4ZFGH

Dual-specificity fab 5a12 in complex with angiopoietin 2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
215
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTISDYWIHWVRQAPGKGLEWVAGITPAGGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARFVFFLPYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/immune system
molecule keywords Angiopoietin-2
publication title Deep Sequencing-guided Design of a High Affinity Dual Specificity Antibody to Target Two Angiogenic Factors in Neovascular Age-related Macular Degeneration.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 215
sequence length 219
ec nomenclature
pdb deposition date 2015-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zfgH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zfgH01
3FTGB 1BD2A 3GUTA 1TPXB 3PABB 3QG7H 4MAYD 3GI8L 4JZOA 5IW1A 3RTQC 1PD6A 1YPZA 4NWTL 1K6QH 1D5MA 2BC4B 3QIBC 5HYEA 2CDEB 1LEIA 4MQXD 5MEQA 1CBVL 4OCXH 2EDWA 3MRIA 4K9EH 5B3JF 3C08L 4E42B 2EDNA 1WT5A 1XGUB 5ANMB 3OGCA 1U8OA 4X99B 4XP6L 3PP3H 4DCQA 3VWKD 1QSZA 2D03H 2HFFB 1Z9LA 3ISWA 3VXNB 3RWFA 3I2CH 5IV2B 4HIIB 4JQXA 3IU3B 1E6OH 5CILH 5TJWK 4KH2A 2WIMA 1J0HA 1AKJA 4UILH 3UTSA 5K59F 1FDLH 1S7XA 1DEEA 3BEWA 5DD0L 1RZFL 1KT2B 1IAII 2V2WA 4WO4B 1HSAA 1F11B 3BFOA 1PX4A 4NT6B 5SWZB 2X5PA 1O5DT 1OAKL 2V5MA 4CN4A 3P0GB 5J6GA 2C3WA 1HQRB 3V6ZB 3AM8C 4MD0A 3ZKXB 5D7KE 4PRDB 2PCPB 2PW1A 1NLDL 3O0RH 1X5HA 2PTVA 2YA2A 1FZKB 3K74B 4O58L 4HK0B 3QXTA 1A21A 2QADD 5FKAA 4WWID 2NCMA 4MQ7A 3DVGB 2WWMD 1CF8L 4YHMH 4CVXA 3T2PA 1FYTD 2GAZA 3TBYB 4UDTA 2CD0A 2NW3A 4XNMA 4NSKB 3AAZB 1ZVSA 3HR5B 4U1NA 1UB5A 5F44A 1FO0H 4OF3A 5EOCH 1W0WA 4OZFB 5CSGA 3UYRH 3FRPG 5D7SL 2DYPD 4NQTA 1UA6H 3P40A 1SJHA 4DVRL 2J4WH 5KSAD 1IE5A 1QKZH 3P4NB 3NBNA 1X5ZA 1YYLH 2A73B 4S1SL 4NKIL 1KB5H 3B5GA 3ULVD 4JDZA 3QDJE 1MOEA 1MFBL 1UJ3A 4WHYG 5EU7C 1CU4L 4EI6B 3PF2A 4QT5A 3K2UL 1OWRM 4DGVL 1TCRB 4NBXB 1GJIA 2BDNH 2WBJC 3K0WA 5F72S 3MBEA 3AS3A 3LS5L 4BZYA 1CFTB 4XBPA 1OPGH 3N9GL 4FNLL 4C56B 4NBZB 4MDJB 3STBA 3MYJA 4HJGA 2G60L 5FM5M 4QGYA 1NSNH 3O3DB 3H8NA 3C5ZA 4ODXA 3U6RB 3V5DB 4NZDA 4BFIB 2X9XA 3H3PH 4GW5A 3I6GB 4JKPH 1LDPL 1HH9A 1DVFA 2R15A 3SCMA 4MD4A 4NQEA 1KN4H 3MUHL 4MCYB 5ID0B 1KEGH 4OQTL 1H0DA 1ACYH 3HPJA 5I17B 4RWYH 4GMTL 1K4DA 4G6FB 3ME0A 4NN6B 4RGOL 5F1NB 2EKJA 1T0MA 3HNVH 4XH2B 1XZ0B 4KKBD 1S3KL 3GSUA 2EDEA 2BNUB 2X4TB 2Y36H 1YDPB 1OAQL 1WZLA 5I8KL 1YMMB 3UJIL 1FZMB 2V7NB 1AY1L 1ONQB 3S7GA 5DJXA 1ADQL 2Y25A 4J3VA 1I8KA 5A3ID 2A77H 5E99L 1DN2A 2QL1A 4M7KL 1R0AL 5I73C 2PTUA 2P5WE 5F1OB 2D7TL 3LMJL 5HGDB 3F58H 1A3RH 4YXHL 2ICES 3CFBB 3WFCH 3WNNA 3W2DL 1HHGB 2ADGB 3QAZC 5HYQB 2Y6SC 4G80A 2GJ6E 3BKYL 3HG1D 4K8RL 3B43A 1JYVA 1IC7H 1CL7H 3REVA 2JKXA 4JRYE 4MJIE 4CJ0A 1P7HL 5DHYB 2XZAL 4JG1H 4RQQA 4CMHB 1AIFA 4C56E 5JR1H 4XVSH 1OAXH 3OJDA 3MROB 4PJCA 2DI9A 4BJLA 3WJLC 3B3IB 4UIKL 3S6CA 1HSBB 1MAMH 1MH5A 4PRPA 3QHZH 4XP1H 5EZJB 5TDPA 1C1EL 3PGFH 4LSPL 1UXWB 3ZYJA 2F8XC 3UJTH 4Q7DA 4E9LA 3Q3GA 2HT2C 2P5ED 3IKCA 4QYOB 3BP6A 5EA0H 3N1PC 1A14L 1KJ2L 2ZG2A 5M94B 5IMOA 1JGDA 2B4CH 4POZC 3NCYP 4E41B 4NOBA 4YHIB 4WFGD 2XZQH 2APVA 1N6QL 1PSKH 2W0KA 2NYYD 3G08A 2OLDA 1X5GA 1T6VN 4MXWL 1LP9E 3QUML 1PG7L 4JY6B 4OGXH 3ZE1F 5GRYA 2AAVA 3WE6B 3O3EA 1MRFH 2UWEB 3O9WC 2Q76B 3P0VL 4JFXA 2AEWA 4M93B 3MQIA 1Q9OA 3QUMB 2AJUH 5AZEL 1DBBH 4DFIA 4GBXD 1RK0B 3QQ3B 4J3OC 4R26L 1J86A 1L0YA 2EEDA 1FRGL 4XI5D 2VOTA 4X6DA 3W9DA 1NBYA 5JZ7D 3ZDXF 2Z92B 1PKQB 3DJ9A 1V5JA 4KK8D 2PF6A 1NGYB 4JKWA 4LLMA 3FFCD 1J8HE 4RMQA 1ZA3A 3VXSD 4H5SB 4YFDB 1TTUA 1LGVA 3SDXB 4BFGA 2P47B 4HC1H 5DWUH 4WI9A 1YY9D 3DI2B 4LKCA 1A47A 3BKCL 2B5IB 3LEVH 1BZ7A 3RVVC 3SGEI 5I15L 1PEWA 4Y5VC 4K71B 1FL6B 3O3BB 1GYAA 2FBOJ 4MAYA 2OL3H 4PRIB 1QPXA 3CLFH 3T8XB 1LK2A 3CVHH 5ELIA 5B8CA 3QIWC 4X7TB 1RJYA 4LPUA 4KJWD 2J1KA 3BP7B 1PZUB 4NZUL 2WP3O 2Z4QA 3R1GL 1UZ8A 12E8L 5SV4A 1WTGT 3VWKA 1BHGA 4PJ7B 2OQJB 1R5IA 2EH8L 3IGAB 2XPGB 3VFNA 5CBEA 5JLZA 4U6VL 5EB9A 4X7SH 2EEBA 5AYUL 1RHHB 4OJFH 2ARJB 4EI5B 4HS3A 3CDFA 2VQTA 3WBDA 3VRIB 4M61B 1DE4B 3CFEB 3P30H 4PJCF 1FVDB 3ARGC 1T6WA 4YFLF 3V6FB 3GO1H 1WFNA 5I1JH 1XAUA 5EZIH 4R97B 4JO3L 2FL5B 4HAGA 3WL9B 5CS7A 2H2SD 2QBWA 1NGZA 3LN5B 5IBTL 3ULUH 5FO8B 2GITB 3MLWH 3P9MB 1WCBA 1FZJA 3MMEA 1FYTA 3CFIC 5IQ9B 1Y18B 3NH7H 4K3JH 4F7TB 1MCJA 3AMLA 1QA9B 4PGJA 4Y8DC 1ZA6A 3MLTA 4KK9D 2EKSB 4AJ0A 4UOW1 4BKLB 4IDJH 1T7ZA 2DTSA 3O3UN 4LF3A 2DYPA 4I4WA 2IC2A 1MCDA 5KSAA 1OP3K 1A7PH 3PNWA 1RSFA 3BX7C 2FBJH 5GGRA 4PRIE 4DZ8B 2E6PA 2GK0B 1ZHLB 2ICCA 2PYEE 1JWUB 2BVTA 5HJ3A 2C3HA 2H2PD 4L4VD 4ONFH 2IQAB 2CKBL 2YD6A 4BZ2L 3B5HA 3ZE2E 4JZJB 3DVFA 1D9KD 2IFFL 1CDIA 5KJRH 4MNGA 3RDTC 4ZYKA 2BJMH 1P4LA 2DM4A 2J7LA 1RUML 2CKBB 2XWJA 5JW3L 4J1UB 3HCVB 3HC0A 5J8OA 1LO3L 2IGFH 2OM5A 3LDBC 1NUFA 3NMEA 3RY5A 1C5CL 1NBQA 2IH1A 3Q1SL 3BIBX 1C12A 5I8OL 3OB8A 3MO1A 3QJFA 1CXEA 4U1JA 3STLA 4X98B 4U1SA 5BZDB 5BVPH 3T2QA 3WFZA 4L9LC 2YMXH 2EDKA 5HDQH 2CJUH 5HDBE 4ERSH 1JGEB 4L8CB 3NFPA 2Q3ZA 1KLGA 5F97E 4UNVA 3X3FH 5FGSA 2DQUL 4LEOA 1KIQB 5IMKA 1T1WB 2AQ2A 4JG0H 3VXRE 1CGSH 3DXAD 5FYLH 1L0XA 4Y4HD 