4ZFGH

Dual-specificity fab 5a12 in complex with angiopoietin 2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
215
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTISDYWIHWVRQAPGKGLEWVAGITPAGGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARFVFFLPYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Deep Sequencing-guided Design of a High Affinity Dual Specificity Antibody to Target Two Angiogenic Factors in Neovascular Age-related Macular Degeneration.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/immune system
molecule keywords Angiopoietin-2
total genus 39
structure length 215
sequence length 219
ec nomenclature
pdb deposition date 2015-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zfgH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zfgH01
5AZ2H 3RWDA 1ZANL 5ACZA 5GQBA 3W5NA 5K59F 3OJMB 3RKDD 1TTFA 3ZE1E 5J6GA 2DI8A 2PR4H 2X7LA 5D72L 5IMKB 3KPOA 3K0WA 3KPRA 4Y16C 3C2AL 1ADQH 2ITDA 5EBMA 4NT6B 1UEMA 3V6ZA 4F8QA 3LQMA 3S6CA 2XOTA 5DURB 4BK5A 3FRPG 5J1AA 4OCSH 3HPLA 1V3LA 1E27A 3MGOA 3RDTC 3SE3A 2DQDH 1JWSB 3VE0A 4TN9A 4GW1A 5DUPH 5IQ7H 4X7SL 1DBBH 1J10A 3L7FA 3GHEL 5D1QB 3U30B 3WV0A 1QO3A 3S35X 4JR9L 3N50A 4YPGA 5I1JH 5BVPL 2NZIA 5KANI 1CFNB 1C8PA 1XF4A 1T6WA 1MFEL 5J12C 3C6SB 2C4XA 4S1SH 2OZ4H 4OCNC 3O8XA 3OXSB 4Z0BH 3UTZA 1F3DH 4ZFOB 3X14B 4P9MH 3GGWA 5E2TL 3TJHC 3K7UA 4LHUB 4XP6H 4E5XB 1NFKA 3KYMB 4DCQA 4QRSB 1ZLWH 2B1HH 4R8WH 4NOBA 1KJ2L 2LABA 5EWIH 3PV6A 1ZVSB 5TGBB 5GZND 1A6TB 2NX5D 3D69B 1GCFA 2A9NL 4CNIA 4W4NA 5DC9B 2RAMA 4AYFA 3BIKB 4JREB 4AL8H 1XIWC 3B8SA 4ZO6A 3IKCA 5A40E 1BZQK 5HHMB 4NKOB 5CMAA 4S1SL 5GS3A 4UTBH 4TSCL 5DTFB 3SCMA 1NFIA 3PP4L 3MUJA 3MXWH 3DV4A 1KEML 5H94B 4NZUH 1IKNC 1RAMA 3ARBD 4QXTB 1AP2A 5D1XA 5FKPA 2C4FU 4F8TA 3HB3D 2NR6D 4LCIL 2JK5A 5HVHC 3SDCA 5D7JD 4UT7L 2R0ZL 4JFDB 2OR7A 1RQ5A 1QLRB 4N5UA 5CZKA 3REWA 3BH9A 4LL9A 4RIRA 2GCYB 2DQHH 5FYKL 5H8DA 5GISH 4RRPG 1JZ3A 4ZUTB 3S4SA 3ET9F 4NHCL 5CJOL 4JFEB 3QXAA 1KCRL 2JK5B 5EH1A 2Y4SA 3RWEB 3IDYB 3DYMA 4WFEE 5JQHC 4PRIE 4BH8B 4FQXA 2E7LA 5DVLA 3LQZB 2ZCLL 2GYSA 3H9SE 3BJ91 5ISZE 4MMZC 4Z8FH 3LS5L 4OF6A 3D3VD 1A0QL 5BQ7A 4IS6A 4U1LA 4GSDL 3C5ZC 4LSDA 1CL7L 4WW2F 4Q6IC 2R9HC 3BJLA 5GRZA 4ENEC 3KYKH 3L3OB 4MVBC 3V5DB 1WZ1H 1U3YA 1DUYB 5IB3A 2EC9U 3ZE0F 3L1OH 5CINH 2VDQH 1FFQA 3MFGB 3EHBC 3W11C 3VXRA 3QG7H 4I77H 3QJFB 1ZT1B 4KH2A 4PRDB 2ESVA 35C8H 4TVPD 5FUZL 3VXOB 2YKLH 2DDQH 3P73B 5I8EB 3G08B 3WDJA 3OG6B 5FYJU 4PJIF 4AH2B 4MZ2A 1CIUA 3IDIA 4EI6B 3MRRB 3WIIH 1LO4H 1NFDB 1RVFL 2WIIA 3QHTC 4F9LC 2DJ4A 3V0WH 4TUOA 1U8MA 1HHIA 2C5DC 2YWZA 5SX5H 2E7MA 3W2DH 4P2OC 2ARJA 4HK3J 4L8BA 5E8EB 4G3YL 3NOIA 2P5EB 2FD6H 2YD8A 2WBJC 3L7FB 3RKDC 4GMSL 5HYIA 2C7UB 1SMOA 1OSPH 5J3HD 5KOMC 4Z0XA 5FGBC 3MRDB 4ZODA 3X3FH 1MJ8L 1U8MB 4P3WA 5EOCJ 1B4RA 4RBPH 4BM7A 3BGAA 4YBQC 2DKSA 2EDQA 3ULVH 1KT2A 3ZDYE 5M7QA 1JF5A 3ZKMC 3GGWB 5IFAL 3A6OA 3VJ6B 3MRFB 4GQPH 1OWWA 4OIBA 4EXKA 4MDJA 5BVJA 1EEQA 4G9DB 4KK6C 4UOW1 5T5NG 2V2TA 4HQQH 1YMMD 3ILPA 1LO5B 4TRPL 1JGVL 3FRUB 3VXUE 1TQBC 4WHCA 1YMHB 1MUJA 1A7QL 4U1KB 1ZGLA 4E41E 4OGYL 5IJKA 3NCMA 1B0GB 3VXRE 4JPIA 3ARGC 4HH8A 5D7IB 3TA3B 4OFVA 4LNRA 2YHGA 1ZOXA 4MS8C 4X99A 2GEEA 1JWSA 5A1AA 1D5MB 4X4XB 4MNHA 3OL2A 4A2MA 2EEDA 5J57B 3SPVA 3S35H 4NO5B 5GGVH 2PNDA 4OCMC 3ULVE 2L7JA 1J18A 1RULL 4JG1L 1MCFA 2OP4L 5ESQB 4CW1A 3AAZB 4LCCC 1A9EA 1I8KA 2XTJE 3VRJB 4NDMB 3DXAB 3Q2CA 1QLRA 1KB5L 3R1GL 2E27L 43CAA 3EJZC 2OYPA 3V4VH 2JIXD 3DVIA 4DGIH 1YNLL 4J1UA 1WEJL 1UA6L 4HIJA 2H6PB 1FZOA 3X12B 3ZHLA 2O5ZL 3KHOA 1XGUA 5GGVL 4MA3B 1S9WA 3AC0A 5I0DA 3LEVH 3U79A 1MFBH 4KY1H 3FAWA 4GAYB 4MNQB 4J8RA 4U1NA 2FR4B 2VSCA 4AZ8A 4L8DB 5ABDE 3QNZB 5E8EA 5EOQL 1JYNA 2IPKA 4ZOAA 1H3PL 1NEZA 3H9SD 4ZYKA 1G7JB 5ACZB 3GMPB 5DJ2A 5E9DE 2J5LB 4FQ2H 3PWJA 3W39A 2Y23A 5DQ9B 5HGAA 4CUCA 3EAKA 2CK0H 2V2XB 2PTUA 1LDPH 1BECA 1I7TB 1YEEL 2JTDA 2J12B 5TE4H 5GS2H 3RZWA 5I8EA 1FL3A 1CDCA 3GHBH 4CADB 4PS4H 2H26A 3ULUF 1HXYA 4O9HH 4J23A 3TYGL 2NY1D 4UV4L 4P99A 4JB9L 1RU9L 1NH6A 3I9GH 4ZSOB 3EGSB 3KLSA 1VGKA 3MLSH 4HWZB 4LVEA 2BSTA 1FBIL 4G8IA 3ZT7A 1JYWA 4EDXA 2Y36H 3IFOA 4NPYA 5TH2B 4PY7B 1P2CA 2FRGP 4G6MH 5E5UB 1CR9L 4UBDD 2AI0H 3O6FA 4YJZL 3S34L 1U3JA 5HDQL 3SKOA 4NGHL 2MMXA 3EW3B 1T1XA 5E8PB 1CDUA 1IGJA 4H1LG 4XAWH 2J6EL 1CBVH 2Q6WB 1YDPA 1OTSD 2R1YB 2HP4A 1HKFA 1HXMB 2VDKL 1A7PH 4PYGA 4GW5A 3GSRB 4C83A 3SO3B 3KPOB 3M45A 4WFHD 1UWXH 4L1DA 5E70A 1YUHB 2PO6D 1NPUA 5I15H 5EBGA 2CPCA 4XMKL 5E08H 1GGIL 4OCWL 5E5RB 1FZMB 1IGTA 2DRUA 2VLRA 3QB7C 4Z78B 4Z5RB 2E8YA 4M7KH 3TBWB 3Q6GH 3I84A 4F33A 5F3BB 4WU7B 3TIEB 2IBBA 4KZEL 5E9DB 3FQTB 4ODHH 1T22B 4QHMA 3PGFL 3PP3H 4CGTA 1MVFA 5INCA 4CU7A 3VXUD 3BZEA 3RGVA 4Q9RH 3MO1B 1X3DA 5CEZD 5I17A 3WEXA 4L8CA 3DX8A 1LMKA 1KB5B 3VXRD 5HVWA 1PYWB 3CDGA 1E4WH 3QYCA 3U46B 3QDME 4GG8A 5E99H 4JM2D 4TUKL 1CLOH 1MIMH 3BZFB 5C0CE 1TVHA 4C56B 3UROR 5JNYB 3I50H 1A1OA 2FSEB 5L7XH 5L8KB 2I9TB 3LIZH 3RX7A 2FJFA 5ITFB 2VLJD 4X6CB 4P57B 4PJAE 5AWNH 3UPRB 2FEEL 4GG8B 5EC2B 1A9BA 4XGZA 3AROA 3BAEL 3U7WH 3LRGA 4KRLB 2X05A 4I18C 1YMME 4MAYA 3MYZA 4Q2ZA 4QCIA 