7PAZA

Reduced mutant p80i pseudoazurin from a. faecalis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTIHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSEUDOAZURIN
publication title Site-directed mutants of pseudoazurin: explanation of increased redox potentials from X-ray structures and from calculation of redox potential differences.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Electron transfer
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 1997-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 7pazA00
1BXVA 1AS8A 4DP8X 3AW5A 5A7EA 4CSPA 4AKPA 4WKXA 3NJIA 1E5ZA 5I6MA 5I6OA 1W6WA 4A2DA 2OJ1A 2QDVA 5I5MA 4AX3A 2PPFA 2XXGA 2GSMB 1PMYA 4TXVB 3WG7B 1OE3A 5AFAA 4A2HA 4UF7C 2IWKA 1DYZA 3TBBA 4F2FA 1JZJA 4DP9X 4GP8B 4KNSA 2YAHA 1A4CA 3ABLB 2DYSB 2H47C 2BW5A 4M3HA 4HIPA 1J9SA 1JVLA 5B1JC 5EHFA 1ID2A 3T9WA 2VSKB 1L9QA 1J5DA 3WKQA 3QQXA 4E9YA 4BDVA 2X88A 3ABMB 1BQ5A 2PCFA 2CAKA 4DP1X 1J5CA 2XVBA 4W9ZA 1SNRA 1A8ZA 2DV6A 3CDZB 3OD3A 2XWZA 3IBOA 4F2EA 2YXVA 3S3BB 3WNJA 4YSRA 3AG4B 3QJVB 3S8FB 4X4KA 1AS6A 2JFCA 1KCBA 5FC9A 4E9SA 1NPJA 1AG0A 1M9WA 5TK2A 6PCYA 3WI9A 2IDUA 1EZLA 5LDUA 4YSQA 2PP9A 1W6LA 1ZIBA 5I6KA 3KW8A 1KBWA 4BXVA 2AFNA 2UXVA 3PPSA 3X1GA 1T5KA 4G7RB 1A4BA 3T6VA 1GR7A 1AZCA 3U25A 1NZRA 4E9VA 5B7MA 3GXUB 2OCCB 4A67A 3N2JA 7PAZA 1GY2A 2P80A 1GSKA 1HAUA 1TEGA 4YSSA 3FU8A 2YAQA 2BP8A 5B1KA 5I26A 1IBYA 1J9TA 1SJMA 1NICA 2EILB 2GBAA 3FSZA 3BVDB 2GI0A 3ERXA 1AZUA 3G5WA 4GP4B 1AACA 1ZPUA 1E5YA 1PZAA 3SBQA 3ZX1A 4YSAA 2X87A 1MZZA 1ET5A 5I6LA 4AKQA 1L9SA 2EIJB 4E9TA 2XV0A 1YLBB 2XUWA 3CG8A 2FQEA 2IH8A 2VW6A 4ZK8A 1NWOA 2FQGA 1NIFA 2HX8A 2R7EB 3UABA 3X1FA 3UGEA 1ET8A 3NT0A 1XB3A 5IY5B 2GC4C 1OCOB 1A3ZA 2BW4A 2CBPA 2FT7A 1RCYA 2HX9A 2BZ7A 4KO6A 3WKPA 2CALA 1JXDA 2IDTA 2RACA 2XX1A 1NIEA 1M56B 3QJTB 1L9OA 1MG3C 1PF3A 3CVBA 1WAEA 3CDZA 4KO9A 1RZQA 1AQ8A 1WA2X 4YSEA 3JTBA 1ETJA 2MTAA 3FQ1A 1BQKA 1JZFA 1OE2A 3T6XA 2VW4A 6PAZA 3T6WA 1KV7A 1TKWA 1KCWA 4AKOA 4PAZA 1XB8A 1WA0X 2VW7A 4BXSV 3FU7B 1GYCA 2VM3A 4GP5B 4BK5C 2GC7C 2J56A 4HALA 4PCYA 2PPDA 4NAJA 3DIVA 1QHQA 5I6NA 2VSMB 3PCYA 2Q9OA 3ZBMA 1BAWA 1JZHA 3OMAB 4F7KA 2IDFA 4CSZA 4KO7A 3FSVA 3V9EA 2XYBA 2GIMA 1ET7A 2TSAA 5AKRA 4QKTA 1RZPA 4RH4A 3IN0A 1QNIA 2EIKB 2YAMA 1NWPA 3OQRA 4W1TA 4A68A 4L0PB 1OOWA 4HHWA 2GB2A 3FPYA 4NB7A 1AZBA 1GW0A 1JXGA 4YSCA 3NJMA 1BQRA 5PCYA 2YQBA 1I53A 3AG3B 2HX7A 3NYKA 4KOCA 1NIAA 1GY1A 2J57A 4FA7B 2W88A 5B7EA 1TU2A 2AZUA 3NSCA 4G7QB 1JZGA 3UAAA 2PPCA 1EHKB 1MDAA 1AG6A 2DY2A 2P80D 3GDCA 4JHUA 4DP7X 2IWEA 1FWXA 4NERA 4G71B 2QT6A 1PZBA 4BWTA 3IN2A 2AVFA 2R7EA 1NPNA 1SF3A 3ASOB 3X1NA 5I28A 3H56A 1NINA 2PPAA 4GY4A 2H3XC 1JERA 2YAOA 1E67A 4UANA 3SBRA 1PZCA 1NIDA 2JXMA 1BXUA 3QPKA 3UADA 1IUZA 1CC3A 1WS8A 2BO0A 3D12B 1ZDQA 3FSAA 2EINB 1J9RA 4P5RA 3OM3B 3NJFA 5I5JA 3X1EA 4AI7A 4YSUA 1HAWA 2QDWA 1JXFA 3OMNB 2TSBA 3DKHA 2N0MA 2YARA 1V54B 2IWFA 1RKRA 3DTUB 2AZAA 3EH3B 3FU7A 2QPEB 3PAZA 2Y1AA 3IEAA 1XB6A 1PNCA 3WNIA 1AIZA 1ZDSA 3PLYA 2FT8A 1KYAA 4E9WA 3PXLA 3ZDWA 5B7FA 1FFTB 3NJHA 1ILUA 4HCGA 4AZUA 2ZOOA 4GXFA 3AZUA 1OE1A 4Q8BA 2H5UA 3EHBB 3NP3A 2UX6A 4EF3A 5D4JA 1R1CA 1SHWA 4WTQA 4DPAX 4K9JA 2BP0B 4QLWA 1L9PA 2LLNA 1SDDB 4BWWA 2PCYA 4FAAB 2UXFA 2MRYA 2FQDA 3NSYA 1MZYA 4ENZA 1AS7A 4E9RA 1PLBA 1A4AA 2PP7A 4BDVB 1M57B 1SFDA 4YVUA 1AZRA 5AZUA 1IBZA 4E9QA 2HLEB 2I85A 3X2QB 3QJSB 2Q5BA 1JOIA 3IE9A 1V10A 1URIA 1VLXA 2Y69B 3PAVA 3T71A 3ZIYA 4A2GA 3MX0B 3QJUB 4YL4A 4G7SB 3TASA 2XX0A 3UACA 2E86A 2I7OA 2XU9A 2XXFA 5TK4A 4BWUA 2UX7A 1UATA 3FYIB 3NJKA 3SQRA 1WA1X 1SF5A 4DPBX 4JHVA 2YAFA 1PNDA 3S8GB 2XLLA 1OCRB 2YXWA 3QJQB 4UAHA 2VN3A 5F7AA 4HCIA 1B3IA 3PAUA 2IDQA 4N4YB 1X9UA 3WIAA 4GYBA 4YSTA 4DPCX 3HB3B 2IAAC 1SFHA 3SBPA 4HAKA 2WSDA 4G70B 3ABKB 3NJGA 3V9CA 2UXTA 1CUOA 3FYEB 1JZEA 4A2EA 3GYRA 3NJLA 7PCYA 1BEXA 1KGYE 1J9QA 4DP0X 3EH5B 2XV2A 2VM4A 3AG1B 2XV3A 4Q89A 4E9XA 3MBWB 3C75A 3ABGA 3OMIB 1PY0A 2OV0A 5I5IA 3CZUB 1TEFA 3TU6A 2IDSA 4KNTA 2FT6A 3HEIB 1ADWA 1AANA 2JKWA 5D4IA 2BP0A 1KDIA 1SDDA 4YSDA 1NTDA 2BWDA 1IC0A 3X1BA 5B3SB 2DWTA 5F7BA 1ZV2A 2J5WA 4YSOA 9PCYA 1PLAA 1XMEB 2YAPA 4HHGA 3CVCA 1GS6X 4JKNA 2NRDA 1AR1B 1F56A 2CCWA 2ZONA 1PAZA 1WS7A 1W8EA 1A65A 3FU9A 5I6PA 1NIBA 4A66A 1SHXA 1MG2C 5ANHA 4KO5A 1GS8A 4DP4X 1ASOA 4KOBA 3L45A 3TA4D 1PLCA 1IKOP 3FQ2A 3S3CB 1E30A 3NSDA 4G72B 1FA4A 2HXAA 1ZIAA 1AAJA 4DP2X 1KDJA 1ASQA 3H4FA 2FJSA 1N70A 2DWSA 3FT0A 1KBVA 1OCCB 4KNUA 3RYMA 2B08A 2B3IA 2GHZA 3FSWA 3T6ZA 2WO2B 5D4HA 3FS9A 2HZHA 2FNWA 4YVNA 2FWLB 5E9NA 2DYRB 3KW7A 3AY2A 3JT2A 4M4RB 2PPEA 4HZ1A 4DP6X 2PLTA 1DZ0A 3NJJA 2EIMB 2PP8A 1V55B 1X9RA 3NP4A 4P5SA 1CURA 1CYWA 4N8UA 1L9RA 3AG2B 2YAEA 2ZWNA 1QLEB 1BYPA 1L9TA 2AANA 4A2FA 2J55A 1AOZA 2HRGA 2CUAA 3EF4A 3FPXA 3ASNB 2IH9A 5PAZA 1HFUA 3S3DB 4YSPA 3H4HA 2VMJA 2ZXWB 5B1AB 2FQFA 1JZIA 2FTAA 5B1BB 2HRHA 1CYXA 2BWIA 2QPDB 1NDTA 4DP5X 1ASPA 1JVOA 1OV8A 2A3TA 2W8CA 1E65A 3NSFA 2BZCA 3BQVA 3NJNA 1BXAA 1OF0A 2UXGA 3FQYA 2BHFA 3QJRB 3UAEA 8PAZA 3N55A 3CVDA 4MFHA 3TBCA 1ILSA 5B1JA 1PCSA 1BYOA 2CJ3A 1N68A 1AZNA 3EH4B 1GS7A 1OCZB 2WO3B 2I7SA 2BP8B 4HCFA