4XNQA 3MRJB 4OCSH 3OG6B 4DVBB 3HRPA 1KCVH 1AHWB 4MYWB 4P9HL 2A6KA 1JFQH 4WCYL 5ENWA 4OZGF 3SDAD 4YHYC 4XWGL 5EO9B 4V1DD 2EDOA 5F1KC 4KMQA 1QBML 1HYRC 2F58H 4R4BB 3IFOA 1GAFL 4HUMB 3SKJL 4EUPG 2ZUQC 1AQKH 3HG1A 1F4WL 1NGXA 2BP3A 3QULB 4GKZB 5F89B 5FCUL 3IF1B 2FJGB 5MEPA 1JWSA 5JPNB 25C8L 1B3JA 4N5ED 1J0JA 3FRUA 4HGWA 1CL7I 5E7BA 43C9B 4X4XA 4X6FB 5DUBB 3DX9A 2CRIA 2UZXB 3TEUA 1MQKL 4OD3H 3B2UD 5FHBL 5JNYB 2DLEA 1CTNA 1MCPL 1C5BH 2QQNL 1LE9A 3GB7B 1XGTB 3M8OL 1TIUA 2P5EA 3ZT7A 4XP5L 4PR5B 4PLJC 1P9MC 5GXBB 2XN9D 4TUJB 4ELMB 4WWKC 1NDMB 1FFQA 4PJFA 4U1LA 1R3HA 3ULVF 5T3XD 4WUKL 2LTQC 1XGPA 3OAYK 3T65B 4HQQH 2QKIA 1C08B 1OVZA 2CLRB 3QI9B 1LK3H 4Y16C 1KF9B 2PETA 1WBYB 4ENEC 4GAJL 3NIGF 5CZVH 1EEYB 5K9KA 4P2QE 2R1XB 2F5AH 1A7RH 1SYVA 2OR9H 1S5HB 4GBXA 1CIDA 3EO1A 5ITFA 4NOFA 1HIML 2R29L 4MA7H 3FO1A 1N0LA 1I8IA 1J05B 2AXGB 4IS6A 2DQIL 4OZFH 1NCDL 2P48B 3CLEH 3H7BA 5EZLA 4CW1A 2LFGA 1NGWB 3FFCA 2W0FB 1YEJL 5I16A 1A0QL 1QEWB 1MWAB 4L5FH 3VXSA 3WDJA 5GGRY 4Q2ZB 4PJ9D 1U93A 2XXMB 5C9JB 2XT1B 4J6RL 3IDJA 4D0BB 3HE7B 4GRWF 4LGSB 2NX5D 4E5XA 4NO3B 5B3NA 1FNGA 2NY6D 3QRFM 4Y4FC 3QEGH 1J0YA 2R1YA 2CIKB 1P7QB 4M4RA 1T7YA 3KPLB 4XNYH 2XOTA 3HB3D 3U2SB 4HMEA 4BSJA 3GMNA 2HJFA 4OCYH 4ZXBD 3T08A 3L3DB 3VW3L 2YPVH 5IGXH 2DQGH 3VXQA 2YN3A 2VR5A 4QHKJ 3OKMA 4NHCL 2ICWJ 4NUJB 2NY5L 1MLBB 1ROWA 1RAMA 2HG5A 1QFWH 1JV5B 3FZUC 5DEGB 4OI8A 2X4SA 4ELME 3EZ8A 2D7PA 1QFPA 2HVKA 1JTPA 4I18A 5EC1A 4CRPA 1FVCB 2VDQL 1ZGLP 2CGRH 2O5XH 1KENH 3DRTB 2BVQA 2VN7A 5GGTA 5DHVB 4S0TD 5DS8B 1RVFH 1MJ7H 1MIEH 4U7SA 3HNTH 4PJXE 4P5MA 1CT8A 3FO2A 3KPRB 4ZFZA 1BOGA 2HMID 4PIRF 1JYWA 3VD9A 3BIKB 4NRYA 1HI6A 4ZNCD 2VERN 5KG9A 3O45B 4ZTOL 4KHXL 2RIKA 3DV6A 5B39G 1CK0H 4GH7B 3L7EA 4IOFD 4LLAA 2VE6A 1ZGLB 2JIXD 3P9LB 4Q0XH 3L6FA 2JB6A 4L4TB 5JTWA 1YNKL 3MV8E 2ZUTA 2J8UB 4LLQB 2GY7B 1N3NB 2AW2A 2ICWB 4PJIA 5ALBH 4FQ2H 2FSEB 3K2MC 5AYQA 5KN5B 4KPHH 2JJTC 2JTDA 4WDIB 4YC2B 3TJHD 5DQDH 2X4RB 1RFDL 3JVGC 5I1IL 1O0VA 2XZCH 4PJFF 4PBWD 5FUCE 4JJ5A 4N8CH 5CZXD 1R3KA 4JN1L 5J12B 4YIQB 3CXDL 1JZ3A 2HKFH 3G5VA 1G84A 4CADB 1B88A 1OHQA 1ND0B 2C5DC 4ODWB 3G5XB 1GGBH 1KPVB 1L6XA 5I18H 2F19H 4OZ4B 2FZ3B 3QXAA 2R1WB 2VIRB 1G7HB 1FFRA 4L4VA 3DETC 3EYOA 4CGTA 4RMRA 4S1DD 4QWWC 3PV7A 3LB6C 1YNTB 3B9KC 3MUGA 1BWMA 1Q0YL 1NAMA 2JCCB 4FZEH 4ZD3L 2PTTB 5H37H 4EEEA 1D9KA 4YBQC 4DZBB 4X8XA 4MVBC 4FRWA 1RD6A 5E03A 4FABL 4NGHL 3MJ8A 1H3PH 5MI0B 3KGRA 1EMTL 1AJ7L 3MRHB 2EC8A 3SE4C 4OCWL 1WAAA 1WLHA 1OL0A 2VDNH 3KPRE 1MI5D 4LHUG 5EPMA 3IAPA 4HUVB 3RAJL 3V8OA 3PL6C 1HQ4B 4UINH 3P0YH 5IVXB 4GS7B 3O8XD 1E28B 1TMCB 2AEQH 1QOKA 4HWBA 1Q72H 2YD7A 1A4KB 1I75A 3RKDC 4L4TE 2MJWA 4BFBD 3RTQB 2J8UE 4DAGH 1NCBL 3TWCL 3QO1A 3QIBB 1SJVA 1T1YB 4PJ5B 4PV8B 1ZEAL 1FE8L 4HFWA 3DXAA 3QNXB 1XGRA 3BEVA 4HIHB 1U41A 4Y4HA 4PY8J 2NNAA 3M45A 1WK0A 4F9PA 2AJVH 2X70B 1UJTA 3F7YB 5JIIA 2RR3A 4ODHL 4WW2F 4O2CA 4HGKC 1W72L 3O4LB 2YBRA 3BUTA 1PFCA 3SDAA 4V1DA 3VFMB 5KW9L 4M62L 4X0KA 4JHBA 2EDRA 5T5FL 4F7EA 3O6LH 1EHLL 1NFIA 2GY5A 5ITBL 5A2JH 4MS8C 1PKOA 3BUYA 1MCNA 1RMFL 4DKEL 3ARZA 5E6ZA 2NXZB 1ZT7A 3O41A 1HKLL 3BESR 4PV9A 4Y5XC 2VDLL 4HS6A 4N0YL 3PWJB 5D6CA 4UNUA 1C5DA 4PJIF 4PRHD 5ESAB 4RGNC 3WUWA 3DOSA 3C9NB 3QRGH 5LJYH 2B1HH 4LCCB 1CN4A 2VISA 5CFHA 1UKQA 3BMVA 1NCNA 1NBZA 5ICZA 4GG6E 4OZHB 4UTAL 5D1XB 1HN1A 2FGZA 1NKOA 3WXWH 4ZPVB 3BI9X 3H0TA 4QY8A 2XN9A 3CFDA 2VSDA 4KK5D 3S35H 1JF6A 4WI3A 1TNMA 4HH9A 4OD1H 4PJ5E 5IMLB 3ZO0A 4YQXH 5L9DL 3WIIH 1DBAL 2FX8H 2Z91A 1PEZA 1FLRH 1RZJH 3QIUD 4P0DA 4M5YH 3A6CL 2WBJB 4AIZA 1A1NA 3VFTB 1WC7A 2IPTH 3QUZC 4UIMB 1OOAA 3UBXG 4UUJB 3BZFB 3O4LE 3M07A 1TZHA 4KXZH 3U9PL 1WAAF 4RBPH 4NKOA 2DMBA 2AK4B 2YK1H 5J9PA 4X4YB 1L7TL 2C4XA 3G9VA 3PWPD 4Q9QL 4P23C 2R0LL 2G2RA 1HWGB 2W0PA 3WHE0 3DO7B 2DLHA 4R4ND 4GAGL 4HWUA 2BOBA 1YNLL 4PJ9A 5CCKL 1ZXQA 5DJ2B 4N0FB 5E1AB 5TH2B 1AP2A 2NX5A 1Z3GH 4KKAC 4OFDA 4X6EB 3ARVA 4D9QD 4H1LA 4PLKD 4NNXA 3F7VA 3ALPA 1SEBB 4NHUA 4QHMA 1IGJA 5JXED 1Z5LB 3LKNB 4QXUH 5IBLC 3R4DA 1KULA 5D72H 4HLZH 5C0BD 3HE6D 4HZAA 4ZXBA 5LGJA 5B4MC 1J1XL 1N64L 1QLRB 5E8NB 4NJ9L 2Y06L 1QRND 3MNVA 5CZKA 5FO9B 2WINA 4PTUB 3THMH 3LKPB 1I9IL 1T2JA 5H35B 1ZLSH 5HHQB 4C4KT 5J6HB 2DICA 2FD6L 1FSKC 2F9BT 3HRZB 1IT9H 3DUUB 3OXSA 4U1MA 4K7PX 3VXPB 2P43B 3AGVA 4JREC 2YC1B 3LKRA 3QCVL 1KPRA 4P49A 2VL5B 3INUH 5DYOB 3FT2A 3RWJA 4MLSA 2H6PA 1MCFA 4L8SA 3RIAK 2J8OA 2OTWB 5E8PB 2FO4B 4KI5E 5CMAA 1JPGA 4YHNA 5EU7E 1CXIA 3LQAC 2QHRH 1QPPA 3IJYB 1FG9C 2D7MA 4P2RB 4W6YB 4AQ1B 5KVFL 4LPTA 3U7WL 1LEGB 3RL2B 3FN3A 4LDEB 5GJTH 4HFUH 2YPKB 3B2VH 2QQLL 3OV6A 3JWDL 4FMKA 5DLMH 1T1XA 4XWOC 1RZ8A 1QBAA 3PHSA 3QZWG 1OAYH 2FATL 5F7EH 4JKKA 2JIXA 4CU6A 2DQJL 2WV3A 3KG5A 4JFYA 2DJ4A 1CFVH 2FWOB 1RZ7H 5DO2D 3SO5A 5TQ2H 5FO7B 4XHJC 4KK6C 2FJFB 3GGWA 3RUGE 4XCYB 5DRZB 4PG9A 3EDKA 3RX8A 1S9WB 4FZ8H 4HKZA 2HKHL 5DI8A 4ZUUA 4RAUB 2N7AA 5DFVD 1L7IH 5BO1L 1NCWL 4FXLA 1CXFA 1ZE3C 2N7BA 1KOAA 3MRLA 4TRPH 4GKNB 4WHYH 2YRPA 1E4XL 3D85A 3PHQA 5EBWB 4FXKA 5IW6A 3BPOC 5ERWA 4NQCD 4M5ZH 5DVNA 5E5MA 3LPWA 4DJMA 5JW4Q 4LDOB 4QLRA 1JL8A 2O61A 3LOWA 3D0LA 2NXYC 4JY4B 4F37F 2R2BB 