2N4IA

The solution structure of skint-1, a critical determinant of dendritic epidermal gamma-delta t cell selection
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
MSSEPFIVNGLEGPVLASLGGNLELSCQLSPPQQAQHMEIRWFRNLYTEPVHLYRDGKDMFGEIISKYVERTELLKDGIGEGKVTLRIFNVTVDDDGSYHCVFKDGDFYEEHITEVKIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Selection and upkeep of intraepithelial T-cells protein 1
publication title Characterization of a Putative Receptor Binding Surface on Skint-1, a Critical Determinant of Dendritic Epidermal T Cell Selection.
pubmed doi rcsb
source organism Mus musculus
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2n4iA00
2B39A 4O02H 4D0CB 4UQ3A 1TVBA 1YEEL 3RVUD 2DQEL 1G6VK 1UJ3B 1G7JB 1UH2A 4K8RD 3QRGL 4HUVB 3S96B 3FO9B 5IT2H 3WIFA 5JW4R 5GIRB 3PF2A 2Z93A 4HUKB 2EIBA 1BQLL 5T5NF 5ACLA 2B1AH 1XR8B 5MEND 1P5UA 2PTVA 3CSBA 3GO1H 3QSKB 1CDCA 1DQLH 2ICES 5GRUL 4XZUB 5HDOA 3SE3C 5FA4B 4U6HB 5EBMA 5J13B 4ZUTA 4MD0A 4PJHA 4AJ0A 1YYMH 4FQLH 2XQYK 2X10A 1UWGL 4D8PA 2HT3D 1JYXA 5K9QI 2PYED 3EO0B 3MROB 4KK5C 1Q1JH 3QEGH 4OBSA 5SWSE 5GQBA 2XTJC 3RWHB 3VD3A 5HYQA 1YEKL 4F33A 2DF3A 1TPXB 4H25A 5FGCE 1T1XA 1KNOB 3VDBA 1ORQB 2E9IA 2ZNXA 3TT1L 5DMKA 5I71C 5SWSB 5CJXC 3FT3B 1FH5L 5KZCD 1I9JH 5EO1A 4CAGA 5F72S 3O8XA 5FGCB 1UM6H 1CGXA 1JIBA 2BXYA 3AXLA 3F5WA 3MUHL 4L4VA 4XPGL 1S7UA 3H8NA 5JHLH 4ZS7H 4J6RH 5I76B 1NFDF 2XY2A 3QO1B 2FJHB 4RWHA 1K9TA 5E8DH 1DBAL 4D0BA 1Q94A 4PS4L 1TZGL 1ZLVK 1BGXL 2B20A 1KBGL 2H32B 3VFPB 4QXTA 4P23B 5E4EB 3L3GB 2FIKB 3C5JB 5CJQH 5BV7B 4EOWH 3QHFL 4L4VD 2VXSL 4ZD3H 1JGLL 3CPLA 4QRTA 15C8H 3HMXH 5C92A 5ISZB 3GUTB 2HJLB 3MLTA 3IJHA 5GGSY 3BP4A 4KQ3H 4HIJA 1P7KA 2V5TA 2ZKHL 4QCIA 4U1HA 4U6YB 3TO2A 3GI9H 2DLHA 2EO1A 5DMGC 4NFBA 2X5PA 1FIGL 1RMFL 3RKDD 3K0WA 1E6JL 2F54E 2EDXA 1FCCA 1RUKL 2A2QT 2HT4D 4I2XE 1YC8A 3SDCC 