1XMWA 1L9MA 4KK5C 4V1DB 3NA9H 5E6ID 2P24B 3UPRA 1SYSA 1RUAL 3CFBB 3VWJC 5INDB 3NIFF 1S7XA 1T83C 4GLRH 4JY4A 1YEGL 3SY0B 1G7MA 3QHFH 5FUOL 4X6FB 5MEQA 3H3PH 4RMTA 4JFPA 4D8PA 3DUUB 5DQDL 4UNUA 1UEYA 3V95A 1CD0A 1TVBB 1HWGB 3IETA 3TF7C 5J06A 2F74B 1N0LA 3D9AL 3ZKXB 4JFFD 4P4KA 4LLUA 5EIIB 2IFGA 1XR8A 3TFKD 1MHHB 1CGTA 1ONQA 4ZUVB 5IT2H 2ARJQ 3IDXH 1QO3B 4P4KD 3RWDB 2P7TA 3MRNB 3NGBB 2I07B 1U95B 5B4MC 2UV3A 1J05B 3I6GA 1UM4L 3B5GA 5GGTL 3TESA 3B5TA 3SQOL 3VD7A 2FBJH 3AXLA 1FFPB 1QSFE 2IAND 1FZJA 1M71A 4J3VA 3V52L 1WISA 4LSPH 4Y4FB 5F7HA 4KDVA 3E2HC 5E00A 2XN9D 1U8IA 1MVUA 5BS0D 3QQ4A 5E1AB 5IB5A 4HUVB 1NL0H 3BX7C 1AFVH 1H3GA 5C7XL 4XI5D 3U30C 5DR5H 5SWZD 5C0BD 4NIKB 1S8DB 1U8OB 4GAGH 5I16A 1BOGB 2GFBB 1EAPB 1IGFL 5ANMB 2DQUH 1AC6A 3F8UB 4O02H 5I8CB 3WN5A 4JRXB 3O6KL 1G6RA 3VA2C 3V52H 5HGGS 1KJVA 4N0CC 4MD4A 4PV9B 1SJHB 1KXVC 2Y72A 1U8PA 3QI9A 3LKQA 5CWSB 1JK8B 5AZEL 1WT5C 3SQBA 4A2LA 2Q86A 3QEGH 3FT4A 6CGTA 2LAAA 1EMTH 2VDLH 4HS6B 3NABH 5IW6A 4CNIB 2D7PA 1I85A 3CU1A 1RZFL 4K94L 5M95B 3UBXI 1JK8A 4TVPL 2YPKA 5E6ZA 4WW2A 3RTQC 4X4ME 2PN5A 1AR2A 3NIDF 1RMFL 5I2IB 1OWRM 3DIFB 4U6HA 1MH5B 2C3GA 35C8L 4BKLB 1S9VB 3MLRL 4M7ZB 4OIIL 5DHYA 5KVEL 4QWWC 1DN2A 2CLZB 2GT9A 1T80A 4G7YH 1MSPA 5D2LA 1YYLL 4PJFF 4KMTL 1AI1H 1RJZB 3WD5H 2GJ6A 1Q0XL 1T7XA 3MLVH 4OZGA 3BN9C 3OAZK 3QIUA 3HZMA 4M7LH 5GS1C 1KN2L 4H5SB 1GGUA 1QZ1A 3VFGL 4OKVA 4XNQB 4YDKH 5KVFH 4YHZH 3EUUA 5BV7L 3SGJA 4MQ7A 2A6KB 4AH2A 4DOHE 1RURH 1BAFL 3KPRE 1AHWC 2PXYB 3SE9H 4I3RH 2CRIA 4LVOB 3S88H 3N1GC 1MJUH 1QFUH 2EH8H 4RAHA 3SO5A 5C86A 5FO9A 1FQ9C 2DBLL 4P2CG 1BBDH 4X6CF 4OLVH 2A73B 2Y5TB 1YEKH 4H1LH 3HC4L 1KEGL 1AR1C 4N5ED 3X11A 3PDOB 5JLZB 4XVUC 3CDCA 2CQVA 2DMBA 3JTSA 4PJ9A 5IQ9A 2R0WH 3CNKA 3SKJL 4YUEH 4LPVA 5C0CD 1BD2D 5E8PA 1XGRA 4UOW0 2W92A 1UXSA 1VFBB 2IMMA 4XX1G 4G8FB 4JKPH 3SDCC 1T2JA 5JHDD 2X1QA 2RJMA 1MLBB 1XH3B 4IMLA 4WFFE 3O6LL 3VXQA 1AY1H 2CKBA 5HHOA 1FGVL 4AEIH 1MREL 5B22A 4MCZB 3S3SA 2GY5A 4DKAA 1N0XH 4FS0A 4H26A 1JGUL 3UBXG 4AG4L 1YUHA 4BH7B 3WS6A 3LZFL 1GAFH 4LLDA 1P4BH 2O61B 4NN7C 5CZXC 3FO1B 3L5XL 4OZGE 2W59A 2F8OA 2A9MH 5CCKH 5C3TA 2YPVH 4RRPA 4K9EH 5IOPB 2VAAA 5HDBE 3VWKD 5JZ7C 3O2WH 4WI5A 3GKZA 5DD6B 1QSVA 1P7QD 2HFEB 1OT1A 2DWEB 3B43A 2QSQA 3D39A 4NWUL 1YYML 5FYJL 3U4EB 3HFMH 4PJBB 5CFHA 4F7TA 5T1LB 4QTHB 5HYSA 3IJSB 2Z9TA 3WFBH 2CDFA 1OL0A 5DD6A 3VFVA 3KYKL 5JOFA 1P4BL 5ALBH 1AD9A 1NJ9A 2FO4B 1DEEB 3GSWA 4YDJA 3MV8D 5ITFA 3D48R 2NY2D 1R5IA 1PQZA 2VXSH 4OD3L 4GG6E 5CSZA 3SE3C 4OI8A 4D0BA 4LSQL 5IHBA 4L1HA 2VDNL 1U3HB 4IMKA 1A64A 5DJZA 4L4VB 1FYTA 1DBKL 1ZKAA 2LE9A 5D71L 5ESVA 3AU1B 1CGYA 2VUYA 1FL6B 4JO3L 1LO4L 1RVFH 4LLQA 2V7HB 3UDWA 4KJYB 2VB5A 3EFDL 1G9EA 4ZS7L 4XTRC 5C0EA 2FZ3B 4HUNB 2G60H 2AJYH 3SDXA 1LO2H 3WO3B 2HT2D 5HHNB 1UM6L 3GRWL 3QIBC 4UUJB 2BVEA 1NEUA 4IS6B 1L7IH 1U42A 3HI1A 4Z18A 4GKSA 1A5FH 1EERB 2XT1B 4GAJL 4Q9QH 3OPZL 4WHTA 3BKJL 3IFNL 3I75A 1DQTA 1OSZA 2JE8A 3PWPB 3BYTA 5T3ZH 1U8JB 5DD5H 5LWYH 2YC1B 1E4KC 3C87A 2P45B 2IADB 4HKXA 5EZJB 4GBXC 4JZJC 1KTRL 3H0TA 3EDKA 4X5XA 3T4AB 4YEEA 1CVSC 1FFRA 2QKIA 5I1GL 1I1AD 3EGSA 3KJ4B 1I9RH 1R3IL 4YHML 1JVKA 1FL5B 3V5HA 3RY6A 4P4KB 2AJYL 5MEPA 4ZUUB 1X4ZA 3FN3A 1S7QB 3UBXB 1MH5A 5EZOH 5HGBB 2CUIA 1FZJB 1M71B 3NGBC 3OPZH 1J8KA 1CT8B 1CF8L 3LY6A 2DM3A 3HE7B 1DQDL 3RAJL 1SYVA 2C7UA 4LCCA 5T3ZE 3D39B 3NCJH 5DVOA 4FQIL 4ZSOA 4GBXB 1SY6H 3W81A 1KPRA 4WFGE 1J0IA 4N1EA 5JXAH 1G6RH 5KN5A 4Q97A 5EU7C 4M7LT 3T0XA 3OR7A 5DJAA 4U1SA 5EZLB 2V5RA 3VWJB 4WEUD 3MROA 4E5XA 5SWSB 1FP5A 2NXYB 2JJSC 4ALAL 3BQUD 4QRSA 1NGQH 3MUGB 3V6ZB 4PJXF 1WC7A 1IARB 4LKXB 1FO0L 4U6XA 4WO4D 4XP9H 1HSAA 1MIML 4NZDA 1KB5H 3R1GH 3N85L 4FTVD 4EBQH 2CKNA 4I18B 3U1SL 2NZ9D 3MUY1 1PX3A 3UC0L 3TIDA 2HFGH 1NBVH 3KPPA 5I1AA 4HF5L 5EIQA 2WP3O 4H88L 2HMIC 1JFQH 1SY6L 1T4KB 1E4KA 2J8UF 2PYEE 2PO6C 2YN3A 4YR6A 4MD0A 2BX5A 3BEVA 3T1FB 2CLVA 5JXAL 2Z31A 3Q3GA 4GKNA 4NNYB 4MA1B 5FGCB 1AE6L 2AV7B 1BQSA 1T7WA 4UBDC 4YDIH 2H8PA 4MD0B 1N8ZB 3T0AA 4LEOA 1R0AH 1XIWA 2J8HA 1JGDA 1CE6A 1A9EB 1WBXB 5IGXL 3ARGB 1LDPL 5F89A 4X5XB 3JV4A 3AU1A 4KK8D 2BDNL 3QWOB 1FYTB 3ULSB 4F57L 2H8PB 5BZDA 2ADJA 5ECJE 2FEDD 2AEPL 2ZJSL 3L3JB 5E8NA 3IJYB 4G9FE 5FM5M 3NZHH 2XTJD 4WW1B 1SM3H 3MXVL 4Z7OE 3QXVA 3LEYL 3CAFA 3ULUL 4XC1L 4OLWH 1O0VA 1F00I 2Y36L 4NQSA 5AUMA 1Z9OA 3TT1H 2AI0L 3HS0B 4XXDB 2I5YL 5IM7A 2HN7B 1N5AB 1SYVB 3DX7A 2CIIB 4JO1L 3T8XA 4BJLA 3IDGA 3ULUE 4PUBL 2HTKC 1FNSH 1GZQB 3DGCR 3CFCL 4YXHH 3UO1L 2HT2C 3QJHA 4Z7WB 1T20A 4I3GA 5D93C 1AIFB 1HXYB 3IDIB 2DQEL 3HMWL 4QXGL 4LSRL 3VWJA 4PG9B 1FGNH 4CVXB 1S7TA 2CGRL 3RVWC 3S96B 1SQ2N 2D03H 4PR5A 1MPAL 5KJRL 1QOKA 3EJZD 5T1MA 1V7NH 5I1CH 5IEHB 4M4RA 3MLXL 3E6HB 3O45A 4DKEL 3VW3L 1G0DA 4WFED 2VDOH 4HFWB 2Q8BH 4BFEA 5L0QC 4TUJB 2Q76A 4NQVA 5JZ7D 4OT1L 3ARBA 2NY5L 1I8MB 3WL9A 3QEGL 1DBAL 5LGHH 1KG0B 4Y5XB 3VXSE 4MQTB 3L3DB 1KFAL 3MLZH 1E27B 3MGOB 4EVNB 4U4BA 5T1DH 3L3HB 4LBEB 4UV7H 5DMJB 4PRHD 3OX8A 4Q6IB 4LLDB 2CDEA 3DXAA 1JPFA 2XKNA 4M9OA 3FO0L 4L3AA 2B1AH 1F45A 2AERT 2BRRL 3OHXA 2VE6B 2G5BA 3QCTL 2VWEC 5HI4C 2F19H 5E1AA 1DBJH 1BX2B 4HD9A 4X4YB 4QHUB 3DVFA 