5DZLA 2CMRL 2A0LC 2D9CA 3HZKA 3GHBH 5I1DB 2CK0H 5DEFA 5BS0E 2PW2A 3MUY1 4PBVC 4MLIA 3S5LG 3MNWA 5TE4H 1MFAH 1VFOA 1RK1A 4APQC 2Y5EA 1MI5A 2BNQD 3CPLA 1S7SA 5TGBB 5HI3D 2MCPH 1T80A 3KXFD 3O8XA 1CD9B 1UH2A 4BK5A 4RA3A 4Y5VB 3RI5K 2DTML 5B39B 4LLDB 2LAGB 4M7JL 5HSFA 2XWBA 3U0TB 4U2ZA 3MV9B 5IVOA 3QIWB 1UVQB 3ROOB 3FB8B 5ISZD 1KLUB 1XF2A 3ZTNL 4Z78A 3JTSB 5D7JC 2PN5A 2X10A 1AXSB 1M71B 2FH8A 5DJ0B 2AV7A 5HHNA 1OSZA 4XVUD 3SKMA 1MWAH 3EO9L 3H9YA 4HIJA 3MC0A 3UCRA 4KDWA 3MV11 3K8MA 4W4OC 3KYKH 1KCLA 3HZYA 3PJSA 4WI6A 3V6BR 5EC2B 4IRZL 2OP4L 1NMBL 2ARJQ 4EDXB 1NC4D 1P7KA 3RY6A 1NDGB 1ORQA 3MZTA 4G43A 2H26A 1A6WL 1SJXA 1JWMA 1N5AA 3ARGB 2DRUA 4R3SB 5EU6B 5J3HC 3KPQA 1UWGH 3FOLA 3E6HA 5IB4B 4ALAL 5GS1A 3IXTB 3MACL 4PRHA 3EAKA 4PS4H 2W9EL 5LGKA 4DUWA 5T3ZE 1MREL 3BJ91 4PYHA 5LCVH 4IOIA 4K94H 4YDLB 3V6OA 3L3GB 1T1ZA 3AXLB 4GW1B 1WT5C 1T20A 4MWFA 4D9LL 1I7TA 2I07B 1DLFH 2CXGA 4JQXC 1CDJA 3LIZH 5IOPA 1FHGA 3P11H 2Z93A 5C0DB 3TBSB 3BYYA 1YQ2A 3EFDH 2VZOA 4JO2L 5IEKA 1T03H 5EUKA 4MDIA 1YEHH 4JDTL 3TPKA 1XGYL 1RU9H 4W6XB 2EC9U 4HJJH 1DQDH 1NCUA 2O5YL 4FQ1H 3U36A 2AJSH 4PJGA 4ZS7L 1FL5B 3TBTA 4KRLB 3CXHK 1CR9H 1BPVA 1T04A 3QIUA 1FN4A 3RDTB 4M43H 1SJEA 4S2SB 1FQ9C 5MP6L 3HC4H 5HYSG 2RCSH 4FQLL 4R7DB 4JO4H 1GOHA 2ED8A 4JFHE 3RL1B 2H32B 3GMMB 3DGGA 3VD5A 1CLYL 1NMAL 3CD4A 3PWPA 4XBEL 4EN3D 1JZ7A 2HLFD 4ONHB 5DRNB 2HA1A 1F3JA 1F90L 4OZIB 1HXYB 2DM7A 1X4XA 1XF3A 4UT6H 1KLFA 1I4FB 5FOBB 1M6OB 2DQHH 4L9LB 1IZJA 5TDOA 2R0KH 2Z8VC 1M7IA 1NL0L 4JKMA 1T4KA 5AWNH 5JXEA 3LV3B 1QYGH 2EO1A 2H41A 5GGUB 1HILA 5C0BA 3HE6A 4NQXB 5ADOH 3CSPA 1BFOA 2GI7A 1J1PL 4OIAA 3RIFF 4UTBH 1QRNA 5F96L 5DD1H 1IL1A 1MJUH 1XR8A 5C0RH 5L6YL 2G9HA 4M6NH 4QTHB 4ZO7A 3JXAA 1ZLUH 3QDGB 2V2TB 4G7VL 2MSPA 2Y7QB 5E8EA 3ARXA 5HHPB 2GHWB 3WLWD 1B2WL 3NN8B 3FHAA 3QUYD 3I02A 3C5ZC 3BJLA 4L3ED 3PWLA 4JVPA 3SN6N 4LSSH 1DVFC 4XCEA 2IALB 4R2GC 1YN6B 3QFJB 3SCMC 3CSGA 3ZYOA 5HHOE 4G9FB 4TQEL 5IB2B 4GQ9L 5DJZA 4K07A 1WZKA 3L5WB 5DQJA 5C6PB 1YMHA 4F3FA 1ITCA 4UI2A 4C55A 3W39B 3VH8A 5F8RC 3RPIB 2IF7A 4JLRB 3OAZK 4OBRA 4OZIE 1FIGL 3FB7B 4WNQA 4N0UA 5JUEL 3KYMA 5LBSH 2Q6WA 4FFVC 3WS6A 1GOFA 2VLKB 1ORSB 1WVZA 1EVUA 5D5MA 5E9DD 3D25A 5F7MC 4WWKB 2MQ3A 3D69B 4OLXH 3VFOA 3RVXD 3T0EB 3KNBB 3EGSB 5FKPB 2NY1D 2OS7A 3IDXL 3QEHA 4FQPA 4PJGF 2F15A 4MMZC 2AABL 3NCFB 4YHZH 3MOBH 3AB0C 4Y16B 3X13A 2ZOLA 2W65B 4N9GA 5F7DA 3V2AR 2HRPL 4NQCA 3WFHB 5C2BH 5DMJB 8FABA 5IM7A 5E2UH 2FR4A 3GJEA 4Q9RL 4X9FA 3GIVB 5MERB 2EYRA 4CMMB 1NFDA 3O2DA 4WHCA 4AIXA 4LSDA 3WN5B 4JFQA 2QJDA 1JP5A 3L3IA 3OG4B 2PKDA 5F7FA 1RIUH 1AD0A 2PXYD 4UB0H 3HMXA 1OWWA 1AC0A 1KG0B 3E8UH 2BNQA 3ARBB 5J13B 1BF8A 4NRZB 4YGVA 3JWOL 3S88L 4Y4FB 5GZOD 2NR6D 3KXFA 2XYCA 1JNHA 4XPFL 2P8MA 3LN4B 3T2NL 3WHE1 3C8KB 5J0BA 3MA7A 4G6ML 2FX9L 5BRZE 4XCFL 4P3CL 4HHAB 4HMCA 3TH3T 5I8CA 2UV3A 3TNNB 5EUOE 4JM2B 4G8GD 3B5TA 5ISZA 3UTQB 1RUQH 3MV7D 1Q9WA 2VLKE 3B6SA 4X9BA 3BZ4B 4L8BB 4LEXH 3ZDZF 5SWQA 4L8DA 1RULL 5HGAA 4RFOH 2QEJA 1S7UB 1KPUA 1MAKA 2XWTA 1QBBA 4WY7H 4Q58C 2FCBA 5DJAB 3TBVA 4JY5H 3U9UA 1MJ8L 3I3DA 3SQOH 4C83B 3WNOA 3NCJH 3KLHC 4IDLA 5DR5H 3I85A 1QSFB 3PQYD 1MHHB 3QXUA 4AEEA 1S7VB 1UM4L 1RIVL 1IAOA 1FG2A 2HFGH 4MA8L 3EYQD 4LSQL 3FT3A 4JAMB 3ILPA 1MRDH 4F15C 4M1DH 1M4KA 3SDXF 4LU5H 3MRGB 2F54D 2FO1A 4C54A 3V4PL 1F45A 1BBJA 1TZGH 4YPGB 4F57L 2HVJB 2D0HA 4R6UA 5IMMA 4O2FA 3VGEA 1VKXB 4MAYC 2AK1L 4G6JL 3IDGA 3A67H 3K7UA 1K2DA 1VACA 2ENSA 4F80A 4KVNL 4DTGH 2GYSA 3S5LB 2WUCH 1A6UH 2FNBA 4FQXD 5D5MF 3BE1L 5C0AD 5FCSH 4BH7B 2ARWA 1DFBL 4ETYA 4X80L 2NY0D 3CDGA 3VWKC 1U8QB 3LQZB 2P24A 5MEND 1UYWL 2SEBB 1WUNT 3A6OA 3BP4A 4F33B 3QPQD 2VNCA 3EDDA 4UNTA 4F7MB 4D9RE 4PP2A 4XCCH 3V95A 1BZ9B 1MNUL 3MLYL 5HHMD 1A4JA 1KNOB 5GSRA 3T0BA 3QYCA 5DUML 1T22A 3SPVA 4HDIA 2DBLL 3VI3E 1T5XB 4L29B 5JOFB 1DN0A 1NFDF 2BSSB 3BVNA 3B9KB 2CDGA 3U7YL 5FDWA 4YE4L 5SWSE 3T77A 1IM9B 2VDML 5F1IB 5IROA 1MFEH 4KFZC 3JZ7A 4O4YL 2X6MA 5CIPA 3FONA 4MHHI 4YPJA 3DVNB 3RWDB 3SDCB 1GVIA 4YAQA 2P8PB 1R24A 4EN3A 2R9HD 4LIQL 3KYNB 1Q9KA 3PL6B 2VZ3A 4G42B 4NKDB 3FMGH 4PP1D 1U8PB 3RHWK 5D7LE 3TFKC 1TETL 1G0YR 1BVLB 3PE9A 2Q7YA 3FT4B 3QO0A 4YUEH 1OGAD 1GGYA 1YEIL 3ULVC 4M02A 4WFFD 3DUSB 4FQJH 2XV6B 3IETB 5J11C 4AM0A 3FN0L 3QG6A 5EU5B 4KRMB 4OKVB 4G5ZH 1K8IB 5C0GA 5T3ZH 1XR9B 2D0GA 5F88B 7FABL 4Y1AB 4YX2H 4GAYB 2WM0A 4NBYB 3VFWB 3RZCD 3QCTL 3MRNB 1UCBH 4XRCA 3QUYA 4MCZB 2ITDA 4YEFA 4OB5H 4F9LA 5CSZB 4LSRH 5E2WH 3WFEH 4L3EA 4P57B 3T1FA 3MJ9H 2OR7A 2VZ1A 4U1KB 3EHBD 1IC1A 1A5FL 2ICEA 5HGHA 1CLCA 4HS8L 1Y0LA 1E27B 5BJTB 3HZMA 3LRSA 3DTXA 4X5WA 1XH3B 4QHLA 3JV6B 3C60D 3IFLL 1CLOH 4GKSA 4O9HL 4OCRH 3GNML 3TJEL 2P42B 5DJ6B 4J4PC 5HYSB 1I9RH 3LEXB 4XC3H 1D5ZB 4GW4A 4KKBC 2BMKA 5DC0A 1FNEB 4LBEA 1R3LA 1G6RL 3D2UD 5CUSH 4JHWL 1LE5A 3CDCA 3KYAA 1I1CA 3CC5A 3RWIB 2WWKO 3RVWD 1BMGA 1UWEH 5I71C 1GPOL 2WANA 4XHQA 3K4AA 4LIQE 5E9DA 1CG9A 5A3IC 3FCTB 5DRWA 1YJDC 4MNHB 4XP9L 3O3AB 2C1PA 4GOSA 2JK5A 4A2MA 3WIHL 3U46A 1UM5H 5JHDD 4Z18A 1K4CA 4K9EC 4KJYA 4HULB 1GGUA 3SDDD 3KPPB 2VDRH 1CICB 1MIMH 1VHPA 1BWWA 3MBXH 4JVWA 2VH5H 3JSSA 4RZCA 2IANE 4P46B 5F3BB 1EERB 