4ZFGH

Dual-specificity fab 5a12 in complex with angiopoietin 2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
215
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCAASGFTISDYWIHWVRQAPGKGLEWVAGITPAGGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARFVFFLPYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Angiopoietin-2
publication title Deep Sequencing-guided Design of a High Affinity Dual Specificity Antibody to Target Two Angiogenic Factors in Neovascular Age-related Macular Degeneration.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/immune system
total genus 39
structure length 215
sequence length 219
ec nomenclature
pdb deposition date 2015-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zfgH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zfgH01
2AJVH 3HZYB 1T04A 2GUOB 3HFML 4JJHA 2V9RA 4D9QD 1XR9A 4ZS6D 5T1MB 2FHBA 5MI0C 2C4FT 4A2LA 3ZKXB 5DVKA 2VZSA 3QUYA 1UM4L 1VHPA 2IALB 2XG5A 4I48B 2XY1A 5I6XB 3RPIA 5J7CC 1ZT4A 2P7TA 3DV4A 3EYSH 1L0YA 3MLWH 3BRFA 1C12B 4PRAA 5HXMA 1G7MA 2CLVA 1OW0C 4UIKH 4G7VH 2CXGA 1R0AL 1ZGLA 1MCOH 3VGFA 4ZXBC 2ED9A 4L3CA 3WDHA 4Z7WA 5D7SH 4JZNA 4YC2C 4YO0B 5C08B 3L3JA 4FMKA 4XPTL 4LASH 1EEYA 4L4VB 1DUYB 4U0RC 1FG2B 2X4OB 3PWLA 5TFSH 1XIWD 2C5DC 5SX5H 3OTTA 3HI1B 2P5EA 5CMAA 4LSPL 5EUKA 1CICD 4IIQB 2GYSA 2A83A 1I85C 1R5WB 3KYNB 4M48L 4TPRL 4ZOBA 1DL7H 1K4CB 3NN8B 5EOCJ 2BJMH 1RZIA 5B3NA 3AS1A 1WBXA 4YPJA 1UJ3B 3O3BA 3RX5A 4JPWL 3WHXA 3X14B 1AGEA 5IMKA 3MJ8B 3ZKNC 3OX8B 1B4JL 4WWKA 1RZGB 3FQNA 5IHBA 1A4KA 4L3ED 3HTLX 4HPOL 4KVCL 1P4IL 4JRXA 2H8PA 2OTWB 3G08B 3RZCC 4KDTC 5F6HI 3UTTE 3BZFB 1SYVA 4NZDA 5JOPE 2GSGB 5HHNA 2YZ1A 1JYXA 1PEWA 1J9CT 1GL4B 2XZQH 3ARED 1G7HA 3LN5B 5I16A 3CCHB 3QPQC 1RZ7L 3DUUB 5BW7A 3I84A 2H2PC 1ACYH 2EIBA 4U1SA 2MPAL 2FGWL 2NY7L 4L9LA 1S78D 3FB8A 4NRXB 1IFHH 1KB5H 4V2BA 4UT7L 4K3JH 4N5UA 3PXHA 3B8YA 4XNMA 4AH2A 4YBQC 2WANA 3WUWB 2A6IB 3DYOA 4RFNC 1NEZG 1UH3A 2YC1B 4YHYB 3VI4F 4M7JL 4ODVL 2FO4B 2AI0L 3T2NH 3KPQB 5T3ZE 1LVEA 2VDMH 3T1WA 4EUPB 4U49A 4AYFA 2BNQB 5JDSB 1S9WB 2A9NH 4NC1E 4X7DC 2AQ2A 2NPLX 1R3JA 1NFDF 1O0VA 3DETD 3FO9B 2F53D 2Z31B 1U36A 3IRPX 3MRQA 3OKKA 1B0RB 2APWA 5HHME 4I3GA 3HI5H 4U05A 1A1OB 4TTDC 4AJ0A 4YNYA 3F5WA 5I0ZA 1DANT 2DQFB 2VQ1B 3QG7L 1JV5B 3C60B 4D0BA 4O9HL 4M61B 3H9SD 4Z7UE 5T1LB 5ENWA 3WV0A 3EJYD 4BSWB 5IEHB 4V1DE 4J6RH 3BQUA 3OKEB 4XAWH 3HZKB 1BFVH 2IAMD 5KSBF 4GW4A 2BY2A 5F9OH 3JWOC 4LKXB 1T0MA 4ZFGH 2BNRE 5KVEL 3LOWA 4DKEH 5DRZB 4R8WL 3BEWB 1J05B 3GSUA 2W38A 2K1MA 3LIZL 5IVXA 2VDKL 4C59B 2VTFA 5FO8A 2AK1L 1P53A 4I5BA 5EO1B 5DMJB 2X4RA 3H9HB 2X89D 5DLML 2XN9B 4DEPB 1YEDB 1EHXA 4RX4A 1U8HA 2ZKHH 4LVOC 3HNTL 4R4FH 4PREA 1N7MH 2VLKD 1G7QB 1KACB 1V7ML 4GW5B 4DN4H 3GRWH 2PXYD 1KG0B 5DWUH 5L7XH 4UV4L 4NO5A 4F7PB 4HS6B 1J0JA 2LTQB 4I0PB 4WFHE 4X5WA 1GH7A 4MAYB 2W92A 3QZWA 4R7DA 4HUKB 1MCBA 1FAIL 3RDTC 4N90D 2D31A 3C08L 3LS4H 1CFTA 1M6OB 2BVPB 4EOWH 4JEGB 1IC4H 1KIQB 3GSQB 5EZLB 5F96H 4P3CH 1H8OA 3GBNL 1PZ5B 2EXYC 1YN6B 1J8HD 4JFDB 1RZ8A 3PWUB 4GS7C 4GSDL 1NFDE 2XZCL 4NJAH 4R2GB 3ULVL 1NC4B 2DQJH 4RGNC 2DLTA 1TVBA 2XQYG 4XNQA 5FGBA 1KCVL 4ODTL 1HHKB 3OMZA 3QUMA 5GRJH 3ULUD 5HHXH 2XKNB 3I50L 3UJIH 2BVQB 3TIDA 5SWSD 1CFQA 5FAAA 4JR9L 3M8OH 3SGEI 1P6FA 4PJBB 4X6CE 1QSED 4NWTH 4HKZB 2D7TH 4MJ5B 2A6DA 1E4KA 4TUKL 3MYZA 3KYKH 5C0ND 1LO3L 2UWEF 1JZ3A 1Q9LB 1MFBH 4MA1C 1QHPA 2G5RA 3LQAC 5D72L 4CMHB 5KSAB 4EDWL 3SCMA 4U1IB 4G8IA 1XF5A 4R7NB 2X4TB 4LKCB 4PJ9B 1C1EL 3SGJA 4OCMC 5ITFA 5D6CA 3WS3B 1SVCP 5BO1H 4UDTA 3V6FB 3MPCA 4Q9QH 5E8DL 1CLYL 2YWZA 1W72B 3HLAB 3MREB 3KS0H 1T1XB 4WFEE 1PYWB 3STBA 4JZOA 3S9DB 4FQ2H 1QRNE 5ICXA 5LXGH 3C8DA 5GISL 1TVHB 2AJUL 2JLLA 4U3HA 2XQBL 1IILE 1NUDA 3FOMA 3O9WA 4RA0C 3TO2B 4Q9RH 5AEAA 3UXFA 1W0VA 3BWUC 1IM9A 3OJDB 3O6ML 4OM0H 3UPRB 1ZEAH 3VFSB 4HUVA 5HHOD 2GW5A 5DSCB 2QLVB 2DQDH 3QISA 4HWUA 2Q87A 2HJFA 4JQVC 1G9NL 1FL5A 4X80L 1AC6A 1AGCB 4PRPB 4DGIL 1EO8H 5J06A 4WV1C 2PW1A 4Y16C 1H8NA 3IDJB 4Y2DA 5DQDL 1KN2L 1CD8A 1G0XA 1BM3H 2E7LC 5IESL 3TWCH 4PJIB 5D1XD 1T20B 4P2OA 3O3EA 2WW8A 4LIQH 5GGSB 1J12A 3WXVH 4YUEL 5DVNA 4OI7A 1NAMB 2VXVH 3PDGA 4P2YA 1JHLL 3CD4A 4YHOL 3QEQA 3HUJB 1N3NB 3EO0B 4UINL 1S8DA 4J4PD 3S36H 3UTTB 1BFTA 4X4YB 3GI9L 3SE8L 4WFFD 2E6QA 1NKOA 1UM5L 2R69H 4DFHA 1NFIB 1OAKL 1T1WB 3CXDH 3ECBA 3JUZA 3QDGD 4Q6IC 3TBSB 2L0DA 1I1CA 5J6HB 3NTCL 5C07B 4PS4L 3GIVB 4QCIB 3ZL4L 1RFDL 4U7SA 3T2QA 4LCUB 4H1LA 2G75A 3HE6A 5MENA 3FJTA 1FNFA 1X7QA 1T7WA 1U3YA 1YNTB 1ZV5A 4QHNA 4KZEH 4OQTH 2ADFL 2E9BA 3F7VB 4NPYA 4X4XB 1U9KA 2O5ZL 2DM2A 5I19L 4HUWA 1YEIH 1HYSC 1DN2A 2VZ3A 1I1AA 3MUGA 2QSTA 4I4WA 4P57B 4ERSL 1DBKH 1RJZB 3FRPG 1UYWH 1MUJB 5FYJH 3BZEB 2VLJE 4OF3A 1SY6L 3P77B 5CEZL 3RWDA 2FCBA 4YDKH 2K3TA 4EXKA 1BVZA 4Z7QF 3IXTA 3NFNB 4RQQA 5I1JL 2BRRH 3C5JA 2GIYA 3SKMA 1ADQL 5DHYB 4I3SL 2AEWA 3FONA 4JFZH 2WK2A 4C58B 5HYJD 4GKSA 1R6VA 2DI7A 4S1QH 5INCB 3BZ4B 3ZT5A 1EGJL 1CXEA 5MP6H 4HKBB 4N1HB 5CEZD 5H35A 2DTSA 4KTEH 3QIWD 4HS3B 2J8UE 4PJEF 2IWGA 1TZIA 1EFXD 4FABL 4XTRC 1V3MA 4GMSH 3D39A 3GM0A 4MQ7A 5GQBA 4M00A 3FFCD 2QADB 1FIGH 1OAUL 