chains in the Genus database with same CATH superfamily
2BHUA 2Y7OA 4TPRL 2YJLA 5IHHA 1A6UH 5IG7B 4B9FA 2VQTA 3TZVC 5HI3D 2AQSA 3H2WA 3U6RB 1OK0A 2K8MA 3FJTA 1DN0B 1MN4A 3BKJL 1M9SA 3PWVA 1AO7D 4DKDC 4L1HA 4PJIA 1UCBH 3GI8L 3EYSH 4OFPA 2DTSA 2XN9B 3FT4A 1CMOA 5AOKA 3C6LB 5D2NB 3QDGE 1NA8A 1P1ZB 3Q8BA 2JCCA 4HUMB 4XMKH 4YHIB 5F1IB 4DGWC 4JDZA 3FQRA 2YD2A 3MKKA 3F58H 3CK0L 5FB8A 5JOPE 2PXYD 2H47C 1TTUA 2FWOA 1UACL 2ARJA 3COOA 5DGRA 5JNYB 4CJ1A 4C4KT 4N2KA 12E8H 3RFRA 3RGVA 3EO9H 3WJJA 3BP4B 1J1PL 3HZKA 3GGWB 1SNRA 3TL5A 5BS0B 4L3FA 4F2EA 1P5VB 2QGBA 4KZEL 2XXCB 3B8YA 2XZCL 4DGIH 2A6JA 1FO0B 3VXTA 1B0GA 4PJ9A 5J1SC 2JFCA 3S37X 2R4SL 3L5XL 1NPJA 2YLHA 2X4PA 2ZYSA 3BVVA 3Q8AA 4LNRB 2QTEA 2WUBL 3NZ8B 2WD0A 1HSAB 3CX2A 1NDMB 1ZLSL 3VYNA 3EHBC 3B7UX 1N0LB 4Z1PA 4IKIA 2PO6A 3GXPA 4Y88A 3CQPA 5EF0A 4ZPTA 1FFQA 1D5ZB 1QSFD 1A4BA 1GR7A 4KX9A 3G7TA 3IT8D 1R3JA 3IGUA 2OXHA 4NCC1 3ZTNH 4AE0A 5CWSA 1OGAD 4LPVA 5HYSB 3D85A 4LXFA 4DKTA 3F7KA 5B38B 3BZ5A 4Q9CA 1JYWA 4PU2A 4G2AA 3EIFA 3VXQA 4L5FH 1DANU 1LO5B 5C0BE 4OFQA 1NL0H 4JFFD 4HWBL 4Y16B 4RZKA 1SBBA 4J3TA 1K5WA 3BZEB 5DJXA 1I1AD 1RPQA 1SYSB 3NIDE 2YMXH 3ALXA 3D69A 4OZGE 3THML 2J43A 5T1DH 2NYKA 2VDKL 3TBWA 2ZCHL 2CXKA 1I82A 5JXED 2ATKA 2NY6C 4OBRA 1KIRB 1CTNA 3VGAB 5JO5B 1H0DA 3ARWA 3KPPB 1AFVL 4HJIA 4QLRA 2ZKXA 1P7BA 2AMGA 4DERA 4UM8A 3KZ8A 3KPSD 4OGYH 4N90E 3NT0A 4G8GB 3D18B 4HKXB 1RK1B 3GSOA 2DWEA 4PJEA 1CFVH 1FZKB 3BDBA 1JHTB 4PS8A 4PGCA 1RP8A 2DQCL 1J5IA 3DI2B 2QSCL 4ACPA 4I3RH 3MAWA 3ARTA 1S7XA 2DLFL 3SE8L 3A5VA 4O2CB 1EMTH 4OD2B 2VDOL 4I2XE 1SEBB 4WI6A 2FNBA 3GB7A 4Z9KB 3DDFA 4KKBC 4FFVD 4S1RH 1R47A 2R2EB 2X28A 1NGXB 2BMKA 4NUGL 1TKWA 5E6YA 4OZIF 1YSOA 4IHOA 2DQGH 3GM8A 1F4XH 4XBEH 4GBXC 3BP5B 4LNVA 1E4XL 2C9QA 1KYOJ 1YDPA 1QHQA 2QHRH 4IU2A 1XBRA 1PZSA 3ZYOA 1UVQB 4XMWA 3F6IA 4PJIF 3VXRD 1L3WA 1IAOA 1T2JA 4FG6D 4LAQL 4U6HA 3CLFH 1S9YA 5JZ7C 5IT2H 2BSEA 4J6RH 1U3HC 4OZGF 3T3PF 2YPLA 4MB5A 4Y4FC 1RUQH 3OKLB 1MXGA 3O6FD 2JCCF 3IJ7A 3QHZL 1MCCA 2CO6B 2GKIA 4NZ8A 4W1TA 3KPRD 4AVJA 3HPLA 4WENB 3DURA 1NANI 4HK0B 2E7LA 1EH9A 1G4MA 3FPYA 3ULSA 3VE0B 3GZOA 3BZFA 4D9LH 1UADC 2XSKA 2EXSA 1UWFA 3CSYB 3MLUL 2ITDB 3WFZA 1T5WA 4H8PA 1WTGT 5DFVD 2C3VA 3DMMB 3T1FA 4TQPA 4OFYA 4A2LA 2L7UA 2YBRB 1HJBC 1V05A 3W3BA 2CPCA 3UAAA 2JKNA 2OXGA 2WJ5A 3IXTA 3PV6A 4GAFB 5DQ9B 4FFZH 5FO9B 3VFOB 2WCPA 2GIYA 2ZSVB 3QQ3B 2GIXA 3O9WB 3AADB 2HT4D 3LRLA 3GKWH 4ZW7A 1PDKB 2HMID 1JHKH 5HGHA 4ZODA 5HDWA 4G6AD 1THAA 3G08B 1F58L 1JNNL 3FT2A 4G1EB 4NDMB 3NH7H 1WFIA 1BXUA 3DX8B 1O9ZA 3QEQB 4AMWA 3HR5A 2O5ZH 1WS8A 1PD6A 4M02A 1QI3A 4WWNA 1YEDB 3DJ9A 4W6WB 2XQBH 3QH3A 1IKNC 1KBPA 4Y1AB 1OAYL 5AAPA 4M1DL 3WEXA 3ULUF 1PEZA 4LGSB 5IB4B 1Z9NA 3EYQD 3MV8A 1HESA 3C5ZD 3KR3L 4HKBA 4IJTA 3EH3B 4JO1L 4R26L 3Q2LA 1JXKA 3EDEA 3KNBA 4RDQF 2OULB 1E4JA 3DBXB 3HG3A 1CIDA 3QUXA 4NJ9L 4BH8A 2WB1A 2VR4A 2FT8A 3TEZA 4LBEA 3GINA 4LSQH 5EEVA 2KZBA 4E9WA 3V0WL 1K2DB 4EAEA 3UROR 5GSRA 3WIHA 2GITA 4KHTL 5KVEH 1EXUB 1NCHA 4ERSL 3Q3GB 1G84A 1P2CB 3GS4A 3H3PL 1DUYA 5BVPL 3ZL4L 1Y18B 2Y22A 1L9PA 1NLBL 2DJSA 2FGWL 4Z3FA 2EABA 3RIAF 2BIOA 2BFVH 1YEHL 2EYSA 4OCXL 4PJEF 1OB1B 5D7EA 4YDIH 4TVUA 3VFVA 3BPNC 1MZYA 3S34L 3ZDXF 2WLLA 5FK9B 2IF7A 4JCWA 4UU9B 5F3HA 1MRDL 3QC6X 2E0PA 5D6CA 4KC3B 3ARPA 5GJTH 3T0DA 5DWUL 3QXDA 4XWOD 5ECGA 2XG4A 1I3RB 1LNUA 4EI5C 4UT9H 2BOBA 4TOYL 3UG5A 5HYEA 1QTSA 4YJZL 5CJXC 3PQYB 4XMVA 2YC1B 5HGDA 5J56B 1Q1PA 3QDHA 1FHNA 2X70B 2Y69B 5HPMA 1NDGB 4M56A 1MW2A 3DSNA 5C92A 4YEFA 4PJ5A 3PABA 4CL7A 1EDHA 1PKQB 4D0CA 4QRSB 1CXLA 1UXWB 1X5HA 2I7OA 1E3FA 4H26A 4NAMA 3BH9B 1HT6A 1JPFA 4ONGL 4IKKA 3ROOA 4L9LA 2H3KA 4AJWA 1Z9SB 4BYHA 3L4TA 3T8VA 1BOGB 2WQAA 3HS9A 1GGCL 2G5UA 2VSCA 4HH9A 3C8HA 4NEHB 2P5WE 4F2ME 2B9BA 2Q6WA 2BFGA 3HB3B 4R97C 2E3VA 5FHBH 2X2JA 1JZ4A 1M7DA 3QUKB 4MS6A 3SPCA 4LLMA 1E2VA 1B0WA 3HRZA 1L0XA 2GVYA 3DNKA 3F7RA 2QPFA 4PD4K 1ETA1 5CBAB 4FS0A 5K9KA 1MCPH 3FQWB 2A6IA 4CC4A 4ZG1A 2GEEA 3GMLA 5ADPL 1KN4H 3ILPA 4UOW1 3O2WL 4OF6A 3VD4A 3NJLA 4PBVC 4FTVB 5DSCA 4L3ED 1KIPB 3UBXI 3OJ2C 2Q87A 2O6EA 2WQSA 3CZGA 3LKSB 3OKYA 1KGWA 1XR9B 5KBMA 2J12B 4C56B 4CKVX 4V1DA 5LVEA 4MJ6A 2RMNA 2EKSA 2MPAH 3GZPA 4I18A 1BD2D 2VLJD 2IDSA 4KNTA 5FDWB 4PRIB 4YGVB 1T0MB 3BUTA 5DEFB 2OYLA 3BPCB 1MRFL 4TV3A 4F33B 3BCFA 3X1BA 4KDTC 4HWEL 3HE7C 4KUCF 4NPKA 3RIFF 1EFXB 1GS6X 4C54A 3EFOB 1CDYA 4MMZB 2WXHA 3VRJA 1MEXL 5B4MC 1CG9A 1XGZA 4XXWA 1WZ1H 1TQSA 2JNZA 1XDTT 4H1LH 2VIRB 4EEEA 2E9WA 3DGGB 3NZUA 1WHOA 4XVUC 1M2VA 3KLKA 3SQOH 3D3VA 5EC2B 1GPOH 3T4AA 2X2UA 3N1GC 4TNGA 2AC0A 1IM9B 2BCKB 4ELMB 4K55A 4JW3A 4QIRA 5FUCC 1INEH 1KJMA 2GJ6A 4APQA 4OCSL 1TYRA 5CR8A 4ZUUB 5F72S 5I1IH 5IFHH 5DJ2A 4K8RL 3AQDA 4U1MA 4XC1H 1ASQA 1XGPB 1YMMA 5B21A 2IO5A 3TZVD 1CFSB 5ANMB 2UV3A 1F6LL 1MH5A 2B3IA 4LCIL 5GGTA 3WTSA 1CD1B 1XGYH 1KCVH 2NDGA 3KPMA 3NIFB 4FEIA 5E9NA 2FWLB 3QIBC 3O2VL 1B2WL 2EDTA 4PS4H 1HKLL 2YWYA 4YS4A 5EU4A 4N8PA 5I16B 5EN3A 4LSTH 5F9AC 3C60C 1I9RL 1K9TA 5AVVB 5I1KL 1JWMB 4FNQA 1IGYB 5AVYB 5TE4L 1CYWA 3DUHA 3VJ6B 3QR2A 1LQSR 3F04A 4FG0A 1KCSL 