JQ6L 1GGYA 2J8UF 3RZCA 3BZFA 4NZRH 4WEUD 4HUWB 5IB1A 1RU9L 1A9EA 5FGCE 4Q0XH 2JJVA 4AT6A 1NGQH 3MXVH 3STLB 2H45A 4PBVC 4ORGA 6CGTA 4NQSA 4TSAH 1DSFL 2YK1L 2VLMD 1NPUA 3EUUA 3FJTA 3C6SA 1G6VK 1RJYB 2ATKB 3MV9D 2QQKL 3WS6C 3UYPA 2UYLA 1NGPH 1H5BA 2NCMA 1BD2D 1YEHL 2JJUA 4ODSH 4O4YL 2PYEB 3TBSB 2BHUA 1IL1A 2BY1A 4CVWA 1YEEL 4JFHE 1H8OA 1DQDL 3RUGF 1T66C 4UTAH 3HPJA 1IGFH 3AREA 3FO2A 5D1QD 3RZCC 1K4DA 1U8QA 3PV6A 3B5HA 5DHYB 1T20A 4I5BB 3MLSH 2XZCH 3GNML 1FNEA 5C07D 1MAML 3VJ6B 4ZTOL 3HNTH 5I15H 3RIAK 1EBPA 3T0DA 4OM0H 5IESL 1C5DB 2HRPL 5DJ6A 5TE4H 3W0WB 1NLDH 2XWBB 4CDGC 3VDAA 4XXCA 5JW4Q 2JELL 1U42A 4PJBA 1W0VA 1NCCL 2CPCA 1I9JH 5EZJA 3ARDB 2I27N 5TFSL 2VLRA 3PWUA 1KIRB 3O2WL 1HDMB 3D5OF 1P6AB 2C26A 2X6MA 3P9WB 2AKRB 4WJ5B 4XPBH 5HHOA 4GRWB 3PABB 2L4OA 2NZIA 1YEFH 4HX1B 5T1MB 2ARWA 2ZCLH 4ZYKB 1YUHA 3L3GB 2CLZB 3TNMB 4WWID 1AD0B 5J3HD 1LE5A 4EBQL 4G9FD 1RJCA 1XIWC 2IFFL 5GJTH 3W5MA 5DFVD 3LEVH 4M1CC 3TJHC 2ADIA 2HH0L 2X4TA 2EH8L 3SBWA 2CXKA 2NY3B 3DGGA 3F58H 4BFBD 3AREC 5E56A 4HCRA 3VXQB 2ZP0T 5MEND 3JXAA 3QDGA 1P7KA 2B1HL 4HF5H 3QUXB 1KIQB 2VABB 3QNXA 1DTUA 25C8H 4JANA 4NHUB 1GOGA 4OKVB 5HDQL 2DQCL 4PRIE 2KQMA 1G9MH 4C56B 5FIEA 2H32B 1DCLA 1RUQH 3L3JA 4BQ9A 4P2QA 4NKDB 1K8DA 1YECH 3MOBL 1HSAA 5F1NA 4J3UA 4LCWB 1WAAE 4MAYC 4EN3A 3C09B 4MXVE 4MLSA 35C8L 4RGOH 1NFDF 4ZS7H 5T3ZH 3D39D 4OCWL 1CT8B 5KN5B 3M45A 5KSUB 4N68A 1RJLB 2K7PA 2VMFA 1KFAL 1DBJL 1YNLH 4MNQA 4ZUVA 5JW4R 5KANG 3WFBL 1X6LA 3UBXG 2IADB 2BVOB 3L3OA 3MODL 2FX7H 2OMBA 5D1ZC 4RMSA 4GG6A 1IC4H 3IVKB 3MLZL 1Q9LA 3QO0A 5EA0L 3BO8B 4LSSL 5C8JA 5L7XL 1X4YA 1KELL 4N0RA 4TPRH 4XNMA 3C5ZB 1QR4A 1JTOA 3KGRA 1KACB 3D9AL 3PWNB 3VD4A 3TCXA 1ND0B 3E0GA 1HH9B 4K7PY 1JWUA 5C0JA 4WNQA 1LO4H 4XPFH 1R0AH 1EX0A 1IAOA 4TUKH 3QCUH 3VGFA 4FQIH 2QQQA 4HIHA 4JO1L 5FYJU 1CGUA 4KVCH 4XCCL 5D7IA 4O2FA 1UJ3B 2AJXL 5MEPA 1HCVA 1U92B 4XP4H 4L4TA 3E2HC 3QXUA 4OT1H 5DQJB 3MLTB 2EYTA 1QLEH 1TCMA 4EN3C 3MLVL 8FABA 5DMKB 4K3DL 1K6QH 3MRQA 1F4XL 3QDMD 4E5XA 4KK5C 4ETQB 4OF0A 3MGTA 4MAUL 4DUVA 5EBMA 4Z7WF 5CCKH 3OJ2C 3FFCE 2VE6A 4Q9BA 3JBG7 4JG0L 2OI9C 3TZVC 1QSFD 1S7XA 3OBAA 4R2GC 4P2RD 1K5NA 3RTQC 4K07A 3R1GL 4RAUA 2AJSL 3S96A 2CDEA 3EYQC 2VDRH 3VXMB 3TBWB 5EZIL 5ILTL 3OAYH 4RZCB 3OSKA 5M95B 5IR1A 1NBZA 4JO3L 1ORQB 3C60B 1KJ2B 5JPMA 1UM4L 3S35H 1RUPL 4LCCB 4J3VA 3FQRA 4KJWC 1WISA 3NFNA 4P9HL 3D3VD 4TQEH 3OG4B 3TA3A 1NAMB 1OAQL 4QRPE 3EKCA 3TVMD 4TSBH 1VGKA 4EQ2A 2X4UA 4M5YL 1PZUB 3QUYA 5HYJB 1VFAB 3F6IA 5E2WL 3QNYB 1LMKA 2C3VA 1GRWA 3MV8E 2ZWLT 3DX7B 1S78D 3GMMB 2FO4B 4YDJA 5EU5A 5KBNC 4AEIL 1VACB 2C3WA 3BN9D 1F4HA 3M8OL 2XRAH 5C09D 1OP3H 5F7EH 2H2SD 4L8DB 4JY4A 2NNAA 3D0LA 4UIKH 1UCBL 2Y25A 5C7XH 2XACC 4CN4A 3FKUS 2A9NH 5JO5A 3DRQB 3CFDA 1HXMA 4QRRD 3QIUA 4XAKE 3QG7L 4H88H 3S8WA 2MQCA 3C6LA 4N0YL 3V6FA 5JUEL 2Q8BL 3RIAF 3P3YA 4I4WA 4AY0A 3VRJA 5I2IB 4O2EA 4PJBE 3KNBB 1XGYH 1F58H 5JOPE 1SEQL 1QBMH 3ZTNH 3NGBB 1NMCB 3CFKB 1JNLH 1A4KB 2AV7B 3TA3C 5J11C 5D7JD 4N5ED 4I48A 4HWBA 3NZ8B 3QUYC 3IU3B 1MNUL 1OGAD 1U3HC 1W72B 4L4JA 1CLCA 3GI8H 1ONQB 2K9UA 1AC0A 4X0KA 4W6XB 1ZA3A 2VXVL 1SMAA 4GAGH 1AO7E 3VFPB 3GRWL 3PWPB 4ESKA 2FJHA 4NQUA 3FOMB 4HXAH 4M62H 5CJ8A 2V7NA 1CR9L 4MX7A 1VA9A 5HYEA 5AZ2L 1UXWA 3TCLA 5JLZA 1MCSA 1Y18B 4OCRL 3VRIA 1QPPA 3TLRA 3QXAB 3ZO0A 3PWVB 5CIPH 2DQTL 5F21B 2OL3L 1WWWX 4GS7C 2Y23A 4X80L 3HC3L 1J86A 3TN0A 4Z77B 3EGSB 5CWSB 1NKRA 3QIUC 4K7FA 3ARBD 4Y5VB 5IOPB 3ET9F 3C6LC 5IV2A 3JTSA 3FO0L 4PJEF 2Z8RA 2VR9A 4JJ5B 2E9WA 5F8QC 1OD7A 4X83A 5JW3H 4KTDH 5DGQA 2UUDK 3WIIH 2R2EB 2LQRA 5BCAA 5MI0B 1QFWH 1U8OA 4L8SC 1UEMA 1X5HA 4IS6A 4WU7B 4XTRD 5EUOB 3ES6B 3SJVD 1VFBA 1U8IB 3O11B 2W0LA 3U1SH 2P7TB 1WWAX 5KAQG 1I7UB 1U8LB 4MD0A 1RZKC 1CLOL 5IMKB 3ULUL 4OGXH 4KI5F 