4YEFA 2HVKA 3TBVB 2VE6A 3CU7A 3LKOA 4OAWA 4CW1A 4JPVL 4R26L 1GAFL 2XNAA 3GSNB 5DEFA 3VFNB 3MJ9A 1FNSL 1JUFA 1UQSA 2OL3H 5HY9B 1DBJH 1GZPB 5D2NE 3O2DA 2YS4A 1UM6H 1WAAF 3D3VE 2WLYA 3KLHD 1F3JA 5T3XE 4L29A 5E4IA 5E2TL 5BQ7B 2IG2L 5HGDA 4Q2ZB 2J6EA 3PL6D 4J3TA 3LKPA 3O45A 1H3WM 3UX9B 4TSBH 2IBZY 3G9VA 3HC0B 3VFPA 1WEJL 4G6FB 1CL7I 2R23B 5BXFA 1MI5D 4NJ9L 3C87A 3DROA 3ZLQC 3BRDA 5GXBB 5MEOA 1H3GA 1YDPA 2WINB 1N6QL 3CVHH 4QRPA 5FCSH 4G8GD 1HI6A 5KW9L 5I1EL 1EMTH 1S5IL 3B3IA 2EC8A 4HG4J 3FOLA 3O4LE 4HF5H 1RK0A 3MLTB 2DDQL 5IB2A 2Z92B 5D8JH 1IAIH 4Y4KB 1YJDC 1MWAH 1MCLA 1NFDB 4QXUH 4KKCC 1I7UB 3T4YA 4Z7QE 2GTZA 1ZTXH 5AWNH 5DDHB 4LPUA 5D6DA 3C6LC 1AFVH 4XVTL 3K2UL 3MSPA 3P73A 5F3BB 2V5SA 3ARVA 4MJIE 2NNAA 3QJFB 1BVKB 4YHLL 2HT4D 3CU1A 1TFHA 3FQTA 1QFWI 4JFYB 1WZLA 1S9YA 2E8ZA 1JWMB 4N0UA 3WFEH 2A38A 2GQHA 4PJEE 1A9BA 2B1HL 4K94C 4JFOA 3AGVA 3GSRA 4LCWD 5KSBB 3CLEH 1Z3GH 1ONQB 1EHLL 2X4QB 1MLBA 2OQJA 2NY4B 5JO5B 4MNHA 5TJWK 4MXWL 5ACZA 1YPZF 1AGDB 4G43B 1CICA 4XVSL 1A64A 2E7MA 3DNKA 2V9QA 1U3HD 2VXTH 4GRWF 4IRJD 5F9JB 5I8OH 2P42B 4FXGB 4TNWK 4DOHB 3GUTB 4LCCA 2V2XA 4M9PA 3K4ZA 5FOJA 5BV7L 2D03L 1WAAE 3BKJH 5A16A 4I77H 2DI9A 1AXTH 4NKOB 1FQ9C 2JJSA 2YMXH 3QRFM 4WHDA 4PJ5D 4Y4HB 1A14L 3HZMA 2CK0L 1UB5B 3PDOA 3QFJA 2DICA 1A9EA 1B88A 2Z0BA 4ZXBB 5K59E 3PHOB 1JNNH 1K5NA 5KG9B 4F33A 3GMQB 3TZVD 3D0VA 4X6FA 1CK0H 4U0RB 1U0QA 2CO7B 3KPSE 4Y88A 3RIFK 3T3ME 3IDXH 3ZTNL 3LRSB 3BW9B 1JGLH 4TQEL 3IKCA 5C1MB 1CBVH 4AT6B 1KJMA 4NQVB 2WUCL 1BQHG 3U2SB 2VITA 5K93A 1M7DB 5KVDL 3KPMA 1KT2A 5AYQA 1U8OA 2LU4A 3U0PB 1B6DA 1AQDB 2YRLA 4MQXD 1NMCC 3KHOA 4XVUD 4X7CC 3L3IA 3QEGH 4RNRA 4M6OH 3WHE1 1INQB 4S2SB 2W65B 1IGYA 1KGCD 4DKAA 3BT2L 5EO9B 3RZCB 3SEPA 4BFBD 1T5XA 3CDYA 3SGKA 4PV8B 1TETH 4QHMA 4DJMA 3KPPB 1BLNB 1K6QH 1OAQL 4PLJD 3C2AH 4MD5A 2EDFA 3RVTD 1F8TL 1E4XI 1AXSA 4U7MA 5E00A 3TVMB 4GJTB 3ZE1E 2PW2A 3LS5H 1MAMH 3H9SA 1OQOA 3MJ6A 2C4FU 5ADOH 1FZKA 5A40E 1HQ4B 1I4FB 4RCAA 2R2EB 1RZKL 5MEQB 2UWEB 1BQUA 2N1KA 2GY7B 3VFVA 1YPZE 1F4WL 4JFEE 2EIZB 4YHIA 1KB5A 1Y18B 5CD3B 4RFNB 3RY5A 4GRWE 1HHJA 5ERWA 2EDBA 5FDWB 4JZJA 4RMUA 2NY2D 3DLQR 4M8QB 2B4CL 1R5VB 2CLZA 3MRHB 3PGCA 2XV6B 3UBXG 3CPLB 5I2IA 2J3SA 1YEFL 4Y5VC 2VLKA 1AO7A 1YYLL 4YBLB 5TQ2L 3V52H 5TF1H 3ULSB 1EXUB 4QHUB 5E8NB 2E9WA 4OCRH 2BVUA 3DGCR 3X11A 3ARFB 2IJ0C 4PBXA 3DX8B 1NCAH 4G8FB 5CCKH 3DO7A 4G9DB 3MX0A 2EDNA 4Z0BH 5LGHH 3X3GH 4BFEA 1JNLL 2PN5A 5L9DL 1SEBA 2Y1VA 1D5ZA 4MQSB 5E2JA 5EC1A 2L7UA 2ZSWA 2NR6D 3F58H 4I1NB 4PBVC 1I9JL 2WIMA 1NBVH 3CFJB 3QHFH 4WI2A 3GGWB 1QRKA 5CKAA 4WDIA 2CIIB 3NPSC 3RKDC 2UVEA 1YECL 4U1JA 1DEEA 2FJHA 1CTNA 4LLYA 3HE7D 4ALAH 5D1ZA 4F2MB 5B38B 5BJTB 1ZWIB 4LVOB 5DK0A 3HAEH 4YX2H 4ONHB 2VUOA 4ZS6C 4XWOD 5TDNB 2I9TA 3QBTB 2GCYA 4R97B 4OKVB 5BMFL 1IEBA 2AK4E 2ED8A 3W82A 1EAPB 3EGSA 1M05A 1J5OH 1OAZH 4O2EA 4YDVB 4OZHF 2H3NA 1FFOB 3GRWA 1QFOA 3IFLH 3TPUB 1AR1D 2AV1B 2OMBA 4Q0XH 1ZLWK 4N8VA 5D5MA 4PUBH 4LLWA 1GGUA 4YHPB 1U8KA 3K4DA 3UJTH 1OCWH 3ARGA 4LAQL 1Q8MA 3D25A 1J0IA 3V2AR 4E5XB 3NZ8B 2YPLE 4MLSA 3E6FB 5D2LA 4EJ1C 1OT2A 1DANU 1XIWC 5GHWH 1A6TB 2OJZH 4LLVB 1EAJA 3PHQA 2CDFB 4HBCL 1CICC 1QLEH 4QTHB 1IQWH 5CWSB 4GS7B 3OB8A 3LEVH 4EI5D 3DVGA 4JFFE 4RGNB 5JPNB 2W9EH 1SM3H 3O4LB 4FN0A 5INDB 4JY6A 2JB6A 2QHRL 3HR5B 2VDLH 2P48B 3CX2A 2N7BA 2B2XL 4OLYH 4Z7NE 5CZVL 3LH2L 2UY6A 4NQEE 4QGYA 3AREC 3KYOB 4Y5XC 4U6YB 1N5YL 3TNNB 4Y19D 5IJVB 1D6EA 4YJZL 1LWRA 3C09B 4FQLL 1WC7B 3DBXA 5E9DB 1OGAA 3FQWA 1S78C 4KV5F 4MA1B 5EOTA 4XMPL 5FK9A 4X8XA 3OQ3B 5FV2A 4PJEB 4PJAF 3UCRA 1PQZB 3RVVD 1S5HB 4X4MA 2R2BA 5IFHL 1G6RH 1GHFL 4Z78B 1DUZB 5EZJB 4MJ6B 4IEFB 1UCBH 3IVKA 1IKNA 4ZTOH 4TSCH 3V4UH 3QCTH 4DZBB 4ACPA 5DJCA 4YFLF 3Q1SH 1E6OH 3KXFE 3L5HA 3DETC 1HQRA 1I9IL 4C56D 5EU6D 3OAYH 4ONGL 4QT5A 3SGKC 3C5SA 4ZO6A 4PY7A 3B9EA 4F80A 3PE9A 4N68A 4WUUD 4AQ1B 3MBEA 3U7WH 1EZVX 2XWBB 4S0SD 4JO2H 1ZHBB 4BQBA 4ODWB 2CLRA 5HHPA 5DEZA 5DHVB 4AIZA 3IJHB 2ZSVA 3BH8B 1OL0A 4G80A 2XTJD 4L4TD 4OCSH 4ZUVA 1JGVL 3EJYC 9CGTA 3QDGA 5HHVL 5F44A 4WV1B 5F93C 2GHWB 4Y16B 3EJZD 3QNYA 4LSVH 5DEGA 3WO3B 4KDWA 1BF8A 1FVDB 1RJCA 4PJXF 3PQYA 4P4KD 3U30C 1MAKA 3IDIA 5FKPB 5TQ0L 3P2TA 2YSSB 1C5CH 4JZJC 4HFUH 1UXSA 5KN5B 3LQZA 3QFDA 4N0FA 4JM2A 4P5TD 2CH8A 3TPKA 3UTZB 2QR0B 2A6JA 2EICA 1DBAH 3QA3A 1WWCA 2UYLA 3HG1B 2FH8A 1EK3A 4R3SB 4RFEB 2D7NA 4X5LA 1Q1JH 3T0VA 1LDPL 4QNPE 3VGDA 2PXYC 4UV7H 5JUEH 1YNKL 4MHHG 1NCTA 1MPAL 4L8DA 4HEPG 3I2CH 2IANB 3FB7B 4EN3D 1R5IB 1VGKB 5CSZB 4YIQB 1Q94A 2V5RA 3O2WH 4HT1H 4K3DL 1TJGL 5ESQB 3GJFH 1A3RH 4PJAE 3L9RA 3S6CA 2I9LA 4Z9KB 3EYVB 4X99B 5EPMB 1CT8A 4GQ9L 4QF1A 3TCLB 2XACC 3TF7C 2ZCHH 5FB8B 1NJ9B 5A2FA 3V0WH 5FYLD 1YPZB 2FL5A 4NQDA 1FNAA 1XAUA 2LE9A 2I5YL 5F3HB 3NABH 4XRCA 4GRWB 2VZOA 5SWZA 4HGMA 3CZFB 4HWEL 4OQTA 5ADPL 1X5HA 3SY0A 4BZ1L 4UT9L 4XPBL 1LEIB 3BKML 5AG9A 1YNLH 4Y1AB 1PBYA 4OKDA 1D9KD 4K2UL 4P99A 2XXMB 1ROWA 4HS8H 1YEKH 3W5NA 3GHBH 4BZ2L 2P8MA 1KCRL 3ULUC 1NCDL 1FLRH 1S7UA 2SEBB 1F02I 3EDJA 4HSQA 4WY7H 3LV3B 1MREH 1FN4B 2Y5TB 3N1MC 3VXUB 1YMMD 1KEGL 3SE3C 5IB1B 3GNMH 1L4IA 4MSWA 3X3FL 3W11D 5JW5B 1CG9B 4U6VH 5GGRA 