1KNOB 4ONHB 3SE4A 3VXMB 2YPVH 5FA4B 5JDJA 5IUSA 1NLDH 3S35L 1JV5A 3V6FA 5IK3A 4OUOA 5A16B 4NQDB 5DMYA 4G5ZH 1UTDA 1G7LA 4FXKB 5KEZA 1BQHA 2UWEE 3UG4A 4AIXA 4DVBB 1N19A 2FLRT 1GGIH 1OSZA 1AP2B 1MVUB 1TTRA 1NDTA 2VCOA 3QDJE 1HDMA 2ZYHA 3QCUL 3R4DA 4BUHA 4OCLC 4DJMA 2VDML 1B0RB 3D0VA 4MCZB 1OANA 3EHBD 15C8H 5KN5B 4FQJL 4ELDA 1CFTA 3VO0A 1IQWH 5CEXB 2VZSA 4OLVL 2NNRA 1OHQA 8PAZA 1HXYA 1E6OL 4KXCA 4ZW3A 1A2YA 4P5KA 3UCRA 4QCIB 2DIAA 5KWYC 1K8DA 1KXTB 1SJXA 4X6BA 5C0FB 5C2BH 4UT6H 5FX3A 4JPQA 1AHWA 3GMNA 4HLZG 5BO1H 1J05B 4BFEA 4WU7B 4AQOA 2DQTH 5KVGH 4AKPA 2ENQA 5SX5K 3PG2A 4G9DB 2K0RA 3SKUD 4BSWB 4ZMOA 1OPGL 5C0NC 5CCJA 3S97C 5DZJA 3WFHB 2WP3O 2CDFB 2A7BA 5KSAA 1WEJH 4JPKH 2E5EA 5DJ6A 5C70A 3HR6A 4KY2A 4EPSA 5IOPB 2EDYA 4X4YA 2AJ3A 4IOIB 5AB2A 5D5ME 2OMVA 2NY6D 1MWAH 1FSKC 1I9JL 3MZGB 4JS7A 5FYKD 2ADJB 3HBQA 3I6KB 1LO4H 3LZOA 3K2MC 1J0HA 5DRWB 3M6DA 2Z0UA 4QKXB 2JIXB 3MNZA 1C9SA 1KG0B 2WYTA 3O6ML 4AM0A 4ICWA 3PL6C 1U8JA 2C1PA 1NKRA 1X5XA 2FCBA 4LBAA 2BLFA 3KBHE 1PX8A 1JDDA 3FU6A 4IJ3C 5DFAA 4BUQA 3ML8A 2W59A 3U36B 1DVSA 1IL1A 4M7JL 3JXAA 5A2LH 1U8OA 1CXKA 1KTRL 2X12A 1QG3A 4XN5A 4E9SA 4FQQB 5E5MA 5I1GH 2GTWA 3IDNB 1C5CL 4TUKL 5JA9A 4KKBD 4YHPA 3WGUB 3CX5J 4GSDL 4S1QH 2DQHH 2UZYB 1I8MB 1KBWA 4BXVA 2UXVA 3OKKA 1I7RA 2E8YA 1T5KA 1E5AA 4G7RB 3CQFA 4P23C 3BIKA 4R5VA 1ZWIA 4GBXD 1UB6B 5T5FH 5HSFA 1AZCA 1GSMA 1MVYA 2G3NA 5E99L 3MV9D 4NJAH 2O5XL 1CF8H 4UV4H 3A47A 5EF3A 2YSSA 5INCB 4MCYB 1KPVB 4H0HB 4R5XA 4WY7H 4PP1C 5JZ7D 3DX9A 2DDQH 3QZPA 1U3HD 3BSHA 1JPSH 2HA1A 3D7PA 1BX2B 1TCMA 4Y4FD 1DJSA 3FU8A 2YAQA 2BP8A 4X6DE 1HOEA 1IGJB 3KLLA 5IG7A 1LO0L 5HYIA 1AZUA 3U6RA 2LU3A 4GMSH 1AACA 3U0PB 1DN0A 3TNMB 1LEGB 2V0AA 4E0RB 1BGXH 5C6TL 3CFDB 5GISH 4R4FH 1T2XA 3GSQB 4XAWL 3V52H 4EOWH 4RFOL 3NCFB 4R7LA 3IJ9A 5JIHA 3BGFC 4FC3E 3ALWA 3C6LA 5D2NA 5EFIB 1T20B 3BKML 1P1ZA 1H9DA 3OLDA 1TENA 4UAOC 1F86A 4PS3A 4YHIA 1CLOH 3L7FB 2R7EB 5F1IA 4LLWB 1YQ2A 5ADOH 4AGOA 3LRKA 1BM3L 3BT2H 2E59A 3W1ZA 4X99B 4HBQA 5L88H 5JNYA 2RIKA 5E4EC 1U2YA 5D55A 4WJG3 1FF5A 2YMTA 3U9UB 4J1UB 3BP4A 4H8WL 1GC1L 2DL9A 3JWOL 1ZSDB 4JFDD 4K71B 1EV2E 4PY8J 5DFWH 1I3UA 1M56B 2F0CA 1GGYA 3B6SB 4G1MB 1NC4A 4P2QE 1XHHA 5BS0A 1RZQA 1P5VA 3HE6B 4B96A 1AJ7L 2IH1B 1JPGB 1FL6A 1FO0A 4L3CA 2V9QA 3N85L 4BZ2H 3TWCH 3QIUC 4GRWB 1KCWA 4S0HA 4LNRA 3EJSA 1IIKA 4KITB 1CD0A 4MYPA 3C12A 5BMFH 3NZ8A 3T6QC 1HSAA 1EAOA 1NDMA 1WBYA 4LRNL 5HVWA 3K0YA 1N0LA 1NKGA 1RZIB 1H8OA 2AEQH 1F3DJ 1D5ZA 3QQ9C 4OCYL 1MW1A 3BUBA 3MRPB 3QQNA 3ZBMA 2VL5B 4I1RA 4IKNA 1CK0H 5KBDA 3VMNA 4X7DC 5F7UA 4FFYH 3LIZL 3NTCL 3Q8EA 4HGKC 5HYSA 4BE6A 3ARYA 4MQXC 1VFAB 2EIKB 4HPYL 3WE6B 2J72A 2MNUA 2BSTB 5IJBC 1I1FB 1LO5A 4BRVA 2X3AA 1BQRA 3ZVVA 1SMDA 3NSXA 4Y16A 5FYJE 2V9RA 1TZ8A 3BZEA 1FGVH 4KQ3H 1NIAA 4U1IB 3HIZA 2MQCA 1SYSA 5FGSA 1CR9L 1XSJA 2CWRA 1OTUC 4E42B 4YDKH 3S36H 2VDNB 5AB0A 3SYPA 2FSEB 4NUJB 5CJQH 4AIZB 1KIRA 3IJ8A 3WTXA 3V0EA 3MLTB 3GNMH 4EI5D 3KPPA 4LL9A 4GH7B 4LPYA 3ZHFA 4IDJH 4NZJA 1H3PH 1P4IH 4F5CE 4PJFE 4HZAA 1UXSB 3VSQA 1DVXA 1S9XB 2QQKL 3ZDZF 3D18A 4GY4A 3K6DA 4HKXA 4R7VA 5L4FA 3B9AA 4WUUB 3GI9H 1FZKA 4G8FA 4TQ8A 5FOBB 1JHTA 1ACXA 5AWNH 5KBKA 1E43A 2IQ9H 3BD4A 2QEJA 2VDQH 1PD0A 3SB3A 2V8MA 4MZ3A 5GGQL 3MXVL 1BPVA 4O2CA 2ERJC 1RK0B 1PG7L 5F3BB 1D9KB 2RALA 2HWZL 4KJWC 4XVOA 1GJWA 4XCNB 1D2PA 1SEBA 3TNNB 3DECA 4HIXH 2A38A 3MRDB 2R2EA 2JELH 3W5MA 1P5UB 1FFOB 1MLCB 3MV7D 5LXVA 1UWYA 1U9KA 3IS0X 4GW5B 1A4JB 3P0VH 3P1VA 3BP5A 3QUMA 3LPFA 2Z91B 3C08L 4ZZFA 1WBZB 2YD3A 3FHEA 3O6KL 3PFQA 3ECVA 3HI5L 1UVQA 4ANVA 3ARSA 1NSNH 3FCSA 4LVEA 1OSYA 2ENJA 4X7SL 3NJHA 1ILUA 4Q2ZB 3AQXA 3CFCL 4P05A 3OG4B 2BY1A 4PJ7E 3OKLA 4F8PA 1C5BH 1EPFA 2YRPA 3HI6L 1HZKA 5L8KB 3SYCA 2CO6A 3LXUX 2X1PA 4HK0A 1G9NH 4ILDA 1SDDB 3VE0A 1E2WA 3WXVH 1CGUA 2GTQA 1SHSA 4FL4C 3U48A 5HHME 2EVGA 3CSYA 4OJEH 4IIQB 4XI5D 4J8QA 2ITDA 5D7LD 5AOLA 1BZDA 4BM7A 4F15B 5EC1A 3TT3L 2WLZA 3HE7D 3HMXL 4XBGB 1MNUL 4RMTA 2VZ1A 3ZE1B 1R6VA 1UB5A 4MLSA 4F93B 1YY8B 1MIEH 1K85A 1KXQA 2EIZB 4HT1L 3EUUA 3NACH 5B4MD 4OSUH 5DQ9A 2FATL 1WLHA 4ZFGH 5F7EL 2R69L 4B60A 5I74B 5FO9A 3VFOA 2ZSVA 3QQ3A 4GXVH 5D2LB 3SBWA 2F74B 4XVUD 3HS0B 1PDKA 2IANE 3FQ4A 3U6XS 1H5BC 2ALWA 2E86A 3AREA 4IRJA 4M7ZB 3VD2A 3MV11 3OSKA 4G43A 4DPBX 3MOBL 1JPEA 3G08A 1O7DC 4NDMA 4G1EA 4QRQB 4DN3H 4NZTH 1RUPH 3DX8A 2VH5H 1HHGB 2XWXA 3BP7B 3QEQA 4XVTL 3ZK0A 5J5EA 5T1MA 4FHJA 1IE5A 2BIMA 1YEDA 4YSTA 4JAMA 1ZHNB 4PJAB 5KAQG 4R2GB 4PJHE 3V9FA 4PSPA 1EVTC 5EUKB 5IB4A 1BBDL 4ORZC 4N0YH 2UXTA 3FYEB 1PL3A 1T04A 3QIBD 4RAHA 3DBXA 4RFEB 3WUWB 3MJ9A 2DM7A 4HU8A 2CDEB 2DD8L 4A2EA 1UM6H 5CIPB 2NR6A 2JJTA 3KJ4C 3BPLC 1VZIA 1X3DA 4LSUH 3MOAL 5KSBB 5FO7A 5IQ7L 3C60D 3EXLA 1K2DA 3BEVB 3ZHDA 1E50A 5EU6D 4DP0X 2NUTB 3IRCA 3RIFK 2CMRL 5ERWB 1EXUA 2B16A 2WKGA 4LP4A 2E27H 1FFRA 3Q3GA 1P2CA 5CZXC 3MRCB 1HL5A 1T7WA 1Y18A 2JKWA 3EJJX 3QUML 4YSDA 4EUPG 4LDLB 3UAFA 4J4PA 1HL4A 1SY6L 3KHQA 3RWIB 5IEKB 4HX1B 1ZV2A 3G9VA 2DMBA 2X2HA 1OHZA 5FK9A 5HYJB 3I9GL 3APCA 3JV4B 3MV01 4M5YH 4PI0A 3RWJB 3VA6A 1CGXA 1VESA 1I3RA 4BFIB 2GUOB 4DK6A 3PQYA 4TRPL 5LAPA 