1N3NA 1G7HA 1AP2B 1W8NA 3GBLA 1X5ZA 3HMXL 5SX5H 1KNOB 3DWTA 3DMMD 5L8JB 3TBTB 3EYUH 4ODVL 2WW8A 3E6FB 5TGBB 1AIFA 1VKXB 5HI4C 3U48A 2R2HB 4M43L 2FLBT 4JAMB 4HV8A 1ZWIB 1UCTA 1G0DA 1AHWB 5EIVA 4ZDHA 4P49A 5A2LH 4GMTL 4G6FD 4X7FC 4ZFFB 5FO8B 3LH2L 3DO7B 3FB5B 3O45B 1MQKL 1FV1A 2XQBH 5I1HL 1KPVA 4U1HA 3UPCA 5LGKA 1CXLA 4KK8D 1PG7W 3LQMA 3TN0C 3ZKXB 2IBZY 4LLMB 2VR4A 2VC2H 2YPKA 2EDFA 5IF0A 1JE6A 3OZ9L 4LIQL 3TT1H 3OR7A 1HHGB 3H7BA 3D0VB 1VADA 4LPCA 2ADFH 2YD2A 3DETD 1GYAA 1PAMA 3LIZL 4NUJB 1XEDA 2V2WA 4JDZB 3FT4A 4XVUD 1I7RB 3ARXA 1OSZA 3HC0A 3VMPA 1LVEA 4G8FB 4XMPL 3O2DL 5FCUL 3MNWB 3T0EC 3EDFA 3U30B 3G04A 1OW0C 5I76B 4PTTB 5C0BA 2ZUQB 3KLAA 4L4TE 5E94B 4YHNB 2XZAH 4NKIL 5FA3B 4HLZG 2QQLH 3KYKL 4BH7B 3SKNA 2VRAA 4HWEL 3REWB 5ETUA 3GJFH 1DVFB 3K1DA 1D7FA 4LRNL 5E8PB 4X9GA 2VXUL 5FYJH 2GYSA 2CRZA 2ZOLA 2GFBB 4LOUD 3TEUA 5B8CB 2VIRA 4U1NB 3HG1B 2MKWA 9CGTA 3UDWA 4OUUA 4XGZA 1SBSL 4J1UB 4PR5B 4QRUB 1KCLA 1UB6B 5C0EB 3EO9H 3BVNA 2R0LH 3WKNA 4J8RA 4PRPD 1I85A 4QTHB 4X4ZA 3QFJE 3QI9C 4ERSL 1NJ9B 3T4YA 1G7PB 5MEQA 2UWEF 4HKZA 2DRUA 2HA1A 2NR6D 2WLYA 2YMXH 3QUZB 5D1XB 1NGXB 1DLFH 2NPLX 2GW5A 4JY6A 4MB3A 3G5ZB 5GS1B 5DEGA 1BX2B 2LVEA 4WEBH 1L0YA 1P53A 4J6RH 1CG9A 1KPRB 1YY8A 5I75C 3DRTB 5D93B 3RPIB 5IHZA 3TFKD 1DN2A 3VMNA 5I1AB 2AK1L 1JGDA 4RGNB 4YR6B 5C9KA 1BFVH 1FLRH 5F3HA 4PJGB 4ISVB 2HFEA 4XVTH 5SWQA 5E2JA 4QRQA 4MMZC 3OG6B 1EGJL 1TZHB 2AABL 4JRYB 4JVPA 1MCOH 3V4VH 1T89A 3P4MA 3WDJA 1RZ7L 3KLSA 4CGTA 1MRCL 3BEWB 4X8JB 5C0CE 3H6JA 2DQGH 2OJEB 3I50H 1U8PB 5GGRB 5TE7L 4JZJC 1CICD 15C8H 3WLBA 3UDWC 4UV4H 5GS0D 2R1XB 1ZGLM 5LBSL 5I6XC 3MGAA 5A16B 1KEML 4FFYL 1I85C 2CUHA 3VFUA 2ZSVB 1MFEH 3RL1A 5JMOC 12E8H 3SQOH 5AWNH 2VDOH 5I73B 4F58H 3IXAB 2R4SH 3LEXA 1G9MC 1MHEA 3GB7A 1A5FL 2VNCA 5IK3B 1SM3H 1KB5A 3EOTL 5B3JF 3GDBA 3LRSA 2DLIA 4PB0L 1T1ZA 1MFBH 1EJOH 4UQ2A 4A2MA 3V4PH 3T1FA 4F7PA 2XA8H 4U6HA 5DMYA 1T2QH 4MD5B 5I1DA 1FVEB 3EZ8A 4QLRA 1DBBH 3MROB 5IMLA 3QEQD 4GW1B 3WD5H 4PTUB 1NUDA 3W2DH 1T89C 4DKDC 4M6ML 3UAJD 2FX8H 3UTTE 3X13A 4DK3A 1FO0A 1ITCA 2NXYC 1PX3A 3TBYB 1TVBA 2O5XH 1FVDB 4QF1A 1JCKA 3IFNH 1X5JA 3O3EB 2V5MA 3IYLW 5T5FH 4RMQA 5IBLD 3MXWL 4FQHB 4R8WH 3Q0HA 1M05B 3GI9L 1QA9B 2NY1C 5T3XD 1KPUA 3TO4A 3C08H 1QTYT 4U1IA 2LVCA 4KMTH 5C0AB 2R0KH 1YN7A 4M00A 5F7YC 1F3JB 3ZKNC 1SVCP 1RUKH 1KSRA 6FABH 1CGYA 1BVZA 1MFNA 4L4VD 3UYRL 2DQUL 3DNKA 4YBHA 1RZIA 1JPGA 1T1YB 4ZO8A 4YHLL 3HE7A 1IM9A 3A6CH 4RAHA 1XCTB 4UILL 5F96H 4Q58C 5CGMA 5FYKL 4PYGA 3T0EE 4Q7DA 2V2TB 2MKLC 5E2UH 5D9SA 4XZUB 2AK4A 2BP3A 1IM9D 3KDMB 1C1EL 1I8KB 1QLFA 5F3BA 3QDJA 4E42A 4XPTH 3VCLA 4CU6A 4HMDA 2ITCB 3BIKB 1DDHA 3QUKA 3RZCB 2AK4D 1A7OL 5IKCB 1BQLH 3LQAL 2X9WA 4IRJD 3S36H 1UWXK 1IT9L 3GMLA 4XHJC 4J7RA 3G5VA 3CXDH 5FA4B 1N6QH 1I4FB 5DFTA 4ORGB 3VXRA 1JF1A 3TO4C 1GSMA 4JFXA 3D85D 4R9HA 2ZNWA 1BD2B 1O7SA 3Q6GL 5IHLB 4R7NA 3W9EB 5EU6E 4XI5C 5EULV 4LLDB 4UV7L 3C6SB 4OFKA 4JFFE 4OCMC 1UADC 1PVHA 3HE7C 4LLVA 4PBWD 5LGJB 1I3GL 2UYLB 4LAQH 3ZE1F 3VH8G 3C5JA 1H5BB 3CDFA 5DC0A 4LEOA 4H25A 1A7PH 1MHPL 4R6UA 1OPGH 2GJZA 3BKCH 2JCCA 4YEFA 5D1QB 4IOFC 4Z7OF 3KR3L 1SJHA 3MZTA 1K9TA 2XTJD 2NZ9C 1E4KC 4MWFB 4EOWL 3BRGC 3WEXA 2J6EL 4UNVA 5K9QI 1F90L 2YKLH 3KPRA 3WN5C 3VG0L 3S5LB 3HPJB 1YQ2A 5J06A 3FO2B 4UINL 3DUSA 3EHBD 3DECA 3AB0B 4U1SB 3PV6B 1U8QB 1Z3GL 4K3EH 5CIPA 3ULVH 1FNEB 1Q0YL 1JZ4A 4LASH 3JUYA 2HT4C 3EYOB 5TDNA 3X17A 1KJ3L 3MRKB 3P30H 4FNLH 5IFAH 1FH5H 2J88L 4HXBL 5ANME 3KXFD 1P7HL 4Z6AT 2VLRB 5E8OB 3PWUB 4G9FB 4HC1L 3ZHDA 4PJ9A 1IARB 1KCSL 4W81A 5HHOB 1NC2A 3KPOA 5IMMB 5FGSA 4LCYB 4NZUL 1U6AL 3L7EA 1KCUL 1YUHB 4WU5B 5BO1H 1J05A 1ZEAL 1JNHA 1WICA 1ZA6A 2IALB 1AI1L 1LE5B 4PJDA 1D5IL 5MENB 4KAQL 3BZ4A 3OTTA 3OR6B 1D6EA 3BDYH 3DGGB 4ZAKD 1R5IA 3OKOA 