7PAZA

Reduced mutant p80i pseudoazurin from a. faecalis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTIHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transfer
molecule keywords PSEUDOAZURIN
publication title Site-directed mutants of pseudoazurin: explanation of increased redox potentials from X-ray structures and from calculation of redox potential differences.
pubmed doi rcsb
source organism Alcaligenes faecalis
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 1997-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 7pazA00
3FYIB 4YSDA 4KOBA 4YL4A 5D4HA 1AZCA 1ID2A 1PZAA 1TEGA 1A8ZA 2XX1A 2BZ7A 1XB3A 2XV2A 3FPYA 3NT0A 4YSOA 4GXFA 1WA2X 2XX0A 3UACA 4N4YB 2HLEB 5I26A 1AS6A 1JOIA 3FSWA 3TBBA 3MX0B 3QJTB 1PLBA 3FT0A 1ET8A 1WS8A 1J9RA 3NJFA 1AZNA 1T5KA 1PAZA 4NERA 4E9SA 2UXTA 1KBVA 2BHFA 4DP7X 1AACA 2FTAA 2PPDA 1KV7A 2UXVA 4N8UA 1OCCB 3TBCA 5B1BB 2W8CA 3BVDB 5F7BA 3ASOB 3T71A 2BWIA 1FWXA 1ZV2A 1HAUA 3QQXA 3QPKA 3T9WA 2BWDA 2QPDB 4F2FA 1M57B 1AANA 1AG0A 2AVFA 3H56A 2I7OA 1SF5A 1FA4A 1ADWA 2IDSA 3IN0A 5I6KA 4AKQA 1JXDA 5I6LA 2Q9OA 2BP8B 3NP3A 1TKWA 3OMNB 4A67A 4HALA 1A4AA 4HHGA 2HRGA 3OMIB 1MG2C 1JZGA 2XXGA 1FFTB 1IBYA 4YSRA 1V54B 5B3SB 2GIMA 2JFCA 4DP8X 5I6MA 1M9WA 1MDAA 1WA1X 4HIPA 5B1JA 2ZWNA 4JKNA 4YSCA 4UF7C 2Y69B 5D4JA 4CSPA 4GY4A 3CG8A 4KO9A 1J9QA 1QHQA 5I6PA 2BP0A 1BEXA 5LDUA 1ET5A 2CAKA 2VSKB 2AFNA 2B08A 1BXVA 4YSTA 2VMJA 1JZJA 1BQRA 3UABA 1SFHA 1WAEA 2R7EB 2P80A 3EF4A 2QT6A 3FPXA 3NJHA 3FU7A 3NSYA 1X9RA 2FQEA 4L0PB 1RZPA 5AKRA 3WNJA 4BDVB 2H47C 1A4BA 2IH9A 3PLYA 1GS7A 5I28A 4DPAX 1NWPA 4HZ1A 3FQ1A 3TU6A 1GY2A 1ASPA 2MTAA 4YVNA 4Q8BA 1NDTA 1PLCA 1AS8A 3SBQA 3N2JA 4EF3A 6PCYA 2N0MA 4KOCA 1AR1B 1NIEA 4DP9X 6PAZA 1BYOA 1E30A 1ILSA 1NINA 2YAMA 1SF3A 1AZUA 1GS6X 4BWWA 3OM3B 1JZIA 2BZCA 2LLNA 3DKHA 1AS7A 2CJ3A 2BP0B 4A68A 1JZEA 3WNIA 2CUAA 2EIKB 3PAVA 1L9TA 4KNSA 1AZRA 2PPFA 1AIZA 2XVBA 1OCOB 1TU2A 4NAJA 1W6LA 3CVCA 3ABGA 3H4HA 3JT2A 1DYZA 3NJJA 1ET7A 1R1CA 3FU7B 1JXGA 4GYBA 1MZZA 2XV0A 3OMAB 4DP5X 1BQ5A 2HRHA 2YQBA 1IUZA 5I5IA 1KBWA 3X1NA 1EHKB 3HEIB 2OJ1A 2XWZA 1NICA 3QJQB 3IBOA 3ZIYA 1MZYA 3AY2A 5FC9A 3PAUA 4A2FA 4HCFA 1N68A 1I53A 1SDDA 2EIMB 1GSKA 1ZDQA 2NRDA 1GYCA 2IWKA 1ZDSA 4AX3A 3GYRA 3FYEB 1HAWA 1OF0A 4HCIA 2PP9A 1E65A 2IDFA 2ZOOA 5B1KA 1QNIA 5F7AA 1OE3A 1JERA 4A2DA 2ZONA 4JHVA 2QPEB 1PZCA 3SBRA 1OE1A 2PPAA 2GHZA 1OOWA 1NTDA 4P5SA 1PLAA 1XB8A 2CBPA 3G5WA 3BQVA 3T6XA 3UAAA 4E9RA 1URIA 1PZBA 4BXSV 4K9JA 1PNDA 3EH4B 4KO6A 2IDUA 2FT6A 2YAHA 3AW5A 2GBAA 4F7KA 2PPCA 2VW4A 1SJMA 1SFDA 4GP8B 2IDTA 5AZUA 1KYAA 3WI9A 2OCCB 1PCSA 1DZ0A 2I85A 1J5CA 1L9SA 4A2HA 2XV3A 3TA4D 4TXVB 4FA7B 1XMEB 3AG1B 2DY2A 3ASNB 3NJIA 1SHXA 1JVOA 2EIJB 5TK2A 1WS7A 1B3IA 2UX7A 4G7RB 1ETJA 2BW5A 2AANA 2DYSB 2YAPA 1CYXA 1NPJA 5B7EA 3U25A 4E9XA 2TSBA 2YAFA 1SHWA 2GB2A 4NB7A 2MRYA 4YSQA 4A66A 2GI0A 1QLEB 4AKOA 2X88A 5EHFA 4G7QB 3WG7B 5PCYA 3CDZA 5B1JC 1RKRA 1V10A 2UX6A 2WSDA 3IE9A 4WTQA 2WO3B 1L9RA 1ZIBA 5IY5B 4W9ZA 1CC3A 1SNRA 2B3IA 2XXFA 1OE2A 3NSFA 3X1EA 3DIVA 3ABKB 1PF3A 3WIAA 3D12B 4X4KA 1J9SA 2WO2B 4KNUA 3DTUB 3L45A 4G71B 2XU9A 4E9WA 1A3ZA 3JTBA 4AI7A 1ASQA 4HAKA 4A2GA 4BK5C 4AZUA 2YXVA 3CVBA 1ILUA 5I5JA 1IKOP 1W6WA 5I6OA 2VN3A 3GXUB 4WKXA 3CVDA 1OCZB 3C75A 2FJSA 2GC4C 3ZDWA 4DP6X 4JHUA 1L9OA 4ZK8A 2QDWA 1ZPUA 1ASOA 2VW7A 3NSCA 4KO5A 4GP4B 2UXFA 5TK4A 1OV8A 5D4IA 2BW4A 1NIDA 3ZX1A 1J5DA 3QJUB 2VM4A 1GS8A 3ABLB 4DP2X 1XB6A 4YSUA 8PAZA 3FQ2A 1E5ZA 7PAZA 3FSZA 4HHWA 3CDZB 1IBZA 3S8FB 3UGEA 2IDQA 1RCYA 2IWEA 1AZBA 1NIBA 2XYBA 1KCBA 3T6VA 1KDIA 3X1GA 1MG3C 2CALA 3FS9A 5B1AB 2W88A 4M4RB 1GW0A 4W1TA 1HFUA 4YSPA 3QJSB 1KGYE 3ABMB 3UADA 4QKTA 1PMYA 1N70A 3KW7A 5ANHA 3V9EA 1W8EA 2YAQA 1EZLA 2FQGA 4YSAA 3S8GB 2I7SA 3PPSA 4P5RA 3PAZA 1KCWA 4YVUA 2GSMB 3NJGA 4YSEA 4E9QA 5B7FA 3NYKA 1CYWA 2Q5BA 1AQ8A 4A2EA 4BWUA 3EHBB 3FU9A 3IEAA 2PLTA 2PP7A 1YLBB 2FWLB 2R7EA 2IH8A 1TEFA 3X2QB 4BXVA 1J9TA 2H3XC 2AZAA 4AKPA 1NIFA 1L9QA 3HB3B 2DV6A 7PCYA 2XUWA 4BDVA 4BWTA 1RZQA 5I5MA 1GR7A 4CSZA 4UAHA 4YSSA 2H5UA 4DP4X 2A3TA 2GC7C 5I6NA 2PP8A 3PXLA 1A65A 1CURA 2DWSA 3ERXA 3NP4A 2OV0A 1AOZA 4M3HA 2EINB 2YXWA 2ZXWB 3S3CB 2RACA 3WKPA 4DP1X 2HXAA 1SDDB 4PCYA 1OCRB 4UANA 3N55A 1PNCA 3AZUA 2EILB 5E9NA 1UATA 3KW8A 2VSMB 1M56B 3EH3B 3IN2A 1PY0A 3NSDA 1JZFA 1NWOA 4QLWA 3MBWB 1BXUA 3FSVA 2FNWA 2JXMA 3AG3B 3H4FA 3V9CA 4FAAB 2XLLA 1BAWA 4HCGA 4E9TA 1KDJA 2FQFA 3FSAA 5AFAA 3NJMA 2J57A 3OD3A 1CUOA 2J55A 2Y1AA 9PCYA 2FT8A 1X9UA 3WKQA 3SQRA 2FT7A 4DPBX 2YAEA 2J56A 4KO7A 2IAAC 1NIAA 3SBPA 2DYRB 3RYMA 2CCWA 2X87A 4GP5B 3NJKA 3X1FA 4G70B 3X1BA 1V55B 3QJRB 1L9PA 4G72B 2VW6A 2YAOA 3T6ZA 2P80D 3NJLA 1IC0A 4KNTA 1ZIAA 3AG4B 1GY1A 4MFHA 2YARA 5B7MA 2UXGA 1E5YA 1NPNA 1JXFA 2HX7A 2AZUA 1F56A 3PCYA 3S3BB 2J5WA 1NZRA 1BYPA 2PCYA 2VM3A 3EH5B 4ENZA 1BQKA 1JVLA 4DP0X 4RH4A 2E86A 1WA0X 2FQDA 3FQYA 2QDVA 4E9YA 3OQRA 1AG6A 2BO0A 2JKWA 2HZHA 2PCFA 3CZUB 2TSAA 5PAZA 3ZBMA 3NJNA 4F2EA 3FU8A 3UAEA 1A4CA 1BXAA 4E9VA 1AAJA 3TASA 2PPEA 3QJVB 4DPCX 1VLXA 5A7EA 2BP8A 2DWTA 2HX9A 3S3DB 1E67A 1JZHA 4G7SB 4Q89A 3T6WA 4PAZA 2IWFA 3AG2B 2HX8A 3GDCA