3QUZB 1DBJL 1LD9A 2BK8A 1YEKL 4Y88A 2IWGA 3IAQA 1U95B 4O2EA 1S7RB 3VFSB 2NZ9C 4HWEL 3O2VL 5E2VH 3S8WA 4FQIL 4UQ2B 5CGMA 1Q0XH 2PXYA 2Q8AL 3TN0D 5DURD 4P23B 1T7WA 1UG9A 4U6XB 2IBZX 3UZQA 4AEHL 3OKOB 4QO1A 4Z7WE 4YHKL 3HLAB 4JPIA 2ZUSA 2YPLB 4NZTH 1SEQL 2BSRB 4MNQE 4XP6H 1WBZA 3ELAT 4QCIA 3C6LB 3HUJA 4RGNE 4G8FB 1H9VA 2NYYC 1Z0NA 32C2B 4KMTL 4HG4J 2X4UB 1VGKB 5CEZL 1RZFH 1QQDB 4JFPA 2XA3A 3O6ML 4G8GA 5KVGH 4IRSD 4M7LL 5C09D 1LO0L 5BOPA 3FAXA 3QEQE 2H32H 3MV7A 1FSKB 2PYFB 1P84J 2C3VA 4X6BB 4W68A 1MPAL 1MHEB 1N2RA 3LH2H 4JREB 4QRPB 4LRNH 5IIEA 3VFVA 1F58H 4MJ2A 1QVOB 1EXUA 1UQSA 5GHWL 5JZ7C 3G6JB 4CNIA 5FM5O 2X7LA 1JHTB 4XNZC 4YHOH 2FIKB 5LXGH 2EDBA 5I19H 3PQYA 4ZODA 1B6UA 3UPRB 2HFTA 4AQOA 1J0IA 5IUSA 3V9FA 1KXQE 3CVIL 1WGOA 1MHCB 1JUFB 1H3GA 2GSGA 2R23B 1QR1A 1YY9C 5F9WC 2NY4B 3V5KB 3V0VA 1S7QA 5JXAL 2F54A 4ZFOL 1NGQH 1ERNA 3BZEA 1UB6A 1B0RB 2J88L 1A1OA 2GJJA 3HC3H 5KS9B 4PY7A 1S9VA 1BJ1H 3BPLB 4NUGH 1IEAA 3QUXD 1JPSH 5BZWA 3O11A 4S1SH 3FFDB 3NIFF 3S97C 4KJWC 2GJZA 4FQXA 4XVTL 2GCYA 3ALXA 4R8WL 5C0AA 2CRZA 1LO2L 4EVNA 1A2YB 1G9MH 1QHOA 3K2UH 1QACA 1GOGA 5I1HL 1FV1A 3B9AA 3D18A 5MENA 3P73A 4NZRL 3ZZ1A 3MRBB 4I18C 4HW6A 2ZSWB 1IILE 3VD7A 1JGUL 5FA4B 4I5BB 3MGAA 5KVEL 2Q20A 2QQQA 2W60B 3BD3A 1AGFA 2K9UA 4WW2C 5DJCA 3W9EA 3BPNC 4OBSA 3S36H 1S9XB 3BPCA 5I8EB 4TUOB 2KBGA 5D7KD 3REWB 2QSQA 1B0GB 5ESQB 1NANI 3GBLA 1A6ZA 5DMKA 1OF2A 4F7PA 1J87A 4ODVH 1EAPB 2ZOKA 2H3NA 3CSYB 1SM3L 1FPTH 1Q94B 4PJEE 3G6JE 2IPKB 2Q86A 3CZFA 5D6DA 2G5BB 4J8RA 4NP4L 3NABL 1JNLH 3GSQB 4HUWB 3HNSL 2DQTH 4AY0A 1S7WB 1YEEL 1IGIL 4K2UH 2LE9A 3F12A 4H26A 3IFPB 4KUZL 4KK9C 4OV6F 5CJQH 4NFDA 2W9DL 5BXFA 1CVRA 3WKML 3RBGA 3I6KB 4PJAA 1U36A 1B0WA 4R4FH 2YEZA 3QDJD 1OTTC 3L5JA 5KS9E 1U58B 2K1MA 3LVEA 5C86A 3QQ4B 2QSCH 3SKNB 5J1AB 3HAEG 1OGAA 3BDYL 1OGTA 2MHAB 2H2PC 5L8KB 2BSED 1EO5A 4OFIA 1G7MA 4AH2A 4C4KO 5D7JB 1TVHA 43CAA 4HBQA 3DYPA 5J4MA 1I1AC 3DHMA 2ZCKH 4UT9H 1TQCC 5K9JL 3H9SD 4L3CB 2C4FT 1HHIB 1VGEH 3RZCA 4JJHA 4OLVH 1R3IL 3VXUB 1GRWA 3PWVA 5CWSA 1CS6A 5BV7B 5I1LB 4Z8FL 4PREA 5B38G 1PDKA 4DGYL 1J7VR 3AS0A 5BW7A 4AIOA 1JYXA 3DX6A 3HI5L 1CFBA 4KTDH 3MCKA 3LS4L 2DLTA 2EIEA 5FYKL 3GUTB 5EIVA 3C60A 3KLDA 4JZOB 5IW1B 1YPZB 5GJSH 2BSTA 1D5MB 2VAAA 4ZO6A 3SKUD 4I2XA 2NLJA 1LEIB 5LQBL 3MGTA 5MEQB 3MRIB 3UAJD 1N26A 1PYWA 4CU7A 1CI5A 4LGPB 3D2UA 1QSEB 3OB0H 3OGCB 1U8OB 3BKJH 2X4QA 3RWFB 4F9PC 1YC8A 1KCKA 2P5WD 4G7YL 1AKJB 4I3SL 5AZEH 2ITCA 3SDAC 1BBDL 1VPOH 1S7XB 5IB5A 5HHVH 3Q2CA 2V2WB 1J10A 1OB1A 2GJ6D 4B5EA 2DLFH 4Z6AT 5JHDA 3GI9L 2EH7L 1BQLL 3EDFA 4YJZL 4JRYD 4MJID 3CX5J 4NM8L 5DQ9A 5J6GB 3SDDA 5C9KA 1INQA 4MD0B 5IFHH 3UROR 3TO4C 4UDUA 4P5KA 2VJXA 3G5YA 4LNRA 1QLEH 2OJZH 1C16A 2PW1B 2L7JA 3BKCH 4M6OL 1EHAA 3BKML 5FKAB 5C0EA 4S1RH 4MQ7B 4CVXB 2M2DA 4LCUA 3QCUL 3QH3A 3X12A 3MRMA 3B2UC 2GAZB 2XQYG 4UDTB 1CD1A 2NW3B 1QBLH 4XNMB 4KUCD 3TN0A 4WU7A 4M48H 2PO6D 4UQ3A 1ZVSB 4U1NB 1UB5B 3R06A 1S78D 3CFCH 1A6TA 5DMIH 3GSNA 1FVEB 3HPLA 5FYJU 1W0WB 3ROLB 4P4KC 1R5WA 4PJAF 4WFHE 1I1FA 3SE3A 4P4RA 5EU3A 2XA8H 3HS0A 5E8DL 1SJHB 5C71A 1OAUL 2J8HA 2BRRL 4JVUA 2EH8H 4G9DA 4HCRH 5IEHA 2GT9A 2VDOH 3CCHA 4O02L 3VFUA 4JDZB 5FYKE 5T5NF 4TVPH 1QLFA 1UJ3B 2J6EL 3EYUL 3IVKA 4Z0BL 4QT5B 2F53E 1QSEE 4IRSA 5C09A 5IJVB 5ACMA 4JPVL 1FL3A 1KCUH 1XIWC 1VA9A 1EZVY 1JRHH 3MBEB 4AEIL 5EBLA 4XBPB 1PW3A 2NMSA 2ZUVA 3DURA 5L0QB 3MYJB 4HJGB 1J8HD 2Y5TA 5DJYA 1D6VL 3ALWA 3VI4E 5DK0A 4PB9L 4AK1A 2G75A 3RQ3A 3C5ZB 4ODXB 3QDMD 3T4AA 3EYFA 4GW5B 4H88H 2ID5A 1HH9B 1DVFB 2VO5A 4R2GB 4MD4B 3SCMB 4NQEB 4H8WL 3KLAA 4LKXA 2VLRE 3RX5A 5CSBA 3FO0H 4PJ9C 2FGWH 4QHNB 1H0DB 4K8RD 2OZ4H 3HPJB 3NA9L 4NIKB 1K4DB 4RGMC 3C8HA 1S5IL 1Z9MA 5AD0A 4X7DC 3VFRA 3PV6A 1T0MB 1Z9OA 2ZJSL 2E3VA 1JNNH 4ZXBC 3NFSH 1BOYA 4OM1H 5E2TL 2XKSA 3GSUB 4WUUE 1DQJB 3QUXA 4GXVL 1AI1L 4K23L 1BFVH 4HT1H 4JM4H 5HVGB 4BZ2H 4K3EH 4NC1C 4PJBE 5JIHA 2V2XA 5DJXB 1OTSD 2R69H 2A1WH 4RMUA 1I8KB 1KJMA 2WK2A 2DKMA 1BQUA 4ZUVA 1FFPB 4BA8A 1UM6H 2VXSH 4L8SC 4ZAKD 4U31A 3TYGH 1MQ8A 3AB0B 2M26A 1IAIL 4RRPA 4EQ3A 1JPTH 1UENA 1W0VA 4G80B 2HMIC 1I9EA 4O5LL 1UWXK 3REVB 2HWZL 4JRXE 2V5TA 4I77L 4KC3B 4RAVA 5I8OH 3U48A 4QRRE 3L95A 2MCG1 4RQQB 1AIFB 4QRQA 4IIQA 3OJDB 4PJCB 4LRIA 3L7FA 4Y5YA 3SDYL 5JOPD 1MH5B 4PRPB 1Q8MA 5TDPB 2AQ3A 3ZDXE 2B0SL 3Q3GB 4LCWE 3LZFL 3IKCB 4EDWL 3BP6B 5AAMA 4MJ5A 4OGYH 3MLVH 5HD8D 2Y1VA 4UOJA 3TJHC 1JGDB 5IMOB 3PABA 1UKSA 3RVUD 2JJVA 2XNAA 1X5JA 3W11C 1N4XH 3SKOB 5I9QC 1X9QA 3G08B 2PYED 1CIUA 4N8VG 5TFSH 3QDJA 5GS0D 4WTZG 1YEGH 3W0WE 1A3LL 3QDAA 1MFCH 2UUDK 1IC5L 1GCFA 3DPBA 3H9HA 3SE9L 4D0CB 3O3EB 4JN2B 5LGHH 4JFXB 4KAQL 4S1DC 1Q9OB 3JV0A 1NMCC 5IHZA 3VG0H 3MXVL 4UV4L 1J8KA 4WO4C 4WV1C 1BFSA 4JRWA 1F6LL 1KT2A 5FCUH 4QTIH 4IMLA 1DUZA 3SGKC 3EDEA 4EI5D 4IJ3C 3W9DB 1NBYB 5DUPL 3H9SA 4WEMB 5F9OH 3DI3B 2B2XH 5F6HI 2A9ML 1INDH 4LLMB 1XF5A 2E7HA 3BD4A 2EDYA 4URTB 2WQRA 5ETUA 1I9JH 3OJ2C 2DQEH 4F15B 1F4AA 4KKLD 4LKCB 3O8XC 3ZDYE 3X3GH 3EZJB 3DX7B 1BZ7B 1FNSL 5JQ6H 2BZDA 5EDXA 2X1XR 3QHFH 4ZUTA 4MAYB 3VXRD 4LK4A 3SJVE 1IKNA 4M9OA 5B8CB 1RJYB 5JHLH 3WNLA 2DD8H 3WYRA 1FJ1A 2Z4QB 3BAEL 