4ZFGH

Dual-specificity fab 5a12 in complex with angiopoietin 2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
215
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTISDYWIHWVRQAPGKGLEWVAGITPAGGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARFVFFLPYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Deep Sequencing-guided Design of a High Affinity Dual Specificity Antibody to Target Two Angiogenic Factors in Neovascular Age-related Macular Degeneration.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/immune system
molecule keywords Angiopoietin-2
total genus 39
structure length 215
sequence length 219
ec nomenclature
pdb deposition date 2015-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zfgH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zfgH01
5CILH 4MSWB 1ACYH 2Q20A 1XGRB 3OXRA 1M1SA 2J8UE 5DMIL 5I76B 1CG9B 3MLWL 4XPHL 4PJAF 12E8L 5EPMA 1NCCL 4UT9H 1YEGH 3IKKA 4PB0L 3SO3C 5I8CA 4MD4B 4MX7A 4L4TB 1N7ML 2EXYC 4OM0H 3OAYH 2AJ3B 5EU5A 1AXIB 5JHDB 3QB7C 1BZ9B 4K07A 3MYJB 4M1CC 4TOYL 3HG1B 4MWFA 1LK3L 1FL6B 1S8DB 2HTLD 4LSUH 3S5LG 4C56D 2GTWB 4Q0XH 5HJ3B 1CF8H 4KRMB 5DUBA 3IDYB 4X5LA 1Z5LA 3MLYH 4MZ3A 4YAQB 1Q9KA 4NNYB 3SE3A 2X70B 3NCMA 1YNKL 4MVBC 1Q72L 4XBPB 4JLRA 1R3HA 4I3SL 5EOTB 3WFEL 3H3PH 4LKXB 3QEQA 4TULL 4ZG1A 1KIRB 5HYSG 3NFPA 3W9EA 5C0EB 5FYKH 5E2UH 3W0WA 1OTTD 1Z9LA 4JHWH 5DA4A 4OM1H 2UWEA 4I3RL 3MV9D 1H3GA 3WHE1 5IBUB 3MRCA 1JIBA 2YRLA 1MH5A 2CKBA 3OB0H 3VFNB 4PD4K 4P4KB 2LQRA 4Y19B 4HFUL 5F3BA 5GS1A 4K7PH 1CD1B 2AXFA 1C08A 2W59A 4TSBL 3F6LA 2L7JA 3PWNB 3QUKB 3T3ME 3VXRB 4G7VH 4LLAA 2DQEL 4JDTL 2GTZA 4MNQB 1CYGA 5KG9B 5CINL 1ZLVK 2AGJH 3IB4A 4LKCB 4OAWA 3VH8B 3WNLA 1OSPH 3ZO0A 1T3FB 1A7QH 2VJXA 2YPLB 2ITDA 5KTEL 2JCCF 1YEIL 5GS1B 3CLFH 4ONOA 4HXAL 1IVLA 3SOBL 5FOBB 1IGML 2BSRA 1YEDB 2CLZA 4PJ7B 2VAAA 2Y25A 3GMRB 5J7CC 3HAEH 3PQYE 4WW2F 5KG9A 2Q7YA 5ELIA 3D69A 4JQVA 2V9TA 1HZHH 5AWNH 3V0AC 2BY1A 4HV8A 1N8ZB 1NC4B 3MOBH 2J2ZA 4KK8C 2APFA 3AM8C 1R3HB 1UENA 5CLTA 5E2WH 4JZNB 1JNLL 4XVUD 2CO6B 1QPPA 5BJTA 1MNUH 2YMXH 1GC1C 5FYLE 2UWEB 5DYOA 1AHWB 1TMCB 4M7ZC 1QLRB 1A1MB 4NWTH 5GHWH 2R29H 4UQ3A 3GJFH 5DHXB 3KPNA 4YZFE 1EHAA 3QNXA 4KI5D 5T5FH 3U2SB 4Y4HA 5CEZH 2XICA 5CEZL 3DARA 2XTJC 4M62H 5ACMA 4U0QB 4FQXB 1EEZA 4P5MA 5H35A 4IOSD 4YPJA 1KPRB 2PTTB 4OKDA 1X5HA 1G9NC 2AXJA 4LLVA 5IBTL 1GGBH 1ZS8B 5E1AA 1MLBB 4ODXA 1ZLWH 1GRWA 1H5BA 2R9HC 3FOLB 4F9PC 2XZZA 3BQUB 5F88B 5IEHA 2BXZA 4JFHD 4FQ2L 4HCRL 5ISZE 5GXBB 2GY5A 1PLGL 5I74B 2WINB 3C6LB 2YC1A 5DJ2B 4UU9B 2OYPA 3T0BA 5ADPH 1JV5B 2R2BB 4CRPA 5E9DD 4QHNA 3C5ZA 3DHJA 3ARVA 4PD4J 3QHFH 4XVJL 5T1KA 4JO4L 4K8RC 5TQ2H 3ME0A 5J1AA 1UVQB 1L7IH 2NTFA 5GGUA 3PF2A 4Z7VF 3VFNA 3SDXF 2FDBP 4HGKC 5IQ9B 1QHPA 3D25A 2B4CL 2WBJA 4LPVA 1B2WL 3MYJA 5IBUG 3V7MA 5KS9E 4LMQI 3SJVB 4Q9QH 4MS8C 2E8ZA 1JTTA 1IQDB 2I25N 4U0RB 3N1FC 2VABB 4ZTPL 4JM2F 3SHSA 1U3ZA 1XFPA 1YEGL 4FQXA 2WANA 5I2IA 3ILQC 4JKKA 5GSVB 1FJ1B 1Q0YH 4ACPA 1WAAF 2NY6B 1FZJB 4D8PA 4OM1L 4UTAH 3W39B 1MCCA 3DBXB 3FMGH 3Q6FA 5GGVY 5DR5H 1NLBH 3QUYC 3H3BC 1NMBH 1VPOL 5SWSA 5B3JF 3ARFC 5F7DA 4PV8A 3ARFB 4EQ3A 2FZ3B 4JM2D 4K8RH 4I3SH 3RDTC 1G6RB 4XP4L 3WFEH 3H3PL 3B83A 3U9PL 5C9KA 3QDMD 1KBGL 4C83B 4LVHB 2E9JA 3CFJB 3DURB 3CZJA 3QG6B 4HKBB 3MLXH 4OD2A 3X14A 1ZGLB 4XNMA 1CE1L 5BRZA 2YZ8A 2VLRA 2CQVA 5KSAC 5CJXA 2DRUA 1P53A 4FS0A 4IOFD 1K4DA 1DQJB 5DT1H 4NQCA 4AH2A 3JWDL 5T1MB 4LPTA 5D1QC 3TPUB 4JDTH 3I3DA 1FZOB 1LK2A 4GS7B 1DQML 5E08L 3WLBB 2PCPA 3JTSA 2VDLL 4GKNB 3NIDE 3GJFA 4QOKD 4JZOB 4KVNH 3MV9A 4KVNL 4OIAA 4Y19A 5DRZA 2DBLH 3QDGA 1RJLB 1SY6A 4NSKB 3VXMA 2LFGA 4CVZB 5BV7B 4ODVL 1EFXD 3TBSA 5BV7C 1R3LA 4OTXH 1UEMA 3STLA 2B4CC 5HPMB 3FB5B 1SBBA 3WLWD 3TBVA 3FO0L 2AEWA 2VOTA 3RVWC 2QSCL 3X11A 1BIIA 1WK0A 5E6IA 4QRRB 4XAWL 5JR1H 4PV9B 2GAZA 1MFAL 2VDKH 2FJGA 1IQWH 3S88L 1XGTB 2R23B 1IZJA 1CFQB 2FD6L 4JHBA 4AZ8A 3STLB 2CJUH 4YFLI 2X4QA 5DGQA 1R5WB 4JPVH 1F8TH 5BZDA 1GOHA 1AGBB 2V5RA 4P3WA 2WZPD 4XBEL 3KR3L 5HPOA 4KKLD 4MJ6B 3LN9A 2DD8H 5F7UA 4N9GB 2YUXA 3PNWA 3ZKNC 3O6FA 2H26B 3SEPA 4YBQC 1BGXL 1L7IL 1S7WA 1J0ZA 3B9VA 4LRIC 3HC4L 1SJVA 2NNAA 1QO3B 3AS2A 4OJFH 1T0PB 4MAUH 1QSZA 3MBEC 5FEBA 4MJ6A 5FV2A 1HDMB 4K23L 2MCPH 4F2MB 1E27A 3L3IA 3VGHA 1U8PB 4NO0B 3QEUB 3A6BH 4PRIA 4DKEL 1MCPH 4Y5XC 4LDEB 3JSSA 4JDVB 4EKXA 1XGQB 3VXRD 3D9AL 3D9AH 4NKDB 3VG0L 2GAZB 3P30H 3NA4A 4U0RC 4M61A 4GBXC 4Y5YA 2FGWL 1SYVA 4OZGF 5I9QB 3VXPA 4OZGB 1G7HA 5ICZB 4YX2H 5LAXB 3WDHA 2AERT 4BH8A 3BSZL 4PGBB 2BXYA 4NO5B 4OZFG 5IVXE 4XXDB 4YPGA 4MD0A 4PV8B 1K4CB 3SOBH 2YBRA 1FP5A 3MRIB 5FUZL 4P23A 1P4IH 1C12A 5F71A 4F9LA 5HDLA 4KKBD 4R26H 5DK2B 1HXMA 3JVGA 2E6QA 5IF0B 5I1KH 2VDRL 5DRZB 5EC2A 3GO1H 2N56A 3QA3A 5C0FB 3BEWB 1TDQA 2Y7QB 1C5BL 3T0VA 3WNOA 5E2WL 3DGGA 4K9EL 4OV6F 1G7LB 4U1JA 1EIBA 2V2TA 2A74B 5HI5C 1MAMH 3HRPA 4Q7DA 5EBGA 2P8PA 3H9HB 3CMGA 1D5BB 2MSPA 5K9KB 1REIA 4RMWA 1RZIB 2W38A 3WIIH 2HJFB 4NKIL 5DURD 1WV7T 4NKIH 4Y5VB 1JK8A 1S9XB 4P46D 2XFXB 1B0RB 1LO4L 1J87A 2Z31A 4LU5L 3CU7A 1J8HB 2A9ML 3FQXB 3MROA 4F37K 1R3IL 4FZ8L 4AQOA 1GAFH 1S7RB 4RBPK 1AC0A 4OD3L 