chains in the Genus database with same CATH superfamily
3THMH 3QZWB 1AGBB 2N7BA 4NQXB 4QKXB 4Y5VC 3KL0A 4KI5E 3RY5A 3PIQB 1AZVA 5IMOA 4PP1C 4JQIH 5E08H 5DRZA 1VEPA 1WITA 4EUPG 1RJCA 2YUWA 5F70A 5CEZD 2EDYA 2HH0H 3GJFH 2H0FA 1JOIA 3T0EA 2FHBA 2BVTA 4F15B 2BSBA 3RA7L 1II4E 1H3UA 2BCKB 2ADIB 2R1YA 3T2LA 4E9SA 2DMCA 3V5KA 1KV7A 5ECJE 3U7WL 1SXSA 4AV4A 4BH7B 1N8OE 1V5JA 3F58L 3GS0A 1HSBB 2OFQA 5HDBF 4DK3A 3T71A 4C83B 3QQXA 2VDKH 1ZEAH 3FT9A 5G55A 2FVNA 1V3JA 1M57B 4YHZH 4M7JH 5D7JA 3H56A 5JHDD 5HI4D 2D31B 2LGNA 3IN0A 3GMPA 4X8JA 3E6FB 4HS6B 3MJWA 3QE5A 4JM4H 2YMXH 1EUUA 4ZQKB 5EZOH 4XPHL 2PABA 4A67A 3T0BA 4M5YH 4ZODA 5DMYA 1DP0A 1PCXA 4UTAH 2RIKA 3VTMA 2XY1A 3D07A 3PUUA 4P8QA 1MCCA 4BZ1A 5TQ0L 3N85H 1EEYB 1FDLL 1MI5D 4YWGH 5FYJE 4QJ3B 4G9FB 3CHQA 2HYMA 4YFLF 5EPMB 5FGBA 3WHXB 5I6MA 5JOFB 1M9WA 3SCMB 4XN8A 2NT1A 1XO8A 1Z0MA 3Q3GB 3UOAB 5IMLA 2F5AL 4TM9A 2V33A 5J6GB 2ADJB 3GNML 3B3BA 4QDGA 3PL6A 3QT2A 4J3OH 4BELD 4L3AA 2EUXA 4JFUA 1DQDH 4TTGA 3W56A 3WEXA 3EDJA 3V4PH 3F04A 2XWEA 2BOCA 1TXKA 1T1YB 2WZ6A 5EU7E 5DR5H 3TN0C 3DUUA 4RMWA 5FIEA 3UABA 2IPTL 1WAEA 2QPFA 4FADA 5D7LA 2FR4A 3QI9A 1D9KD 1OLLA 2UY6B 3U9UB 4E9LA 5I2IB 3U6RA 5EOCH 3FQTA 4XI5C 1F8TH 3FT4A 4LQFL 4XCYB 5SX5K 3KPSA 3GM0A 3UTTB 5K9KA 2DQFA 3L5HA 1M1XB 3C8HA 3RVWD 3BH9B 3L9RB 2IWGA 1E90A 4TL4A 5EWIH 1JTTA 2IPKB 4YDVA 3TBTB 3GGWA 4N0YL 1ZLUH 1WZKA 2N59A 2YPLE 3GSNL 4TUUA 1GTFA 2EVIA 5DI8B 4L8CB 1CU4L 3MV7A 4LEOB 4LLVB 2R0LH 2HTLC 4LPXA 1JPGA 1I1AD 1NQBA 1NIEA 2OTUA 2RA1A 5D2NB 1NINA 1SDYA 3HFFA 2G3MA 4DEPB 3HG5A 3ULUF 3ME0B 5CWSB 3V0EA 4ZO9A 4OJCA 4PJFB 4JHZA 4Q0XL 2V0AA 2YRLA 3MRQA 2P8LB 1I9EA 5DHVB 4QTIH 1ACYL 4KQ4L 1DL7L 2XA8L 3I84A 1FIGH 3OJVC 3MLUL 4LLQB 1AXTH 2P8PA 3ZGHA 1LDPL 4QYOB 5HHVH 2XVBA 1TJMA 1I85A 3CQPA 4KI1A 1YA5A 2A73B 4W9CC 4Z3FA 5EZPA 4HSQA 4DGIL 4QRRA 3BMVA 1YQVL 4GSRA 1ZHKA 3QORC 4CC4A 2CGZA 1E7VA 3VCLB 1KTDA 1EK3A 2Q86A 4P2QA 3VG9B 2H3NB 1S9YA 3MRPA 4WV1A 5B8CC 4Q74A 4IRSD 5DS1A 4X42A 4JL2A 1CDJA 3VI3A 1HNYA 3SKMB 3WMQA 3DO3A 4MJ5B 1FCCA 3IBOA 5AB9A 1X6LA 2E7CA 5C8JA 3IGAA 3V52H 1XXDC 3GSNB 3K91A 2VQ1B 3TTSA 1XGPA 1DUYA 2GSGA 1USZA 3NIFE 1HHHA 1N5AA 3L7FA 3ELQA 4BFIA 4DWHA 1E4XL 3W3BA 4PGJA 4D9LL 1TNNA 2YGQA 4R0LC 1DANT 3H9SE 5F96L 4N24A 2DLFL 5I19H 2IGFH 4J1UB 3GBLA 2FATH 4QIRA 3O4OC 2P5WB 2W81C 2ORBH 4JO3H 1KBGH 2X38A 1FAIL 3DROA 1UKQA 4OJFL 2LFGA 2EH8H 2N0KA 3U83A 4IU2B 3MODL 5DJAB 4RGMB 5KBLA 2GEEA 4XAWH 3T3MB 3KM2A 4APQD 2OYKA 1W0WA 1UASA 2YRZA 1IQDB 4NNPL 4ZFFB 4PH8A 3WFCH 3BXNB 1DDHA 4KO6A 1D5BA 3C5ZA 2GJ6E 4BFFA 4I2XA 2OR7A 2YD5A 5K93A 1BLNB 2DQDH 3EGXA 2C9PA 3VD5A 1YC7A 4XO5A 2NUPB 2O5YL 1J5CA 3W9EB 1DBML 2G2RA 3CE1A 4K71C 4TXVB 4NCC1 4L1HA 4JVWA 5C0CA 1MFAL 2DWEA 2J6EH 1W15A 4Y16A 2UWEE 1SHXA 2EIJB 2EADA 3SPIA 1CDIA 4MA3B 3POHA 4X6CF 5DEGA 1XCTA 4C54A 2C1PA 4UU9B 3SJVD 3IMTA 1TT6A 4QRFA 1UZ6F 4G8GB 1QFOA 3QRLA 5ILTH 4G7QB 1CGTA 4HJTA 2MNWA 1NCBL 4WTQA 5FKAB 1W72H 2QGDA 4NUGL 4B27A 4ZXBD 1BVNT 4U7SA 1M3IA 3NA4A 1IFGA 2X4SA 1QATA 4EUPA 5DWUL 1JGEA 2XJKA 3AQXA 3NDZE 4WKZB 2E7LA 2YLHA 2OLDA 1VGKA 3FCUB 4OQTA 4ZS7L 3ZQWA 4ZW5A 3CXHJ 3DTUB 4ONFH 5DMKB 4KQ0A 2H41A 4GI6A 1HZLA 4NO3A 1QOKA 2WQ8A 1FL3B 1PFCA 2Y3AA 1HKLH 5ID1B 1L9MA 3WYRA 3QIWA 5E9AA 2DQEL 4ZO7A 4KKAD 4ZX6A 5I1CL 1IAIH 5KBKA 4G5ZL 5D4IA 3FQUA 4FXLA 2ZX7A 2ICES 2VQ4A 3WD5H 1TJGH 4J3OG 5I66B 1AGEB 2ERJB 1QI3A 3LDBC 2Y5TB 1F6FB 1WO2A 3MNZA 4GRWH 5HGDA 4P05A 5IMKA 9CGTA 1Z1WA 3DRQB 2G75B 5L8JB 1QUNB 4YZFE 3BKYL 1KT2B 1X7QB 3FOMA 4Q6IB 1RUKH 1QRNA 4NEHB 4MCYB 5E5MA 5F1SA 3TZVB 3ZRSA 3LEXA 4QAMB 3RBGA 2CBQA 4WWKB 1YPZF 2J2ZB 1W9XA 2ADFH 1ZK5A 4DVRH 3SQOL 4JPIB 2BSEA 3AWGA 3U0TA 1CTOA 1UD6A 2B59B 3BKMH 4J6RL 1FYTD 2P24B 4JRXB 3W39B 2FQGA 4YR6A 2NDFA 3L3OB 5DD1H 4NN5C 4AJWA 1KCWA 3T8XA 1ZV9A 2MIZA 3F7LA 5EUOA 3VH8B 4MDIA 2OBGA 1Z32X 4R4FL 3DYPA 2EC9T 5SX4H 1C12A 2VLKA 5EO9B 4BWUA 4EIUA 4OUUB 4E41D 5LWYL 4KHXH 4W4OC 5C97A 5F3FA 6CGTA 4K8RD 4AGQA 1D5XA 1R24A 3GMNB 4BH8B 4X8XA 4PR5B 4C55A 4FZ8H 4JZOB 1BAGA 1M7DA 1J0KA 4HS8L 2O6FA 2ZZUT 1KPUA 5IEKA 3ZKMC 1A6ZB 5KYYB 1DO5A 2AZAA 3MLXL 4N2HA 4MNGB 2YS4A 2DB8A 1CLCA 4HC1H 1QPXA 4M7ZB 1UFUA 1DJIA 3DPBA 2XUWA 5I5MA 4WNJA 4OAWB 1N7MH 4LSUH 1BV8A 3VGDA 2ZUQC 4Y2DB 3WKYA 5IUCA 1KIRB 2AJYH 2A9NH 3AQZA 5EBMB 4QY8B 3ZMRA 4ODSL 3K2UH 5AVXB 1H3VA 4FYQA 4RFOL 3HG1E 2CHNA 4IEFA 3UXFA 5JIMA 2YXWA 2O1AA 5JW4M 2BNUA 2EE3A 1IGTA 3IDNA 5DEJA 1MQ8A 4ZMWA 2VZTA 32C2B 2EILB 4GRWE 4NUMA 2VITA 2HKFH 2V6HA 3BFWA 1OP3K 1K8IB 3QAZC 4P5KB 4I77L 1XF1A 2W07A 2WXNA 4PRPB 4JPWH 3T09A 2ZOKB 3BEWB 3TIDB 5CP7B 1I8KA 1JNHA 3KH3A 5F9OH 4MDRA 3O3BB 5AFAA 1A0QH 3M1BA 1MFEL 2H3KA 2LT9A 3ZLQC 4PS4H 5DVNA 3TURA 3ULUD 4J3VA 1OXYA 3DX6B 1SM3L 1XSOA 5KBPA 2J7LA 4K7PY 5L2KD 1LHZA 3BW9A 2GEQA 2EDFA 4IRJC 2CK0H 1MVUA 3C08L 3EDEA 5KSAC 1F41A 1RPUA 1KMGA 1WBYA 1Q9KB 3CSYA 2PYEE 3GMQA 1HH6A 1NUFA 4NP4H 3FJTA 3PDOB 4JANA 4XOBA 4BFNA 4IBUA 4GIAA 1JXFA 5I15H 5EN2B 1IEBB 1JGVL 3HMWH 3RZCB 1V8HA 4JFEE 5AYTA 1N5YH 2VM3A 3HE6C 3ZDZF 1T1WA 3IPEA 4FQLH 2R8SH 1HCYA 1D6VL 3X3GH 2O6DA 