5GRVK 1UZ8B 1FAIL 4DN3H 4Y2DD 4H0IA 3VWKB 5DT1L 2P5WA 3LQAH 3GBNL 1R5IB 3VFNB 1IM3A 1T5WA 5CBEB 3DYMA 1DSFL 3FL7A 5JLZB 1ULVA 2APXA 3C2AL 5IQ7H 3L5XH 2D31A 2GJ6A 3QISA 4HS3B 5CJ8A 2DQIH 4ZUWA 4FFZH 4JRYA 4MJIA 3UTPE 3HAEB 1A0QH 4JPKH 5F3HA 3RY6C 1VEOA 2BNRB 1P4IL 3QFDA 1A7QH 1T2XA 4ZQKA 3GSVA 5CEYA 1Q1JL 5KZCD 2AJYL 4MAUH 3RIAF 4MA3A 1NCCL 4Y19E 1MVUA 1AD9A 4QXGH 3VXTA 5GS1C 1JGLH 3PDDA 1NGZB 4D3CL 1DEDA 1G1YA 1WCBB 3MMEB 3FQWA 1FYTB 2GEEA 3FB6A 3V6OC 5DZNA 2PO6A 3CU7A 1HHJA 4LQ1A 4YDIH 2DLIA 1ZA6B 3MLTB 4NHCH 5AG9A 2R8SH 3LKQA 1PG7X 1E4KA 3K1DA 4PJDE 2VITA 4OQTA 4LF3B 4NJAL 4RNRA 4IMKC 4KK5C 4I4WB 5KSAB 1LP9A 2VXTH 1KYOK 3PWNA 3PNWB 3G6DL 1E4WH 2BX5A 4YWGL 5GGRB 1OP5H 1OW0A 5HJ3B 1GGCH 4P2QD 1LHZA 2IQ9L 3IB4A 1RZKC 5GRXG 1AE6H 2VDKH 3NAAL 1G7IA 5F93C 3HA0A 3QIUC 2DQCH 4ZYKB 5C08D 5TF1H 1BIIA 5FYJL 1P4LB 3KPNA 4XAWH 4Z5RA 5KSVA 2VABA 1A9BA 1CQYA 3V7MA 2XWJB 1FH5H 5LVEA 1VENA 1ZKAA 1ADQA 1J8HA 2PR4L 4OZGE 3ABZA 3NZHH 2VXUL 2JJWA 2P8LA 4UT7L 4A6YL 3KPSE 2VC2H 2IH1B 3QDMA 5IT2L 1C12B 1R6VA 4X6CE 4R4NC 3TV3H 3W82A 3M1BA 4MA1C 3QP3A 2BNRE 2XQBH 3MO1B 3QJFB 1G7QA 3NPZB 4U1JB 4U1SB 2GUOA 3STLB 4ZFFA 5E4IA 4Z7UA 2QSTA 3QXVA 4PLKC 4GRWB 4H25A 4JQIH 1ITBB 5AEAA 4EOWL 4JN1H 3CXDH 3NFPB 5JXEC 1KLGB 1QNZL 2NPLX 2RJMA 3MCLL 3HE6C 1YQVL 5DMYA 4EBQL 4LEOB 1FYTE 4WJ5B 5IMKB 4TOYL 3OWEA 5F7LB 1G9NL 5EZOL 4TTDD 1T66D 4XNQB 3MYZA 3KWWA 3QG7L 4WENB 3RI5F 1K6QL 1KJ2A 2V5YA 5I71B 4WHDA 5K9OA 1X5FA 2A6KB 4Y8AA 3BT2H 4OCXL 5ENWB 4ZD3H 4K9EL 4POUB 5BV7H 4MB4A 3MXWH 1U6AH 1YZZA 1NUDA 4NGHH 3T0XA 3QSKB 3WE6A 1L4IA 2JJSA 4I48A 4P9MH 4ZAKA 1I7ZA 5IWLC 1T83A 3MREA 3I2CL 5IESH 3IFOB 1A02N 3QUMA 1LO5B 5CILL 4XMLH 4UILL 3HG1B 4DK3A 3S37H 1FDLL 4KV5F 3QQ3A 4Y2OA 5MEPB 1JWSB 3MV8D 2FB4H 3UTTE 3FRUB 3DX9B 2X09A 2NY2D 4KUCF 1U8NB 1JZ5A 3BXNB 4N9OB 2Y9RT 3EJYD 5FYJE 3BRFA 1AR1D 1NLBH 2B5IC 1NCBH 3ZT5A 1LE9B 3RWHA 3O0RL 2P5EB 2JF1A 4K71C 3T1WA 3ZE0E 4S1QH 3O3BA 4XPBH 2A2QT 3H42H 4YHML 5DFVC 4GRWE 4ZNEE 4Z95H 4PJFB 4DQOH 2PNDA 4U1LB 5C07E 1R3HB 3Q5OA 1FO0L 5EH1A 2PYEA 1XGPB 5EOCL 4NNPH 5FV1L 1EIBA 2QKIB 2CUIA 1MCOH 3O4OC 3AVEA 3UYRL 3C09B 4RMSA 2NTSP 1EHLH 1UA6L 5IB1A 2EYSA 2J4WL 5F7YC 3LKOA 1QKZL 2E8YA 5K9KB 4NYLA 3KHQA 1YYLL 1MCBA 1SYVB 1KB5L 4GBXB 2BVEA 3LHPH 4G6AD 4JFFE 4NFBA 3EO1B 4RISH 5ITFB 1HZHH 1JVKA 3FO1B 3VDBA 3MFFB 1I8IB 2V5RA 4TNWK 5KSBE 4XNZB 4IS6B 5EZLB 2BDNL 4CW1B 3FFCB 4OLEA 4U1IA 5I16B 2EYTB 4OCMC 3VXSB 3HG1E 4Z7UF 3IDJB 4E5XB 2R2CA 5CP3A 1JNJA 1U3ZA 1FNGB 5F9WB 1BQHA 1RZJC 3J8F7 2CPCA 4L4TD 5HI4D 2R1YB 5GZND 4R90H 1IQWH 1S8DA 2CXKA 1CE1H 1X7QA 1QFUH 3H3PL 4BSVA 3GMNB 2HJFB 4KMLB 4HEME 1LO4L 1V05A 1KN4L 1ZMYA 1R3JA 3VXRA 5D7IF 1KEGL 2XTJD 3TBWA 3VXQB 1QA9A 4RWYL 2DB8A 3BH8A 5HY9A 1DL7H 3X11A 3FQRB 2HG5B 4JM2F 3HNVL 3ZMRA 4F7CA 1M05A 5KAQF 3D39E 4Y2DA 4YNYA 2X4SB 4DUXA 3A6CH 2HVKB 3VXMB 2GK0A 4XVUC 4I18B 2HN7A 4PJFE 1ZHLA 4QOKE 5C0CD 5SX5H 5JIKA 3P4OA 2Y36L 3RWGA 2BVQB 3DBXA 4HXAL 5JDSA 3U9PH 5TE6H 3BPNB 4JFOB 1AGCA 1CT8B 1G7PA 2ZCLL 3FO2B 3QQ9D 4P5MB 3BWUC 3OXRA 4ZFZB 5LAXA 1BOGB 4M6AA 2A77L 4MX7A 4NRYB 1HI6B 1ZT4A 1HNGA 4IHOA 3BO8A 4GAGH 2CKBA 3DV6B 5I30H 4TSCH 1A3RL 4WI2A 4ODUA 3L7EB 3WFCL 2VE6B 1AXTH 4X4MA 3L6FB 2JB6B 4OZFG 3EJZD 1CL7L 2EXYC 1Y6KR 4PJIB 4YZFF 2OCFD 2KQNA 1D6EB 4JG1L 4P3DA 5HGGS 3ARED 4M03A 4XVSL 1OAXL 4NJ9H 2YD8A 1K85A 1MAML 1I9IH 3RTQD 3QHZL 4XP1L 5A2KH 1R3KB 3OKLA 2P44B 2JE8A 3PGFL 1KFAL 3QIBD 4KQ4H 1BJ8A 3G5VB 3UJTL 4PJ5D 3QXWA 4Y7MA 3TH4T 5EA0L 5FUZH 3ZE2F 5EO1A 2B4CL 3MRFA 1FYHB 3QXAB 4N1HB 4JDVA 4L4VB 5GGQH 5C6TH 2EIDA 2Y72A 1RUAH 4P2QA 1E4JA 3I9GH 4Q9CA 1CCZA 1T2QH 3VWJC 3MRPA 3MUGB 1NAMB 3U7WH 3LPGA 4S10A 5C0IA 5C08A 2EDHA 3FRPA 3VXME 1CGYA 1U8IA 1X5XA 2YZ1A 2WLZA 1TQCB 2ZPKH 4OGXL 5IROC 3JWDH 3MJ8B 4HEPG 1MRFL 3O2WH 1BVZA 3FQTA 4MGXA 2HT4D 1JCKA 2C4FU 2AJUL 1DBBL 2X42A 3MLSH 1DBKH 2HLFC 5DTFB 3OR7B 3OF6D 1J9CT 3EOAA 2AQ1A 5T1DH 1IGMH 2ESVE 1ZLVH 5T33H 4EXKA 4BFEA 4MD5A 1NCWH 3CAFA 2VTFA 4HC1L 5DWUL 4J7RA 3QO1B 4XZUA 4ISVA 1N6VA 4PJIE 5HYFA 5ID1A 3C5JA 2LU7A 3DXAB 1XGRB 3BEVB 4TUJA 3AU1A 2NNAB 4LLYA 2OL3L 1JZ4A 4M8VA 3CVHL 4ZOAA 1FC1A 3QI9C 5FGCE 4O2CB 5I0ZA 2CR6A 1F8TL 4HPYH 2YBRB 2D9QB 1N7MH 1KC5H 4KI5D 2HH0H 4MSWB 4PJXA 3SDAB 5HHXH 4V1DB 2DF3A 1BQSA 4F7EB 2OL3B 3VGAB 1AO7E 5HI5D 1TTGA 1RZIA 5C92A 1J0KA 5H37G 3BUYB 2YUWA 5IR1A 1ZT7B 3O41B 3UTOA 3RA7H 3TO4B 5D71L 5I1CH 4X7SL 4HG4K 4XPGH 4HS6B 4OJFL 5D6CB 3GJFK 3MV8A 3WLBA 5CKAA 2X1QA 4PLNC 1F4YH 5GRJH 2IAMC 3WUWB 5K9QG 4PGDB 4PJ8D 3P30L 2VISB 1P84K 4HF5H 3ZKSD 1QRKA 3GO1L 1NBZB 5ICZB 5I1JL 5EZIL 3U2SA 4P4KB 4NKMB 4R96A 4ORGA 2DKUA 1O7VA 3DROA 3ULUL 2KQMA 4QY8B 2XN9B 3MLWL 3WCYA 3CFDB 4CVWA 3SGJC 3S96A 4K3JL 3DIFB 3RVXC 3MTRA 4TNVK 2NY1C 1F6FB 3LPFA 2N56A 1OARH 3U1SH 4IDJL 2E7LA 4K94C 3TYFA 2EDTA 2YD9A 2VR9A 2Z91B 3IDNA 1MCWM 1A7PL 3GMRB 2FBJL 1FVCA 4AIZB 1A1NB 1WC7B 3N85H 5BS0D 4LQFH 1TZHB 1U3JA 2F74A 5FHAH 4ONFL 4WRLA 2AGJH 3BH9A 2M8XA 3AY4A 4NKOB 5J9PB 5IG7B 4JFDE 2PXYC 5CJBA 2N1KA 5KJRL 3TPUA 3TF7C 2BJML 2G2RB 1ODAA 1RQ5A 2UYLA 1MREH 2XZZA 2BOBB 4PJ9B 4X83A 4L4TA 2IGFL 4H1LB 5GZOC 3BQUD 3BN9D 2NR6C 