5FKAB 5C0RH 4G80A 1P6FA 4UV7H 1U2HA 4JFFB 4KRPD 5JXAL 5D6CB 3LKOB 4YFDB 3SDYH 3T0EC 4HKZA 1TQBB 2F53D 2O5YL 3T3MF 3TJHD 1MFDH 1MFDL 4MDIB 4F7CA 3MUZ1 4YDKH 3I50H 1XGPB 5ETUA 1NPUA 1C08B 3AS0A 4EUPH 1I9EA 2F53B 1FYTD 4GRWB 1Q9LA 5EBWA 1MHPH 3FRUA 5T1DH 2J12B 2K7PA 5E5UB 1AQKH 3QWOA 4ZSOB 2DMCA 1T6WA 4HHAB 2NY3B 3ZKSD 5TQ0H 2HJKA 5HHOE 2VZOA 5IM7A 1CL7I 2YPLD 4LLQB 4LIQL 3BGMB 5C7XL 3BDYL 1YNKH 2X10A 3ARQA 3TBTB 1XIWD 4ELKA 1U8KA 2R56L 1DVFA 4XHQA 5FECB 4PTUA 3CFEB 4LSVH 1I7RA 2DQGH 2ICWI 1WGOA 5IMLA 2A9NH 5GGRB 3G6JA 12E8H 1FRGL 3QWOB 4ZSOA 1AE6L 5B39G 3K1DA 2ATPA 4TOYH 1IM9A 3ZL4L 3LD8C 2R2CA 1HWHB 1BECA 1KENL 1JCKA 2GJ6A 5B38A 3SQOL 2AK1L 3HE7D 3FTGA 4PGJA 4G7VL 2D0GA 3JUYA 3QWQB 1CD9B 5HHOB 4KDTA 3RWCA 4NQCD 1HSAA 3CFDA 4WWKD 1FFNB 2DB8A 4G9FA 1F4WH 1WAAA 1A7QL 3SGEH 3B2VH 5DEGA 2AEIT 5ID0A 4GOSA 3SE8L 1Z9OA 3BSZH 4OFYD 1RZIA 1JRHI 5T1LA 1RUKH 3U1SL 5I73B 1H15B 5FHBH 1NC2D 1F11A 1ITBB 1JNHA 2JB5L 3OKKA 4QWWD 5DJAB 2VDRH 5GS0L 5DRWB 4B50A 4RFOH 3LKSB 5F7EL 2IAMA 4ZFFA 1LDPL 4LSDA 3KPSA 3K2MC 5EC2B 1TQCB 3ULSB 4OLXH 5F7FA 4XRCB 2WLYA 4XPTH 1QA9A 4MNQE 4YO0B 4DUWA 5E8NA 3MLPA 4PGEA 4JG0L 1P7QA 4J12A 1EXUB 1ZHKB 5EZLB 3TT3L 3DRQB 4NT6A 2IGFH 3D0VB 2NYYC 2X40A 3PWPE 1ZEAL 1GH7A 2BERA 2OQJB 5EZLA 4EXPX 4ODVH 4CNIB 1NAMB 1K2DA 1SJEB 4FZEH 1LGVA 2CDGA 1NCAL 5GSVA 4PJCE 1PEZA 1CDJA 2PYFA 3LQAH 1EO7A 3FQNA 3FQTA 3RTQC 1N2RA 1IQDA 2DI8A 5I76A 1OAUL 3K2UH 5J0BA 2IPUK 2ZCLH 3HMXL 3LKPA 4L3EE 2CRZA 3PDGA 4XHJD 4DN4H 5HSFA 4GKSA 4M7LL 3V6ZA 3MV11 4P9ML 5K9QG 3NCJH 1PY9A 2B1HH 5GRUH 5T1LB 1BOGA 5HYEA 1OSZA 3G5VB 3V4UL 5D7LD 4PJIB 1NCWL 3PGCB 1NCWH 2ESVA 4F7EB 4PJEF 1QFUL 5EU3B 3RIAK 2A83B 2JJTA 1JMXA 4LBEB 1R5VA 1FORL 3S37L 1S9XA 2BMKB 2IAMB 3MRDA 5BVPH 1R5VB 3B9AA 3PGFL 4WGWB 5DRNA 2W65A 4MA3A 5C0AE 2YD2A 4C83A 3UROR 3T1FB 4RAUB 1F2XK 1MCWW 3QXVA 4PJ7E 5DUMH 5F44A 2YK1L 2WWMC 2DN7A 3H9SA 3SO5A 1CGVA 4ONFL 3RVUC 1J05A 1RZKC 1A4KB 3QPXL 1RURL 5FYLH 3REVA 5FYLL 4IMKC 3SY0A 1J86A 4QRQB 5C0CD 4I0PA 2X1OA 1HQRA 4YGVB 2VERN 4UQ2A 3PG2A 5KVFL 1HSAB 5AUMA 2Q86A 4YHML 1UEYA 4P5TC 3R8QA 1OPGL 4IOIA 2NZIA 2BVOB 1BZ7B 1LEGA 4JE4B 3EJYC 4K3JH 3QNYA 3WXWH 1HE7A 4S1DD 2V17L 2QLVB 1WAAE 3K1KC 3JZ7A 3SDAA 5JPMB 4PJXA 3RDTB 5MP6H 1JWSA 3TNMA 4M1GL 3GBNH 1F5WA 3GK8L 1Z0MA 5CZXD 3THML 3H9YA 1KJMB 3RY6A 5FOJA 4ELKB 1VFAA 4F33B 2VDQH 5DJ6B 2I9TA 1AR2A 4GQ9L 5DMYA 2W9LA 1F4YH 3UTTD 3T09A 2NYYD 1S5IL 5LGHL 4ZFZA 3PDDA 2ZUTA 3OKLB 4XCNA 3MRRA 2RCSH 2RCSL 3DTXA 3SDXE 5A2KH 2KPNA 4B5EA 2X4RA 4L4VE 4U1LA 3DXAA 5TH2B 5CZXC 2Y23A 4I77L 3DWTA 1RK0B 1N6UA 4FQQB 5JNYA 4LVNC 5IW1A 3HE6D 4BJLA 4PRAA 1T5WA 3DOSA 4XAKD 4PJ9D 2XZQH 5HHOA 1AC6A 4YBQD 1CGYA 4OLXL 4J3TA 4FQIL 2DQHL 2IH3B 5EO1B 3LCYA 4JFYA 1CFTB 3I3EA 3R0MA 1UA6L 4LRNL 5KANG 1HXYB 5SWSD 3MREB 3RZCA 2ADGA 3FJTA 5C0AD 3ARWA 1YA5A 3WHXB 2EDJA 4ZYKB 1MCNA 3HE7A 5HDBF 4A6YL 1JZ4A 2A1WH 2UUDK 4RFOL 5ESVA 1Z3GL 3HRZB 3TV3H 3QDMA 3TP4A 5ISZA 2FJHB 3G04B 3RBSA 1FFOB 5ID1A 2X70A 5FHAL 3T0DA 2R15A 4Z7VA 1A6WL 4ONHA 1YEKH 4N0UB 3S88H 1KCSL 5CIPB 4KK6D 3U7YH 4ZTOH 5I8OH 4LSQL 4G3YL 1L4IA 3C6LD 5K59F 5MEPB 2DYPA 4FQLL 1XF5B 32C2A 3IXAB 35C8L 4MX7B 2ZWLT 3FO0H 3P0YH 4TRPL 3DLQR 1A14L 2AQ2A 4YDLB 1NL0L 5FK9A 3O4LE 1CICA 4KPHH 5IFJB 2VDML 4ISVB 1NMAL 1N6VA 1P9MA 3ULVF 3UTTA 5EO1A 4UB0L 4OUUA 1R5IA 1ZHBA 5J13C 1KPVB 4ZS6C 3HC4H 3DXAE 3ZE0E 2V7NA 4GRMA 1CFBA 2RHEA 4RGNC 5F72S 4NZJA 2ITCA 3T2QA 3WMSA 5KVEH 1XF4A 4LSRH 4OLYL 1F8TL 4AT6B 4MLIA 2J4WL 4KROB 4X6FA 3BISA 3GSNL 4JAMA 1B0GA 2DWDB 1ZT4B 4XAKE 4HPYH 2EXWD 3J8F7 4LVOC 5CGMA 4X5WB 3UBXI 1JL8A 5DD1H 1GC1L 1YN7B 3U83A 3S4SB 3NTCL 1JFQL 2I9LB 3KJ4B 4U6VL 5DDHB 1MIML 1N64H 3KWWB 2CDFA 4QYOB 2EYTB 2DQUL 2PO6C 5E0QA 3U82B 1GZPB 1ED3A 3IS1X 1TVBB 5E8EB 3S35X 2X4QB 2D0FA 5DF0A 4ZPVB 4NNXB 5E4EC 1FL5B 4M93B 3EYUH 4CU7A 2NY2D 2X42A 3D18A 5D6DA 1R3KB 1PY4A 2VN4A 3MCG1 2MJWA 3CLEH 5FA4B 2F53A 5JXED 3NCYS 4Y16B 2BOBB 5T33H 1ZXQA 2AJSL 4HLZH 4PJ8D 1WIPA 2VR4A 4BQ6A 4M1DH 2D4FA 1NBZA 1KIUA 2JIXD 5ESVB 1FNAA 2ZKHH 1KB5H 2AXGA 2VXTH 2VZ3A 2YRPA 5HBBA 5IHZB 4PJ7A 1WSST 1MREH 4MNGB 2X5PA 3LHPH 5D93C 4APQA 5B4MD 4HBQA 1S7XA 4IJ3C 3UBXB 1S7TA 2NTSP 3MRPB 2XZCL 4MAYC 5DMJB 1EK3A 4TNWK 2D03H 3U0TA 2WMPA 4YDIL 3D39E 4NHUA 3IETB 3RWHA 4P2CG 4GRLA 2EE9A 3OHXA 4LEXH 3QIBB 1ORSB 4L1DA 1BJ1J 5FKPB 3GM0A 3LEYL 3RPIB 3CPLA 1ZGLP 1S3KL 3OL2A 1S7TB 4WEBH 5TH2A 1H3PH 3PWJA 1GCFA 4LGRB 1H3PL 4AJ0A 1WIOA 1ZGLM 4K7FB 5CHNB 5E6YA 3NCJL 1C5DB 2VISB 2BOCA 1KCVH 3S3PA 2YKLH 5CCKL 4QF1B 1MCWM 4DN3H 4AMKL 4UDUB 5DTFB 3FFDB 4PJFA 1EH9A 3MLSH 2PYEE 3OJVC 4LLUB 4LSPH 4LLVB 1N59A 3ARGA 3O4OC 3QUMA 5EUOF 4X9IA 2NY5H 1I8MA 5C0CA 1N59B 1F58H 3OB8A 3IF1B 2EDKA 5C0GB 2VDOL 4PBVC 3G08A 4GMTL 1MHPL 3PWPA 5C0DA 5KZCB 1LEIB 4DOHB 1HK6A 2Y72A 5MEPA 4M48L 4OGAD 1FZKB 4NOBA 3RBGA 5T1LD 4IBLT 2NPLX 5IQ9A 5IG7B 1UCBH 5BOZG 5EOTA 2F15A 5C0CB 4Q97A 3NIFE 4NC1E 3MRNB 2HN7A 1MFCL 1G9NL 3ZYJA 3HZMB 4FFVC 3W9DA 3WSQL 1N26A 5B8CA 3SGKC 4U3HA 4EI6A 4XPHH 4HKJA 3BO8A 3O3BA 3QIUC 4WUKL 3JBG7 4ZXBB 4PRBA 4WTZG 4JGJA 1BF8A 5D4QA 1NFKA 3FAWA 5T1DL 5EFIA 3KS0J 2VDNH 1E6JL 3TBWB 5BW7C 