2VDNL

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist eptifibatide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
214
structure length
213
Chain Sequence
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPRFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 54
structure length 213
sequence length 214
ec nomenclature
pdb deposition date 2007-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdnL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdnL01
1IQWL 1G0XA 3W9DA 4ZFFA 1WVZA 4ZPVB 5HHOE 3LQZA 4U1KB 3N9GL 1MCDA 2RBLA 3T65A 1JJUA 2IQAA 1FPTH 4KK9D 2CKBH 1TENA 1Q9WA 3T2NH 3QDMB 3GHBH 2XA8H 2NCMA 3KPPA 3VA6A 4G6MH 5GPRA 3B9AA 4I3GA 2A73B 3PWPA 3K1KC 3WXWH 5C0CB 1EBAA 4IM8A 1BD2B 3RWHA 1C08B 4NO2B 2J8UB 4PG9B 4YXHH 4PIRF 1J0KA 2DDQL 3MOBH 5E2TH 3WHE0 3QHTC 2Y6SC 1NFIA 1CE1L 1CLYH 1UWEL 2PYED 5CKAA 5D9SA 4OD3H 3OAYK 2AJVL 2PO6A 4XVTL 1L0QA 43C9A 4AL8L 2LU3A 2DQFA 2JJTA 2VLJA 5DDHA 5HYJE 3IKKA 4KZDH 2V7HB 1FH5L 3WNOA 4XCYB 4DVBB 5CZVH 1A1OA 1FVCB 3STZB 2GAZB 3KYOA 2GIYA 1KENH 3C09B 1P1ZA 4JFFA 1JYWA 3AM8A 1P4LA 4ODUB 4Y5VA 1ZA3A 3RTQC 4HV8A 3BP6B 3VXTB 3LZFL 1A6WH 2AEQH 1EFXB 4OBSA 4RFOL 5D1QC 1IQDA 1YECL 2P5WD 5D1ZD 2PF6A 4MAUL 4Q0XL 2C4FT 1NEUA 3FRPG 1Z0MA 3IFPB 3GSNH 2JE8A 5HGAA 1HHIB 2CLZA 2H8PA 3U7WH 3WS6A 5F8QC 3P4NB 5ESQA 4MD5B 5FYKH 3SDYH 2VZSA 4OLWL 5CIPB 2UY7A 4JQIL 2FJGA 3GSVA 1BVKB 2AI0H 3VXSA 1CZ8L 5D2NE 3HMWL 3OJDA 4KJYB 3SE3A 5K9KB 2OCFD 3CXDH 3CFBB 3RWCA 3VFGL 3F7QA 2JCCA 5ACLA 5I19H 1JZ8A 3V6OA 3RZCB 4K9EC 4NHCH 5SWZD 3GHEH 2HKHH 4H1LB 4X6EA 2DL9A 2GJ6A 3SDCA 4PRHB 5DVKA 4W4OC 1CTNA 4ZUVA 1IAOA 3BH9A 2XICA 4WY7L 4K7PL 2NTFA 2QBWA 5I1HH 2YKLL 5DJZB 3QCTH 2CRMA 2OMBA 1ZT1A 2NXZD 3PWUB 3QBTB 3A67H 1A7PH 5B8CB 4TVPH 3EYOB 4IRSD 4DN3L 2SEBB 1TQCC 3QQ9D 2ZOKA 1J8KA 4HCRH 4CADA 4HG4J 1NDMB 1XGYL 4KQ3L 1JV5A 4Y1AD 2WBJD 1KN2L 1IAII 3FO9B 5FM4A 2CR3A 1U6AH 4ONOA 2OL3H 5T5FH 5HHMD 3VI3F 2W0KA 1UWXK 1U8KB 2YWYA 1J8HA 3TWCL 4ELME 4GMSL 1B9ZA 3A6BH 4OZGE 4LNRA 3G9AB 3GSOA 3QIWB 3FZUD 3IS1X 4V1DB 5EOTB 1RJYA 5T33L 3L6FB 4KY1L 5IGXH 3MV8A 5ID0A 1XF3A 4DKEL 1NFDE 5C0ND 1CICA 4UT6L 2HWZL 1ADQH 4XWOC 1TZHB 4JM2A 1G6RH 1EIBA 2QADC 4QRUB 3I6KB 2CQVA 4CRPA 5EZOL 5FOBB 3VXRB 3BPCA 3X14A 4K71B 4J7RA 3TIDA 5AYUL 4PB9H 4YHOL 1I8KB 3GRWL 2IANE 1X6NA 4Q97A 5CSGA 3EFDL 1PYWB 3R8BB 5DT1L 5DRZB 3HI1B 4EEEA 3U83A 1KIQB 3S7GA 5JW5B 2GTWA 3VWJD 3GMMA 5HJ3A 4LPYA 5I1EL 4JFYA 3U9PL 3RVUC 1FYTB 3ALPA 3QHFL 4IMKC 1IT9L 3R06B 5JO5B 5KAQF 2OP4L 4BQ9A 2F5AH 4R7DB 1X5XA 1FVDA 1HXYA 2DQTH 3G5XB 5C0JB 1D5XB 4OFVA 5F9WB 2BVOB 3O4OB 1N0LA 4NRYA 3GSRB 1QEWB 5KVDL 3G04A 3QUXD 2XY1A 3HLAB 4MNHB 3IF1B 3WFHA 3BDYH 1Q1JL 4YDVB 1OSZA 3T3MF 2YHGA 1CGTA 4G7YL 4B7LA 3IDMA 1WICA 3O8XB 5EO1A 1YEKL 5F1OB 3B3IA 2C3XA 2ZOLA 3QIUB 4XZUA 3BGFB 2MKLC 4DKDC 3LSOA 3UTZB 5C0EB 1MAML 2E8YA 4PJBB 2Z8SA 4KDVA 4MA1B 3N06B 1YUHA 4I77H 4YHLL 4PBWD 1CDCA 1TCRB 3BJLA 1CVSC 1PEZA 2Y36H 1NAMB 1AQKH 2YA1A 3S88L 1MLCA 3D69A 5ENWB 3WEXA 1AH1A 3KXFD 5KVEL 1QHOA 3KVQA 3MREB 2ORBL 4ZXBD 3QFJB 4LLMA 5EDXA 1GZPB 4LASL 2E27L 3DV4B 3GIVA 3HE6A 3QRFM 3F7VB 4JFEE 5DFVD 2W9LA 1UT9A 1T1WB 2EDRA 4GS7B 4PJAA 4CW1A 2ED9A 3P11L 4XNZC 1KACB 2ZPKH 3MXVL 3OKDA 3O2WL 4HIHB 4NNYA 1FZOA 2J88L 1L9NA 4NRXA 5HDBF 3LPGA 4JHWL 5F88B 1DLHA 1PG7H 2ED7A 3HRZB 1A5FH 3PL6C 4NQSB 2VLLA 1BQUA 3NCYP 4ACPA 4OV5A 1HH6B 1KGCD 4JB9L 5I1GH 1KFAL 1XGUA 1I7RA 2D7PA 5TE6H 2YXFA 4AT6B 1I1AB 3MV9E 3QDJD 1CLZH 4YNYA 1QSFA 4KJWD 3MNWA 4WNQB 2YD3A 4MLIA 1CI5A 2IAMA 4G3YL 4Y0GA 3NA9L 1KLFA 4QHMB 3GI8L 3M8OL 3WHE1 2W0LA 4AEFA 2FX7H 15C8H 3TN0A 4H26A 1RIHL 4F7TA 4CGTA 2LAAA 3LVEA 3O4LA 3VD4A 4JZJB 3TJHC 3H9HB 5D93C 1RUQL 1FL6B 3QEGH 3ZTNH 4FQCL 4OJFL 3WDJA 2F9BT 4ZNCD 3IDXL 3NH7L 4P46B 5HGGS 3RWFB 2Z31A 1ZGLA 1I8IB 2YBRB 1X7QB 4R97B 5DD0L 3WN5C 4JFZH 4L8BA 3B5GA 2HH0L 5E70A 4D9QD 3PG2A 4KGLA 4EIGB 2FL5B 4PJBF 4KWUA 2OR8A 4XBGB 3S35H 5C0BB 5A1AA 4QLRA 4DOHE 2HLFC 4LOUD 3S96A 2AJZB 4LCUA 1KC5H 1LDPH 2W65A 3V95A 4ZUSA 3DO7A 1CD1A 2PXYA 3C08L 3DO3A 5TJWK 5C70A 2X2YA 2X4UA 5EOQL 5ITFB 3WFZA 5T1KA 1DE4B 1VFBB 4RGMC 2P8LA 1KYOK 4QF1A 1QSZA 1OW0C 2EDNA 4FG6D 2XKSA 4LL9A 3CFDB 5E5MA 5C0AA 3H9ZA 4UILH 1AHWA 2IGFH 4Y4HA 5F9JA 5HD8C 5DJYA 4DK6A 4ZUTA 3RDTA 5JNYA 4LARL 5GZOD 1ACYL 1UACL 3I6GB 1VESA 3MA7A 4RIRA 3KPOA 3AS3A 5JPMA 2BMKB 4PJIE 5B3JF 1JGLH 1J1XH 4Y19E 1JK8B 1HHGB 1G7LB 3PP3H 3E6FB 3VMPA 4HWEH 5BV7C 2Y23A 3ARGB 5ADPH 3OKMB 3RFZC 3ZKMD 2YRZA 2VQ1B 1XIWA 5IEHA 5KAQG 1CCZA 2A74B 1QYGH 2DMBA 4PRID 4PS4L 4EI6B 4Q9RH 5CZXD 3S36L 4RRPG 1EFQA 2Q3AA 2VQUA 3C5ZA 4FQQA 4ZFOA 5SX4H 4XAKD 3VGHA 1GAFL 4LCIL 1MCFA 2VLKB 5EFIA 1JF1A 5DXWA 4KKCD 2NNAB 2VL5A 5EU4B 5FM8A 5I1DA 5IVNA 4UQ2B 1T4KA 5DVOA 3V8CA 3VFOA 2F54A 2V2WB 2VDRL 5E0QA 3TIEA 3HNTL 4X83A 5H2BA 2A6DB 3ME0A 2X4NA 1T04A 1OWRM 4DEPB 4H0IA 4R2GD 5C6TH 3OGCB 1AGFB 4GXVH 1C12A 1EGJH 3TPUB 4GKNB 5LG1A 3T0VA 3OGOE 4ZODA 1T1XB 5IVXA 3U1SH 3WV0A 1A14H 2NY1D 1WFTA 4U1LB 4KI5D 4R90H 4HBQA 1GHFL 3TA3B 4PV8B 3QFDA 4O5LH 4IBLT 5EOCL 4JJ5B 2AXHA 4U1HB 2BHYA 1MCWW 1YPZF 1RQ5A 