3RZCB 5CSBA 4Y4KA 3PWUA 1U3ZA 4LLAA 1AQKL 2A6KB 4OB5L 4X6DE 2DBJA 4HIIA 4XNMB 5F9AC 5C9KA 4E41A 1NDGA 4I2XB 2DKMA 2IMNA 1CK0H 2IFFL 3CH1A 4M7KL 1SMAA 3QXWA 1KJ2A 4NYLA 4ZSOE 3QDAA 3VRLF 4Q97A 2UY6A 1MFEH 3U79A 2GCYA 3TO4D 3S36X 1SJEA 3SKOB 4NRYB 4HF5L 2Z31C 5J6HB 1FYTA 4NC1C 4ZSOB 1N2RA 3FQNA 4OFIA 2H45A 2W07A 1QG3A 4E41D 3SN6N 5DZLA 4X99B 3UXFA 4FTVA 1V3JA 1EEYB 2FHCA 2DQEH 1M6OA 2G5BB 1UZ6E 2YPLE 4MB3A 5DMJB 3QRGH 3GBMH 1IILE 1N64L 3ALXA 2B4CC 4X98B 2R0KL 2HTKD 2DLEA 4FFZH 1BQLH 1FYTD 1KCKA 3P40A 4H1LG 3IDXH 1P6FA 3KJ4B 4MVBC 3U0PB 3HE6A 1ZT7A 2YPLB 3Q1SL 4EXKA 3RKPA 1UWEH 1AGFA 3CLEL 2VLKE 5IEHB 3PGDA 4R97C 5EBGA 5GRUH 4KKBD 2RGSA 2JJSC 1NCWL 5JHDE 1X4XA 4I5BB 1UWGH 1I8IB 3VFOB 2VLKB 2X89A 4QO1A 1IZKA 4WI8A 3QZWB 1PLGH 3MV8A 3H0TB 4TQEL 5CEZL 2WIIA 2NY0D 4NIKB 4WWKB 5JHDB 1O7VA 1LP9A 1YEKH 2QEJA 4K9EL 4PIRF 1FRGL 2OTWA 5ILTL 1KTDA 4JREC 5K9JL 4M7ZB 1UADC 3TT1H 3NN8B 1A1OA 4YFDB 2APVA 3C8KA 3OL2A 1FH5H 1M7DA 5IVXA 1RZFL 3UEZA 5IJVB 3DX9B 2AJ3B 1MCSA 3JV4A 4XPGH 2CLZB 5FOBB 1JYNA 2FEDC 3WIHL 2YN3A 1FORL 2BX5A 3CLFL 4F8TA 2BERA 1ZE3C 2ESVE 4GW1A 4OFYA 5CKGA 3TBSA 4PS4H 4U2ZA 1TZGH 1UA6L 3BP7A 3DBXB 1BGXH 4IIQC 2JELH 5EU3B 4JRYE 1FQ9C 4KI1A 5E8PA 1ZTXL 4LEOA 4HGMA 5B38B 5HI5C 1CDBA 1F3DH 1LDSA 2ESVB 1D5MA 4GQPH 2VXSH 4OZHA 1JGLH 4HFUL 1VADA 2DIJA 4HSQA 4Z5RA 2HKHL 4JRYB 4CL7A 2M8XA 2C3VB 3FFDA 5D6CB 3MLXL 1L6ZA 5D9SA 4OFYD 1RV6X 4RGND 4JFHE 1N59A 1IM9A 2ZKHH 1A9EA 4ODSL 3HZYA 3S5LG 4Y16C 3O4OC 4TUOA 3QCTL 1N5AA 4MD5B 2YC1A 2Z92A 1RMFH 3C60B 4YR6B 1E6JH 2G2RB 3TPKA 2G75A 5DUBB 1F11B 5D7IE 4GW4B 5CEYA 2EDJA 4K71C 5ICXA 1EJ6A 4ELKA 1D9KD 1WF5A 4OB5H 1PVHA 4O9HH 3V5KA 1KLGB 1IEBA 3HI5L 3JTTB 5KVGL 1G7MB 4PJAF 1UH3A 4M5ZH 5D7IB 4GSDL 2IFFH 1ACZA 4M7KH 4S1QH 2Y5TB 4JJ5B 1FZJB 1T6VN 2Q8BL 1MCNA 5CBAA 3MO1A 3HRZB 1DBJL 4K2UL 4AENA 2H2PD 3ELAT 1I8MB 2AEQL 