2YC1A 1JBJA 4N2NA 1C08B 2C4FT 1SJHB 5DMIH 3SDXE 5C0GB 2X70A 2XJLA 1NDGA 5FYLD 1ZV5A 4FFTA 3TA4D 4BQCA 1DJYA 3OSVA 5T1KB 3MRGB 4JRXE 4AL8L 1PKQA 1T66C 4QRSA 3I50L 1UXWA 2J1YA 1M2OA 4LLQB 3E6HB 3BH9A 2G9KA 4OI7A 4ATTA 1Z9SA 3H4FA 3Q5YA 3K1DA 2WVTA 1BOGA 1FVEB 3H42L 1KYDA 4NRXB 3MRIA 4GG6A 1ERNA 4G6FB 5D1XE 2VQ4A 4P3WA 5C0ND 1P9MA 3BHBB 3RG1C 3QUKA 5C09D 4MNQD 4LVNB 1JZ5A 4F58H 2DYRB 3KW7A 3N43B 5I75B 3K3QA 5D71L 2CXGA 3B56A 1O6TA 4I9XA 2OR7A 3F5WB 3S2AA 1DZ0A 2X4UA 5CBAA 1G7HB 1AQHA 3FQWA 4TUUA 2FBRA 2Y1YA 3HC3H 4BA8A 3LEYL 2WAQA 3MUHL 3PY9A 5GGRB 2ICEC 1DBAH 2WSPA 2BNRD 5F9OL 5DRNA 4AJYV 3NN8B 3VFWB 1KIPA 1WZMA 5DK2A 2FJFB 1FV1B 1KULA 1F41A 3FXIC 2ZX8A 4UDUB 4N2FA 4FQ2H 3FTZA 1SVBA 5DUPH 5KW9L 5KVDL 2CUAA 3G5YB 4V2CB 3NFSH 3BI9X 1UC6A 2ZCLH 3NOIA 1NCDH 2RCSH 4PRIA 4U1GB 4YGVA 5FDWA 1T0MA 5DEFA 2R1YB 3BPCA 3SDXF 4F33A 2V37A 2BXZA 2O61A 4Y4KC 4Y19B 4XZUB 1NBYA 2F1BA 3EG9B 4JGNA 2F54E 1EFXA 2NCEA 3EFOA 4MMZA 2ZG1A 2PXYB 1RJZB 1RU9L 1KT2A 3L2MA 5E9DB 4BEIA 2CO7A 3KCPB 4Z0BH 3HKZA 4Q6YA 2LOEA 2ADYA 5HHXL 4P23D 3KWXA 3DGGA 5EA0L 1IC4L 3V5HB 5EC2A 2A9NH 3U7YL 2AJVL 1IM9A 2BCKA 4ELMA 5A2CA 5BW7C 1FGNH 4K5NA 2WO3B 5IMLB 3QA3B 2EEFA 1UD5A 25C8L 4YBHA 1NEUA 4PP1D 5AW0B 3MRKB 5LUMA 3GIZH 1BV8A 2EYTB 4DZ8B 4HUVA 5DJ8B 1S3RA 4I1NB 2DQEH 1XGPA 1PW3A 5AOJA 3I3BA 1WAAA 4MJIE 4A2DA 4LMQE 1QBLL 2HRPH 4I89A 1CFSA 3D39D 5ANMA 4FKHA 5K33A 3SN6N 4DN4H 5BOPA 3VXUE 3F7VB 1QSFB 1CD1A 1TFHA 5AFAA 1WGOA 5IESH 1IGMH 3RHWK 3CAFA 4UNVA 3QWQB 4JQVA 1G6RH 4KVNH 3L5JA 2OYPA 1UJ3C 4XGZB 3QFDB 1CFMA 4ZBJA 4AOFA 1OGAB 5I16A 3L4VA 3DRQB 1IT9H 1FZMA 2W5PA 4ZD3H 2OMTB 3V7AE 2J1KA 1S5HB 2ZUQC 5M7QA 1CS6A 1IGYA 4BDVA 2X88A 5DO8A 5KVFH 1R3HB 3SKJL 3RA7L 2JK5B 5KANG 2CAKA 3VJ6A 4NN7C 1ZE3C 5EUOA 4AY0A 2IBZX 4OF8A 1I1AB 1F6FB 1KNOA 3K5RA 4ONHA 4PJDE 3VXMA 1AGFB 2VRAA 3MBXH 5FA4A 1JD9A 3B2MA 2CLVB 5ESAA 3AG4B 4A55A 2JJSA 4NFCA 4O5LH 1X5KA 3TBTB 4AIOA 4NQDA 5T5NG 4FXKA 4HVBA 4Z8FH 3OZKA 3LN4A 3NZHL 3V6OE 5IBTH 3IKCB 3WFDH 4MXWH 3LZLA 3QIUD 2QMKA 4U31A 3RTLA 1AP2A 1MVUA 3IDGB 4AVKA 1IZKA 2LAAA 3D2TA 2FEEL 3IGAB 1B0RA 3E38A 1YN6A 4MCZA 1KB5B 4YC2C 4GG6F 5KN5A 1AXTH 4NQCE 4G83A 4J39A 5CEXA 3QQ9D 3IMUA 1CL7H 1K4DA 2NQDA 5FEBA 3EKCA 1DLFH 3CDCA 2X6AA 2DQIH 2MTPA 1KXTA 2H41A 3KPOB 2IBZY 1TNNA 4MQXD 4NN6C 3PPEA 4XNXL 5SWSD 1J05A 3VD3A 2DLGA 1FPTH 1DBBL 3ET9F 3ATBA 5MP6L 3SPJA 2FO8A 4G9DA 1DVTA 1MZZA 1NANH 2J1ZA 3GSWB 4NI6A 4BSWA 4IGBB 2YKKA 3B9KC 2AABL 2R0LH 4D0DB 3SOBH 5HHVL 5K9QI 3WN5C 5IOPA 5C0EB 1OTUD 3VXRB 3X3FH 4GXUM 4IOIA 4ZW6A 3TV3L 3M8OH 1QUNA 2IPKB 2BNUB 1S7UB 4UOW0 3V6BR 2WXRA 4KVCL 1YPZE 2ADJA 2Y7NA 5GRYA 4YQXL 1ZMYA 5DRWA 2JIXA 3AABA 1KENL 1F4AA 3WU1A 2W07B 3JTSA 4FQ1L 1NUGA 1KG0A 4FCHA 1T89A 1GL4B 2AXFA 4ZSOB 2FBJL 2BRRH 1CFNB 1EHAA 1F6AB 4M5ZL 32C2B 3TO2B 1CDGA 4MA3B 4Q4EA 3HC0B 1T21B 2VUOA 4PCSA 3V10A 4KJWD 4XP1L 4HCRA 3MROB 5FCUH 1V3LA 1ZLWK 4YO0B 4FQQA 3IDNA 3WKMH 2WXNA 3EJZC 3T0EE 4GP5B 4TPRH 2UZYA 3HG1E 1I8MA 1HTYA 2CLRB 2HG0A 4FQHB 1WAAF 2VABB 2OSXA 5I9QB 4F9PC 3WEOA 2FVNA 2HT2C 3MJ6A 5JHDE 3FU5A 3QNZB 1UB6A 2RD0A 4MXVE 4BSJA 2YUZA 4NO0D 3GI8H 1X7SA 5I24A 5INCA 4MCYA 2WTOA 3NIFF 4M00A 5DVMA 1KPVA 3DTXB 1EERB 3GMQA 4KTYA 2AF2A 3OQRA 3OAWA 5FM5O 1SBSL 4L0PB 1BX2A 4YFEA 1KEGH 3CK0H 2DQ6A 1IGJA 1YMHA 4HIEB 3VB9A 4B7IA 1UACH 1HN1A 1MQKL 4KOCA 3INOA 4XOBA 3U0PA 5DC2A 2P26A 3NEOA 1LEGA 4GUPB 3TNMA 4AQAB 4CVUA 4E0RA 2VDPL 1TU2A 1PEWA 3CFDA 1I85C 5EUOF 1J1XL 4KMQA 1I1RA 3GSQA 4FLSA 1LP9B 3VFNA 2ZXDA 1J1PH 3TLRA 3UZQB 1AH1A 5F89A 5LXGL 3RY6C 1RFDL 5EFIA 2ILLA 1XQ4A 3W2DL 1UCTA 4L37B 4A39A 2B4CL 2XZCH 3EYFB 4KZEH 2X0WA 2DQMA 2R7EA 1ROCA 4LLWA 2R4SH 3VRLF 1WICA 2WCSA 4WGVB 2WUBH 4Q14A 3K7UA 4X99A 2DIJA 3FFOA 1A0QL 3KVDD 5CHNA 1ZLSH 1L5GB 2EVHA 3F3HA 3SBRA 1GOHA 1PZCA 3U9UA 3CSBA 2G3MA 4J1UA 4R83A 1ZSDA 3VQMA 3QPKA 1RIUL 3FSOA 1IUZA 3U1SL 4IK7A 4Y5YC 1DQKA 2IH1A 2IJ0C 1JPGA 2ZG3A 4Y9CA 3U7WH 2I9TB 5ISZE 3ZMNA 1YEIL 2PMZA 5I82A 5JUEL 5D4QA 4HWBH 1WG3A 5GZNC 3UERA 3BMWA 4QRPE 4QRRD 1HC1A 1RZIA 3QXUA 3JWNG 3FB6B 3MRPA 1E9OB 2K6WA 2VL5A 3THMH 4TNVF 2ZP8A 1HJCA 4HSAC 2VDKH 5L7XH 2ZCHH 3A6CL 3BAWA 1BFSA 3DTDA 4GAGL 1RZJC 1FP5A 3LDBC 4U6VL 4XXCC 2XKNB 4PRPD 3DLQR 2XICA 1TZOA 3VTMA 4FQIL 1LMKA 3WE6A 4JO5A 3PAYA 2BSTA 2HFFB 3JV6B 3K4DA 1I1FA 1ZS8B 2PCYA 3U46B 5CZXD 4PHZA 4M8RA 4U1IA 4U2ZA 2Y7QB 3S98A 3QULB 4Z7NE 1U8QB 3BUIA 3CVIL 1Z3GL 4E42A 2QSCH 5D7IB 1IBZA 2DLFH 3SE8H 4IRSC 4NUJA 2LR4A 4AIZA 4L3EB 1CGYA 4OBSA 2VDOH 5C7XL 3MLTA 4NM8H 5GQBA 3S36X 3GIVB 3MODL 3QEGL 5TGBB 1TT6A 3VFSB 2W38A 1P7QA 1FCGA 3AB0C 2FEEI 5EIIG 1UXSA 2DN7A 4F8QA 1S9XA 1BD2B 2VLJB 1MW0A 3OAYK 2P47B 4AJVA 4WUUA 3NJKA 3X11B 2D7OA 4ODUB 4PLOB 5FOBA 3SQRA 4DIXA 1T66D 5KTEL 1UUSA 2CRMA 3MRFB 2QKIB 5BOJA 1XT5A 5J8OA 4LAQH 1OM9A 1OPOA 2DBLL 1X9UA 1RK0A 5AL8A 3V4VL 2P7TB 4XCNA 3QBTB 1R4XA 5J6SA 3CSPA 4PWHA 2P44B 3Q8FA 2IG2L 2PR4L 2WYIA 3MRDA 3VU1A 1G7PB 1J1OL 1D7FA 1P5UA 3FRPG 1FFOA 4G70B 1MLCA 2Z9TA 2EO9A 2VB5A 3MGAA 3U9PH 3NA9L 4GW5A 1A4JA 4UNUA 1ZOXA 4DTGL 4RGMC 2M8XA 2ZF8A 3MLUH 1H6TA 2Z91A 1WBZA 4KH9A 2FK9A 2NSMA 5DJZB 