1IRAY 1JCKA 2W60B 1KBGH 1KLFA 3F7RA 4NKMA 5TPWL 4FFVD 2YK1H 2F5AH 5HDOA 3STZA 3DRTB 4UNTA 1GGIH 4ODUB 4XZUA 1FORH 3RTQA 5MERA 3BHBB 1DLFL 1NGYB 4Q9BA 5LBSL 4PGEB 2QSCH 3NACH 3D69A 1CVSC 4KRNA 4KHTL 4H26A 4YFLI 5KANI 4JVWA 3WS6A 5DJ2A 1OLLA 3DUSB 4XCNA 1NEZB 3KPRA 5I1LB 2R0LH 4P2CG 2XZAH 1F00I 4YXLH 4OZ4B 4U3XA 3VGAC 4U1NA 3DTXA 2ESVD 2OL3A 1U95A 3B9DA 4O2CB 2DQUL 4XX1G 3MLPA 2AV7B 1ZKAA 1NCBH 3N85L 2AK4B 1DE4B 3PF2A 5FECA 5DMKA 4WU7B 5EBLA 2J4WH 1H15A 1MCIA 1YEEH 3N0PB 1JGDB 3QO1B 5F7DA 5I8EA 1L7IH 1HN1A 4NCC2 5DJ8B 1KNOB 1G7LB 3RWCA 2VDOH 3L5JA 4LCWA 1ZHLA 3DYPA 3PG2A 3HI6H 2X40A 5DUPH 4OLUL 1ZVSA 4WHTB 1K8DA 5BZDB 4BA8A 3IGAB 3QO0B 3V8CA 5DFWH 5GSVA 3U36A 5ISZA 2X4PA 2VKWA 4JFXB 5KSUB 3LEXA 5D1XC 3CVHA 1HKFA 1HILB 4MGXA 5IR1B 1FC1A 3OKYA 1CF8H 32C2B 3MRGA 3FO0L 5DYOB 4DKFL 4WEBH 2Q76B 3MCLL 5GGTH 3U46A 3WFCL 1FL3B 4JFFB 1NGZA 2EIDA 4YGAB 3QDJE 5E2VH 3RZWA 5DD5L 1MWAA 1WZ1H 2IQAB 2EE9A 3MRFB 5IOPA 4QRRA 3CSYA 3MV8D 1L0XA 5HI5D 2QKIA 1QFUL 2AKRB 4PJ5A 2IH3B 4NFDA 2VQUA 4J4PC 2DYPD 3D48R 3OKOB 4Z7OE 3JWNC 5E8OB 2H32H 5GS1A 1RUQH 4BH7B 1VERA 1QVOB 4FZEH 4NZTH 2APBA 2WUBH 3MTRA 2ZUQC 3ALXA 4P2RE 4JLRA 3L3HA 3SO5A 2EXWD 1NBYB 3VXNA 4UBDD 1K3IA 3QSKB 1OLZA 1RUMH 3EW3B 4G7VL 3U4BL 2DLFL 5CIPB 5EOCH 8FABB 5EN2A 3RAJL 4UT6H 3TV3H 3EYUL 4KHXL 3RHWK 4GUPB 3BISA 4KUCF 1CR9L 2X4SB 1F6AB 4P4RB 1QFWM 4OTXH 5ESAB 1I75A 4UQ2A 4HULB 1MVUB 5FKAB 4P2QD 4EDXB 5KVGH 3VGEA 5TGBA 1FO0L 2BRQA 1DL7L 2ZOLB 4AL8H 1QUNA 3TO4D 3IETB 4TYUA 3L7FB 1IL1A 1LO5A 5A43C 5C0DB 4OZHB 1HZHH 2G60L 4MXQD 5JMOC 3ULVF 3QNXA 3EFFB 2P8LA 2C1OA 4Y4FD 5BRZD 1BZ9A 1SJHA 2D7PA 3R06B 4MNQE 3AC0A 4WI6A 3RWHA 3I6KA 2LV4A 3SJVA 1B90A 3T65A 1DCLA 3MLZL 3QIWC 5C0BD 2V17L 1XCQB 2EEBA 2JCCF 1WWAX 3ZMRA 1W0WA 4LCYA 5FO9A 4MYWB 1JE6A 1J1OL 4OB5H 1HEZA 5F9DC 5SWQB 4PGBA 2C7UA 1IFHL 1KB5L 4NKQB 3QP3A 1NMCB 4JRYD 4K3JL 3IDGB 4YQXL 1CLZH 2IC2A 2DQCL 3RFZC 4XXDA 1KENL 1NCUA 4Y5YC 4HLZG 1PKQA 4U1HA 2HKHH 1AY1H 3ARDD 3EO1A 3PGDA 1VACA 3MNVB 5GRZA 5CGYD 4J3SA 3TYFA 4PR5B 5LGJA 3EFDH 3QNZA 2JE8A 3KLHC 1T6WA 2CKBB 5JDJA 5DJAB 3GSWA 3STLA 3H2WA 5C7XH 4PJCE 3PL6C 4CVZB 2VH5H 4ELMF 1BWMA 2G9HA 4HV8B 3FT4B 3HI5L 3S35X 1XGPB 1IC7H 1FGVL 1SMAA 2FX8L 2JK5A 5C0CB 5D9SA 6CGTA 1H9VA 3Q6GH 2R0WL 1T2QH 2EDWA 3AM8A 1FSKB 4HIHA 4ZAKD 4Z7VA 1TLKA 3O3DA 4PRHA 1HHIB 3NZHL 3MLSL 4HKXB 4OUUA 5JHDD 3IAQA 1HKLL 1LK2B 4KY1H 5F9OL 5IHUH 4CBPA 3GSVA 2Y36H 1BBDL 5SX5K 1LP9F 3BO8B 4Y5VB 1T3FB 3RRQA 3S97C 3PDDA 1P7KB 4XP9H 1RJYA 2MHAA 2ZP0T 43CAA 2Y4SA 3A67H 1FLTX 5DD3H 1N64H 3HC4H 5GPRA 1JYWA 2AJZA 1ND0B 5F88B 4XPAH 3IDYB 2MJWA 4A6YB 3ULVE 3RWJB 1U8JA 4DN3H 4PB0H 1QNZH 4XP5H 1IC5L 3MROA 3PNWB 5FOBB 2HT4C 2Z8SA 2ZKHL 2P5WE 5J12C 4R4FL 2RFXB 4Z95H 1RURH 2N7AA 2A9MH 2EEDA 1NCWL 1C5BH 2JCCE 5DWUL 4PY8I 3Q0HA 4FQJH 3CFCL 3NPSB 1U41A 2ATKB 3QDMD 2DWEB 3AVEA 4PJXB 1T03H 4KXZI 2DKUA 1ZLSH 4F37F 1CXKA 4JAMA 5D7LD 4XCCH 4Z77A 2K7QA 2O5XL 1TJIH 2BNUA 1U3HC 2X70B 4IRJC 3OR6B 3I6GB 2GJ6D 2IH1B 3DYMA 3FKUS 3MOBH 2VDNH 4P9HH 3MRCA 4HXAH 4EOWL 2R2CA 5I66B 2DQEL 3IYLW 1ITCA 1D5IL 4LLDB 1NGXB 3HAEA 2L4OA 3P9MA 3C8HA 3QCUH 4X6DF 1U8NA 2CIKA 2VC2H 1CFBA 4P59H 5FA3A 2XWJB 5HJ3B 3V7MA 4ZSOE 5GS1C 3MRRA 4Y19A 4NKIH 5I76A 3JVGC 35C8L 4LDEB 1WBZA 5FUZL 4FTVE 5GRJL 2NX5D 1BFOA 25C8L 4F7TB 3VWJD 3H7LA 4GXVL 1XIWB 5JQHC 5FM8A 2Z4QA 3EHBD 3VFRB 2I07A 4OCWL 4WW2C 5F1KC 4QRUB 3ZKQD 4FFWD 1VFOA 4F15C 3KYKL 2P49B 4L1HA 5JIIA 1LP9E 3VXOA 1A22B 4P23B 3JV6B 5DD1H 3MODH 3FQRB 3EYQC 3T08A 4XVUC 1QBAA 1FFPB 3TT1L 4YDJB 4L3EB 2BVOB 3CLFL 1XGRA 1KC5H 3IKKA 2ZUYA 5C6TL 2VXQH 2ATPB 4EI6A 3QUXA 2FH6A 4JRWA 3U0TA 1X4YA 4KWUA 2NZ9D 4CMMB 3UBXI 3O41A 5HI3D 4JQXA 5J1AA 4BQ8A 3ZYIA 3RVTC 1NC2B 3AB0C 5BO1L 4MAUL 1JMXA 3DVFA 2M8XA 5DJXA 4HBQA 4Y5XB 3G5YB 1OT1A 1XCTA 1OF2A 2H6PA 3EOYG 4TNWF 2OCFD 1IJ9A 4XNUH 2DQIH 1IZKA 4FQ2L 1IGIH 2F74B 4DGVL 4EQ3A 1YYMH 2YUWA 4PTTB 4HPYL 3GKWH 1QSVA 4XNXL 3QUKB 3BPCB 1F4XL 1VKXB 3GB7B 4XB8A 3TH3T 3OXSB 4BKLB 1K85A 4UB0L 2DQDL 1DBBL 4QXWA 4QXTA 1HE7A 4FNLL 1F3RB 1A6AB 2DJ4A 4NQCA 5I1AB 1RJLB 2NY2C 1I3RB 5KS9E 1OGTB 4KKLC 1WLHA 1PVHA 1EO8L 4P5TA 4QYOB 3L3OB 4K7PL 1C7TA 4UMGA 1G6RA 4P3WA 4NO2A 3RA7H 1CLOH 1RZKC 3QWOA 4WVRA 1ETZA 5LAXA 1IGMH 5E99H 4MNGE 4KZDL 1X5GA 3N06B 3VRIB 2VRAA 5GGUA 1NEUA 4FZ8H 3WNLA 4D9LH 5ICYA 2VXUL 3TWCL 2F54E 2FB4L 3HZVB 1UZ6E 2HJKB 1I3GH 2YEZA 3CJJA 3KLAA 5T33L 1CGSH 2B4CC 2J12B 4EN3A 3ELAT 3CC5B 2EECA 3WXVL 3QUZA 5IKCA 5ANMA 2BC4B 3I02A 2X2YA 2C1PB 4NBYB 1N4XL 1WCQA 4F9LA 2NTFB 1MH5B 1QBBA 3MNWA 2IAMB 3QIUD 4GRMA 4RMWA 5DD0L 1LEKB 2NR6C 1I8MB 3S36L 2MCG1 4PJHA 4XH2A 2H9GA 4J7RA 2HLAB 1I7RA 1DR9A 1LD9B 2DLHA 3FQXB 5BS0A 2ZCKH 5E8EB 3UTSE 3V6OE 1F42A 4GKNA 1R3HA 1HXMB 3CXDL 5FGCB 2IPTH 4X98A 2B8OT 2W0FB 4JHZA 3HE7C 4CL7A 2CMRL 2BOCB 1G7IA 4YXHH 1U3JA 5JORA 1BD2A 1A3LL 4HJGB 4XC1L 3EDKA 4G7YL 4PJFE 1DVFA 5JMRA 2YPVH 2PETA 4KZEL 3JSSA 4OQTL 4XWOC 3VCLA 4Y8AA 2PXYB 4OZFB 2F5BH 5JPMB 1DQQA 3T77B 5HGHB 2YD6A 2A6KB 3MJ7A 3OJVC 4BSVB 4NP4H 3L1OL 1UYWL 3AY4C 1RMFL 3VFMB 1G9EA 4QRQB 2VLRA 4WENB 1AR1C 3L6FA 3GSXA 3QR2A 2Z31D 3C8KA 3T0XA 3GJFA 4ONFH 4OUOA 