2OLDA 1YZZA 4UILH 5FYKH 4KK6D 2CDEB 3GNMH 3WDIA 1GC1H 2ICWJ 2PF6A 4IMLB 4CMMB 2DQFB 3QIBD 4KPHL 3F7PC 1ITBB 4XBPA 1MCOH 4GKSB 3BFOA 1D9KD 4FTVE 3S3PA 2EDBA 2R69L 3F58L 1W2KT 3WFDH 4K23L 1EEUA 1IGYA 3ELAT 1N59A 3NPSB 4OV5B 4Q6YA 4X98B 1A3RL 1A14L 1UQSB 2JCCB 3QG6A 5HGDB 4MLSA 5EU4B 1M7IB 1FL6A 4OCXH 1VADA 3ZYOA 4HIEB 4K55A 2D7QA 1ACZA 4JDTH 2XQYK 3C2AH 5GJTH 2E9JA 4ONGL 4XH2B 2IPTH 3MUHL 2DI9A 5DFWH 2XG4A 2M2DA 3A6BH 3O6FC 3GBNL 4IOFC 4NO3B 1CICC 1D5BA 3AB0B 4Z7OF 3QEQE 1AIFA 1OLZA 1YY9D 3MRGA 4HSQA 4MWFA 3RTQA 4X99B 1OAZH 2FB4L 1OVZA 4Y89A 5HYEA 3SDAA 4NRYA 3IFOB 4NPYB 1CYGA 5ILTL 3QDJA 2WUCH 1QLEH 4P5TB 4V1DA 4OZ4A 2O26U 1II4E 5T3XE 2D4FA 5D7IF 5EDXA 3OWEA 3BPOC 4OUUA 3RWGA 5IQ7L 2IPTL 1B88A 4G3YH 2ATKB 4M6ML 3W0WB 2NYYC 1TCRA 2MCG1 2C4FT 3D1MC 5DSCA 3VRIA 3GBNH 5DJYA 3CCHB 1BVKA 4BYHA 2A77H 1Q1JH 3ZKMD 2YR3A 3VWKB 4ONFH 4ZUUA 5D4QA 3L95A 3QJHB 4Z0BL 3O8XB 3OXSA 4HIHB 2VLRB 3ES6B 3AREB 2E9IA 1NEZG 2X7LB 2C3XA 4HT1L 4JDZB 4XPHL 4XPBH 2A1WH 5KVGL 4YHYB 3QUXA 2UUDK 1I1FA 3LD8B 4J8RB 3MBEA 3V79C 5ID1A 3QCVL 5C0GA 1XIWD 4GW1B 1WWCA 3MLWH 1EBPA 2VIRA 1U8JA 3DVGA 1NCAL 2YEZB 4AL8L 4AJ0A 1TJIL 4Y4FA 1MFDL 4M00A 1JHLH 4H25B 4XBPB 5DRNB 1FDLL 5IBTH 3A6CL 4NN7B 5IROC 1HILA 1WUNT 1OD9A 1QBLH 5JHDB 2X4UA 4XWGL 3WUWA 3G6DH 5IV2A 4JO4L 4D0DB 3I02A 3VRLE 1YMHA 5HJ3A 2HG5B 3S35L 4PRHB 2DWEA 1R3LA 2GJZB 1S9YA 2AK1H 2RQ8A 5CJOH 3INUH 4ZFFB 1KCRH 4RWYL 2W0FB 1IEBA 3B9KA 1R5WB 3MV8E 3FB5B 1TJGL 3HC0B 1EFXA 1ZHLB 4GS7B 3DIFA 5GISL 5A43C 4NC1C 2RBLA 2IEPA 1I9JL 1X5GA 4X7TA 1NGPL 2W0KA 4DEPC 4U3XA 3E6FA 4JVUA 2JJSA 3CMGA 2P46B 2VISB 4QO1A 2XWBA 1U58B 3TNMB 3ZMRA 5F9OL 1KCUH 2OS7A 4S1QH 3KXFE 1QA9B 4WI6A 1F5WA 2P24A 3QPQD 3VDBA 3O3EA 1J0HA 5IM7B 3KPLB 5FF6B 4HUKB 1QSZA 1O7SA 4XZUA 1T04A 1CLYL 1F4YH 4WGVB 1HHKB 4Y1AE 3TT3H 2VLLB 1WFNA 1TJGH 3I2CH 4I8DA 5C0RH 3C5ZB 2YK1H 2ZZUT 3KLHD 1AHWB 3EZJB 3LV3A 3K2MC 4HMDA 4ODUA 5F88B 2ZUUA 2F5BH 4N9GB 5HHQA 1DEEA 4YDJB 3G04A 3FTGB 4OZIE 1KEGH 2CK0L 1ZVYA 4KMLB 1MCNA 5GS1B 3GHBL 4PJ5D 2QADD 2IPKB 4WUUB 1LHZA 4NO2A 5IKCA 5DRWA 3KR3H 4JRXE 3NFPA 4JB9H 4GQ9H 1CF8H 4NQDB 4P5TA 3P9WB 3TVMD 1CGWA 2FL5A 1MHCA 3MRCB 4Y4KB 3BDBA 4U1LB 2D9CA 4M7ZC 1IGYB 3GRWA 4XNZB 4UINH 3SGKA 4HPOL 3IDMA 4HKBB 4ZS6C 4JM2C 4MAYC 5F96L 1RZKH 3QSKB 5J6GB 1T0NA 1CFSB 3PIQB 5FO7B 3UCRA 2DICA 4H26B 3MA9L 1TNMA 2HYMA 4NC2B 4XPTH 3NPSC 2ZSVB 2A73A 4C54A 4XCNA 4NUGL 1BQHG 3BHBA 3BGMB 2BNQA 4PJFE 1R3JA 5B3JF 4G8EB 2CKBL 4WIQA 3RL2A 3PABA 5IEKA 1BQUA 5E7BA 1HCFX 1FFPA 4PLKD 2XNAB 3DV4B 2NY4D 4WI3A 3WFBL 3OAZH 5D7SH 5IWLA 3SE8H 1PKOA 1D5ZB 4GUPA 5DHVH 5GRXG 4P23A 1FAIH 4OZIA 4FQJH 3O3EB 4RMRA 1V5JA 3PQYA 4X5WA 5K93A 5CEYB 1A6TA 1D5XB 2DQCL 3LQAH 4X9HA 2Y7QA 3MRKB 4OB5L 3WSQH 4BQ8A 3MRFA 2OP4H 4GJTB 4R90H 3VWKA 4PGJA 2ZKHL 3T2PA 3CGTA 2MQCA 4JFFE 4R3SA 2NX5E 1FG2A 2E27H 3DNKA 1TDQA 4LCYA 4HKZA 1OF2A 1CCZA 1FORH 2I60H 5ICYB 2Y7QB 3GBMH 4XBEH 5BMFH 2VL5A 4Z76A 3MSPA 3UTQB 5FGBA 2RFXA 3VG0H 3ZZ1A 4X6EA 1OQOA 3UTSB 4HS6A 4JFZL 5AWNL 1URLA 4OTXH 1KBGL 3VFRB 3T0EA 4PJCE 3KPLA 1QA9A 4BUHA 3TH4T 5F44A 3D0LB 3RVTD 1UH4A 3F12A 5C0CB 4HXBH 3T4YB 4QHMB 4P49A 1H8OA 3JTTA 3D39E 2EXWD 2Z31C 4O9HL 3TYGH 4PUBH 2OQJA 4Y4HC 2DLIA 1WBYA 1I9RL 1R3IH 2HFFA 4LF3A 3WN5B 1AKJB 3WBDA 3DI2B 5DJ6B 4XH2A 4M6OL 3PDOA 1J8HA 3JSSA 4UAOB 3C6LD 3S37L 1FBIH 2W0FA 5C07D 3VFNB 2NY1C 3GBLA 1TQBB 3UXFA 4PS4L 4RGMB 1P7KB 2MJWA 1NLDL 1OAUH 1DUYA 2DQIH 4H0HB 1W72B 3C60A 2C1OB 4M1CD 2ITCA 3OMZA 2CUHA 5C70A 1H3XA 1MHPH 2BERA 2EDHA 3WS3A 3FQWA 2NCMA 5JHLH 5TE6H 3ARSA 2ATKA 1GOFA 4DAGH 4Y4KA 5IFHL 2EE6A 1W72A 3KPRB 3LVEA 3K2UH 3X11B 3E8UH 5C0FA 1QHPA 4QHNA 4CVZB 1CQYA 1M1SA 5AYUL 1M6OB 1UWEL 2R4SH 3ARFC 4PB0L 1LK2A 5IW1A 1OAUL 3C6LC 3TNNB 1EJ6A 3IDNA 1LO5A 3RNKB 4DN3H 4LVHC 5DXWA 1LP9F 5AD0B 3N85H 1L0XA 5DEGB 3OF6A 5DK3A 2CMRL 2AJ3A 5F3HA 5E00B 2AXGA 3DUUA 1MCLA 3C8KA 1AGCA 2AEQH 1QYGH 1NDMB 4KXZI 2FJGB 3F7RA 4JG0L 4AEFA 43C9A 2W9LA 5C09D 3O6KH 4FRWA 1WQVT 4U49A 3CZJA 1W8OA 4Y2OA 4QOKA 1MIEH 2GI7A 4P5MA 4YEFA 4GBXA 1T04B 4Z7VA 1EGJL 2EYTB 4X6EB 4J3UA 3ZLQC 4X0KB 3O45B 1F13A 4P2RB 2PYFB 3FO9A 3QQ9C 3MBEC 4DQOL 3Q0HA 4RMVA 4R2GD 1FAKT 5DK0B 1KCKA 4I0CC 5DYOA 1R0AL 1ZV5A 1AJ7L 3KNBB 4NRZA 3GSVB 1WZLA 3TVMA 4LKXA 1OAXL 3C60C 2B8OT 3FO1A 1I7ZA 4O4YH 2OK0H 5JIKA 2PW2B 2B5IB 2VZTA 1N4XH 4KKLD 1ROWA 4MNQE 3I6LE 2X09A 2XFXA 1YA5A 4Z7UB 1KNOA 1VACB 1RMFH 1BP3B 3JV4B 2HT3C 4JFYA 2P8LB 4XZUB 4LDEB 1IGIH 2X9XA 3GKWL 2CKBB 5HHOB 3EYSL 3HLAB 1RUAH 4HXAH 5F1NA 1U8KA 5KSAA 1LD9A 3HZYB 3RY6C 4R0LA 3OZ9L 5FDYA 4Q9BA 1F4XH 1CG9B 4PJ8A 4ODVH 2AJXH 5F7DB 4LASL 2AV7A 1H0DA 1IC5L 4O4YL 4X6DA 4LCWA 2IANA 1UZ8B 4GLRI 2AJSH 2DQFA 2JIXA 2WUBL 4HIIA 2XKUA 3EDJA 3FONB 3KYNA 4MJ4A 4PIRF 4PJGF 4YFDB 3CFEB 5DHXB 4I4WB 1U8KB 3BEWB 4LLQB 3TWCL 5EO1B 3KLHC 1INEL 3B9KB 3P9LA 3QHFL 4HJ0C 5FUOH 2IFFL 4OZFB 4PP1D 4YDVA 1CL7I 4WUUA 1EBAA 3O9WA 4U0RB 4WWID 4RZCB 1TJHH 3BT2L 4P2YA 4KVCL 5JOEA 5E4IA 4FXKA 2DBLH 1E28B 4IOIB 4R4FH 2F54B 4HW6A 3D9AH 2J2ZA 3RNQB 1B3JA 2ERJB 3AY4A 4MQ7B 1T6VN 4Z7QF 5KVGH 2Q7YA 3MLXH 3VW3H 1BD2A 1E4XI 5A16B 5JOFB 5EU6B 3P2TA 5D5MA 4PREB 