2J12B 1EZVY 1AXIB 4OLZH 1QR1A 4JHWH 4M61A 3H42L 1QUNA 5HHMD 2VLLB 2AJZB 4JO4H 1HH6A 1QO3A 3QDGB 1P7KB 5E24E 1PYWA 4N8CH 4DGIL 1MRDH 2X70B 2BVUA 1NL0H 4OZIB 2B5IB 4JANB 1LE9B 4WUKL 3LHPH 3GHEL 1JGVL 3G5YB 4Q97A 5CJQH 3K2UL 4OLUH 4Q2ZA 1XGUB 1DLHA 4ZSOA 4H0HB 1F4WH 2EKJA 3FCTA 3S7GA 2IBGA 5CGYD 4FQLH 3L3JB 4P2QB 4PJ9C 5IGXL 3PXHA 2XKNA 3D39B 1HSAB 3SDDD 5F1NB 4AM0A 2UVEA 3CLEH 4O58H 2PR4L 4P23A 5FECA 3AS1A 4WW2F 2DYPA 4N0UE 2BSSA 4JVWA 3GBNL 3ORJA 4KHXH 3LKOA 5A2FA 2DTSA 4TTDD 4PP1D 2J8HA 3B4NA 2ZKHL 3O4LE 3CMOL 5CZKA 3O3AB 3T65B 4MJIA 2FH6A 4OV5B 3BHBA 2IQAA 3GEWB 4MNQB 4PJ5A 2VKXA 1GIGH 3OHXB 4HFWB 4F8TA 3HI5L 1RUAH 3L3OB 4NUGH 2YD4A 3IJYB 4Z7UF 3GIVB 4UT9L 1QKZH 4GG6B 1AGFA 3QO0B 1JZ6A 5C8JB 3G6DH 5LCVL 4PJ5D 1Y6MR 1T1WA 5GGVL 3T2QA 2RBLA 2XWTA 5DD1L 3T8XA 4C59B 4UU9A 1IBGL 4HFUH 5L9DH 3G6AA 3IF1A 5DFWH 4YX2L 2Z0BA 3VA6A 2F5AH 2VL5A 2IEPA 4KRNA 2F58H 3FB7A 3MFFA 4P57B 3I85A 4X5WA 3AC0A 4Y2DC 3TP4A 3WIHH 5LGHL 5MERA 4U1MA 2FCBA 3KPTA 2QSCL 5I8KH 2EYTB 2AS5M 4TYUA 4OQTL 4P23C 5KJRH 8FABB 5DMGD 3BPOB 4IRZL 1QFHA 2NX5E 3UZVB 3CDCA 2GITA 2CRYA 3DI2B 2NY2C 5HXMA 2G60H 3KLHC 3QDJE 4E5XB 5IHUH 2GJJA 4P2RB 2X89A 4NQVB 3HR5A 4I77H 1T1XA 1HIMH 4GQ9H 5DJ8A 2O61B 1PSKH 1WBXA 4I2XE 5F7MC 1X4XA 3RDTA 5GPRA 1DR9A 1RY7B 5CEXB 3FMGL 3QHFL 3TPKA 4KTEL 3P0YL 4M7JL 1K5NB 4WUUD 1YN6A 4IRSA 1LO2L 4RAUB 1JYNA 2CDEB 4QXUL 3D3VB 4UT6H 3V5KA 4NGHL 1EO5A 2EKSA 4CN6A 4X6EA 3VFSA 5DRZB 2FYYA 3TVMB 1AXTH 5D7SH 1NBZB 1WFTA 2Z9TA 4WI5A 3RDTD 4QXTA 2DMBA 1Q0XH 3GHBL 4B53A 3W5NA 1KEGL 3JUZA 5KW9L 4BQ8A 3FQRB 1H3XA 3NFNB 4U1GC 4BJLA 3ARGC 2YC1A 4PD4J 3TA3B 2OM5A 4Y8AA 1AKJD 2E8ZA 4HKXA 4NQEA 1VGKB 3QNZA 3MJ9H 5FHAL 3QUYB 4RISL 3BKJH 2JCCE 1XF2A 5JZ7C 2PXYD 2OR9L 1Z5LA 5C09B 2DTML 2C3VB 1NCAL 4MDIB 2QR0A 2VLKA 4LF3A 1IEHA 1FDLH 1R24A 3GIZH 3WLWC 2MNUA 5EU5B 3O6KH 4MJ6B 4GKSA 2VZ3A 4WFGE 3QWQB 2VR5A 4L9LA 3SDCA 3FOLA 1DEDA 4KKLD 5DUML 5C2BH 5CMAB 4O51B 4G6MH 4JY4B 2NNAB 5CP7A 2PO6A 1IAIM 1BAFH 1BVLA 5IBTH 4JKMA 3O3UN 5JO5B 5JOFA 4ONHB 5JA8B 3GK8L 4IRSC 1KENL 5DUPH 4BFIA 2NY6D 4RFOH 5D7JB 3GM0A 5F7FA 1LEIA 2P5WA 3DXAA 1D3CA 3WS3A 1CFVL 4O2EB 4AIOA 3UMTA 3ZTJG 1OGAB 1CBVL 1UXSB 3T0BA 2DKUA 1M71B 4QHLA 4HPYH 1W0WB 2D7NA 2ITDA 4KPHL 4DVBA 1HHKB 4UBDD 1WIOA 1ZLUH 3BMWA 1F3DJ 4MA3A 1IAIL 4JZOA 2YXMA 1RUMH 4Y1AA 1QSVA 2DKMA 3JV5A 4URTB 1C5BL 4U1LB 3OV6A 2D0HA 4OZGF 2B2XH 3SDCC 1HQ4A 3ARBB 1FAIL 1MCKA 2P49B 3VRIB 1XGTA 1N0LA 4ZFGL 1ZHBA 4NWTH 3A0OA 1A21A 1K8IA 1RIHL 2PO6C 4KY1H 4IDJH 3DIFB 5D6DA 5DHVB 5I1IL 1HOCA 1X5XA 4KK6C 5T5NG 4PJFF 4K7FB 2EH7H 4P5TA 5DJZB 3LDBC 1T03H 1CN4A 2I5YL 4XWGL 5CSGA 4X7DC 5EU4A 1X44A 3JTSB 4H26B 3RHWK 3SJVB 3HAEH 5GRUL 5ADOH 2X4PA 3DHJA 4MB5A 4RFEA 2P47B 1S8DB 1K2DA 4KVNL 5AAMA 5ESAA 1FG2A 5DK0A 3SKJH 2J2ZA 4Y4FA 4CMMB 4IS6B 1Q8MA 5M94B 4LSRH 3FFCD 1J1OH 1VFBB 4QO1A 4U05A 3OB0K 4KK9D 4PRHA 5FYJE 2GK2A 3HUJB 4NOFA 4R4NC 4JRXA 4HBCL 4G6FB 1N3NB 3V0AC 5LQBH 4MJIE 4HMCA 3VFTA 5BJTB 4YC2B 4U0QB 3QWRA 3QCVL 4JPKL 1AIFB 1JTTA 2D7QA 4S0SD 1RIUL 1LO5B 4ZDHB 3LN9A 4IEFB 5GGSA 1YMMA 2D7PA 1WEJL 1P2CA 2Y6SD 1D5BB 3GSOB 5IJVA 2A73A 4QRPD 1KPVB 4FQ1H 5D6DC 4OI8A 1BEYL 3BXNB 2YPKB 1R5VA 3IRPX 4P5TC 5IF0B 3H7BB 1VADB 1CL7L 1IAMA 5J0BA 4ELMF 4U7SA 2V2WB 2JB5L 4ZNEA 2J8UE 3DARA 1MCDA 5TDOA 3HC0B 1LILA 1OSZB 3VXTA 5DR5H 5FOJA 2O5YH 3CVIL 3HHRB 2F8XC 4YDLB 5C0BB 2X10A 3BQUA 4Z7VB 2Z92B 3SKUD 1MAJA 3SKNB 5KOVC 4PJ8D 1CVRA 2HLFC 5ETUB 1F00I 1WK0A 2ZOLB 1KG0A 3AU1A 4XAKD 3TH3T 2A77H 4GSDH 3CCHA 1ED3B 5JHLL 3MLVH 4JFQA 1LO0L 4M7LH 3ULVC 4XNXH 2H2PC 5K9QG 4JHAH 4OUUB 3D2UD 4GRLD 1UB5B 1V7ML 3BVNB 4J8RB 4XVSL 2BRRL 4Z8FL 1FJ1A 5I17A 4I9WE 3T4YB 5MEQB 4MAYD 43C9A 4DAGL 1EHLL 3FQNA 3RKPA 5GGVY 1CD1A 5EOQL 1YJDH 4DZBA 1XR9B 5C71A 1L7IH 