3FONA 5IFHH 2ZG2A 3GZKA 5FCUH 4UT6L 1HH6B 4OLUL 4KKCC 1LO3H 1YY9D 2XWJA 1TQBC 5GRVL 1GGCL 1KC5H 3QUZD 1OL0A 4ZPTA 3O3BB 5ILTH 43CAB 3S34L 2ZNXA 4MA8H 4FABL 4WHTB 1TZHA 5SWSE 3E0GA 3ZL4H 3SE8H 4K23H 5EU6A 3RWFB 4P46B 4KWUA 3OKMA 3OZ9L 4OCRL 4GUPB 3VRJA 3BP5B 4LHJB 5D7IF 5T3ZH 2BX5A 3MQIA 1MELA 1NUGA 1KN4H 2WUCH 1FVCB 2J8UB 4LKXA 1FNHA 4ZFOA 3L5HA 4KHTH 4M02A 4IMLA 3DGCR 1UQSB 3G6DH 3CIQA 3KLHC 4Y5VA 5KS9A 2XN9E 4MJIE 4PBWD 1RZKH 5A2IH 2GJZB 1L0XA 2QKIB 5IMOA 3ULUC 5F9OH 2HWZH 1B6DA 1NGZA 3MLZL 5TF0A 1A47A 2JJUA 3VGFA 3NGBB 4F37F 3CXDL 3GMMB 3DMMD 4UILH 1K8IB 1N3NA 1WITA 1OAXH 1RV6X 4L5FL 1Y6MR 5H8DA 4QGTA 3AMLA 3HAEG 3LD8B 1K8IA 5BV7L 2Q7NA 1VGKB 4A6YH 4JQIL 1W8OA 4HIHA 5E1HB 4HWBH 1WC7A 4ZUVA 4JRYD 4DFIA 4N0RA 2KL6A 3FB6A 1CXIA 5K93A 4Z8FH 1Z6JT 4PGDB 4JY5L 1PJ9A 2Z8SA 3ALWA 5CINH 1KJ2A 3N85L 4V1DA 3CC5B 1OSPL 3QUKA 1KCSH 3VXRA 1BD2A 2OL3L 1FDLH 5C09D 4GJTB 2OTUB 3EYOA 4JFFA 2R8SH 3RQ3A 1S7XB 1U8NA 1DBAL 2UUDH 4G8EA 1N5AA 3TFKD 3MLRL 4N9OB 4LSPL 2AXGB 2YPKB 3VH8G 2GT9A 1QSEB 4U6HB 1O7VA 3KNBA 3LIZL 1AKJD 1MFNA 1RJYA 5KVDL 1PW3A 4CW1A 5FECA 3ALPA 3BAEL 1EMTL 3RVUD 4HUMB 1UB6B 4I8DA 4OD3H 1DP0A 2VUOA 5K33A 4ZOEA 4IRSD 4ZMAT 3BVNA 1FO0B 2KQNA 3CH1A 4A2MA 4GMSL 4N8CH 2MPAH 2FWOB 3RWDB 3U9UB 1XEDA 1TJGL 1O5DT 1TJGH 3QUXC 5FV1L 2FO4B 2KH2B 3NZ8A 1NEUA 4HF5H 5ENWB 2VXVL 5E7BA 3RWIA 4Z78B 5L7XL 1ADQA 1P2CA 2AI0H 1FNGB 1VERA 2C26A 2IFGA 3HE6B 1ZLWK 4KJQD 5KVGH 5ICXA 1MI5D 3GNMH 1YC7A 4FHBD 2WNGA 2ZSWB 1YN6A 3C09B 1ZANL 1S9YA 1BWMA 1WQVT 1SYVB 4Q9QL 4OF7A 3P4NA 4CN6A 3S9DB 1AXTL 4L4TA 1QA9B 5C08B 1RUPH 4JRYA 3THMH 4B7LA 2BJMH 4MHHG 4ZUSB 4LFHD 4HUVA 1NGXB 1JWUA 5GRJL 5GGTL 5BRZB 3A6BL 3CLEL 4ZTPH 1GPOL 5F6HJ 4M3KB 1I8KA 4HWEH 3RFZC 4PREA 3HUJB 4XCYB 1A1OB 3BKMH 2DWEA 3KAAA 3MCKB 3NN8B 3QFJA 3ZHKA 3TA3D 5JORB 1T66D 3DO3A 1LE9B 2ZSVB 5C9JA 5FYJE 2CSPA 3QEUA 3UC0H 1CGSL 3F12A 4I48B 1CLYL 1A7NH 4JFEE 4ZXBC 1MWAB 1JNNH 1QQDA 1MREL 1TPXC 3H8NA 1QEWB 2ZUQC 3ZDXE 3LRSB 2VXQL 1E0OB 1I8KB 4RWHA 3V5HB 4ZPTB 3MRFB 3O4LB 1KPVA 5DJYA 1VACA 4U1GC 4X0KB 3EGSB 5D7LB 4BFGA 1ZTXL 3MLZH 4L9LC 3S4SG 3AUVA 1EZVX 2YWYA 4QHLA 1C5CH 4C55A 5KSVA 2P48B 1IKNA 4Q2ZB 5HGDA 2G2RA 3QO1A 4XNXL 2HFEB 3WS3A 4HEME 5DD6B 4J8RB 4X6DA 3F58H 5FDYA 3PWPD 2Q8BH 2AABH 1H8OA 3LS5L 2DTML 3BPCB 3LS5H 3QIWC 1PDKA 3TBTA 2CXKA 2I9LA 1MWAL 4OLVH 3IU4H 3VG9B 1JTPA 4P4RA 5DUBB 3IU3A 3LS4H 3BGFC 4RMSA 4AK1A 3RZWA 3VFPB 4NZRL 2BNUA 4J1UA 3KHOA 4OZHF 4NNXA 1U8IA 2FWOA 4YFEA 1M7DB 2SEBA 3VXME 2X4PA 4PYGA 4PJIA 2XWTA 4QXUL 4QTHA 3MNVB 1DJSA 1IAIM 2HFFB 5D1ZB 2EDOA 3M17A 5GGSA 4UTBL 3JTSB 1KB5B 1KEGH 4BK4A 1P84J 4OGYH 4JPWL 2HJLA 5A2FA 1QSEA 2VDLH 3CFDB 1P4BL 2H2PC 2WK2A 4U1KA 4ZS7H 3TPUA 4L4VB 2B1HL 4O51A 1BBJB 3RU8L 3FQUB 1J05B 5EA0L 3GRWL 3MRGA 4KQ3H 4Q58C 4RGNE 2VLRE 4DEPB 1ZLUH 4JY6A 5DK0A 1U3HD 1EHNA 2ZCHH 3TA3C 1ORQA 1E6JH 4PP1C 3RIFF 4XI5C 2OR7A 4YDLC 2LVEA 3JXAA 3FO1A 2DL2A 4EN3B 3S98A 1A64A 4ODUB 4HPYL 1VFAB 2QQLL 4MNHB 2HVJB 1YDPA 1K85A 3C6LA 1FPTL 2ZUWA 4LIQH 2FB4H 2JELL 4OD1L 4HMCA 3MPCA 3NIGE 1U3YA 3FN0H 5C92A 4LHUD 2PO6A 1YPZE 1AGBA 2AJYH 1TLKA 4TUJA 4JHWL 2J4WH 3W81A 3VFSA 2ZUYA 4R97B 4X9FA 1CFQA 2BHYA 5JZ7C 4NQDA 1FO0A 1QRNE 1QNZH 1UXSA 1U91B 3T08A 1FZMA 4YDJB 1FO0L 2M26A 2ZOLA 4Z77A 2IH3A 3QUXA 3GIZL 5HGAB 2YPVH 3F7QA 2RJMA 3U6RB 4IMKA 3VWKB 1CGSH 5KSUA 5D8JH 1U8QA 3UZQA 1HKLL 1A3RH 3JWDC 1OGAE 1XCTA 1WWBX 3LHPL 1MJ8L 1D5IL 1I3GL 5EO9B 4PJDF 2OJZH 2QADD 1GPOH 4FNLL 1LP9F 4HLZG 1EO8L 1J8HA 5LGHH 4PY7B 3UJTL 4JFFD 1B0GB 1DN2A 1HYSD 4UNVA 3MTRA 4LEXL 3MV7B 1U8PA 4RSVA 4PJEA 5DVNA 2AGJL 3FQTB 4HWBA 1N5YL 2DIAA 4F58H 1KTLA 4WEBL 2JJVA 2CDEB 4YK4B 4NGHL 5E2TL 4ELMB 5ITFB 3MRBB 5L2KB 4YIQB 4IRSC 4YNYB 2PTVA 2OLDA 2UVEA 3QJFB 3BT2H 4YXKL 3BI9X 5EZOH 3V6OC 1JPTH 3MLRH 5AZ2H 5EBLA 1U93A 1CICB 1NCDL 2XPGA 4W4NA 1QBMH 3QA3B 1AKJB 5IB2B 2NQCA 2NY7L 4LNRB 1G7MA 3MOBL 2BOBA 1AGCA 4DKFH 3L5JA 3VXUB 1URLA 1S9VB 3HZKA 4N68A 2RIKA 1J8HE 2CDGB 3K8MA 1BQHG 3E8UH 2HFEA 2XKUA 1M7DA 3CMOL 1MAML 4FZ8H 5JW4M 1T0MA 4DN4L 3NIFF 3QXDA 5L2JB 1S7QB 4OCLC 2EIZB 4W81A 1KIRA 1IEAA 4NWUH 3SKJL 3H9SB 4K94H 3EHBD 2WW8A 3MLSL 3OKMB 1UM6H 2QKIA 4PTUB 2CDFB 1G7MB 1DTUA 3HB3D 3OSKA 1I3RA 2EICA 1UFUA 5CJ5A 4HGWA 3L3JB 4WU5B 5IEKB 4NNYA 3GSXA 4YR6B 2X9WA 1VFBB 3IFOB 4JRYE 2CD0A 1UACL 3LRHA 2DQCL 4U1HB 1DL7L 2EH7H 1G84A 5HHOD 1IC4H 1IC4L 3BGFB 4X4XB 5AZEH 3DVIA 4MDJB 3VFWA 2YUWA 2FL5A 1D6VL 3U36A 1OB1A 2FLBT 4LDLB 5F89A 2RAMA 3MLVH 3VXSD 1DUYA 5HYJD 1AQKL 4LKCA 3P11L 1CD8A 3TGXA 2C5DC 1CI5A 4TUOB 4WDIA 1IEHA 3EFFA 4E41E 1FFPA 4HXBL 4MNGE 4JGUA 1EPFA 2APVA 1NCCH 4UT9L 1U8JB 5DMGC 2NW2B 2F58L 3HG1E 1V7NL 3U0PB 4KTDL 4MQXD 5LCVL 3BRDA 1BFOB 4U2YA 1PBYA 4OI9A 1MI5E 3INUL 4K3JL 1BD2D 3QEQE 1QLFA 3ZYZA 5I16A 3QIUD 2QHRH 3D6GA 4CDGC 3G6JB 3IFLH 3IT8D 5F8QC 4YO0A 4HGWB 3X3GH 3I3BA 4DGYH 5E2VL 2C3XA 4KJYB 4KUZL 3S96A 5CEYB 1R24B 4Q9CA 4QRRA 4Y4HB 3B5TA 3BYYA 1EAPB 3U9UA 4PJFB 1U41A 1ZSDA 4JO1L 1NGPL 4M5YL 4TUJB 5A16A 5HVWA 4NKQB 4OI7A 3FHAA 3QJFA 4U6XB 4H0GA 5FB8B 3HAEB 4U6TA 2X44D 3QHTC 5CIPH 1BBDH 2VISA 2P49B 2R0WH 2GK2A 5T3ZL 4LPXA 2EKSB 3FT2B 4P2QD 