1OSZA 3SE6A 1S7QA 1MJUH 4BE5A 3QORA 1CGWA 4MA7L 1INDL 3MUJA 4O2EB 4APXB 4F8QA 3CC5B 5PAZA 2IG2H 3US9A 5IFHL 2BY3A 5M95B 2X7LA 3JWDH 5B8CA 4OIAA 3VXRD 4DPCX 2Y6SC 5JW4Q 2L7UA 1O9VA 2BSCA 2QFRA 3AAZB 5A7BA 2AW2A 4G7SB 5FXCH 3KBFA 3T6WA 4GSQA 4UQDA 4UIKH 2EEXA 2IH3A 2IWFA 1CICD 3WHE1 3AM8C 4ZTOH 3D2UA 4KDWA 3RRQA 3UFIA 1OAJA 4M6NH 3KPRD 3EFFA 2XV2A 2ZWZA 3CN0A 4OGXH 4KJWD 3U4AA 5C3TA 1G7QB 4AL8L 4EXKA 4PG2C 4JQIA 3VSVA 2J8UF 3S0PA 1IM3B 3RX9A 4X0NA 3ZHKA 5E9DB 4I3RL 2BIOA 3US1A 1JJUA 1T6VN 3GJFA 4F7TA 3GIZH 2A6IB 2Q3XA 5CKAA 5DJ6A 3CN3A 3NTCL 1LO0L 2QSQA 3HLAA 3LEYH 2NQCA 4JM2C 3QDME 4ODWB 3MR9B 4DGYL 5JUEH 1LO3L 5ADOL 3EOAA 5EBLB 5CZXC 1KC5H 5B1BB 2A1WL 1UD3A 2OCFD 2BWDA 3X11B 2DN7A 3PWPE 4KWUA 3SPJA 2F5BH 3RTQA 1GGBH 1MCQA 5IV2B 5JMOC 5FA4A 5KZCD 4EPSA 4D7BA 2EABA 3NP3A 4JFPB 5I75C 3BEVA 2AJZA 3VVVA 1WRFA 3VXTB 3QQ9C 2AABL 1Q94B 2ZYIA 3FO0L 2MOGA 1AO7E 1U3YA 3UJTL 3V4LA 1NSNH 1D7BA 4UTAA 5IEHA 2GIMA 4Y4FC 3FQXB 7FABL 1KPRA 2CLVB 4TVPL 1FNHA 5FUOL 2AJ3A 5DZAA 3IXAA 4R7LA 1XCXA 4TLUA 4GG6F 3FAXA 3UTZA 3AXLB 5ERWA 4BQBA 1UM5H 2F7QA 1NA8A 1CDHA 4HU8A 2Y69B 1CL7H 1DJYA 1HXMA 3PWLA 4U7MA 2NNFA 3QDGD 1CB4A 3QZNA 4JN2B 5D5ME 1RJZA 1S7TB 1QHQA 2V2XA 4AH2A 3O6KL 2VLRE 2YUZA 2EXYC 2WBKA 3O3EA 2PR4L 3T0AA 3ZSTA 1AHMA 2GITA 4PJGF 3G04A 1LWJA 5TFSH 3A67L 4PRID 1K6QH 3S5LG 4B9CA 4D9RE 1AKPA 3I02B 5FHAL 2NTFA 1OO2A 5LBSH 1AQKH 3FPXA 5LXGH 5CJ8A 1W2KT 2QFPA 1CGUA 4L5FH 1RZ7L 2C4XA 2H6UA 3MGOB 1BJ8A 5I1DB 3FRUA 4PGDB 3NPSB 3MV8D 3RAJL 1FCGA 3UTSA 4AT6B 5I1EH 4PJ8C 3H9SA 1A3LL 4TQEH 5JXEC 2Q7AA 3QEHB 3IAGC 3K6FA 1A6WL 1B0GA 3ESVF 3K6NA 3ULAB 1J8HD 3A5VA 3SBQA 4ZMXA 2W0PA 3A6CL 4HGKC 3IDXL 4XTRC 1OTTC 2HFTA 3NIDF 5D70L 3RI5K 3RL1B 1C5BH 2MPVA 4K55A 5FEBA 3WS3A 4PLNC 5CIPH 2AAAA 4O2FB 5DVKA 5KVFE 1NDGB 5DURB 1IV8A 4GKLA 5FO7A 1SMOA 2CUIA 5F7YC 1IZKA 5C0EA 1CLOH 2GJ6A 2GUYA 3MRIB 1U91B 3KCPA 1AE6L 4X0KA 3L4VA 4A68A 3KGRA 2F74B 1DZBA 3JUZA 1BVOA 4EI5A 2W60A 2PPFA 2VAAB 4OLXH 4YHOL 5BQDA 3RVTD 3VW3H 2FEDD 1I82A 2DI9A 3HE7B 4AIEA 2UWEA 2ATPB 4PS7A 4KTGA 3RX8A 2QHRL 4G80B 3ARXA 3DV4B 1MZZA 1IC4H 2X3AA 4UDUA 4XZ4A 5FCUH 3ARVA 3WLBB 4JY6B 2DEXX 5C0BE 1I1FB 3VD3A 3CH1B 5I16A 5T1MA 1MHEA 5JNYA 1Z9MA 2C9RA 1U2HA 4LF3A 5HVHC 3RDTA 2JCCB 4JDTH 3CQFA 3MRNA 4LAQH 4WEEA 2L8AA 1S5IL 2C3VB 4G8FA 1OD9A 4XNXH 4FG6D 5GS1C 4WO4A 1L9NA 1INEH 1QX1A 2Z0BA 3S5ZA 2X1PA 3EFDH 2HTKD 3POCA 4KXDA 1OL0A 1DLHB 2PCPA 5J11C 1RZ8B 2ITFA 2R2BA 3QXAB 3HIZA 2IWKA 3B2UD 2P45B 5DJZA 2Y06H 4PWEA 2XIBA 1C16A 1RIHL 2NR6C 4L5FE 3Q8CA 5T8IA 1WHOA 3OQ3B 3RVUC 2JTDA 3PHAA 2Z7ZA 3AACA 3G6JB 3ARED 1HAWA 4OD3L 1IU1A 1FJ1A 1RK1B 1A6TA 2O30A 1IGIL 1N3NB 43C9A 5L4MA 3KDMA 4P5MA 5BXFA 4HJEA 4RFNC 4Q9QH 4OZIF 5GZOC 4PJBE 1JERA 1H3GA 4AV0A 2ZONA 3Q2WA 4YX2L 4PJAE 4Z7WF 1XCWA 2BH0A 4UBDD 2VDRL 3AU1B 3QEQB 3NZ8A 4Z3IA 3K71B 4XVOA 2CBPA 1V3MA 3P73A 3DMMB 4OZGF 3ZYJA 3H2QA 2F53B 2QQKL 4BKTC 2HG0A 4PJHA 2O5ZH 3VAEA 2IFGA 1GC1H 5FYKD 2WQSA 4X9IA 4H1LB 1K2DA 4KROD 2ICEC 5AZUA 5LO7A 2ZG3A 5BMFL 2OCCB 1HK6A 3DUSB 2I32A 2PXYD 1K5WA 2FHFA 2X6MA 3ZSSA 2WK2A 1UM4L 4A7UA 1XMEB 4NX0A 3A4FA 1IC7H 1BF2A 4MA8L 4U0QB 5E94A 1T7ZA 4IRJA 3MKGA 3DDFA 4KDTC 5AZ2H 2BXZA 2GJPA 2J6EA 1ETJA 2YMTA 1RAMA 5IB3B 3B2XA 5E00B 4P9HL 2FIRT 3GSOB 3N1FC 4NB7A 1M4KA 4EDXB 1ZCRA 3VFWB 1IO4C 5CN1A 1R3HA 2EAEA 2HVJB 3CFCH 3OAZH 1EPFA 5C0AA 4FOMA 5ECGA 2A99A 2WSDA 5DRWB 5TPWL 4HK3N 3RVXC 1A4JB 1G7IB 1VESA 3QIBB 1W72A 2FBJH 2Y36L 3V5HB 4QHMB 4ZW3A 3KHOA 3NAAL 1U95B 1K4DB 3HR5A 2VDRB 4RGND 3WIHL 1AQDB 2X2JA 1FNFA 4XO8A 1WT5C 4EBQH 3F7KA 1Q8MA 3GKZA 5I1IL 3HFMH 3UC0H 3V4VL 4CSTA 3M07A 2QR0B 2OTWA 3TV3H 3ZL2A 4J12A 4MWFB 1XGYH 1IAOA 3FF7A 4AXWA 1U3HA 2DIBA 4MBOA 4JQXC 4R4BB 3AM8A 1R75A 3E6HB 2AJXH 2YEZA 1QSEB 2OM5A 4Z3HA 1F4XH 3NUKA 5CJOL 2GC4C 4KAQL 3WN6A 1NCNA 5A2BA 3GRWH 4U1LB 1J1XH 3SKOB 3CZFA 1ZPUA 4H0LC 1YMMD 1F1GA 1L0XA 3KPLB 2QKIC 4JDVA 5CEZH 4PG2A 5H37H 4G42B 1ZXKA 2LLGA 2J1YA 1FC2D 2NY0C 5CZVH 3DX8B 3PU7A 1G0XA 4F5CE 2IMNA 4IS6B 4Z7OF 1RP8A 4Y8AA 2X4UB 5E2WL 1YEIH 2Y7MA 5C3IA 3QUXC 3EDFA 3VFGH 1I9RL 3NCJL 4JM2A 4MHHG 5MHSE 4AMKH 3Q5OA 4HFWB 1A6VL 4QWWD 4OLWL 5F1NB 3BWUF 1MG3C 5C9JB 4JR9L 3BLPX 4DGWC 2BMKB 2XSKA 1L5GA 4M4RB 1JZ4A 3BSZL 2P46B 3GSRB 1XGQA 3RNQB 5F7HA 3QJSB 5F7UA 1MSPA 4TUOB 3V4VB 3N0PB 5EOTB 4IKLA 4FYTA 3UO8B 1JF1B 1NEZA 4JMXA 3V9EA 4ERSL 1CQYA 2VC2H 4Z3EA 1SJEA 1EJOL 3LSOA 4XMLL 1O0VA 4W9FC 4AGOA 4PD4J 4YSEA 2PYEA 4Q97A 5KWYC 4WUUA 5ICUA 4ODVL 1JDDA 4GKZA 3MRBA 1AQ8A 4PJEB 5CHNA 1JI1A 4K73A 3UPCA 1RJLB 1CDBA 3TBSA 2GQHA 4P23C 5LN8A 5DT1H 2IH8A 4LVNB 3T2NH 1NMAL 4OCXH 1UWGL 1MRDH 3GB7A 5EU4A 5J06A 3VFPA 1XIWA 4MTMA 3IS1X 1HCZA 3ZDXF 2PWFA 1BOYA 1L9QA 1UJ3A 4XC3L 3UTQB 5MERA 5K69A 2ROYA 2X4OA 3DETD 4BDVA 7PCYA 4YUEH 1XCQA 1FFPB 4Y4HB 1N0LB 1FF5A 2XOTA 2E27L 4HC1A 4K2UL 4XH2B 4OZ4B 4Y9EA 1VCBC 1SHMA 3VDCA 4E42A 2X4TB 4QHLA 1U93A 2V7NB 5C0RH 4L18A 3M7FB 5HHMB 1KEML 2F58H 3CSFA 4UDTA 3IDYC 1GMEA 2VXSL 2VDPB 1MFDH 2B1HL 1I8MA 1CVRA 2DLTA 1G7MB 4EZJA 5E1AA 5EO0B 1B4JL 2HLAB 5KANG 3CQQA 1XF2B 5T1LA 5HHQB 2R9HD 1G1YA 1HCFX 2FIKA 1QVOB 