4KMQA 2E9JA 1D6VL 1D9KA 4JN1L 4OB5L 1AO7D 5F7NC 1TJGH 1JYVA 4P4KA 3QXVA 1WQVT 2GEEA 4Q9RL 1JGDB 3LSOA 1G7IA 5KZCB 5F3HB 3O3BA 3VFOA 4CVUA 5SWQB 1X6NA 1Q72H 4QRQB 3BQUC 1CICB 1BMGA 4EI5D 5JTWA 3O6LH 2NLJA 3P4MB 4G8GA 4RFNB 4DUXA 2VLKE 3Q6FB 5HGHA 7FABH 4R3SA 4YDKH 3U4BH 3QEHA 1BJ1J 5JW4M 4BKLB 4Z76A 2ICES 3VW3H 2HFGH 2NW3A 3SGJC 4XP6L 2ARJA 1MPAH 5BRZA 1PBYA 4L5FH 1UKSA 2NY1B 1WWBX 3SY0A 3VFUB 2GAZA 3TJEL 1FFOA 2IANE 1U2CA 3BT2H 3QUMB 3RL2A 2LAGB 3CFBA 1U8JB 5IROA 3ZE0E 3GB7B 4WTWA 4RBPK 2P5WE 3VFVA 3BPLB 1KB5B 4F15C 2QSTA 3WIHA 1NLBH 5D2LF 5DRWB 1A6VL 1RZFL 1JRHL 1T1ZB 3MO1A 4UQ2B 2QSVA 2IFGA 3HPLA 5SWZD 5E6ZA 1BBDH 4P4KC 3T1FB 3V2AR 1MJ7L 1ZANL 5D96C 4U6HB 2VZ1A 2BDNH 2QSQA 4LSVL 2HN7A 1VDGA 2VDQL 1RIVH 4OCYL 4S10A 4WO4A 3LVEA 1QLRA 1RFDH 4YBQD 2EDQA 4E41D 5IMLB 4A6YH 2YN3A 3WFDH 3HR6A 3ZHKA 4KDWA 5ICYB 3RTQD 1E6JL 2XI9A 4QKXB 3MLRL 3DSNA 3T3PF 5HHXH 3K0WA 1JPTL 2X7LA 1FO0B 3OJVC 3OAUL 1TVBB 4L4VB 4JDTH 4QF1B 2E6JA 4QHNB 5D7LA 4NNPH 1KPUB 5H2BB 4DN4H 1GGIL 2ZJSH 4KROC 4ZUWA 3NIDE 2OTWB 2BXZA 3HMWH 3U0PA 4Z7NE 5D7LD 1JPGB 1IC7L 4I1NB 1LK2B 4TVPL 2BSED 1IM9B 3RQ3A 3KPLA 1EFXA 1IFHL 4APQA 3MJ9A 4F57L 2I9TB 4FP8H 1ROWA 3OPZH 1EHNA 5FYLL 1J0JA 4ODTL 3RHWF 2O5ZL 2ID5A 1CLZH 4W4NA 1MJ8L 3F62A 2M1KA 2AK4B 4ZD3H 3H9YA 3MLXL 3PQYA 4M48H 4WO4C 5L88H 2YHGA 4APQD 1EFXD 2H3NB 1QLFB 4IRJB 3A67H 2NY7H 3GUTB 3LRHA 4JRXE 4OJFH 3U9PL 1DDHB 3X14A 3B2VL 3R8BB 1BWMA 2WAHA 2WANA 4RMTA 4UDUA 5ICXB 3V5DB 3RWDB 2FBOJ 3ULVE 3D85B 4R97C 4TRPH 4Y88A 3EOYG 4O9HL 4Z7QF 1EMTL 5F1IA 4IBLT 2EYRA 3GMLB 4M6OH 5DMIL 4CVXA 4M7KH 1NDGB 3G5VB 4XMKL 4D3CH 1MY5A 3VXRB 5EIIA 4UAOB 3V9FA 3GMPB 5JPNA 4JFXB 1AFVH 1MCPL 4PS4L 5A2JH 3F8UB 1Q9OA 4R7NB 2FL5A 1U3HD 4RRPG 4XBGA 2R69L 4GRMA 5BV7H 1R6VA 5CD3A 1A6ZA 4MQXC 5C0CD 5IVXE 4HLZH 4Z7WE 1X5GA 4OCSL 4LEOB 3K1KC 1OARL 1KBGL 2NYYD 3B6SA 4XBEH 2GJZB 3IT8D 5DLML 3AVEA 3ARRA 2HG5A 4G3YH 5CHNA 1A6UL 4KJQD 2WINB 1SJHB 1N59A 3QCTH 4R4FL 3PL6A 3GBMH 4R7DA 2BOCA 4XNQB 4YHOH 5FV2A 5I16A 4P2CG 2VXQL 3KPRB 1K85A 4WWKC 2IPTL 3DVIA 3OKMA 3DUSB 4PV9A 4FTVA 4ZUSB 2FECI 5EC1A 3TNNB 3X3FL 4O00A 2E27L 4OLEA 1QSZA 3FO9A 1GZPA 3KXFB 4QEGA 5E9DE 3DROB 5DMJB 2OX5A 5DDHA 2XA3A 4G6JH 3QH3A 2A9ML 4LPTA 3MREA 5FUZH 4FTVD 2AV1B 2VXSL 4M4RA 1MEXH 4MHHG 3G5XA 5TQ2H 2DI7A 3RA7L 3RU8L 2H26A 2W0PA 4X6CE 3OJDA 2BSTA 1S7UA 3ARFC 2MHAA 5BVJB 1KXVC 5J4MA 1FGNL 3MRLB 3L7EB 1DFBL 1HKFA 3UTTD 1ZVSA 3MJ8A 4HK3J 4X6DB 3KYOA 1JNHB 4ZAKB 3P4LA 3GSVB 4OGAD 3PWJB 2FBJL 4ZOAA 5HI4D 3UBXA 1MWAB 1QRNE 1SEBB 1NUNB 1SY6H 1CVSC 5HHMB 3MSPA 4WI7A 3TWCL 2C1OA 2XN9E 3BZ4B 2Q8AL 3PL6C 1BIIA 1D6EB 5I18L 4O02L 4V1DE 3MNZB 4C57C 4G8GE 2FHCA 3OKOB 3D69A 1QR1B 3FB6A 4M61B 2WUCH 3BH8A 1HEZB 3MBED 3KYAA 2DBJA 1XZ0A 3DV4A 4FMKA 1A14L 3NA9H 3FT2A 4B7LA 4X4YB 3CPLA 2YSSB 4NM4L 1J5OH 2I24N 5I0ZA 2G5RA 5BRZE 3QRGH 3IDXL 2VLJA 4PJXF 2Z35A 3SDDB 4BH8B 3T0ED 3MNVB 2E8YA 1ZHKA 2CLRA 3MLUL 4PP2A 4HS3A 5A40E 5E95B 5CJOL 3S5LG 4Q2ZB 3QHTC 4ZSOB 4YXKL 5CBEA 3PP4L 4F33B 4Y16D 2A83B 2XKNB 1HHJA 3UO1H 4NT6A 4FQCH 1U91A 4YUEH 3UTQA 5FECB 3MV7D 5CJBA 3FHAA 1P7QD 1TQBB 3MLWH 1EERB 2BSSB 3LKOB 1FZMA 1F6AB 2IPUG 1VGEL 3OJMB 3QI9D 1B4RA 3WO4B 3G9AB 3TV3H 4LLUA 5FO9B 3LKRB 3WFEL 4M03A 3BHBB 2IQAB 2C5DC 5I30H 3QG6B 4PJ5B 4MA8H 4LLWB 1B4JL 3D18A 3WSQL 5EU6D 2W65A 1FE8H 3FAXA 1AGDA 4NQCE 3KPSD 4JFFD 2C4FU 1AGFB 1UFUA 5IMOA 1L4IA 2XG4A 3O9WC 5C86A 3EYVA 3UJIH 5EC2A 2P5EA 3VE0A 1R3KA 3Q5OA 1OL0A 2A6JA 3E8UH 3G6AB 3IF1B 3MCLH 4JFEA 1WBYB 2HKFL 2X4QA 4NO0A 1YPZE 5FHBH 4NJAL 4LVNB 3MFFB 2B4CL 1KF9B 4CADA 3MZGB 5I1KL 4XPAL 2PNDA 4FXLA 5MERB 1KN4L 4U1MB 5JMRA 1A6AA 3IFLH 5JW5B 2FSEB 4ZQKA 4F7MA 5DZLA 2AW2A 2GITB 1C5CH 3SO3C 2VITB 2E7LA 3BJ91 5EU3A 1X5KA 4WUUB 3KS0J 1CFTB 3HR5B 1T1XB 