4MRCA 4WEMB 5FGBA 2K4AA 3PWLB 5J89A 2BC4B 3UTSD 4Q2ZA 4UT7L 1FJ1B 3ULUH 2BIHA 4HS8L 3CHPA 5F9WC 3CZUB 2NTFB 4PGZA 3BAYA 4MJJA 5EORL 1KDIA 4QD2E 1SDDA 3TN0A 4F57H 3BKCL 4IIQA 4PREB 1IU1A 5I18L 3L1GA 3VSVA 3EGSA 1SXZA 1F58H 1JNNH 2VDLB 4OD1H 3DHPA 3QQDA 4Y4KD 4K73A 1KB3A 1XZWA 1BVNT 1DBML 2LT9A 2VAJA 3KL0A 5E4OA 2EIZA 2VE6B 5JPNC 1ACZA 2F53E 1NAMB 5AG8A 5FFLA 1NCWL 4A66A 1CB4A 4KO5A 1DSFL 2V2XB 1CD8A 1GOGA 5HDBE 4GRWF 1T2QL 1ASOA 5D2LA 2F74A 3MACL 2VC2B 3LXCA 5I17B 3CX5K 3VVWA 3KR3H 1BHGA 4FQLL 4R26H 3QDMD 2F18A 3HAEH 1NEZB 4QRQA 1LO2L 1QD0A 3U4AA 4FNLL 4NJ9H 2FJSA 1HHGA 3BP7A 1Z1WA 2NZIA 2APWA 2P8PB 2O6PA 4KNUA 1S7SB 3PYCA 2WZ0A 1AYOA 1JK8B 4AH2B 1ZHNA 4NHUB 5ILTL 4M5TA 3FS9A 4PJAA 4U6TA 1XZ0B 5KS9B 4ERSH 2R27A 1EHLL 4K5MA 5BVPH 5K39B 3ZL4H 3S4SG 3RPKA 3BAXA 3OF6D 1NLBH 2Z34A 4KK9C 5CM1A 1UM5L 4EN2A 2NDFA 3NJJA 4YE4L 3PGFL 4P2RD 4E36A 1AR2A 1R75A 2CDEA 3ROLB 4HJGB 1ZANL 3BXNB 5CIPA 3S34H 5DHEA 2R8SL 4UQCA 5KSBA 1MRDH 2ZXQA 2EVJA 4YPJA 2G0KA 3BEVA 5DWUH 4MMYA 2VZTA 1AQMA 4UIKL 2NUTA 4TOYH 5MEOB 1EUTA 2KBGA 1MI5E 5ERWA 4HUKB 4J2XA 5AAWA 1H3GA 1I8IB 3MRCA 5IJCC 2Z7UA 3CZFB 4HZLA 1CVSC 1TJHL 1NC2B 2Q7YB 1I8LA 2J1WA 3TCXA 2CRIA 3RWIA 5IEKA 5HHOE 4GI9A 2X6MA 3DSFL 3QYNA 3NPZB 1YQVL 5GS2D 4JFOB 1X5JA 2NY6B 4ONGH 5HYJA 2ESVE 4LO9A 2GJRA 3JV4A 2X4QB 5KYYA 1JZ2A 4HJ1A 2CCLA 3UJIL 1U3ZA 2GUOA 4BFIA 1GGCH 1MCDA 4WIQA 4L3AA 4TVPE 4PTUA 2FJUB 5C0GA 3QS3A 1SJHA 2XZQL 1CFBA 3AWGA 1KBGH 5J11C 2BS9A 3MRGA 4GNKB 3D25B 4PRNB 4LLQA 1VFUA 3E6HA 3ZDYE 4HIIB 5I1JH 1LDPL 3AW5A 3MLRL 3IMRA 3O2WH 3WNOA 2WNXA 4PN6A 4QOKD 4LEOB 4AIEA 5C1MB 1W6WA 4M7LL 2CIIB 4B9GA 4NRXA 3K2UH 2XXGA 2WSKA 1SOSA 4JG9A 3K5SA 1JZ6A 4Z3JA 3CMOH 2MH4A 1X9LA 4GBXB 4ECNA 2XBTA 2Z3FA 3B9KD 3MV9B 4LSSL 3G9AB 2HVJA 5JW4Q 4OJAA 3K1KC 3F5WA 3Q2VA 1G7HA 5DYFA 4LPUA 3ABLB 2B14A 4M3HA 4PRHE 4HWEH 1U3HB 2F8VA 5GGRA 5B1JC 2R83A 3BGMA 3BPOC 3NN8A 3VFWA 2FLBT 4MVBC 3UYOD 4JKPL 2FJFA 1FV1A 5AVZB 4L05A 1INQB 4X5QA 4UDUA 4L4TB 2JE8A 3KWVA 5C08D 3STLB 3CDZB 3KYOB 3LH2L 1AO7A 2IWGA 3G5YA 1SOKA 1TG8A 5D2LF 4YDLB 5BPPA 5JIQA 3UPAA 1N6VA 2LFEA 5I1HH 2R1YA 1M9WA 5TK2A 4E5XB 3CXHK 4GLRI 4Y19A 1V7NL 3CZKA 4XZUA 3EG9A 4K94L 2A6KB 3F6LA 5GRZA 2XZAL 2VLKD 3EJZD 1QEXA 3IJSA 3N6YA 2PXYA 1IBFA 2YUWA 1BVNP 1RJZA 5E9DA 2XWRA 2EH7L 3HTLX 2R23B 3KCPA 3SJVD 4LEEA 5J0BA 3MKGA 5TF0A 1OOAA 3WJLC 2HT2D 4LCIH 1G9EA 3CZJA 4PJAF 1HK6A 2OCCB 3V5HA 2R1WB 3M88A 4X9FA 4JFDB 1SXNA 3MLYL 1XGUB 4HJ0C 3SO3B 5IMLA 1MHHB 3JVGC 3QA3A 1B2WH 4QUOA 1HKLH 1OO2A 1Z3RA 4N2DA 3MRKA 3L3GB 2EILB 3ESUF 3JBG7 3ARUA 3C09C 3MCKB 4K5PA 4DZ8A 1I9RH 5I1KH 5DJ8A 3IDUA 2BJMH 4L8BA 3PDDA 4J3OF 4ZJ9A 2Y4SA 3LNEA 1N3NA 2JKRM 4MKTA 3QEUB 2HSIA 2XDHA 4B9YA 1NCGA 1Y7VA 1C16B 1KCSH 3CG8A 3F7VA 3FO0L 1QSFA 4E9TA 3NZSA 4P59L 2KMWA 2BNQB 3S35H 3MRNB 1CDIA 3ZQWA 5DZNA 4ZQKB 1TSHA 3UABA 2H2PC 1OGAA 3GC3A 3AS2A 3UGUA 3DRQA 5IY5B 4PJGB 5HDRA 5CFHA 3K2KA 3P54A 4NT6B 1RPUA 1S5HA 1SEQH 5F0JB 3QCUH 1R3HA 1I8AA 2YR3A 4JFFA 2JK5A 2VXTL 1QA9B 2RH0A 4F8OA 5LN8A 1DFBH 5HD8C 1I1AA 2ZD0A 3Q8CA 4GKZB 1RUKL 2XIIA 1AGFA 2ED6A 3HUJE 1E6OH 3BPNB 5J06A 2A2QT 2IGTA 1VAHA 1T22B 2JTDA 2L7EA 2VLRD 4O00A 5JXEA 3TBTA 2E47A 4L8SC 1TJMA 4UZUA 2BM3A 5E8OB 4AKOA 4CKQA 1XB8A 1JE6A 2FH6A 4EI5B 1EGJL 3HKFA 1TZGL 3IDGA 5I6NA 2CRYA 3M1CA 1MJ7L 4M93C 5IVXE 1KB5A 2YD6A 1BAWA 1OPGH 5GZND 5J12C 4PLNC 4U1SB 3RY5A 1T4KB 2Q0ZX 5D9SB 4MNGE 1IM3D 5JPMC 3QWOB 5DHMC 4GI8A 2GIMA 4CVZB 1QTPA 5E6SB 3C5JB 3SPIA 2KZWA 1QNIA 5DURB 4NQTA 3CHSA 4U1KB 1OOWA 1Y0LB 1D7BA 3KPOA 3B1TA 4K8RC 4Y4HB 1I9JH 5FXCH 4P5TB 5I0WA 4NQEE 4BFNA 2ZNXA 1IEAB 1AYRA 1IC7L 3ILEA 3BWAB 3K71A 4R97B 4U1LB 1WH0A 3WMQA 3D8MA 4Z7AA 3CVHL 5E1IA 4OTXH 3GSWA 3OHMB 4U7MA 3O6MH 1A6ZB 3A6BL 5D6DA 3NSCA 4U1NB 3VMOA 5I73B 1JZGA 1T03H 1RSYA 4D0DA 4F1ZA 1R34A 4JDTL 4KGLA 3UMNA 5C0EA 4OZFH 2H1PL 3VXRA 3GSVB 5AAMC 3OXRB 2YEVB 2BNUA 4IRSD 1GYWA 4BWTA 1S7UA 1WFUA 2E76C 3DVGA 1P4LB 3E0GA 3ECWA 1N8OE 2OSLB 3O6FA 4K7PL 2APFA 2MMXA 3WO4C 1C5CH 4TUKH 4Z23A 1NFDB 4GSDH 3RZCC 2FB4L 1KBKA 1WYJA 2OMXA 2W07A 3LXAA 5TF1L 4HEMA 4XP5L 5ACZA 2ZWLT 2J8UE 4PJBE 2ZUXA 4DK3A 1HL8A 5D7LB 1RLWA 2O5XH 1HEJC 5IVXF 1CFNA 1F6AA 4P3CL 4NLAA 1X7TA 3HE7B 3X13A 3GJFB 32C2A 3QDGD 3TO2A 4MA3A 2H3NB 3NVQA 4OIIL 3HC0A 1T21A 4KK6C 3L9YA 3AGVA 1QRNE 4X5LA 4XNUL 1CYGA 2AQRA 4CJ0A 3MROA 1YVLA 2KERA 4YO0A 1QWUA 3GXFA 5JOPD 4JFUA 3K4ZA 4XMPL 3FO1B 4YL9A 3UTPE 5L4MA 2H9GA 1LO0H 1JMXA 3DBSA 2EDDA 2CLRA 1T1XB 3AS1A 4FQHA 2VABA 1T5XB 3D50A 4W70A 2C34A 2I24N 4AQ8C 5C6TH 2AV1B 2EE6A 2YD1A 4XAWH 2XA3A 1J5OL 1XH2A 2NQ3A 4RFOH 4ZX3A 4OFKA 1X5LA 3PHQB 4XB7A 1OD9A 4ZX5A 4Q8BA 3DTXA 4NXKA 5F88B 4GI6A 2H0FA 3AQZA 3EJYC 2E6PA 4EF3A 3CC5B 3LQAH 4AG4L 2CRZA 1WVZA 3NQKA 3L2NA 4HIEA 1BM3H 4FAAB 1WIOA 3S5LG 3PP3H 1OAKL 4D9QE 3O11B 1T7VA 1KWGA 4GUPA 3C5ZA 3MRMB 1ECZA 4DETA 1N59B 3ZUCA 3DIFB 3QIBB 2YRLA 4H8WH 1GC1H 3JWOH 2WNWA 4F27A 2HTKC 4R90L 4EXKA 3T4YB 3UZQA 3FOMB 3TCTA 2J8UF 2ZP0T 3ESPA 2HJKB 3C60B 2WGNB 1AJ7H 3Q2NA 4WO4C 3EYFA 1BQSA 4JY5L 3G04B 4GMTL 5EU6B 3KPRE 3N85H 1R17A 5IW3A 5BUPA 1WZAA 1H8LA 5LBSL 5C0BD 