2VSMB 4NNYA 4NWUL 1OARL 3JYCA 2OX5A 2RR3A 3WE1A 3D52A 2WXOA 3GXIA 3AITA 5B38G 4TUKL 4FAAB 1FG2B 1U8CA 4PUBL 4WI7A 1GC1C 4HWZB 4ODXA 4X99A 3BAKA 5JXEA 2I07A 4XP9L 2J57A 2UV3A 3IFOB 3TEYA 2JIXA 1QA9B 4DAGL 4PJ7E 1H15A 4B9YA 3IKKA 3OXSB 4KO7A 4U3SB 1KB5B 1KIPB 4PJXA 2G2PA 2FJFA 3D0VB 4K5OA 2ALAA 2YQ2A 4ATTA 3DPDA 4KQ3H 1U8NA 2UZYB 2YAOA 5FHBL 4DTGH 3ULVH 4XNUL 3ZY7A 1MUJA 2J5LB 5DA4A 3WN5C 3UPRB 5TD4A 1B2YA 1FHGA 1OGAB 3NH7L 2HUEA 4WEMB 3PWPA 3EXLA 3NFSH 5I8EA 5JO5B 1FZMA 4FTVD 1MI5E 1BYPA 2CIKA 1NC4D 3O6LH 5D2LE 2A9BA 2RB8A 1UOWA 1L6XA 2ODHA 3HI1B 4GAYB 3WDJA 2AC0A 2HUHA 4YDKL 1IKFL 3CFEB 2PW2A 4JPVH 4JFDB 4XC1L 3SDAB 5DVMA 4NPKA 1N2RB 4FQ2L 4Z7NF 1AAJA 2VJ8A 3TASA 1CBVH 3QBTB 4ZAKB 4HXAL 4UNIA 4ZUSA 1ZHBA 3LX9A 3IDUA 3WFBH 3HNVH 1P6FA 3EUDA 5A7EA 2HX9A 1QFWL 4XN4A 3VRLE 2R4SH 1B4LA 4Q89A 4TLSA 4QRBA 5GS1A 4PJ5B 3GUTA 2ETWA 1UEMA 5FFOA 3EHBD 2OR9H 3BQUB 2A6KB 2DJMA 3FO1B 1TEGA 2Z8RA 5D5MA 2EE6A 1WGOA 2NR6A 4LHJB 4W9KC 1EAPB 2CRIA 4KZCA 3KDPB 2VLRA 3X12A 3GTNA 4HPOL 4N4YB 1CFSB 1N26A 3G08A 1DVTA 1HSAB 4ISVA 3TBBA 4HEPG 4S1DD 5F21B 2OK0L 1TVHB 2AK4D 4GKOA 4IRZL 5DZOA 5AL0A 1DBAL 1OHZA 2XWBA 1U36A 1OWWA 1X5LA 4N9GB 1B3JA 4FKKA 3R8BB 1PAZA 4EJ1C 3F6IA 3RL2B 3U4KA 3EO1B 5CJQH 3EYSL 2EO9A 4UOZA 2K4WA 1TG8A 1NGYB 1M7XA 2CNZA 2F54B 3EDKA 3UYRL 2OMYA 4F8OA 4RSYA 3BO8B 3GK8L 4F2ME 2QGCA 3GF8A 3V0WH 4JGMA 3MJ8B 2NXYD 4EN3D 1QLEH 3SE3C 4M03A 1XH3A 1HAUA 5E1HB 3ULVE 5BS0A 1DBKH 3QDJD 1IX2A 3APNA 3SZKC 4PV9A 1J12A 1R4XA 3EGSA 5JQIB 2K8MA 3VQ2C 4G82A 2K0RA 2D7OA 2IDSA 5LCVA 1U3ZA 5IB2A 1B0WA 5H37G 5HI4C 3TPUB 1E8XA 4ZFGL 3QNXA 5H8DA 2OYMA 3VXMB 3S88L 1JWMA 1K85A 1S5HA 4KK5D 4LU5L 4W4NA 4KDTA 3T3MF 1WPCA 4KV5F 4LP4A 1MEXL 4XODA 3FTZA 1CYGA 4YFDB 1EBPA 1EMTL 3CVIH 3DVNA 3QJZA 2AEOA 4BSVB 4DFIA 3LIZH 3MJ6A 2D7TL 5B3SB 5ID0A 4OLEA 3LB6D 4KTYA 4BZYA 2DQUH 2OMUB 1IBBA 1ZANL 4TV3A 1SLWA 4IJ3C 1M7IB 4ZBJA 3B8YA 1ETZB 3LS4L 2NDGA 1XZ0B 2X10A 4PSRA 5LGHL 4QRPD 1EGJH 2EE9A 1TYEB 3QHZH 5HYJD 5I1GH 3VQ1C 5C0BA 5C08A 2VR6A 5LDUA 4OFYD 1WT5A 2KL6A 1U0QA 4C56B 1DE4A 5EU6B 2J71A 4LCIH 3OL2A 3UZQB 4L4TD 4D8PB 1SVCP 1ZAGA 1MCPH 3TL5A 2YRPA 3KPQB 5I1KH 4XCEA 1AR1D 3MA9L 4Z8FH 3DWTA 3WIIH 1D5MA 3K6SB 3SDXB 5LBSA 4JQXA 4PJCB 4GQ9L 1JXKA 1YY8B 4NQSB 3UDWC 5DJ2A 4PRNA 3TEZA 3VJ6A 4P0DA 1B0IA 1RIUH 1RZJL 4MX7B 4K5NA 3S3PA 1ES0B 2OZNA 2IH9A 3NFNA 3OTTA 5DXWA 1ED3A 1E5AA 3CH8A 5JZ7D 1FH5L 4M1GH 2HMIC 2AJSH 4MA1C 1NFDE 3OAWA 4PJAA 4AENB 3OWRA 2KKQA 2JSFA 4NQDA 4UT7L 4FFVD 1E30A 3O3AB 4NQVB 3QUXA 1J0YA 5G5DB 1E28B 4M8QB 5SWZB 4FI7A 4HUUA 1IAKB 4HWNA 1GAFL 3MLVH 4M9OA 5BZWB 3OX8A 1SUJA 2VR3A 4OCLC 5EEWA 4J3XA 3SD2A 1AFVL 3MOAH 1W0VA 4YDMA 4JL1A 5B3JF 1ZKAA 1VKXB 1OCOB 2OMZA 1CCZA 4K7FA 1KNOB 2QADC 1NOLA 4PS8A 1ZWIB 4QXTB 3SKNB 5K9QG 4EDWH 2ZUTA 3F5WB 1LE5B 3CFDB 1RUAL 3BVNB 1F2XK 3WTSA 4DGVH 2HJKB 1VB9A 5GS0L 4Y19E 1BQ5A 1PPIA 4AYFB 1S8DB 3DIFB 4MZIA 2WSKA 5IB5B 4ZO8A 5INDA 3HEIB 3S35L 4L8DA 3MNVA 4LEXH 1F58H 5F9JB 4K8RH 1JAEA 5HDQH 2EKJA 4WW1B 2CU9A 4P23A 4OR1A 3ARSA 4U6VH 1PSKH 5EUKA 5BO1H 5H4YA 2X0WA 4Y8DC 1AKJB 4OKVA 1I53A 1KCUL 1TQTA 3S6CA 3KJ6H 4OCRL 5MENE 4WJ5B 1G9NL 2F19H 5B38A 4G9FD 3WFHB 3OR7A 1N64L 5IROD 5SX4I 2K6WA 1QACA 3DX4A 3HS9A 3SCMD 2ARJQ 4RMVA 2CCLA 2C3GA 2K70A 2VLMD 3QUKB 3N6YA 2QPEB 2BSRA 1PKQA 1J0ZA 2EIEA 4JKWA 5FYLL 1T5WB 5D72H 1I9JH 4RIRB 3MCYA 5ALCH 1MPAH 1QSFB 5HDBE 1F3JA 1EFXA 5EIIB 3LV3B 4QHUA 1OTSD 3MREB 4ZS6C 4Q52A 3F7VA 1HYSD 5HYQB 2B1AL 4APQC 1YYML 1NDMA 2OYLA 1I3RB 2OAAA 3UP1A 5K39A 3D9AH 2WVUA 1SJMA 5GRVK 4J39A 4ACPA 5F7KC 4B9FA 4OVVA 3ULUH 3ZQXA 1L9SA 3PGCB 5F6IB 4NO0B 1X5MA 3LRSB 4IMKC 1ZTXE 2PMZA 3ZPDA 1NM4A 5TK2A 4L8SB 1WS7A 4J28A 5BRZA 1ZXQA 2HN7A 2EQDA 3A0OA 1QWHA 3MXWH 3U9PL 2XVKA 3HZMB 4N6RA 4HV8A 4JREB 5BPPA 2P8MB 2APBA 4M6AA 1F6AB 4PRBA 4YXLL 2IV8A 3BP7A 3WEMA 3QXDA 2JKNA 3QJXA 4E41E 1BZ9B 1O75A 2NNAB 2ADGB 3MJ7A 3WG7B 5J57B 1FO0H 1ZVSA 3BDBA 1MH5A 4HKZB 2YXMA 4M7LH 2UX6A 4OIIL 5FGCE 4QXUH 4D7PA 2Z6FA 3ALXA 3Q8FA 5DLLA 1X3DA 4RMUA 3KNBB 2BHUA 1G6RL 4MJIA 2E0PA 1YEJL 5JW5A 4ZXBC 3SPVB 4WK0B 2FX8L 3M7OA 4WENB 5IVXA 4BFRA 1Y0LB 4I3SH 2BIIA 4HEPA 4AIZB 2DAVA 3QEGL 3U82B 5EFIA 3W9DA 3FFCB 5KSBE 2M2DA 4G71B 2XU9A 3FN3A 1ASQA 3ZYIA 3U7YL 3MX0A 4AZUA 1JF5A 2DYPD 1QLRA 2XWJA 3IYLW 4GB9A 4W9IC 4M7KL 3WMSA 3WELA 4HAGA 3VRJB 5I6OA 4G1MB 3R8QA 3S4SG 5J12B 5LNDA 1FNEA 2FJSA 4L9DA 4MGXA 1CGSL 3L4WA 1AD9B 4N1EA 3NSCA 3RY4A 4OLUL 4PIRF 5L8KB 4RGOL 5F93C 2XFXA 4OJEH 1JNLH 4U1NA 5C0NC 2WB7A 3QNZA 4KHTH 5KVEH 5H37A 4QHPA 2YZ1A 3PNRB 4F7PA 3F64A 4X6FA 1JI2A 3H55A 1Q9LB 3SE9L 4OT1H 4CBPA 1U2YA 3NRFA 4MQSB 1QR4A 2EDEA 1HHJB 3PP3K 3QWRD 4HWUA 4N90E 5KUMA 4FS0A 5L2KE 3Q1SH 1E8YA 1T0NA 4QNPE 4GLRH 2Z35A 3VD9A 1NFKA 5IQMA 3KPPA 4WCYL 2VZUA 4L1TA 1ZLWK 3SE3A 5F9AC 4WI9A 3AUWB 4N5EC 4YQXH 3TT1H 1LK3L 3HVDA 3KS0H 3ATDA 5LAXB 4G6ML 4X5XB 4XCNA 2G3NA 4OB5H 2X1XR 5JHDA 2H9GB 5FUCE 3LQAC 4WFFE 3S8GB 2XWCA 4P57B 4ZYKA 1A3RH 2FWOB 5ALBL 3AXIA 5I1JH 1CR9H 2Q3AA 4B9ZA 5ICYB 3EJZD 1LO4L 4WI0B 3VFVB 1E27B 1AGFA 3IEAA 2BIQA 4TL5A 3TIEA 4E5XB 1YNTF 2GIXA 4I3GA 4X5WA 4UM9B 1UWXH 