4OCXL 3FOLB 2EDHA 4YX2L 4HF5H 4NN5C 1HYRC 4FFVC 1L4IA 4M7LL 5DQ9A 5IWLA 1IGYB 1D5XB 1R3HA 2X1XR 4O51A 1ZAGA 1MEXL 1CZ8L 1IC4L 3LN4B 4C59B 2EDTA 5KSAC 1FVDA 2OXGA 1FL3B 4DQOL 5ICYB 2B5IC 5BS0A 2H8PB 4FQXB 5JOPE 2W9EH 3WE6A 4NZTL 4WI6A 1EFQA 4KI5C 1J0IA 2R0KH 4Y89A 5IB4A 2BOBB 5D5MA 5SWZD 1LEIA 1QO3B 5C7XL 1ZVSA 4XAKD 3Q1SH 1J18A 3TPUA 5EC2A 3CLEH 3QI9A 2MMXA 3GMQB 4EI5B 1U95A 1MAML 3MGOB 3QPXH 3RVWC 5I8CB 4ONHB 4JKWA 1NCWH 4ZUUA 3HPLA 4ZS6D 4HKZA 4ETYA 1REIA 4KRNA 1QFWM 3FN9A 2JJVA 4PP1C 4R2GD 1O7SA 4XBPB 1G7QA 4HCRA 3RDTA 2ZCLH 4TQEH 5KBNC 1W0WA 2X09A 1CLZL 3UDWC 1WVZA 2P8LA 4YHKH 2AV7B 3U0TB 4DZBB 1F3JB 4K9EH 1FRGH 3ARFC 5DMYA 3PIQB 1YEDB 4L4JA 2FR4A 1JF1B 1MHEB 2QR0B 4D0DA 3L5JA 2FGWL 4PGBB 2ZCHL 5IVZB 2IALB 3OWEA 4HUWB 1UC6A 1ZSDB 4AG4L 1OPGH 5DHYB 1WC7A 2FCBA 3DRTB 3S3SA 1XIWB 5C0IB 3WIHH 1HEZA 1TQCC 4HV8A 4G5ZL 3CLFH 5DDHA 4YXKL 4MQXC 1PG7L 2IPTL 3NPSC 2HFGL 4M4PA 4ODWB 2EIEA 5J57B 3OTTA 1UA6H 1WAAF 3EOBB 4LPYA 3VXSB 2HVJA 2J7LA 1ZTXH 4TVPL 1G6RB 4QY8B 3VDCA 5D6DA 4HFUH 2VIRB 2XV6B 4K7PY 3CXDL 3GSUA 3AS2A 4OZFG 2HKHH 4JO4L 4PJXE 1FVCA 4PRIA 4R4BB 3MLXH 5DRNA 1ZT4A 2H3NB 4ZFGH 3VXQB 1R6VA 1RHHB 4ODSH 2H9GA 1DANU 2D2OA 1G7LB 4NUJB 5IB5A 4CJ0A 5AWNL 5KSBA 3QCTH 4JB9H 2OQJA 5JA8B 4PJXB 5IROC 1YEHL 5CGYC 1CD9B 2Y1VA 4ENED 3I75A 3MRBA 2LFGA 1RAMA 1IQDA 3DXAA 1S7XB 3OKKB 1JTPA 5AYUL 3FMGL 3VXOB 1I8KB 1JPSL 3ECBB 5CFHA 3TA3D 4XCCH 2M26A 2NXZD 1V7NL 4LSUL 4KMQA 4ZNCD 5L0QC 3VFNA 4L9LB 2VZVA 4GSDH 5C07A 3GFUA 2YK1L 1OGAE 2Q8BH 4HGWA 3L5WA 5E8EA 4WW1B 1T1WB 1DBJH 4OF7A 4A6YL 2GTZB 4Q0XL 4OCXH 4HG4J 1L0YA 1K2DB 2BRRL 2VDRL 2QQQA 4M8QB 2DWEB 3F58H 2XKSA 1OGAB 1W2KT 4G80B 4PP2B 3T8XA 5DD5L 1G1CA 3HG1A 1MEXH 3UAJD 3STZA 2D7OA 3PV6B 2AEPL 2LU7A 2HWZL 1C08A 3D3VD 4DQOH 3AM8A 1FG2A 3IKKA 1ZGLB 4X9GA 2MOVA 4NZTH 1PZ5B 1QNZL 4P2OB 3QQ9D 2ADFL 3HC4H 4X4ZA 2VR5A 3FO2B 