4PP1D 2V2WA 2WIIB 3B6SA 4LARL 4XCYA 4HUUB 4ZOCA 3HCVB 4WW2F 4L8CB 3C60D 1JL8A 2KZ1B 4FQPA 2VLLA 2GITA 4M62H 5TE6L 3RIAF 3GZKA 5B3JF 4PRIA 1J8HB 4JKPH 1KJVB 1U8LB 3VXMA 4M1GH 2D0HA 4EI5C 4DVBB 4F9PC 3E8UH 1QSFA 2PO6D 15C8L 1MCPH 4NNPL 2JELH 8CGTA 1BQHB 4JQIL 4NN7C 3VFOA 4GMSL 3WIIL 4QY8B 3S88H 1FIGL 4LHUA 1KFAH 4Y2OA 1N2RB 1IKFH 3FAWA 3OPZH 2JIXD 3VE0B 1NUFA 5SWSB 4RMQA 2ARJB 5DGRA 1FZMA 1CFSA 4HWZA 3RI5F 3ZDYF 1QSEB 2CJUH 1WVZA 4CN4A 2XN9D 1WT5C 4LF3A 4OLWH 3WO4C 2OL3L 3PP3H 3ZKMD 5DK2A 1IEAA 4KFZC 2VDQL 3M1BB 1WUNT 2P5WB 3SO3C 1HOCA 1J18A 4M5ZL 4PRNA 3PIQB 1NDMA 3IU4H 4FQIL 1IAKA 2JCCB 5EU5A 4U1KB 4Q9CA 3RVVC 1E27B 5CHNB 2EYRB 3BPOC 4NHUB 3UEZA 4FXKA 2M26A 3BEVB 3BP7B 4MAYD 3GEWB 5EOQL 3K74B 2VABA 3SDCA 2YZ8A 2BZDA 4J1UB 2Y07L 4PLKD 4O02H 4UU9B 2YA1A 5GJTL 4G6MH 5CAYB 3QB7C 1T7ZA 1OB1B 1DQDL 3VGAB 1X6LA 1T22B 1RHFA 1UWEH 5D7KD 1IMHC 3AFLA 3GJEB 1CGVA 1Q9WA 1EMTL 3LCYA 4UTAL 3ARBD 3VXQB 4JQXC 1T0NA 1CGTA 1FVEB 2YD7A 3UBXB 5D8JL 1IAIL 2D9CA 5HHOB 2A73B 3MRKB 1DN0B 4X6EB 1UACL 3IRZA 5SV3A 3BH9B 1WF5A 5L6YL 3ES6A 3P4MA 4MHHI 1CZ8L 2XTJC 4ELMB 4NO0A 4IRZH 3WUZA 1MSPA 3OKNB 2AXFB 5B8CC 5F1NA 3EJZC 3FT3A 3T0EA 4JRXE 4HLJA 2CPCA 3EYOB 3D0LA 4P4KC 1URLA 5B3JE 3GSOB 3ZE2F 2E7CA 4K3GA 2ZJSH 5D1XB 2ERJC 4HAFA 3VWKA 1KPUA 4XBGB 2CRMA 1FL6B 2VLMD 3ZHLA 5HYSB 4P5TC 2BHZA 3WNNA 2BSTA 5I30H 1LP9B 3NBNA 3MGTB 5KSAD 1BX2A 3INUH 4GFTB 4NRYA 3WJLA 5GGTA 3ARTA 4FQXA 5C09D 4U6HB 3TO4A 1FZOA 2HFEA 4PBWD 3BX7C 3B9KB 4DAGH 2RIKA 4NZRH 1EA9C 5I71C 2PYEA 4WCYH 3TBWA 5JIKA 3CDGA 1NAMH 4ZQKB 1LO4L 3WDJA 4EN3C 1OAXL 2R4RH 3RUGA 3DMMA 4RAUA 3UTQB 4W6YB 3OKDA 2H32A 3MLYL 4FQHB 5DRXB 1NMBH 1SBSL 2B0SL 2P4AB 2YMXL 1A02N 4PRBA 1DDHA 1XGUA 4TVPE 2N4IA 5BVJA 3FTGA 1TCRB 3I9GL 3WFDH 4H5SA 5BOPA 2PTUA 1JNNL 1V3JA 4PB9H 3U9UA 5J8OA 5IB3B 5C86A 4LPTA 2GAZB 2DD8H 1CK0L 2BDNH 3VGBA 4G8EB 2MQ0A 3IDXL 3X12A 4QRTA 2HG5A 2APVA 1T1YA 3U0WH 5DTFA 1UVQA 4ZUWB 1RPQA 3S96B 3NIGE 1WISA 3P4LA 3V7AE 1TTGA 6FABL 1D9KC 4KJPC 4MNGB 4JDTH 5I17B 3VD3A 5T3ZH 1CDCA 1KB9K 4X6DB 1FE8L 1Q9OA 2F54B 4WFGE 5IVXE 3WLBA 4BM7A 1A47A 3T3PE 2EO9A 1A7OH 4XMKH 5DFTA 4HCRH 5DO2D 1ZANL 2IADB 3W11C 1TETL 2XWTA 3ZO0A 2P47B 4F7MB 3C9NB 1ULVA 4ZFOA 5B39A 4L8SC 4NCC1 3WFHA 2V5TA 3UPAA 1EFXB 4FFVC 3FO2B 5EIIB 1RULL 4LFHD 5JOFA 3UTTD 5KSVB 1K8IB 4GRLB 3O6LL 1YN7B 4LQFH 3S5LA 1Y0LA 5JOPD 4YXKH 1A7BA 1XEDA 3FFCB 3QI9D 5J6GB 1BOGA 1MY7A 1ZLVH 3UTSB 5J11C 2GSIB 1BECA 4JPKL 4PG9A 1P84K 1LK3H 2Y6SD 4JKKA 4M7ZC 2IBZX 4Y5YB 5I74C 3BDYH 3RWFB 1I8KA 1CIDA 3VU2A 3X13B 2QQKL 4KH2A 2BFVH 2R29H 3WE6A 4M6AA 2MKWA 1VB9A 5GS3A 2X4UB 4XAKE 1U92B 5HGAA 1S7XB 3GMLB 1Z5LA 4JFPB 2W1NA 4OCLC 3S37H 5KTEL 4ISVB 4NOBA 3VXSA 5ID1B 2IQ9L 4KI5F 5DMYA 1ZHKB 3GSNH 4ZDHB 3O8XD 1ODAA 3AU1B 4G6JH 3BPNC 5GZOD 5T3ZD 2AXGA 1KPRA 3PL6B 1UH4A 3DX7B 2NY1D 5HVWA 4AZ8A 1HH9B 4X8JA 4GAJH 3U9PL 4NNXA 1B4RA 1MI5B 3OL2A 1JPFB 2F9BT 3WN5A 5HHMD 3Q3GA 3TA3D 1MFEH 4J3XA 3CMGA 3X3GL 5LGHL 4KJQD 4G8GB 4OD1H 1EJOL 2CUIA 3RVXD 3KPOA 3SDXF 3HB3D 4QOKA 2VERN 3F58L 5I1GL 1JZ5A 4XPFL 2P8PA 4V1DD 5H8DA 3OAUL 3DX6A 1KIRA 2FWOB 4NKDA 3MA7A 3MV01 4JDZA 5IVOA 3DXAA 4LSQH 2DTML 3S8WA 1HXYA 1S7VB 2BNRD 2DQHH 3LN9A 4U1GB 2C3VB 4HK0B 4MB4A 4M02A 5HI5C 3RX8A 5L2KA 4K9EH 5I8KH 4L5FL 3RGVA 4BFIA 4E42A 1OARH 3EUUA 1LMKA 3RWGB 1B0GA 3JV4A 4N0YH 3VG9B 5J12B 3PGFH 1MCQA 2FATH 4ELKB 3MUHL 2VWEE 4WTWA 3U4EB 1FDLH 1PSKL 5CZXD 4KK8D 5C0IB 3QXAB 2Z35A 3NIFE 2WWKT 2DBLL 4WI9A 1OAZL 2EXWC 3DARA 4UBDC 5D7JD 3L5WA 4U4BA 4P46D 3TN0D 4MCZA 2PTVA 1N8ZB 5EU3A 5JW4N 1U3HB 3THMH 4PYGA 2FZ3B 4LDLB 4HKJA 4LRIC 3UJTL 4AG4L 4HDIA 1T21B 4QHLB 3WXWH 2OR9H 4WFHD 4EUPG 3B43A 1D5BA 5JHLH 2X6MA 1KELL 4LRNH 5EBWA 4PGCB 2P44B 3VRLF 1NSNH 4KGLA 1IGCH 4EZMA 5FV1L 1J0HA 4HMCA 2HFGH 4S1DD 5HVFB 4KI5E 2HKFH 1J7VR 3LEVL 2NW3A 1U8PA 3TO4C 5DJZB 5DVOA 3UTOA 4JPIB 3HZYA 3EOTH 1SM3L 2GUOA 3FN0H 4MXQC 4Y4KD 4ZPTB 1F58L 3FT2B 4X9IA 4Y4FC 2ITCB 5T1MA 3TZVB 5BV7B 2PYFB 1RZIB 3RJQB 2IALA 4I48A 3WHXB 3AS2A 1BZQK 3HRPA 2HRPH 3TM6A 1KUMA 5LWYL 3QEQE 4AK1A 1NAKH 2YD5A 4WW2B 3I75B 1FNGB 4F15B 4WHCA 5IVZB 4YO0A 1E4WH 4ZO8A 5C08A 1Q0YH 4L4VA 1DUYA 3HNVH 1FG2A 2X4OA 3MRJB 5D71H 1I1FB 3HI1A 1F90H 3SE4A 5E08L 4IIQA 5EZOH 1R5WA 1G6RL 3ARDC 3KYNA 3NN8A 5CGYC 5MENE 3AB0B 1UCBL 5EFIB 1AR2A 1UJ3A 4JN2B 1NANI 5IQ7H 3MJ8A 2FGZA 1RZGA 2HN7B 4EKXA 4YE4H 2OTWA 3G08A 3P0VH 4ZO9A 3MR9B 3BZFA 2D3VA 3WSQL 3MOAL 4WFED 1CE1H 3MNZA 1AC0A 2GSGA 3E3QE 1R3JB 4NIKB 1QRND 1MFDH 2OZ4H 1MFAH 3LN5A 1J1PH 3CCHA 2KBGA 3OKKB 5F7HA 3DUUA 1QFPA 4OCSL 4ZAKC 2UUDH 2NY0D 3S4SG 3MV7E 2XIDA 4KKAD 2AS5M 4NRXA 4RRPA 3VFWB 5IQ9B 3F5WB 4I2XB 3MA9L 5E24E 4OCYL 3WUWA 5GGVH 3MBXL 4FA8A 1MAJA 1P4LA 1C5CL 4M6ML 5E7FA 2YC1A 3O0RH 4JN1L 5CJOH 2G2RB 4KRPC 2FO4A 1UKSA 1CFVL 4GT7A 3D39E 1X5LA 5JDSA 2BNQA 4NQSB 1S9WA 1G9ML 1P7QD 1DBAL 3CIQA 1EX0A 3ZKSD 4P0DA 3FO9A 2Z31A 1S3KH 1B0RA 2J88L 4XMLH 2FIKA 4S0TD 4OGYH 4UV7L 2X4RB 3IJSB 4JY4B 1KSRA 1A1OA 4NCDA 1KIPB 4GBXD 3TVMD 1WK0A 2DQFA 2VQ1A 1GOHA 1JV5A 3C60A 3GK8L 3O2WL 1FRGH 3ZDXE 4M61A 1A7NH 5T1LA 4PG2A 2MTPA 3JWOH 1Q0XL 2XOTA 3PHSA 4HK3J 2R1XB 3TC9A 5C0AA 4BSWA 