3FTGB 2R7EA 1E9PA 3GHEH 3W0WB 1MI5A 1X5JA 3FCSA 3NEXA 3PGFL 4GO8A 2WINA 1ROCA 3TO4B 3RNKA 1P84J 2FZ3A 3HG4A 4NNXB 3L7EA 4G8GD 1J0JA 4PY8J 3W5NA 2ZXEB 1RZQA 4GW5B 1DFXA 2F8IA 5IHLB 4ZOEA 4Y7MA 3KPRE 5DRNB 2AEQH 1C5DA 3BGMA 4P9ML 4TLKA 3D3VB 4ODHL 2EUZA 4GUPB 4DESA 4XO3A 4C4UA 4UT6L 4YDLB 5AAPA 3FB5B 4FI8A 5I30H 1XVSA 3TESA 1HQRA 4LARL 1CL7I 2NX5B 5KVEE 4PCYA 1D9KA 3X14B 4F80A 5MEPA 3NDYE 1I1YB 4UQCA 1C9SA 2B4CH 1GPOH 5FX3A 1U58A 5CCGE 1X5GA 3PJNA 4PJIB 4YPGA 3IFNL 5D96B 3M6DA 4NZUH 3FT1A 1KJ3H 3ARWA 3H4FA 4JLRA 1ZT1B 5JOEA 2RJMA 1MIML 2ZF9A 4HHAB 1E9QB 2P5ED 1H0DA 2D3LA 4MHHI 3WXVH 3CUPB 1R3KA 1RMFH 2G0KA 3LRLA 4AC4A 2VT0A 2R0KH 2R23B 3RGVA 3ULUC 5HYSB 2FT7A 3BCFA 3HS0A 1KBKA 3OKEB 5KYXB 4I48B 1NIAA 4HDIB 3ZT7A 4BIKA 3OB0H 2DYRB 2X6CA 1O7DC 3OXRB 4Q2ZB 5GGQH 3X1FA 4GP5B 4DVBA 1I1AA 5KSUA 3FULA 2OMNA 4LLWB 5KS9B 2DIEA 2GTWA 4G6JH 2MHAA 3MROB 4FXKB 1TZAA 1J10A 2BK8A 4NM4H 2JI1A 2O5NA 3K2MC 4OCYH 2CDFB 3FUDA 4K94H 4C4KT 5GRYA 1A5FH 1SN0A 3PV6B 1RZGA 5E56A 4L0YA 3E1F1 4FP8H 2AMUA 3TZVD 3O2DA 3ZE2F 3P4MB 4WWKD 4U1KA 5MEQA 1JK8A 3OQRA 1LO5B 1SY6L 4IMLA 4Z78A 4JGUA 4F9PC 3F05A 3ZBMA 3NCWA 1JWUB 3QDGE 4R97B 4TSAH 3T2PA 4F2EA 4E9VA 4WNQB 2XICA 4XGZA 4JRXD 1SBBA 4KC3B 1XMWA 1Z5YD 4IRSA 1AHKA 4JGJA 1UB6A 3Q6GH 1R5VB 4PAZA 5F97E 4PRIE 3L5WB 2X2YA 1LTXA 4JE4B 4LKCA 5D1XB 2CO6B 4G7VL 4JKPL 4OGAC 4UUJA 1YEFH 5GGTH 3ZUCA 1HILB 1AYOA 1R3LB 3FO9A 1ZTMA 2JV6A 1VFBB 3DX9B 4KRPB 5JW3L 3BP6B 3DLQR 1INQB 1WA2X 2XX0A 1ADQL 2BNQE 3MRDB 1DSYA 4FQXB 4N0UE 4KJWC 2HLEB 3QISA 1RERA 4OCWH 1WYJA 4IBQA 5L8LB 3FSWA 1GKOA 3QJTB 1PLBA 3QYNA 4PREB 4M5ZH 4WFGE 1UQSB 4UNVA 1PTZA 2RHEA 4Y2DD 3EO9H 3MUGB 2KLRA 4A55A 4NQCE 3ZDYF 4OF0A 5GRUH 1QG3A 2UXVA 1YPZE 3JTTA 3ZZ1A 3D0LB 4LFHG 2EDMA 3NCEB 4HFUH 2ZOLA 3NK4A 2Q6WB 1IBHA 4J8RA 5FYKH 5GRWA 2PF6A 4J3WA 3T9WA 1T2XA 1NFDA 1RZKH 4UTBA 3UBXI 2XPYA 1EXUB 3HZKB 4AC2A 3SPGA 2WHVA 4MJ6B 4NWTL 3LD8B 4JFZL 4E36A 5EB9A 1ADWA 4PRPD 1E4WH 2H1XA 3T1FA 2V5RA 3MXVH 1A4KA 5J1SC 1CFVH 1ZVHA 2HKHH 5GIRB 1HXYB 1MG2C 1RUQH 4GAJH 1CS6A 2R2HB 3I3BA 4WWOA 3TBWB 4A38A 4DO4A 5HHNA 2BDNL 1OW0C 5HXMA 2IOMA 3LIZA 4K9EH 3SJVA 3C2AH 3KLLA 3UBFA 3WIFB 2KZ1B 3KYMA 1KENH 4QOKE 3X3FL 3KR3H 1M53A 3TCLB 3S4SA 3UGXA 1HS6A 3SDDD 4U1MB 1SMAA 4I18A 4UF7C 4X80L 3W1ZA 3L1FA 1HDMB 2ATKA 2VABA 4N8VG 5HVWA 5B21A 2ROXA 3MCG1 2W80C 3MTRA 4TOYH 4ZXBA 3RZCD 5GGVY 5MP6L 2W1NA 3MJ9L 1C1EH 2J43A 1JPSL 1EGJA 5EBGA 4Y9GA 4OGYL 1AQHA 3OKMA 1IBDA 3N50A 1B9ZA 1D6EB 3BPOC 5AW5B 4FQCH 2WLMA 5AD0A 1JBJA 2J1KA 3A4EA 4CN6A 5DO2D 5IQ7L 4YC2B 3VU1A 3D7PA 5CCHE 3U4EA 5I1LB 4HK0B 1U8KA 2VXQL 1NGXB 1T20A 4XNZC 5HVFB 1X9RA 4XMKL 4PV8A 5TE7H 2NY6B 5JDJA 4CMMB 4YBLB 3ARBA 3OAUH 2YEQA 3ZYOA 4S0TD 3FQWB 1E6OH 3T08A 4L8BB 1CI5A 2ZXDA 3C09B 4F58H 2EECA 1A9BB 3HMXL 5FYKE 4KY1H 2AKRB 5BZXA 1I8IA 1NC2D 2BS9A 4P2OD 5FFGA 2N0MA 2VWEE 2WTPA 4PVLA 2GK0A 4D8OA 4Y2OB 4JFTA 2VN7A 3H9HB 3FMGL 1Y18A 4YNYA 4M48L 2HAZA 5E9DD 2X9WA 1SF3A 5IW6A 4XWOD 2EYSA 2GAZA 4XBMA 1JZ3A 1DBJH 2A5UA 2GUOA 3IS0X 5ITFA 1AS7A 2V17L 3WNMA 3HBZA 3HZVA 1UYWL 3SPHA 2EC8A 4I4WB 4IOFD 1JZEA 1ID5I 3O6ML 2EIKB 4ZPTB 2Q7NA 4K94C 4XCCL 4UQBA 1AIZA 3O11B 2AQTA 2HCZX 4FG2A 4RWHA 1HWWA 3SDCD 3VXSB 2HRLA 3HUJF 3RVTC 4HD9A 5AW0B 2Q8AH 4B9IA 2FEDC 3L17A 4FHJA 5KW9L 12E8L 3H3PH 1I7TA 5F8QC 1KTKE 2DH3A 3IDMA 3M88A 1FYTA 4RAHA 5DK2B 4XXDB 3A6OA 5C0GA 3SOBH 3JWOH 3ATEA 4XPFL 4LSDA 3REWA 3ZKXC 4XP1H 2KHAA 5JHBA 4ZUTA 2YQGA 2EO1A 1J8KA 2ITCA 4E41A 4HKXA 5GRJH 2WNGA 3VSTA 2H8PB 2COQA 3V95A 5F3HB 4FG6C 1J5HA 4XWGH 4LOEA 3DBXA 4UOW1 3BUPA 3HPJA 1P4LA 3B9KB 2EXWC 2HTKC 4JAMA 3UYOD 1FL5A 1DQML 3MRMA 2J8UE 4FFTA 4D3CL 5JPMB 3VMOA 3BDYH 3LS5L 2GJRA 1X4XA 3SE8L 4QTFA 1U2CA 3BWZA 4NSKB 4HCIA 3AREC 4BFEA 1YMME 4P5TD 1U8MA 1PG7W 2WWKT 3VI4B 3GC3A 2DWDB 2X41A 4ZW8A 1PZCA 4CW1A 1CN4A 5CD3B 3L9BA 3P9LB 1OOWA 4JKKA 5ESQB 1VACA 2NLJA 3MLYL 3O0LA 4QR7A 2WLZA 4Y5XA 2ZOUA 1SGKA 1UACL 4M7LT 4UBDC 3VRIA 3ALPA 3GBNL 4X6DF 4GBXB 3V0HA 3OLGA 2MWCA 1XL4A 1HESA 5DDHB 1R5WA 2NNCA 3O0RL 5I9QC 2EYRA 4JRLA 3APFA 1XEDA 5F89A 1FG9C 5D7IA 1QFUH 2LLLA 2OW7A 5F1KC 2N1KA 1HINH 2XQ0A 5D7KD 1MW3A 5GQBA 4A2HA 4OZHF 2BY0A 3AGWA 4U1GC 3C12A 1MCHA 1AXSA 4V1DB 5JPNB 3KEDA 2PXYC 2Z9TA 1N0XH 4IKNA 1IBFA 1JRHH 1BWWA 4FQPA 3LRHA 4JFXA 3VACA 5L2KA 1K4CA 4POUB 1R3IH 2NW2A 4XVJH 3QPXL 4G7RB 3IDIA 2YPVH 3QC6X 3U25A 2W59A 1DEEA 3W81A 2RFXB 4GG6E 4FD0A 4QO1B 2WQAA 4TVPD 5K9QI 4PJ9A 4PRDA 3IMBA 5DURD 3N44B 4JCLA 1D7FA 3MNWB 4OSUL 1FRGL 3ZTDC 1H6TA 4MVBD 3QZOA 1FO0A 5DYOB 4AUJA 1ZJAA 4LLAA 4OIBA 1E6JL 1MHCB 2Q20A 1SNRA 1I3UA 3RWIA 2VRAA 4PJGE 5CLXA 3KPTA 3H6AA 3NSFA 3Q9PA 3BAEL 1RZFL 4F9PA 4RGNC 1QYGH 1UOKA 2F18A 2IQAA 3ATAA 3M17B 3JWNE 5JDSB 4X4KA 3KPMB 4ABVA 2QSCL 4ZUVB 3TA3B 2Y7SA 3NJXA 3VXRA 3LKRB 2GBTA 3ROLA 3FRPB 4K7PL 3LKQA 1NCAL 3PQYD 3V0VB 3CVBA 5L88L 2SEBB 4XX1E 1IKOP 2NTSP 1DN0B 2EE2A 2M8XA 5GGRB 2HT4C 3DX7B 4H8WH 3CZSA 4M93C 4R2GB 1Z9SA 1CICA 3P2DA 3U0WL 4O4YH 3UX9B 4P99A 3O6FA 4DP6X 5DRXB 1NGQH 3NACH 1G9MH 4AGLA 4GXVH 1ASOA 1QP1A 2XZQL 3BHBB 3N40P 2CKNA 2X5PA 3KPRA 5E99H 3GMRB 1DFBL 2EDXA 