2ARWA 3QNYB 2JIXD 4HFWB 1OSZB 3FAWA 5C7XH 3QNXA 3LKNA 3QUZA 3BEWA 3DSFL 5KVEH 2R1WB 1NAKL 4PRAB 3T04D 1I1CA 4Y5XB 3LDBC 4BYHA 3X14B 2NZ9D 2YRPA 1MAMH 1K8IA 2AXFB 1C7TA 3TN0B 1QLFB 3P0VL 4YHML 1QKZL 2HH0H 4N90E 5IK3A 4JKPH 1Y6KR 2VLLA 4XNYL 2A6IB 1R3LA 2W0KA 3EUUA 3AREC 5GZOD 4L3ED 4XB7A 1J8HD 2OLDA 4M8VA 2Q7YA 5TH2B 4OJFH 5FDYA 1NKOA 3QULA 5E6IB 4I13B 4LCCB 1QR4A 3OPZL 5ID1B 3HC0B 4WI9A 4ZNEA 2W1NA 4XBEL 3LKSA 1N8ZB 2JB6B 1G84A 2FGWH 4BH7B 4JPWL 2CKBB 2ZCHH 3VFRB 2D0HA 1VA9A 2YD1A 4X7TB 3NFPB 2UUDK 4P46B 4AG4H 1QPPA 2BVPB 1X5GA 4L4TA 1KCRL 4QRQA 3S37L 5J11C 4GRWE 3ROLA 4G5ZH 4YXKH 1R3IL 4Q6IB 4GAYB 2FX9L 1PG7H 2IPTH 4QNPE 4BA8A 3V79C 1LEGA 2HFGH 3PQYA 4RCAA 1UEYA 4QTHB 4YZFF 2AXGB 3P73A 1P5VA 1U2HA 3RIFK 4U1SA 5L9DH 5T3ZE 4GRWB 1A6PA 5IBUG 1HHGA 3CK0L 2QQKL 2X4OB 3X12A 5FUCC 5C0CA 2DI9A 4KK5D 1QRND 2BSRA 3QXAA 1VERA 1YMMA 2JCCF 1SEQL 4F57L 5E2TH 2XTJD 5IP4A 5EUKA 1QFUH 3VWJA 3IDYB 1TMCB 3CXDH 1A2YA 5C2UB 3RU8H 5F9JA 3FQTA 5I0DA 1DUYB 4JO4H 5KVDL 1OB1A 4LFHD 1E4WL 2HFEB 2VWEE 3I6LD 3BMWA 3GZKA 4NNPL 5F9WC 3FONA 4U05A 1ZHBB 5B8CB 2AK4B 2P1YA 4PRHD 2C3WA 3E0GA 2WWKO 5F93C 3D48R 4JR9L 3SOBL 3HC3L 1KN4H 1YEHH 2H6PB 4LLUB 1HXYB 1RK1A 5ID0B 3C6LA 4PJBF 3D9AH 5AYUH 1Z3GL 4QHNA 3ZYOA 4Q9RH 2XWBB 3BD3A 1MFAL 1G0XA 2XY1A 5F70A 5IKCB 4LSUH 4U0QB 1V7NH 4JFEB 2GSGA 1YMHB 1OT2A 3W39B 3TM6A 3I3EA 2EE3A 1IT9L 4WW2F 2E5EA 4ZODA 1NL0L 3QIWC 4YPGA 4F8QA 5I1KL 2HRPL 5FM5M 2F74B 4Y4HA 3EO9L 1S7RB 1OLZA 1LK2A 4DGVL 4Q0XH 3VFWB 3C6LD 3QUYB 5GS2D 2FJGB 4Y5VC 1M7IA 3T77B 2BRRH 2VDRH 1C5CL 5E03A 2IANE 1Z0MA 1XGRB 4NZJA 1CDJA 5DD5H 1MVUA 5D7KE 1H3GA 5DFWH 2AEPH 2HWZH 4AEHL 2CXGA 5EOQL 2P45B 4B41A 5EU4A 2IANB 1D6VH 2ADFH 2QSTA 3K4DA 3BKYL 3SDCD 3TH4T 3U30C 4E42B 1QA9B 3RL2A 2F5AH 2OM5A 1VSCA 1DN0A 2QKIB 4L8DA 1K3ZA 4UUJB 3RGVB 4PBVC 3DSFH 4Y0GA 1NAKH 2F53B 3CUPB 1NEUA 1RIVL 