5IEHA 3HE7B 2OP4H 3OKEA 3F6IA 3HZKA 2F19L 1MCHA 4OLZL 4Y7MA 1XGYL 3QH3A 3BIBX 4TOYL 5FHBH 1MEXL 2JB5H 5DRZA 5IJKA 3BEWA 3E6HB 3A6OA 4PD4K 5EBMB 5B21A 3U7AA 1FNLA 3QEUA 1A7RH 4QLRA 2H26A 4QRPE 5IM7B 1G7JB 3LKQB 5AZ2L 4CVUA 3RU8H 1YNLL 5D1QD 1SVZA 3OAYK 2RBLA 2UZYB 1LO0H 3ZZ1A 4OM1L 4CNIB 1G7QA 5C0GB 1UA6H 5D96B 2Y9RT 4HUMB 3ET9F 1FNEA 4GW5A 2VLJD 1KG0A 4WY7L 4MXVF 3VWJC 1NCCH 3LZFH 3ARFD 1OQXA 4HS6A 3GNML 1S7QB 4OFPA 4OF8A 4RGOH 4I0PA 4TRPH 2APTA 5JLZB 4MAYA 1JGUL 2HLFD 2KZWA 1F4YL 4IS6B 4HQQL 1LO2H 4N0UE 4NDMB 3L3KB 1CFQB 2F5AL 2W9DH 1U6AL 3CXHK 5LKNA 4NN7B 4RBPH 1M6OA 2BVPA 1KIQA 3GSQA 3WD5H 1JYVA 1FV1B 4E9LA 4FMFA 4PJGF 1PZ5A 2QSCL 3OR7B 1JFQL 3QPXH 4R0LC 2NLJB 1YN6A 1MELA 5HI3C 4JFDA 1LHZA 3PWUA 2H41A 2AEPH 3G04B 3TBTB 4UTBH 4LFHG 4LHJB 3KPNA 1WICA 1NC4A 1TZGL 3WO4B 5T3XL 2EE2A 5ETUA 1YEGL 1H3PH 3RNQB 1X44A 4YWGH 1PZUB 4YXLL 1PKOA 3SO3B 1KB9J 1Z6JT 4BQ6A 1QLFB 2CRYA 1IEHA 1HHKA 2VDRH 1OTTD 3NAAH 5I6XC 4UDTB 1JRHL 2XKNA 4JO1H 4XXCA 5ESVB 2BVQA 3IJYB 4YHZL 2EDLA 1XR8B 2J4WL 3BPOB 4PJBA 3D3VD 5IHLB 5E70A 1YEEL 4K3HA 3GJFK 4JO4H 5ICXB 2LABA 4MJ5A 5T3XD 3QFJE 2FJFB 2Q7NA 4QKXB 2ZUUA 3ZHDA 5HDQH 1GCFA 2VDOL 3F65A 4D94A 1ZMYA 4OGXH 1VDGA 3EDEA 4CDGC 4PJ7F 1Q9LA 7CGTA 1NBZA 3GKZA 3K8MA 2EIEA 2MCPH 4P49A 4U1IA 1P84J 4C56B 4R7NA 5EU6B 5C2BH 2X4TA 4LKCA 4JCLA 5HPMB 5D7IF 3VFGL 2R4SH 1FL5B 1JF5A 4PJ9A 5C3TA 3SE4C 2NQCA 5IW3A 4IIQC 3VRJB 5AYUH 4JHAH 4WUUB 1CF8L 3R8BB 3OAZK 4FQ1H 3SE9H 1CXLA 2VZTA 3V6FA 1NUNB 1I1YB 5AUMB 3KLSA 4WTZG 2BVYA 5F8RC 3O4LD 3HLAA 3MREA 2XTJB 1T1XA 1D5MB 2HWZH 1PYWA 5DHXB 1IT9H 5LQBH 3L3GB 2O5YH 5FCUL 2HMID 5CP7B 3QXVA 4M7LT 5B8CB 1TVHA 1FPTH 3QIUC 3TO2A 5JQ6H 1N59B 3GIZL 4P4KB 2KH2B 2AJ3B 1E4XH 3VFSA 4LP5A 5DHVH 1RUQL 1K3ZA 4MJID 5DSCA 4GXUN 3W39B 3QEQB 2EH8H 5L2JA 1Q38A 5DR5L 2YD8A 3SDXB 1AGCA 4PRPA 2HAZA 2OI9C 2W9LA 4N0CD 3WIHH 3IDJA 4PJGE 5EOCL 3MLXH 5IT2H 1H5BB 1AHWC 5ACMA 3V8OA 2UY7A 3BE1L 2IFFL 3HPLB 1BAFH 1ES0B 1EO7A 4KMTH 4PJIA 3BD5A 2BOBB 5I71B 4F7EB 1T20A 4ZFZA 2BHUA 1XGTB 3HE6B 2VNCA 5GGSA 1DZBA 1VFUA 4FFYL 5KVGL 1ZGLM 5GRYA 1CD9B 1NAMA 1AGBB 3H3BC 2X7LB 2Z31C 4AL8L 3HUJA 1N3NA 3EO0A 3IAGC 3O6FD 4I4WB 1AO7E 4PP1C 2GJZB 2FD6H 3UTTA 4X4YA 3ALPA 1F5WA 1EEUA 4ZUUB 3C60C 3PWVB 1NFIA 2DRUA 1T1WA 4J3UA 1QFHA 2CD0A 4PG2C 2N56A 3OG4B 5GGVY 2WQRA 5J6HA 2PO6C 1XH3B 2IBBA 5GIRB 3MV7B 4WJ5B 3GIVA 5C07A 4QCIA 1T1ZB 1VEOA 4LCUA 2HH0H 1G84A 1AJ7H 3KPSD 1L7TL 4GRWH 1R3IL 2ORBH 4J8RB 4U1LB 1B2WH 5IJKC 1UG9A 3IU3B 5ITBH 2BCKA 1MHCB 3F7VA 5E5RB 4JY5H 1MQ8A 1ED3A 1FCGA 4Y0GA 1EZVY 1CLZL 2AXJA 2ZOKB 1YMMB 2AP2A 4P57A 5IW1A 2ZCLH 3ARZA 1JPST 3LKSB 2LU3A 3BZEA 1MCRA 1AY1L 4MMXC 4DQOL 3P77A 4L8SB 3ZKMC 4HCRA 1BGXH 1H3UA 3NFNA 3J7HA 3GMPB 2ICCA 5BZWB 3EFDL 1JTTA 3MUZ1 4OD3H 5CJ5A 5I15L 2OTUB 3KVQA 1TJHL 2XY2A 2XTLA 3BIKB 5J11B 3HMWH 4HXBH 3BAEL 2HTKD 2VH5L 4WEUD 4M7ZB 5INCA 4MAYC 3BZ4A 3B2VL 4HKBA 4DK3A 4L29B 4HS3A 1IC7L 1X5IA 5C0RL 3VD9A 2BX5A 5D5ME 4PLKC 3QHZH 4P9MH 5HGDB 3Q5YA 3WKML 4HUXB 2EH7H 5TH2B 1IM3B 3LKPB 1B6UA 4KMLB 4ZTPH 4JFED 5KVFH 5IROC 2ESVB 4NQXA 4OFYA 4YHML 3ARBC 3TBVA 3BPNB 2IF7A 4DW2L 4RISL 3GSNA 2HT3D 3VFNA 3L95B 3OKMA 5DJYB 4ETQA 4D0CB 1KTLB 4I8DA 1YQVH 4K7FB 1GZPA 5HYQB 4NM8L 5JXEA 3PWPE 3R0MA 1MHPL 1QNZL 4XP5L 2Y5EA 1KLUB 3KPLB 3UC0H 2FX7H 3OGCB 3S35H 2W59A 1A6UL 2V7NB 4M5YL 5BQ7A 2ITDB 4Q2ZA 5HSFA 1M71A 3REVB 1GPOL 4OCXH 1VFAB 5F70A 4XVJH 3OWEA 2R23A 1A2YB 1T03L 1MJ8L 4CU7A 1OGAE 3W2DL 4CMHC 5KSAC 1VFBB 1H8SA 5EA0L 3TGXA 5I1HL 5IBTL 2WINA 1RZJC 3EO9H 4JFOB 5CBEB 3HNSH 1RVFH 5FIEA 1YJDH 3GI8H 4KQ3H 2DYPB 4IDJH 4X4ME 3L7EB 3MLTA 4MNHB 3CVIL 3UO1L 2Z92A 3FB5B 4Y4KA 5DURB 1T83C 1GSMA 2F15A 1NFDA 1I7UA 1JWSB 1U58B 5DDHA 12E8L 1NL0H 3BP4B 4MJ2A 5GSRB 1JI1A 5C3LD 5F3BA 4LCCB 3QJFA 4WO4D 1BVKA 3LRHA 5J56B 4OIAA 1DBMH 4MS8D 2AK4D 4OZGF 4K94H 4ZUTB 3LSOB 4JFYA 3JV0A 1JWMA 1RU9H 3BKYH 3MMEB 5C0JB 2XZZA 3O11B 2ZZUT 3ZHKA 3MZTA 5KSBA 1V5JA 1ONQA 4PRDB 1VADB 3F7YB 2X4QA 4LPXA 4ODSH 5JO5A 4P2QB 3R1GL 4F57L 1AGDA 3V9FA 4Z6AT 2YPLD 4G43A 3SOBL 1BVLB 3PQYE 3H42H 3IFNL 1MHHB 5F9JA 4JHWH 4JG0H 3FMGL 4TULH 5IB5B 4FXGA 3GUTA 4PD4J 2VITB 4D0DB 4Y4FB 5BRZB 4JFFD 3VXRA 3IAPA 2VXQL 4OLVL 5DO2C 1F13A 2Z91B 5TE7H 1FO0B 4HK3N 1U8OB 4XNYH 1BEYH 4NKOA 4LIQE 3QCVL 5DS8B 5C0BB 2FSEB 2YUZA 4Y4HA 1OW0A 3OZ9H 3V6BR 3Q5OA 1UB5A 1O7VA 4B7IA 4ZXBA 2A1WL 2DOCA 4Q58C 1T5XB 1IGFH 1QHOA 4OGAD 3PHOA 1MRCH 1KCSH 4N0RA 4R4BB 3MLUL 4O58L 3QI9C 2HFFA 5KG9A 3CX5K 3MRBB 3GMQA 4NQED 3SHSA 5HDBE 4JRYB 3RPKA 3GKWL 1K4DB 2Y6SC 1HHGB 4NUJB 4M1DH 5ID0B 3LRSA 5DQJA 4FHBD 3BW9A 3BSZH 3V5DB 4AT6A 1VEMA 1MJUH 1MNUH 4NQVA 2ADJA 1FZKB 2IMNA 3ALWA 1I85A 3ARDB 1M7DA 3WJJA 4PJGB 1I8IB 3R8QA 3CXHJ 4WGVB 1MCKA 5IF0B 4NQDE 3U0PA 1AQDA 4LU5L 1KB5B 4AEEA 2ZNWA 1ZS8B 3B2UD 4WUKH 5SWZE 1IGML 3TT3H 2FBJH 5GZOC 1NLDH 1INQA 2DI8A 2FNBA 4S2SA 1QR1B 1UEMA 2W65A 4ZOEA 5EO9A 3N9GL 4HGKC 3RZCA 4KDTA 4D9LL 3QWQB 4LSUL 4O5LH 4KTDH 4NC1C 4PV8A 1FFNB 1OWWA 1IVLA 1I3GL 3KXFD 2CKBH 4KAQH 5C9KA 1NBQA 4HW6A 2E9IA 2VXSH 4I3RH 1CGSL 5FYJE 1NLBH 3BUYB 4LPCA 1Q72H 3P9WB 4NZJA 3TA3C 4KJQC 2A0LD 2OZ4A 3BKCL 1HQ4A 1YZZA 1I4FA 