4NNXB 3F7VB 4RGMB 3ULVH 4NHUB 4LLQA 4QHMB 4DKDC 1IGJB 5F71A 3HFMH 3GSRA 4B7LA 2ATPA 4YC2C 2HT2D 1ZWIA 1IQDA 3WFBL 4ZXBB 1I8MA 5LGJB 4JO2H 4PD4K 3RVTC 4M4PA 5KTEL 1AFVH 5J12C 5BVPL 3RHWF 5ICYA 3MNVB 5EO0A 4HIXH 2CJUL 5HDQL 2WINB 4NO0B 4ERSL 4ZS7H 2X44D 4PJXF 3X3FL 3OXSB 4U1MB 3OKKA 3S3SA 4ODWA 3UJJH 3WIFA 4JG0L 1CGSL 3LKRB 1DDHA 5C0CA 3WNKA 1KPRB 4X7CC 3BOVA 5FYLL 5T3XE 3FT2B 3RWJB 1RUKH 4OCSL 4NQDE 4YDJA 2H6PB 3O9WD 3ULUE 4L8SB 1KJ3H 1KCVL 5CMAB 4YHNB 1OD7A 1P4BH 2EZ0D 1A7OH 1JFQL 4DZBA 1CLYH 4PRBA 4ODTL 3N50A 5MI0C 4OLYH 1MSPA 3IDMA 1A7NH 5DA0B 4MJ6A 2F58L 1T1XB 4HXBH 1RZ8B 4U6YA 2ZSVA 2JIXB 2N4IA 4JFYB 1AQKL 3OPZH 1C8PA 4M3JA 2XFXA 4RDQG 4GG6A 3GGWB 4ZTPH 5CJ5A 3CSBA 1YJDH 2W92A 4PG9B 5IF0A 3AREA 4FQXC 4HKZB 5F96H 3KJ4C 3ARDA 2DQDL 4LLVA 5L6YH 3RTQA 5ADPH 1C5BL 4HLZG 3DMMD 1ZLWK 2BFVH 5I9QB 1QFOA 2ADFH 4PJ5A 5I76A 1EFXD 1RI8A 2HP4A 2I27N 4MZ3A 4K3DH 2YWZA 4P5TD 5MHSD 2DQFA 4PRAA 2ZCHH 3D85B 3PHQB 4LVOB 1T89C 3M17A 4FXKB 1B2WH 3DARA 5IW6B 1I7RA 3V5HA 5E5MB 1F5WA 1NMCB 4NC1E 2O61B 3D0LB 3MOQA 4HQQL 3MLRH 1JK8A 3NIDE 4WV1B 1X6LA 1LK3L 2L4OA 4IJ3B 2FJHA 4YFLI 3HZKB 5DEFB 2PW2B 4JGMA 2NXZC 4WFEE 3MNWB 1W72A 1KTDB 2R56L 5DC4B 3VG9C 1RK1B 2F5AL 4WTXA 1A7RL 2YXFA 1CLZH 1I3RA 2OR9L 1A9EA 4MXQD 1MI5B 3CPLB 1S7SB 5FYLE 2R9HC 1TCMA 5H8DA 5GGVH 3OF6A 3CUPA 4PP1C 2DL9A 3O8XB 2CQVA 1CFQA 4KI1A 5SX4H 4LOUC 3TLRA 5JUEH 4TPRH 2EDLA 3CLEL 4LCCC 2R39A 4ONGL 4L5FL 5E5UB 1WWBX 3TA3D 3CX5K 3PUCA 1HCVA 5D1XC 5ACZA 2VR4A 2XWBB 4P59H 3QEGL 4LHUD 3B8SA 4XNYL 4ODSH 5TPWH 2HJLA 4ZPVA 3E1F1 4D0DA 1XF2B 1IAKA 4Z78B 4OCYL 2OI9C 2AV7B 1E4XI 2YPVL 5HHNB 5IGXL 1OSZB 2DQGL 1ZHNA 2VSCA 3SKMB 4HIJB 2I24N 4NRXA 5C0FA 5ANME 3HZYB 1QFWL 4UMGA 3PJSB 3E3QE 5L2KD 5E94A 5HHOD 5JW4R 1P7KB 3RJQB 2CGRL 2O5XL 4G43B 2H26B 1KENL 4LLWA 3EHBC 4XMPL 5BW7C 1JWMB 1RVFL 1MJ7L 1N5AB 3PGCA 4KJQD 3HNTL 4UZGA 3ARQA 4LSTH 5D8JH 1TJIH 2VAJA 5SWZE 2HLAA 1K8DA 1JI2A 4X8JA 4P99A 3FOLB 4BSWA 3E6HB 5E8OA 3C60C 2HTKD 4GG6F 1HXMA 3MODH 5GS1B 4PRHB 4X9HA 1Y6NR 3RUGA 3BD5A 4LVNC 4PJ8A 4KZDH 4YDVA 5E1HB 3QB7C 1YPZF 1CK0L 3S4SA 2MQCA 4X6EA 4J3XA 4EUPA 4Q0XL 5GGTH 1T20B 3FQXA 4MWFB 5D1QD 1I7TB 4XCNA 3O6FD 4ZS6D 5LG1A 2W91A 2MKLC 3MRDA 1YECH 3RNKA 3QUKA 4OGZA 5ALBL 4FQ2L 4LLUA 2P7TA 2Z93B 4QF1B 2R4SH 4KPHL 5IEKB 5T1LD 4MDIB 5DQDL 4FFYH 4X5XA 1NBVH 2XZCL 2YSSA 4N8CL 1MJ8H 3L3KA 5FF6A 5D93C 2R2EA 4PJGB 2HKFL 3HRZA 3MLUH 4DN4H 1T04B 2FEEI 3QIUB 1PG7W 1FN4B 2DWDA 3IT8D 5IVZA 4G8EA 1D5IH 1SJEB 5I18L 5BS0A 2F19L 3KLSA 3ARFD 5CD3A 1FZOA 4NQVA 3FOMA 3JUYA 5JDJA 3MLXH 2CLZA 3DGGB 3GRWL 1U8KB 3NTCH 4FZEL 3KR3H 3PWPB 3GK8H 5HYIA 2DI7A 4M00A 1J12A 1IBGH 3VFGH 4LPWA 1F3JB 4NPYA 2E9WA 4MA1B 3GBMH 1H3PL 1YUHB 2VZSA 1XF3B 2EIZA 5BRZD 1CDUA 3SE3C 5EOQH 1G9EA 1T3FA 4X80H 5TDOB 3BQUA 5KVMC 3QDHA 1M7IB 1T4KB 1V7MH 3WD5H 5FO7A 4UINL 4E0RA 3P0YL 1HILB 1NAMH 2LVEA 3HE6B 5C0BB 1DQLH 4Q74A 1PBYA 2EE6A 2AEQL 1A6PA 1S9WA 1Q72L 2ADJA 1QRNB 2R0WL 1IL1B 1XR8B 4RMWA 3GSOA 2G9HB 1EPFA 1KSRA 4HZLA 4DAGL 5L8JB 3NZ8A 4FTVA 4KI5F 4WGWB 5EWIH 3U7YH 4YE4H 5E8EB 1YMME 3DYOA 5IHUH 2C3XA 2ENYA 5F7HA 5A2FA 2DIJA 3I02B 4ENED 1V3MA 1XGQA 3O9WA 4HWBH 3QPXH 1TNNA 3BRDA 2AJVL 3PWLB 3LCYA 4PJGE 4XCEB 2EE2A 4HKXA 1II4E 4KJPD 3KPTA 4BZ1L 4MHHG 2VQUA 2GKIA 5DJZB 3RUGF 5DQJB 2M1KA 4QKXB 4XP4H 3TIDA 1YMHB 4XVJH 1VFAA 4F3FB 2F5BL 1WISA 2X41A 5TGBA 3PWPE 1EK3A 4PRNA 2BERA 2OBGA 3ZTJH 4TSBL 3BWAA 1BAFH 3WJJA 4WNQB 5GS0L 4N0UB 3KYMB 3GMQA 1AGDA 1T0NA 4YXKH 2Q6WB 2HT3D 1ZTXL 1TJHH 4NN7C 1IGCH 1GC1H 5D5MB 4D9RD 3D25B 4GRMA 3QRGL 4ZFGH 2B1HL 5INDA 4EIGB 2X9YA 3ULSA 3VFOB 2P46B 3U0TA 3DMMA 4D8PA 3QEHB 4PJHA 4E41E 1EFXA 4P5TA 1KLUA 3WXWL 3O4OB 1B90A 5CP7A 2QTEA 3FZUD 5HGBA 3X13B 2ZOLB 1QRNE 4N9GB 5F7DB 4DOHB 3V7AG 3S35L 3CH8A 3BP5A 2ADIA 1IAMA 3NGBC 5SWSD 8FABB 1BEYH 5IM7B 2FR4B 4HX1A 3W5NA 3GJEB 4OD1L 3FAWA 3STZA 3BW9A 1OM3H 3C5SB 1NFDB 2YR3A 1YYMH 5D70H 2UWEE 4JFQB 3DNKA 4RIRA 5FGBC 4LRIC 2APFA 4Y5YC 3PGDB 3L3IB 3WIIL 5GIRA 2FX8L 1FLRL 1MFNA 1AD0B 4M5YL 1CGXA 3KPMA 5D7LD 3E6FA 5HTSA 3MNZA 1ZSDB 2AS5M 4YGVB 3MA9H 1PKQE 5T3XH 3NCMA 1TVDA 1YEFH 1RZGB 3KXFB 2A9NH 3C6SA 2YK1L 1JNHB 2P8MB 4BK4A 3UPAA 3MA7B 2RFXA 4YDLC 3SDXE 4B50A 1OSPH 5SX4I 3TA3A 2IMMA 5C3LD 3RGHA 5I8CB 1LNUA 5INCA 3UEZA 1Z3GL 2ERJC 4XPTL 1IGFL 4LHUA 3BSZH 5EFIA 1KIRA 4MMXC 4ZMAT 5ISZB 2D0FA 4LFHG 1W8NA 4HIEA 1Q9WB 4QXUL 2EC9T 3B6SB 5D72L 2B39A 1I85A 4Z7VA 1CFSA 4L8DB 3S3JA 1MFDH 3Q6GH 3TBSA 5HGAB 3IDYB 1KPUB 2AI0H 1DBJH 2XWTB 2VWEC 3TBVB 4OIBA 3RGVD 3DETD 3U9UB 1ZLSL 2R4RH 4QWWD 3EBAA 4X6DF 4H1LH 5L2KA 4PJ7E 3B9KD 1IT9L 5C0ND 5DD3H 3KAAA 3VJ6A 3T4YA 3RWEA 1IAOB 1FG2B 3MRKA 1WBXB 1EUTA 4MVBD 5HHOA 1TJGH 3FT3B 3QNZA 3ILPB 3KYOB 1AXIB 3INUL 2FH6A 3I84A 3EOTH 4GUPA 4YHKH 3WDHA 1IKFH 1Z9SA 4JANA 2BCKA 2KZWA 1UEMA 1BBJB 3F7RA 3RL1A 5DD5L 2X89D 2QHRL 5IMMB 2IADA 4O2FB 1RV6X 4AENA 4PB0H 2E7MA 1K2DB 1KCRH 1VACB 2XQYK 5GJTL 4OZIA 4HFUL 4N0CC 2ZKHH 1IKNC 3GMLB 3WFDH 3B2VL 5DLML 5T5NG 5CEZH 1OAYL 5F7EL 4L9LA 5B22A 4KY1H 3RKDD 1F6AA 5D1QA 3VRLE 1PVHA 1HOCA 1XT5A 1CFVL 4LL9A 3CDGB 3O6FA 1RZ7L 3LSOA 3VMNA 2P24B 5AG8A 5TQ2L 4PJHF 2CO7B 