3ZDXE 3L95A 5IM7B 3I02A 4ORGB 5E6ZA 3FAXA 1OP5H 1U92A 1I85A 4OFVA 1F4AA 2VQ1A 3MV7D 4OZ4A 3VWKA 2BMKB 4YHMH 1QKZH 1TVHB 3EDKA 5C0FB 4XCFL 4NDMA 1T7VA 3WUWA 5ALCH 3UYRL 1G9MH 3NCJL 1MWAL 3ZE1F 3LRSB 1NBVL 2ZSVA 4HIXL 4TULL 3OV6A 3OPZH 4YDVB 4JQXA 2BVQA 1EO5A 3DETC 4FZ8H 4WWID 3BD5A 3KAAA 5BMFH 3K8MA 4JPWH 2PW2B 5ADOL 4H26A 1S9XB 5FHBL 3G5VB 2N56A 3C9NB 3LRGA 3S37H 4PJEF 4KDWA 4U1GC 1BVLB 3L6FA 4HZAA 4ZUWA 3SCMD 4MVBD 2OR7A 4NN6B 1R3IH 3T3PF 1KB5A 1UB5A 3QIUC 5E6YA 1S7TB 4UDTA 4XVUC 3ZYZA 3KPLA 3IJSA 1VACA 4ZUSA 1SBBA 4O2CA 3FT4A 4FFWD 3CK0H 3MRPB 2QQKH 4Y2OA 1EZVY 3GI8L 3NH7H 2VERN 3ZSTA 1EHLL 3RWFA 4XBGB 2G9HB 1SEQH 4F57H 2VQUA 5GS0C 5DQJB 2Y23A 3DMMB 4NQXA 4ELME 2VUOA 5EOTB 3GSWA 5KVDH 3NIDE 3SKNB 1E4WH 5D7JC 3MLPA 4HEME 4LRNL 2MCPL 3IFOB 3C5ZC 5EZIL 2CDEA 4NNPH 4KTEL 5IF0A 2X40A 4J3OC 1IKFL 3QT2A 3QG6B 1WLHA 2VMFA 3UBXI 4JHZA 4MCYB 2BC4A 4PJIF 2AJZB 4GS7C 1ED3B 4F37K 2NY1B 4KDTC 5C1MB 1Z3GH 1KLFA 4O5LL 5H37G 3EDJA 1NFIB 4HS3A 3DTXA 3FJTA 4AIOA 1MUJB 1HYSC 3CFDB 4HG4K 2EH8L 3PWPD 1IT9H 3VXME 2X4UA 1NL0H 4KVNL 2O5XL 2CUMA 4LRIC 2FECI 5I1KH 2HRPH 4PJ8A 3SGDI 1AGCB 3EO9H 1ZA6B 4HW6A 4C58B 4PG2A 2OL3B 4DGVH 4J8RB 3RWDA 2ITCB 3RI5K 4P57A 3KYKL 1C5CH 5D2NE 2IBZY 3GKZA 2DOCA 2BXZA 3VXMB 1MELA 3BEVB 3GBLA 3EHBC 4EUPB 4Q9QL 4UTAH 5IGXL 4RISL 2NYYC 4TUKL 3MJ8B 2MFNA 4AEHH 3B5HA 5B39B 4LLVA 1A1NA 1PG7W 2B0SL 5D2NB 5FO9B 4G6FD 4PJ8D 1CD1A 4X83A 1CYGA 1AO7D 2B2XL 3W0WA 2V2TA 2VLME 4NQED 5IFAL 5DEFA 2I27N 5DHXB 4JHWL 1EJOL 3U0WL 2XZCH 3C6SA 2GJ6B 1RIVH 2X7LB 1YNLL 5BV7L 4JGMA 2RFXA 5HHOE 2YEZA 4FHBD 3V6ZB 4XVTH 5FV2A 3MV01 5I73C 3W0WD 3P4OA 5DRZA 5MEOB 4XCFH 3BUTA 4XNQB 2PR4H 3NCYS 3QUXA 3Q5TA 3UYRH 3NCJH 4FFVD 1MWAH 4JFFD 4OAWB 4G42B 5HHOB 5DVLA 1Q0YL 5TDPB 4K3EL 1NBVH 4HEPG 1GGYA 4TULH 3L3DB 2IEPA 3I3DA 1F4WH 3OAYH 4KAQL 4JFYB 3LY6A 5KSAD 1CICA 4PLKC 3T2OA 