3LKRB 4I13B 1KN4H 3RVXC 4J3WA 2R2EA 1RUKH 3TYGH 5JHDB 5MEQA 3HB3C 2UWEA 4PJ7B 2ZWLT 3VA6A 1Y18A 2B1AL 3JTTB 5CD3A 4KKBD 3CFBB 2BHYA 3VFUB 5L8JB 1SEBB 1H3TA 4OF6A 5L8KB 2YD4A 3K0WA 5D7IB 2UZIH 5FDWA 4GG6F 2H1PH 3SBWA 3UZQA 4M8QA 2QADC 5K9KB 1R5VA 2WBJD 3MRHA 3U79A 5LCVH 3CPLA 2FEDC 5EUOF 5I18L 1FZJB 2ICES 2YPVL 4AEHH 1BQLH 2JJUA 3W0WE 3LPWA 1P2CB 2DQTH 2J7LA 3PJSA 3VFTB 5CZXC 3I6LE 4KK8C 4A6YH 4U0QB 2H2SD 3ULSA 1EXUA 4QHUA 1A0QH 3KPRE 5E8NA 3P9LA 3PP4H 3QDMB 5IV2B 1Z9SA 2XA8H 2B7DT 3MLRH 4P46C 3TN0C 5D7LB 5JW4M 3DX8A 1D6VH 5MEPB 5EORL 4G6KH 1MRDL 1PFCA 4G9DA 4HEME 1A6VH 4FQCH 2PCPB 3KJ6L 4LCIH 1CDGA 2QBWA 2OK0H 1JPTL 5I75B 4NM4L 5A1AA 2I60H 3CFJA 3TFKC 1U93B 2CGRL 3GGWA 4HWBL 2R39A 2CIIA 5FYKH 4N8VB 5J9PB 2CDGB 1U8KB 4S1DC 3P0YH 3D2UD 4OI8A 4M1GL 3D25B 4AEIH 4OFDA 2AEQH 3MV9A 5B38A 5BJTA 1NDGB 5ISZE 2FLBT 4NZUL 3BWAB 4Y4KC 1MY5A 3HKFA 4LVEA 4ONHA 2IGFL 5TDNA 2PKDA 3W9DB 2NX5B 1E6JH 4OKVA 1INEL 3VWJB 2APFA 4YDVA 3IF1B 5M94B 1FFOA 3HFMH 4QRRE 2CJUL 4MVBD 5K9JL 3MRLB 1UXWA 3PWPB 4QTIL 4OSUL 4DGYL 1MRFH 1CFNB 2AV1A 1UM4H 3GMOB 1D5XB 2YBRA 3CMOL 5DUMH 4YHPA 3OB0H 4XBPA 5FUCE 2AABH 4E5XA 3IXAB 3UDWC 5H37G 5C0EB 4XNZC 3E6FA 1YQ2A 3ARWA 1R0AH 1MCWM 4PV9B 1A6TA 4LLVA 3BGMB 3GMMB 2CDFA 1QQDB 3DBXB 4QTHA 5A2LH 3FQWB 5CWSA 2YKLH 1X4ZA 4XPTH 5EUOE 4F7CB 5CGMA 1AI1L 5M7QA 3CK0L 5JPNA 3VH8G 4YHKH 1CGWA 1DLHA 2FBOJ 3O4LA 5DT1H 5INDA 1UWEL 2HRLA 2Z93B 4M48H 5JXAH 3HR5A 1BJMA 1TQBB 1V8HA 1IAII 4Y4HC 1ERNA 1B4JH 1RD6A 1KCLA 1PG7H 1HQRB 4K8RL 3O3AB 4KVCH 1P4IH 3KYOA 2IPUG 3TNNA 5IJVA 2NY0C 4Z7UF 5E9DA 4KKAC 4X7EC 4DK6A 1V3LA 2CLRB 1PQZA 3SJVE 1SQ2N 4GAGL 4XWGL 2R2HB 1S5HA 2MPAH 4K8RD 2NY7H 3S3SA 3LPFA 3WJJC 2IEPA 4Z78A 1DUZA 4YR6B 5EZJA 4P23D 4MJ6A 1KCUL 4NUGL 5I30L 4G3YL 3VMOA 4DZBA 2DJSA 3INUL 2GEEA 4X9FA 2DN7A 5BCAA 4M7JH 5F97E 4ODVH 2AI0H 1OTUD 4HX1B 3QIUB 5CUSL 5EO0B 1C8PA 3QDJD 1PKQE 5DRWB 1EERB 4EBQL 1WAAA 3MRMB 1NC2D 4UNVA 1NAML 4GBXC 3TVMC 4GH7B 4ODWA 1JI2A 3QA3B 3WEXB 3PP3K 4JQVA 5DHVA 3OKLB 1G9MC 3IJHA 3BH8A 4IOFC 3ZE0E 2ILLA 1NMBL 4WIQA 5F7KC 3G5VB 1BMGA 5LVEA 5BVPH 2OI9B 1K2DB 4PFEA 4WV1A 4Y16A 4I0KA 1BBJB 3U6RB 1FVDA 1AHWB 3WFDL 4P2RD 3WIHA 4HG4K 4O9HH 5E5UB 2O61B 5FKPA 2E7LA 2YSSA 5IBLD 3OF6D 4BELD 2DD8L 3BD4A 2BDNL 4Z76A 2J8HA 4RIRB 3DHJA 3SBWC 3RKPA 4Z7VE 3UTZA 2QR0A 3DI2B 4PRHE 5KVEH 4LBEB 5E6ID 1DQTA 5D1QC 4GKOA 2ICWJ 3HG1A 3LIZH 3T04D 2VDKH 4R3SA 4JDTL 3ROLB 4YBLC 1W2KT 2DM7A 4RFEA 5KOMC 2AK1H 1A7PL 1S7SB 4F3FA 7FABL 5F71A 3FFDB 4IRSD 1YUHB 1Z9MA 3V0AC 5K9QG 5DLMH 2OXHA 5CP3H 2IANA 2R1WB 3ARFC 4IMKC 4OZGB 4XMKL 1R5IA 1VGKA 5CSZA 4LLUB 1TZHB 4H88L 4HCRL 3P3YA 1V7MH 4PGDB 4X6CF 4Q6IA 5ESQA 1S7UB 2HLFC 1F6FB 1JN6B 5F7WC 3HN3A 1S7TA 1X5AA 2PO6B 4QHKI 4JDVB 3ZTJG 4X99A 5EPMA 3QYCA 1WFOA 4ZS7H 3SDAD 3TCLA 4MNQD 3UYRL 5JW3L 4OJFH 1YEHL 4MX7B 4LQFL 2Q3ZA 1NJ9A 1PX3A 3KWWB 3RL1A 5F89B 5CD5D 5F3HA 3DGGB 3P4OB 1CDIA 1LK3L 3CZFA 1T5WB 2JIXB 3C08H 4J2XA 4FOMA 4XZUB 4GMTH 4H20L 1LEIA 2YWYA 4Y1AA 4RZCB 3GBNH 3ULUH 5F9WB 1A6ZB 4JREB 4GAYB 2DWDB 4H26B 3S37L 3GMRB 3W0WB 4R97C 4GSDH 5JA8B 2XZCH 1HH6B 2SEBA 1CGYA 4URTB 3FO1B 1FN4A 4P3DB 3VXUA 3IB4A 5D2NC 2DMBA 5FXCH 1G1CA 1G7PB 1UB6B 4ODTH 4H0GA 5IB1A 4NO3B 5JW5A 3O2VL 1TQCB 4ZUSB 2AQ3A 3HPJB 4AM0B 2X44D 3SDYL 5JW4Q 4E0RB 4M3JA 2W60A 1L6XA 3D18A 4OBSA 3ILPB 3DRTA 1H15B 1U42A 3CX5J 4ODUA 3BHBA 1RIHH 1WWBX 4XBEL 3BMWA 1WFNA 1V3KA 1NGYA 3REWB 4OD1L 1GC1C 4TUKH 1LO3H 2YA0A 3N1FC 4GKZA 2OX5A 4NFBA 3ARBB 3MUJA 3S4SB 4PGEA 3K46A 3A6BL 4PJHF 4DVRL 4TN9A 5A3ID 4KUCD 5D72H 1FHGA 3ILQC 3HA0A 2W0KA 3BGFC 3DUSA 4HZLB 1NEZA 5I1LA 2M2DA 4K7PX 1C1EH 5ISZB 3LEXB 4OZ4A 2HMIC 3K1DA 4O2CA 2QQNL 3PWNB 3SQOH 2AV7A 5E8DH 1HYRC 4R96B 1Q9KA 1WZMA 1CLYH 4N9GA 4C55A 4WU7A 4GXUM 3ULVD 2O93L 4OT1L 2PNDA 3QO1A 1JGDA 1QSZA 3VJ6B 3RWIA 4G42B 1KNOA 2AJUH 2UZXB 1G7LA 4LEOB 2P5WD 5IG7B 3C09C 4HGWB 3GDBA 1N0XL 4IOIA 3O6MH 4N0CC 1JGEB 4TNVF 3DVNB 4WHTA 4ZFFB 1S7RB 3MXVL 1ZLVK 5C09B 5BZDA 2XT1B 3IFOB 3THML 1G9NH 4WHYG 3S36X 4GG6B 2ZG1A 5MHSE 4X80H 4JFXA 4DGIH 5KSUA 5IR1A 1HILA 3VGGA 2OR9L 4WI4A 32C2A 1RI8A 4NQCE 3TNMB 2Q76A 3T8XB 5EUOB 5DQDH 1KN2H 1FL3A 4JFFA 5GJSL 2I25N 1IGCL 5IESH 2IQAA 1DQJA 3C6LA 2HKFL 3MRFA 3QQ4B 1P1ZB 3CSBA 2AKRA 5HYIA 1WZKA 3O6FC 2IH3A 1KV3A 3OKOA 3FN0L 2ZUWA 5E8OA 4BH7A 3FN3A 3IFPB 1QVOA 1JHLH 3MQIA 4YHOH 3NMEA 3FCTA 5J89A 4AENA 1G0DA 1FH5L 5ANME 3NCYP 2HRPL 5D70H 3U7YL 1NBYA 3FB6B 3GI9H 5T1DL 3SE8H 1NMAL 1NAKL 5L88L 1G0YR 4FTVD 1UM5H 3DO3A 2J8UF 8FABA 1OAKH 5KANG 4PJHE 4C54A 1M4KA 3V4PL 1E4WL 5BS0E 3MRDB 3T65B 4GUPA 5J3HD 2X4SA 4YFEA 1F6AA 3NTCH 4P4RA 4PS4H 5ESAA 3IS1X 3ZL4H 3QT2A 1RFDH 4EIZC 4OBRA 5FO9B 4HH9B 1MVUA 1MCCA 1XZ0B 4EDXA 5IGXL 1A1MB 3MRNB 2ADFH 2R9HD 5DF0A 5LG1A 1BD2E 4IOSD 2O5ZH 1IGJB 1KXTB 2ZOLA 5I19H 5M95B 1DFBH 4QRSB 3GBML 3IETA 3B9KD 3L7FA 4ERSH 2EYTB 5C0DA 3GFUA 3AAZB 4OZHA 3T0WA 1A8JH 2NXZD 3QI9B 1SY6H 1MCFA 5TF0A 5CEZH 3P0VL 1KIUA 3R06A 2HTKC 3SQBA 5CSBA 5I1JH 5TE4H 2VLRE 2HJLB 1XCQA 3D9AL 4NYLB 4I3SH 3QIBB 4RGMB 2PR4L 5F7EL 1EGJH 5A2JH 4N1EA 1YEJL 3MGAA 3IDGA 3O8XB 2EEAA 4PRIE 1REIA 1XF3B 3VXME 2NY1B 2HT3C 4PRHB 