3MRBB 5B39A 4HD9A 4N0FB 4RX4A 2J1KA 2EZ0C 2EC9U 1BBDL 4QXGL 3T0EE 1N6QL 2D4DA 5I1CL 1U8MB 4UAOB 2DQDL 4Y5XC 5ISZD 5CP3A 4IRZH 1DEDA 3DYMA 2A9NL 5D7SL 2MJWA 3UTQA 5BVJA 1N2RB 3QXVA 2GEEA 3MLTA 4P4RB 4UB0H 1R3JB 2FO4A 3S37X 1BQLH 4OGAD 2YA0A 5LGKA 1QA9A 4FRWA 4PJ9D 4G8EA 1RVFL 3SPVB 4G9DA 2VRAA 4MQSB 3L5XH 1HHJA 1YY8B 2R1WA 1QRNA 3EYVB 5KSAD 1MJ8L 5T1LD 1NGWB 2NY5L 4HG4K 5DEZA 4DGYL 5CJQH 4TTGA 2G9HA 1FIEA 4TPRL 1QRKA 3KLDA 4N9GA 3W39A 4M6NH 4FQLL 1U2HA 4AM0B 3GI9L 3VDCA 2ADFH 1N8ZB 1Q0YL 4P3CL 1IGJA 2DKUA 3M17A 4HK3N 4G8IB 5CEXB 4XTRC 4RMQA 3KPSA 4QHKI 2YMXL 3UEZA 4QGYA 1L9MA 2PYEE 1MF2H 3BEVB 4ODHH 1ZA6B 4AEHL 2AV1B 3BGMA 2HLAB 4WFHE 2IPUK 3RPKA 2LV4A 4R4NC 5I16B 1IMHC 3PV6A 2FDBP 5MI0B 4EKXA 3TZVD 3T4AA 2NY3B 1FNAA 2BSRA 1I3VA 5JOFB 1MLBB 4JVPA 3MRKA 3I84A 2W38A 1RJZB 2N7AA 3TV3H 4D2NA 4NQDD 2OJEB 5FA3B 4Z7UB 5TE7H 3ROLA 4M7KH 1Q0XL 3I02A 4L5FL 3MRQB 3CDCA 1U8HA 4S0TD 3EFFA 3NOIA 3HZVA 5J56B 1F00I 1AGCA 2ZCKH 4QCIA 1GJIA 5FHAH 2AK1L 1XGRA 5C0FB 5F1IB 5B3NA 1WZ1H 1A7OL 1OCWL 3ECBA 2X1PA 3O45B 4HGWB 2Y06H 4TOYH 1QFUL 5I17B 1U8NB 3TFKC 1DEEA 1WZLA 3E8UH 1A02N 1XR8A 1BGXL 1BX2A 1DN2A 3E1F1 3L3JA 5LCVH 3HFMH 3QDMD 5BOZG 4ZSOE 3ZYZA 3CFKB 1A0QL 5I75B 2VDPL 4I3RH 2BNQA 1R5VB 2OSLB 5C0CD 2DWEB 1BD2D 1HYSD 4UTBL 2HG5B 3QNZB 3VFRB 4FZ8L 1D5ZA 1XCQB 4LEXH 4TUJB 1JPSL 2J4WL 5HHNB 3JV6B 4HWBA 3G08A 1RK1B 1UCBH 2OTPA 3FB5A 1A3LH 5DD6A 3QG6A 1M7DB 1PSKH 3RVVD 1MWAH 4NN5B 1A4JB 2DM7A 4I5BB 1E4WL 5JDJA 1SEQL 2HFGL 1YEHH 3V6OC 5CEZE 2YD4A 4OCXH 3G9VA 1OAXH 1DL7L 4HBCL 4HC1A 4X80H 4LVOB 5SX4I 3G5YB 1NH6A 3F12A 4NZRL 3VFNB 3GM8A 4W4NA 1RV6X 5DK0A 5D5ME 3HUJB 3WJJC 1N0XH 4NQVA 3PNWB 4KRMB 3IDIB 4NHUB 1EFXD 4HX1B 4OD2A 4KVNH 5HYSA 4J3SA 3P0GB 1CGVA 1V8HA 1PZ5A 2BHZA 5DO2C 1T03L 3CGTA 1MHEB 4JAMB 4YHYC 1NGXB 3HA0A 5IHBA 4P4KA 1G7PB 5SWSA 1JUFB 1UM4L 4NKIL 3RVTC 3PDOA 1T0MA 4KJPC 4P2YA 4GG6B 1MREL 4AYFA 4Z7UF 1Y18A 1FRGL 4HUWB 3PWNA 4I9WD 2H1PH 4M62L 2NW3A 5GS0D 4OQTH 4OIIH 2VH5L 1W0VB 5EG6C 1NDGA 5TDNA 5LQBL 1H5BC 4JR9L 1FNFA 1U3HC 4R3SB 5LGJB 1KJ2L 3RZCD 1YEFH 1KTDB 3TO4B 1UXWB 2VKXA 4Y5YA 5EBWA 2VABB 3MUGB 3FFDB 3EDKA 3CSYB 2VWEC 4FFWD 4WIQA 4PRHD 5IBLC 4NRZA 4G9FA 1VGKB 5LXGH 4JM2C 5E56A 4DTGH 3CXHJ 2L0DA 1VFOA 3VH8G 2FJHA 3WSQL 1JZ6A 2IFFH 4CMHB 5EIVA 4HH9A 1RZ7H 2XIDA 2HVKB 4O02L 2VLME 4MQ7A 4TRPL 2BOBB 1OP5K 2X70B 3LKRB 2VR4A 2DRUA 4YE4H 4L9LA 3DMMB 5E5RB 3JVGA 1FZMB 5D1XB 3NGBC 3LDBB 1NBZB 3P77B 3T2QA 5F3BA 4ZO8A 3MRFB 1ZAGA 4WHYG 2Q86A 1FGNL 5BS0B 4UIMA 4X99A 3CVHB 3CPLA 3HI6H 3WUWB 3F62A 3INUH 3X13B 1AJ7L 2OI9C 2DKMA 3QUZC 3E6HA 4CU8A 1MCOL 4TVPE 2APVA 1NMAH 2R1XB 1WITA 1YEJH 4MNGE 4PGDB 5B4MC 1BZ7A 5DUBA 1NCCH 4OKDA 5HGHA 2KBGA 4FQIH 3FB7A 5F72S 2Q87A 4YFLF 4HGMA 4JRYE 3MLSH 4UU9B 3D1MC 2ZUQC 4BSJA 1QZ1A 3FCTB 4RFNC 2LE9A 3MC0A 4X9FA 2BK8A 1DBBL 1C5DB 4PUBH 3AREC 4UIKL 4Q6IB 3TCXA 2B4CH 4WV1C 5I73C 2H32H 4Z7QE 3ARDA 3UROR 5CMAA 2Z92A 4J23A 3V4UH 1CFVL 4NQEB 4LNVA 4LAJH 1MELA 3O3AA 4OCRL 4F7CA 4PJCA 1VPOH 4X6CB 2EXWD 1P2CB 1FYTD 3EJZD 3WNKA 4F57L 3ZTJH 3OXRB 3HG1A 4HKJB 5GS1A 3GB7A 1WBZA 1UJTA 2JJWA 4KK9C 4N0UB 4YHMH 5A16B 4QRSB 1A6AA 5HHOA 2X10A 4J1UA 3P3YA 3QUMH 4EDWH 4LDOB 1YC7A 3WBDA 5F1KC 1LE5A 3S3PA 4FQ2L 2MFNA 3IT8D 5F96L 5EN2A 2ITCA 4DGVL 4ZAKB 2VE6B 1W8NA 3VD5A 4G8FB 4TSCH 2I9TB 3WIHH 1D9KA 1VDGA 4WFFD 3TYFB 3LKQA 3X12A 5KOMC 5HHXL 1E4XH 2NXYC 1KULA 3TVMA 5ICZA 3QIUD 3CH1A 4OZIE 2GJZB 4U33A 2OTUB 4IRJA 1AI1H 4N8VB 1HZHH 2RFXB 3BW9A 3QRGL 4JVWA 4X5XB 1INEL 1S5HA 2WIIA 3RJQB 2WUCL 4MJIE 4GRLC 4Y2DB 5GGSA 2B7DT 2DQHL 2IPUG 1GZQA 4KKBD 12E8L 5CJXC 1LEIA 3UYRH 5HYJA 5B38B 1IC4L 4LU5H 1JWUA 3T08A 4MAYA 5FKPB 2QQLL 4HPOH 4JKLA 1JPFA 5DS8B 1MFDH 2APWA 2DTML 1BMGA 1YQVL 3DSFH 1TETL 4KI1A 4YUEL 4GRWH 2VXQH 5I9QB 1F6AB 3VDBA 2EICA 1T1ZA 2G60L 2Z31C 3MLXL 3WE6B 2MTPA 4HS3A 1EBPA 1NLDL 1PAMA 4OGZA 3IVKA 4P2QE 3DVGA 4AMKH 4PJEE 1RMFH 2BXYA 3NFNA 1D6EB 4I18B 1I1AD 5KG9B 3IJHB 2P8MA 3RRQA 1A1NA 2YUVA 4XP9H 3TBYB 1IBGH 4KQ4H 4X6CF 2X1XR 3ZE1F 4K7PX 3KPNB 2PXYC 2EDOA 4HUVB 5GRXG 3SQOH 3UBXI 2QQQA 3B6SB 3WKMH 4LQFH 4GQPH 3IU4H 5CD3A 4OF3A 1KTRL 3MRRB 3HN3A 5T3ZH 3NIDE 2BJMH 5I76B 3S37H 1KUMA 4QHLA 1AHWC 1NCWL 4X6DB 4ORGA 4X7EC 2AEWA 1BZ9A 3LCYA 3RDTC 1GPOH 4IRSC 2VDQL 2VXTL 3TC9A 3X3GL 3MACH 3RA7H 1OTTC 5ELIA 1BHGA 3KPRB 2OZ4L 2FB4H 4UZGA 4WENB 3U0TB 4PRIE 2W0PA 5FECA 2AJUH 1KEMH 5DJ8A 4HKXA 4PGEB 5BJTA 4Z0XB 1UB6A 1OT1A 2BZDA 4P49A 5I1KH 2WK2A 4QY8A 3WIFA 1UENA 2X4QA 3NPZB 3LKSB 5CUSL 5C0BD 1K2DB 4FFYH 3T77A 4ELMA 3Q6FA 3OB8A 4OZGA 3L95A 4ZTOH 5BQ7B 2BVQB 4YEFA 5INDB 1JHLH 1ZLUK 5E6IB 3MA9L 1N59B 1T83C 2X4RA 5DD5L 2DQEL 1HEZB 2NY5C 4MSWA 4D94A 1FL5B 2CLVA 2ZSWA 1NCAH 1NFDA 2BY2A 4JFDD 4YDJB 2ARJA 4YQXH 2DM2A 3LEXA 3KPMA 5TE4H 5E4EC 4NDMA 4GH7B 3MTRA 3IFLH 5DJCB 5A3ID 4YX2H 3AS2A 3FQUA 1A3RH 3RVWD 3S4SA 2XNAA 3QJFA 1BF2A 3G5ZB 5J9PB 3VGAC 2YK1H 3RNKB 1SMAA 3DROA 4XVSL 5E8PB 3OR7A 5DHVH 5J6GA 4KI5E 4NN7C 2X09A 5FYLD 2IANA 3ARGD 2DLIA 4Q9CA 2OR9H 4XHJD 2ZUSA 3QXAB 2W1NA 4JKKA 1VEOA 4DCQA 4DVRL 1HOCA 4CN4A 1XFPA 4KV5E 1XGPA 4XWGL 4Z0BH 3QG7L 