3ZT5A 3MLYL 1H0DA 2V7HA 4PTTA 4UBDC 4EDXB 4BFIA 5ADOH 3K80A 4KI5D 5L2KA 5T1KD 1KCUL 5FHBH 1AFVL 2EE9A 1NEZG 3GJFB 1S7VB 5L6YH 2EYTA 3MBEA 3F65A 1M05B 4FXGA 1OAZL 2Q3AA 4G43A 3KHOA 4GG6B 3TH2T 2GEEA 3L7FA 5CP3A 2EC8A 3WCYA 2AGJL 3MFFB 4LP4A 3PWJA 4Z77B 4ODXA 4LOUC 3BN9D 3IXTB 5DSCA 2AKRA 2A1WH 8FABB 4NFCA 1RZKL 3T3ME 4OF5A 3HCVA 4UT7L 2Q76B 1JP5A 3BP5A 2YUVA 3C5SA 3NFNB 4HH9A 5CEXB 1Q9LB 4G9FA 4JPVL 5ESAA 3IU3A 5DJ0B 4TNWF 5FV1L 1EDQA 4HX1B 1EHLH 4LK4A 1U6AL 4A6YA 3VXPA 4OCYH 3WKNA 2ADGA 5DS8A 4X9HA 3G9AB 4XGZB 3UTSB 4MNGB 3KGRA 3CFIC 1C16A 4LRNH 4JZOB 4YHPB 2WAHA 3VFTA 3WSQH 5EZIH 5SX5K 3SDDB 4KTEH 3S9DB 3X3GL 1IKFH 1FFQA 3WXWL 5L88L 3EYSH 4RMVA 1MH5A 1TJIL 1GHFL 1PEZA 4JM2A 2NW2A 4GMSL 4JANB 3KPPB 1W0VA 1M71A 5FGRA 3E1F1 3B9KC 4U6XB 1FSKC 3DX8B 5FB8B 1AE6L 1ZHKB 4MDIA 3EOAB 3PWLA 2YWZA 3VGHA 4MQXD 1A14L 3V4VL 1AD9B 2LABA 1LWRA 3LV3A 5E94A 4LHUB 4TSCH 4WY7H 2XPGB 3VFUB 5EULV 2KZ1B 4HKJB 4WV1A 2CSPA 1SYSB 5E99L 4XP4L 4KVNH 1U91A 2O5XH 3IVKB 5F88B 4F7PB 2XXCB 1T20B 3BH8B 1RZ8A 4CVXA 4G6KL 2DLIA 1JZ4A 4JHAL 1AXSA 3ZO0A 5IB3B 2Q86A 1OP3K 5TDOA 1A6TB 1P7QB 3KYKH 4OM1L 1XR9A 1ZHNA 1ADQL 2GJZB 2NLJA 2EE6A 3FTGB 1KIPB 2CLRB 3RAJL 5IGXH 4RISH 4U1NB 4TUKH 4WGVB 1JTOA 1NSNH 3I6KA 3UO1L 4MQSB 5D93C 1YEFL 1RIUL 1F13A 1INEL 5D71H 1RJYB 5EN2A 4CUCA 1KG0B 2ZOLA 1EK3A 3U1SL 4PRPE 1HSBB 3QIBC 3IDMB 1IAMA 4PG9A 5CSZB 2AXJA 5MEPB 3V6OE 5IFAH 3OGCA 1BAFL 2R1YB 1PKOA 4Y5YA 2DYPA 3IAGC 3FO1A 3HZKA 1BF8A 3D39D 2H32H 4LGSB 3L3IB 4WIQA 4XCYB 2NY6B 1EJOH 3U0WH 1T89A 2YA1A 1EO8L 4P5MB 4PRPB 4YHOH 1YNLH 5BV7H 5CIPB 3KLAA 2VDMH 4MDJB 1DQDL 2BNRE 2P8MB 4PRNA 2R8SL 5H35A 1UZ8A 3SE4A 1NC4A 4YO0A 2QHLA 2ATKB 1NGYB 1CT8A 3G6JE 3P11L 3BPOB 3U2SB 5IFJB 2DM2A 3U36B 1X5AA 4U1IB 1FZKB 4K3EH 4YDLB 1R5VA 2BNRB 1FFOB 4NO2A 2WBJB 4GBXC 2AABL 3E3QE 4M93C 3ZHKA 5HGGS 4U1MB 4KRLB 4JO3L 4NRXA 