1QSFE 1YA5A 4F8TA 3O0RL 3KPTA 5CJOL 5FA4B 5FUOL 1QYGL 1OAUH 3MNVA 3UTPE 2FHFA 3GSVB 2ZG3A 5I73C 3H3PH 4YBQD 4PR5A 1WTLA 4JPVH 3IDNB 1GAFH 4R26H 4EQ2A 1RJYB 5GS0L 4PJ8B 2F54D 5HHMB 1TTUA 2CKBA 3E2HB 3TA3B 3GO1L 5DJAA 1DQLL 3V5HB 1FNSH 2GY5A 4CVZA 4XMLL 4Z7UB 3FT4A 1XGPA 4V1DB 5E2TH 1IGTB 5C0CA 2IG2H 5GS0D 2MOVA 4GRLD 4OD2A 1GRWA 5T1KA 3MGOB 1U91B 2BNRB 4CU6A 3JWOL 4ZPVB 4H8WL 4CAGA 1HHIA 4JJ5B 2OP4L 3UTSD 2APXA 4HKXA 3LKNB 1LK2A 4GAFB 1FGNH 3BO8A 4Y5VA 1T3FA 3RQ3A 1MJJB 1P7KA 1LEGB 1VPOL 1N6QH 4F58H 4JFHE 4EXPX 5KW9H 1JZ6A 5DQ9B 1S5IH 4N8CL 1ND0A 1ZVYA 5F88A 2WP3O 5D7JB 2BERA 4MDIB 4P46B 2DDQH 3BDBA 1CGUA 5ALCL 3RWJA 3TN0B 4A6YA 5TDPB 3F7PC 4WO4C 3ZT7A 1CDUA 3RWEB 5EH1A 3PNWA 5FOBA 4BJLA 2XICA 2RFXA 2XRAH 5K59F 4MDJB 1MLCA 1UEYA 4XVTH 2V7HB 3UZVB 1U8NB 4AIXA 4H0IA 5E2UL 4OFIA 1T7YA 1NCCL 2DF3A 2ATKA 2DMCA 4XP1L 2DWEA 3LHPL 4PJXA 4TVSa 1VSCA 3T3MF 4M7KH 5I76B 3L5IA 4FFZL 3T0EE 2UUDK 2VAAB 2B1HH 2X70A 1BFOB 3I6GA 3OR6A 2QL1A 2IH1A 3F7QA 4W4OC 5CEXA 1EHLH 1AIFB 1JHKH 4KQ4L 1U8MB 1T89C 3WD5L 3HR6A 5I66A 1C16B 4DUVA 4XVSH 5F7LB 3O6KL 4M6NL 1E28B 4LLDA 4CGTA 1NGXA 3KYAA 4FS0A 2Q3AA 2DAVA 2AEPL 3G9AB 3QXDB 1LGVA 1JNHB 4O4YH 1XGRB 1N5AB 3V6ZB 1F2QA 3FRPA 2XWJA 3QUXB 5HJ3A 3BN9C 2D03H 4OGAC 2PYEE 3ZE1F 4X6CB 3GMNA 1JRHI 2VDRL 2QHLA 1CS6A 2VQTA 1QLRB 1A14H 4K55A 4XNZB 3ETBF 3RUGE 3VDAA 4F7TA 1QD0A 4PJDF 2Q8BH 2UV3A 1XIWA 2X9XA 3VMNA 3VFRA 2J2ZA 4LPYA 5F6HJ 2ICEB 2R56L 2YHGA 3ZDZF 4QRUA 3QUYD 1WIPA 5HI4D 3A6CL 3LQAL 4OLXH 5GS2D 4OZFG 4KK9D 4OGXL 4P23A 3ZTNH 4TQEH 3FQRA 1HDMA 1CD1B 3B2UC 4RWYL 2WUCH 3FRUB 1FFPA 4YDJA 4L3EA 2VDPL 2BVOA 4HIEA 5KVDH 2ATPA 3KG5A 4CVXB 1G6RB 4LQ1A 4FP8L 4WWID 4FQ1L 1QRNB 1K9TA 1NC2A 5FM5M 3WCYA 3CUPA 3AREA 3SDDB 5FYJU 4Y5XA 2BSSB 3EOAA 3D6GA 2YD2A 4G9FE 1HSAB 3TEUA 1IT9L 1CYGA 2A0LC 2NY0B 5LQBL 2D0FA 1OAQH 2F74A 2NW2A 2J5LB 3QWRD 1MIML 4PTTA 3KLAB 1F8TH 4L8BA 5F7MC 3QUKA 2DQGL 1JTOA 1AD0B 3BPCA 5ANMB 4WWKD 1U8QB 1VKXA 3GB7A 3I02B 1J10A 4BKLA 4KKBC 2C3HA 1WITA 1IAIM 5F1SA 3JXAA 4JRXD 1ACZA 1OP3H 3MNWB 1HHHB 3OF6A 1A6AA 1RZKH 5F72S 5I1AA 5DC4B 1RJLA 1M7IB 1I3RA 1OGTA 4PJHB 5CEYA 4QYOA 3K80A 3L3OA 1ZA6B 1F4WH 4RBPK 2P24A 2WBJC 4XHJC 5E5MB 4OIIL 1P7QB 3S98A 1JIBA 1UC6A 1R3HB 3G5XA 2F53A 4DFIA 4Z0XB 3G6AB 3VRIA 1BAFL 3HZVA 2B4CH 2CKNA 2H2SC 4PP2B 3WNPA 1UWGH 2HJKA 3CNKA 3RBGA 2HP4A 4GBXB 3JWDL 2YUXA 2OS7A 3KNBB 1YEFH 3I3EA 3ROOB 3CC5A 4TVPL 2W07A 3W81A 3VXSE 1YYLH 2BC4A 3VCLB 2C1PA 3DRQB 5TQ2H 4D8PB 2NTFA 4WU5B 4PJDE 2IAMA 4Z5RB 1LEKA 2XXCB 1I8MA 3ZDZE 2HLAA 1LD9A 5E8EA 5IMMB 4IDLA 1JJUA 4OCNC 1JNLH 1HXMA 3WDIA 2C3WA 5L9DH 2EC9U 3TIEB 4TVPD 3MFFB 1FSKC 3FL7A 3K7UA 4X83A 2W0FA 1NUGA 1I9JH 2BMKB 1KJ3L 2X89A 1OAYH 1OD9A 2BOCA 3K8LA 3OXRB 1YECH 3LDBB 5D1QB 4QOKE 1Z2KA 4HJGA 2HH0L 1AJ7L 1ITBB 2R15A 2ORBL 5KJRL 5A2IH 1KEML 1EBPA 3BQUD 4MA7L 3HC3H 4D3CH 3ORJA 2VLJB 2PXYA 2W0PA 1TXKA 2H45A 5JPMA 3V4VL 4AIOA 3T77A 3MOQA 5HGHA 3IDYC 3DXAE 1RIUL 2NXYB 2A77L 2C26A 4MVBC 4BSVA 4Z7NF 1FJ1B 5CP3A 5L2KE 4CN6A 1F2XK 3VFMA 4YHNB 3NFSL 4UILL 4WFGD 4QRQA 4LHUB 4S1SL 4G6AD 5BMFH 4K23H 5C9JB 2RAMA 4LLQB 5HYSG 3EZJB 4WEMB 4CJ0A 2WIIA 4OD3L 4OIBA 4HUUA 3AMKA 1DJSA 4RX4D 1KOAA 4WW1B 4BQCA 1OWRM 2J8UB 1UKTA 5DK2B 1JHTA 1IEAB 3HMWL 3QJHB 1KTKE 4W6WB 4HHAB 1AGFB 1J8HA 2EDKA 4BZYA 1U8LA 4LAQH 5DXWA 4DVBA 3QQNA 4UUJB 1GZQB 2Y06L 2AJXL 2EH7L 1BQHA 5T5NG 5CBAB 5E94B 4HBCH 2ZUTA 4QY8A 2ENSA 3SDCB 2FYYB 3FQUB 4NC0B 1BFSA 3VE0A 4JM4H 5SWSA 1JBJA 4XAKD 2ARJA 4HLZH 4MCYB 1CQYA 2GT9B 2NZIA 5D2NB 2Q8AL 3KHQA 3D3VB 3SE3A 1QSEA 4L4JA 4HFWB 2EDEA 1GGBL 2YPKB 4OI9A 3QUML 2QHRH 3MYJA 5CS7A 2AEIT 3G6JF 1RZFL 1YQVL 3M1BA 2P5WA 3JTSB 2B2XH 3PIQA 5CZVH 5IK3B 1J1XL 5CILH 3DX9B 2JCCA 4U1KA 3NA9L 1ZXQA 5CHNA 2EYRA 4NHUA 3OHXB 5C6WH 4FQLH 4K8RC 3BP7A 4BH8B 4ZMAT 2QEJA 3OV6A 4XMPH 4XVJL 2ID5A 3T0EB 1FFRA 1BF2A 3BGFB 4P23C 4J1UA 5C08E 4TUJB 4CADB 4D2NA 1OB1A 3Q6FA 4DCQB 1T4KB 1XT5A 4L4VE 1T22A 1MFNA 3V0VA 1GHFH 3GJEA 4TTGA 4P5KB 1O5DT 4HIXL 4KQ3L 1F11B 3ABZA 3VXQA 2BSTB 3J8F7 1GGCL 1AXIB 2A2QT 1YY8B 2DLGA 4IMLB 1FVEA 2WM0A 4QNPF 3UBXA 5HHOA 1NANH 4LSTL 2A73A 3MRKA 1DN0A 3MRPB 4MJIB 4X6EA 3SCMD 3BH9A 4LNRA 1I9IH 5CZKA 5K9QI 4H0HB 4ZODA 4BK4A 4ELMA 4NGHL 4JKWA 5H2BB 5LGKA 2OMNA 3OKNA 2AXFA 5BOZG 3SKOB 1HINL 3RL2A 1PW3A 4K94L 3EYOA 1UFUA 3K1KC 3U1SL 4Z8FH 3GSOA 4O51B 1KTDB 1B9ZA 2QSQA 5I1DB 2D7MA 5D1XA 1I7TB 5IBLC 3BKYL 1A6WL 3O9WD 4XBGA 2R0KL 5IIEB 1FL6A 4R90L 1ZSDB 3MACL 4UAOB 1IM9D 4XI5D 3FTGB 2KL6A 2XYCA 4ODSL 1R3KB 5EC2B 5E6IC 1JWUA 1TVDA 3MGTA 3ARSA 1EHNA 3N1PC 2ADIB 2Q86B 3QRGL 5GGQL 5LJYH 4LEXL 4U6HA 2CUMA 3O6FB 4ZNEA 2NYYD 4JHWL 2Q7YA 4J4PA 1QA9B 4KI5D 4IRSC 4WI5A 5I1KL 4Y2DD 3BJ91 1BZ7B 3W9EA 3G6JE 4X9GA 1PJ9A 4QO1A 4ZQKA 2AJSL 2E8YA 5DMIL 4NHCL 3UTQA 2BNQE 1BEYL 4FQHA 5DRXA 3LB6D 2BXYA 5JA9A 5HGGS 4G9FB 2YD9A 1Q9OB 1YNKH 4P2OD 2IAMC 5CJBA 1MPAH 2GK0B 5FYLH 4TUOB 3I3BA 1J11A 3SDAC 4HWNA 1TCRA 3G5ZB 1IGFL 3KPSB 3L5XH 5DD6B 4K3DH 2LVEA 1Z9LA 3QEQD 5IB3A 2GAZA 3B5GA 3EKCA 2WSKA 4M1DL 5ILTH 4G8EA 1MFCH 4GQ9H 3S5LB 5C0AE 4ZUWA 1Y0LB 4CJ1A 1H3VA 1R3LA 3S96A 3BI9X 5ALBL 5DZLA 2I5YH 5DRNB 1INDL 2X1WL 