1XGRA 2APTA 3D5OF 4U1SB 2EZ0D 2YPVL 1CFTA 2VABA 1FFNA 3KPTA 1KCLA 2AEPH 2V5MA 3IU4L 3QIBA 2WQ8A 3BJLA 4S1QH 2DQHH 1YEJL 2EIEA 1J0HA 3ARBC 3QQ4A 5KTEH 1I3GH 4FTVD 4OI8A 4RGOH 4R2GC 1IKFL 1DLFL 2IQ9L 2X4OB 4FNLH 4Z5RB 5DT1L 3BZFB 5J1AB 4AL8H 2IFFL 5C70A 4WI5A 3DRTB 1JGEA 2Z31C 4NKDA 1WZKA 1KLUA 2Y9RT 1P6AB 4L4TD 2BNQB 4LFHG 1MPAL 4AIOA 2XN9B 2IANA 3RTQB 3PHOA 2R2BA 3C5SB 4KAQL 4DTGH 2YD9A 4XGZA 1T04B 1RSFA 2YN3A 4R4NC 4WV1B 4XBGA 4L8BB 1F6AA 3BP6A 2NLJA 2YD3A 4JPIB 2H3NB 4HH9A 4PJ8A 2FD6H 5JQHC 3QYCA 3K8KA 2R0KH 4XP6H 1FL5A 3AM8A 3KYOA 3U4EB 3OTTA 3KPRD 2ZCHL 2ZG1A 4N0UA 3D39D 4FA8A 2D4DA 3KXFA 5A2JH 1RVFL 4EVNB 1UB5A 1WCQA 2VZSA 3N1PC 4PJHE 3GJEB 3BZEA 1FH5L 1ROWA 5DC4B 1S5HB 4BFBD 3B5HA 4H20H 5I1GH 4DZBA 1QSFA 3EOBA 1K2DB 2WUBL 5DJYB 1AGFB 3O41B 1XF3B 3E3QC 4KZEL 1OAKL 2HT2C 1T0MB 4CMMB 4JGMA 4BK5A 4DGIL 5IESL 4PJBA 4B53A 1BQLH 3NCEB 2Y4SA 3K4AA 3PE9A 3R8BB 5DEFB 4DZ8B 1QFUH 5HDOA 5EPMB 5AAWA 1QSEE 2OXGA 2VC2H 4KK6C 4NC0B 4PJ8C 3T1FA 4OZIF 4G5ZL 2YD6A 5DRNB 5DXWA 3BP4B 4EN3D 2V5TA 3X14B 5J11C 1A1NA 1ZGLA 1IFHL 1C1EH 2DKMA 2O61B 3GMRA 3BN3B 3QXAA 4W4OC 1N4XH 2L7UA 1FZOA 2YUZA 4Z7OE 5HYQA 1OAZL 4P3DA 1BJ1H 1KN2H 1MRFL 4PRHD 1JFQH 5F89B 3GNML 5BOPA 4QXGL 4S2SA 4H1LB 3RRQA 1JGLL 2XY1A 4G42A 1T20A 4R2GB 2NY2B 4HXBH 1XIWC 2XIDA 5CGYD 1BVLA 2KBGA 3P4LA 5I8EA 5I73C 4N1CA 3U30C 5ACLA 2M2DA 4JM2B 3WLBA 3QJHA 2OL3A 2EXWC 3CFBA 3PNWB 4GRWH 2NY4D 3ARBA 4IOIB 3BGAA 4X6EB 4XMPL 5ENWA 3LKQA 2WWKT 2FEDD 3FT3B 1BIIB 2XG4A 4XWGH 5E03A 1CDBA 4PJBF 1X5KA 1Q94B 4Y4KA 3W82A 3ELAT 1J12A 2YRZA 4QTIL 1W0YT 3IDMB 2VXQH 4NGHH 5E2TH 2R4RL 2A2QT 3CFEA 3D39A 5I75B 2FECL 4HX1A 2H2PD 4P59L 1YEFL 1RUML 4X80H 3P9WB 8CGTA 1JPTL 4ZO7A 3SDDB 2KZWA 2LU7A 1A6PA 4Y4FD 1CE1H 1UC6A 4PV9A 5CS7A 2ICWB 3I6LE 1H0DB 2HG5A 1NAMH 5DD5H 1NCTA 4ODUA 5I1CH 1G1CA 1L7TL 3CFKA 3PIQA 1FG9C 3CVIL 3VD5A 2EEBA 2R0WL 2X1WL 1M05A 5IHUH 3FFCA 3RGVA 2EDXA 5JNYB 1R3JA 4R4BB 4WUUE 3BP7B 4I48A 3CX5J 4XNQB 3UXFA 2NX5B 4P0DA 1FE8L 2VB5A 5D7KD 4PG9B 3OHXB 3ARGB 1MCOH 1KB9J 2X4TB 1IAOB 1C16B 3E6HB 3IDXH 5DUPL 3UYRL 3MUHL 1V7ML 5IW1B 3CSGA 2WAHA 2X05A 5EU3A 5K9JH 4MD5B 3BHBA 5HHME 3QUXD 3PV6A 3FN3A 4WW2C 5TFSH 2CH8A 2NXYB 2I60L 2GK0A 1YY9C 3EYFB 4Y0GA 5EC1B 5D1XC 4XVSL 1CE6B 1LO0L 3S3SA 5J8OA 1F3JA 1MRCH 3P0YL 4H26B 5BRZD 4J3SA 2BHUA 3T77B 1CGUA 3NFPB 3T0XA 3HI6H 5B8CB 1JPSL 4ONHB 3T2NH 4JQXA 1W0WA 2HA1A 4RBPH 5CLWA 4WNQA 3HNVH 4BUGA 4EBQH 5IG7A 5I71B 4LSRL 1QRNB 1J1XL 4Y5YC 3ETBF 4JFXB 2HLFC 2X41A 4PJXE 5KSBE 3R0NA 5F9JB 4N90E 1M71A 1I9RH 4XX1E 3MJ7A 5DQDH 5CBAB 2IBBA 4HPOL 1U36A 5CEXA 1UJ3A 3K3QA 4HSQA 4YGVA 4JFZL 4NN7B 2R56H 3Q1SH 1OAZH 3IS0X 4FP8H 2XTJD 2GCYB 3QFDB 1P7KA 4KUCF 4RZCA 4K71B 3H0TB 4ODHL 3C2AH 4NQUA 2Z92B 1RHFA 4XZUA 1R3LB 3LH2L 3QQ9D 1QQDB 1UGNA 2AJYL 3AREB 2EEDA 2NX5D 4U05A 3WJLC 2G9HA 4OAWB 4OLEA 4PRPE 3H9SE 2FIKA 3VH8A 5D7LA 3DUSA 2HP4A 2GI7A 3WUZA 5FDWB 1G9MC 3ZKMC 1B0RA 1FV1B 1VEOA 4WFFE 1MFBH 3L3JA 4WU5A 4XWGL 3NIGF 5TDPA 1V05A 4P4KA 1RFDH 5C1MB 1JGDA 1ZLVH 2BVTA 1R3JB 3T04D 3ZE0F 2DAVA 3OGOE 1AO7E 5JHDD 3AGVA 2NY6C 4DVRH 4R3SA 4QTIH 2ESVE 3ZE1F 1IGMH 3MZGB 2IGFL 4M4PA 1RZ8A 3WFDH 3U4BH 1AHWA 5BV7H 5CJOL 1ZTXH 2VSDA 4G6ML 3BMVA 1KCRH 2R1XB 3KPQA 3WDIA 3DVGB 3IF1A 2FYYB 2Q6WA 4QNPF 3CGTA 5T33L 4P2QB 3H3KA 5ETUB 3C87A 2Q6WB 3RNKA 5F3BB 3NAAH 2HJKB 3ARPA 4OCSL 1IL1B 3I2CL 3SDCB 4OCNC 1A3QA 3MV7E 4EDXB 3MLTB 1OAQL 3ZE1E 1F3JB 2XYCA 3QT2A 4HD9A 3HFML 4ODTL 1BJMA 3HI1A 5HHPB 3ZSTA 5CCKH 1VEPA 1MWAH 1WISA 4W68A 5DD3L 2A38A 4QT5A 4FQ1H 2P1YA 4MQXC 4PLKD 2XQYK 4YXKH 1UVQA 2XA8L 4M62L 5DMGD 4DAGL 3GMLB 5GGQH 4TTDD 1BFTA 1Q9WB 5BZWB 2F74A 1NUFA 5JMOC 1CXLA 3L7FA 3GFUA 5AYUL 4NNPL 4WI8A 1BQSA 3C6LC 3LAFA 3PWVA 1PZUB 1CLOL 5HPMA 3KLDA 3PGFH 2I26N 3EDKA 3T3PF 1GVIA 5DJ2A 2VDOH 5CEZD 1G6RH 1HH9B 4PJ5A 5C0BE 5C0IB 3SKJH 1KTLB 5IGXL 6FABL 4ZO9A 3UO1H 1TETH 3RPIA 3MXVH 4GG6F 5I1HL 3JWOC 2ZNWA 1BIHA 1KTDA 1FC1A 3WSQH 5D2LA 2FHFA 3QI9C 4GXUN 4XP9H 4G9FE 5FGRA 4J3WA 1JMZA 4HUVB 2VN7A 4KMTH 1DQTA 3T8XB 4FQHA 1TCRB 4PP2A 2Z93B 3HB3C 4UUJB 3BZFA 1FCGA 3FO2B 4GW1A 5DJZA 4MQ7A 3CZFA 4QRUB 4JANB 4AY0A 3CAFA 5LXGL 1D6VH 5LXGH 2R4SL 2GJ6E 5I0DA 3DYOA 1B88A 3SQBA 1VFOA 3L5XH 2Y7QA 3LDBC 5HHXL 1SEQL 3H7BB 4LCCB 3T2NL 2AJ3A 3RGVC 3GHEH 1RPQA 4PG2A 4QYOA 4X4ME 5EORL 5D1QD 5I1AA 5F21B 3ZMRA 4P48A 2W1NA 1EUUA 5HJ3A 3HPJA 5GGTH 2A73A 2BC4B 5KJRL 2FCBA 3EFDL 5MI0B 2FZ3A 4YAQA 1ZT4A 2C1OA 1PQZB 2IH1A 4JG1H 4PUBL 1MY7A 3V6OA 3KJ4C 5DR5L 4XPFH 1WIUA 3QIWA 3CU1A 1ZT1A 5JOPD 3FQRB 4PLOB 2OBGA 1RZ8B 3D0VA 5LQBH 1N6QL 4H25A 1P84K 3VA2C 3R1GH 4HPOH 4KZDL 2AK1H 4Y4KC 2PXYA 5I1DB 3UDWC 2R2HA 4K8RL 3WE6B 4I18A 4NPYA 4XNYL 3MMEA 1CGWA 2QHRL 3REWB 4FFWD 1CCZA 3BZDA 2GUOB 1QBBA 3WXVH 3C2AL 1J9CT 1F4WL 5D6CA 5ABDE 5IFJA 2PUQT 2QV2A 3I9GH 4P9HC 1XIWB 2B39A 4RGOL 1BBDL 4P5TD 1XIWA 4HWBL 1VB9A 4APQC 3SDAD 1X5GA 2JB5H 2AK4D 4TSBH 4MA3B 1MUJB 1I4FA 2J8UF 1RZ7H 4Z8FL 2XFXA 3BZ4A 4GBXD 5C0EA 3STZB 1XGTA 4RDQF 3G6AA 2IBZY 4RQQB 4L3EB 1EBPA 3MYZA 5GGSB 3VXSA 2C7UB 4WY7L 1FDLL 3DX8A 1D5BA 3CDCA 5J3HC 1PD6A 3VFVB 1KV3A 1NFDB 2XWTB 4UILL 3WIHA 4PJCB 5LGJB 1TTGA 3EJZC 