1JMXA 4Y19A 3TVMC 1HH9B 4HFUH 1SYSB 1IQWH 2DAVA 1WAAE 2FH8A 2N1KA 3V7MA 3U2SB 1BFOB 2CJUH 2HKFL 1N5AA 3FOMA 4N68A 4IRJA 2BSRA 1HI6A 4G9FA 1MCEA 3MGTB 4WEBH 1PY9A 1K3ZA 1VPOH 1NGWA 3JVGC 5LJYH 1QBAA 3IS1X 1MCPH 1WAAF 3QO1A 1EUUA 5TQ2L 4MXQD 4M1DL 3STLA 3MJ7A 1YMMB 3GIVB 4OBSA 1NMCC 3TVMB 3ALXA 2VXTH 3HNSL 2P5EE 4PJ8C 4XAKE 3RWCB 3D25A 3CCHA 5HSFA 1JL8A 4WJ5B 5IJVB 4QXUL 5I16B 1A6UL 3VXOA 2QQQA 4JM2A 1NC4B 4OLUH 2IWGA 2HWZH 2ICES 2YBRA 2O93L 1NUNB 1X5JA 2EYRA 1S5IL 3KWWA 1KB9K 1U91A 1E4JA 4GUPB 4R2GB 1V3MA 1U8IB 1EO5A 1OGAD 3RU8H 3VGBA 4FXGA 2VQ1A 4TUOB 1A14H 3PWUA 2VQUA 4YAQA 4WHDA 2O5YH 3SGDH 3QXDB 3S97C 2HJFA 3CFJA 4LLYA 1DE4A 5CS7A 3KXFD 2B4CC 4FFYL 4K3JL 1S7QA 4XNXH 4NNXA 4ZAKA 4PJDE 4XMPL 3RUGB 2DQHL 3BHBB 3MMEB 3KVQA 1QEWB 1U8HB 2YUXA 1NMAH 4OF7A 1ZTXL 1QG3A 2DLFL 3TNNA 4Z7UF 5EPMB 1UM5H 5A2JH 4MVBD 1VEMA 4OZFA 3ZHKA 2F5BL 4MA8H 5DS8B 1C5CL 3Q5YA 1VERA 4Y5YC 4ZOEA 2BCKA 3SE4C 5CEXA 1VKXB 4EQ2A 3QDHA 2ZCLH 4FP8L 4A6YH 1JGLL 3NBNA 1V7ML 3KDMB 3V9FA 1FFNA 4R7NA 2FWOB 2UWEE 4W6XB 3VXTA 3QDMD 5H94A 3MJ6A 3HZMB 1NFIB 2YD4A 1WCQA 5BO1L 3C5JA 3V2AR 3O4LE 4OLXH 4XNUH 1K8IB 2DS4A 1Z9SA 4CBPA 2YA2A 3DUSA 1YEHH 4M8QA 4J2XA 3GSUB 2I9LB 4PJBA 3MNVB 4HBQA 1FVEB 2JF1A 1NAKH 1PG7L 2X70A 3RWIA 1QQDA 4KRMB 2PR4L 5D72H 4HV8B 2VLKE 1BM3L 2GCYA 2FYYA 4HUMB 4AMKH 3SE9L 4ONFL 1I3UA 2P5WB 2LVEA 2N4IA 1MJUL 4LAQL 3ZE1F 1CFTA 1I75A 4YHMH 5CKAA 4LSUH 3R8QA 4NO3A 3LDBC 3P73A 4PGZA 4D9LH 3MJ7B 2NYYD 1KIQA 3VRLF 5INDA 2DJUA 2HT3D 3RWJB 5L2KA 2P5WA 3GMPA 3KHQA 3QEQD 1DBBL 4JN2B 4UZGA 3D0LA 3ARBB 1CXFA 3QIUB 1M6OA 3LSOA 3P4NA 4A6YB 4X0KA 3CC5B 1JZ8A 3G5VB 1UZ6F 4JFFA 1UGNA 2NX5A 3TCLB 2NXZB 3FO2B 4AG4H 3L3OA 2EEBA 4YX2H 1ZHKB 3DGGA 3QIWD 1DLHB 3C08L 3QUYB 4AK1A 3BP4B 5D8JL 3VXME 4M61B 1GGTA 5F1KC 1HEZB 2ZCKH 3FOLB 2QQLH 1BPVA 5CEZL 3NIDE 1YJDH 1NSNH 3OJ2C 4V1DE 4QRPB 5DVKA 2XTJC 2AQ3A 5F72S 2JJVA 1A7OH 3UTSD 2GFBA 2X4QB 3STLB 4OZIF 1UCBL 3B9EA 4RISL 4RX4A 3M17B 3IU3B 4QHUA 3CFKA 3O4LB 4WEMB 1G7JA 3RVVC 3CLEL 2X2YA 3HFML 4LHUG 2MHAB 1PZ5B 2DLHA 4PG2A 2UWEB 5FO7A 5T1KB 1NGPH 3U4BH 3VA6A 2KZ1B 4E9LA 1XF1A 4NZTL 2BMKA 2F54D 4M3KB 1KJ3H 5TE7H 4ORGA 1X6NA 2ERJC 1JFQL 5DEFB 5KG9B 2XZZA 1IM3B 1F90L 5TF1L 4ZQKA 5SX4H 2VXSL 4H25A 5DRNA 5SWZA 2AXFA 2DMCA 5GZOD 4HX1A 1I3VA 3WIFA 4U0RC 4GRWH 1MLCA 5FFLA 3L5WA 3I2CL 1HQRA 1KLUB 2QSTA 3FT2B 1AE6H 1J1XH 1U8OA 2MWCA 5E1HB 4FFWC 1S9YB 3HE7C 2Y07H 2J4WH 1KSRA 3ILPB 2J7LA 3AS2A 1B2WH 4M1CC 3MBXL 5DUBB 3RWCA 4N9GA 3GMOB 3HC3H 4LLWB 2VNCA 2UWEF 3PWLB 4M6NL 1UZ8A 4EOWL 1OW0A 3LEVL 3LRSB 1IKFL 5DTFA 3JZ7A 3NACH 3OF6D 4M43L 2K7PA 2P5ED 1ZT4A 2FEDC 3IJSA 4KKCC 3VFVB 1BBJB 5IW6B 4IHOA 2B0SL 3FFDA 4YHOL 3UJTL 3BSZL 5FF6A 3DUSB 1U92A 1C1EH 1BVLA 2BY1A 2KPNA 4G6KH 1PD6A 2QSVA 3BH9B 4RIRB 4OD2B 3T2OA 2DD8H 2XRAH 4G43B 1DSFH 4BELD 4LPWA 1BQLL 5AYUH 1GHFH 5FIEA 7FABH 5JTWA 4IRSD 3RNQA 4C56D 1P7QB 1YPZF 5BS0B 2HTKD 3GI8H 5MEPB 3WFCH 4KWUA 1W72H 1ZVHA 4PLOB 1BMGA 1DVFA 3CH8A 1OQXA 2A0LD 4Q9CA 2CO7B 2D7NA 3EO1B 1X5LA 2XV6B 3BQUA 3P4NB 2QLVB 1CR9H 5IB3B 3GMQB 1ZLVK 4RBPK 1S7UA 4NO0B 3PJSB 1K4CA 3QNYB 3KPMB 5F7YC 1DQDH 5KOVC 3QXDA 2NTSP 5FYKU 1MCRA 4PJHB 3C5SB 5FYLL 4N8CH 5J56B 3M1BB 3VFWA 3ARDB 3L3GB 2AJ3B 4K2UH 1XGQA 1MF2H 2A6DA 2EXYD 2WQ8A 3N1MC 1OTUC 3VCLA 1YPZA 1IEBB 1BD2E 5C0IB 3H9YA 2LFGA 1FFOB 4KK8C 1VEOA 5DO2D 1FL5A 3V5HB 2ZSVA 4KQ3H 4OZHF 4KI5F 2ZKHH 4O58H 3VXMD 1FZKA 4BQ6A 3MODL 4HLZH 1F4AA 1BFVH 4PJEB 1OPGH 5ENWB 5H37G 1EIBA 5LBSL 1HNFA 1IC4H 2P47B 3PGFH 3DX6B 4L4TD 3LEXB 1TZGH 3VDAA 1PJ9A 1IQDB 1EX0A 5JDSA 3MLPA 4XNYL 4I0KA 2YD1A 4NRZB 4MAUL 5EA0H 1SJXA 4BFBD 4Z7NF 2ZCHH 5TH2A 3OBAA 1RK1B 4R6UA 5JOPE 5L9DL 4MB5A 2AJXL 2VQ1B 2EEAA 2NX5B 3TCLA 2R69H 4U1JB 5I66B 4HUWA 3OQ3B 4X4YA 2H41A 1E4WL 4HFWA 3QIWC 3WN5C 2W91A 1G0YR 1U2CA 2NZ9C 4QOKB 4F15B 2SEBB 1DVFC 3FHQA 4ESKA 1EXUB 3HI5L 1YN6A 3P11H 4K7FB 4Y19E 4L4TE 3D0VB 4DGIL 2VAAB 3V0VA 4KFZC 3B9AA 4MLIA 3D18B 1FG2B 4HAGA 2NW3B 2X42A 1E6JL 2GAZA 5M94B 3FB7B 2CLRA 3KNBA 1NANI 1OD7A 1UB5A 3SJVE 2FGWH 2A6IA 1EK3A 3NCCB 1RIVL 3VGGA 4K7FA 3O8XD 4FXGB 3PP3K 3U9PL 1AXTH 2VLLA 5C0JA 2ED9A 5J13B 1KCSL 4KKBD 3FFDB 1X5AA 1MJ7L 4U1GC 1JRHI 1FNSL 2WUCL 3VFOA 1U8PB 3QI9B 3UO1H 1Z3GH 1B4JH 3O2DH 2VXVH 1JHTB 1LVEA 3FCTA 2BFVL 2EDWA 4OF3A 3ZTJH 3F6IA 4FNLL 3JXAA 2VXUH 2CGRH 2X4RA 3DV6B 3SJVD 4MSWB 1MCPL 1CFTB 4OBRA 2AJVL 3IF1B 1AGDB 3D39D 1CD1A 1Q94B 1CIDA 5IMOA 5JORA 5BZDB 2V7HA 1J88A 2IAMB 4YE4L 4BZ2H 3BGFB 2YOCA 5FDWB 4S2SB 3D3VB 1MI5D 1V05A 4LLUB 5EIIA 3R8BB 1UM4H 1UXWA 4BZ1L 2OSLB 4P9HL 4YDVB 3B9DA 5HHOE 1V7NL 5I1CL 2FX9H 3QISA 4R4NC 5AUMB 4TQEL 2MQ0A 3LKPA 1T1WA 3W11D 5L2JA 4CDHA 3MRMA 1CDGA 4PRAA 3WS3B 3HI6H 4K3EL 1HKLL 1MHEB 3MLWL 4BH8A 2J3SA 4QY8A 5MP6L 4OT1H 2F5AL 5FM4A 3LKRA 3BPNB 3JTSB 4PJ9B 3QFJB 2E6PA 3KPNB 3QR2A 1KPUA 2NY6B 1SJEB 4DZ8B 3LCYA 5CUSH 4LHJB 4WV1C 2V2WB 1NC4A 3MR9B 3OKLA 3X3GL 3CUPB 5I0ZA 3M17A 2OMBA 4U3CA 6FABH 3B8YA 2EH7L 1S7TB 1OGTB 3RDTA 1W0WA 1A4JA 5FUZH 4ZOCA 3D18A 5FA3A 3MX0A 5GGQH 3RTQD 4FP8H 2V17H 1JGLH 4BH7A 4XRCA 1GC1L 4R26H 1MQKH 3WFEL 2APBA 4DK3A 1PKQA 3EYQC 4OM0L 1UB6B 3MOQA 2FIKA 4KPHH 4LQFH 