3UACA 1CGVA 5EBWB 2NX5E 1XCTB 4LRNH 1PCXA 4OLWL 4JANB 1PNDA 1PX3A 2CLZB 4OCYH 2OFQA 2Y1ZA 5LNDA 3N9GL 2FZ3B 5BZZA 4JPSA 4RAVB 5GGVL 4E68A 1QO3B 3KPQB 3WIAA 3ZL2A 1XO8A 3LX9A 4YZWA 4JZJC 4NBZB 1AHKA 4UYPA 3LIZH 3NTCH 3P4MB 4JMNA 4LP5A 4BV1A 1L9NA 2VRQA 4LRIC 4YHKL 2I9TA 1R3KB 5FV1L 3N06B 4XNYH 3B3IB 2L8AA 4XCFH 4N90D 2OKMA 4MD5B 2JKJA 5D1QE 4KUZL 1E28B 1KEML 4H7VA 4F7PB 4KK9D 4IBVA 3FB6A 3UAJC 1E9OA 1KWKA 4L1DA 3VQLA 1G1YA 3V8OA 3LKPB 2NY4C 4O58H 2YPKA 3MTRA 4NRYA 4APXB 4Z7WB 2W92A 1BLNA 1TVBB 3APFA 1GZHA 1DO5A 3IDXL 3RVTC 2HFFA 3JV6A 1ZS8A 2QQKH 4TQEL 2DWTA 2CK0H 4JJHA 4HHGA 4AGNA 2Y7QA 4HK3N 1VCAA 2EDEA 3QULA 1U8QA 5CZKA 2IMMA 5D7IA 5GGQH 3MXVH 5AW4B 2V6HA 3K81A 4PV8B 2HWZH 4L3EA 3TIDB 3QYCA 3SGKC 1RZFH 2VYRE 3GIVA 4K15A 5TGBA 3RVVC 3VFSA 3RWDB 2PUQT 5IUCA 3O2DA 5C0DB 1BOYA 1HCFX 5DU7A 2PCPA 1IKOP 3IJHB 3RNKA 5IWLC 1BD2A 2VLJA 3B2PA 3PL6B 3LV3B 3II2A 3JWOC 3NIGE 4H8WC 4S2SB 3TYGL 3X11A 1BIIB 4ODUA 4WW2F 4U49A 4H5SB 4XB8A 1S9VB 4IJ3B 2BHYA 2Y23A 4TL5A 3O6KH 3MRFA 4L4JA 4PG9B 5AB9A 1TFPA 3K8KA 2FD6L 4RMRA 3EOTL 4X7SH 1TLMA 3K6SB 2P7TA 3CFCH 1ED3B 3T6ZA 4QTHB 3HI6H 3MA7B 5MI0B 2FNWA 3DRTB 4DGVL 2K9UA 4PGDA 3O3UN 1AGBB 1BF8A 3KBEA 2BY0A 3O45B 4TKWA 4BFFA 3D5OF 3L95B 1YO4A 2ZTBA 1R9FA 1V55B 5HJDA 3WTVA 2YOCA 3CHXA 5DJZA 3TT3H 5C6PB 1CN4A 1MNUH 4HUXB 3PWLA 4KFZC 1J8RA 2BC4A 2DI7A 2HTLC 3RURA 1G94A 1YNKH 4MVBD 1FJ1A 4HT1H 3P30L 3IMBA 1L9TA 2FATH 1MVFA 2PN5A 5F7EH 2R69H 3N91A 3D39B 3FPXA 1G1CA 5HBBA 2AI0L 3RBSA 3BAJA 3IBEA 3GSNL 3BX7C 1WO2A 4GKLA 3ATEA 2RQEA 3O4OC 4PREA 2FO1A 3BGFB 4GQRA 3MOBH 2YBGA 5CSGA 1ZHKB 3VFUB 4UAOB 5TDOB 4XVTH 1L0YA 4FLRA 2DWYA 2D9QB 2VE6A 1BXAA 2PETA 2W0KA 2FECL 1NAMA 4M1CC 2DKSA 2O93L 4EZLA 1OTSC 2CHDA 1PCSA 3AT9A 5E4EB 2V2XA 5CLTA 1M6OB 1ZLVK 4AZ8B 5B3JE 5TDNB 1NH6A 2Y36L 5I17A 1BBDH 2I7SA 2DBJA 3VWJB 2ZKHL 5IROC 4IEFB 4HJ0D 1ITBB 1NFIB 4J23A 1MWAB 4IIZA 5IBUB 3RNQB 1FC1A 2DD8H 4YHZL 1DZBA 2J71A 3L1EA 1RVFL 1MUJB 2VKWA 5DVLA 2XN9E 4IBSA 3GSRB 1WRFA 5IQ7H 3ZE2F 4IBLT 2P8PA 3QIUB 2QDVA 4ANXA 1EANA 4KJPC 3KWWB 1PFCA 2GSMB 3L1OL 3O2DL 1JK8A 3NA4A 3GWJA 4AH2A 2CMRH 4NHUA 4IHBA 4N3TA 1XZ0A 5KS9A 4OM0L 1A7QL 1SM3L 3EJPA 3MRQB 5K39A 1EXHA 3V95A 1E8YA 3QUMH 2WQXA 2AXGB 4S1SL 4X6CB 1KJVB 2E56A 2X6CA 3KXFE 3ZE0B 1AQDB 1SY6H 4N8VG 4Z7OB 3ROLA 4HJGA 4TVSa 3BXNA 4FMKA 1J5DA 2H2PD 3I9GH 3V0GA 4JX0A 5D7IF 3STZB 3D9AL 5SWSB 3WDJA 2GBVA 5I19L 1CICB 2P5WD 2XHNA 3SPGA 4QJ3B 5JW4R 5MEOA 3MFGB 1JGVL 5JOFB 1YZZA 1RHHA 2XWZA 4GOSA 4WTZA 4YHMH 5DYOA 2ZUUA 3V2AR 4YSRA 4KX7A 1I8IA 3F7PC 1H3TA 5HD8D 4P5MA 3CZFA 1ZVYA 2J88L 3HNSL 2CCVA 2WHVA 5FC9A 3JUYA 1NC2A 2Q7YA 4XB3A 4AL8H 3I50H 1UA7A 4HMDA 4XPGL 1UURA 2RFXB 3GLAA 4KTGA 1YECL 4PJXE 1MKFA 5IIEB 4RZCB 3FT1A 2A99A 2LFGA 2X4QA 1MHCB 1JGLL 3H42H 4C4BA 1DQIA 4E9VA 3V7AG 4PI2A 3FTYA 2YEZB 1Q0YL 3QNXB 2AQTA 3OR6A 1I7UB 2J6EL 1Q0XH 1UKSA 3KPTA 4N25A 5D71H 1TEGA 3D25A 2NW2B 2PWGA 4OZ4B 3N3EA 3U2IA 3MNDA 1GOFA 4PRNA 4U4BA 4K3DL 2GBAA 3LEYH 4HIIA 2ERJB 2M2DA 4L29B 2GI0A 5LDSA 4K8RD 5F9OH 4ZO8A 3ZTJH 4WHYH 4O02A 4WI3A 1WUNT 2CIIA 2P8MB 4HIHB 1I3GL 1IX2A 1DL7H 3ENEA 2AJXH 4AEIL 2NY2C 2VJ0A 3QQ4B 5K1JA 1RIVL 1G7MB 5AVWB 3P77B 2VC2L 4QHMA 2Q8AL 1JZ8A 4LEBA 4GBXA 4NM4H 4HEPA 5KW9H 5KVDH 2JI3A 1UT2A 1Q9OB 3MV9A 5E2TL 4G8GE 4KMTL 4IOFC 2P9RA 1VFBB 3MJ9H 4XNMB 2AQ3A 2F19L 2XWBB 4FQXB 4TSBH 3MLWL 4XAKE 3KJ6H 3QK0A 1U3HA 3R7QA 4N8CL 4Y4FA 4I7ZC 3T3MB 4OLYL 2B8OT 2H0EA 3MNVB 1EXGA 2HX9A 1ETZB 2F61A 4KO6A 4DFIA 3RZCD 3RWHB 1RU9H 1A7RL 2WWKO 5DQJA 5T1LD 1INQA 6TAAA 5HHXH 5AQ0A 1PF3A 3BE1H 3STLA 3CDZA 5EA0H 3KYOA 2VZ3A 1S5IL 3DI3B 4H2CA 1XXDC 3BZDA 4BKLB 3U7YH 1F42A 2AJVH 4G59C 4UWQB 2WWMC 4N5EC 2CUMA 4GSUA 5D72H 4XMUA 2ARWA 2A6KA 2IPTL 4KK6D 4XP9H 4BK5C 4WNJA 3HJEA 2PPDA 3GK8L 4KH2A 4P2OC 4YHYB 5F44A 4F7CB 2CZNA 1S7VB 3OMAB 1QBLH 3B2UC 4O9HL 4F7KA 4ZMYA 1XX9C 3ASWA 1IBGL 3QJHB 1ZT4B 4MTMA 5KS9F 2R1WA 1QYGL 3JV5A 4JFDA 2A83B 4DGYL 5DZ9A 1XGUA 5F1NB 5DCCA 4HGWA 1MHHA 5B1CA 1A7PL 3SE9L 4XRCB 3EJYD 2RA1A 3L3GA 1G4RA 2D0FA 3NCXA 3MCKA 4FULA 3QDJD 3P4OB 3WHE1 3QFJB 3FUMA 1RZKC 1XF1A 1LEIB 4FG2A 4HD9A 3EBGA 5DK3A 3WL9B 3SKJH 3DVNB 2OW6A 3RA7H 3QEUA 4OM1H 5AB1A 3TO4C 5GHWL 4QRRB 3WNMA 5IJDC 4JM2C 2ZX7A 1C16A 1MOEA 3GDCA 1CXIA 2HTKD 3MRNA 1MCKA 1CLYL 1J0ZA 3KJ4B 3ZO9A 4ZQKA 2RAMA 3H55A 1FAIL 4H8HA 2XVKA 4PRPB 1G7JA 2H2SC 4PRBB 4O02L 4WO4D 4PJGA 5DD0L 2Q8BL 3S35X 4EE2A 4NT6A 1NBVL 4IBWA 2H3XC 4BFGA 4J3VA 4Z76B 4G80B 2YSTA 5D1XC 3UJTL 3S96B 4LT7A 5K9JL 2F5AH 1QA9A 5CAYB 3SSGA 3ORJA 1U33A 5HGBB 3OBAA 4ZUTB 4Y1AE 2XKSA 5BZDA 5F7LB 1NCJA 1ZDQA 4GKZA 4JFZH 1U8LB 3OM3B 3NJFA 1IVLA 4ZAKB 3US9A 2X42A 3Q44A 1A25A 3HHRB 1T22A 2HRLA 1UASA 1UWXH 5ALBL 3X3FL 1DVFC 2AZAA 2WXQA 5BQ7B 4EI5A 2GSGB 4XNXH 5CJXA 3GXDA 1DBBH 4HC1L 5MP6H 1ZDSA 2A4CA 3R19A 2DQJL 3I74A 4H88H 2PYEE 5EOCJ 3BRDA 4U1SA 1T4KA 5D9SA 3OG6B 4AZUA 2R0ZL 2AABH 5IMMB 3QWOA 4POZC 3UAJD 1F4WH 2PCXA 2TRHA 4CVZA 3B2VH 1JRHL 5LQBH 3C5JA 4ODWB 3TV3H 3JWDC 2X4OB 3WV0A 1G87A 2AJZB 2NY4D 1YUKB 1BP3B 3D05A 3E2HB 5T3ZE 1DJGA 2VGLM 2Z31C 1Y0LA 4U1KA 3VM5A 5AEAA 4KVCH 4YDVB 3BSZA 