4UOW0 1NCDL 5JUEL 4G5ZL 2EIZA 5E00A 3O3UN 1WWCA 4I4WB 4QWWC 3MZGB 1QQDB 2CGRH 5FO7A 1EO7A 5L2KB 5GGVL 2VSCA 2C26A 3BRDA 1CFTB 2VLKD 4ODBD 1OPGL 1ZS8A 5ISZE 3DUUA 5IJKA 1T1YA 4M7ZC 1RZKH 2GHWB 1Q94A 4NFBA 3S5LB 2OTWA 3CUPA 4OKVA 5IR1B 3CD4A 2BFVH 2CK0H 4WO4B 3MXWH 1QSEB 5H94A 5IWLA 4R0LC 2YRLA 4JG0H 5KN5A 4AG4L 5GS0L 5C92A 4NJ9L 2CO6B 1JE6A 1G7MB 4KGJA 1KIUA 4ODSH 3QZWG 2A77L 4J6RL 1MJ7L 1Z9LA 4MXWL 1IGIL 4RMVA 4EN3B 2GUOB 4NWTH 4P23A 4QXTB 4C58B 4LPCA 1E4XI 5I30L 4JO1L 5I8KH 3EGSB 5HTSA 5J1TC 3HR5A 4Z76B 2Y07L 1NBVH 4ZXBC 1P7QA 1OAUL 5EZLB 5MHSD 5D7JB 3ULSB 4XMKL 5IV2A 3T3PF 1M6OA 4N0CD 3PWLB 5DFVC 4NPYB 4RGNB 3NTCH 3LQAL 5DD1L 1GGYA 1CFNB 5IHZB 5I8EB 5DF0A 4HS6A 4JFOB 5IIEA 4JFEA 3T2OA 4FN0A 1R0AH 1IKNC 5CJ8A 5F7DB 2P7TA 2DD8L 3KYNB 5DQDH 5IQ7H 4WW2B 2HRPH 5CEYA 5IKCA 3D5OF 1LO3L 4JPKH 4O9HH 3CXHK 4XC1L 1OD9A 4MXVE 3LKPB 1CU4H 5DR5L 4XMLH 4U6VH 5FYJU 3MV9A 1IAKB 5DRNA 2ZKHL 1Z3GL 3HC4H 4M02A 1OAKH 3B9KB 3THML 4F9PA 1XR9A 2BVUA 4XP6H 5C2UB 1BIHA 2Q76B 4PRAA 2BVEA 3QH3A 1IM9D 3JWDL 4M4PA 3EZ8A 2X42A 1EH9A 4K8RH 5AD0A 2VIRA 1JL8A 2O93L 1GXEA 5IB4A 5JQ6H 2A6JA 3E2HC 2IQ9L 1WWWX 2LVEA 3ARBD 3GMLB 1CQKA 2BCKA 1LP9B 3QDME 4GUPB 4NNXB 1CE6A 1HSBB 3ZZ1A 4MDIB 3DRTB 4F33B 4KKNA 4WHDA 1RJLA 5C0CE 1IC1A 3QXTA 4Z78B 2J8UE 4BFGA 4N8VG 5E2UL 4NKMA 1MCJA 4WHTB 1Q9OA 2ADJB 3REVB 5L8LB 5FCUL 3BKJL 2IFGA 4JY6A 1JTOA 4L4TB 3FT3B 1RZGB 1RZJH 3F7YB 2YD2A 4QO1A 4LOUC 2NY3D 2Y5EA 3BPLB 2DOCA 2JB5H 2Q6WB 1F58L 1WAAF 5GIRB 4JFXB 4P9HL 3H0TA 4L9DA 3V6BR 1GH7A 3ARUA 3E3QE 1LO0L 4OFPA 3ZYIA 5EO9A 3H42L 2EYSB 4FG6C 3HE7A 4KDWA 1TVBB 2DQCL 4P5TB 4FQ1H 5DHXB 2VDKL 3RUGB 3QEUB 1FLTX 4G6AD 4ZTPL 4YGVB 5KSUA 3V5HA 5GZOC 2HFTA 5J1AA 3SY0B 3GDBA 4PY7A 5DYOB 1NJ9B 1I1FA 4KRNA 1OB1B 4HUXB 4HFWB 2ERJC 3ARRA 1CDIA 3AMKA 1DCLA 3O2DA 1H3GA 4PJIA 1MNUH 4Y19A 4APQB 1QVOA 3QWOA 4HXBL 4HKBA 3BE1H 5T3XD 2JIXB 5CZXC 4RAUA 4OLXH 3RBGA 4AQOA 4MCZA 4ZS7L 1B3JA 1YDPB 3TBVB 4F80A 1KCVL 5HYQA 2B1HL 4KKCC 4PRHE 1J10A 4YPJA 3FQWB 4M9PA 1LP9F 5IB5A 4K3GA 1FCCA 1YMHA 1QBLL 1XGQB 3RAJH 3VFWA 3RWDA 5EIQA 3D2UB 2FIKA 3L3KB 4A6YB 3OMZA 1BLNB 3FMGL 4R2GC 3BHBB 2YC1B 1WTGT 4WDIB 1OGTB 1D5MB 1DR9A 3EO0B 3O9WA 4UV7H 4U6TA 2R29L 1VACB 2VUOA 3CDGB 2BVPA 2F74A 1LK2A 4PG2A 1O5DT 4H25B 3NZ8B 5K9OA 4YBLB 5I8OL 1T6VN 3EAKA 1WT5A 4H88H 2GCYA 3B2UD 2JJUA 3MLRL 4OZFH 1DQMH 2A1WL 4V1DE 4X0KA 1FVEB 4HULB 2Z4QA 2I5YL 3U46A 3K80A 2Z91A 2R4RL 1AXTH 3TJEL 4D3CL 2ZUWA 2HFEB 4GW4A 5DZOA 2R2HB 1HWHB 4OQ1A 4IIQA 1BFSA 3RUGF 1S7RB 3JZ7A 1KPUA 3TO4D 3VXRE 2DKSA 1OHQA 1AKJB 1QBAA 3OX8A 5GS2H 5HDBE 4Z7VE 3T0EA 3P73B 1ORSA 1MCBA 1FN4B 5C0IB 1J1OL 2A9MH 3UTTD 1INDL 4LCWE 1BIIB 3OKEB 5EU6E 4UDTA 1YEIL 4BSVB 2AW2A 1H3TA 3FO0L 1EMTL 4OGAC 3RL2B 3MCLH 2H9GA 3PHQA 4HFUL 1BFTA 1MHHA 5FV2A 2ZG3A 3DURB 5T1DH 25C8L 3LKOB 5FO8A 2XPGB 4EUPB 1UVQA 1ONQA 4PBXA 1A1MB 5E7BA 1OM3H 4YHIA 4PJ8A 3R8QA 1T5XB 4K7PY 3DMMD 3DX6B 5J3HC 5D1XD 2FNBA 4LPTA 4NZUL 3OKNA 5IP4A 1DANU 1T7YA 1FCGA 1IGMH 2JB6A 1JNLL 4N1EA 4KMTL 1DQTA 4X8XA 5TPWL 5BS0D 3V0WH 2FJFA 1UCTA 4LSTH 3VFMA 4GAJH 5D6CA 1BBJB 4OI7A 1ZANH 5ERWA 2VISA 4JVUA 5BRZE 2OQJA 3VGBA 1RIUL 3MNZA 5C0DB 5FYLL 5JHDE 1VA9A 5C7XH 5IJVA 4HJJH 2J6EA 1K8DB 2NR6D 2MPAH 2C1PB 5IK3B 3WDHA 2C3VB 4LLWA 2ZUVA 4JRXE 3QULA 1UJ3C 1FO0H 3D18B 2PYEA 5EC1B 2IBBA 4KUCF 2V2TB 4PJBE 1JNHB 1QLEH 1KLUA 3NAAH 1FFRA 3ISWA 4I2XE 5BMFH 5ICYB 5EORH 4GSDH 2D0GA 1T7WA 4UI2A 2EH8L 2GTZA 3R1GH 4DW2H 5BZWB 3Q48A 1BPVA 3FT4B 32C2A 4U6HA 3QFJE 2UWEE 4NQED 4KK8D 5MP6H 4B0MM 1EHAA 3FHAA 2DBLH 2EIDA 3VXMB 4WEBH 3VJ6A 4MA8L 2IEPA 3QEHA 5D1QB 2G5RA 4M1CD 3UTPD 4MAYC 5IVOA 2PKDA 2VZVA 4W6XB 3BWAA 3HTLX 3WNLA 1J0JA 5JPNA 2AJXL 1MI5E 3NCJH 3IJSB 3VFUB 5IB3A 3DV6A 4ZSOA 5L6YH 4EXPX 5C0RL 4LVHB 4WEMB 3RNQB 4QRTA 2FCBA 5D70L 3W5NA 1M1SA 1A2YB 3NABL 3GBML 3PWJB 3VU2A 1ZT4B 3O11B 1PD6A 2QSCL 4JZOB 5F7EL 1ORQA 4GW1A 4MHHI 1E6OL 3RVVC 5IMLB 2GITB 3MUZ1 3B2VH 1IAIL 5IFHL 4YDIH 1WF5A 2YN5A 4Y2DD 1KNOB 2VSDA 5E8EA 1UYWL 1INQA 4PGCA 1AY1H 2X4TA 1DBMH 1JPGA 2CKBA 1F2QA 4TQEH 5C2BL 3H7BA 2XQBL 1NGQL 5F7UA 1JHKH 8FABA 1TQCB 4UUJB 1I3GL 1OL0A 4GJTB 3HZMA 3QP3A 1HINH 1C1EH 3HKFA 4NM4H 5LAXB 1VFUA 4JPIA 1ZV5A 2XOTA 2WBJA 3OPZH 4PYGA 5D5MA 2NY7L 4OM1L 2BSTA 1UM6H 2VLRE 1RUPH 5C0BE 1W72L 2ICES 3MO1A 1SBBA 1EO8H 2BERA 5FAAA 2V5TA 3EO9L 1QOKA 3L3GB 5DUML 1A47A 4S1SH 3FOMA 5GS0C 2DS4A 2CDGA 1T22B 3T0XA 2P49B 3ZYJA 7CGTA 3SKMA 3IDGA 1A7NL 4PB0L 2F5BH 1MAJA 3DARA 4U3HA 5HBBA 2CDEA 1SVZA 2H3NA 2X1QA 1YA5A 4CL7A 4FFWC 3LMJL 5EIIA 1NCBH 2EDBA 4XPBH 1SEBB 4M61A 4M8QB 2Q8BH 3UJTL 2VDNH 3SE9H 2HTLD 3L9RA 2R0LL 3GO1L 2MHAB 4S1DC 3N50A 3G6DH 3QDHA 5DQ9B 1IGYA 3MJ9A 3T1FA 3CAFA 2BSED 1CGSH 3KPRD 5IT2H 1F5WA 1RHFA 3KJ6H 1Q9KB 5DQJA 3VWJA 4LF3B 4YK4C 1DQLH 1FPTL 1UQSB 2AV7B 1RUKH 2CKBL 1KELH 1JP5A 4POUB 1MCPH 1MHPL 5L8KB 3T2NL 2XA8L 4G6ML 3BO8B 3GMOA 3LQMA 1NGZB 4ZPTA 3RGVA 5T3ZE 4CN6A 1M71A 2VLKE 3HAEA 3ESVF 3WXWL 3C5JA 4YR6A 4NZTH 5C9KA 1OY3B 4YXHL 3QDAA 4GRWF 3PWVA 3MOBL 1IGTA 1CLYL 5E6ID 3D0LA 3H9SB 5IJKC 3QUXA 3WL9A 1IZJA 2H45A 3WFBL 4CMMB 4FP8H 3RPIA 3UBXG 