1HHHA 3LRHA 1Q72H 3ARWA 1U92B 4GRLB 2DYPA 4MZ3A 2EYTA 4IRSA 4U1JA 3TN0D 4OFYA 5IIEA 4JN1H 4P5KA 5E99L 2X6MA 4L8BB 2BVYA 1T0PB 4IDJH 3UJIL 5TDPB 2EE3A 4KTDL 4LCYB 4YQXH 1IFHH 1KJ2B 4Y4FC 5IB1A 1R24B 3MNZB 4DCQB 3E6FB 5I9QC 3ETBF 2ID5A 4G8GD 1BM3H 1NC2B 2JB5H 1JHKH 4Y4FD 2R2HA 4P48A 2OZ4L 4ZFOL 2NQCA 4ONGH 1PFCA 3G9AB 1EAPA 3U0WH 4TSBH 1I8IA 3QUYC 5F7EL 2NY6D 4D9QD 4LSUL 4P46B 4U05A 4X7DC 1P1ZB 1MAML 5FAAA 4L8CB 2D3VA 3DROB 4G42B 2QTEA 3O9WD 1EHNA 3QXTA 1WLHA 5IMLB 1IAII 4LRNL 4YIQB 4IDJL 2OZ4A 3UJIH 3WIFB 4LIQH 5DMYA 1IGMH 4YQXL 2R29H 3MLYL 1YEGH 4LVNB 1CE1L 4OV5A 1I3GH 2JIXB 3VFWB 2ICCA 3GJFB 4LP5A 1T2QL 5I1HH 3DXAD 3KDMA 4PRAB 4J1UB 1P4LB 4K3DH 1AO7A 3PE9A 1QP1A 4MHHI 4YXKL 2KKQA 4ONOA 1BZ7B 4D9QE 2PW1B 2FZ3A 1JI2A 1NSNL 1TETH 4JZNB 1EHXA 5E6IB 3TGXA 1ZA3A 2DBJA 2AS5M 5JA8B 3D3VA 2IANE 5IMOB 4J6RL 5JORB 5DVMA 4UT6H 3WMSA 2AK4B 3ES6A 1A6UH 4WY7L 5KAQF 4YK4B 5HHVL 4BSVB 4HT1H 3IKKA 3P77B 5J9PB 1T1YB 3MRIA 4BZYA 1Q9LA 2ILLA 2QHRL 5JMRA 3U83A 2C1PA 3PXJA 4WUUE 5FV2A 3SN6N 1TENA 4WDIB 3JWNC 4Z7UE 1ED3B 4PJEF 1MRFL 2IBGA 1WEJH 2QL1A 3I6KB 4M6AA 1S9XB 3VWJD 5K9JL 5DDHB 1J87A 2GTWA 3EFFA 4JQXC 3SBWC 2EKSA 2LV4A 1JWUA 4ZPTB 3TO2B 1K8DB 2XWJB 2R15A 2F58L 3HMXA 4PJ5A 5FM5O 3IS0X 3TJEH 1X5YA 5DMIH 2BSTB 3X13B 1ES0B 2F74A 3WCYA 5CINL 4O5LH 4Y1AB 2ZUTA 3DOSA 3DVNA 1MCWW 2CLRB 5JR1H 2AXGB 5MENA 2DQCH 3LQAL 3SDDB 3RZCA 3MTRA 4K71C 5F9OH 1C5CH 1R5WA 5MERA 4LFHD 5EN2A 5F70A 2WBJA 2P8PB 4P5TC 3FO9B 5CIPH 3VH8A 3LKNB 1UJ3C 3IFPA 3C6SA 3QNXB 4NCDA 4WNQA 1Z5LA 3P4LA 5B4MD 3QXWA 1I9JH 4KKBC 5DJ8A 5LVEA 2AP2A 4YPGB 1E6OL 4XBEL 3MACH 5C0FB 5C0BE 4TVPH 3VG0L 2YK1L 4M62H 2BVQA 5C3LD 2L7UA 5CGYC 5DA4A 4WU5A 2ZUSA 3OAYK 4YHOH 4HS3B 4LDLB 3GSXB 1QBBA 4OD3H 2XNAA 5D1XC 5IG7B 3W9EB 5IESL 2FECI 2LQRA 1F4YL 3KYMA 1ZK9A 3QUMA 3RRQA 1Q9KB 3NZ8A 2AJUL 3ARDC 2EE2A 4F80A 4NCC2 4OQTH 3RL1A 3T0EE 1KACB 3ILQC 3AAZA 2VC2H 4XPAL 4ONHB 5EPMA 1X4YA 5C2UB 5IFAH 4KAQL 3PQYB 4X5WB 3U4AA 1HSBA 3QRGH 2V9TA 2OTWB 2X41A 4I5BB 2BVUA 4XP5H 5KSBA 1X5IA 2YSSB 3MREB 1KLGB 5DJXA 1BJ8A 2EZ0D 1F6FB 2P48B 4NP4H 5CBAB 2YUZA 3S36H 2E7LC 4PJDA 2Y06L 2B20A 4NM4H 4NQEA 4D9RD 4YDLC 2FJHA 1IAMA 3IRPX 4AIZA 5J1TC 2OTPA 2X1XR 4TVPE 3P4OB 4F7CB 4IIQB 1MFAH 4OGXL 1QKZL 2D9QB 3JUZA 5JOPD 1JNJA 3THML 4U1MB 1UWGH 2ZOLA 3BPCA 4YR6B 1F02I 3MBED 2VLRE 2ZPKL 3T1FA 3QXAB 4I0PD 4PJXB 1J1OL 3BDYH 1C12B 3BWAA 1MCJA 3O4LD 3MRBA 2L0DA 1BBJA 4Z7WE 3HC4H 4Y1AD 3GJEB 3TO4B 2X4PB 1NCDH 1ORSA 2CLZA 2GT9B 3TBSB 3K2UL 2IAMA 4BA8A 2AV1A 2Y5EA 3O6ML 3SKJH 1T0NB 1KELH 4FQPA 3HUJA 3FTGA 4Z7QE 5FCSH 1TPXC 2R0KL 1VA9A 1BF2A 4YHIA 3N9GH 4TUKH 3UBXA 2A83B 5IVXB 4JPKL 5JA9A 5E8OB 2B2XH 1A3LL 1U0QA 2AV1B 1NUFA 4PRDA 1J1OH 3BDYL 3HAEG 3RWGB 5I30L 1LK2B 5DA0B 4JFFB 4FFWD 1OTUD 3QEQB 1FPTL 4G9FB 2ZCHL 3NAAH 1UKTA 2FATH 5C8JA 3QFJA 3ZKXC 1KENH 1PSKL 1KELL 3FB8A 4JAMA 4EN3D 1J0KA 4O51B 3P0GB 1F6AA 5SWZB 4PJGB 1H3WM 5BZWB 4MJ5B 1AGCB 3MGAA 1F4WL 3VFSB 4RFOH 2APFA 5CKGA 3HC0A 3QZWG 4UB0L 4BUGA 3KPTA 4PTUA 5HGBA 3MLUL 3EOAA 4OB5H 3WSQL 4ETQB 7CGTA 3H8NA 3CUPA 3QXUA 4PLKC 2EXWC 2Z31D 1A1NB 3H3PL 2Z8WC 1RIHH 4NWUH 3RP1A 1JF1B 4OFYD 2YD5A 5E2WH 3KGRA 1PX4A 4K7PY 4NC1E 1CXEA 4X6BB 1FNGB 1LNUB 3M8OH 4EOWH 1PZUB 4KUCF 5IV2B 1CDIA 5FECB 3DO3A 3QEHB 4IRJB 5ICXA 3VXQB 3GBML 2RGSA 1QFOA 2NY4B 4HIXH 3UYRH 3STBA 3E3QC 4HWEL 4MA7H 4J3TA 1IM3A 1VGEL 5GS2D 3QDGB 3PDGA 1M05B 3ESUF 1IQDA 4MS8D 4WU5B 3RX5A 4WUUD 1MCBA 1XF5A 1A6WL 2EDXA 5IVXE 3S37H 3BP6B 5DHVB 2ICWB 3CFDB 2BCKB 3QO0B 4RNRB 4U1KA 5GXBB 5SWSE 1Z2KA 2KQNA 1XCTB 3M8OL 1YC7A 5DRZA 2QR0A 3BQUC 3PWNA 5HXMA 2DQJL 1MCQA 1PKQE 3EO9L 4LRIA 1U3HD 4Q0XL 2C3HA 3O81A 5MI0B 1GC1C 5CP7B 3EBAA 3WFCL 3UP1A 2ZUQB 1AP2B 1SY6A 2PKDA 3FONA 3U6RA 2PW2A 3GSWB 5EU3A 4DVBA 2ED8A 4MNHB 2EDKA 4GS7C 1CDHA 5IBUG 2MPAL 3OTTA 4WWKD 4MJ6B 5MI0C 4TQEH 5IR1B 4R8WL 5I1DA 1INDL 2BSED 4KZEH 1QACA 1N7MH 4KKAD 3BQUB 4UI2A 4HG4J 3AM8A 4OKDA 1MJJB 3TBTA 4P9HC 4RWHA 5TFSL 3RI5F 3BPLB 5GZOC 2Q86B 4Q9RL 4GOSA 4WCYL 1WK0A 2Y9RT 1R5VA 4QXGH 4WEBL 3GIZH 3QWRD 2R4SL 1NFDF 2JCCE 2FSEA 2I9TA 1FN4A 1QTYT 1LEKA 1AD0A 3H9HB 3AS3A 3W0WA 1QBML 1YN7A 2VXTL 4DKDC 2MKWA 2R23A 1WCBB 4M7JH 3ESVF 3BRDA 2GHWB 2W9EH 1T2XA 5IVNA 3EHBD 2ADFH 4R26L 2YC1A 4PGDA 1QPPA 3IJHA 5L9DH 1FCCA 3OXRB 4DZBB 1IBGL 3UMTA 2WIIB 3LAFA 4XPGH 5D2LE 2PXYC 3NH7L 4CVUA 3BWUC 1T1WB 1CK0L 1BLNB 5GGRA 5C08A 5CGTA 1TMCB 5CJ8A 1N3NA 3V4UL 3OKKA 5HYJA 1CTOA 4XNXL 4H20L 4I5BA 3HCVB 1ONQB 5EFIA 3EYSH 4KDTA 2RHEA 3SGEH 2ZNXA 3WKML 4DZ8A 2J8UA 4HKJB 4HLZG 1EVUA 1MRCH 3HRZB 2QV2A 3WUWB 1CGUA 1IBGH 2VOTA 1LDSA 5IMMA 2YPLE 1IC5H 1MAMH 3ZDZE 3FQNB 2PYEB 5DJDB 3CSPA 5IB2B 1BJ1H 2R1WB 3IXAB 1KCSH 3L3DA 3OJDA 3FOLA 1ZT7B 4L4TA 2NMSA 3X13A 1ZLVH 3B5HA 4IMKC 3G5YB 4OCXL 4JKLA 4C4KO 1FH5H 2HVJA 4PLNC 2DYPD 1WTGT 2MQ3A 4F9PC 3KPPB 4OJFH 2AK4E 2DQTL 2H9GA 1HINH 4V1DD 2B39A 4P9ML 1FG9C 3UTQA 1ZT7A 5HD8D 2VAJA 1U58A 1G7PB 2AEPH 2AJVH 1UVQA 2VH5L 1OSPL 3L5IA 1CDYA 4RMQA 1NL0L 1FIEA 5EN2B 2IFFH 4HCRA 2R9HD 1U9KA 3OKNB 2PYED 3RWHA 1RUML 2ADIA 3UTPD 5CBEA 1GAFL 1KPVA 2IH1A 2FO4A 5CP7A 2ORBH 1E28A 4IOIA 1LWRA 2HRPH 3WNKA 3B9VA 2KBGA 