3U36B 1I7ZA 3TH2T 4DW2L 2NZ9D 4L3CB 1VENA 3G9AB 5CAYB 1YYLL 4GLRI 4PPTA 1CFNB 4Z7NF 4ODBD 2C3WA 1WBXB 3PWPB 1UXSB 2NR6C 2X6MA 1VFBA 3GIVB 4G6FB 5DEZA 5FGCE 3P0VH 5F3HB 3PHQB 3QEGL 3I75B 2YA2A 1IGFL 2MKWA 2OP4H 3QSKB 3SKNB 3T2PA 1MQ8A 5F70A 2XV6B 3FO1B 5ANMA 1FN4B 3WD5L 4JEGB 1QYGH 3W2DH 4DK6A 3CMOH 5I6XC 3TH3T 1EMTH 1H3VA 2CR3A 5JXEA 3CX5K 4KXZH 2DJ4A 3O6LH 5CKAA 2M8XA 4NKMB 3CSBA 3TA3A 2D3VA 4BUHA 1BFVH 1YC8A 3ULUH 2EDTA 1DLHB 3DJ9A 4P2RD 2YXFA 2Y5TB 2MPAL 5MEND 3O6MH 3L7EA 4Y4KD 5KVEL 4GRWF 2OTWB 2DWEB 5I1GL 4RISL 1LDSA 2DLEA 1GSMA 1UM5H 4Y5XA 2VDMH 3BAEH 4R7NA 5L7XH 1S9WA 2BSTA 3GMOA 5CP7B 1FC2D 4MA1B 5HY9B 2CGRH 3FT2A 3S35L 1X3DA 4CBPA 1UJTA 1FIGL 3IGAB 1FIGH 4HDIA 1RURH 3KPLA 4R96A 1PLGH 3VXMD 4OSUL 3CFKB 1TVHB 3PIQB 4FFVD 4L3CA 5ALBL 3IXAA 5L6YH 4PJ9A 3OR7A 5GRJH 2D7OA 4ZODA 1I7RB 3ARED 4G5ZH 3RWCB 4DKEH 3KS0H 1UXWB 1MJUL 2DJUA 4URTB 2UVFA 3SKNA 1DN0B 5IHBA 4WU7A 3ULVC 4P5MB 1KN2L 2H9GA 1CU4L 3JV4A 1NLBL 3BQUD 3F7VA 1CFVH 4XH2A 5F6IC 3LMJL 1KGCE 1LO2L 1G7LA 4U1JB 3SKMB 2P5ED 2A6DB 5FUZH 4OB5L 4X6CB 4NRYA 4X6CF 3QUXB 1DN0A 3EOTH 4R26L 1PKQA 3ULVD 5T3XD 1EEQA 1DANT 1F4YL 3P9LA 5IB5B 3VWJA 5E99L 5A40E 3GO1L 1T5XA 1B9ZA 1KG0A 2X1XR 4WO4D 5EO0A 3DUHA 3MRIA 1UM4H 4NUJA 4CN1A 1I1CA 4XMKH 1GGIL 5IFAL 3IGAA 1G7PB 1Z2KA 2VXTL 4N5UA 4IEFB 1QD0A 4WI4A 1WJ3A 3LQMA 4N0YH 2VLLA 4YHIB 4S2SB 2GITA 3OX8A 1LNUA 2FH6A 3GHBL 5JUEH 3HR5A 4XGZB 1FSKB 1Y0LB 3OKEB 4FQIH 5EO0B 3VE0B 2BSSB 1TXKA 1T89C 5IB4A 1E4WH 1Y0LA 3OKEA 3QIWD 1JGVL 3M45A 4MNQA 4WTZA 2FX7H 3FB6B 4YR6A 5HI4C 1OM3H 5AG8A 2R2HB 2VLLB 1F58L 1PG7X 4WFEE 5C0JB 4CMMA 1KFAL 1ZA6B 4HAGA 2G60L 4L4VD 3H0TA 1PAMA 4HH8A 3F58L 1GYAA 2VUYA 1RIHH 4J1UB 2LTQC 5GISH 3QDAA 1RMFH 1FGVL 3GIVA 5L8LB 3EDEA 5DMIH 4JLRB 1HHGA 3PGDB 1NC4A 4NJAL 3RDTD 2ATKB 3S5LA 1FFQA 3LDBB 4NZRH 4L9LB 3D18B 3U7YL 4BZ1H 5I8OL 1XR9A 4G6AD 4PB0H 1AP2A 2QHLA 3QCTH 4UT7H 4N0UE 4D3CL 5I30H 5I19H 1HQRB 3QUYA 4WUKH 1A21A 3E1F1 4QCIB 3GMMA 3VRLF 1T20B 3PJSB 3O2DL 3S36H 5HDBE 5HHXH 4WU7B 4M6NH 3QFJD 5DQJB 1GL4B 3GMQB 3NCCB 2XI9A 1BWWA 4JFYB 5JIPA 4NKOA 4AEEA 4G8IB 3BDYH 1NC2A 1P4BH 3Q5TA 2NMSA 1B4RA 4QHNB 3SY0B 1TITA 5D7SL 1K3IA 2ICWJ 3P4OB 1WEJL 2IANE 4DK3A 3KR3H 4N8PA 3DMMB 4HDIB 5D2NC 3IKCA 4P2OC 5DC0A 1QRND 1VESA 3VW3L 5A3ID 1U8JA 2JJWA 3KPMB 5DVMA 1PZ5A 5J6HB 3TYFB 1G0YR 2NY4B 3T4AB 5E4IA 5AAMA 4HT1H 5EU4B 2OSLB 2E8YA 1U0QA 4X7SH 1JWUB 1E28A 3VWKC 5J1TC 3Q1SL 3B9KB 3TO4C 4HS6B 3B2VL 4KY1L 2BVYA 2H45A 1HXMB 3HR6A 3KJ6L 5FB8A 3GRWA 3QWRA 4PFEA 1CBVH 32C2B 1V3LA 1NBVH 5E6ID 1ERNA 2E6PA 8FABB 2BY2A 2V5YA 4QCIA 1CQYA 4MCZB 4U1IB 4U1MA 4XI5D 3TN0D 3HUJF 3L5WB 2EE2A 3L95A 5CEYA 5E9DE 5C2UB 4DWHA 4R97C 5BVJB 1CT8A 1E28B 1J8KA 3F5WA 2FR4B 4J7RA 1BOYA 1LDPH 1WWCA 5EUOB 4EXKA 4EZMA 5DQ9A 5IVXB 3GSRA 1AY1L 3D48R 4LQFH 2N1KA 2NY5C 1S7QA 5C09E 4WRLA 4ZDHA 3SJVA 3TIDB 3UMTA 3MX0A 1IMHC 4M93C 4QWWC 1HHIA 4KKBC 1IGTA 3UZVB 4B41A 3IKCB 1B4JL 3AMKA 5K9QI 5ITBL 4XRCA 3MRQB 2DQIH 1A9EA 2X4NA 4NQDD 5AWNL 1A2YB 1PYWA 3BUYA 3ARDC 1KACB 4Y5YB 1KTKE 4O5LL 1A9BA 1JP5A 3OF6D 5F93C 2BFVH 2ICEA 5GZNC 4BKLA 4QHMA 1GOGA 3VGAC 4WVRA 1X4XA 1BVKB 5F9DC 3WEXB 4OZHA 1QBLH 1HH6A 2JK5B 3QULB 3A6CH 4NN5C 4UIKL 1MNUL 5IOPB 4UIKH 3TIEA 3MJ7B 3GKWH 1BQHA 2G5RA 2VL5B 3IVKB 3RHWF 2CDEA 1K6QL 5J3HD 2QR0A 5M94B 2VH5H 1WZ1L 1IC5H 1OARH 3IFNH 5F1NB 1OP5K 1K4DB 3TYGL 3TCXA 3FKUS 1MCOL 3ARXA 4OZ4B 4B7IA 3BN9C 5BW7A 5LVEA 3MROB 5I8KH 3UPRB 2EXYD 5JPNB 2XA8H 4XCEA 4GO6B 2DI7A 1XT5A 1ND0B 3QQ3B 3BWAA 1UACH 1OGTB 2CR6A 2X89D 3I85A 5B8CC 4RISH 2VZVA 3QHFL 3MMEB 3LN5B 5FUCE 5KVDH 2BVPA 4PRPB 1DL7H 4PLKC 2ESVB 4AH2B 3KG5A 1JWSB 3TNMB 2VQ1B 4G43A 6FABH 5HTSA 3EOAA 5JXAH 4JFXA 1W0VB 5GSRB 5DC9B 5GS3A 3NA9L 3BP5A 3V5DA 4S10A 3LKPB 3UPCA 1LEGB 4FFWC 5E6ZA 3PDOA 3D0LB 3QQNA 4AENA 5JDSA 1RZFL 2D0HA 1DSFH 3C60C 3FFCE 4WTXA 4NSKA 1WICA 5D1QB 5CBEB 2JJSC 5HGHA 4Y2DC 3ARGC 4S1SL 5IW6B 1RU9H 3BE1H 5BXFA 4GBXB 4WDIB 4Y89A 1KB9K 2UZXB 4Y4HD 1JPFA 5T1MA 1P5UA 4M6NL 5DI8B 3AREC 4DCQA 3ILPB 4WENB 1GGCH 1KC5L 3VI3F 3TNNB 3S3JA 3FZUD 4FFZH 4RFNB 5HHVL 3GSNB 4JFPB 3MCLH 3T4YA 2G75B 3X3FL 5JLZA 4PUBH 2F58H 1FFRA 4MXQC 4CDHA 2W9DH 4UZGA 1KNOA 3LPGA 3BPOB 1FVEA 5GQBA 1YEDA 4LVOB 4OGAC 3WN5C 3L7EB 3MRQA 1YNTA 4LP4A 3HZVA 3OG4B 1F4XL 3VW3H 1AD9A 4TVPL 3FQUA 4F57H 4ENEC 4MJ5B 5ID0B 2PKDA 1A3LH 4X7CC 3UYPA 5HGBA 2IMNA 2JTDA 4KQ4H 1A7OH 1FNLA 2FX8H 4XP1H 3RWHB 1CXHA 3CCHB 4WWID 3WEXA 5GGRA 3CUPB 5DFVC 3G6JF 2XZQL 1RJCA 4M8QA 2AABL 3HZMA 1I8IB 3PQYA 4FQJL 1EO5A 5IVOA 3BGMA 1I1RA 4XCCH 3OPZL 3KYKL 4OCYL 4XPAL 3PABA 3EYQD 4KDWA 1A1MA 2NY2C 1CICD 5IJKC 1QRNA 3U4EA 2QQQA 4P23C 1MY5A 2HLFD 3MGOA 3FQWA 2Y36L 5IBLC 3IFPB 2VQUA 3BIAX 4RA0C 1WWWX 2MWCA 3RZCB 3V0WH 1NUDA 1A6TB 3QUYD 5GS2D 4LEOA 3UJIL 5C2BL 2AV1A 3MGTA 3V6FB 4Z7WA 4HFWA 3KYAA 1MHHB 1MFAH 2WP3T 3GM8A 2WWKO 4PJGE 4M5ZL 3TT3H 4M7LH 4XXDA 5LGKA 3OKKB 4MWFB 4PP1D 1KLUB 3U48A 2B2XH 2B2XL 1AD9B 1I8LA 4RAHA 4W6WB 2OI9C 1OAYH 4O4YL 3MREA 1TZHB 3BW9B 2QSCH 5FO7B 2ZSVA 1I9IL 1S7VB 2FIRT 1W72B 4JN1H 1AGDA 1MPAH 2C3GA 3QXAB 4BZ2L 4JDVA 3V4VH 5IP4A 3G5ZB 4JCMA 1HQ4B 3P77A 2WUBH 4XNMB 3IDNA 4JAMB 