4Z5RB 1DDHA 2AGJH 3JWDC 4MNGA 3LRSB 3MFFA 2HFFA 4ZS6D 1H3WM 2R4SL 1UH2A 4XC3L 1RD6A 1Q9LB 3U4BH 2CUMA 5IWLC 2OL3A 3MJ7B 4KZDL 3SGEH 3FQXB 1UZ8A 5TDOB 1FZKA 5CZVL 5KTEL 4JRYA 2FEDD 3OKOB 4S2SB 1JMXA 1KENL 2B8OT 3WDIA 1WBXA 1CXFA 1Z5LA 1ITCA 3HZYB 5E99H 4F7EA 5FDYA 2CJUH 5E94A 2HRLA 5MHSE 3MBED 2AEQL 4NO3B 2EXWC 3RVXC 4IHOB 5I1AB 3CVIH 1K6QH 2YUZA 1I9JH 2JK5A 3PGCB 3GJEB 3GSNL 1ADQA 4XNZB 2NZ9C 1KB9K 1G6RA 1B6DA 1QO3B 5L2KD 5FYKL 3SDYL 1J5OH 3PJSB 1TMCB 4EZMA 3PL6B 2HJLA 2R8SH 2AI0L 4PRDB 4K3EH 3C60C 4X7TB 4M48H 3N1QC 4J3UA 4DQOH 1NCUA 4EUPG 5I19L 2R56H 4NHCL 4WO4D 1QSED 1CDBA 4PJ7F 5IMOB 3C2SA 3ROOA 1MFBH 3GHEL 4JDVB 1ES0A 3NIFE 4WI3A 1REIA 3QIUC 3CZFA 4POZC 1IL1B 1FJ1B 3B5HA 3DXAB 5D7LD 2AXGB 4LCYB 4FXGA 4OZIA 4GKOA 1I9RH 4KK6D 3ES6A 1ZLVH 4GLRH 3VMOA 3QCTL 4Z7NF 5CILH 1XEDA 3LKNA 4EN3D 1SJHA 4F9PC 1P84K 5IEKA 5MEOA 4XPTH 3MYJA 4HCRL 4MJIA 4GW5A 5DJAB 2PYFA 5F70A 5D93B 5IFAL 2OMNA 1VENA 1GIGH 1U6AL 5T5FL 5C9JA 2VNCA 3NPSC 2ATPA 2X40A 3IETA 3K1DA 4PV9B 1AO7B 4RGND 3SO5A 3FN9A 2R0WH 5IROC 4V2BA 2GT9B 3A6BL 2J8OA 2MMXA 3TYGL 3WN5B 3O0RH 5KSBE 3LB6D 4G6FB 4IS6A 3V2AR 1EAJA 1GGIH 2QQNH 3VWKC 2XWTB 5KS9B 3BP5A 1NMBH 3HPJB 1S7TB 4I0PC 4XH2B 2RAMA 4ZOCA 3O2VH 2VR9A 1I1YB 1S8DB 1XGTB 1O7VA 3T0AA 1X4YA 5FB8B 3SBWC 3BXNB 4LGSB 3IAQA 4JFHD 2NYYC 4P2QA 4PJEA 2V9QA 3HC0A 1ZVSA 4ZQKB 3L3DA 4Z7UE 4MJ5A 5KSVA 3CMOL 2APXA 1DVFD 5CD5C 4NUGH 4JQVC 1BREA 3PXHA 4JHAH 3D0VA 4PLKD 4RGMB 3B9KD 3OR6A 4Z7WF 3QEQB 1F02I 4NN6C 3UTSB 1Q38A 4PB9L 3WFEL 1JGEB 2P8PA 1R24A 1YN7B 3HE7C 1RI8A 3KAAA 1KJVB 5KZCD 1YN6A 4FXKB 1NUDA 4B5EA 3P40A 2E3VA 1EEYB 5HVWA 5DMKA 5BV7B 2G5BA 2VXVH 3C8KB 1NEZG 1LE9A 1Z9OA 1EVTC 2F5AL 2DQUH 3CCHB 5FUOL 3ZSSA 5T3XE 1TJIH 3PGDA 3SGJA 1ZEAH 4RA0C 2DQTL 1TPXC 4YHPB 1KCSH 4RWYH 5TDPB 4MA3B 4U1IA 2K9UA 4PRIA 4L4TD 2APFA 4MCYA 3RY6A 3BKMH 3BDYL 4HSQA 5JW3H 2XTJC 4M43H 5SV4A 3AMLA 2WQ8A 1SVCP 4EQ2A 5AG8A 4NO5B 3VXQB 3CC5B 1KIPB 4K7FA 4LKCB 5FUZH 3TBSB 4E41E 5INCB 1HKLH 1FGVH 2FGZA 2D9QB 2V7NA 4PJDF 5IHUH 2HJFB 4P5TD 4I77L 4D9LH 5L7XH 2YSSB 4XPHH 2ATKA 1XF4B 4P57B 4XNYH 3HUJE 4NZJA 1KT2A 4RZCB 5CP3H 1AQKL 2VC2H 1KPRB 2EYRB 4LPWA 3NFPA 4XNMA 5KS9F 1T3FB 5E8DL 1S7VB 1CXKA 3U7AA 4P5MA 1FL3A 4LLYB 1L7TH 1UADC 4PBVC 1JIBA 2DYPB 5DJ0B 3WKNA 4XHJC 4GG6E 1WT5C 3SGEI 1WISA 1C5CH 5GSRA 3C2AH 1EA9C 1PG7L 2X1OA 4WJ5A 1MUJA 1A5FL 2R23B 4TUKH 4WGWB 3V5DB 3GMNA 2ARWA 5EU3A 3W9EA 4C83A 5I1GL 1ND0A 2BC4B 4XNUH 4Y5XB 1NL0L 3JBG7 4L8DB 4Z95H 5CSZB 3EOBB 1QFWM 5ISZA 5M95B 1MJJA 2A83A 3T0EC 4MQTB 3D2UD 1I7ZA 4HW6A 4NSKB 4MDJA 3JV4A 1MY5A 1BZQK 2H2PC 1K4CA 4PJ9A 5JIHA 2HT3C 15C8L 4MNQE 5ID1A 5GJTH 1S9WB 2FZ3B 2CDFB 1FZJA 1N7MH 3VRIB 2FHFA 3T4YB 5KSAA 5ILTH 5E08H 4KUCD 4JANA 3QEGL 1EEUA 4PJHF 1XZ0A 3ZTNL 1RIVL 5DUPL 1KXVC 4ONFL 5BS0E 5ESAB 4FQHA 2YPLB 2EE3A 5HDOA 4JQXC 3W9DB 1D5BA 4ZFFB 5BVPH 4R26L 4LSSH 2QEJA 2J8HA 3W5MA 4JFZL 3T65B 1YC8A 4GLRI 4XGZA 5D7KE 5JA9A 2DBJA 2OS7A 4HK3J 1Q9WB 1UZ6E 3S35L 1G9MH 2K7QA 4F8TA 1J05B 3KPPB 3PHSA 4NQTA 4CNIA 4YHKH 2A2QT 3MLWH 3L5WB 4ENED 3PWPB 2LTQC 1EGJA 1F4XH 1KC5L 2D3VA 2Z35B 1LDPL 5LGHH 4MXQD 2XFXB 3AY4C 1NFIB 3ULUF 4JFQA 2OYPA 4OF7A 3SJVB 1G9NC 5D9SB 1KB5A 3TZVA 3DUSB 1IKFH 2PO6B 3ZHDA 1U93B 1VKXA 3H3KA 4UILL 2IGFL 4HWBH 1MCEA 1RUMH 1IC7H 1WZMA 2ESVE 3MGTA 2QHRH 2AQ3A 2W0FB 3BZEA 1CFSA 1JGLL 1J1XL 4LIQL 1P1ZB 1T21B 4HWEL 3HS0A 2EECA 4XP5L 1ZHBB 3KHOA 1F97A 1P4LB 4LLVA 3ARBC 4ZPVA 1IQDB 3GKWL 1QYGL 4OF0A 3JUYA 1NC4B 1OARL 1A8JH 5DLMH 4Q9RL 1BM3H 1LQSR 4FFVC 3QDMA 5E9DE 5HGAB 1E6JH 4PJGE 2H8PB 5ESQB 2A73A 4PJFE 1CGUA 4HEPG 3TH4T 3EHBD 5C0CA 2Y6SD 4PG9A 4NO2A 2J8UA 5JORB 1K5NB 5C07B 4QNPE 4N0RA 4FS0A 3GSVB 2VXUH 3IRPX 2AJ3B 4QTIH 5CLTA 3VXSB 4OD1H 1RUAH 1I7TB 1WGOA 5FKAA 3EYFB 2JCCB 3FQRB 1C5BH 4WFGD 2BDNH 5E1AB 1FSKC 4M7LT 3WNNA 4X6EB 5C6TL 1DN0B 4GXVL 1EGJL 3WXVH 2V7HA 3BH9B 3T8XA 4DVBA 3CLFH 3ILPB 1SM3H 1IAMA 2GAZA 4G6AC 2FD6H 3VXMD 4QXWA 5GXBB 4O00A 4R90L 5AAMA 4ETQA 4ODUA 4QT5B 2EIBA 3BP6A 3VXTA 1UM5H 3BDBA 4CADB 4GXUM 4O5LL 1EFXA 4U1MB 4P2OD 4YHYB 1AD9B 4UT7H 1JV5B 4ZDHB 4AIZA 3TH2T 5K59F 1EERB 3D85B 3SE4A 1BOGA 3N85H 3BKCH 4MD5A 2X9YA 3VG9C 2NX5D 5CIPA 2AXFA 1NFKA 1BVKA 1RJYB 4R96B 1H5BB 1U3HB 4KJYA 5EUOE 5K9KA 5GHWH 4S1QH 5I18H 1HI6B 5ID0B 1A9BB 4FTVB 4UB0L 1P7HL 3MLUH 4H1LA 4GBXA 4JM2B 2V5SA 3D25B 4NT6A 4Y4FC 3GNMH 4PRHA 1HKFA 4X6DE 3L5XL 1SYSA 3JWOH 4IEFB 3X14B 4Z18A 2R2EB 4LBEB 3ULVH 1MFEH 1PX3A 5DJZA 4IOIB 3TIDB 4CBPA 5A2KH 4G8GA 4EQ3A 5B8CA 1A6VH 3UJIH 2R39A 4Z8FH 1MPAH 1NDMA 4IMLB 3UPAA 1ZHKB 1EHXA 1NMCC 3FHQA 4O58H 1WIUA 3FO9A 1MWAA 2JCCF 1AGEA 3Q5TA 1RSFA 3B2UC 4RQQA 1U8KA 2ADFL 2G2RB 1CD8A 1ZK9A 5E2JA 1ZE3C 2DICA 3QIWA 1NC2D 3N1FC 2KZ1B 2OI9B 4Y8DC 4V1DA 3RGVC 5EOTA 1HXYB 1MF2L 3L6FA 1OSPH 3R0MA 1RU9H 3T3PE 1ETZB 1VB9A 1X9QA 4NRYB 1DBAH 2ED8A 2PR4H 3G04B 4XWOD 3TO4C 4FQXD 3LN4A 1TJGH 5HI5D 1TZHA 1OSZB 4D8PB 5HHVH 4QRUA 3AS1A 5I1IH 1LO4H 3I6KA 3TV3L 5FOBA 3IDMB 3VXRA 2ZUQB 2ZOLB 4Z7VA 4RFNB 3HMXL 4XZUB 5TE7L 3DTXB 1HWGB 3PE9A 3VRLE 3LSOB 3D9AH 4LCWA 4OT1H 3AREB 3FTGB 5EU6A 4U05A 4WV1B 43CAB 2ZCKL 