5DMKA 3QUKA 1BVLB 1IT9H 4ZD3L 4L9DA 1J9CT 4LAJH 5GS0D 2CIIA 3DX8B 3MCG1 3NN8B 1HINL 1KLUA 1YQVH 4JHWH 3MC0A 2BY0A 4APQC 4NYLA 2YD2A 4X98A 2XWBB 1BFOA 1A6AB 3MV7E 4QRQA 5ADOH 3TN0C 4DVRL 5I1IH 5L2KE 2R8SL 1JPST 1MHEA 4GRMA 3HNSH 3WXVH 2A83A 5GJSL 3VMOA 1T1YA 2IQ9H 2HLAB 1GPOL 3B2VL 3OAYH 3MRIB 5KS9F 3EOYG 4F58H 4NCC1 1J05A 3I6GB 3HUJB 4QRRA 2JJUA 1QSFD 1IZKA 4PP2A 2K7QA 4IJ3B 4OI7A 4KTEH 1WF5A 2ENSA 1AGFB 3PWNB 3OKLB 2HWZL 3GMRA 4JRYD 1X6LA 2YD7A 4HV8A 2EYSB 5GSRA 1N3NB 3T09A 3VU2A 5GZNC 3DX7B 2VDRH 3UTTA 1T66C 3BKYL 3ZYIA 3RFZC 4ENED 3BZDA 15C8L 3Q6FB 1S7WA 4QRRB 2AJZA 5F6IC 1DP0A 4JHBA 4OIAA 3GSNB 4PRPA 3VD9A 4LBEA 4TULH 1FV1A 4H0GA 3V4VL 1FZOB 3X12A 3M1BA 3PWPD 1TCRB 3O3AB 4U7KA 1KN2H 2ZG3A 4L4VE 1S7WB 1VHPA 5C0AA 4IRSB 4F15C 4LVOC 4GAJH 3CXDH 3C6LB 3QULA 4GSDH 2VKWA 2BVOB 5T3ZL 5TGBA 3WKNA 1JHKL 4L3ED 5IEHA 2F53A 3MV9A 4OSUH 4YBHA 5DT1H 4ETQA 3QWRA 5E8OA 4JDVB 3FN9A 3RDTD 4ACPA 3VXSD 5F7EH 3SHSA 2IJ0C 1W0WB 3ARBC 1SEQH 3V5KB 5JUEL 1D7FA 1NC4D 2FNBA 1QRNB 4YC2B 1Y6MR 4QKXB 4UU9B 4Y5XA 3T77B 4LRNH 2VLJA 2BC4B 4JPIB 3ABZA 2VTFA 2H2PD 3MCLH 5J7CC 4EQ3A 2X10A 3IU4H 4UV4H 4R9HA 4WWKA 1EVTC 1I9IH 2E6JA 2APTA 3MLSL 3LKSB 1Z5LB 2O5XL 4ZUWA 2OJZH 5BW7A 5BO1H 4KJQD 4K3DL 3RAJH 1NBYA 3T77A 3ULVL 4LPTA 3UDWC 3DMMC 4JJHA 3LS4H 2QQKH 4JFOB 4MJ2A 3U6RB 2OL3A 3KPSA 2BNRB 4M1GL 2XA8L 2GAZB 3MRHA 1NCDL 1ZHLA 3CK0L 4PJIA 4QGTA 3KYOB 1KJ2H 5EWIL 3AGVA 4IM8A 1DBMH 1KC5H 1DSFL 5DC4B 4EUPG 5EZLA 1EFXB 1UJ3A 5EO9A 5I8OH 3QIWA 3U0TB 3BKMH 1QSFB 2BNUA 1WGOA 3ZHDA 5CCKL 3GMRB 1SEBB 5ETUA 5HI4D 3G6AA 4K9EL 3UZEA 5GGUA 2BJMH 5D7LA 1DQJB 3EYVA 3DARA 3FOMB 1WIOA 1H15A 4MSWA 4JFED 1PLGL 2WSKA 1JWMA 4X83A 4KV5F 4TNVK 4KMQA 3JWDC 4PY8I 3SJVB 4EI6A 5KS9E 1KENL 1P9MA 1ZLSL 3K4AA 4PRBA 4WI7A 1Y0LB 5DMIL 5E5MB 1NCTA 2PETA 3DJ9A 3S4SB 3G5XA 5CEZH 5FA4B 5J12B 5D1QD 3ARFD 3KPQA 4M48L 5E2UH 1DCLA 1O7VA 1U6AL 4YGAB 3T1WA 3QFDB 2JJTC 4N0UB 2V7NA 3WJLC 2XZCH 1AO7E 3K1DA 5LCVH 2BVTA 4FQHB 1TZHA 3RVWD 1NC2D 1BVKB 2I26N 1I7UA 5CJ5A 1ODAA 5D7SL 2RCSL 3L3IA 3HI1B 3NCYP 2ZJSH 3S5LB 1IE5A 4G5ZL 2Q3ZA 2BXYA 2IQAB 4ZS7H 1WZ1L 3GMNB 3NZHL 3GSOA 4QHLB 4N1CA 4ORGB 1MRDL 3S98A 1P2CB 4EN3C 3SKNA 1CI5A 1OARH 1ZHKA 4PJ5B 1VGEH 4J3WA 3EO1A 1W0VA 1I1CA 5IP4A 2JCCF 2ZOKB 4WGWB 4E0RB 4KZDH 3GMMB 3BKJH 3IFNH 4P2QA 5D7KD 4PJEE 4ZG1A 5FUCC 2H3NB 3GMNA 3BESR 3CFKB 3HC3L 1RUQH 3D25B 2H26B 1B9ZA 1IAOA 5B21A 5B39B 3VG9B 4JFPB 3VFPA 2WK2A 5D1XB 1CFBA 2OL3B 3KPSB 1CWVA 1MI5E 2H3NA 4PGEA 4MDIB 4OTXL 5HYQB 2LTQC 3T0WA 2Y06H 1JPSH 3SDAD 3EOBA 1VDGA 4HGKC 2SEBA 3RGHA 3NTCH 5B38B 2DYPB 2ENYA 3T2NL 4ZO7A 2IAMC 1KPUB 5I6XC 3X3FL 4D0DA 5C0RL 1QD0A 3EYFA 2WBKA 5IG7A 2ZPKH 2WWMC 4K71B 5SV4A 4MD4B 2CXKA 2BY2A 3WIHA 1A7PL 2NY5H 4YHKH 2IPUK 1EEZB 5CILH 1KN4H 3BE1L 1Q0YH 3PWPE 5F1NB 5C0EB 4RGNE 4LSPL 5C0BA 3VD5A 3MV01 2EYSA 5GSRB 3TBSA 5IVZB 1YEIL 3C9NA 1A7QH 4UIMA 2HMID 1QRNE 1HSBB 3MPCA 3T0DA 3LHPL 5EO9B 3OHXB 5BS0A 1D9KA 2AGJL 2NY2B 3U9UB 2Z8VC 2Z92B 2IBZX 4XMKH 3PL6C 3QIBA 5JHLL 3I85A 4OCWH 5K59E 3O3AA 4NNYA 1JWMB 2XN9B 3MOAH 4RCAA 2C9AA 4K9EC 5B3NA 1HEZA 3RIFF 4NYLB 2IALB 1G7IB 2X4SB 1L7TH 4JLRB 5B8CC 4EXPX 1HKLH 2M26A 2CSPA 4IJ3C 2P5EA 3D5OF 2N7AA 2OSLA 1Q38A 4KRPB 4HJJL 4ZOBA 4KRPC 1P84J 4JKKA 3UZVB 1T1ZB 5LAXB 3ZDXE 3U36A 3OV6A 1A2YA 2FGZA 1P7QA 4WDIA 4APQA 5DJ0B 5DQJB 4Q7DA 2FX8H 3SDCB 2GK2A 1U93B 4XNYH 1PGRB 5DZLA 2EKJA 2P44B 2GJ6E 3DV6A 5B39A 2PTVA 4JPWH 1SBSL 4M61A 1T89A 2OL3H 3NIGE 3PWJB 1IVLA 2Z93B 2H32H 4JVWA 1G7HA 2BVQB 4EKXA 3O2VL 3Q1SL 5F1IB 1YEDA 5ANME 3T8XB 4MAYD 3T0VA 2FX7H 4TOYL 2XWJA 1XZ0B 1W0VB 3HI5H 4POUB 3E3QE 3CLFL 3HNTH 4KHTH 4LSTL 1A6WH 5ERWB 2HTLD 2Y6SC 1P5UA 4OLYL 4ZO9A 2ZG1A 3SKMA 1UXSB 1VFBA 3TZVA 3O41A 1HYSD 3V5KA 4CVXA 5I75C 4R3SB 5IMMB 3DVGB 3TIEA 5DEGA 5DUBA 1KXTB 5E6YA 1FE8L 3TBWA 2FGWL 3S5LG 5AD0A 4LLWA 1JNLL 3I9GL 2UWEA 2GSIB 5T1KA 2IMNA 1N64H 1JN6A 3O4OC 5ENWA 4N0UA 5ADPL 5IF0B 1JF1A 3FB6A 5GS0L 4QRUB 3C9NB 3RGVC 1CZ8L 3AREA 1CQKA 1QUNA 1NGYA 1JWUB 4ZPTA 4MD5A 2MPAH 2R0LL 4LEOB 2VXVL 3MUZ1 2Q6WA 2CK2A 4O00A 3QDGA 3U0PA 5F8QC 2VXUL 2J6EH 5F7DA 1MJ7H 1HE7A 1IGML 2VIRB 5F97E 2QEJA 5TFSH 3VWKC 2VDKH 1NCAH 2RIKA 4N0FB 2R2EB 4TPRL 1H8NA 1UC6A 5IK3A 4EDWL 5T3XL 2D0FA 3U7YL 1KLGA 3C5ZD 3AUVA 1PDKA 1IEAB 3OJVC 4JFHD 3G6AB 2VSDA 5I1AB 5E2TH 1RUKL 2P5WE 4AEIL 2GW5A 3O9WB 3LKNA 2XFXB 3WDHA 2R0LH 3BPNC 4KTEL 5F7KC 1CFQA 3T0EC 1D5BB 4ZDHB 3TA3C 3INUL 5FYJD 2KDGA 3L7EB 4NJ9H 1NC2A 4C57C 1DBJL 2AKRB 3CFBA 1H0DB 15C8H 1YNTB 1IAIL 4KI5E 4M5ZH 4OQTA 1NUGA 4JY4B 1GZQA 5TJWK 4PFEA 1CG9A 5KW9L 1KF9B 3U7YH 1ORSB 5FHBL 3OKYA 4OLZL 1MJJA 3CVHH 1ITCA 4JCMA 4PJIE 3BWAB 4G8IB 1ZS8B 3ARRA 4C56E 1EO8H 3MRQB 2BSRB 4N8PA 3MNWB 5LXGH 1AR1D 4N5EC 2BVPA 4X8JB 1YNTA 2GTZA 2CXGA 1MFCL 2W07A 3ALPA 5F6HI 5AYQA 3EYQD 4JN2A 5L7XL 2FHFA 1LK3H 3HPLB 1HDMA 3TJEL 1S9VA 5DHYB 1LEKB 5DD0L 3ZE0E 2NY0B 4H20H 4KI5D 2E9WA 4PJDB 3RUGE 5GJTL 3UPAA 2BSSA 5DQJA 1T3FA 2DJSA 4FQHA 1RZ7H 1EHLH 2X4NA 4I2XA 3A67H 3CVHL 1FJ1B 1WVZA 4MNGA 4M93C 1VFOA 4P2OB 4TTDD 3T4AA 1DUZA 5FEBA 1OGAE 5FYLE 2NY7L 4XMLH 1KCVL 1G6VK 2ZG2A 2W60A 4X9FA 4G7YL 4FHBD 4XI5C 4RFEB 