1BVKA 1MJJA 4QRTA 3PDOA 4TSAH 4XPAH 5TQ0L 4J3WA 4PP2B 5ESVA 4LAJH 5T1LA 3RWCA 4FZ8L 1PJ9A 2CKNA 5D2NA 1A4JB 5GSRB 4PBXA 1L7IL 3PP3K 1T22B 5F7KC 3SPVB 4HDIB 2IAND 1SVCP 3GIZL 1AR2A 5I75C 1DN0B 2P4AB 3BVNB 3VWJB 2CDGB 5KOVC 4TRPL 5FDWB 1CGUA 5EOTB 1G9MC 2C9AA 1B4JH 1H3UA 2A6DA 3T77B 3AC0A 1I1RA 1I8LC 5IBUG 1EGJL 2H1PH 3ARFA 4M5ZL 2P49B 2ZUYA 5CIPB 4POYA 2B1AH 3FONB 1H15A 4OLWH 1EJ6A 4YAQB 5DDHB 1R24B 4EN3B 1Q9KB 5KVDH 2HJKA 4MNQD 4HSQA 1I3GH 3O6KL 4LASH 3GHBL 2CK0L 3TIEA 4AG4H 3L5WA 5BRZA 1E4KC 2YD1A 4RGND 5TE4L 1MFAL 3UBXA 4BH8A 5I1HH 4OF7A 3W39A 4U1GC 4HUUA 5DRXA 5EUOA 2Q7YB 4XNUH 4HJ0C 2MCPL 1GIGH 3QO0B 1OW0C 3PIQA 2YN5A 3LD8C 1JF1A 3QEQD 1UACH 4Z7VF 1KTKE 1ORSA 1FNLA 3T0EC 3LEYH 4AM0B 3QG6B 3D69A 3ZHDA 3ARWA 1NEUA 3NOIA 3RU8H 3IJHB 4OUOA 2UZIH 1U8HA 2VLMD 3QJHB 4M9PA 3SY0A 4K7PH 2RBLA 4WU5A 1SBSH 2NW2A 4XRCB 2ITDB 1VB9A 1JHKH 3V0AC 2QQKH 4L3EB 4RWHA 4QHUA 3T1FB 3QUZD 1MWAL 2XKUA 3WN5C 3LAFA 4FMFA 4Q6IC 4NCDA 3HNSH 2ICEB 5HGHB 4M7LT 3U82B 1M7DB 5DZOA 2L7UA 1Y0LB 3HZMB 3LRSB 3DTXB 4X5WB 4QHLB 3PP4H 2JELH 1CE6A 4GKSB 3ARBC 5J13C 3ARUA 2IFGA 2VXVH 2IAMB 3OZ9H 5D1ZC 3LQMA 5JMRA 3I6LD 4NZJA 4HH8A 3OAUH 4GW4B 1N59A 2BMKB 4KKAD 1RUPH 4LBEB 1VDGA 1FFOA 5M7QA 3L5IA 4OIIH 1LE5B 4AL8H 1K5NA 3CC5B 4MXVE 4GFTB 5EBGA 5IBLD 2D7QA 5EIIA 3QZWA 5E9DB 1NJ9A 1OTSC 5LCVL 4JM2C 5DRWB 2Q7NA 2VZTA 3R8BB 2C1PB 2ZP0T 2NY1B 1PAMA 2JK5B 2GSIA 3GM0A 1HDMA 2JJSC 3U46B 3CIQA 4ZAKC 1DLFL 1HYSD 1H3XA 1K4CB 4KJYB 5CEZD 2MOVA 1GHFH 1R3IH 3LIZL 2FLRT 3P11L 1JTTA 1S7UA 3EFDL 5E4EB 5SWSA 4RZCB 1T03L 1YEHL 3QWOA 1LD9B 4CAGA 4IEFB 4HJJL 5E08L 4O2EB 1DQDL 2GK2A 3ECBA 4FQ1L 1XF4A 4Q9BA 2AJSL 3OSKA 1CR9L 4ZPTA 3K46A 2PXYB 4HV8A 4M43L 4L3EE 4JB9L 1X5LA 4RSVA 5DGRA 1NQBA 5LQBH 2FRGP 5J1TC 3OKEB 3HC4L 4XWOD 2RCSL 5D7LA 1FBIH 3TZVD 4JPIB 5HD8C 4JO4L 4FHBD 5CEXB 4U0RB 1JZ8A 2R0ZH 5EUOF 1G7LA 1WBZB 4QCIB 3RVUC 4FQHA 6FABH 1BF2A 4JGUA 4XGZA 5DJ8A 1RZKH 4XHJD 5EN2A 4R0LA 3FQUB 2JJTA 4UT6L 4JFPB 4XBGB 2DQHL 4G8GB 2R0KL 4BELD 1A8JH 4XC1H 1U0QA 5AWNL 1QYGL 3NIFE 3MV7B 1HWHB 2C3VB 3DGCR 3UO1H 2OK0H 5ADOL 5IIEB 3VFVB 4UTBL 3ARPA 3IFNH 5DD1L 1EXUB 1IC4H 1UQSB 4TUKH 1EDQA 5C0RL 5CGTA 3RGVA 4CNIB 2X7LB 4M6NL 2E9IA 1C7SA 4L29A 4BQBA 3B9KA 3PQYB 3QA3A 5JOEA 2NXYD 4OSUH 4YXLH 1ZVHA 3UXFA 3GSWA 5T1MB 2GSGB 1QR1B 3KPOA 1AQDB 1IEBA 4KKLC 2FX7H 3V0VB 1S7QB 3SDCC 2F54B 1NUNB 3SE4A 5GGVY 4LSSL 1UB6B 4APQD 3NACH 2X89A 2E5EA 1EBPA 4F58H 1A1OB 1C7TA 5IHBA 4PY7B 1S9VB 5IVNA 5F6IC 1P53A 1IEAB 5FV2A 3O11B 4KROC 5I0DA 3AUVA 3D3VB 4BUHA 2GJZB 4FQXB 3UC0L 4LHJB 2GCYB 1F3DH 2V9QA 5C0AB 3U4EA 1P5UA 4KZEH 3KJ4B 2NY0B 3EYSH 3JTTA 1FV1B 1B9ZA 2EDJA 1A1MA 3D18B 5MENB 3P73B 1UZ6E 3OBAA 3U4BH 3CFKA 1OTUC 1AGFB 5LBSL 5DJCB 3W9EB 3IETA 5DGQA 4YO0A 4ZUSA 1MUJA 3BPCB 2VZUA 4LPVA 5L8LB 3V4VH 3GKZA 4OLXL 3IAGC 1QO3A 5CLTA 2IANA 3QHTC 4NC0B 2YD3A 1KIUA 3MRQA 3LRGA 1A6ZB 5DMKB 1OF2B 3AS1A 4F7PB 5DC9B 1LILA 4YHZL 3MOBL 1A6AA 1MCIA 4LSVH 1UC6A 2H3NB 3HZVA 1S5IH 5CSZA 1J88A 5C2BL 1JE6A 3BN3B 2JCCE 2Q86B 3CZFB 3CH1A 3P3YA 4J8RB 5E2UL 3VG9B 4ZOBA 1O7SA 2X4PA 2OSLA 2YOCA 4Z7WA 3EOYG 4Y5XA 2FYYA 1SQ2N 1FNAA 4MNQA 2ORBL 4H26B 3V7AE 4OLUH 3DRQA 1RIUL 5BXFB 4JQVA 4ETQA 3JWNC 5F9JA 2DJUA 4UB0L 3U30C 4PTTA 4PJAB 3E8UL 4HKBA 5IVXE 2YEZB 5FYKD 4JGJA 1SYSA 1L6ZA 2F53D 5C0JA 1OGAB 1QSED 3G5ZA 1OGTB 3O2DH 3D3VE 1R5VA 3QEQA 2IJ0C 4FP8H 1F13A 1G7MB 1ZV5A 4AH2B 1AGEA 4GSDH 1TVHB 43CAB 2OI9B 2X4NA 1G6RA 3SOBL 2QR0B 3O3AA 1GZPA 4P2OC 3HMXH 1OCWH 4NM4H 5I66A 4P9HC 5M95B 1CICC 1RUQL 1PX3A 2OYPA 2AJZA 3RZCB 4PGCA 5FIEA 1X5IA 4DEPC 4P46C 2VLRD 3JUZA 4LEXL 1DZBA 3PWVB 5FM8A 3WIHA 4RFOL 5CWSB 2WIIB 3QUZA 4PREB 3BGMA 4OAWA 4YHPA 4QXTA 3BIAX 4JY5L 3DX6B 5DK2A 3SQOL 1KJVA 3NCJL 2EDXA 3MCKB 5DR5L 2VXQL 1DUYA 1UXSA 3C60B 4WUUD 3L1OH 2HFGL 3OKDA 4O00A 3MOAH 1TZIA 2BSTB 2VAAB 4LVNB 4I2XB 1MRDL 1BM3H 5IBUB 5EORH 2NLJB 4M1DL 3MGTB 4QRUA 3EO0A 2CK2A 4TTGA 3QQNA 4LU5L 4G6KH 1PYWB 2ATKA 1ZT1A 4AEFA 1TZGL 4TTDC 5T1KD 3C6LC 4U33A 3D2UB 2WBWB 3MLZH 3MRRB 2H8PA 2YKLH 5GS2D 5GGSA 3SE9H 2V7HB 3VRJA 1RIHL 2X4QB 3A67L 5I1KL 1EJOH 1MCEA 4JCMA 1MEXH 4DTGL 3MXVH 2DWEA 4UV4H 2ITCB 2X4UA 1FC2D 2WUCL 4OZHE 5IB5B 1QQDA 1A6UL 2I9TA 3I3EA 1OB1B 5DUPH 1E6JH 3ZLQC 4WFFE 5D93B 4JRXD 5DQ9B 4QRRD 3SDDB 2G5RA 2IMNA 1INQB 1NEZA 4WGVB 2DAVA 4XCCL 2A74B 3CMOL 4UDUB 4UV7H 4P5KB 3G5YB 4LNRB 1C16B 1H8NA 4PJEA 4ACPA 4JFED 1KEMH 5A16A 5C0EB 5CINH 4Z7WF 2IG2H 1JN6A 2NY2C 4LCWD 4LCUB 3FO9A 3QH3B 2NY4C 4ONOA 3MRMB 1CD1B 3TN0B 1MHPL 5E24E 4WU7B 4UQ3B 3CMGA 3R06B 1A6TB 3GSNB 3HPLB 1MFEL 5JORA 3TZVA 4BM7A 1I1FB 2AK4E 2VDPH 3BAEH 4P4RB 5EU3B 5KAQG 2Y23A 3ARSA 1FAIH 3BPLC 3HS0B 3G6AA 4OM0H 4UBDD 3VA2C 3GJFA 1INEH 5KS9A 3W0WD 5C7XL 3GFUA 4ZFOA 2RGSA 1HEZA 4X9GA 2V17L 4G9DB 3TCLA 5IEHB 2GT9B 3CCHB 4FFVD 3VFUB 3UDWC 1MY7A 1QLFB 2L0DA 2E7LC 3NCYS 3IVKB 4IRSB 2AKRA 5CIPH 4YHLH 5C09B 5FECA 1PLGH 1FL3B 4HUNB 4W6WB 4YUEL 5EBLB 3CK0H 3F7PC 5H2BA 1QD0A 2YXMA 3DURB 3MGOA 2Y5TB 4FQJL 2BHUA 4HMDA 2OX5A 3HKFA 2C1OA 5DK0B 1NGPH 2G75B 3TT1H 1J18A 4G5ZL 2NTFA 5L88H 3T4AB 3EYFB 5T3ZL 2A83A 5FA3A 1EO8H 5IFJA 3KLAB 4LKXB 4YX2L 4KRPC 2Q1EA 