1BVLA 4FG0A 4WZ9A 3TO2A 4LCCB 1J1OH 1X7TA 1PQZA 3PHQB 5LAPA 3WNNA 1JN6B 3G7TA 4K15A 4WTXA 1DQLH 1P69B 1ZOXA 1HL4A 3M8OL 4HHWA 1RXLA 3KYKL 1T1ZB 5I6XC 4PRHE 4Y0GA 1KYOK 4DCQB 1LILA 4ONGL 1AHWA 3N43B 2XWXA 3BZ4B 1PZDA 5CU5A 4HBCL 4QWWC 3FUNA 2X70B 3QEQD 1ZT4A 4OCSL 4XVUC 3DMMD 3HG2A 2F53D 1IVTA 3ABMB 3UADA 3GTVA 1PMYA 5AOJA 3V8OA 1QRKA 1B0RA 2W5PA 2JB6B 2QQLL 2WYTA 4X6CA 4MQ7A 1EZLA 4TUJB 3J8F7 1JHTB 4WQOA 4QTHB 5LJYH 3NJGA 5C6PB 1FGNL 4WU7B 3I6LD 1MNUH 2ZAHA 4JG9A 4B3EA 4HIXL 5KJ7E 3JWOC 3STLB 3FO2A 4KZDH 2PLTA 1OW0A 2D8KA 2W9DH 3MVSA 4M8UA 1FFNB 5DK0B 1HHGA 5FK9B 4AE1A 4F1SA 1U6AL 2Y0SA 3W82A 3F12A 4ZX5A 4F9LC 1HNGA 3RWCB 1PG7L 2ZCZA 1EDYA 3TXAA 4HIEA 4LSQL 4MB4A 1DJWA 2UY7B 5T3XL 2X3BA 3WXWL 4OZIE 5IFJB 4CBZA 3QDGA 3HBQA 1KGCE 3DETC 3QQDA 2W9EH 3M1OA 5E4EC 1FC1A 4JNXA 2JCWA 3HC3L 4Z7WE 3QO1B 3WUZA 2QZQA 2V3EA 3QIBD 4FFZL 1UWFA 2OV0A 4BFKA 2X12A 3T3PF 5HTSA 1WGVA 4OZGE 3LKSB 1TZOA 4PRIA 2EUWA 4JM0A 5FUZL 2VDMB 4DP1X 2XTJB 3EGDA 3BESR 3L5XL 1EO5A 1PNCA 2IV9A 5B1CA 2YD7A 2ZG2A 3W11D 1DQTA 2J88H 1PX4A 2R9HC 4AJ0A 1KLUB 2EDQA 1RUPL 4FMFA 3V9CA 2ZKXA 4ES8A 3MV8A 2DM2A 1MRCL 2V2TA 1WZLA 3NSJA 1DO6A 4ENED 1JMXA 3B2MA 3T2QA 1KTBA 4LBEB 1YYLL 1FE8L 5EF2A 1WBZB 1G5AA 4TYUA 1J0IA 4XNAA 4XX1G 4A04A 1YPZA 4Y7OC 2QVIA 1JUFB 4LIQH 5BO0D 4G72B 3QXWA 4ZMVA 4R83A 5CUSH 4HIHA 4HH8A 1G7PB 5B4MD 3NJLA 3BH4A 2HFEB 2O72A 4H20L 1Z2KA 3ZU8A 1OZUA 5C0FA 1OK0A 1P5UC 1E5YA 4XP5H 3CN2A 1MN4A 3DVGB 3I9AA 2N4IA 4JKLA 1JD9A 1I7ZA 4X5PA 5DZ9A 4YE4H 1JVLA 1NFIA 3AQDA 4G6FD 2VO5A 2QDVA 5F88A 4LCYA 1TQSA 3WNOA 3B5HA 4MXVF 3T65A 3OGCA 1HQ4B 3ATBA 4EVNB 4OV5A 3V4UL 4YHYC 1QTYT 3VYNA 1KELH 4LQ1A 1I9IL 2DZEA 4N3TA 5C07E 1Z9PA 1TETL 1YNKH 2AJUH 4LAJH 1WUNT 2MOQA 1QLFB 3VXNB 3IDGA 1UT2A 4NZ8A 3NZHH 1S7WB 2HX8A 3L81A 1BZDA 5A6MA 2R29H 3H1ZA 3CLFL 3EHBC 3VWJB 5BZDA 3C87A 1V7ML 5GGTA 5HYFA 2YLKA 4JFHD 1ZSDA 4YDZA 3TEUA 1R46A 5DFVD 5IFAL 3RWGB 3KBEA 3AREA 4Z7OE 4G8IB 4HH9A 5I26A 3VD4A 2H6PB 2JTYA 1G9EA 5F9WB 4XCFL 2PTTB 3NGBB 4JE0A 4S1DC 4PGEA 4Y4HD 2OP4L 1YYCA 3U7WH 2K8QA 4QXVA 4UMSA 5HHMD 3I6KB 4HKBB 4JO4L 4F1ZA 4F7CB 2A9ML 4HJUA 1CFTB 2HFFB 3E0GA 2ESVE 1YEHL 3BLBA 1T21A 1ONQB 2IAMB 4LIQE 2C9QA 5AKTA 2NXYC 4EN3C 5LGJA 4NENB 3DJTA 4FN0A 3LQZA 3JZ7A 4KKQA 1LEKB 2GJZA 1Q38A 3GJEA 3PJSB 4P2RE 4ZRGA 3RPBA 3TT3L 4AKQA 5I5RA 4R4NC 5F1IB 5I76A 2PXYA 3QR0A 3LAFA 4OJYA 1RFDL 4R7NA 3C8KA 1NEUA 1XF4A 4FNPA 1E2WA 2HRGA 3OMIB 3O45B 4LMQE 5EEVA 4KK5C 4A63A 1SYSB 5TQ0H 2XXGA 1FDLH 4EZKA 1FFTB 4L1SA 4U6HA 3BWAA 3ZKND 1WC7A 4KK9D 1BD2B 4PGBA 1O9WA 2WZPA 1GZPB 1L0YA 2W38A 2XT1B 3KJ4B 3LB6C 1MJ8L 3AWFA 3ZDXE 4DP8X 1TCRB 2F5AH 5H35A 4HIPA 1QBML 4Y2LA 3IRCA 3RLSA 4EXPX 3IGKA 3DURA 3GSXB 1BW8A 4ZZKA 2MQ3A 2WV3A 4PP2B 1OGAD 2RQ8A 1ZA3B 4BEIA 1IGYA 2UVFA 3OAYH 3TBYB 3RTLA 4EN2A 2JK5B 5IESL 2IPTH 4KKBC 5DJ0B 3FL7A 3ZTCC 2QLVB 3O41A 2E4TA 3SGKC 3FHQA 2VLME 3WUWG 4JFDD 43CAB 2LU3A 3UROR 5EZIL 4LQFH 1MCNA 4PTUB 5EUOF 5I1HH 2YUVA 3E7JA 1AR1C 3ZGIA 5F3BB 4MD4A 4AK2A 3EJQA 4PRAB 5T5FL 1TF4A 4ZAKD 1QBLH 4ZOBA 3VGBA 1U3JA 4PYHA 1A14L 3QVAA 4U1SA 4DNLA 4KKPA 4BZ2H 1HJCA 2R2EA 4N0YH 1PLGL 4PJ5D 3RWEB 1RIVH 3RPKA 1XF5A 3BH8B 3I9PA 4JY4B 1CU4H 1YMMA 3BQUD 5IBLD 2PCXA 4YHML 2O61A 3KD4A 3TF7C 3I6GB 3CIAA 4DUXA 2D2OA 1NDTA 4Z7QB 5CEYB 5BVPL 4CNIB 3RJOA 3N2JA 1JYNA 2YA0A 1G7LB 4L9LB 1MCDA 1BQHB 4X83A 4DP9X 3HPLA 1F02I 4YHNA 3CVHL 2GCYB 3D0AA 4FFVC 4Q0XH 3TJHC 5GS3A 1ZSHA 3VE0A 3HR6A 2XA8H 4F15C 2LLNA 3MLUH 3WJLC 1Z3GL 2AQ3A 2BVQA 1E9OA 1LDPH 4PLOB 2F54D 4PBXA 5C0DB 3RDJA 5DC4B 1J11A 3ESMA 1VZGA 4P3DA 1PDKB 1L3WA 4MSWA 1NAMH 4W9DC 4DGIH 1YQVH 5CSZB 3BAWA 4Z7NE 1HEJC 3UZVB 5CD5C 4HZLB 4MAUL 4GLRI 4EMZA 5AAMC 1W91A 1BMGA 3D39B 3RG1C 4IOIB 5HHOE 5I5IA 4GG6A 1BZ7A 2FGWL 4ZI8A 4PI0A 3K2IA 2FO4A 3VXMD 2XWZA 1NICA 3FC8A 1YJDH 2EICA 5A16A 4NFBA 1UGKA 2DM4A 2YRBA 3TJEL 1E4XH 3QZPA 2BVOA 3SYOA 3UO1L 1ZDQA 2HJLA 3DOIA 5DD6A 4LPVA 4PJGA 3MO1A 3OLIA 4YIQB 2K1MA 3GYRA 1F11B 1MWAL 3CVHB 3ZE1F 2VR7A 4Q7DA 1NBCA 3RWFA 2WB1A 2YMOA 2IGLA 2K45A 1QNIA 2BNRB 3SCMC 5CR8A 1OE3A 1L3NA 2N1TE 3ULSB 5K1NA 1OPGH 1XGUB 4A2DA 4OF6A 4KXAA 1WFIA 3LYRA 5FFLA 4K3JL 1HH9A 2VDLH 3GWJA 2GHZA 4FQ1L 5IW3A 3RQ3A 2VJ0A 1ERNA 4KJPD 3ZL4L 5EU6D 1PLAA 1SBSL 3N9GL 3D25A 1A7OL 1MREL 4FZEL 3P0VL 1KTLB 2X44D 1J5IA 2DBJA 4BZ1L 3KVPA 4ZUUA 1XH1A 1GGCL 1WJ3A 2AERT 1ZVNA 4TNWK 2IDUA 4NDMA 2YAHA 3UJJL 2O5YH 4J5VA 4CAGA 2NYKA 1YN6A 4ELDA 5AOLA 5SWSE 1DBMH 2F1EA 4JPKL 3T0EB 2ED6A 2NPLX 2ID5A 1MFAH 3GO1L 4KTDL 1KWKA 3T3ME 2WIMA 1YQ2A 4UT9H 3DXAE 1U8JB 4KV5E 1CGVA 1HI6A 2AEPL 4S0SD 4N68A 3ZMEA 2NY7L 1LEGB 3AC0A 3WTVA 4ZMPA 5E70A 4J6IA 4KVCL 1Q0XH 4OLYL 1V7NL 4CVUA 3MTXA 4J3SA 3GZQA 3QS2A 5GSVB 4W6XB 3BN9D 2FO8A 1MWAB 1P5UA 1CDCA 5SWZD 2H7WA 1MWOA 3WHE0 4EQ2A 4LDLB 5D2NC 4LKXA 4JGNA 3CDZA 2CDGA 1EZVX 3OSKA 4OUOA 4X8JB 5B1JC 1CFBA 2WZAA 5FDYA 4DEPC 2B16A 3FHEA 5F8RC 3VXOB 4HYTB 1NC4A 4JHBA 5DWUH 5JLZA 4W9ZA 5L0QC 4GRLB 5AWNL 5DJCB 4ZS7H 4PCKA 1QABA 4B0MB 3RHWK 1HZKA 4ETQA 3GI9L 3WIAA 4E9WA 4B5EA 3U0PA 4JG0L 1VERA 3GRGA 3SKUD 5AW8B 2DKMA 5IMLB 3FUMA 2E7HA 1FBIL 2ZCHL 4WKXA 2DQEH 