3KLSA 1R3HB 4Z77B 5FHAL 5I73B 1YUHB 4YC2C 3HPLA 4NGHH 4NQCE 3HI1A 4MLSA 1KIQA 2Y06L 4TOYL 4P9MH 3D69B 4OQTA 3DMMC 3WEXB 4KKLC 3ZKXB 4LSPH 4LHUG 3E8UL 1B0RB 4XI5C 4ZD3H 4P59L 4CVXB 1S7WB 4LCCA 5LCVL 4CN1A 1K9TA 3W2DH 5L2KE 3GIVB 4I3RL 4JM2F 3MRLA 2QSQA 4WFED 4R7DA 1Q72H 4NNYB 1FZOB 1D5XA 3I3BA 4D0DB 4M6MH 3KPQB 4HDIB 3H9SD 4OZFG 2Z8RA 5BRZA 3HLAA 1QSEE 1PSKL 3IF1A 1H8OA 2X44D 3UC0H 3VW3L 1MY7A 3H3PH 5JHDA 2NXYB 1U8QA 1J0IA 3EO1A 1YEHL 4X4ZA 5IVZA 2X4PB 1JGDB 3O8XA 4QTHA 4OCXL 2WINA 4JRXA 5C8JA 5C71A 5IFJB 3FQNA 3UTZA 5C0EA 3ARFA 2B20A 4X80L 5DSCB 3EYUH 5ESVB 4GRLB 1BWMA 2OM5A 1P9MC 4I2XA 4ZO6A 1GYAA 1TCRA 2JJSA 4Y7MA 1NAMA 1N0XL 5ENWA 4YDLB 1F4HA 4KVNL 1WJ3A 3MREA 5JZ7C 1YEDA 3QFJA 4AIOA 4JCMA 2UWEA 1GZPA 2W9DL 3DV4A 3VXPB 4M1CC 3F7VA 1A6TA 4XCFH 3BH8A 2XKNA 2ZJSL 3PP4H 2Z31B 1L7IH 1ZGLB 3PL6D 5F88A 4XVUD 1L6XA 2H1PL 1S5IH 4L8BB 4NQSA 4JM4H 4OIIL 1JHTB 1MI5A 1V7MH 4F58H 4F9LA 1HH6A 1YEFL 1U8OB 2H32A 1BFOB 4OZHB 5K93A 3S96B 3MRDB 4LCUB 4XXDB 1U92A 3DXAD 5SWZB 3DO7B 4FXLA 4XCNB 1AD0A 2PXYB 2VXSH 4WNQA 4DTGL 1IFHH 3GMPB 5B21A 3F7RA 1ZLVK 1Y0LA 2IFFL 5IESH 4CAGA 2DF3A 2FYYB 4PJAF 1LK3H 5HGDA 3L3OB 4TSAL 1RZ7L 3ARQA 3MRGB 3C6LA 1AHWB 2KZWA 3QUMA 5F9JB 1WCBB 3SO3C 1LP9E 5IOPB 4ZUTB 3RDTB 3MGAA 5LVEA 4YE4L 4IRSB 1C7SA 3T0BA 4RIRB 3UJJH 1FL6A 5JPMB 1AO7D 3RU8H 2EKSB 5HHMB 4P46A 3NCBB 3RWFA 2V2XA 4M03A 3IDYC 2CO7B 3HI6L 2YBRA 4OIAA 4L4TE 5IEHB 3INUL 2IALA 1BEYH 4RMSA 3DNKA 1SJEA 1KEGL 2VLRA 4M93B 1F11A 1C16A 1NMAL 3ESUF 2L7UA 4XBGA 2HLFD 1UWGL 1YEJL 5C0BA 3CU1A 3ETBF 3WJLC 4ZFOB 5GGRA 2EDTA 2ADGA 3MFGB 1OP3H 2AJZA 3DGGA 4WI9A 3U6RA 1EJOH 2EEAA 5EFIB 3RX7A 2F8XC 1JF1B 5AWNH 2DDQH 1BFVH 5I1DB 1T4KB 3VFOB 3IDJB 1MEXH 4A2LA 1JNJA 3UTSD 2FLRT 5E4EB 1VFBA 2FEEI 3D3VB 3BGAA 4PUBL 3CFDA 5LBSH 2B4CL 4JZNA 2X4NB 1T04B 1BAFL 2P5EB 2Z0BA 4XX1G 1IJ9A 1P4IH 1TVHB 1ZVYA 3VGAB 3MRIB 3STBA 3WS3A 3V4UL 3CFEB 4F7MB 2FBJH 3IDNB 4NN7B 2KQNA 1FH5H 1TNNA 2X7LB 1VPOL 5FCSH 2BMKA 5ADOH 5FYJD 3Q1SL 3QYCA 4MYWB 5IVXB 1JK8A 4HKZB 3UYOD 1EO5A 1HHGA 1VFMA 3L5IA 3QCUH 3ARGA 1LILA 3OKMA 3FB8B 1PKQB 4UDUA 2VQ1A 1FDLL 1J11A 3QFDB 4YHML 4RFOH 2YD6A 2H26B 5F7YC 4EDWL 2MKWA 1L0YA 4U0RC 2ZP0T 4LMQI 4Q0XH 2YPVL 5DMYA 3BKYL 2XWBB 2BP3A 2VKWA 4TSCL 3WIHL 5FO9B 1D6VH 4M7ZB 2VLKA 2VL4A 1X5FA 1A64A 2NNAA 5EU4A 4JN2B 2K3TA 4UQ2A 2P44B 4Y16A 3WHXA 1WSST 4KDTA 3DOSA 4R0LB 1AI1L 1WBYB 1HZHL 3WD5H 5DK2B 4WWKD 4K3HA 2A6DA 2FO4B 3QWRD 4O2CA 1H0DB 4K9EL 4G8EB 4G9DB 3OGCA 4QRQA 5HHQA 5FK9A 3TPUA 3UYRL 2R1WB 2FEDC 1PW3A 5C86A 1AE6L 4BQ6A 4LU5L 1F3DH 2CKNA 4XMPH 3ULUD 3KXFB 2DYPD 4HPOL 5I74C 1A6ZA 3MBEC 3MLPA 4X6FB 4NKQB 3TESA 1MFDL 4LPXA 4ZXBB 4L4VD 3TA3A 2VXQL 3V7AE 4NP4L 2CUHA 4PV8A 2D31B 3LS5H 2E9BA 3W39B 3GBLA 1T2QL 1KN2H 1U9KA 4JJ5A 5DRXA 4TSBH 1PGRB 1RULH 1DQJB 1GOGA 1QTYT 1IGJB 4N0FA 2D03L 4AMKL 1CD0A 1RMFL 5FGBC 3KPSB 5CJBA 4QHNA 4LHUD 1U8MA 1BWWA 5T33H 1F45A 4LHQB 1IBGL 3BGMB 4KQ4L 4KY1H 5J8OA 2EDLA 4YFDB 1IE5A 5IVXF 2IBZX 3PV6B 4U2ZA 3LS4L 4OBRA 3NIGE 4M7LH 3GJFB 3SQOL 3EOYG 4P4RA 1ODAA 1R3JA 2HWZH 4J3VA 4UT6H 3WKML 4LQFL 3IU4L 3SPVA 2DB8A 3CLEH 5EZOH 4NO0D 5IM7A 3S37L 1C7TA 1TZGH 1V3LA 3ROLB 1KTLB 1CIUA 1NGWA 1U8HB 1IC5H 4BSWA 1GPOL 3VGFA 4Z7OF 4PY8J 3BPOC 4HT1H 4QCIB 3MACL 4X9GA 3GRWH 3RA7L 5JXEA 2YPLD 3EFDH 2YD9A 1F90H 2FB4L 1U8JA 3ECBB 1SY6A 4FMFA 2A6KA 3BIBX 3D6GA 4AM0A 1DEEB 1DQDL 2CRZA 5I1KL 5I1EH 1XR8B 1KJ2B 4XTRD 1BX2B 1LD9B 3U9PH 3B83A 3ZKND 5E03A 4MZ2A 3QHFH 3V4PH 3F58H 5CEXA 4FFYL 4OB5H 3EDJA 4YJZL 2NLJB 4PY8I 5DWUH 3PWPD 4ZTOL 4R4ND 4JJHA 5KSBA 1WV7T 3BEVA 1ZA6A 3BP4B 4KTEH 1D5ZB 2AV1A 3O2DH 2HLAA 4GAGH 1MSPA 5I16A 1J18A 3J8F7 3SJVD 2CSPA 5KVDH 3FB5B 5A2JH 3QG6B 1AFVH 1NCAL 2PO6D 1Q1JH 4M8VA 5JOFA 5TE4L 1DVFC 4NKOB 1RJZA 2BNUB 4TNVK 1DBJH 3IFLL 1JRHH 4PLKC 4YX2L 2VLJD 1OQOA 3B9KC 4LRIC 1A3RL 4Z7UA 2XN9E 2ARJQ 5E5UB 1RJCA 4PTTB 3MRQA 1I8MB 2YK1L 3MJ8B 3LN9A 3C9NA 4J4PA 4QHUA 3ZT6A 2XWJB 1GCFA 1RAMA 2DIAA 2ICCA 5F1IA 3F12B 4WTZA 5CGYC 3TFKD 4HGWA 4LLDB 4U2YA 1PDKA 1TVDA 1DJSA 4HPYH 5DK0B 1DLFH 4NQVB 2ERJB 4DFHA 5KVEH 4JPVH 4Z0BL 4JGMA 1NC4D 1PZ5B 2ORBH 4GRMB 3W0WB 4ZFGL 3CFKA 4HAGA 2XQYK 2CGRL 2DI8A 1R5VA 2OSLA 5IHLB 5SWSB 1B0WA 5TFSH 2HG5A 3BT2H 3QNZA 4JLRA 3O2WH 5C07D 3LD8C 1HDMB 1Y18B 5D7IE 1RZKL 4TUJA 1ZSDA 3PWNB 3VXSD 2CXGA 2NW3B 1RK1A 1JGVL 3TNNB 3BPLC 4S0SD 2BFVL 5TDNB 4FNLH 3MXWL 3K81A 2BY3A 1CQYA 1A4JA 1R3KB 3JTSA 4I5BA 1T20A 2MNUA 5HPMA 4JG0L 5DJ2B 1A3QA 4Y5YB 5EBWB 3MRHA 1U2CA 2Y5TA 1FHGA 4NRZB 4G9FB 1ZT7A 4ODSL 5CHNA 4GBXC 5MERA 4ODVH 4R2GB 2MSPA 5CJ5A 3G5YA 4E41A 3U4AA 4NWTL 7FABH 4HH9B 3V4VL 2FLBT 5I8KL 3VFNA 5CWSB 4XAWH 3QNXA 4KKAC 5DVMA 1F3DJ 2RQ8A 3HUJA 1MCQA 5DO2D 1RIHH 3PNWA 3IDIA 1JWMA 1NBVL 3K2MC 1PG7X 3OTTA 4GOSA 5DJDB 4TNVF 3SKJH 1S9XB 1NSNL 4MB4A 2NPLX 3RVTD 3NTCL 1X44A 1J8HD 4FQCH 3QI9A 5F3BB 3VMNA 3BD5A 3IDXH 4WI5A 2D7TH 1J88A 3L7EA 4GG6A 1CDJA 4UIMB 4HZLB 1LNUB 1TJHH 2I07A 4WRLA 4JPWL 4PTUA 5DQDL 3BYYA 2V5MA 4HUWA 2HRPL 5IQ7L 1QR1B 1RFDH 2ENYA 2ENSA 2WQRA 1U3HD 2HH0H 4GAYA 1U95A 5CGMA 1FQ9C 1W0VA 3CU7A 4JPKL 5LGJA 4XPGL 1KTDA 1CR9L 