5HY9A 1A7RH 4M8VA 4MQXD 3HPJA 4QHLA 4JFEE 5BV7H 1AJ7H 2A6KA 2B5IC 4HUXB 2XN9A 1NCNA 4RGOL 1FH5L 2G5RA 3FQTA 1NBZB 1Q0XH 2C1PB 2FLBT 3CPLB 1OP3K 1LO2L 5CJXA 3D87B 5DURD 1JMZA 5E03A 4CN1A 1AQKH 3MRCA 4JQVC 5D93B 1P6AB 4PRPB 5ALCL 1BBDL 1DQQA 2DB8A 2EIZB 3VI3F 1I1RA 3O11B 5ICXB 1YEKL 5J11B 5EU6D 4JGMA 5SX5K 2H45A 4PGEB 3VDCA 1QFUL 2A6JA 4Y7MA 1I8IB 3OZ9H 3QZWA 1S78D 2HRPL 2R1XA 3L5WB 5I8KL 3GSRA 2ADIB 4C83B 1BZ9B 5C9JA 3NCFB 5C08E 4ZSOE 2Q87A 4HZLB 4F7PA 2Q1EA 1AGEB 4NP4L 4X7SH 4NJAL 3GDBA 4O51A 2BOBB 3QCVH 3BD3A 4LVHB 3CVIL 4POZC 4L29B 4J3OC 1X44A 5JW5A 1I3GL 4QGYA 4HC1A 5B39G 4Y19D 1SJVA 2P8LA 3MJ9A 4Z76B 1C5DB 4Z7NE 4UT6L 2XQBL 4FQJL 2FDBP 1YECL 2I27N 3RWHB 3ZTNL 2HA1A 1P6FA 1QVOB 3CSYB 2IH1B 1LE9B 3LZFH 4XC3L 3BPOB 2VDRL 1CFQB 2AK4A 4N90D 3L9RA 3MA7A 4JRWA 3FHAA 2ZP0T 4J7RA 5MHSD 1UH3A 1ZT1A 1HYRC 3VFOB 1GGBH 4PTTB 2VN4A 4FFZH 1NCUA 4TSCH 4UAOC 3GSUA 3WNOA 3KPNA 1MRFH 3SGJC 1EJOL 2RFXB 1G9ML 1UENA 3I6KA 1K8IA 2CD0A 2KUTA 4XXCA 5FK9A 1AQDB 2V9QA 4JLRA 4LLMA 4PRNB 4L8SB 2WW8A 1C16A 4O2EA 2LU4A 1FNEA 1UADC 4Y4HB 4AIOA 4RAUA 4W4OA 1OT2A 1ZGLM 1HK6A 5C92A 5EORH 4IIQA 1BD2B 3CXDL 4RISH 3T3PE 3D2UB 1PSKH 2NLJB 5KVEH 1DZBA 4N90E 3NCEB 2V2XA 1OP3H 43CAB 3TV3H 5JO5B 2J8UB 4HKJA 4APQB 4OLUL 4JM2F 4QRUA 3BP5B 4KMTH 3GJEA 4KRNA 4QT5A 4YH6A 3VXRB 1S7SB 4YO0A 4KJPC 3JV0A 5KSVA 1UA6H 1G9MH 2IG2L 3IVKB 3I75B 2O5ZH 2X4SA 3SOBH 2NPLX 2KQMA 3RA7L 1CL7H 4U7MA 1DE4B 4JFXB 1FV1B 5KG9A 5EB9A 2VDQL 1H5BA 5DD1L 3UTTE 3QG7L 4I77L 1DFBH 3IVKA 3GJFK 1I1FB 3RPIB 2MOVA 1JUFB 3QUZB 2ICEA 3VFTA 4L4VD 1CFVL 5DZNA 4MA8L 5C6PB 1V8HA 1X4XA 5DS8A 1KN4L 3BE1H 1FC1A 2Q7NA 4G80B 1CGSH 3BUYA 4LARL 4M1GH 4XCFL 3MBXH 4XBGB 2V5MA 4BFIA 3EYUL 2E3VA 3S36L 2X4TA 4NHUB 3PUCA 5JQ6L 4KGLA 5TDOA 5EBWB 2VXQL 1LEGB 1YNKH 1T3FB 1AGBB 3SDXF 3TBYB 2YZ1A 4NWTH 3IAQA 3QRGL 1I7RB 3CFJB 4LLYB 3CSYA 1NJ9B 3L5JA 1NCWL 3EYOA 3UTZB 5C71A 2AGJH 5TDPA 3UAJC 3GSVA 4AIXA 5EG6C 1KIPB 1VESA 1YN6B 3C5ZA 4K8RL 2ESVE 2R4RH 4NM4L 2F53E 3MV9E 1RHHA 3MOBH 3QFJD 3T0EB 5J4MA 1PG7H 4EUPB 4WWKB 1ETZB 1HQRB 3FT2A 3PL6D 4XHQA 3BIAX 2P49B 5JW5B 4NFCA 2H32B 4N0FA 3T65A 1A6VL 1FAIL 5E4EB 1A6ZA 4ETYA 4WFHE 3ULUC 4F2MB 1DQLL 1A1OB 4LPCA 1W72L 5I15L 3MLZL 1JYVA 3DMMB 3FT3B 3TCXA 3UC0H 2R4RL 4J4PA 1FVDB 4R90L 3MOBL 4UQ2B 5T1KD 2NXZC 4HIEA 4P3CH 4M7KL 1H5BC 4X7EC 3ZYZA 4B41A 3QNZA 3B2UD 5EZJA 5ESAA 4XCEB 1BZ7A 2RCSH 5D1ZC 2VERN 2HVJB 4DEPB 2PUQT 3RGVB 2YD9A 2X1PA 4U1MA 1J11A 4NQSB 4N0YH 5BQ7B 4N8CL 1T0MA 4GW4A 1LEIA 3UAJD 4WUKL 1B6UA 2E7HA 3D2UD 2YD3A 2HRLA 5EUOF 3F65A 1T5WA 1A7OL 1HQ4A 4ZO8A 2GITB 5DMGC 4L5FL 3FMGH 4RAUB 3VFMB 3SCMB 1XGTB 1F4XL 3CLFH 3LQZA 1HOCB 4OZGF 3FQRA 5GRVL 3ULSA 3NFPB 3FZUC 4P4RA 5F9DC 3VXMB 1P7KA 3QWQB 2EICA 3I50L 1N6UA 4X4ZA 4GBXD 2XY1A 4Z7WF 4JFDA 1MHHA 3TH3T 1Q8MA 5L0QB 5CLTA 5C9KA 2XTLA 3DRQA 3REVA 3RVVD 1RIHL 4WUKH 5JW4Q 4LVNC 1IGJB 2DLTA 3PGDA 4E41D 5EBWA 3E0GA 5EUOA 3T2NH 3O41B 1XR9B 4HUXA 3VGDA 3KPMA 5LWYL 2W1NA 4ZUWB 2GTZB 5F9WC 5C8JB 5FGSA 5E2VH 4X4MA 4Z0XB 3ARZA 4P46D 4Y5YB 4HWEH 4EIGB 5L2KD 2WANA 4QTHA 1XF2A 2NTFA 4PJFB 1IQWL 5BXFA 5CHNB 3TIDB 3RUGF 2ARJB 5D96B 1Q9OB 2VZUA 2WBJD 12E8L 4G8GB 2R56L 3V0AC 4R0LC 3D85A 3PP4H 4XTRD 5KSBF 3QAZC 5TDOB 5F3HB 1JPTH 1IKFH 2DM4A 5I8CA 4OZHE 1EA9C 3WLBB 2VITB 3TN0B 4JANA 4WHYG 5J89A 4Y8DC 3GZKA 5KSUB 1G0XA 2NY0D 2A6JB 2IF7A 4G8GA 4W4OC 3VRJA 2DQEH 2UYLA 5JPMA 2KH2B 3HCVA 1B90A 3PL6B 4K8RD 1IL1B 1ZA6A 5D1QA 1F8TH 4XHJC 4KQ4L 3HMXH 1C12A 3LN4A 1RZIB 4B5EA 1XF5B 5E94B 1S5IH 2Q8BL 5DLMH 4R96B 4N0RA 5KVDH 3BD5A 4WU7A 3IDJB 4HAFA 5IW3A 3WFHA 1HHGB 4ELMF 4S11A 4XP9L 3U0PB 1CXHA 2CLVB 2FJHB 3LN4B 3HUJF 1A0QH 2COQA 3O3DA 1HIML 4B7IA 5T1DL 3P40A 4UV7L 4CU6A 3LN9A 2EE9A 4XPFH 5DD3H 5ISZB 4ZUTA 2A74B 4JO4H 5IVZA 4CRPA 2BNUB 3PNWA 2X1WL 4KQ4H 4UIMB 4Y2DD 4S2SA 3EOTL 4TTDC 3KXFA 1L4IA 3Q6GL 2EIBA 5CP3A 3B3IB 2P43B 1UM5L 2EIDA 1IZJA 1LP9E 5IBLD 1C5BL 1CLZL 2CDGA 4K3EH 3GSQB 3V6OE 2UY7A 3F58H 3WFDL 4PJ5E 4D8PB 1N59B 3O2VH 4Z7VF 3EO0B 3C5SA 4UQ3B 2VLRD 1TPXB 1F97A 3UTOA 2BHZA 4YFLF 2GUOB 2ADFL 3U82B 3TA3A 2X89D 5BZWA 1T0MB 4GW4B 8CGTA 3IJHB 2NNAB 2V9RA 1AQDA 4KU1A 2ITDB 4KQ3L 1C08B 4H8WH 3TO4C 3SGEI 4OZHA 4LCCB 1RUPL 3NH7H 5D6DA 4Q2ZB 3EOTH 3MV8B 3QDJD 3PWVA 1B0WA 1TLKA 1RZJC 5A2IH 1ED3A 5I75B 4HIHA 2JKXA 2XZQL 4NKIL 3S5LA 5HHME 1AD0B 1Z0MA 5A16A 1TJHL 3BT2H 4UIKL 4FZEH 3ULUH 4ODXB 1WZMA 2YZ8A 3ARUA 1YYLH 5EBLA 1AH1A 1HDMB 4WFFD 4U1GB 3OR6A 1A47A 3MYJB 1QLEL 5LGJB 1XGPA 5EU6E 4L3EA 1AI1L 4NFDA 3VXPA 4P2QB 4P2RA 3TJHD 1U91B 5DEZA 3CSGA 4YNYB 2F54E 2OMNA 1VFMA 1T66D 5ACMA 3W0WD 5EUKA 4BQCA 3G5YA 1CT8A 4EDWH 3VFMA 43C9B 1JNHB 3F6LA 1JZ7A 4XNZC 2DQTH 1A6PA 3PHOB 4YHLH 3MXWL 1N6QL 1RUKH 2NR6C 2VYRE 4NQEE 5HGAB 2VH5H 3MBEB 4HWUA 1YECH 2IPUG 4DKEH 3U46A 4YZFF 3RVUC 1HZHH 4U2YA 1WBXA 3BPLC 5DZOA 4PLJD 4PBXA 3WHE0 4JG1H 5C0DB 3CFIC 3S7GA 1ZHBA 3CFDA 3HG1E 3QG6B 4PP1C 4FA8A 4QRPD 1DBAH 3G6JB 3RIAF 3PF2A 5LGHL 5T33L 4HLJA 3RL1B 1KFAH 2IALA 4PJ8D 4Q6IA 3B4NA 4L4TB 1CD8A 4LGSB 1DLFH 2D31B 4NZTH 4ZAKC 2QQNH 4OI9A 4YAQB 5D70H 4MXQC 4UQ3A 2CKBH 3UYOD 1WFUA 3TA3D 4QYOA 3LPWA 1RZ8B 2Z35B 3AS1A 5EC1A 1D5IL 