1T2XA 3PUCA 3EBAA 5E2WL 4MNGA 1QZ1A 4HWEH 2IPKB 3QG6B 5I17A 2QQQA 5KZCD 4CN1A 4X6DA 5DA4A 4BZ1H 2F54A 4WUKL 4XPBH 3SGDI 3BKMH 3VH8B 3KR3L 5IWLC 3IT8D 5IUSA 1P4BL 1NLDL 4AMKL 3HE6D 5MEND 4K2UH 4Q6YA 5HYJA 2IADA 1Z5LB 4KKNA 5SV4A 1SY6A 4F7MA 5EU4B 2AJYL 1KCRH 4U3CA 1U8IB 3QIWA 1II4E 1I1AD 2GTWB 3V5KA 1EFXA 3VG0L 4PJDB 5E4EC 5EIIA 1L0QA 1KEGH 5KSVA 1K8IA 1YN7A 4JFEB 1RHHB 3FFCA 5J6GA 4NNXB 2PF6A 3UTSA 3V6OA 3TLRA 2O26U 2NY5L 5TPWH 2QQLL 1EGJA 5A3IC 1C08B 3WN5B 3JUYA 3OAZH 4Y5YA 5CSGA 3RWFA 3DSFH 3MV7D 3ZSTA 1TTFA 4NWUL 1DLFH 4XC3L 5E0QA 5DZOA 2RHEA 5LBSH 3KPOB 2X4UA 3BXNB 1U92A 2H1PL 1S7XA 5I73B 3GMLA 4KHTH 3FZUD 4JFPA 1SHMA 5ID1A 4KVNL 1CE6B 3MJ9L 1ZHKA 3DX6B 4ZDHA 3AU1A 4OGZA 1OM3L 2Q6WB 1F6LL 3VD5A 4JFDE 5HYEA 3D39D 3PL6A 3ULVC 3DX7A 4Z7OF 3O2DL 1QTYT 3H0TB 2EKSA 1HH9A 3UP1A 5C0NC 4PTUB 2DQUH 3RGVB 1A0QL 4W81A 2VZUA 4E42B 5CJQL 3K4AA 5DFVD 3PP4L 2XQYK 1LNUB 4YH6A 1MI5A 3GBLA 2J6EL 1JPFA 3ARPA 4MZ3A 1A6VL 2RCSL 5HHQB 4LCIL 4G8GA 2OK0L 3VW3L 4U2ZA 4PJBE 1FNHA 4M7LH 3L5WB 3NVQA 1GIGH 3MO1B 3H7BA 4OLUH 1IQDB 1HIMH 2MFNA 5FYKL 3NCEB 2FWOA 1NGPH 2D7OA 3NCJL 4TSAL 3MCG1 3P0YL 2BSRB 1S7VA 2I26N 3WIFB 2C3VA 4HK0A 1D5BB 2VB5A 4WO4B 4POZD 3FO0H 4HJJH 5C0FB 5I1IL 3MCLH 3RWGA 3WFCH 2WMPA 4OFKA 5IMLB 1EBAA 1KLGB 4ELKA 3U4EA 2K9UA 4QRPD 4NN6B 2NW3B 3NIDE 5C0IA 1QFUH 5IEKA 2DIJA 5F9AC 4J3OC 1H3XA 1MCSA 1N8ZA 3KDMB 2YPLB 2OXGA 1MRFL 1U3HA 4IRJA 4AQOA 2FZ3A 1EV2E 5DUML 4OV5B 1HCVA 1V05A 5F7NC 3V7AG 4M9OA 1G9NC 2AABL 4X9BA 3DWTA 4QHLA 1T21A 5J3HC 1H0DB 3BRGC 3U4BH 2DLFH 3EAKA 1KJ2H 4PRPE 1JZ8A 4PGCA 3RAJH 3EYUH 2MNUA 2DLIA 1V7NL 4KHXH 2EE6A 1DQML 1GGYA 2BVEA 2R9HC 2YKLL 5EZIH 4X0KB 1CR9H 4YDIL 2VR5A 4KROD 1UZ8B 2AJVL 3B9KC 3VA2C 1CCZA 4MLIA 3WL9B 5DJZA 3B9VA 4JPIA 2KQMA 4PJIE 4YHKL 3ZYZA 5DURD 5DT1L 4ZPTA 1FO0H 3FT2A 3JVGA 2NXZC 2VL5B 2ITCA 4NQEB 5JXAL 3TZVA 2PYFA 3QWRA 4RSVA 4RAVB 4PJCF 5H94B 3EYSL 3MLWL 1BP3B 2G60H 3LD8B 1JK8B 5AAWA 4UIKL 1PG7L 4X7TB 3HUJE 3I85A 4WW2A 1MCOL 1JPSH 3P30H 3I75A 4XPGH 5DK3A 1FNGA 5D7SL 3P0GB 5IVZA 1FC2D 1YC8A 3QZWG 3WNKA 2Y7QA 3MNZB 1ZHNB 3HRZB 3MLZH 4LASL 2VAJA 2V17H 1KPVB 3QFJD 1C5DB 5TFSL 1MHEB 5EU7E 4XGZB 3MRJA 4YGVA 1QBLH 1J1OH 1I1FA 2OJEB 5C07E 3BP5B 1X5FA 2BJML 5IB4B 3KXFB 1YMHB 4YQXH 5EFIA 2DQCH 4JN2A 3QQ3B 3H9ZA 4LSRH 1KENH 1P4LB 4P5MB 3VXPB 2B5IC 2HN7A 4YAQB 4LPWA 3G6JB 2Q1EA 1XF2B 4L1DA 3F12B 3MR9A 4IHOB 3CAFA 3ZSSA 5ICZB 2XFXB 2XZQL 4NT6B 3C6SB 4K3EH 2QTEA 1P5VA 2XPGB 1BQSA 5GS0C 4GO6B 4GRLC 2GFBB 1ACYL 2C3XA 2JJTC 1FYTE 3OB0K 2FIKB 5BVPL 3U4AA 3BPLB 2WBJB 3V6OC 1FGVH 2BY1A 3VFWA 5IQ9A 2FX8H 4RDQG 4QWWD 4BK5A 4I2XA 3PWJB 2F58H 2R0WH 3F8UB 2M1KA 3CH1B 3QHTC 2VOTA 5C0AB 3LRGA 3T2NL 3NZHH 2G2RA 3MLSH 3TH2T 2VDML 1HKLH 2P46B 4KJYB 3QH3B 4H8WC 1BBDH 2A9NL 1A1NB 4NQSA 3ME0A 4PYHA 4XT1C 3QEUB 3PV6A 2H26B 1HNGA 4K71B 3IJSA 4JY4A 4OFVA 3NOIA 1IC5H 3PXJA 4KUZH 5IW6B 2CR3A 4PJAB 3RNKA 1KIPA 2D4FA 1CVRA 4KC3B 1EHAA 1AO7D 2QV2A 3D2UB 4J6RL 1NCWH 1S9XB 1FNEB 4XAWL 5KOVC 1A4JB 2R1XA 5E1AB 1BFVL 2D4DA 3HE7A 4LSSH 3CFCH 1J0KA 4ZFGL 4ZS7L 1ZVHA 3NCFB 4OJFL 2WP3T 5F21B 4DKEL 2O5XH 4G5ZH 4ZYKB 5FEBA 3E6HA 4UIMB 3VDBA 2P45B 5EBMA 4UQ3A 4U1GC 3LN4B 5CLWA 3VI4E 1QPXA 5IM7A 4GMTL 2CRIA 1G7JA 3LKQA 3AY4A 2DQEH 1P9MA 3H3KA 3RY4A 5T5NF 1SJEB 3VG9C 5E1HB 1D5IH 1N7ML 1W8NA 3ULUL 2YN3A 1XGQB 3QEHB 3HMXH 1Z9OA 4CNIA 1NGQH 5C0GA 4DN4L 3GRWL 4WNQB 5D1ZD 1RY7B 2NMSA 5L7XL 4R6UA 3KPNB 3SKNB 2OR7A 1BPVA 2QJDA 3Q48A 5T5FH 5ETUB 2CDEB 1TPXB 3PABB 1S7QA 5GZND 35C8H 5FUZH 4OZIF 5JLZA 3QUYC 1AP2B 1OSZA 5HI4C 3G6DH 4EI5A 4F9PA 3LS4L 4KK9C 25C8H 4IS6A 4GXVH 3L3KA 4NDMA 4R9HA 4P48A 3FAXA 5KS9F 4I9WE 4H1LG 5J13B 1IC4L 5JNYB 1RIHL 4OCWH 3ESVF 5F96L 4ORGB 4P3CL 5KSBE 1FV1A 43C9B 5HGBB 5L0QB 2AVGA 1WQVT 2HTLD 3OR7A 4JANB 2NLJA 4MD4B 3DPBA 3ARGD 3VXTB 4NJAL 1NBZB 3JBG7 5FF6B 3G04A 1UZ6F 3TBTA 3EOBA 3TT1H 2DQJL 3EYFB 1WT5A 3CLFH 3MJGX 4HIIB 5C6TH 5J1TC 3RNQA 4OLEA 4MA3B 1QLFA 1UWXH 4DOHE 5EDXA 3TZVC 5BV7C 5HHXL 4PGJA 3VXRE 3UJIL 3SQOL 1MQKH 4MAUH 5ESVA 5K9OB 3M8OL 1VA9A 3IJYA 3T1FB 4WWKC 4NWTL 3KYMB 1XR8A 2D7TL 4EVNB 3PWPD 3OBAA 4JG1H 4DGVH 2FJFA 1FFQA 4M1CD 4HPYH 2YXFA 3Q5TA 2VIRA 4XNXH 3M17B 1MFBL 4MQXC 1F4XH 1MIEH 5DJDB 4CRPA 3MFGB 5C2UB 3UYPA 1NKRA 1IZJA 4UB0H 5L2JB 1RK1A 1DBBH 4LGPB 5BW7C 4C56A 2YD3A 5EU6A 4FNLH 5HPMA 3QDJB 2F8VA 4PJFF 3K81A 3VRJA 1ORSB 4L9LC 1OGAD 5HBBA 4K7PH 4PLJC 3SPVB 1TENA 4WUUA 3DECA 1JTPA 4Q9QL 1I7ZB 1GJIA 5AUMA 1I1YA 1B0WA 1BIIB 4KZDH 2DS4A 5DJ6B 4L4TA 5LXGL 2VXUH 1D5MA 2FB4H 3L3GA 5CP7A 5B8CA 4ZFZB 3N1GC 4Q9RL 3VMPA 4OM0L 5T33H 5SX4I 1N59A 1ZEAL 3AXLB 4I18B 4P4KA 4P2RB 3S7GA 3RGHA 2AJ3A 4OZIE 1CDHA 1N4XH 3CFEB 4PPTA 4YDLC 3JWDC 3W39A 4APQB 5DD0H 3SDXA 5D70L 2MWCA 2NY3D 3DURB 3MBED 1EEZA 5E6IB 3TBYB 4GW1B 3RIFF 2WBWB 2UWEE 3CDCA 1H5BA 1BM3L 5I8CB 2HVJB 4M43H 2ZNXA 3HPLA 1ES0A 3BQUC 4EUPH 5JTWA 2BOBA 4IRSB 5F1OB 2CMRH 4F7EA 3DIFB 2Q20A 4LIQL 5JZ7D 1YY9D 1G1YA 3PQYD 1A3LH 1XGTA 1FVCA 3NCCB 4XC1H 4POYA 3JZ7A 3C2SA 4G7YH 2VXVL 4D9RE 1UENA 2BCKB 2X4NB 5EWIH 1P7HL 1AGBA 1ED3B 4G6AC 1DFBL 2X7LA 1UGNA 4YLQT 4JM2D 1EUTA 3WMSA 5IW1B 2GJZA 2COQA 4MNQB 3SDAB 5DMGD<