5IBLD 4YHZL 4RBPH 1CU4L 4JM2D 3FFDA 4U6VL 4EI5C 1VGKA 3RKDD 3OWEA 1E4KA 3HC4L 3FB7B 3VE0A 1OAKL 5EOQH 3L3HA 4XP6L 3NCFB 3Q6GH 1FFOB 1PG7W 3IGAB 2YD8A 1QBBA 4K23H 5MENE 2HVKA 5B39G 4K8RL 5T1LB 1BQSA 5JQ6L 3Q3GB 2GY5A 4MNQA 3M1BB 2LU7A 5CMAB 2X70A 1R3IH 4F7PB 5TQ2H 2IG2H 1ACYH 1UACH 1FE8L 3O3AB 4WGVB 1FZMA 3LIZL 5DMIH 5IF0B 3P77A 4MMXC 5IQ9A 2UY6A 4WFEE 3HG1B 3HNVL 3MRFA 4LCCC 3U4EB 5BS0A 3BEWB 3GB7B 3CVHA 3ULVE 3WUWA 5FYJL 3X13A 2F8VA 3SDAC 1PEWA 4J1UB 4NM8H 2R2BA 1LE5B 4PS4H 2R1XA 5B4MD 5EN2B 3F6IA 4PGDA 2VYRE 4NJAL 3RHWF 3BISA 2JB5L 1UJ3B 4U1NB 2ITDB 4MXQC 3FRUA 1ZHLA 4UBDC 4LCIH 3FKUS 3LKQB 3X12B 5FIEA 5ICZB 4WCYL 4UU9A 1V3KA 3ARED 4AENB 3FCTA 4NQDB 5JA8B 3HNTH 5AUMA 3BW9B 4FQ1L 1S5HB 1C5DA 5F6IC 1NUFA 4Q6IA 1UXSB 1HK6A 2F53E 3GGWB 5F1NA 2PTUA 2FX8L 3BAEH 5JOPD 3FOLA 3EJYC 4NIKB 2ESVA 4ODWA 1JZ5A 1YJDH 1HNGA 1P2CA 4HUMB 1X5LA 1KLGB 4AIXA 4MAYB 2KL6A 3AAZA 3OXRA 1I85C 1IGFH 1JPFB 1JRHI 1MCLA 1MNUL 5CEZH 3D39E 3KJ4C 2OXHA 3IKCA 5GGTA 1G7QA 4X5WA 2AXJA 3ULUL 3K3QA 3NBNA 4QRSA 1P69B 4LMQE 1T1ZB 4OLXL 3C5SB 3GK8H 4HS3B 1V3MA 4ZAKA 3HI5H 2VE6A 3EHBC 5E9DA 1BBDH 2NXYD 3DVGB 2I9TA 4PJGA 3NFNB 4K3DH 1MCNA 2B4CC 4PJFA 1N26A 4KJQC 5I1CH 2IPTH 4LSRH 2GJZA 5FYKU 2P8MB 1QSFD 2WBWB 4PJCF 2R0KL 1L6ZA 2ZUXA 1N64H 4PLOB 5JR1H 2A9NH 3KPTA 2B1AH 5CZKA 4GRLD 2RFXA 2E7LA 1MRCL 4LEOA 4Y2DA 4G6JH 1PQZA 2R69H 3HB3D 1U42A 2HKFL 3O6MH 5IB1A 3QUYA 3C6LC 3BN9C 3TF7C 3QUKB 1AO7E 4ORGB 2E6PA 5B38A 2W92A 1DBKH 2X4SA 1BZ9B 4H88L 3P9MB 4UQ3A 1CXLA 3QDGE 4ZNEE 5DS8A 4TPRH 1QLFA 1RURH 4PLJC 1U91B 3WFCH 4P2OC 3MROA 1FO0A 2Z31D 2NY2B 1CL7H 3GKZA 4OFDA 1A4KB 5KANI 1AXTL 3MJ9H 4JFPB 5BJTB 4ZOBA 5AZ2L 4DUVA 5LKNA 4CDHA 2VZOA 3GI9H 4LVHC 1A9EA 4HJ0C 3FO1A 4WUKL 3T77B 4KRLB 1HHKA 4L3CB 2YMXH 4I18A 2APBA 4OZGB 3L95B 4OCYH 1WIOA 2A9ML 2PXYD 3QEQE 3TBYA 4AEHH 4Q9QH 2XQYG 3ARZA 1MHCB 2IPKB 2B39A 3KYKH 4N8CL 3KPNA 5EUOA 3HAEH 5HYSG 2B0SH 4HUVA 2CLVB 2Z93B 4Q2ZB 4CJ1A 3B6SA 3MX0A 2ARJB 2ICEB 3KPMB 4BFIB 1SJXA 5I71B 3DX9A 3RIAK 4Y4HD 4YO0B 4TUOB 1D3CA 3RDTD 4X6DA 3F7PC 1OM3L 3MOAH 1GGCH 2GK0B 2XNAB 3QJFB 1QKZH 2IBZY 2XRAH 1OTTD 4R8WL 5J6GB 1IGML 2HT4C 3GUTA 3U2SB 4P2CG 2IANB 3QWQB 4HLZG 3V0WL 4CUCA 4YK4B 4LSTL 4K94H 1J87A 1M4KA 3U0TA 1XIWD 1QFUH 1R6VA 4PGJA 1BVLB 4NCDA 1ZANL 1BGXH 3TBTB 2E7MA 2IWGA 5C7XL 2VTFA 4HJJL 4WWID 5J1SC 2VDPH 4BQCA 2MPAL 5IG7B 5FO7B 1OP3K 1DUZB 3MYZA 4EOWH 1ZOXA 1B90A 3U30C 2BVQA 3OL2A 5INDA 3AU1B 3PQYB 5E6IA 5JTWA 5EO0B 3RL1A 4FQXC 2J4WH 1N59A 1QLEL 2WAHA 4YLQT 3NAAL 2R1YA 4BH7A 5HI5C 3CUPB 4LGRB 4Y16C 1FL5A 3D3VD 4GSDL 4YDJA 2ZZUT 5H94B 3R1GL 4HXAL 3NA4A 4OLYH 4XBEL 5H35B 4BFBD 1Y6NR 2P5ED 2GSIA 2FHCA 4DZ8A 1RZFH 3G5ZA 5D71L 5J9PA 5MP6L 5ALCH 2DBLL 1IM3A 2DMCA 5E8PA 3VFPB 3VD3A 5BOPA 4WU5A 4ELMF 2P45B 1AXSA 4WEBL 3KDMA 4BFEA 3RZWA 4OZGF 4NZRH 4JN1H 3HNSH 3QXAA 3EYQC 4NQCA 3H6JA 3CK0H 3QO0A 5TQ0L 3MLYH 1BJ8A 3RIAF 3OKLA 3MRCA 4QWWD 4H5SB 1ZGLP 1T03H 3NCJL 1M6OB 1F4AA 1NFDF 4HIXH 2V9RA 4RX4D 5L6YL 3P30L 5L2KA 4N5ED 4NKIH 2GK2A 3C60B 4RISL 5GSVA 5IIEB 1FNGA 2VDOL 3RQ3A 2P7TB 5BW7C 3MRMB 1FRGH 1P7KB 2BY0A 5F9OH 1B0GA 4ZMAT 4ZFZB 3S5LA 2VH5H 5BO1L 3UDWA 1KCRH 2GY7B 1KJ3L 4JR9H 1QSEA 2ICWB 3DWTA 3B5TA 5MEPA 5SWQB 3RWGB 1I3RB 1LWRA 1AY1L 2P43B 2VDLH 1NKOA 4WI7A 2IADB 1VERA 4XRCA 1JHKL 2EDWA 2EKJA 2YPLE 2GUOA 1DSFL 3OF6D 3QH3B 4QXTA 5L9DL 5FDWA 3EGSA 1C1EL 4NC1C 2VIRB 5AD0B 4Z76A 3BSZH 5IB4B 2C3WA 4AH2A 2HAZA 3NPSB 3OPZL 5EZLA 5D6DA 3K4ZA 5D7JA 2B5IC 3PHOB 1UM6L 3CFIC 1RZKC 1RUPL 1GOHA 4NPYA 4E9LA 1BJMA 1QR4A 1EPFA 3BUYA 1CFNA 5IHZA 4WI4A 5I8EA 1RJLB 4XVUC 3ZKSD 3VWKB 3KPSD 5F7DA 4I0PB 3BQUC 3KYNA 2EC8A 5F9AC 4WW2A 3SJVE 3QQ3A 4A2MA 3SKOA 5GISH 4JGUA 3VXOA 2IF7A 4QOKE 4OM0H 1CL7I 3FN0L 1NCBL 3LKPA 1KOAA 4DOHB 3ZDXE 4K3JH 2Q8BL 4NN6B 1IAKA 2VDNL 4M5ZL 3SE9L 4U6XB 4XNXH 1MIEL 5EO9B 4D0CB 4MD0B 1J0YA 2Q76A 2R0ZH 3HE7B 3Q5YA 3A6CL 3ZDYE 5E8NB 4XP1H 4X4YB 3PABA 4J4PC 2DQIL 5KSUB 3V5HB 3KJ6L 1H3PH 1CDHA 2YUXA 4I3SH 1FNSL 3GMLA 1QHPA 1LP9A 5E4IA 1YNKH 2C3GA 1RUKL 1HSBA 2E8ZA 4JKPH 4MDIA 3DRTA 4F33A 1P53A 5D2LE 1F3JB 4NFDA 4F57H 4FOMA 4Z78A 2AABL 1TPXB 4HJGA 5C07E 4I13B 2QV2A 4GMTL 2ILLA 1QVOB 4NZTL 4WHTA 1P5VA 3REVA 1U58B 1MFAH 4RAUB 4L4TA 2XTJB 1U8IB 1RZGA 3V6OE 2X4OB 3F7YA 2WV3A 3LN5A 1FNLA 4FP8L 3SGKC 2AGJL 2D7NA 2E7CA 3S6CA 3SKNA 5GS3A 5GIRA 4YGAB 1S9YA 4JFXA 1YPZB 4K8RC 5M7QA 3U4BL 4MB3A 5HHXH 3R4DA 3GMQB 4JFDB 4PYHA 5DA0B 5SV3A 3VG0H 5IB5B 2EYSA 1YMHB 4ZYKA 3VFWB 1S7UA 1R5WA 3RWDB 1TVBA 4P5TA 4MZ3A 4HWUA 4G7VH 3QEUA 4PGBB 5FUCC 2DQHH 4H0GA 1J1PL 2M2DA 2P48B 5DZLA 1CYGA 12E8H 1LK2B 1NJ9A 1OB1A 3CVIL 1K6QL 4HFWA 4P3DA 1I9JL 4NFCA 3W0WD 4PJ5B 2E7HA 3VH8B 3MQIA 1AQDA 4JKMA 2HJKA 4P4KD 1J5OL 5SWSD 3T0WA 1G7IA 4APQA 4X0KB 4YUEH 1TETH 2Z4QB 2R8SL 2JIXA 4K3EL 2Z91B 2O5XL 2G60H 4LHJB 4M48L 3MLXH 4GT7A 4DQOL 3SN6N 3QJHA 4D0BB 4GW4B 5JDSB 4FTVE 2R56L 1S7XA 1NLDH 2VWEE 1YYML 3S4SG 3SEPA 1MFBL 1KPUB 4P0DA 3MPCA 3CDYA 3OX8B 2X05A 3FQWA 3MGOB 3T0EB 4MX7A 4G9FD 4WI6A 3ELAT 1HILB 5C6PB 3LHPH 3ZE0E 1XGQA 1I9RL 4UDTB 4WWKC 2I9LB 3L3KA 1E4KC 1JTPA 1OTUC 1N3NB 4J3OC 