3ECBB 4CADB 4FMFA 5HGGS 1OD9A 1U9KA 2P43B 4XAWH 4K8RD 5L8JB 1IC5L 3IFNL 3RAJH 1G6RA 5C0BD 5I66B 4NPYB 1JZ8A 2IG2H 4U4BA 5D7SH 4D94A 4R3SB 3CJJA 1JF5A 5F9JA 2CK2A 4K94C 3HPLB 2YWZA 1AXSB 2VC2L 2PTUA 4OUUB 2EYRB 1GZPA 1IEBA 3DROA 1DZBA 5K9OB 1F90H 2W60A 5JOFB 2NY0D 4WFGD 1TZGH 1FZJA 4D8PB 2VLKE 1X5IA 3HI5L 1A6TA 2BC4A 3GI9L 4EUPB 1G9ML 3QNZA 1CDGA 1DUZA 3MLYL 5D71H 1FNEB 3S35H 4C54A 2Q87A 1AO7A 2B4CH 3SGJA 3ZZ1A 4HUNB 4LF3B 4WWKC 1DQDL 2DQUH 1ZWIA 5HHMD 3NH7L 2G2RB 3QO1B 1IGJB 3DROB 3RWEB 2EH8H 3IDIA 2CLVB 4X6DE 3WS3B 5DZLA 3BKYH 5GRVK 1D9KC 5KW9H 5FF6A 2PETA 1CGTA 3HE7C 4NRXB 3MGAA 2VLKB 2X7LB 5JTWA 1OPGH 1SY6H 3QDJE 4TSCH 3RZCC 3WFHB 1TJIH 1BQUA 3N1QC 5CP3A 3V9FA 3U46B 4NO3A 1N8ZA 3EYVA 4KK5C 1AJ7H 1U3JA 2VNCA 4OF0A 5D7JB 3ARRA 4XMKL 1MCBA 5D1ZD 3TM6A 4KJWD 1OT2A 4MVBD 1N5YH 4BYHA 2Z8WC 1YNTB 4F7TB 4XP4H 4P46C 4XWOD 5FKPA 3QQ4B 1G0DA 5FFLA 3WHE0 5ITBH 5BXFB 3PWUB 1X5YA 1MI5A 5HI3C 1T03H 1XGUB 1QR1B 4LPCA 3I6LD 4UOW0 1Q1JH 5HVHB 1CLZL 3R06B 5IROC 1QR1A 1ZVSB 4X7DC 4G8FA 5J11B 2VXUL 5DJ0A 3VRIA 4H8WH 1EEZB 3RVWD 3PV7A 2K1MA 2VIRA 2VXSH 3ILPA 3ZYOA 3PWNA 5HI5D 3WLWC 1FYTA 4DKFL 4I77H 1S9YB 2DLTA 2P5EA 2DQJH 5TDOB 4GXVL 3IDMA 3P4NB 3LZFH 5CD3B 3DX7B 4NQEE 2UZYB 4A2LA 1EJ6A 2DTMH 5C0DB 1UWXK 1UZ6E 3CSYB 3GI8H 2RB8A 1UM6L 4X98B 4YC2B 1S78D 1PKQB 3BFOA 4HIIB 4NQXB 1OW0A 4FQXC 5D2LB 3SDDC 1JZ2A 1OCWL 4WW2B 4JFDE 3KXFB 2OS7A 5T3ZE 3BPNC 1C8PA 1GGUA 4HZAA 1TQCC 5J9PA 2QSVA 1MFEH 1I75A 4GAJH 5JIHA 3VCLA 1ACZA 3TVMA 4Y2DB 2I60H 1QVOA 1L6ZA 2VITA 3NCYP 5FHAH 2ED8A 1FE8H 3B8SA 4UV7L 4HIIA 2W0FA 1JE6A 4NQED 5FM8A 4YHNA 2UWEE 4H8WC 1X5JA 3ZTNH 1MFCH 4UB0H 4R7NB 3HI6L 4LBEA 4PRHA 3AVEA 4PJHF 2W07A 5C0AB 5ADPL 4UINL 1DEDA 5EDXA 3ULUL 4CVXA 1JHKH 5GPRA 5DZNA 2G9HB 2P5EB 4TRPH 4NO2B 1Q8MA 1LWRA 4RRPG 4ZUUA 4L8SC 5FCUL 1S7UB 1I7UB 2Y06H 1GZQA 4ERSL 2V2TB 2BCKA 4OZHB 2VLKD 3CFCL 3FRPA 5ICXB 3IDNB 1F45A 3O6KH 2QQLH 3MV8E 4XBPA 2ARJA 3KPSD 1ONQB 4ZXBD 4TN9A 2R69L 1J18A 1I9JH 3TT1L 5I9QC 2ENYA 3NPSC 3JV0A 1FGNL 2AJZA 1D5XA 4HUWA 3UTSD 4X5XB 2DQDL 1DFBL 4AEHH 3D87B 4MAYD 3ZT6A 3VCLB 1JHLH 3MRBA 3OZ9H 4CNIA 4M4RA 1OF2B 1ZLUK 5BQ7A 1IM3A 2J7LA 3GDBA 2AW2A 4RAUA 3WFHA 4FFYH 2P5WA 4UAOB 2Z35B 2X89A 4KY1H 1U3HA 1E6OL 1HSBB 3VXUE 2DMKA 5F8RC 3HKFA 3A6OA 5FYKL 5DJCA 3RWEA 2NY3C 4QO1A 2DIJA 3C5JB 4DOHE 4NQSB 2IPUG 1FIEA 1KPUB 4JO3H 1YUHA 1D5IH 3WKNA 2H41A 5H37H 4RFNC 4NCDA 1SMAA 5DMKA 1JZ3A 5E7FA 3KYMA 4YDIH 5CJOH 3CX2A 1WCBA 5GZOC 5F7EH 4OLZH 4UMGA 3QUZA 1RUQL 2HFGH 4NJ9H 1JYXA 4KI5F 2G5BB 4JG0H 2EYSB 1ADQL 3RWDA 5EZJA 5KSAD 3MUJA 1ZEAH 4DCQB 1QVOB 1YEIH 3MA7A 1QSFE 4NFDA 1YQ2A 4G6KH 3HFMH 4R0LB 2E5EA 4IDLA 4Y2DD 3LPWA 4AMKH 3DYPA 1MCRA 4MB3A 5FM5M 4PJHA 4P3CH 3LQAL 3QH3B 4HUXB 3RJDA 4KJWC 3TJEH 3ARDA 4PJAB 1JNJA 4RMRA 2XNAA 3N50A 4GMTH 2WINA 1G7QB 2JIXB 4P4KD 5FUCC 1ES0A 1A6ZB 4HS3B 1CK0H 1BREA 3HC0B 1ORQB 2ED7A 3EDFA 2F5BH 3SKMA 2OZ4A 4PTTB 4JFOA 4R9HA 5H2BA 3CC5A 2J8OA 4OFIA 5I8KL 4LDOB 5ANMB 1U8KB 1YECL 1YEHL 4CVZA 4HK0B 4HS8L 4M7KL 1BBJA 2JIXA 4DGVL 4DAGH 4QRTA 3ULSA 2EIDA 2DQFB 5CJ8A 3TZVB 2IPTH 4S1SH 5BVPL 3KVQA 2P5WE 3OXRB 5AZEL 2J3SA 5DRWA 3IFPA 1K4CA 3BKCL 4GG8A 4FN0A 2NX5A 4KC3B 5A16B 4C59B 1HCFX 2H3NA 3IAGC 2D7QA 4M6ML 3FCTB 2Y06L 4ERSH 1X9QA 1M05B 1CWVA 1A7BA 2PYEB 4LPUA 4YLQT 1TCRA 4UNUA 5C9JB 3BPLC 3WO3B 2B1AL 5CP7A 3DIFA 1NGQL 4G9FB 1EHXA 1I3VA 1SY6L 1Y6NR 1R6VA 4JRXB 3BWAB 3MBXH 1AE6H 1NKRA 4JG1L 3GMPA 5TDNA 3BE1L 4R4FH 2E7BA 1T66C 5BS0D 4L8SA 5I0ZA 5ALCH 5IWLC 5T3XH 4ZUSA 4NO2A 4TPRH 2F19H 3P9MA 4KZDH 1PFCA 1IGTB 1A3LL 5LQBL 4G8GD 2DKUA 5IOPA 2Q76B 4OQTA 2WBWB 4OIBA 4IOFC 3PP4H 4NUGH 5E2VH 2CXGA 3QI9B 2P5WB 1KIPB 3O0RH 5KSBA 1AQDB 3MCLL 2XA3A 4WFHE 1PG7H 4LCIL 3O4OB 3TVMC 3WV0A 2GTWA 1UWGH 4OBSA 5DFTA 2EYRA 3ZSSA 1XGYH 3AU1A 3VXNB 2V2XA 1NMCC 4Z0BL 5E8EA 2LV4A 5D7IE 4L4TE 4NYLB 3VWJB 3QEQB 1YN7A 4E5XB 4OZGA 5ICZA 4EUPG 5KSVB 1SBSH 4JKPL 1SBSL 5DJ8A 5I1LA 1U8LB 4LNRA 4ZD3L 1NUNB 4OLVL 4YE4L 5T1KD 3RNQA 3DUUA 2AQ3A 2GKIA 3MLXL 4EI5A 2QADC 3OJDA 4PB9L 3PL6D 1MIEL 4FOMA 5ESAB 3ZE2F 2R1YB 2DIBA 4NHUB 1NCUA 3CSPA 4LSQH 4PTTA 1X5LA 2I07A 5DRXA 4J3OC 1DE4A 5EU5B 4G43B 2ZPKL 5DWUL 1FBIH 1XF4B 2DM7A 1WFTA 5TGBB 2ZCKL 4FXGA 2EECA 4X9BA 5FO9B 3EO1B 1OY3B 3MR9B 5FGCB 3VGDA 3O2WH 4QRRD 5GGSY 3O2WL 3HLAA 4NRZB 1UYWH 2OMNA 4GSDH 3EO9L 3K4ZA 1WCBB 3WD5H 3W2DL 2XRAH 5DTFA 4Y4FA 3RX5A 5LWYL 3S8WA 1IGFH 3NOIA 5HYFA 1SHMA 4H1LH 1AD0A 4NCC2 5TGBA 5CSZB 1EFXB 2MHAA 3GRWH 4KQ3L 2PW1A 1JHKL 5EN2B 1A14H 1MJJA 2BSED 3MGOB 5L0QC 1YEHH 2DQTH 3CVHL 2BNRD 4ZOAA 3PP3H 35C8H 4ZNCD 3T2OA 1YYMH 3VFVA 5DJXB 1HHKB 4P9HH 1FJ1A 4KTEH 5CILL 3VXRE 2XNAB 4HIEA 4DKDC 4L3AA 3B5GA 2R0ZH 4V1DE 3NZ8B 1RULL 4XPBL 1D9KA 2GSIA 2OR8A 2PN5A 3CCHA 4XXCC 1OAKH 4RCAA 5AG9A 2BY3A 5E8DH 4HKXB 3T0AA 3TO4A 4OJFL 2B5IB 4EDXA 4I2XB 3VWKA 4HC1H 3GSQA 3ROOA 2GK0B 4QXWA 1HXYA 5HGAA 1I8MB 2BK8A 1B6UA 2N4IA 4MQSB 4OZIB 2X9YA 1WBYA 2P7TA 5IV2B 4UIMB 4G6JL 5SX5H 3T4YB 1S7WB 5MHSD 2B20A 4K3EL 4FFYL 1C12B 3ECBA 4J4PC 4CGTA 4PJ9C 3VFSB 5IKCA 1CLCA 2FGWH 2GITB 1EFXA 2ZUQB 1CQKA 1F6FB 4OT1L 4FXKB 3P9MB 1CXKA 2JF1A 4K9EC 1MJ8H 3QZWG 3FO9B 