3NN8A 1BOGB 5IB5A 4XAWL 1CS6A 3VFMA 3B8SA 2QQNL 1WBXB 3IDYB 4NWUH 1N0XH 1UKTA 4HWZB 3RDTB 1EO8H 3R0MA 1WFUA 2A1WL 2GTWA 4LDLB 1ZT7A 2RB8A 1YN6B 1AJ7H 4FQXA 3WDIA 3V5KB 4X6BA 1JPFA 1YJDC 2VDNH 3P9LB 3VFSB 4FFZL 4OD1L 5FGBA 5F7UA 3RWJA 5BVPH 5ISZD 5IQ9B 4N9GB 5TH2A 4BZ2H 3B9KC 4L29A 2BXYA 5FXCH 4JQIL 4NQEB 4ALAL 3NCYP 1XF5B 2PCPB 5E8DH 4PJ7B 3MRGA 2PW2A 4GBXC 1FGVH 3SE9L 3IJSB 2QR0B 4LF3B 4P9MH 5DK2A 1A2YA 1BZ7B 1R24B 4XC3H 3WIFB 3L3IA 5J6GA 3C8DA 3SDXE 2UVFA 2VDKL 2XKUA 4L9LB 4NN6C 3SDCB 3FOLB 4C55A 1E4XL 2OJZL 1E27A 2ADGA 5ADPH 4HGWA 3GRWA 2NY6B 1OSPH 5FV1L 2ESVE 1F4YL 4JM2D 3O2VH 1IC1A 4NN5B 5CP7B 4M1DH 4LL9A 1X5IA 1BVLB 1QOKA 3DSFL 5JOFB 4JGMA 4NZTL 3ZYOA 1OAKL 5IFHL 4FQXC 3IDNA 3QXDA 4BFIB 1GAFH 4MD4B 1LEIB 2Y36L 2X41A 3WS3B 4UT7L 3Q1SH 4JFDD 4PY8J 4C54A 3EFDH 3U2SA 5HYSB 4W4OA 3CSPA 4NOBA 1EEYB 1Q9WA 5HGBA 5DJ0A 4UOJA 1PG7X 4IM8A 2VWEC 5KVFL 1FFPB 4OF5A 2C3HA 3GSNB 4JY5L 1RZJL 1VFUA 4RQQA 1JHLH 4K71B 5J8OA 5BXFA 4NKOB 1OGTA 5FKAA 1OAZH 4Y1AB 1YEJL 4PGEA 3GMRA 3GJEA 1JK8B 5FUCC 4G9DA 1NCDL 2ZNXA 5DQDH 3PIQB 1RAMA 3BP4A 4HIIA 3BKMH 5I1LB 3IETA 1HQ4B 4JZNA 4M1GL 5GGQH 5HYQB 2FATL 3BE1L 1KGCD 1HYRC 1F2QA 4NFCA 5I1JH 4QGTA 2LU4A 4MYWB 4EXPX 4XNZC 4YNYA 2Y07L 3LKNA 1K8IB 2GI7A 2A0LC 4KQ3H 2XWJA 1WZMA 3NTCL 1WAAF 5E08L 1HOCB 4MXVF 3ULUD 2CMRL 2VLJE 1DN0A 5DS8A 2BK8A 5GJSH 4IOFD 1B0GA 3DYOA 5EU4B 1TTFA 4ZS6C 2NX5D 5EOTA 2APVA 1BECA 3JV0A 3RNQA 5D2NB 1K2DB 1FL6B 2CJUL 3U36A 3CSYB 5ESAB 1VFOA 1FG2B 1GGCH 4S1RL 4XP9H 4LVEA 4Y4FB 4P48A 4PJCE 3QIWD 4JGJA 1Y6NR 2DLFL 1GGTA 5I8CA 1IKFH 2VAJA 4OCXH 2O93L 2H8PA 5FM5O 1I9IL 2FGZA 1P4IH 3O2DA 4ENED 4IOIA 1NH6A 1MRFH 4JG1H 4M5ZL 2IBBA 4GRWH 3MBXL 4DTGH 2EDDA 1AY1H 2VXTL 3AUVA 4GUPA 3SDYL 3UTSE 4PV8A 4YGVA 5TF1L 4DUWA 2YD8A 4UDTA 1I8MA 3UTPE 3ZT5A 3AS3A 3VGAB 1EK3A 2ADJA 1P2CB 1MI5A 4LSTH 2A73B 5HHVH 4JPVL 2WQRA 4TVPE 1H3PL 3ECBA 1CQYA 3VFGH 3QQ9D 5BV7C 3P0VH 2P5EE 3CK0H 4H8WH 4QHMA 5D7KD 3EDDA 1ZAGA 4N1CA 4HS6A 4PJ8B 4AENA 1RK1A 2NW2B 4U1KA 2APFA 5DF0A 3H3PH 4FQQA 2P8MB 1SY6A 3KJ6L 3TT3L 5B3NA 5IVOA 2I9LB 4K9EL 3MUZ1 3MACL 1NCBH 2BNQE 3U79A 4AEFA 4D9QD 3AMLA 2H32H 5DK3A 4G8EB 4M02A 3D2UB 3V52L 4GRLB 2FECL 4FA8A 4ONGL 2CGRH 3SKMA 1KG0B 1EGJA 3BIAX 1WZ1L 4GAJH 3P11L 1NCTA 4JFQB 1FN4B 1MIML 2CRIA 2EDKA 4RIRA 2AJYL 3UTZB 4HUVA 4L1DA 1RZ8A 4R0LC 1SYVA 2KL6A 4X9HA 2VJXA 3RVUD 3F7VA 4DEPC 4YDIL 1IGCH 4WV1A 1FJ1B 5I17B 4XCNA 1BREA 5C08A 1EHAA 3RZWA 4QOKD 2GJ6E 4YHYC 1N8ZA 3TPUA 2R2BA 3QJFA 3PG2A 43C9B 3FQNB 1QP1A 1CD1B 4AYFA 2IWGA 4DZBB 4G42A 2CIKB 2ICWI 4F7TB 2GSGB 1D9KB 3BDXA 5IWLC 2AVGA 4ODXB 4EEEA 3BWAA 5HD8C 4MA1C 4EDXA 4EI5B 1R3JA 4X7TA 4P4KB 1G9NH 2DLHA 2YUWA 1UA6L 4YHKL 1TZIB 2VWEE 1G7IB 1FORL 1SJEA 2Y1VA 1TPXC 3HRZB 2A6KB 3LEYL 1H3GA 2XFXB 4WVRA 3SQBA 2W60B 3VDCA 4PGCA 2NLJB 1WT5A 3BGAA 2D2OA 3ARTA 5FUCE 3WHXA 4NZDA 2B1AH 4PREA 4NQDA 4DGYH 4FS0A 5DHXB 3QEHB 3TBVA 2VL4A 4Z76B 2LV4A 1A64A 3N1PC 4PJBF 3WXVH 5K9JH 1KB9J 1UM6H 3MOAL 1Q1JH 2ARJB 4AEHL 2AXGB 2APXA 2OR7A 3PWLA 5DT1L 5C2UB 2HWZL 5LVEA 2B0SL 3BAEL 3R0NA 4DKEH 1UJTA 5HTSA 3U4EB 2GK0A 1RULL 3FRUA 4RA3A 3SY0B 5KOMC 2GAZB 1B6UA 2YWYA 2IAMC 1FFOB 1A3LH 3NZHL 3RL2B 3VD5A 3RVVC 3CFBB 4C4KT 1EJ6A 4M9OA 2NTFA 3ZTJH 4HUUA 2YUZA 5D5MA 5SWZB 5E2VH 4M9PA 4XMLL 5CEZH 4OGYH 5FYJD 3THMH 1AGBA 5GGTL 3NH7H 2NY2D 4N90D 3UX9B 3ARWA 4E41B 4F2MA 4K55A 1NGYA 1NFKA 2IMNA 3PHQA 4YHZH 1PZ5A 4MXWH 1LQSR 3MO1B 4NHCH 3HPLB 4ODHH 1OB1A 1AXSB 4DQOL 3IKCA 5C6TH 5DD3L 4BUGA 1G6RL 1KJ2H 2HN7B 5LKNA 1QLRB 3PNWA 2IH1B 4GMSL 4PJIB 1ZLSL 3K80A 3U46A 4HIXH 3IDMA 1NAMH 1WT5C 2J5LB 3N85L 4R97B 5KVDH 4OLXL 1V7NH 3DBXB 3MOQA 2W0FA 3VWJA 1CFSA 3HZMA 3T4AB 3TF7C 1PG7L 4JPWH 5D7LB 4KC3B 3QQ3A 1FYTD 3P77A 1QG3A 3BSZH 4YE4L 4NJ9H 1J0ZA 2XOTA 4PRDA 