4PJIF 3O3EB 5CILL 1BLNA 2XG4A 5H37G 1P4BH 2YC1A 1HXMA 4WDIA 1MHHB 4XPTL 3TO2B 1V5JA 3CDGA 3BMVA 3S9DB 4D9RE 4H25A 1KB5H 3NZ8A 3ULUC 1GIGL 4IOFD 2ZCLH 4OLEA 4X6BA 1NCWH 3OAZH 2W60A 1ZHNB 3O6KH 5CAYB 3HCVB 3MRJA 2VDQH 3OKNB 1MQKL 4Y4KA 1IRAY 1YY9D 2OZ4H 3O0RL 5DZNA 1GGIL 3QA3A 2QKIA 1LO2H 2QQNL 1IGCH 4C56B 1NMBL 2FGWH 4H0HB 4X9HA 4L29B 1F4YH 2VISB 3AVEA 4BH8A 2OQJB 4KHXH 4LRNH 1G7HA 5ANMB 3MNZB 1JGUL 4S1RH 2C4FU 5HPOA 2R2HA 3O2VL 5HGBA 1CGXA 2LTQB 3ARYA 5IJVB 3MUJA 4I48B 4H20H 2NY6C 4B7IA 4RBPK 5HI4D 1AKJA 4LLWB 3HZKA 3QULB 4RFEB 1FN4A 1TIUA 4CKVX 1BIIA 3OKEA 2ZSVB 4BSVA 4ZFOL 3VD9A 4YXKH 1KLUB 2DQEH 5F93C 3ABZA 3S8WA 3RL2A 3B4NA 2Q8AH 2M8XA 3S34H 1U0QA 2C4XA 3DURA 2L7JA 3BOVA 1IM9B 4UINH 32C2B 5J3HD 1OQXA 1A1MA 4OF8A 4U6HB 1W72B 1V3JA 1T5XA 3DX6A 3CMGA 5LJYH 3DBXA 3UTOA 3FAWA 3ARBB 2G75B 3L7FA 2FRGP 3HG1D 4YWGH 2DQUL 3QEHB 1TJIL 2A6IB 1ZEAL 3BWAB 1AGBA 1KCSL 1S3KH 3MV01 4RWYL 1BBJA 5HHOD 3DVNB 5H8DA 3ZKNC 4XWGH 4GQ9L 1N5YH 3QG7H 3WNMA 5C0DA 5JUEH 2VERN 3BKML 5FGCE 5SX5H 5JW3L 1UEYA 4ZSOB 5IK3A 5GGVH 1U3ZA 1GSMA 3IJYA 1OPGH 1AC6A 1OAQL 3MBXH 3D18A 4P2RB 4YXLH 3UCRA 4XCEA 5FUZL 5DJXA 2PO6C 1HKLL 1AIFA 1FSKB 5IBUG 4IRJD 4BZYA 5IHUL 5CIPH 4XNQB 5L7XL 3OQ3B 2JJTC 4XPHL 4XPAL 5KVFH 4HIJB 5GS0H 3FT4A 4LSQH 1INQB 3V52H 4N90D 1JPGB 2CKBB 3SCMA 2A0LD 4LDEB 3H7BB 2XN9A 1MJ7H 5HYJD 1U41A 1L7TL 2P5WE 1IGIH 3X3FH 3N1MC 8FABB 3QUYC 4H1LH 4MAYD 3RTQA 4YZFE 3U0PA 4BZ2H 3AM8C 4G42B 3MRNA 4Y5VC 1F3RB 4LDLB 5D1QA 3UZEA 2KPNA 4WU7A 5KW9L 3OHXA 2Y07H 3C2AL 3VXUB 4JPIB 1T7VA 4PRBA 4O51B 1P6AB 5D5MB 4TUKL 5HVFB 3IJSA 2R2CA 1UWXH 3WS6C 3VG9B 2I26N 4XB8A 3LQAH 4OZHE 3AGVA 4HK0B 1EEQA 4XNUL 1JZ3A 1A2YA 5SWZE 3PWJA 4Z95L 1CXEA 1ZT4A 2ADIB 3O11A 1ZLSL 5TF1L 5ETUA 3SE3C 5I66B 4ONGH 5CJOL 2CDGB 5D7IA 2MWCA 5IMLA 1VCAA 1LO3H 1L0XA 3ZE2E 2H6PB 2CDEB 2H3NB 1Z2KA 4Y4FB 3BX7C 4NBYB 4XC1H 3SDCC 4W4OA 3TLRA 3P4MA 4URTB 5EIIB 3TGXA 3G6JB 1UKQA 1FLRH 5GJTL 2P24B 4YBHA 4F2MB 1CD9B 1HHHB 4NQXA 5IW3A 3GSNB 5ILTL 5E08L 1D5IL 3THMH 4Y1AE 4WTXA 4KU1A 5C09B 5HHME 4OGYL 3T1FB 3DYPA 2X6MA 1NMCB 4LSSL 2NY2D 4U1JA 4KTYA 4KTDH 3KG5A 2CR6A 4YHNB 4O4YH 3VI4E 1CT8A 5DEGB 4PP2B 1OAZH 3GMOB 3RGVB 4YHKL 3O6FA 1BF8A 1YNTA 2XTLA 1M71B 3MLWL 4QRRB 3L3GA 4YR6B 1F4XL 4G43B 4QRPB 3UMTA 1QFHA 1G7JB 3IRZA 1F2XK 2F8OA 3PWVB 2VAAA 4J2XA 1T22A 3BKJH 4EBQL 3D0LB 4YBQD 1CICC 3D3VE 5EU5B 5DC0A 5J57B 4X7SH 1OAYH 2FWOB 1IKFL 1DP0A 4JO3L 4OIBA 3UTTB 1DDHB 2P5EE 4MNGB 3RKDC 3AUVA 1E27B 1SEBA 3JTTA 4P9HH 4HWBL 5D5MF 4S1DD 2OL3B 1RUML 1F8TH 4O2FA 2QHRL 2MHAA 3A6OA 3H42H 1UZ8B 4YC2B 3TP4A 5DQ9A 2O5YH 2DI7A 2F58H 1KCUH 4JRYB 4DK3A 3OSKA 5JIPA 2DQCH 3SDXE 3BZ4A 3CFCL 1PKQE 1PX4A 3IFNH 4IDJH 5T1MB 2IAND 2Y7QB 4F7EB 5MENA 4HC1L 5I15H 4I1NB 5F1SA 4IMKA 2AV7A 3QZWB 1J12A 3LRHA 1BM3L 2V5RA 5DLML 2JK5B 3ZL4H 4XPFH 4NWUL 1V05A 1NGZA 1G6RB 1NAMH 5JW4M 2YXMA 2VOTA 3OB0H 3G6JF 3CDFA 4HXBH 2VXUL 3PQYD 3QXDB 4X98B 4OD1L 5BXFA 2MCPH 1RUAL 2O26U 3BUTA 4ODXB 4ZS7H 1C5BL 1WC7A 1S7SA 4CMMA 3TCLA 4Z5RA 4ERSL 3LRSA 2YD7A 2XZQL 3ROOB 1ES0B 2B1HH 3ZDZE 4OCWH 3UDWC 1Q9LA 1CK0H 1YQ2A 3MJ7A 4S11A 2M1KA 3FQXA 3WXVL 4MS8C 1R5IA 2AJYH 3GSQB 1X5ZA 4OCSH 3KXFE 2DTSA 3EZJB 4OUUB 3OKOA 4S2SA 1OF2A 2FD6L 3V6ZB 1WZKA 3FMGH 2EDFA 2J3SA 3KPLB 3HZYA 3F5WB 5IEKB 4PREA 3ZKXC 1UM5L 5HY9A 4MJIB 3RVXD 2F53A 2R29H 2PYFB 3DJ9A 4GW5B 3VFVB 3LEYH 2EEDA 4ONHB 2NZ9D 5I1AA 1QFWH 5D72H 5C9JB 3PGCA 3GJEA 3HE6C 2ATPB 3IETB 3V6FB 4P5KA 2CPCA 2C1OB 2R9HD 3N85L 3BKCL 1QO3A 2EO1A 3PJSA 2A1WH 2YD5A 3C60D 4JFED 3PL6A 1KGCE 3D39A 3EOAB 4PJXE 1EHNA 2I5YH 4PRDA 5JIKA 4PLNC 5E1HB 4M3KB 3K8MA 4G6KL 1H8NA 3QDJE 1X4ZA 3I3EA 1NBYA 4LPVA 4S1QL 5GHWL 3NACH 5I18L 4C55A 5L8JB 4JY5H 1OGAB 3MRPA 4POZD 4KVCH 1IARB 2OJZH 5IMOA 3GSXB 4JDVA 1WIPA 2NY4C 3MLUL 2FSEB 2FR4A 4P2QB 5E8OA 5J13B 3HC0B 1ZVSB 3GNML 1IL1A 1FJ1A 4Z7QF 4FFZH 3MV9D 1J1OH 1QPPA 2IAMC 4LCYA 1INDH 3D0VB 1E28A 4J3WA 1YEIH 5L2JB 2YA2A 1EMTH 1LEGB 3SOBH 1FFPB 3HB3C 4LGPB 3TN0C 3SO3B 1A6VL 1NQBA 4YDLC 1R24B 3UJIL 4Z8FL 4HQQH 3TT3H 5DJAA 1FC2D 5HI3C 5GGRY 5IMMB 2OLDA 3AXLA 4I0KA 4OTXH 5F7KC 1UA6H 1WEJL 1EEZA 3KGRA 1AO7A 3QQ4A 3ZYOA 4D9QE 2G5BB 1UB5B 1O7SA 3IDYB 3BIKB 4U1SB 4FQJH 4NC0B 3O3BB 2DLFL 1JPTH 1BQHA 3QDGA 2FEEL 4KMTH 3VWKD 4ZNEA 3CJJA 4X4XA 4I0PD 2C3HA 1OSPL 4HHAA 2XWTA 1JFQL 4XH2A 1MRDH 2JLLA 4EXKA 1RIUH 1DBAL 5FYLH 2NYYD 1I1YA 1XGTA 5FB8A 5EPMB 2VUYA 3BXNA 5D2NA 5CD5D 4HF5H 2I24N 4I8DA 5I1IL 3MV7B 4ZQKA 1N4XH 4PR5A 5DI8A 2MQ3A 5EUKB 1VFAA 5ACZA 2PNDA 4K7FB 3QEQA 3P0YL 4OT1L 1JN6B 2V7NB 3HE7D 1JGEA 1JNNH 2FATL 4Y4HC 4NGHL 2EH8H 2ATKB 1T0NA 2C5DC 4X8JB 4P9ML 4XNMB 4LSPL 4UMGA 3W0WE 1EEYA 4ZD3L 5DMGC 1FNEB 4LLUB 1FL3B 3W2DL 3STLA 1KXQE 3C8KA 1A6UH 2XZZA 2PETA 4PGZA 2C7UB 5EC2B 3L3IA 4PJEF 1XIWC 1KPVB 4U0RB 3RX5A 3BPNC 2QTEA 4XAKE 3PIQB 3RBSA 2V17L 4M93C 4E42B 5TDPA 4MA3A 4PP1C 2AJXH 4FABH 3TNMA 2XTJD 5D96C 3C5ZC 3WO4C 3VGDA 2D9CA 3NFSL 5DGQA 1PY4A 2OX5A 2FECI 4NYLA 3W9EB 1TTUA 1ND0B 1XT5A 2HT2C 1CFQB 1TFHA 3K74B 4KFZC 3GBMH 1FIGH 4NO5A 3NIDF 4K55A 2QSCH 3VXQA 1NAKL 3I2CH 5F3HA 4JDZA 1KIPA 1EXUA 4LKCA 1CXHA 