2VSDA 3VG9C 1A8JH 4RAVA 1K8DB 3PL6B 4G5ZH 3ZDWA 1WZ1L 5TK4A 1A1NA 1IKNC 1AKJD 3QJUB 1N4XL 4Z7WA 3DUUB 1ZHLA 2CH8A 3HNSL 5C09B 1AVAA 3I6SA 2OSXA 4Y9BA 5F7EH 5D7LB 2P5EE 5GJSH 4D0BA 2FR4B 1U92A 1JV2A 4OZGA 3ZHFA 4L2YA 1GHFL 3OKNA 2J25A 3FQTB 3IJSA 3FT4B 3S8FB 3QH3A 2DQFB 5L4IA 1X5KA 2KLTA 3CNKA 4LHUD 3VFNB 3KZ8A 2WCSA 2E76C 3QRGL 1A7PL 4N2EA 4YDVB 2GPZA 4FULA 5F7LB 5B1AB 4OF3A 1CTNA 4PMFA 3SQOH 3EFOB 4EN3A 4UQ2A 4N2DA 1QSFD 4MZ2A 1GYVA 1S46A 3IJEA 4ZSOE 1KWGA 1E43A 4RGMC 3MV7B 4H44C 1C7TA 4J6RH 4HG4J 3QDJA 1NCOA 1UCBH 2VUYA 3DX1A 2ZKMX 2JF1A 4PTTA 3P2TA 5GS0D 2PWEA 4P5RA 5KVDE 4R4FH 1SJHA 5LWYH 3CN1A 3H3KA 2V7HB 1UJTA 5T3ZL 3RZWA 3C5JB 4K3DL 4Z77B 4NO0D 2C9AA 5EOQL 3EJZC 1ZJBA 4IDJH 1QAWA 1XAUA 2OMXA 3WUWA 5FKPA 2PP7A 4HS8H 4N0FA 2I9TA 5F72S 5FAAA 2P8PB 5DF0A 4BXVA 3MLXH 2PWHA 4IBSA 4Z1PA 2Q3ZA 4GJTB 3C6LA 3CFNA 3SY0A 5F0PB 4FJYA 4QRRB 3UAFA 4AVKA 1TZHB 3HB3B 4LPUA 3IE4A 4LSPH 1F2QA 4X7SL 1KTDB 2DTMH 4P2QB 4QRPA 3CFQA 1I7RA 2A3TA 2X6AA 3GXMA 2NNRA 4K23L 4ODSH 3MRPB 4JO2L 4WV1B 3ZE0B 5HYJA 3UZEA 4BA8A 2NQ3A 3VI3B 2Y7OA 5FYLD 2VYRE 4L4TA 2B2XL 5C8JB 3IGAB 2Z4QB 2RACA 4FQIH 5D93B 1EO8L 1CXLA 1DUYB 4I77H 5F6HJ 2Y07H 1L7TL 1CE1L 1FL6B 1DJHA 3HS8A 1N5AB 3L7FB 1UATA 3ZTJH 2HG5B 1H6UA 4JG1L 2C5DC 5AW7B 5JORA 2JKXA 2XG4A 3NRPA 3IFPB 3MRFA 1MFEH 1P1ZA 3VFMB 3U1SL 3WJMB 1SM3H 5JHMA 3T4AA 3VB8A 5J8OA 2J55A 3MPCA 3TN0D 1AGBA 2A6JB 4NQXA 1X9UA 5E6UB 1UWEL 4G9DA 3DROB 3C08H 1MNNA 1F3RB 3C5SA 3PIQA 1ETB1 4S1RL 2BJML 3RYMA 3QXVA 2CCWA 2HKAA 4BK5A 4FNRA 1SVBA 1KACB 3BFQG 4LDEB 4Q58C 3RGBA 4ANKA 5FO9B 2XZAL 4TKWA 2L0DA 2ERJC 2G60H 5IB1A 1D5BB 1DJXA 1WDAA 4MJHA 2AV1A 4I2XB 1AGDB 4ALAL 5CILH 3WJLA 1F4YL 2GHWB 1DJZA 3AG4B 2CHDA 3EGXB 4FQJH 2BCKA 5AVTB 1CK0L 4P2RA 2M26A 2B0SL 5JW4N 4Q6IC 1PW3A 2EYTA 4PJHF 4UM8B 4UZSA 2XXMB 5C0CB 3TZVC 3OHXB 2VXVL 2WW8A 1PU0A 1INDH 2Y7QA 5LB1A 1A9EB 1FZOB 5IFHH 4PV1C 4ZFZA 4WWKC 3UCRA 5GJTH 4C83A 4FXGB 5AAMA 1JNNH 4JFFE 4FFWD 4XBGA 3NJNA 1KG0B 4J3UA 1KULA 3QJOA 3IJYA 4LVHB 3VXUE 4JRYB 2V8MA 3KLQA 3PWNB 5LDSA 4ETYA 1VLXA 3E6FA 5FGRA 5FOBB 1KBBA 4ZQKA 4NQUA 4XPTH 8CGTA 1RUML 2LU7A 3L3OC 3D5OF 4B9JA 3QCTH 1YO4A 1E8ZA 4OGZA 4U7KA 1VEOA 3D30A 4KUZL 4HUXB 4UM9D 4AL8H 3AXHA 5E6YA 2R29A 3W0WD 1EEYA 1AH1A 3DV6A 4YPJA 1J86A 5IROA 3WHXA 4I3RH 5EPMA 3TO4D 4A1RA 4X98B 3DHPA 3SCMA 4DHLA 2LQRA 3Q3GA 3NTCH 2ZUWA 5C2UB 3G9VA 5J6GA 1LO0H 1X5XA 4UV7H 1THCA 4M7ZC 2NY2B 3CX5K 1GKEA 4DGYH 3BUDA 3W37A 5ADOH 2YN5A 3D3VD 1HCVA 2XN2A 4Y2DC 3VH8G 4QRAA 2NY3B 3QIWB 1T1YA 2XIDA 4I9WD 1J1PL 2NX5D 2E7MA 3IMRA 2UY6A 2GG1A 2ITEA 3U9UA 3QPKA 3LXBA 5I2IA 1FGVH 2YKKA 5TE6H 5CGMA 3CN4A 1FA4A 1M1XA 1IC5L 2HLFD 2AK1L 2Q9OA 3UBGA 3T0DA 2AABH 4AYDC 3FB7A 2CJTA 1E3XA 2OMBA 3TBTA 4ZQTA 3UJTH 3O4LE 1QRNB 1GGIH 3KXFD 1T04B 1B6UA 4TVPH 5DI8A 4L8CA 1AJ7L 1BVKA 5BUGA 5CEXB 3I75B 4LLVA 4N2CA 3GIVB 4DZBA 1ZLVK 5DJ8A 1UCTA 3L1GA 2HT3D 2DICA 3FOLB 5B1JA 1JRHI 3ME0A 2VLJD 3U2IA 3VA2C 1ZGLM 3CG8A 4DOHB 4PJFA 3O6KH 3T8XB 5FDWA 1ZY9A 5EU5A 3MLZH 5FM5M 1IT9L 3L13A 2CAKA 1W8OA 2ICWB 2VLKB 4LLQA 3A67H 3RZCC 3G5ZB 3UBHA 2OQJA 2ZPKL 3VFUB 4FC3E 3HC0B 5FHAH 1PIFA 2CBTA 5TH2A 1KYDA 1TQVA 2UYLB 1D5XB 1R24B 1WK0A 3QFJB 3VB9A 2YSSB 2A73A 1OAXL 5DO2C 4GG8B 1Z6JT 4K5PA 1BZOA 4ONHB 4FTDA 2DYPA 4L0ZA 2FQEA 3DO7B 3EAKA 1YN7B 3RAJH 4PWFA 5I0DA 1CG9B 2H3NA 5GZND 5T1KD 3DPBB 2K6ZA 3WNJA 5ACZB 3KL5A 1H3PL 2VB5A 4MDJA 1A4BA 3PLYA 1KB9K 1A6WH 4JS7A 3F7PC 3SKMA 4BZ2A 5BW7C 3S34H 5D1XD 4NFDA 3A6CH 4I0KA 3V79C 2C26A 3IDXH 1OWRM 3GSNA 4PB9H 2VQ1A 2HPTA 1YDPB 1OM3L 4ILDA 3VFSA 4HJJH 3RP1A 4WU5A 2BNUB 4FQXD 4KOCA 5D7KE 1BYOA 4AW7A 5D1ZA 2VITB 3K7UA 4H13C 4XRCA 1U8HB 5JHAA 3CBJB 3QWRA 1AE6H 4UB0L 4Z7UF 5FYJL 1EAJA 4XWOC 1I8KB 3PWVB 5SWSA 3ZTJG 4TMPA 4YHOH 3M1BB 3ZE2E 4IU2A 5DJAA 4IOFC 1GIGH 1AMYA 5JR1H 1GJWA 2QV4A 5B39G 4ZFFA 1IQDA 2X89D 4LLYB 3H4HA 1DYZA 1P7KB 3BXNA 4WEBH 1MVUB 4OCNC 4N2AA 3SDCC 4DETA 2A6DB 2WKOF 2XWTA 4JQIL 2EDBA 1EHAA 3CSYB 1OQOA 3OMAB 4AW4A 2CJSA 3GMMB 1HTYA 2C7UB 1PD0A 4FNQA 4JFYB 4KJYA 1UG9A 2GFBA 2F68X 4YHPA 3EIFA 1S5IH 4B9GA 3TBVA 3W9EA 3P4LA 4GFTB 4UINL 3R0MA 1IE4A 3CFBB 4F8PA 2JQMA 4AQAB 4XXWC 4MA3A 3QWOB 3KYAA 4M1CC 1T1WB 3BVWA 2YUXA 5CCKL 4URKA 1LE9A 4FMKA 1RIHH 3PQYE 5DD0L 2BWQA 4YK4C 4ZUWA 1TYJA 4KVNL 4OD3H 1OSZB 3EJSA 3VG0L 4UU9A 3WV0A 1S7QB 1EJ8A 1FVCB 2XDHA 2QJDA 3KH4A 4G8GA 1GZQB 4CVXB 1OF0A 1NAKH 1MFVA 3LNDA 2VDKL 1ZEAL 4JHWL 5B1KA 4JN1L 4R90H 1K72A 4YX2H 4AGPA 4YHZL 1IEAB 3MGTB 4M7JL 1JK9A 5FKAA 5AOMA 5LGKA 2F9BT 5DHXB 3WNPA 2VDRH 3ZDYE 4P5TC 1JPEA 3QYCA 4AQEB 2IH3B 3B43A 2QQKH 4P5SA 5AW2B 2DJUA 4WKZA 3GBDA 2KDGA 3QFDB 4O2CA 3ZKMD 1WVZA 4A2LA 2DJ4A 2DDQH 2VDNL 5CCJA 4OIFA 2G5BB 5DMKA 2WJ5A 5BMFH 3PS6A 3TF4A 3EH1A 3N85L 5DU7A 2KERA 3ZTEA 2NY6D 1FL3A 1UM4H 2P5EA 5ID1A 3GJFB 1DZ0A 4QEGA 2AQSA 4D9QD 4F7TB 4MA8H 5E8PA 3NPSC 4PBVC 3TM6A 4F93B 3ZIMA 5K33A 3U9WA 4NRYA 4UT9A 4P9HH 4GXUM 1F3DJ 2A83B 2UX7A 1DQVA 1XQ4A 2DYSB 3ZR5A 5I66A 1YAIA 1AGEA 2ICCA 3V4PL 4GPVA 2WZ0A 2O26U 1XR9B 2TSBA 4NZFA 4P49A 2A7BA 3DA0A 3WCYA 2BIHA 2Y5TA 4YHKL 5BQ7B 2YPLB 1KGXA 4ZSOA 2R4RL 4ANXA 1F4HA 