4AM0B 3GMNB 1NCBL 3MLYH 5GGVL 3HS0A 4OUUB 3G6JB 1CDHA 1RD6A 2QADD 1JPFA 1OHQA 3TYFB 1WBXA 3L1OL 1KCUH 1I1AA 1AFVH 4OLYL 2FX7L 1MF2H 3BPNC 4WFED 2IPUK 4JKKA 3D85A 4UV7L 5D70L 5FAAA 4LCIL 3VRJA 1KULA 5BW7A 5IFHL 4PJCF 3TZVA 3CFJA 1QEWA 1JV5B 1RVFH 4GRLA 2WWMC 3E6HB 3NTCL 4R26L 1K8DB 4HJGA 3PL6B 3QO0B 3MNWB 1RZKH 1KC5H 4BQ8A 5TDNB 2R2BB 3KPTA 1AR1C 1YPZA 1GGTA 2VB5A 3KLHC 4LNVA 3LKQB 4NHUB 1I1AD 4ACPA 4JPVH 3O2DL 3KHQA 2ADJA 1U58A 1NKRA 2X4PB 3D85D 5KSUB 5DJXA 1XCTB 1CGUA 1U6AH 2WK2A 3OKOA 1FN4B 2VZ1A 2NW3A 1I4FA 4FQQA 3QAZB 3GSRB 1ZLVH 2XYCA 1HSAA 6FABL 1JGDA 3GHBL 2MNUA 2X4SA 4JM4L 5MEQB 1QSEA 3WLWC 5JXAL 4UZGA 4KK9C 3WXWH 4OV5B 5L88H 1FC1A 3P9WB 3DO7A 3JVGA 1HH9B 1JWMB 1TJIH 2GAZB 1GHFH 4XXDA 1ZA3A 4XP9L 3FFCE 3WHXA 2WP3T 2NXYB 3GSXA 4GMSH 4P5TC 1IEAA 3BT2L 4PJDA 3NIGE 3QEQE 4ZPTB 4WRLA 4QHUB 1AE6H 1NDMA 1S8DA 5JQHC 1KYOJ 5J56B 1QUNA 1FGVL 3V4VH 4OF8A 2NY4C 5I6XB 3VFVA 1VCAA 3QA3B 3MNZA 3K4ZA 1QSED 3AMKA 3FFCB 4RGOH 4AH2A 3QEQB 5BZDB 5T33L 5E99H 1DVFB 2ARJB 4YC2B 5T3XE 5D1ZC 3MOAL 5TF0A 4UB0L 3HMWL 4PGCA 3HE7A 4YAQB 4JHAH 2BSSA 5IVNA 4PRDB 1WISA 4HS8L 3BRDA 3QFDA 4NQCA 3ZZ1A 1YYLL 3TWCL 5ANMA 4IS6A 4OM1H 1QBBA 4MA3A 1MWAA 2XKNB 5BVJA 4IDLA 3RAJH 4K9EC 1CQYA 3CJJA 3F7PC 5ETUA 4GQ9H 4WO4C 1E4KA 3UO1H 3MXVL 1YEFH 1RY7B 1AGBA 2PF6A 3EAKA 5HPMB 5E2UH 3EZ8A 5TE4L 1XFPA 3O9WB 4ONGL 4W70A 3RL1B 1RK0A 25C8L 3MRJA 3HE7D 5KN5B 4PJFA 1FIEA 3QUKA 2FSEA 4NQCD 4UAOB 4IBLT 1RPQA 5K59E 3V4UL 2YRLA 1JZ8A 1BAFH 3EFFA 3LHPL 4AQOA 4PJ9A 1CFVL 2OSLB 1EO8H 1FNFA 3N0PB 2FWOA 1G6RL 1I85C 5E9DD 3HNVL 3VWKC 4LF3A 1T4KB 3B5TA 4X8JB 1B0GA 5DJCB 2R8SH 1DBBL 1RU9L 5ESQB 3UJIL 5DJ6A 5TE6L 4YDJB 4R4FL 2F8VA 4W4OC 4LIQE 1B90A 2VISB 5JA9A 4ZG1A 4KC3B 4N0CD 2Z0BA 1T1ZA 4N8VG 4F7CB 2YSSB 4QHKJ 3OB8A 1DL7L 2E27L 1J1OL 4Z7OE 9CGTA 1EH9A 2AABH 1DR9A 4RIRB 2HMID 2GY5A 3GDBA 4POUB 4JO3H 5JW5B 