1MFDH 2R9HC 3VH8A 3K8MA 5C0NC 4PUBL 1CFQB 4P59L 1TJHH 3P4NA 2XZQH 1CE1L 4LP4A 5GS2H 2Z8VC 3KPLB 1EFXB 4Y5YA 4APQB 3WLWD 2ENSA 1JV5A 2ZUVA 3FB8B 4TOYH 2N4IA 2C3GA 2JIXA 4YFLI 2QHLA 1UH3A 5BMFH 4MCYA 5HJ3B 1LK3L 5KSBA 1IJ9A 1RMFL 4LPYA 1GC1H 2W9DH 2OBGA 3VG9C 4WFHE 5HVWA 4AK1A 4GG6F 2J1KA 4KQ4H 4I9WD 2K3TA 3BD5A 3BI9X 2CKBL 4TUJA 4Y19E 2X05A 4DK6A 4UB0L 2AEPL 2R0ZH 3B9AA 5GRJL 4UDUB 3B83A 1I9RL 3EOBA 1A3RH 2HVJA 2Q86A 1W72H 4G5ZH 4OFDA 4HW6A 3P2TA 5I1CL 5F1IB 4JO2L 3VWJC 1XGPB 4XC1L 1KLUA 3TO2A 1GVIA 4X5XA 5D7IF 1A8JH 5DD0H 2ZCHH 1MI5E 5EIIB 1CU4L 3U7WL 5L2KE 2VTFA 3V6ZA 2FL5B 1CK0H 2AXHA 2CK0H 3WL9A 4XBGB 3HCVA 3STLA 3LZFH 4QHUB 1Z6JT 3CH8A 4CDHA 1A6ZB 4G7VH 3K8KA 3JVGA 1UWEL 5AYUL 5J56B 4HC1A 1TLKA 3O8XC 1KUMA 4CNIA 4KRPD 2ATKA 5HGDA 5HVHC 1NCWL 1C7SA 2VDMH 5CHNB 4TN9A 4WHYG 2JJTA 1C12B 2QV2A 3T2NL 4FXKB 2IAND 4R7DB 1EVUA 3SOBL 3CNKA 1RVFH 2PYEA 1A6TA 4OCLC 4MS8D 3EFFA 4AQOA 4PV9B 4IJ3C 4FTVB 3EOAB 3O6FC 4L8CA 1QSEA 4WGWB 1IGTA 1F3DH 1INDL 3L6FB 3UJTH 4PJAA 3MREB 2XXMB 5DJYB 5TQ0H 3V95A 4LLYB 3ARYA 5ID0A 3ARZA 4BSWA 1TJIH 3EJYC 4ZPVB 5IB4A 1KC5L 3OJDB 3K2MC 1YZZA 2BSTB 3MUJA 2OYPA 3K74B 2Y9RT 3NCBB 3WMSA 2F19H 4FABL 1HI6B 4G7YL 1ZVSB 3MJ8B 4AIZB 1JGLH 4PG9A 3NPSC 3KYOB 4P46A 3EYFA 1HDMA 3KPPA 4NKMB 3PABA 5IQ7H 2F8VA 3S3PA 4OIIH 1LDPH 3L3GA 2CLZA 2C1OB 3LMJH 3V8CA 1BIIB 3H2WA 4U4BA 1ES0B 1AD0A 1H15A 1QNZH 2RCSL 2Y5EA 3QIBD 1QQDA 1E6OL 1X5AA 2Q76B 4P46D 3D69B 2V5SA 3FB6B 4NQDE 3LKQA 1XZ0B 3JWDH 1BQHB 2PKDA 3FT2B 1CE6B 1JNNL 5DRNB 4OQ1A 1HNFA 3G08B 3WXWL 5DTFB 4DKAA 4EI6B 2A6DB 1LP9E 1A7QL 5DVOA 1QBLH 4PP2B 3MV7B 2GY7B 1REIA 2HLFD 5F8RC 1P7QB 5CGTA 5B38G 1YMHA 3TJEH 3BWUC 3I6KA 5EORL 3L9RA 3B9DA 4ZXBD 1HHJB 2ZPKH 3ALXA 2R23A 3ESUF 4NT6B 4LKXB 1MELA 2YPVL 3LKPA 2RHEA 4C56A 3JWNC 4HZLA 3OAYK 5IW3A 2H32A 3ARDC 3SHSA 4OLWH 1CXFA 5CP3A 1K4CA 5BOZG 4NKDA 5SWSE 4Y5XB 4HHAB 3ZDXE 2BX5A 3S88H 4NC2B 1JHTA 3KPSB 1FZMB 3NVQA 4WFED 5GRZA 4LCWA 4LLUB 1M7DA 1N64L 1QD0A 4QXGH 4PJFE 3GKWH 1DJSA 1FFQA 5J1TC 2DMCA 4OBSA 3SGDI 1IKNC 2VH5L 1A4JB 1Z9MA 1KYOJ 3D18B 4J3OC 4PJHB 4AEEA 4KZDH 2W65B 2YEZA 1AGDB 1H0DA 2QADB 5KN5A 1J8HE 3ROOA 2OP4H 4WTXA 3PP3H 4YWGH 4LCIL 3AM8A 1KCKA 3H3BC 2BVOA 4YHPB 1U2HA 5E7BA 2N7BA 5F7DA 3VE0B 4K3JH 2XV6B 4H8WC 4I3SL 1OP3K 1G7JA 4JFEB 3CDGA 1VFMA 3GMQB 1OTSD 3QUXC 3BISA 2D7TH 2R29H 4NO0B 5GSRA 5TJWK 4CADB 4XP5L 3FONA 4KUCF 1MIEL 4KJPD 3IAQA 1JHKH 3HB3C 4HKBB 5F9OL 1A6AB 3NABL 4LEXH 5KSBE 1C08B 1F6LL 3WFHB 2AJUL 4NO5B 5DQJA 3MLTA 3C09C 4G6KH 4HZAA 5EU3B 2CKNA 4OZFG 1NMAL 5SX4I 4F7CA 1CD0A 4U7KA 3VFMB 5CJXA 2ZUTA 4ETQA 4MXQD 2R8SH 3HS0A 5ISZB 3MGOA 4YDVA 1F02I 2R56L 4X6BB 2D9CA 1JPFB 4LFHD 4WGVB 3QB7C 4KKAC 1QRND 1BJ1H 2DM3A 1TMCB 2FRGP 2XN9D 3C5ZC 2W91A 3VXMA 1G9NC 4RZCA 4V1DD 4L29B 3VGGA 4AL8H 3C60A 4LCCA 1TVHB 3GGWB 2WZPD 3MRGB 1L7TL 2CO7B 2PW2B 3C2AL 1T7WA 3DYPA 3WFCH 1NAMA 4NO2A 1UJ3C 3B9VA 4JM2B 2QJDA 3MRRA 1RSFA 5DK2B 1A2YB 3L3IB 5J6GB 3TYGH 4UTBH 4KROD 2PYEE 2DN7A 3QNYA 4LSDA 3CMGA 3GMMA 4XNZB 1XMWA 2WUBH 4JFDB 1L6XA 2V5YA 5KS9B 3L5WA 1A02N 3VFWA 5CILL 5SX5K 4FQ2L 4YGAB 5EO0A 4L8DA 4YBLB 1BFSA 4CW1A 4PGJA 5HDLA 4M93B 3DRQA 4L3EA 3U2SB 3W0WE 4FZ8H 1FZKB 3BP7B 1Q9WB 4XB7A 5HGBB 3FZUD 1LD9A 4KXZI 3C60C 3RGVA 4I18A 3KNBA 1BJMA 4LCCC 2XY1A 1CDBA 4RQQB 4KHTH 5BXFB 1OGTB 1UM5H 4GRWE 4S1SL 2RIKA 4HBQA 4G9DB 2G9HB 4J3XA 3NZ8A 3QPXH 1CGSH 5FB8A 5J12B 3BP4B 1G7QA 5DURD 1ZTXH 3IETB 1INQB 3EZJB 1YA5A 1SHMA 5D2LE 2WBJD 1A0QH 3H9SE 4KI5D 5ALCH 1HK6A 3PWPA 3GJFK 2N56A 5DVMA 3FOMA 4YNYB 2WWMC 5CUSH 5E8NB 4U3CA 4H20H 4MQXD 1UH4A 2XT1B 3QXAA 5DS8B 3WCYA 3PWVA 3QIWB 5BV7B 3LB6C 1KCRL 2M8XA 5EOTB 2Y5TA 1B2WL 2DD8L 5I71C 1T22A 3SCMD 3RVXC 5KVGL 5CWSA 1CF8L 1EEUA 2J3SA 5IOPA 1DQLL 2OXGA 1CZ8H 1AC6A 1T2JA 