3DRQA 5ISZE 2VDKB 4GSXA 1F18A 4CU6A 1QUNA 3RTQB 1F90L 3TEXA 5ANME 1R3JB 4MRBA 4P2AA 2Y36H 1BWMA 2XV6B 1F8TL 3NAAH 3TZVA 4MCYA 1EEZB 2DQCL 4ICWA 1AD0A 4NC1E 5KG9A 5FGSA 2XKNB 4H4NA 4WWKA 3WEOA 2OTPA 2XXFA 3GKWL 2CO2A 4IBZA 3V4VH 5KSAD 5IEHB 5HY9A 4MYPA 4PY8I 2VDNB 3BJLA 1KCRH 1OP5K 3B8SA 1KPRB 3B5GA 2GI7A 2B59A 3AS0A 2X4RB 3L95A 3IXAB 4A2GA 2FO1A 2R0LL 2YZ8A 4P59H 5GPRA 3L3OA 2KZWA 3VH8A 1WICA 2HRPL 2VN3A 4KAQH 2BRQA 2XACC 1HXMB 4PWKA 4Y5YB 5E5UB 2CLRB 1TLKA 5EO9A 4OUUA 5IM7B 4GRMB 1RJZB 4ZO6A 4JHUA 1SQMA 4AH2B 4N9OB 4KNQA 4BKLB 5CXPA 3F62A 3GMNA 3MV9B 4GP4B 1OV8A 5CGYD 5H94B 4BH8A 4QTIL 4PR5A 1NIDA 5HPOA 2QSTA 2GITB 2HFGL 3P40A 1FIGL 3R06A 3ARGA 3QJHB 3V4PB 1A6ZA 1AXTL 1HNFA 3CPUA 5KYYA 1A6UH 5HHVL 3V6ZB 2Y6SD 2NTFB 1E5ZA 4ZOAA 5E2WH 2ZUYA 3VGGA 1KYOJ 1I9RH 4LNRB 3NIFB 1A6VH 4OLWH 1XH0A 2H0PA 4HKJA 1H5BA 4Y2DA 1BJ1H 4M1DL 4QY8A 1KLGA 1KCBA 1T83C 3BSZH 3H9SB 1PZUB 4HWEH 7TAAA 5BOPA 4RMSA 4R7XA 3HUJE 3TGXA 5I74B 3IFLL 1OT1A 4GBXD 1TEYA 4NN7B 3DMMC 3V52L 1EJOH 2KH2B 3AFLA 4FE9A 5E5LA 3MRHA 4PRPA 4UZGA 2ZOKA 3BEWA 4F7EB 5K9OB 2IPUG 5CP7A 4ODVH 3EYOB 5L2JA 4RCAA 2JKJA 3I9GH 5FO7B 4BQ6A 1FN4B 4JVPA 5C0EB 1BIHA 2GJ6B 3IRPX 3ZT6A 1F13A 2Y72A 4V1DD 3DX6A 3KCPB 5CZXD 2COVD 2IGFL 3CV5A 4X0KB 1NMAH 4LRIC 4F91B 2FATL 3TWCL 5TDOA 5I0ZA 4JO3L 2X9YA 4EI5B 1KBGL 2XN9E 4LGPB 4TNVF 4HUCA 2LU4A 4XC3H 5IJVB 1T5XB 3NZSA 2YKLL 2X9ZA 5HDWA 2J4WL 2UWEB 4B60A 4K2UH 3SDDA 2E27H 2IF7A 1MFBH 2EIZA 3GBMH 4L4VD 2WXRA 4BWTA 3AMKA 3QARA 1SMDA 4JFFA 4WIQA 3QXTA 3FUKA 4UAHA 5EN2A 1KEMH 2H5UA 4KFZC 5JNYB 1NUGA 4LF3B 4CKQA 4F33B 3RZCA 2DQDL 5I6NA 3RDTB 2VXSH 4JFHE 4OFDA 2B1HH 4BKSC 1KN2H 3MRNB 1HWGB 3UP6A 4QHNB 1B4JH 2CGYA 2WP3T 3QIBC 4A7TA 4WO4B 1A22B 1J18A 4X6DE 3NPZB 3FB6B 4NWUH 4WLCA 1NBYB 2Z7WA 5C86A 2PCPB 4O2EA 3N55A 1ZD6A 2R2BB 3B2PA 4I85A 3SOTA 1C16B 3TA3D 4ELMB 1JNJA 3K6OA 4PUBH 1S7UB 3AAZA 2O4EA 1A6TB 4XP9H 4NS0A 4TTDD 1JDCA 4YO0A 4B50A 43C9B 4MXWH 1LP9F 4OZHE 1KDJA 3EBGA 3KDMB 5BW7A 4DAGH 5ILTL 5HJ3B 3DI2B 4B7IA 2YA2A 4JFOB 9PCYA 1PS3A 1H9DA 4ENEC 1TVBB 3NIGE 4U1HB 4S0HA 1NC2A 4JUTA 4OF7A 3NZ8B 4AQOA 4P2OA 5FHBH 2NYZA 5D8JH 4F27A 1V55B 4XNUH 3NH7H 5E9DA 5CFAA 5CZKA 4DSYA 3WS6C 2XC8A 1KCKA 5B4MC 2ZKYA 2VKWA 5CSGA 4QXGH 5EORL 5TGBA 1OM9A 3IGLA 3WE6A 4LDCA 5EV7A 3S3BB 2J5WA 4ZMOA 4IBWA 1NZRA 3ARFB 4YDKH 1I8UA 4S1SH 1IKFH 4M00A 2PCYA 3BKCH 4OBRA 2IJ0C 1HKLL 1NGWB 5EBLA 4RH4A 4XTRD 5SV4A 3IM1A 3L3HB 1YVLA 4KH2A 4PVMA 3SDCA 5KJ4A 3FTWA 5AB0A 1IAIL 2HZHA 1CWVA 3QJFA 4HXAH 4IIQB 3X11A 5IIEB 3G6AB 3I50L 2MQ0A 1JMZA 2WIIB 4FF9A 2PPEA 3PNWB 4U49A 1R3HB 3BT0A 1AOHA 3EYUH 5FOJA 3N1GC 4XAKE 1G7JB 2E9BA 4AMXA 4XMVA 3G5YA 4JFDE 4YLCA 4NO2B 1N67A 1Q94A 1OSYA 4P2CG 3R7RA 1IQWH 1PAMA 1A8ZA 3Q2LA 4NZRL 4HPOH 4PWIA 1QI4A 3HR5B 4OVUA 4LL4A 1S9VA 2CLVA 4LVNC 2OK0H 1BBJA 5F1OB 3AXLA 4IRZH 1DBAH 4MMYB 5DFVC 3LNFA 1IAOB 4BSJA 4DQOH 3EYSH 1U3HB 1SXZA 2NY5L 3IRZA 4P5TA 4JN2A 1F45A 1UVQB 3AUVA 1ACCA 3UYRH 1S7TA 4Y4HC 5IVXF 3GK8H 5DD1L 4LXFA 1I75A 2FTAA 5EEXA 2EEBA 3H7BA 4LGSB 2XBZA 3CZFB 3L54A 3FXIC 4AY0A 3IMSA 4KHXL 2XTJD 3KPSE 3I02A 4NQED 1ZV2A 5CF3A 3HG1B 2DLHA 5KYWA 1H3TA 1AG0A 3CFKB 4ZFGH 3A4AA 5CJXC 5GZOD 3EBIA 4E68A 3MGOA 3S88H 4LRNL 4XZUA 4LU5H 4XE0A 3BVTA 4GRWB 1MEXH 4AT6A 2JJVA 3KGUA 4PSPA 4IYKA 3FH5A 2L7QA 1EH9A 3QEHA 5D7HA 1N8ZB 3ECUA 4JJHA 1Q0YL 3BRGC 2C9UA 4YZWA 4KK9C 1A2YB 4O2FA 4MB3A 4G43A 1NDGA 1E4KC 2WQVA 5T3XD 4NM8L 1WWCA 1NL0L 1THAA 4OGQC 3LSOB 1EVTC 1MCWW 1VFMA 3REVA 2J5LC 1OD7A 5IVOA 2AXFA 2PYEB 3N91A 4QRTB 5EZJA 4OH2A 4GKZB 4AEEA 3MRBB 2VMEA 5F9OL 3T3PE 3S5LB 2AFNA 3FU3A 4N3UA 1A0QL 3MA9H 4YHIA 4A6YL 4PS4L 2WGNB 4H0HB 3K5SA 2GW5A 4QRQB 4RBPH 2ATPA 2PKDA 4JFEB 5F7DB 2BXYA 3DV4A 4G80A 2OMVB 3WO4C 1XIWB 3SDAC 3PQYA 2FEEL 3CPLA 3DJRA 4JY6A 1RZJH 4AWJC 3FN9A 1MCSA 1UJ3B 3CH1A 3GJFK 4L0PB 2ZIDA 4MJ4A 4PLJC 4XP4L 4PHXA 2X4OB 3P77A 2V3DA 4PM1A 4ZAKC 4BDVB 2DM7A 1XCQB 5LBVA 2LE9A 1TKWB 1MIEL 3KWXA 4E42B 4QHLB 3RX5A 4IHOB 5I15L 3AT9A 2XZCL 2X4PA 4W81A 2VLLA 3GMOB 3UERA 3BQUC 4P4KB 2OS7A 5IBLC 1MHHB 1PLCA 1RZ8A 1D5IL 4UT7H 2A2QT 5FV1L 4EF3A 1N5YL 1I8MB 6PCYA 2CHZA 2R8SL 3ZHNA 4AQ1A 3ISRA 4Q9CA 3TJPA 3GHBL 3TYGH 1GW6A 3ILDA 3G6JA 3OBAA 5T1LB 4TNGA 1WBXB 1RK1A 3KLHD 2FIKB 3ECWA 1N3NA 3DSFH 3IGFA 3OKLB 3BZDA 4JX0A 4MNQD 4YDNA 4WF7A 4ODUA 2KQMA 1HN1A 3B6SA 1T83A 4H5SB 1OTUD 4X99B 2WCPA 1QHPA 1FNSH 1TTAA 3MV11 2BP0B 2I07B 4I5BA 3AU1A 2KI6A 3AQYA 3QEQA 3K71A 1COBA 1XWVA 2JIXB 3QRBA 4UIKL 3UYPA 1J7VR 1H15B 4A6YB 2G30A 4ZTOL 2NY0D 2MPAH 4MXVE 2IAMD 3BUYB 2FJFB 4D0CB 1ET7A 4M6NL 3QDMB 3FU7B 1JXGA 3SIKA 3S35H 2Y7LA 4H1LA 5AAWC 1IUZA 1HWHB 2J12B 3X1NA 2VXUL 4AZ8A 3DUSA 3Q2CA 4LRIA 1FSKB 3PWPB 3GIZL 3NG5A 5I8EB 5ISZA 1KCUH 2CIKB 2FLBT 4WFED 3I9IA 5FC9A 5ANMA 1G9NH 1UGNA 4HPYL 1SN5A 5E00A 4KRLB 5IREA 3SGDH 1BD2D 5D6DA 4QAWA 2FRGP 4Y1AD 2EH7H 4EDXA 4LZKA 1EHNA 1DVXA 1AO7B 2WP3O 3MBWA 5DLML 2HVJA 2H0EA 4Z0BL 4FDWA 4R7DB 5AKVA 1TJXA 3PP4L 5DRWA 4ZUSB 3INUH 2KZKA 3DGGB 5AVUB 5EA0H 1FFOA 4I89A 1GGBL 1PZ5A 3SBRA 4NZTH 3QIBA 1OE1A 4H8PA 1L7IH 5KVFL 3GUTB 1ZGLP 1NCGA 1U95A 1K4DA 4ANWA 1ZA6B 1AQDA