2DLGA 2VZSA 4OGZA 3MRQA 5ISZD 3IKCB 3BZ4B 5TDNA 4LSSH 5DR5L 3SDXE 2JB6B 1DQJA 5CSGA 1I8KB 4JGJA 4WY7H 1IAKA 3SDAB 5A2FA 4P2RE 1FVDA 4M3JA 2DQUL 3F7VA 3DMMA 3FT3A 2EO1A 5SV3A 3DYPA 2YPVL 1MFNA 4I3SL 1ZEAH 4NFBA 4Y88A 3O2WL 2Y07L 3MRHB 4FQQA 3HI6L 4ZFZA 4HPYH 4NO0D 1F11A 5LQBH 3LPFA 3WO4C 1D5MA 3BXNA 4I9WD 3WNPA 2C3VB 4JZOA 1I4FB 1NCCH 4ODBD 2FL5B 4G6FD 4AY0A 4AT6B 1T7VA 4RFEA 5C09A 5HY9B 1MOEA 3F5WA 4KRPD 4YHNA 4XVTL 2HH0L 5I1EL 5CIPA 3EJYC 1BWWA 1QLFB 4PJHE 5FHAH 1UWXK 4JE4B 1OLLA 3GUTB 4KKAC 4FABH 1SEQL 4FQ1L 3L3IB 1A4JB 1FL3B 1NAKL 3OKOB 4CADA 4Q74A 4BQBA 5EUOB 1BQHA 3UTTD 5IWLC 1I8LA 4RAVB 2DD8L 5K9OA 5B8CA 1TVHB 4C56A 3CZFA 4OSUL 4DK6A 2F53B 3MV9B 3DYOA 1EFQA 1NGYB 4EN3A 1NGWB 3RJQB 2YD6A 3VFNA 3KR3L 4QRRD 3VMPA 4D9LL 2G60L 4RA3A 4L3CA 2HLFD 3GI8L 4M7LL 3JWOL 4GRWF 4U1NB 3H6JA 4WFGD 2FR4A 4PRHA 4HJGA 4G7VH 3LKRB 3LMJH 1OSZB 3VFGH 3I02B 3WJLA 4XXCC 4AQ1B 2GTWB 3EFFB 1GGCH 3RVXD 2AABH 3BD4A 1RJLB 1HOCA 5C0AB 4Q9QL 4PJ7F 4HK3N 4ZQKB 2DKMA 5EOTA 3FQXA 3WFHB 2AXFB 4MNGE 3C60D 4G6AD 1T89C 3OB8A 1S3KH 4MB4A 4HS3A 3HRPA 4XB7A 2ESVD 1T21A 1OTTC 4LIQE 3O0RH 3GK8H 4NQVB 2AEWA 3LS4L 4OCRL 4UMGA 1A6VH 2XYCA 2IAMD 1J8HD 2ZNWA 4MD5B 4H8WC 1PZ5A 2XA8H 2BJML 3IGAB 2Z93A 3VH8B 4AENB 2UVFA 4HJ0D 2UYLB 4DFHA 2QHLA 4JFDD 4XC3H 1RZJH 1U8NB 4HKZB 4PJCB 5TPWH 3ARED 2GY7B 2R29L 3MLYH 2HJLA 5I1LA 3QA3A 3BP6A 1VFAB 1JPFB 2XKNB 3BKML 4FZ8L 1C7SA 4PJ7A 5JHDA 3VFPB 1EZVX 1FDLH 1CICB 2YUWA 3O6FB 3THMH 5J6HB 1RV6X 1FSKC 1J5OL 1A6ZB 1UVQB 5KN5B 1AY1L 2QSCL 5GRJL 3BRGC 2XWTA 1Q9OA 2Q76B 3F12B 3G9VA 5MENE 3BAEH 5B38A 1NLBH 4L9LA 2CRMA 3O3UN 4Z7VB 1G6RL 1P5VA 2FECL 3SE8L 4NRXA 4PY8J 4HEME 3WJJA 3DI3B 1TXKA 4ALAH 1KIQB 1HHJB 4KROC 3K8MA 1BF8A 3QCUL 5F9AC 3R0NA 1J0YA 2FLRT 3EO0A 4LOUC 4WVRA 1H3PH 1QVOA 3BO8A 4ZTOH 1FORL 2I60L 1J5OH 5HPMB 4FQQB 5I76B 1R3HA 2WWMD 4F37F 2V7NB 1MRDH 5LCVL 5JXEA 4FQCL 2BVPB 3NPZB 1NEZB 4JPWL 1NAMA 3TO2A 1D6VL 4UDUB 3MV7D 4QTIH 5F8RC 4G5ZH 1A7NL 4NNPL 4HXBL 3MLTB 2ZOLB 3BPCB 4D3CL 1NANH 1RK0A 3Q1SH 5E5MA 3NFNA 2NNAA 3SJVA 1KBGH 3KLDA 4FQLH 1KGCD 4X6DB 4KZDL 5T5NF 3FQXB 4G8EA 3KG5A 1LEIB 5GGSB 3L3JA 3LKPB 4F3FB 5IEKB 4GKOA 2D0GA 2OJEB 1T03L 2BFVH 1TZIB 2HT4C 3IAPA 8FABB 5IKCB 2ATPA 2Q8AL 4FFVC 4FTVA 1D6VH 4GXVH 5KSVB 1F58H 4QT5B 4NN6C 4D3CH 1WAAA 4P23B 2OJEA 3PIQA 3EJJX 3L95B 4GW5B 1TZIA 4NKMA 4X80L 4OLWL 1GOGA 4M4PA 3CPLA 4Z77A 3SY0A 4P23C 4MJ5A 1KUMA 4OQTL 4OKVB 4XNQA 5JIHA 5SWSD 4MCYB 5ID1B 5EU7E 3GMMA 1ZWIB 5CIPB 5EZIH 1PG7W 4Z78A 2JJTA 1DTUA 1LO0L 4XCCL 4D9RE 5F9JB 5SX4I 4MB3A 3E1F1 3KWWB 4YHKL 3EO9H 3TEUA 4TPRH 1HHHB 5C07B 4P2OD 3D69A 3ZE2F 3P30H 3K4DA 2P8PA 2X44D 2E5EA 1I3RB 2V5SA 3PDDA 3L9RB 5CSZB 5IOPA 5EO0A 1JZ5A 4JG0H 4NZUL 3O3BA 3K81A 3S8WA 1ULVA 1OGAB 3Q5OA 4XVJL 1BFVL 1KJ2A 1I1AA 5FKAA 4DUXA 4KXZH 1X5KA 3CMOH 4EI5B 4ODTH 2PYFA 3EYFB 1EGJH 3CDGB 3HAEH 2ZUQC 5HBBA 1QYGL 4NQCA 4YHNB 4YHYC 4EUPA 1MCHA 5JIPA 2ZUWA 1EAJA 3R06B 2WIMA 4LK4A 4M93B 4YHPB 5DK2A 2Z35A 3P0YL 3G6JF 3PV6B 2J5LC 1F11B 3FB7A 1HH6A 3P4OA 4PV9A 3WUZA 1SVCP 4MHHG 1ZANH 3EZ8A 3MJ9L 4DQOH 1G6RB 4CMMA 3SCMC 2O5YL 4MNQD 4PJ9D 2F8VA 5DQ9A 4BK4A 1WT5A 3ZKNC 3U9UA 3IGAA 1FYTD 3ORJA 5J3HC 4KHXH 4NC0B 2LU3A 3H9ZA 1N4XL 4NZJA 4UIKH 1ADQL 4G6FB 2FX7L 4TOYH 1IGCH 3NAAL 1YEFH 2DWDB 1DL7L 4GRLC 4TNWK 1U8QA 4IDLA 1CXLA 4L4VA 5DJ6A 1Y18B 2FEEI 1YPZB 4PJBE 4QYOB 1G7IA 5CAYB 1H5BB 2C26A 3MZGB 3V5DA 3OGCA 4XMLL 25C8H 2GITA 1Y0LA 1J8HE 2VLKA 2R0WL 3ARPA 3QDMA 1JZ4A 2G9HA 3ROLA 5HVFB 1G1CA 4NT6A 3HNTL 1U95A 5IHUH 4ZUSB 4P3DA 4W81A 1N64L 2BXZA 4ODWB 32C2A 4JY6A 2I07A 4A6YA 1N6VA 4JKWA 5E2WL 2Y5TA 3LB6D 4JFEA 1R6VA 5FDWA 2WNGA 3H9SA 3I3BA 5HYQA 2ATPB 5ESVB 5F7NC 3ZDXF 3PXHA 5IB4A 1FVCB 3G04B 4YE4H 1HSAB 4AMKL 2XQYG 1K6QL 3ZT5A 1OAZL 5I76A 3LEYH 2FO1A 1NDGA 4XC1H 5MEND 1ZE3C 3RWFB 5D7KE 4LAQH 2X4QA 4EVNA 3I6LD 4YXLL 4R4FL 1JNHA 4PJHA 3FFCE 1GH7A 4Y1AA 3CXHJ 4KJQC 3CU7A 4TSAH 3FN0L 1QLFA 1T5XA 4PJGA 4OFDA 2YRLA 3RVXC 1XZ0A 1KPRB 1FNHA 3H42L 5BXFB 3MRNA 1JUFA 4M6MH 1QSEB 2HLFC 4ZPVA 3MZTA 4MCYA 1D5IH 2BNRE 2WAHA 4I48B 4PJAA 2A6IB 1T5XB 4MDJB 3C8KB 5BVJB 3NABL 4CJ1A 2OR8A 3CDYA 3HKFA 2R2HB 1AGBA 1CICA 4FN0A 5JDSB 5D96C 2QQLL 3QIBB 5D2NB 3BZFA 3O3BB 1MAKA 4TSAL 5K9QI 1VFAA 3O6FD 4IOFD 5DJAB 5KW9H 5CEXB 4X9BA 5DYOB 3RHWK 1D5XA 3HNVL 5D6CA 3H42H 4LCWE 4YDLB 3MLRH 3P9MB 2VE6A 5IIEB 3V7AE 5KVMC 3HB3C 2X4OA 2V17L 4CKVX 5C0BB 4QF1A 4S0SD 1NCCL 4OM0H 2R39A 3VI3E 5IK3B 1Q72L 3DRTB 1HHGA 1M4KA 1RZGA 4H8WL 4MWFB 3WNMA 4DW2L 3WIHH 3ZT6A 2B1AL 4ZTPL 5T3ZD 1A1MA 3KS0H 5JNYA 1VKXA 1RJZA 1BVZA 3QWOA 1RD6A 3IT8D 4W6YB 4L8SC 5DD0H 3EDEA 1AGFA 5EOQH 3QUXC 2HFTA 1CE6B 5A3ID 4ZNCD 4U31A 4ONHA 3AM8C 4I2XB 4PPTA 4PD4J 4NO5A 4OCSL 5A2LH 2NLJA 3IDYC 3TH2T 2DQDL 3W2DL 2IG2H 4NSKB 1MELA 3FCTB 1N2RA 3JWDH 4IRJC 2APXA 5ERWA 5CGMA 3LMJL 3ISWA 3NFNB 3Q3GB 3SOBL 1RK0B 3HPJB 2NY1B 1OM3H 3MNWA 3V4UH 1JNNH 3BW9A 3TPUA 3ULVD 1K4DB 4NKDB 3QUXB 4OZGB 3M07A 4AT6A 1VGKB 1HH9A 1FCGA 2FD6L 3K4ZA 4XP6L 4JANB 3IU3A 4R97B 1XR9A 2VQTA 3IDUA 4DN4H 2CR3A 5DJDA 4OD1L 1H3VA 2XRAL 4Y16D 2FJFB 1MCDA 1JZ2A 1OAYH 5BRZD 4N8VA 5DI8B 3MRPB 5ILTH 3SKOB 5DUML 5IHZB 1OM3L