4WWKD 4XT1C 4C4KO 4LLAA 2LAAA 3N9GH 4JJ5A 5C6PB 1S7SA 4MA7L 1GC1C 3U0TB 4C56E 4HT1H 2R2EA 3LS5H 3SE8H 4IOIB 3ARVA 1J8KA 1U8NA 5CKGA 5DEFA 1KXTB 3ES6A 2GKIA 5B4MD 2DBLH 4GUPB 3V0VB 5IBUG 5HYSG 2P7TA 2MWCA 2X1WL 4KKCD 4YGVB 3VI3E 3DUHA 4GKNA 1I7UA 4UDTB 5SV3A 1I8MB 4W6YB 3VXPA 5IMKA 1AQKL 5KTEH 1EO7A 3SE4A 4AMKH 1CD8A 2I60L 4XPGH 2OR8A 4HGMA 4OD3L 2ADJB 3ARFD 5F9AC 4D9LL 3VXUD 2UWEA 5C1MB 5C9JB 3MUGB 1X3DA 1L0XA 3TBTA 3SGEI 3VWKD 1FNSL 5E0QA 4PFEA 2R2HA 5CZXD 3PDDA 1PX4A 3N1QC 2R4RH 1ZHLB 3ECBB 1DEEA 2JJSA 3UC0L 1A7NL 3DO7A 3FB5A 3N1FC 3O45A 3KVQA 4OLVH 4HS6B 3MRJB 4K94H 3S37H 4P5MB 4AENB 3S3JA 1RK1B 1NBVL 1YQVH 2X4OA 1IEAA 1KYOK 1HE7A 1DQML 4Y5VC 2F5BL 3CX5K 1JVKA 3KYNB 8CGTA 3PDOA 1HHGA 3D0VA 4FQQB 4S1DD 4Z7QE 4NUJA 3RVTC 3CLFL 3S34L 4JDZA 1YY9C 2ESVD 3CVHL 4TULH 1ZGLP 4E9LA 5J13C 4G8FA 4LQFL 3B43A 5MI0C 5E99L 5I76A 4JFZL 1T7VA 5E94A 1FVCA 3DI3B 3QPQD 5FM5M 4ELKA 4QOKB 3CFIC 4BH7A 4CU7A 3REWA 1EDQA 5CKAA 4XNUL 5T1LA 2EDOA 4RIRB 1DVFA 5E8PA 2IJ0C 5AG8A 4ONOA 4HQQL 3ZL4L 4QGYA 4ACPA 2BNRA 2W9EH 2GFBA 4LPWA 3WKML 1HYSC 4WV1B 3HG1A 1MVFA 3OF6D 5C08B 4D2NA 1HZHL 1UACL 5E00A 4QHKJ 3TPUB 2R2BB 4HJ0D 2ARJQ 2G2RA 2MCG1 3QFDB 1GPOH 5C0EA 1UYWH 4KDTA 2DM4A 4K3HA 2JCCF 4W70A 5CEZE 1FRGL 4G42B 1AHWC 1T80A 5MP6H 3CDYA 4IIQB 5D72L 4KKNA 5FK9B 2GIYA 2YPLD 4H5SA 5D1XA 3WO3B 1R3JB 4X7TB 3ZKXC 3VXME 3B2UD 3G5ZA 4FFVC 3MLPA 2DQHH 1PKQB 1WC7A 4AG4L 3VFNB 1RZGB 1UEYA 3RP1A 1R3LA 2HT3D 4LSPL 3SDAA 5BW7A 3QJHB 4YXHH 1YEIH 3L3KA 4CKVX 1ZGLB 4PJGA 4ISVA 3WHXB 3U30C 3W39A 4PREB 4WHTA 3O9WD 2GUOB 3U0WL 5HYJE 4JM4H 1DZBA 3KG5A 1CQKA 1TZHA 2HFTA 2UZYB 3C9NB 2PETA 2VUOA 3JWDC 3F7PC 1DVFC 5JXEA 4X8JA 5B8CC 1PLGH 4BM7A 4DKFH 2GK0B 2OJEA 3K4DA 4U6VH 5GGRA 1U8PA 2E3VA 3LKSB 1IGIL 5E6ID 3SE3C 5I74B 2LTQB 4HUUB 5D5MB 1DBKL 3KJ4B 4G43B 4GLRH 5JXED 1A6WL 4PJDF 3I3DA 5F7WC 3MA9H 1GH7A 1S9XB 5FCSH 5A3IC 2DM7A 1BM3L 1HINL 4F2MB 1OAKH 1NGYB 3IXAA 2X44D 4HCRL 1PZ5B 3QUZC 5D1XC 3UTSD 3GO1H 4DN3L 4RGMB 5GS1C 4QXWA 1MCHA 5MHSE 1EUUA 5DZOA 1YYML 3KWWA 4BSVA 1BGXL 3PNWB 3H8NA 5CINH 3HZYA 2C3XA 1GOFA 4KUZH 5TPWH 3RJQB 2V9TA 5D93C 2BHZA 5BW7C 5L6YL 1NSNL 2HTKC 3U46B 1MFCH 4RGNC 4TVPD 4FFWD 2Z8WC 1FYTB 3RWHA 1FVEA 3HNSH 3WFZA 1HXYA 5IB3B 2ORBL 5FYLD 4GW1A 1G9EA 5DO2C 2DQIL 2AEQL 3HE6D 1P1ZB 2BFVH 3NFSH 2BJMH 3Q3GA 3HZMB 5GISH 1ZMYA 4RRPA 2E5EA 3QQ3B 3PWPE 3B9KD 3P77B 2FDBP 5K59E 3ZT7A 4LHQB 2G75A 5JR1L 3TBYA 5FDYA 3WV0A 1CFBA 5AZEH 4HJJH 4PRDB 2ED8A 4IMKA 3VH8B 4CUCA 2DM2A 3INUL 2BNQD 3KS0H 4YIQA 4ZFOL 4FQHA 2DQDH 2EYSB 2WK2A 3P4NB 5C0AA 1MSPA 2ZCKL 1F3JA 4JB9L 3IU4L 1BQUA 1JPSL 4Y5YB 4OTXL 5I73C 5GGUB 1JBJA 5I19H 4FHBD 4NPYA 3I84A 4MCYB 5HVHB 4HUXA 2Y7QB 3L5XL 1J0KA 1RJZA 1XCTA 1TIUA 3LS4L 5J1AB 3DJ9A 4RWYL 3FQWA 4WFFE 2EC9U 4GW4A 3RUGB 5C0FA 2V2TA 4TUJB 3UTOA 2DLFH 2D7MA 3NAAH 5EUOE 4XZUA 3U6RB 1KCVH 1YEGL 3ALPA 4OUOA 3KDMA 3QHZH 1IC5L 5F6IB 2VN7A 2JK5A 2HVJB 2Q86B 4YHIA 2FD6H 5D70L 3CZJA 2ITCA 3GKZA 2NXZC 4F9PA 4X98B 1JYXA 1RURL 1KLUB 3TO2B 2FHBA 4X5XB 2EIBA 5GSVB 4M7LT 2A74A 5IKCA 1GL4B 4J4PA 4WCYL 4V2BA 3V6ZB 1P84J 1HHIA 1S3KH 4LSQH 4KRPB 4HS8H 1JWSA 3WL9B 3I6LE 3HCVB 3MV9A 5FA4A 5DJDB 2V17L 1I4FA 5C0RH 4CMHB 1MFAL 1MY7A 1I8LC 4HIEB 1I9EA 2MCPL 3RWEA 1BD2A 3OL2A 3Q48A 1XF4B 1N2RB 2IANB 5DHVH 3W9EA 4J4PD 4LLDA 2HKHH 3NPSB 1FPTL 4CNIB 3FO1A 1NMBL 5HGDB 1OF2A 4OGZA 5H8DA 4ZO9A 5LGJA 2WSKA 5LJYH 3BIBX 2HLAA 5JDSA 2A0LD 5ALBH 1ZLWH 4X7SH 5D1QA 4ZFZB 1A6TB 5IJKC 3EFFB 4TSCL 4MWFA 2P24B 4Z0BH 2Z8SA 1MCIA 4I3RL 2MOVA 2CDGA 4OF3A 5C07A 1QBAA 4L8CB 1OAXH 1QSEB 1IGTB 3S5LA 1U58A 1OT2A 1MJJA 4F9PC 1LO3H 1CLYL 3LRGA 3VXSD 4U1SA 2XNAB 1IQWL 4PJAB 4UZGA 5ABDE 5JHDE 1DBAL 5ID0B 1WGOA 2ICCA 1BVKA 4LHUD 5CS7A 3A6OA 4BSWB 3CD4A 3EYOA 2CR3A 5FUOH 5IB4B 1OM3L 