3ZKQD 1X44A 3T3MF 1UCBL 4FQCH 5CJOH 4ZDHA 5ALCH 3VE0A 5GZNC 5AD0B 4OB5L 2ZG3A 4LSRL 5FK9A 5E2WL 3SJVD 4P2RE 3WFEL 3PV6B 1WEJH 3MJ9L 4GMSH 4N1EA 4APQA 4ZG1A 3IKKA 4HWZA 3G6DH 2XTJC 5I2IA 5HPMB 3RIFK 3QUXB 5DVOA 3X14A 2BVPA 1CLOL 1OP3H 3MJ7A 4OCRL 1J5OH 4NN7B 4JPWH 1I9RL 2V2XB 4XC3L 1KJMB 4ZUVB 1KELH 3SKNA 2VQ1A 5CUSL 3MR9A 1TQBC 3UTPD 1UWEL 3QQ9C 1WFTA 1W0VB 1BQHG 4O51A 5C09E 2ED7A 4PJEF 3NGBB 2X1OA 4EQ2A 5KSUB 4RAVB 4NN5C 3OHXA 4Y19D 2GTWA 5CLWA 1UM5L 1JHLH 4QRQB 3KLHD 4IIQB 5BV7C 3L7FB 5GGSY 4YDKH 4Y5YB 1KB9J 2VDRL 2EXWD 4G8IA 4PLOB 3MBXL 3EJZC 2VH5L 3DSFL 1U3YA 1Q9LA 4EXPX 4MJ5B 4XXDA 3AREC 1U3HD 3RFZC 3ARDC 5E2VL 2E9BA 1UGNA 1Q0XL 1U91A 3T0WA 3FQNA 2XNAB 4LARH 1CDHA 1FNFA 1J1OH 5I1AA 3TVMD 4AT6A 4IOSD 3QDJB 1CXKA 4Y4KD 4NZTL 2ERJB 4NO2A 2F53A 1NFKA 1QSEA 2WAHA 3H9HB 5IKCA 5CGYD 3S34H 4HAFA 3P4MA 2XY2A 5IHZB 1PZ5A 5DK3A 3MV9E 3KS0H 1QR4A 4IMLB 2BVYA 4TNVF 1DUZB 4DKFH 4ZO9A 3IXAA 5KVGL 3H9SB 1MF2L 3KPSD 1JTOA 3R0MA 4PGBA 2ZNXA 1PQZA 2HT4C 4PG2A 2VLRA 1HH6A 1XF5B 2BNRD 1BJ1J 2QV2A 3LH2L 4LRNL 5ETUB 3ZL4H 2ZZUT 1F58L 3V4UH 4OFPA 4KKCC 1H5BA 4YHOL 5LXGL 5BVJA 5I19L 5AZ2H 5HYJD 2A6IA 2YA1A 3EDJA 4ZUTB 2MPAH 5I1GH 4DGIH 4WUUA 5LWYH 1QFWM 1NAKH 1FVEA 2RB8A 2FECI 4XPHH 5EU6E 3ROLA 1QTYT 2Q8BL 1ETZA 1NGQL 1VFMA 3TFKD 1FJ1B 4PJBA 3MJGX 5T1KA 5FM4A 3E2HB 2NY3C 3OAYH 3HC3L 2RAMA 5B21A 4NUGL 1JPSL 2P5WB 1JGVH 5GRVL 1UJ3C 5GPRA 1V7NH 1U8JA 1IM3B 1T5WB 4KI5C 3BHBA 3U4AA 4LNVA 3ZT6A 4KVCH 1JPFA 1ZHBA 1UH3A 2D31B 2GJ6B 2I26N 3GSXA 3MBEC 3EYVA 1G9ML 3Q0HA 1IGTA 1MAJA 5IJVA 5HI5C 3WSQL 4ZUWB 1ZS8B 4JRXA 4JRYB 4MJIB 2GFBA 4HUXA 5I75B 5L0QC 4K7PY 4HPOH 2D2OA 5F3HB 4U3XA 4QRRA 3UTTD 4CUCA 2J6EA 3QFDB 4ZQKB 3GSVB 5CEYB 5A40E 2WUBH 2AJXH 3S36L 2VWEE 5CHNA 4JFEA 4YR6A 4MA3B 5FYJD 3H9SE 4IBLT 1MVUB 1AD9B 3VXTB 4YBLB 2WW8A 4PGEA 5DMGD 3BDXA 4LCWA 4PJ8C 1LO4H 4KQ3H 3FQWB 4FFWC 1DTUA 4QHNA 3FB6B 4ODVL 2PO6B 1HHJB 2Z35A 4OKDA 1FPTL 1LEKA 2CLVB 3LKQB 2CDFA 2O26U 4ELKA 4LSUL 3CXHJ 5C07D 5FUOH 4J4PD 1JNLL 2VITB 3WEXA 2BOCA 4RNRB 4ZOCA 2EDQA 5DF0A 1VEPA 1CZ8L 1ZANH 1LP9B 4U1GB 3W0WA 2DQTL 2ED9A 1MCCA 3PWNB 1DQJA 5F6HJ 5CJXA 4K2UL 4LCYA 5CJQL 2J2ZA 4HXAH 3WV0A 5ILTH 3LD8B 2EO9A 2E8ZA 5F8QC 2ZCLH 3ZKNC 5IFAL 1MCLA 4PUBH 5JW4N 1G7IB 4HBCH 5MEOA 3EFFA 5BOZG 4JFFD 35C8H 1AC6A 4R4FL 3VI4F 2XXCB 1S9KC 4PYGA 3D9AH 1X5YA 4YH6A 1BIIB 4JKLA 4Z5RB 1FFPA 3KPNB 2QSCL 2E6JA 5KSVB 2VABB 1A9BB 1YN7A 3EOBA 3ESVF 3Q6FA 1OLLA 4OF0A 1J8HB 2Y07H 3TH2T 4XMKH 1UEYA 1X3DA 3QDGE 1FORH 2P8LB 1IMHC 4M3KB 1HHHA 3QDMB 5JW4M 15C8H 5GISH 2ZCKL 4UT9L 4Q6IB 3M1BB 4N5UA 2EICA 4JR9H 3GMPA 3OJVC 1G7QB 1VGEL 5IK3A 4ZFFB 2GUOB 4I0PD 2NZ9D 4OLVL 4WEBH 4RBPK 4KV5E 3LN9A 4Z7UB 3BQUC 3BN9C 5DA4A 2H45A 1WZ1H 4H25B 3QFJE 3SJVA 1TDQA 5D1ZB 3JWDC 1KFAH 5HVFB 1OT2A 4G9FE 4PJBF 1XCQA 4KTDL 2XRAH 4GG8A 1D3CA 5D7IB 3D39D 3KWWB 4Z7OF 4QOKD 2OMNA 3Q48A 5GJSL 1KJ2B 3SKOA 5K9OB 4B41A 1KN2H 4HK3J 1VFBA 4LMQE 3NPSC 3VMPA 2E27H 5BMFL 2WMPA 1N0XH 3H3KA 4D0CA 2V9RA 2BY3A 4I48B 4AMKH 2JB5H 1GSMA 3BKJL 4ZAKB 4JN2A 1I7ZB 1OAZH 2YZ8A 3MREB 1DANU 4DW2H 3PWUA 3T0EE 1IZKA 2EZ0C 3L9RA 4LAQH 5EU4A 5GRZA 1VPOL 2PUQT 5HHVL 5JW5A 2DLFL 2VB5A 4Y19A 5DVKA 2MWCA 3VMOA 3FKUS 1FFNA 1S9YA 1RJCA 3GZKA 1NC4A 1N5YH 5IFHL 5C6WH 1I7UA 3QDME 3V52H 3GHEH 1QLEL 2OJZL 4HD9A 3RWHB 2AXHA 1RJLA 5J7CC 3WJJC 1EEZA 3DX7A 4PJDA 1U3HA 4S1RL 3K3QA 5IP4A 4Z7UE 4HKJA 1DQQA 5D9SB 2DL2A 5B8CC 4MQXC 3V0WH 1QBLL 3N0PB 4M48L 3DMMC 2HTLD 4CBPA 3CFCL 5DMIL 2PYEB 4OT1L 1F8TH 3SO3B 3TVMA 4P5TC 5DJDA 3GEWB 4Y4KA 2EE3A 3WHXA 2Z31D 4L9DA 2FEDD 3MUZ1 2XA8L 5D7IE 3K1KC 1FGNH 2I9LA 5IB1B 2NY7H 2EYSB 4Z7NE 3LKOB 3VXMD 2F8VA 4NYLB 1OLZA 1MRCH 4HCRL 1NANH 4KKNA 1NC2D 2VDOL 3WS3A 3QXDA 5D71H 1CTOA 1DBMH 4OZGA 4TVPL 2DOCA 3GSNH 1L9MA 2CIIB 1ZK9A 5DFTA 3KPSA 5F9DC 2DDQH 3VDCA 3ZDYF 1KCUL 5DVLA 4X6CA 3HAEA 1L0QA 3U7AA 1JRHL 5JA9A 4U1IB 3NCBB 3TT3H 2B8OT 1FGVH 2BNRA 4MXQC 2A38A 4WI5A 2YWYA 3JV4A 2ESVD 3I75A 2QADC 1ES0A 1BQHB 4UU9B 4JHAH 1EEQA 3F5WA 5F70A 1S8DB 4DWHA 1QSFE 2WWMC 1BP3B 1X7QB 1RHFA 4H88L 5HYJA 4BSVB 2HFEB 3K80A 2VLLA 5JOPE 1R3JB 3FO0L 3TA3C 3VXRB 2FGWL 5F6IB 3IU4H 2OZ4L 3TBWB 4G3YH 4KROB 4OI9A 3BH8B 5HY9B 3GKWL 3X11B 2VLJD 1U8LA 4YZFE 5KSAC 5B38A 4Z7QE 4F7CB 3L3OA 1M05B 1I85C 1JNNL 3NFSL 4Y2DB 4YNYB 1OTTD 4OM1L 1U8MA 1VADA 2HN7B 3P4OB 1CXLA 2Y4SA 3RWGB 1AO7D 1UADC 3I50H 4H20H 3DBXB 5JDSB 1BFVL 4HT1L 1MCRA 1P69B 4JM4L 5FYKU 3SE8H 1AGCB 1G7PB 4K3EL 5H94B 3WO4C 2I5YH 5IJKA 3OXRB 5LAXB 2R69L 2A1WL 1P1ZB 1I1AD 1N8ZB 3B83A 4MX7B 3ZKMD 1ZT4B 4IHOB 3BO8B 3UTTA 1UM6L 2VXSL 4JFZH 5BQ7A 4KTEH 1OQOA 1MCQA 4ODUB 4KJQC 3TYGL 5KZCB 3S98A 1JPTL 4K7FB 3SQBA 1TXKA 4F8QA 2HTKC 1NCAH 1ZHKA 4OLZH 3U0WH 2A6JB 4PJDF 3WFBH 4XNXH 4TVPE 4P3DB 4P2CG 5KTEH 1WITA 2AXFA 2EEAA 3HI6L 4A6YA 4U1HA 2OTUA 4JO1H 4ZNEA 5D1QC 3KDMA 5JO5A 3O6FC 4ZS6C 3OKLB 4KHTH 1H8OA 4I9WE 2AEPH 5C07A 2XKNA 4J4PA 4M1CD 1IFHH 3U30B 1LVEA 1WZMA 5CBAA 4I3RH 4WJ5A 5ICXA 4OGYL 3MLVL 4M8QA 5EO1B 2XICA 4U3CA 1KIPA 1AGBA 3QEUA 3MRFB 5D2NC 4JDVB 1KXVC 4L3AA 3HMWH 2O5ZL 4P2QB 1HINH 2LV4A 5FB8A 1N4XL 4QRSA 2W1NA 1BGXL 1P6FA 3MRPB 4M1GH 4XAKE 4JFFA 4ODTH 5TFS