3FUIA 1IEAA 4JCLA 2UXFA 3VW3H 2VQ1B 5E7FA 3L3DA 3ZIMA 3P0GB 3RVTD 1KENH 2PP7A 3MV7A 2HT3C 4FQ1H 2MQ3A 1CDBA 3VM7A 3WTYA 1N7ML 1HINL 1A6ZA 4Y8DC 5ID0A 5IMOB 3WAJA 1OTTC 4HULB 1BG9A 1IAIL 4RESB 2HLEB 2I85A 2YQ3A 1JOIA 3FDWA 1M6UA 1P7KA 3GSVA 3OXRA 1BJ1J 2ICEB 4G9FE 3UXFA 3UTSB 1FYTB 1VJSA 4FZ8H 5T3ZL 3IJYB 1P4LA 3FW6A 4XP1H 2OSLA 1WWAX 4YL4A 4P4RB 2XX0A 4N2OA 1OXYA 3RVVD 1NFDA 1GMIA 4X8JB 4WO0A 4XCCL 1N64L 4WI4A 3L9RB 5E4AA 4CNIA 1YNTB 2RTTA 3F12B 1NM9A 5FA3B 3IFNL 2X38A 3Q13A 4MX7B 4XMZA 4MD0B 3L3JA 5D7LA 4Y4KB 4KDTA 3HE7A 3L8QA 2JQZA 3GJFA 4PB0L 4Y89A 1P84K 2BVOB 2H3NA 4N2GA 5T1JA 1KTLB 4EVNB 5IKCB 4G6ML 5CEZH 1IAIM 4DNLA 3RX8A 4FADA 3TEUA 4FTVE 2Y7SA 3FO1A 4YH6A 3M17B 2V5RA 5BVJB 1T1XA 1Z9OA 3EBHA 4C47A 1T5XA 3FH7A 3DJSA 4C56E 3TVMB 3L7EB 2AV1A 2N3JA 5DI8B 1J1XH 1VZHA 3CCHB 3PHQA 4P2QD 1P1VA 5LXGH 5F88A 5JMOC 3WIIL 3AC0A 4UT9A 3W2DH 1RXLA 1TEFA 2HTLD 3V6OC 2B4CH 3SKNB 3CC5A 1KXHA 1XIWB 3MBEB 3JZ7A 2PW2A 4B6ZA 4PJGF 3LAFA 4M7KL 3OJDB 2CU9A 4LL4A 1R5IB 4OF0A 4D3CL 1A0QH 3O11A 1U8NB 3BEWB 4ODXB 3RWFB 3ZTDC 3ZXAC 4FYQA 3MRMA 5CNHA 5DMGC 1N59A 3DIFA 3V55A 3QIBA 1OP3K 4P2RB 3MQIA 2M1KA 1RIUH 3T4YA 3U1SH 1A65A 3FOMA 4FJZA 4GT0A 1TTAA 3OR7B 3RJDA 4ELME 2FJHB 2FX8L 2HJKA 3C60A 1NCUA 3TX4A 3BSZL 3G6DL 4N68A 1EK3A 3G04A 5EU6A 3WTTA 2ZUQB 4M1CD 4MRBA 4JEGB 1OTSD 5JUEH 3D4ZA 3CFEB 4NN7B 5EBWA 3HFML 4H0LC 4LKCB 1XCTA 5FYJD 3S8WA 3G5VB 2DI9A 2DYPD 5DEJA 3UO8B 3UTZB 1BYNA 5A1AA 5JR1L 2XPGA 4JANA 2EKJA 4TMPA 4CC1A 5IROD 2CLZA 3A24A 3GXMA 3N1MC 1N70A 2CK2A 3GT6A 4KRPC 4W68A 4RAVA 1QO3A 4ONFH 4XWGL 4WWID 5EOCH 1ECYA 4HCRH 1BEYL 4GAGH 4U6VH 3P4MA 1BSIA 4KJPD 4YVNA 4D9RE 4FQIH 4LLUB 1Z9PA 3B3IA 2R4RH 4DP6X 4NKMB 2Q3AA 4CSTA 4KKPA 4MB4A 4YC2B 2JSFA 4I1PA 3F83A 3QR0A 3B9DA 4MD5A 1ZEAL 4WWPA 1GW6A 1E28A 5GSVB 4F7PA 2J20A 1OAUL 2OJEB 3BQUC 3KLAB 3MNMA 1HYSC 2WQ8A 5CEYB 3CVIH 1Z3GH 3L1FA 5DA0B 1L9RA 2PNDA 3LKPA 3E8UL 4PRAA 4QGTA 4QOKB 1LK2B 4NN6B 4APXA 4Z7WA 2WLJA 4NQDE 3T0EC 3DO4A 3KGTA 1TVBA 4ODTH 4I3SL 3QEGH 1JWSB 5D7JB 5D7SL 3H4HA 3QO1B 4YXLH 2AJYL 3MOQA 1BJ1H 5C09A 2B1AL 4MNQA 2ATPB 3KPNB 3B9KB 2BWIA 5KTEH 3WN5B 5C9JB 4KX8A 3HHMA 3IAQA 5EV7A 1ZXKA 1HHKB 2A3TA 2B4CC 3QIWC 4GLRH 2BNRA 1JCKA 3V4VH 2IQAB 1BZ8A 1YEEL 4PV8A 3TIDA 3VFMB 2DIEA 2CE6A 4LCYB 4NCC2 4NQQA 4AQ1B 4Q6IB 4N28A 1BF2A 4WCYL 3NRFA 4HUNB 3RWDA 3EH4B 1PG7X 4GUCA 1GS7A 1J1OH 4EUPB 1OK8A 3IJHA 5C08B 1WJ3A 5LWYL 3FTWA 4DTGH 3VSUA 1FAKT 3NA9H 1IEHA 3PL6A 3LV3A 1G5GA 1G6RB 3A4EA 5HHMD 4S2SA 3OGCB 3JZYA 1BIIA 4H5SA 1S9VA 5HYQB 5ABZA 2V7HB 4WKXA 1YYML 3B7TA 1XF4B 3L5HA 4S0SD 5SWZE 3VGEA 2N4IA 2VLKB 4W9GC 1ED3A 1KLGB 1OE3A 1QI4A 2D0GA 4UT7H 3W56A 4B5ZA 4NNPH 1BVZA 4QTHA 5JXAH 3MA7A 4MZIA 2IOMA 1AR1C 1FYHB 2IWKA 3SJVB 2NY2D 3DRTA 1MY5A 2HUHA 4OFDA 1T3FB 2YA0A 4ENEC 4PV1C 5EORH 2IAND 1QLRA 1AGBA 3WENA 3O45A 1U3YA 3AY4C 1MFEL 1IAII 4IOFD 4L9DA 1J9SA 1G5AA 3L95A 3H9SE 5BRQA 3T9WA 2VSKB 3GHPA 3V0VB 3BRFA 3RY4A 2V5SA 3TC9A 5DD3L 2WN2A 4HUXA 2ZXCA 1DBMH 1J5CA 3L5WB 5A3IC 1UGKA 1NCWH 2YXVA 4NPYB 3A6OA 1F3JB 3D39A 5FYLL 1DSFH 3FQNB 2DAVA 2OK0L 2ZIDA 6PCYA 3MACH 4WTXA 3KBPA 4FQLH 2AJUL 1GTNA 1XR8B 1EAJA 1MXDA 3O0RL 2NY0B 2AFNA 4UT6A 3V7MA 3FB8B 2WWMD 1LO2H 4N5ED 3GBEA 1ZHKA 1GYVA 4NP9A 3VFUA 3T6VA 1EJFA 3O3EB 5TDOA 3O8XC 4J3OG 4CDHA 5AD0B 1CI5A 2H6UA 35C8L 4P2OD 2ZX6A 4Y5XC 4MLIA 1XGTB 3DUSB 3A23A 4TULL 3L2LA 5ILTH 3N2JA 3B2UD 3IU4L 4AZ8A 4LIQE 4YK4B 3WELA 1EHLH 4L1TA 1JF5A 3VWJA 1KOAA 1UM5H 3MXWL 4QXVA 4IEFA 3TJPA 4YE4H 2P45B 3PGFH 1NFIA 4MKMA 4Y5YB 3RNQA 3C6SB 4UMSA 5EH1A 4MAUH 1QKZL 4QJ4B 1PZAA 3VG9C 2R8SH 1MUJA 3UZEC 4L8CB 3ARBB 4QT5A 3QIUA 2IIJA 3VG0L 4BQBA 4QAWA 3KWWA 3SPVB 5LGHL 2W9EL 4UIKH 1U8IA 3GBNL 2AHIA 3DX3A 3TBVB 3TO4D 2FSDA 4FMFA 1NWOA 4H8QA 2CJTA 3MRQA 4JM2D 4LIQL 1ZD6A 1O6SB 3MLZL 3E80A 3BCDA 1TJHH 4JRXD 2AXGA 4X6CA 4UV7L 1ET8A 1KJVA 2C9AA 1AQDA 2CA4A 4M9OA 1BMWA 5F6IB 1YQVH 4NUMA 4Z7VB 3TGXA 5FWQA 5FKPB 3D06A 5A2IH 2H2SD 2X89A 5IVZB 4X9YA 3STZA 3ZO0A 3EYUL 1NOAA 4HWUA 2CALA 5SWSA 3UJIH 1CICA 3DX6B 5D1XD 5T5FA 5JOFA 5BZXA 1TR7A 2WMPB 3OKMB 2XZQH 1V7ML 1EEQA 3IMVA 3L17A 1D5BA 4JO2L 1QBML 2XJKA 4MBRA 2DLEA 2N0KA 3ZZSA 4MA8L 4OQ1A 3OTTA 3BFQG 1R5WB 2ZCZA 3ZHLA 2RFXA 4JM4L 3W0WE 2AJSL 3P3TA 4UQBA 4QMEA 2OTWA 3MLRH 1DVFD 4FEMA 4LVOC 4YR6B 3VD0A 3QZWB 2UVFA 1M7IB 4M7LH 4XP4L 1BECA 2QADC 3AB0B 4GKOA 1XH3B 2OBGA 3L3OB 1PSKL 1DVUA 4N0CC 2HLFC 1D6EB 2YEZA 3HG0A 1UYWL 1SLXA 3QNXA 1I7UA 1JTTA 5AZEL 4LSSH 5IB5B 4POZD 2V5YA 4ZI8A 2NW2A 3WLBA 1TZAA 3S88L 2EDQA 1UD3A 3QDGB 3NJMA 2W94A 2F54D 1DBJL 2Z31D 3LNGA 4Z95L 1QW9A 4OI9A 1NFKA 2P8MA 4HIHA 2XZZA 1NJ9B 2WB7A 3BJLA 3MA9L 2HT3D 3ZYJA 3QQ4A 1G7MA 5TH2A 1FG9C 2GK2A 1QMUA 3BAEL 3PIQB 1OTTD 1Q9OA 3RFZC 2CGRL 4NO0A 1J8HE 4QHLB 5E6IC 4OR1A 4XNMA 5E6RB 2AVFA 2Z8SA 3OJMB 3KD4A 2XWBA 3IPEA 4DQAA 4FQXA 4WUUE 5CIPH 4KJYB 1KGUA 2Z8VC 2ZOLB 1A1NB 1V7NH 1DQDL 1PZ5A 2PPAA 4J3OH 4K94H 4JQIL 3TJEL 1D7DA 5CF3A 1CBVL 3MNVA 4LOFA 2XZAH 1IBBA 5F9WB 3MGOB 1ETZA 4PYHA 1OZTG 3RWHA 2EH7H 3N41B 1FFNB 3ATAA 3VXUD 4EI6B 4AI7A 1SQMA 3VU2A 3FTUA 2YUXA 5LG6A 2VDKB 4PIRF 4BKLA 1TCRA 3MLYH 