4JFYA 3MRKA 4BZ1L 5EWIH 2QTEA 3G9VA 1WJ3A 4FG6D 5DD5H 1JGUH 2SEBB 1FIGH 3CIQA 1NBQA 1NFDB 1P4BH 3QIBB 4PG9B 5E8OA 4G9FA 5HBBA 4P46B 3EYFB 3KPPB 5IMMA 4KH2A 4LCYA 4LU5H 4YHMH 4WU5A 1AR2A 1H5BC 5HPOA 1F5WA 5JDJA 4RGNE 4FRWA 1IQDB 2IALA 1IGML 1H15B 4PJGE 2A6IB 1QQDB 4POUB 5D1QC 3BKYH 4Z7UA 3ZE0F 1HWHB 3LKQB 5MENA 4JRYE 5I8OL 3IS0X 3HI6L 3OR6A 5BZDB 5D8JH 3X12B 4XPHL 1TQCB 4HWBL 2ED9A 3ZKSD 5IUSA 3BYTA 5I9QB 4GXUN 4ZXBB 2ZUYA 4XVJL 3AB0C 1RZKL 3S35X 2D03L 3MJGX 2MPAH 2VLLA 2AJZA 1YC7A 2NY5H 5CSBA 1YYLH 4NZRL 1CDUA 2HFFA 2X70A 1S9WA 2FWOB 1YMHB 4OZIA 3I6KB 4Q0XL 5EU7C 3L9RB 4Y19D 1LE9A 4JDVB 3G5YA 2R23B 4JKPH 1GGUA 4PIRF 4XXCC 1NGQL 3MXVL 5KVEH 3MRBB 4CN1A 3LKPB 4TSAL 4HZLB 1XGUA 3CX2A 1WWCA 5J3HC 2VOTA 1EIBA 4KZEH 1K4CB 4HIJA 3D39A 5DFVC 5GIRB 4X4XA 1XT5A 1JHTB 4EDWH 3QRFM 1M7DB 1A9BB 4PGZA 5CZVH 2VISA 3BUYA 4I0PD 5EOCH 1QFUH 1NGPL 3NIDF 4KI1A 4P3WA 1N5YH 2BCKA 1OP5K 4ODSL 1QYGH 2YEZB 1H0DB 4Z7NF 3O3AA 3T65A 5JXAH 4OV5A 1IEBB 1MCCA 3ROOB 5GS0H 1J0HA 3OHXA 1INEH 4HFWA 3SBWC 4KRMB 3T0XA 4OI9A 4ODBD 5HI3C 3IJYA 2ZUUA 3GIVA 4UTAL 5F7DB 2YD9A 1IGFL 2P8LA 1T4KA 1E28A 4XCFH 1G7JB 1A22B 1OAUH 4K94C 3MLSL 3CDGB 2XZCL 3CU1A 3QEGH 3FN0L 3HNTL 1C16B 4P2OD 5I15L 5GSRB 5C0AE 1BQHG 3QUMH 2B5IC 4OM0L 4QT5A 1EZVX 3FONB 5TE4L 1NLDL 2FJGA 1FCCA 3NCMA 3ULVF 4WY7H 4UOW0 1WFOA 2YD3A 1SJVA 2Z31D 1I9JL 1KB5H 4P57A 4JGUA 3QDMA 5FF6B 2K1MA 4XPBL 1S5HB 3T04D 3KPMA 1YEFL 4JPIA 2CD0A 2ZCLL 2F74B 5HGAB 4F7CB 3BGFB 1YEDB 1QSFA 1UWGH 1ZLUK 3T3ME 1GCFA 1G0YR 4YJZL 2HMID 1S7QA 2PTTB 3RAJH 4P2RA 5GJTL 3HS0B 4NQVA 3LEVL 4BELD 3MGOB 5IVXF 1SJXA 1I7TA 4YDVB 1EVTC 4IOSD 3UP1A 2O61A 3K4ZA 3KYMB 5T3XH 2VLME 2OTPA 3Q5TA 4UUJB 1FO0H 3F58L 5CEXA 1IM3A 4J3SA 4X5LA 1H3WM 3I75A 2HT2D 3D3VA 4N0CD 3L1OH 3BMVA 2R0WH 5DRZA 4HF5L 3TVMA 4YPJA 4LKCB 1BD2E 4NN7B 4WHYH 3IDJB 2GQHA 25C8L 2VDLH 5CEYA 1MJUH 2AEWA 1TZGH 3MCKB 1HKLH 4I3GA 1G9ML 1J1PH 4ZPTB 5IIEA 4NO2B 1RUQL 3DVGB 3MRRB 5IVZA 3HZKA 1YECL 2DS4A 1YC8A 3O0RH 4JN2A 1VESA 5C09A 5C0ND 4O5LH 3MV01 3PF2A 3BPOC 4MDIA 1MF2H 4RGOL 3RBSA 4ZNCD 4X6CF 3LD8C 4NP4H 4ZS7L 5T3ZL 4MJ6A 4X9BA 1N26A 3L5JA 1QFOA 4QRRA 3PGFH 3L5WB 1XCQB 3VFWB 2F54D 2YN5A 3L3DB 4Y2OA 3UZEA 1YNLL 2XG5A 4O51A 5CMAA 1A6PA 5EO0B 1N7MH 3HNVH 4PJEB 3VU2A 4WI9A 1Z0MA 5F9WB 5SWSD 4CW1B 5I1GH 5AEAA 4RNRB 1AE6H 2FX7L 3DOSA 5I71B 4Q9QH 2NMSA 2FIKB 4L3EB 2X1OA 4M6NH 4ONHA 1IC4L 5EU7E 1KLGB 5D7JA 1JZ5A 1LD9B 1T5XB 4TPRL 4XCYB 3TVMC 3RWFB 4IMLA 4B5EA 3RGVB 4I18B 1K3ZA 1OGAA 4N1EA 1UXSA 2VLRE 5DURB 4G9FE 1J8HD 1M71A 2WP3O 3TIDA 2D0FA 1LO4L 5HHOE 4XPFL 1R0AL 3VGEA 1W0WA 4TUKL 3QCUL 3GMNA 4FQIL 2WBJB 4U6XA 1S78C 1S9VA 1HHKA 3A6BH 2Y06H 1EXUB 4KVCL 1RV6X 5GHWH 4KFZC 5FB8B 4A2LA 1G7QB 4XP4L 2UZXB 2EDRA 4OT1L 1QLEL 4QTIH 2H2SC 2AI0H 5MENE 2OTUA 5E5RB 4U1LA 4PG2A 5GZOC 1K6QL 4GG8A 4OIAA 3JWOH 3SCMB 3VD7A 3ARBA 4DCQB 4LNVA 4R26H 4PGBB 4P3CH 2H6PB 5C0DB 5CCKL 2Y5TB 3QDGE 3VXOA 3DIFA 5T1KA 4ONFH 5DHVA 1T22B 4E0RB 4OZIE 5DJZA 3V8OA 3CFCH 3AXLA 3JV4A 1MQ8A 4H26A 3SJVA 1MVUB 3PGDA 5D7JC 4N5EC 1NUFA 2VDRL 1S7SB 1AD9B 1JMXA 2VDPH 1S8DA 5T1KD 3O6FD 3T0WA 3UYOD 5J13B 4B0MM 4P2QE 1DL7H 3S35L 3D39E 3GSWA 3LV3A 3R06B 1U8NB 2AQ3A 5DEFB 1RHFA 4CMMA 1J10A 3BEVA 5L2JB 4MQ7B 3VXUB 3DMMA 4TQEL 2VZOA 3FFDA 4NCDA 3RVWD 4GKNB 4TSBL 4YPGB 3HUJA 3I2CH 1C7TA 1MWAH 2Z93A 3VXPB 4F80A 3IAGC 2D31B 4DFHA 3S3SA 1YPZF 1MHCA 3IDIB 3STZA 4PG2C 2UWEB 3QT2A 1HWGB 1ZV5A 4MNQE 5BJTA 1XR8A 2NY4D 3ARBC 5CSZA 4OBRA 5HGGS 1LO5A 5GRVK 4AH2A 1DEEB 4GG6E 4I0KA 3NFPA 4RAVA 2WV3A 3BP6A 2IG2H 5L8KB 1D5BA 3GSOA 5F7EL 1J12A 4LK4A 2GCYB 3CXHJ 2R2CA 2LFGA 3WUWB 4UIKL 4DOHB 2X4OB 1IEAB 3BXNA 5C7XL 1GZQB 3EYSH 2KDGA 2B39A 3BX7C 2A9NL 4U3HA 2EDNA 3PDOB 1EPFA 1EH9A 4H88L 5J89A 1TITA 1UQSA 5F97E 3IDUA 3EO0A