2BSTB 3GMOB 1FL3A 3BHBB 3CLFL 1LO5A 4X8JA 4Z7UE 1UJ3C 4YHOL 2PCPB 3SN6N 4M1CD 3BO8B 1Q1JL 1U92A 2XKNB 4K3DL 4ZFOL 4QLRA 3UJTH 4AIZA 1KCRL 3BD3A 1TJIL 4OFDA 4WHDA 1NLDL 4IRZH 1EJOH 5IFAH 1MCSA 4U6YB 2Q8AH 2EE6A 4WUUB 1JNNL 2EDYA 4PJBB 1ADQH 3H7BA 2ZOKB 3C09C 5F88A 1M7XA 4I2XE 2BY0A 1FL6A 1S8DA 4HMDA 3TJHC 4Q9BA 5GJSL 5MEQB 3ARFA 1N3NB 2RQ8A 4XNZB 5ADOL 3O6FD 5HGDB 5CJQH 2LAGB 2CLRB 1NFDA 5CBEA 3KXFE 5C08D 4DJMA 1T03L 2P8MB 1EGJL 1FAKT 1JRHH 5KS9B 5INDB 5D1XA 3BPCA 2HFFA 1CFNA 3MXWL 5D1ZA 4NRYB 2VXUH 4P5KB 3SE3C 2W60B 2Y07H 4QHKJ 3VXNA 5IHUL 5BZDB 2MQ3A 3UJJH 1WFNA 4LSSH 2VR9A 3ORJA 2YMXL 3BQUC 3GKWL 1J7VR 2O5ZL 2YKLL 2O5ZH 4JCLA 2NY0B 3SGDI 5FKAA 3O4LD 5DFWH 3UO1L 3V4UH 3QDJA 3ZTNL 4M7KH 5CWSB 5CD5C 4GW4B 4BZ1L 2G75A 2DBLL 2OZ4H 4JY4B 4OLWL 1RUAH 4AM0B 4O02L 1BVLB 3NABL 2X1QA 5F7KC 1UZ8B 2ZUUA 5H94A 5FOBA 1OAYL 5EIVA 3QUMH 2YD7A 2VDPL 4WFFD 3VFRB 1CFSA 4ALAH 1L9NA 1X5FA 4N0FA 1AR1D 3BXNB 5TE6L 3V7AE 4WCYL 3V4VL 4PJ7F 2M1KA 3CFCH 2MNUA 4GRLD 3HCVB 5H35B 1JPSH 5K59E 1DVFB 2VLJD 3MLWH 3MV8B 3O3UN 5FCSH 3BUTA 1A6UH 2R39A 2HMID 4LPWA 1WFOA 4QTHB 1IGCH 1V7NH 4DVBA 1H5BB 2BDNH 5CUSL 4HC1L 2WWMD 1FRGH 3HHRB 3PJSA 3DTXB 2QQKL 1VGKA 5E2JA 4C58B 1KJVA 2GSGB 4I5BA 4GAGL 1HKFA 4ESKA 3L1OH 5HGHB 1MJ7L 1YQVH 1U8MB 4MMXC 2ID5A 5DQDL 3NGBC 5FM5O 1AI1H 3Q48A 2HT3C 3EAKA 3C60A 3DPBA 1N64L 1JN6A 4MDIA 2IAMD 3TT1H 2A6DA 1XGQA 3ZKMD 3KPSE 1QLFB 2DM4A 4H88L 4U7MA 4Y4KB 4H88H 1HHJA 2DDQH 1JHLL 1NGPH 4M5YH 4JO1H 4F9LC 5ISZD 5EC1A 4I13B 3IAPA 1P7QD 1U8NB 3ZKND 3W5MA 3JV4B 2QTEA 3U0PA 4KHXL 3IDGB 3D3VA 2ZJSH 3P4OA 1MLBA 3HN3A 3PV6B 4ODXB 1RI8A 4PRDA 3GUTB 4G8GB 3O3AB 1YZZA 1FCCA 3DVNB 1NBYA 1RZKL 5T1KB 3TIEB 4M1DL 1RJYB 4DKAA 5MENA 2WIMA 1E6OH 2W92A 2CRMA 4LAQL 5J57B 4BH7A 3CXDH 4R90H 3DRTA 1TVHA 4LHUG 4O9HH 3EOYG 2EKSA 2V5SA 2RGSA 2GJJA 2JE8A 4YDVB 3WJJA 3F7PC 1EERB 1MAKA 3I6GA 4J6RL 3OKLA 4XCNB 3LB6C 1JZ7A 3A67H 5EOQH 2A0LC 3MBEA 5MERB 4Z95L 2XQBH 3MGTB 2P5EE 1Z3GH 3E6FA 3V6FA 1FYTE 5AD0B 2K7QA 5DQ9B 4LHUA 4UI2A 1PX4A 2LVCA 4OCXH 5F9AC 3TESA 2XRAL 4OFKA 4JY5H 3VD4A 3HC3L 5L8KB 2IBGA 1OVZA 4X7EC 1FVDB 1Q0XH 4TVPE 5F7DB 3N9GL 3NIDF 4IRJD 5DJCB 1J0KA 4ZTOL 5KSUB 1I7TA 1XF3A 3O41A 3O6LL 3H7LA 4AEFA 4K94L 4BZYA 2GCYA 3P3YA 4XH2B 2R29L 5AEAA 2C1OB 1XR9B 4Z7WB 1VSCA 2H6PA 5BMFH 5F7LB 2GJZA 4I9WD 2HFTA 4HKZB 15C8H 4FTVE 1CG9A 1OTUD 1CLOH 3WNKA 5GS0C 4F7CB 5LKNA 1BFSA 5IBTH 3MA9L 4XCEB 2CK0L 4GRWE 1CD1A 4KRPC 1NGWB 3HTLX 5B38B 3H42H 3J7HA 4WJ5B 1ZLSH 2QQNL 4LL9A 4P4KC 4IJ3B 4L8BA 2FL5B 1KT2B 1JZ5A 3V95A 1ZVHA 2PR4L 2XN9D 4P3DB 2VXVH 4YDKL 4GW4A 1IAMA 2EH7L 3QPQD 1P7KB 4J3UA 3L3DA 4JY4A 3RWJB 4BSJA 7FABL 5DA0B 1RAMA 4BFIB 1D5ZB 1BGXH 4APQB 3QZWB 4OIIL 3KYMB 4CJ0A 3PL6A 3ULVL 3VFRA 3EYOB 2X4UA 3BOVA 3MZTA 3OGCA 5B4MC 5I17A 1G0XA 4PIRF 4GAGH 5K9KA 1CF8L 3T3PE 2J1KA 4UDTA 3TCLB 3RUGA 5C07E 4U1KB 5IW6A 5MP6L 5LG1A 3BKYL 3D1MC 5KSAA 1F3DJ 4NQDE 3SDXA 3X3FH 2BVOA 5KSBF 1PKOA 2E7LC 5IW3A 2FEEI 1CN4A 4NQEA 1W2KT 3QO0A 4LPYA 3MNWA 4EI5C 3N1MC 1U91A 3PDOB 4R8WH 4QT5B 2DDQL 4WFHD 3SKUD 4R4BA 1G7IA 3RHWK 4QXTA 4Z7NE 4Q9RL 2HAZA 3WUWG 1CVSC 3LEXB 1IM9B 2PO6B 3KHQA 1WWAX 4YX2L 5JHDE 3F6IA 2HH0H 5IMMA 1A0QL 2XT1B 5IVXA 4MHHI 4PR5B 5J6GB 4JQXC 2AK4E 5TDPB 3C60B 4YHZH 1RUMH 4HV8B 3B3IB 3LV3A 3DO7A 3GSWA 2VIRB 2HWZL 4M9OA 5JLZB 3WO4C 4KK9D 4L8CA 4M6OL 3L3HB 1FLRL 1QHOA 1UWGL 2W9DL 5ACZB 4KK9C 5D96B 5MEOA 1QPXA 4HCRA 1UA6H 5EBMA 4Q6IB 2X4TA 4ZYKA 1RK0A 4I3GA 3VFGL 4MJ5A 5F7MC 4P2RB 5FA3A 4F7PB 4LOUC 1T89A 1DQMH 1RUQH 5EIIA 3L3HA 5C0NC 1C7TA 5IWLA 4JKPH 5E9DA 3JV6A 4OCXL 5JHLH 2DM2A 3V4PH 1EFQA 1HILA 3TZVA 4EEEA 1A2YA 2OMBA 3FQNB 4XHJC 5CGTA 1MVUA 4E0RB 3QDHA 3O11B 1QR4A 1Y18B 5CP3H 4HAFA 4HG4K 3IJYB 2YBRB 2B7DT 3C08H 1MHCB 2OQJA 3AC0A 4YHYB 1V3KA 4P23D 4QRPB 3TJEL 3VWJC 3WIFA 1H5BC 4EDWL 5CD5D 4XXCA 4JPWH 1QFWL 1QZ1A 1FZMB 5JR1L 1U58B 3IYLW 1U8LA 2J5LB 3O2VH 3SBWC 1X4ZA 2P42B 2V6HA 4I4WB 1M71B 2CLVA 4PS4H 4PS4L 1MHCA 5EA0H 1A8JH 3PXHA 4DGIH 5IESH 2APWA 43C9A 4FQ2H 2HMIC 2AJUL 3I02A 1OP3K 4OUOA 1OSZB 1ZKAA 3G5VA 4Q6IC 1YYML 4DGVH 2ZOKA 2VQ1A 5FUOH 2BHZA 1NL0H 4XBGB 1A5FL 5F1IB 2WLZA 3M1BB 4WI2A 3IXTB 3SJVD 4KU1A 1NMCB 4BZ2H 4IDJH 4NO0D 3L3GA 5F1SA 5E24E 1ZHBB 4JB9H 3UTQA 5FXCH 1HOCB 2Q86B 1XCQB 4Y19E 4K3EH 1DBJH 2DWDA 4OCWH 1KLGB 4K55A 1ZE3C 1TIUA 4KK8D 5FIEA 5I8EB 1TENA 2D7TL 4G80B 3VGBA 4U6VH 1LK2B 4X7SL 5JPNA 4JQVC 5CSZA 2MCG1 4WJ5A 3MNVA 2I5YH 4D9LL 2PR4H 3LOWA 5HYQB 3WKML 3RKDD 2R2EA 1IJ9A 4YHOH 3U1SH 4G8FB 4C56E 1SEBA 4K3DH 3V8OA 4YXLL 4OIIH 1KJMA 2HRPH 2HRPL 1K5NA 4PLJC 3EO1A 1ZAGA 1U8HB 2I9TB 4WI7A 4HQQL 1DBMH 4ETQB 1A7NL 5FO8B 1KJ3H 3L3KA 2HKHH 3TA3B 5DRXB 4X6DB 5F6IB 3RI5F 1LO2H 1RZJC 3ARTA 5BJTB 3EYVB 5D72H 5IJKA 5JA9A 3RNQB 1YMMD 2F8XC 5IIEA 3SDXB 2X2YA 4WTWA 4TUKH 4OV5B 5JIKA 1II4E 5L9DL 4Y2OA 3C9NB 3GJFB 1ITCA 3F7RA 3QH3A 4X99B 4QOKB 4JFDD 5IB3B 1P5VA 3MJ9A 4K9EH 2HH0L 1XF5A 4LQFL 2UYLA 1GGIH 2YN5A 2DJSA 3JWDH 2C1PB 4K3GA 4ZOCA 3RA7L 2DQJL 1J1OH 3PABB 3MODH 1DBBL 4OZIE 5HD8D 3MODL 3BT2L 3VGAB 2FSEB 1D9KB 2GSIB 1GOFA 1UZ6F 3OJ2C 5E08H 4R6UA 1PKQE 5ADOH 5DJDB 4KRPB 2LABA 3MRRB 4HWZB 3SJVE 1KNOB 5E6IB 