2WY3B 2EEBA 5IVNA 5E2WL 3TP4A 5CILL 5AOIA 4OZIB 1UA6H 1XAUA 3UBXB 3B1UA 2VUKA 4MQ7B 5JPNB 3V4PA 2BVYA 1QATA 3EJCA 1E3XA 4LLDB 1NGPH 3I2CL 1AIZA 4NKDB 5FO2A 3G6JA 4F7CA 4CRPA 3LB6C 3FFCE 1S7VA 3HNVL 4ZMXA 4KTDL 3L48A 1M71B 3NIDB 3DXAB 1ZT4A 4IYKA 1H5BA 4OZGB 3FO0H 1IBHA 3WD5L 3AU1A 2A83A 4P59H 1DVZA 4RGNE 5F1NA 4AEEA 2KT6A 1QSZA 3DX7B 4X6CF 1IILE 2VDOB 4QLWA 3B7SA 5I1LB 4XRCA 3HFFA 2QVMA 3JTTB 4PSRA 4OY9A 4E41E 3ZE1E 3NSYA 3P4OA 2BX5A 1WHPA 1LEIA 1A4KB 4J6IA 4X50A 3WL9A 2EP6A 3AT8A 5BRZE 3DVNA 2VXTH 3VXNB 4NQCD 5AZUA 4HS3A 3PDGA 3B9EA 4QRRA 4E9QA 1AHMA 5I6XB 1MREL 5DMGD 2E7DA 5F1SA 3BESR 4CAGA 3FTSA 3ISRA 3ZIYA 4PJ9B 1CO1A 4CU7A 4JFXB 2BP5M 1Y1UA 4XMLL 4PRPA 2X9ZA 3EFDL 4UNTA 3O3AB 4URKA 4C83B 2V3FA 3ARRA 1EVUA 4Z76A 1TZGH 1WZKA 1WA1X 4IBYA 4JHVA 4G80A 2K7PA 3S96A 1CGTA 2QVIA 1TVHB 4WEBH 5DVNA 1MJ7H 1QPXA 5J6HA 4ZUTA 4JFQB 2DICA 1SUHA 1U8LA 2XY1A 3LPGA 4BK8A 1XL4A 2EH8L 1MCRA 4KRPD 1SVZA 4ZAKA 3K6FA 4HKZA 4J3OC 4K94C 2MHAB 5IF0B 3HRPA 1D7CA 4FQCH 1DHKA 5BQ7A 1X4XA 1NAKL 4YWGL 5AYQA 4AYEC 1VADA 1IC7H 4TLUA 2P5EE 3QJXA 3CVHH 1KLFB 1BEXA 3IETB 2BHZA 5J11B 3DGCR 3A6BH 2UY6B 1EEYB 3EH5B 4ZYKB 3BQUD 4WK0B 1MIML 5IMMA 1TQBB 1HYSD 4Q89A 4JDTH 2XY2A 1A64A 1CE1L 4J3WA 4ODWA 3NABH 2X4OA 3UCQA 2X09A 2KS0A 1M7XA 3V4PL 5BRPA 3WS6C 4UM8B 2C1OB 5IW1B 1G1OA 2GJJA 1CIUA 2KC0A 4YDVA 3QRBA 4K7PH 4KKCC 3T0ED 1NGQL 4PQXA 2VQ1A 1XCQB 2IV8A 3HG1D 1WIUA 5F7BA 3T3MF 4NKQB 3VFTB 1UZ6F 3TONA 2EDRA 3HW7A 4F37K 3HC4L 4XNZC 5JHDD 3HAEB 1MFCL 3SDCC 5IQOA 5IMOA 2Z4TA 4XZ4A 3UTOA 3F64A 5DHXB 1N5YL 2WUCL 1JNJA 4UQIM 2X1WL 5I6PA 3FBQA 4P3CH 4PIBA 2OL3L 3QIWD 2ICEA 4OIIH 5H35B 3UTSA 3BPOB 3CSFA 1E5BA 3FUKA 3IJYA 4XNUH 1PLCA 1AZVA 4P4RA 4IHOB 1OGTB 2IADA 4CSSA 5IMKB 5JOEA 1N8ZA 3D09A 1HXKA 4W9IC 3QORC 1P7HL 5FAAA 3UX9B 4X8JA 5EEWA 1IJ9A 3G6JF 3L9RA 4GFXA 3F00A 1CLZL 4W4NA 3GRBA 1MCWM 1YNTA 2Y72A 3F12A 5FA3A 3FT0A 3H85A 3QXWA 1A7NL 3QC5X 4MD0A 5DHVH 1ULVA 2YPLB 2CHZA 2J25A 4Y4KA 4YHOH 3GO1L 3U30C 4TSCH 2BVOA 3K72A 2YZ8A 4AE1A 1KTLA 1TPXC 4EVNA 2QFRA 4EDWL 5IKCA 4JFEE 3DURB 4OT1H 1FH5L 3VTAA 4AG4H 1BFOB 4X98B 1AR1D 2WINB 3ARGC 1CF1A 1KB5H 4S11A 5HDOA 2OSWA 4C4KO 5BVJA 4ENED 2PP8A 1OAKH 3VUAA 4ZW5A 3QDMA 3TVMA 4Z5RB 3L7EA 1Q8MA 3U0WH 2PCFB 4HFUL 2WXOA 1LE5B 5BW7A 3QUGA 4FFWC 1OL0A 3IXTB 4R90H 2YAEA 2F58L 1OLLA 3CCHA 3MRHB 3PV6B 5JTWA 4R5TA 3C09B 3FRPB 4YX2L 2GEQA 2NLJB 4GMTH 4Y19E 5I0ZA 4KZ0A 5A3ID 5ISZD 5IP4A 1EJ8A 4GS7B 5GZOC 5LBSH 3WY4A 1RAMA 1R5IA 4M9PA 4X4MA 4LPXA 2HUEA 5HGHB 1ZK9A 4QRPD 1U8NA 3BEWA 1NEPA 4OLWH 3FUHA 3MJGX 3OF6A 4RIRB 3PGDB 1CDUA 3CH1B 4P2RA 3HR5B 4YBLC 3QG7H 1UJ3A 5C07E 5GGVH 3ILQC 4ZO7A 2CJUL 3OR7A 3QH3B 3CZEA 2FJHA 2O5YL 4HETA 4MFHA 1PVHA 1G9ML 3O8XD 4R7XA 5F7NC 4X0KB 2D9CA 4YHKH 4F2MB 4KXZI 5F9JB 4P9HL 3CFEA 1UHVA 3KNBB 4LKCA 2N7AA 3G5VA 3TH2T 4LOEA 2K1MA 4DP8X 3F7YB 4KUZH 3UTZA 2A4ZA 2YXFA 5MENE 2WYHA 5A7EA 2MCPL 3FC8A 3UJJL 1E5ZA 3FCGA 4KDVA 2EO1A 4MQSB 5HI4C 3RUGE 4L8SB 4AX3A 5DZLA 1WSST 4P0DA 1PQZB 2AKRA 3KGSA 3GKZA 3QUYC 4KHXL 4KDWA 4LLUA 3BP6B 1EA9C 1YG9A 2LLLA 4F24A 1HZHL 2PTTB 4NKMA 3IDXH 4M93B 2RJMA 5J12B 5FUOH 3A0OA 3CXDL 4TQEH 4RMVA 3VFVB 3WLWC 2I60L 4HK3J 1E4WL 1JVLA 5GSVA 5JPMB 1JMZA 2OJEA 3KLAA 5I8EB 4DW2L 5CEYA 4PVBA 2H0JA 1GTFA 2D2OA 4AUJA 4GEJA 1KB9J 4YPGB 3M7OA 4QOKA 3BD3A 1LK2A 5HGDB 3CC1A 4JREC 5KJRL 5FW7A 1TYEB 3WY1A 2QJDA 2JKTM 1JWSA 5D7JA 2EYRB 3PNRB 2XQYK 3QO1A 5IJKC 4K3JL 5EULV 3KPNA 3B9KA 4AK1A 3HMWH 1A9VA 2MNJB 1JPFB 3TYGH 5I6KA 3WN5A 5C9JA 4RQQB 4FYRA 4JHAL 2B1OA 2ZAHA 1Z66A 1HHKA 1ODAA 1R33A 2FD6H 5B8CC 3S9DB 5E2JA 3FTXA 3WO4B 5JHLA 3VFMA 4D8OA 4LCYA 4AQ1A 2QADD 3H9YA 1U4FA 1K5NB 1E6JH 2KDGA 3DIDA 4N0UE 5HDQL 3WYRA 2CKBL 1W9XA 4N0CD 4EUPA 2HLFD 5C08A 3U1QA 1HIML 2B77A 4KPHL 3K71B 1A6WL 1Q1JH 2N7SA 5I26A 5I1DA 1SJMA 3KCWA 1G6RA 1A14H 1DDHB 3OGCA 3MNWA 4GIOA 4RMSA 2NW3B 5HYQA 2V7HA 4YSAA 4RBPK 1J0YA 1ET5A 1XF4A 3GMOB 1O0VA 1TEYA 2UYLA 4YIQB 2CHXA 2VLKA 3DV4B 3OHXC 2F53D 1KLGA 2VDMB 4UZGA 4Y7OC 2WZAA 2EKSB 1Q72L 4I18B 2VW6A 5K9OA 1KLUB 3SJVA 1TOXA 1NBCA 2ZUVA 3NCBB 3APNA 2AI0H 3EFFB 4F9PA 2DQFB 1T3FA 2L3BA 4Z7QF 2CO3A 3GSNH 1H8SA 1UENA 1A7OH 1X5YA 5GRUH 3ZZ1A 5B38G 3LS4H 5E6ID 1NUDA 1PZ2A 1OCOB 4NSKB 7TAAA 3UTQA 5I8KL 4ZSOE 1DN2A 1TJXA 3VRJB 4WV1C 2Q3XA 3B5GA 3V0VA 4N0RA 3BIAX 2EIEA 4TTDC 2UWEB 4TNFA 3UDWC 3UO1L 2GBTA 4G6KL 1L9MA 3QDJB 2ID5A 3BVNB 1BF5A 5ABAA 2E9BA 5TQ2H 1F3JA 4QHUB 2ZWZA 3FQ1A 3OWEA 3T4AB 3FQNA 5D1QC 3T6XA 1WFNA 3VGBA 1I85A 2JKIS 4PY7A 1ZA6A 2ZKHH 1XR8A 4FKEA 1HCYA 2Y06H 4GJTB 3RY6A 4YXKL 5DJ2B 5TFSH 4AEHL 3FB8A 1NMAL 2CA3A 5AVRB 4YHZH 1E4KC 4WO4B 1RVFH 3AXLB 3DX1A 3O3EA 3PCYA 5AD0A 4N1CA 3CN2A 3MJWA 3L1OH 1QQDB 1O7SA 3O2DH 4GEIA 1XGTA 4JKLA 3DUSA 4MJ5A 3LB6D 1MI5D 4UTBA 1ET7A 2DF3A 2VERN 3KPMB 4H8VA 4NKIL 4GB9A 3MZTA 4OM0H 1BA9A 1KGXA 2YAMA 1A7QH 2OTUB 1USQA 1X5ZA 3EOBB 4UNIA 4UB0H 4OZFB 3BJ91 4XODA 2LHAA 5DLML 5J9PB 4S1SH 4YSCA 4HUWB 1QP1A 1UM4L 3MI6A 4RNRB 1Q9WB 5HHOD 2VLRA 3IWVA 4Y5YA 3C6SA 4P2YA 1EO8L 3VAEA 2ESVD 3PHAA 1LP9E 3E9TA 5MEPB 5JHLL 3HZMB 4L8CA 4PWJA 5DC9B 1Z7JA 3D9AH 4W9LC 1ZLUK 1JFHA