5INCA 1MJJB 2A83B 3EYUL 4KH2A 5K9JH 1I7ZB 4ODTL 2YSSA 4MDJB 4OFYD 1XF4A 4JO4H 1QLRB 1FBIL 3QWRA 1K4CB 4JCLA 3QSKB 4RZCA 1KPRA 1GVIA 2EYRA 1VADA 1JZ4A 1T3FA 1FG2B 1S7VA 2PTTB 3HAEG 3PP3K 3ZHLA 2UZIL 4FZEH 5I74B 1T2XA 3I9GH 3MBEB 4LLYA 4PJ5D 4JANB 4QXUH 5DJ0A 3P9WB 4XCFL 5J6HB 4FQHB 1IEBB 3PP4L 3P4OA 5DRWA 1L7IL 1D5BB 1G1CA 4Y4KC 1IEAA 3AS0A 1NANH 5EWIH 2D2OA 2R23A 4O2EB 4JM4L 2IH1B 3V5DA 4M3JA 4N5EC 5C1MB 3N1GC 4CNIB 4OSUL 1SY6H 2ZG2A 2DLGA 2GQHA 2BC4A 3KYMB 4Y5XA 2HTKC 1QFWI 1XAUA 3ET9F 3EOBA 3NCEB 2EXYD 1FV1A 3T0ED 2VXSL 5CCKH 1IFHL 1I7UB 4JFQB 4HMDA 4P48A 5IESL 2AKRB 3OZ9H 2XT1B 2CIIB 2H2PD 1CGYA 2HT3D 2FHBA 4YDKL 1LK3L 3ILQD 5D7LB 3CH8A 4EVNB 3K0WA 3N1PC 1S7QA 1I9EA 1AR1D 2YEZA 2FZ3A 2PUQT 3UJTH 3UX9B 3VRIA 1KXTB 1KSRA 4KV5F 3H3BC 5B22A 4CVZB 2CXKA 3BPOB 5IW6B 3UJJL 1CFSB 5GRJH 2XACC 4TYUA 3RU8L 4K2UH 2YPLA 2VDMH 4OLUH 2DQGH 3U36A 3HS0B 3VRJB 2Y9RT 2GJJA 3X11B 4LLVB 3SDDA 2LVCA 3F6LA 1BEYL 4C56D 3GIZH 1UFUA 4UNUA 1MHPH 4WW1A 1J05A 3V9FA 5DJ6B 3MSPA 3SQBA 3L5WA 4HIEA 3PGFH 4TVSa 4KUZH 2J12B 2Z35A 3NN8B 1EJOL 2XFXA 5DEFB 5AWNL 5MEQA 1BFVL 1XCTA 2YPKB 1SBSH 2BSSB 4MD4B 4NQDE 3QR2A 3KLHD 3SJVA 1MEXL 5FKAB 4WFHD 1VEMA 3DUSA 3WFBH 1DVFB 2E6JA 4QOKA 5T3XH 1U93A 5LBSL 4DJMA 2R4SH 4N90E 4L8SA 4XC3H 4MJ6A 1P4IL 1UKSA 1QFOA 4RAVA 4E5XB 3QPXH 1ZLWH 1RK0A 3C6SB 3G5VB 5IBTH 4DZBA 2FBJL 1GL4B 1CBVH 2W0FA 3K2UL 3T8XB 5KZCB 5ADOL 1MJUH 3SCMC 4F8QA 5KTEH 3FT2B 1G9MC 1T21A 3QCUL 4U7MA 4ETQB 1ZHBA 2EC9T 4FFVD 1BD2E 1NC4A 4X5LA 1HSAB 5HVGB 4AIZB 5D4QA 5E7FA 4X7DC 3P0VH 3K8KA 1BOGB 5SX5K 3O6LH 4IDLA 2O5ZL 1CG9B 3LD8B 5D2LA 4M7JH 3VI3E 5CLWA 4KAQH 3I75A 1CF8L 1D6VL 5HYIA 4MXVF 2WWMC 1S9KC 5JORA 3LH2H 1K5NA 2AXFB 5C07A 1DFBL 5JQHC 1OWWA 2AJ3A 4P2RD 1FORH 3BFOA 4UV4H 1FC1A 1I7TA 1VSCA 3EYFA 3FQRA 3GRWA 4KRPC 3EUUA 3WD5L 5E1AA 3V7MA 1B4JH 2BRQA 4GBXB 3F65A 4NT6B 1DN0A 1GGUA 5CEZD 1SYSB 4R4FH 4XMPL 3BIAX 1ZWIB 3ILPA 2O61A 1CLOH 3WJJA 5IB2A 4JGJA 2FIRT 5ITBH 4G8GB 2QSTA 4HIIA 1U3JA 2J8UF 2UZYB 4QT5A 3WMSA 3LS5L 2HMIC 4U1MA 3VXUD 1AD9A 2EDYA 4U4BA 1OP5H 5IFAH 4ZDHA 2WLYA 2CIKA 4UT9H 4TSBL 1MWAB 1AGEB 2HYMA 1RULL 2DLTA 4P4KC 4RQQB 3MZTA 3D85A 4I9WE 1RZ8A 3K46A 4JREC 2FX9H 1LEKB 3TYGH 1LO5A 4OV6F 2DN7A 3LPFA 3O6FC 4R96A 1G84A 3ARTA 1H5BA 4ZUUA 2GSGA 1U3HA 4YAQA 5LWYH 3DX7A 5EBLB 5AZEH 1HI6A 4N68A 2VITB 5GRYA 3HC3L 4M7LL 4Y5YC 3LN4B 3CVHH 1A9BA 5DD3H 4FTVA 4EI5B 4Y4FD 3AFLA 1NANI 5ICXB 4JE4B 3CLEL 3D25A 4LSUL 3O41A 3CMOH 5FOJA 3T3ME 3MR9A 1GC1H 4Z7VB 1TZGL 2R2EA 4LBEA 4G80A 1YZZA 2EH7L 1IC5L 4LCWB 4KK5D 3MCG1 4IOIA 5EU6B 5J0BA 5C09D 5FYKD 4HT1L 4S10A 3WFEH 3VDAA 4RMTA 3UBXB 1F90L 3HPLB 1HIML 1HQRB 4JG1L 3MMEB 4IMLA 1H8SA 4IOFC 4X7CC 1ZHKA 4OZ4B 4L9LC 2VLMD 3JVGC 3OG4B 3NMEA 1D7FA 4LCCB 4M5YH 5A40E 1QACA 1CFBA 2G2RA 3V4PL 1YY9C 3F58L 4OB5L 3RGVD 3I6LD 1B2WL 1B6UA 1T5WA 3MRLB 4QRRD 2PW2B 5FUOH 5DWUL 3SDAB 4QRPD 3PQYE 3QUZA 1N5AA 3FO2A 1U8PA 1G1YA 1R3LB 4KTEL 4M6OH 3O2DL 4GAGL 4JHBA 3JWOC 4AEIL 3QIBA 1ETZA 5DGRA 1U8LB 4J3XA 2UVFA 5BRZB 3ULVC 5I1JH 3TT1H 5C3TA 5HI4C 1AFVL 4TVPD 5DTFA 5GGTH 1XF5B 1BECA 5JHDB 3PDGA 4D8PA 1U8QB 3EO1B 1QNZH 2HVJB 1DBJL 4DKFL 1JRHL 5IVZB 1B4RA 4QTHB 4W6WB 1A22B 1JTTA 2WINB 4JRXB 3DTXA 5C8JB 3P9LB 3FQNB 3ARFB 5F6IB 3AREA 3FTGA 2PW1B 5JW4N 4WV1A 43CAA 4B53A 4JRYD 1R3HA 4Z77A 8CGTA 4K07A 3KNBB 1FYTE 1XH3B 4I2XB 3ARDC 4ALAL 4KKLD 5JHLH 1I9IH 4XI5D 4OFKA 4MWFB 5AAWA 4XVJL 4HPYL 1DLFL 4J8RB 1MIMH 3KR3H 3OXSB 4KPHL 5I2IB 1URLA 5FV1L 5E8DH 1K85A 1B0RA 4H8WH 4JPVL 4CVXA 1YMMB 1S7WA 1PJ9A 1OVZA 1YEDB 2UWEB 3KJ4B 5EZIL 5GS1C 3OB0K 1A6TB 3BH8B 2XKNB 1NGYB 5TFSL 4JKWA 4OFIA 3BT2L 3I50H 4Z7VF 4WFFE 4D0DA 3MCKB 3KPQA 3QAZB 3JV5A 4HDIA 4TTDC 5I0ZA 4GG8B 5IW1B 3KWWA 4ZUWB 2Q7NA 1MI5B 4FNLL 1D9KC 2H32B 1WFNA 1QP1A 3SHSA 4HAFA 3TVMC 2X4PA 1JGDA 1NL0H 1U92B 4OCLC 4IRJC 1AD0B 5IFJA 1YNLL 4ODVL 5DSCA 1CVRA 2APTA 5ESVA 4GRLA 1NGPH 1Y0LB 2L4OA 3FB6A 2YOCA 7FABL 5HGDB 4LAQH 4DN4L 1TTGA 3TBWB 4YFLI 5CJXA 3VXNB 4XAWL 3C6LB 2A0LC 5ALBL 4CVWA 1CXIA 3QUMB 4MJID 1AGDA 4UTAL 5JZ7D 4R4BB 5CBAB 3SKJL 1AP2A 5ABDE 3G6AB 4P2OB 4Q58C 3VXPA 1RIVH 2BOCA 4HUUA 2P5WA 3IU3A 5D1ZA 5DUPH 1YEGL 4ONFH 3O3DA 1FP5A 1MH5B 2D7TL 5EA0H 3SE8H 2V2XB 5B3JE 1CIDA 2RIKA 1TJHL 4R26H 1VGEL 2IALB 1RFDL 2NX5B 3DPBA 1SJEB 1JHTA 4QYOB 5F9DC 2VLRB 1F11B 1C16B 1MCCA 2YRPA 1OGAD 1U8OA 1CGWA 3DECA 1BFOA 1NEZB 4OZHA 2B2XL 5GGRB 2ADGB 5KOVC 4P2QD 3MRDA 2NMSA 4XXDA 5DHYA 3DGGB 5J7CC 3H9YA 4L3EB 3U6RB 5SWZA 3MNVB 4XCNA 2DLHA 5D2NC 2EDDA 4XBPA 1ZLUH 3GMPA 2J6EL 2UWEF 3S3JA 5TH2A 3Q6GL 3OKYA 2FYYA 1WFOA 5CINH 2EYTB 4PRNB 4N0YH 4L8CA 4GRWB 3L3OA 1G9NL 4K23L 5KVGH 2IH3A 3MRGA 4JZNB 3QXWA 1WCBA 1E0OB 5IOPA 3WS3B 1R3IL 1V7NH 4IRSA 2IG2L 5TQ2L 2F19H 3RY4A 5DMIL 1YEEH 4Y1AA 3WO3B 4OGXH 2EE9A 2EKSA 3DI3B 4LIQH 2NY2C 4WUUB 4XP5H 4Z6AT 3QCVH 3LAFA 2XZAH 4JY4B 4UDUB 3QQNA 5HHPA 4N1HB 4NCC1 1M7IB 2XTJE 3GKWH 1W0YT 4H1LG 4NM8L 1NC2B 2V5YA 1OARH 4I0CC 1JWSA 3K4AA 5GGUB 4BUGA 2AK4B 3U30B 1YPZE 5CS7A 4YIQB 1MFCL 3MV7D 4JFDE 4FQXB 1T83A 2J2ZA 4YBQC 2BRRH 3IXTB 4Y16B 2CMRH 3WHXB 3IDJA 1M05B 1QUNA 1T6WA 1T66D