1W8NA 3K8LA 3F62A 5E00B 1RUAL 4YGAB 1BPVA 3C5SA 4GG6A 4LU5H 3WO4B 5EOCJ 2XTJE 1VKXB 1GAFL 3JV5A 1R3IH 2PW1B 2VLJE 3MA9H 4R0LC 2ITDB 1I1YA 3MLVL 1X5AA 1FZKA 4XVSH 4M00A 4Z6AT 2R9HD 3EO9H 4Z7VE 5DURB 4CAGA 4X7FC 2E6JA 4UV4H 4OGYL 3QRFM 1A6VH 4XCYA 5C6PB 2LTQB 1KPRA 3HMXA 2EEAA 1IILE 3O9WB 3JV6B 3VI4E 2IH1B 3OF6A 1IQWL 5K9JL 5IK3B 3EJJX 4IHOB 4PRDB 4AYFA 2AV7A 3FB8A 3U7WL 2H32A 2QL1A 2IAND 3SDCD 4KKAD 4PGCB 5JQ6L 1G7PA 3HUJE 2X4RB 2DYPB 4YHLH 1NAMA 3VRLE 4OCMC 4M03A 3LEVL 4E42A 5E8NB 4LSUL 1ETZA 3L1OL 3MOAH 5F96L 4WO4B 2NY0C 1T21A 2ORBL 1NMAH 4YFLF 1F6AB 2J6EL 5C7XH 3GK8H 5KVFH 3HZYB 3F5WB 2JCCA 4FABH 2FR4A 3DV6A 3L3OA 3MFFA 4JM2C 4LSTL 3BZEB 1Z5LB 3W11C 5IT2L 4X9GA 5K9OA 2EIBA 3W11D 2MQ0A 3NPSB 4E42B 1S7UA 4H26A 4X4MA 4RNRB 5JA8B 4XPFL 1DCLA 1OLZA 4U3CA 3PGCA 3EDDA 4F7EA 2GQHA 3SE4C 1MCPL 1KXQE 4P2OD 4XZUB 2R1WA 2J88H 3OKDB 4JB9L 4UT6H 1CD0A 5EUOE 1JPGA 5GIRA 4HK3J 43CAA 3QI9A 3HMWL 4YBHA 1A6AB 1XZ0B 4P49A 3B4NA 3UPRA 1U95A 4Y16A 1KJ3L 2KQMA 2E7CA 1CDYA 3IXTA 2CKBL 5I1DA 2APXA 4ZUWA 2R1WB 2YD4A 4YHIA 4DUVA 4C56A 3GBML 1PG7L 2P45B 1QUNA 2H8PA 4LLDA 1OAXL 3MO1A 2N7BA 5JW4N 3MJ9H 1SJHA 4RAVA 4U7KA 1KLFA 3CDGB 4LHQB 2BRRL 2O5XH 3G5XA 3P73A 1N0XL 4G6AC 1RHHB 5DJ6A 5INDA 3JUZA 1H8NA 1K5NB 5CBAA 1I1FB 1KELH 3I6KB 3I2CH 1PVHA 3CH8A 5JDSB 3TVMD 4JJ5A 3SDAB 5JPMA 4NOFA 5MHSE 1RY7B 5CMAA 3RX7A 1T83C 4RA3A 2BSRB 1Q94A 4U3XA 5I6XB 4G6MH 5CSBA 4LCCC 2HLAB 5I15H 3UP1A 1BM3H 4CKVX 2CPCA 4BSVB 3PGDA 1T3FA 4WHCA 3V0VB 3SGJC 3UBXG 2L4OA 4FQXD 2OSLA 2Z9TA 3K4DA 4EN3A 4OLZL 3VXQB 5F7NC 3TN0A 2ZUVA 2J8HA 2ZCLL 3HMXH 3ZDZF 1J1PL 3V6OE 4RGNB 4ZFGL 1CK0L 2BNQD 5J1SC 1KULA 5C8JB 1RK1A 4KVCH 3JWOH 5GJTL 4PP2B 4UUJA 1RIVL 3O6ML 1L6XA 4LQ1A 4RGMB 1T0NA 1HHJB 4LARH 5EH1A 4OZFH 1A5FH 2VWEC 4HS8H 5SWZA 3CDGA 4WI9A 3U6RA 5HYSB 1MI5B 5DO2D 3QDGE 4PRIB 2VDPH 3UTSA 3ZDZE 2P7TB 3WJLA 5IV2A 4Y4FC 5ESQA 2HTLC 4FTVB 2MOVA 1F13A 4X6BA 3RZCD 3DMMA 3RVVC 3WCYA 2CGRL 4X6CA 5HVHC 3CNKA 3ROOB 1O7SA 2A74A 1BD2B 2GSGA 5J13B 4PRBB 4UNTA 2BJML 2VLME 3Q0HA 4O51B 1SEQH 5D93B 4OSUH 4P2QE 2ZSWA 4XP9L 3PQYD 2AJZB 4Y5VC 4ONGL 2F53E 4JN2B 1IBGL 4BKLB 1H3TA 5JQ6H 1OW0C 1NBYB 2FEDC 3SDDA 3IJHB 2Z4QB 3FB8B 3SPVB 3FT4B 4YXLH 2Z4QA 3EJYD 4J23A 4X98A 1XF1A 5E9DB 3TVMB 4Y19D 3BKCH 2UZIH 3NTCH 2ICCA 5JW3L 2EE3A 2ZZUT 5LBSH 3VD7A 1NFDE 1AJ7L 1QSED 3V8CA 4RNRA 1DBKH 1XR8B 1OQOA 3IJSA 4YPGB 1MWAA 1PQZA 1KIQB 1QKZL 2OJEA 1Y18A 4OF6A 1MCHA 1HSBA 1QFWI 4OT1H 1B2WH 1GHFH 4HIXH 4JPIA 4FQHB 1AGCB 3C5ZD 2C3VB 4ORZC 4F3FA 5EUOA 2JCCB 3VDCA 5F6HI 1EBAA 4X0KA 3MRMB 2FHCA 1KYOJ 2IALA 4MCYA 4M7JL 4X5WA 4UTAL 4TVPD 3CFJA 3DURA 5MI0C 1ULVA 2NW3A 2VAAB 4LASH 4U1MB 3FO9A 1EEYB 3MOQA 5F7WC 4R8WL 2ITCB 3NCFB 2A83A 3MR9A 5FHBL 4HFUH 4P46A 1F4XH 4PJDA 4G8EB 3FO2A 4GW1B 5DJZB 1NAKL 1VADA 3S97C 4DQOL 2V7HA 3SGKA 3D2UD 4XNYH 5I8CB 4K71C 3AAZB 2HRLA 4P2RE 2DM3A 3GHBH 4HUUB 3IRZA 4RZCB 5ECJE 1A6AA 1XZ0A 4HIJB 2VE6B 1IAII 3DUSB 3FL7A 1TVDA 3QG6A 1JF1A 4DN3L 5A3IC 4WY7H 5F1IA 3FT4A 3O0RL 4XC1H 4KGLA 4XC1L 1L7TH 1VDGA 5I1EL 1YMHA 1DDHA 1DUYB 4BA8A 1VCAA 4JR9H 3OAZH 3P0GB 4UQ2B 5D9SB 5TFSL 4F15C 4S11A 3WIHH 2ATPB 1HINL 1JYNA 2CIIB 3MLTA 4XNZC 2XACC 1KG0B 1HZHL 3W0WB 2XXCB 5C0RL 1A4KA 2X4PB 1T2XA 3Q3GB 5ESAA 4WWKA 4P4RB 3IDXL 3D85D 1NGZB 3WFBH 1KF9B 2AS5M 4POUB 4PRPA 3X11B 2E27L 2A6JB 5GGVH 3RU8H 1MIEH 3R06A 1F2QA 1R3KA 4UBDD 3NZHL 1JUFA 2QADB 1A7PL 4FQLH 1DBAH 1S7SA 4Q2ZA 4WFED 3CH1B 1H15A 3HZKB 5EU7C 1SJXA 4PJ5B 5C0IA 3MV9B 4L9LA 4TNVF 4OQ1A 1FVEB 3QR2A 3C9NA 15C8L 4E41B 3BWUC 4RDQG 3PQYB 1IGYA 1T4KB 5IKCB 4HIJA 5KSAB 4MNHA 3RWJA 3CSYA 5D7JC 3ESVF 3MCKA 2LU3A 3MACL 1PZ5B 1C7SA 1JF1B 4G7YH 5J6HA 2NXYD 3OR7B 1Q9WA 3RAJL 4FQQA 3M8OL 5JIIA 3BKJH 1BFVL 5HHNA 4MAUL 1JWMB 5I17B 1R0AL 1E4XI 3BP7A 2GJ6B 4OM0L 4KFZC 2BVQA 4YWGH 1LD9A 4FG6C 2DQDH 5FYKE 3ES6A 5IFHL 1RZGA 5E8PA 2IALB 4MCYB 5B21A 3IDJB 4YK4C 2YHGA 4H1LG 4LEOB 4KJPD 7CGTA 5E4EB 2OK0H 5CZKA 2DLHA 1QRKA 3RNKB 1T22A 1VGEH 2YK1H 1CU4H 3WXWL 2KUTA 3QAZB 2DF3A 1A4JA 4JFQA 1G7JB 1Q72H 5DI8A 4F8QA 1G9EA 2W9EL 5ISZB 4CVWA 3GGWA 3KJ6H 4WIQA 3X17A 5HHPA 3IJSB 4X7TB 5L0QB 4XCFL 3U4BL 3VXSE 3E2HC 3BIBX 5C0BA 3ZT5A 4YDJA 3VXOA 4NQVA 4BH7B 5I1AB 5DK2A 5E99H 3EZ8A 4C57C 3EO0B 4H0HB 4PJIF 4LCYA 1VACB 3WDJA 5FGBC 5DSCB 2C4FT 2Z0BA 3FQWB 3TYFA 1AY1H 1AGDB 1E4KA 1RJZB 2VAJA 4HQQH 1X4YA 3PWLB 2NLJB 5ITFA 1P4IL 3REVB 2AJVH 4LVEA 5JUEL 3LKRB 5I66A 2ERJB 4CVXB 4FZEL 5SWZE 4O5LH 4KUCD 3MV7A 4WEMB 3EW3B 5D5MB 3NAAL 3HR5B 5D5MA 2XWJB 1IEBB 4LCWD 1JZ6A 1I3RB 4Z7QF 1A9EB 2X4NB 5ICYB 2A1WL 1ZOXA 4J4PD 3IJYA 3UDWA 3WE6A 5DD0H 3AREA 5L2JA 4K3HA 3EKCA 3ARSA 4ZFGH 4NQSA 3FHQA 5GJSH 3TLRA 3LKNA 5B3JE 1KCVL 5E94B 4FQ1L 4P2OA 1KJ2L 2NW3B 3WYRA 1NQBA 4NP4H 2C9AA 3LS4L 1H3UA 1OM3L 1JRHL 4NQEB 3VXUD 2A73B 2X09A 4O02H 4OF3A 5D7LE 3I02B 3QXDB 3FQRA 1MFEL 4ZO8A 1IKNC 2SEBB 2F54E 4LSSL 5HDQH 1TETL 5D70H 4WI6A 3T65B 2VLRB 3VGEA 3CK0H 5E70A 2H2SD 1SVCP 1IT9L 3OGCB 3T1WA 1HYRC 1WLHA 3OJDB 1I1FA 5EORH 3L3KB 4EUPA 3DX8B 5DZOA 4NJAH 3B3IA 3LV3B 1DQQB 4O58H 2WIIB 2OM5A 2MQCA 1Z0NA 2APBA 5LCVH 1RZJH 1HYSC 3G5XB 3NABH 1UWEL 1UWEH 4PJBE 4WW1A 3QDJB 4HWEL