3CVHB 1DBMH 1G7JA 4QGYA 1NCBH 5GGVH 4H20L 3FO9A 3VXUE 4IRSA 4QRSB 2Q7NA 2NTFA 3L3HA 2AJXL 4ZTPH 3BJLA 4F80A 3L1OH 4ODTH 3WDHA 3VFMB 2P5WD 4OLYH 1U8HA 2FX7H 4UU9A 4EI6B 5SWQB 1XR8A 3MV9E 5D70H 5ALBL 2VKXA 4LCIH 2UWEE 2ZUXA 1K4DA 3VXUB 5IFHH 3IJYB 3VGAB 3SGJC 4LCWE 1HIML 3ULVE 4U6HA 35C8L 1E4XL 3EDDA 4J1UB 1CGSL 3NTCH 4R26H 3KPRD 4U1LB 1TLKA 1YEIH 3MV9B 4FN0A 4YUEH 3MROA 1T5XB 2UWEB 3WFEL 5CZXC 5HI3D 3BZ4A 5EZLB 5JPNB 3T4AA 4D9RE 4LCWB 3O2DH 3FQXB 5K93A 4CVZB 4DUVA 5IIEA 3VD4A 4M1CC 1KNOA 3VXNA 2H26B 1U8IA 4TSBL 1ULVA 4LLQA 3P2TA 1ZLUH 4AZ8A 3SDXE 3I84A 1T04B 5CMAB 4JM4H 1IAKB 1B3JA 2VUYA 1Q8MA 3Q2CA 5DK0A 1ONQB 3RX7A 3SGKC 5KANI 1N26A 3IDGB 4JAMB 1VFOA 1J88A 4L8BA 3PP3K 2I07A 3O41B 4Y19E 4WHTB 4J4PD 1SMOA 4AT6A 3SDXB 4XP9H 2BHUA 4X6FB 2FJHA 3BT2H 3WO4C 2XZQL 5IUSA 2JF1A 4QRPD 3DX6A 1H3PH 5JW4Q 4X7SL 5F1KC 1NMAL 1FGVH 3QIUD 2VC2L 1G7PA 4M02A 3OJMB 5I1AA 4YFLI 4Y19B 4PY8J 4IMLA 4P23A 2D7NA 1A4JA 3FZUC 3STBA 4L9DA 5HVFB 1T66C 2FIKA 4NQDE 5T33H 3C5JA 1QZ1A 3W9EB 3MOAH 2Z8WC 1RZJL 3HAEA 4NM8L 1UYWH 3HMWH 4UB0H 5T1LA 4HS8H 5DA4A 1J86A 3BH9A 5GS0D 1YYLH 2IQ9L 5C70A 4HUNB 3DGGB 4NQDB 5IMKA 3IGAB 1G7IB 5KVMC 4OKVA 1VFAA 4PYHA 1RZ7L 1BEYL 5D7JD 1WCBB 2CKBL 4U6YA 3C5ZD 1UXWB 4UI2A 5HDBE 4L29B 5IQ9B 3GMPA 5TE4H 1X5LA 2FB4L 4LSRH 4ONGH 2R1XA 2IADB 4KJYA 25C8H 2HJKA 5C0DB 5EZOL 1J1PL 2GTWA 3BO8A 2FYYB 3V4UH 4MCZB 2F54A 3AS3A 1C5BL 4XNMA 3LHPH 1A7RL 4I2XA 3VG9B 2F58L 5J89A 3RBGA 1CFVH 1HYSD 3H2WA 3VE0B 2HFFA 4QTIH 1CGTA 1G6RH 4WTXA 2ICEB 4KHTL 1YZZA 3HNVH 4OFDA 4X6DA 2YUWA 4OD2A 4BQBA 2I24N 1DBBH 4NRYA 5T3ZL 3UJIH 1P4LB 5TE6H 3MRDA 1DQQB 4R4FH 3JWNC 5L2JB 5J6HA 1X5IA 5DO2D 2NY3C 4L1HA 4RFEB 4U1JA 4DFHA 3RGHA 4AK1A 4LSQH 5C0EB 1VFUA 1XF5A 3BZDA 3CCHB 2VXQH 2LVCA 4Y7MA 1DL7H 2E27H 1J1OH 2NYYD 1TENA 1EEYA 1CICC 2GFBB 1WWWX 2PYEE 1I9IL 4M6NH 4UQ3B 1TVBB 3SDYL 4H20H 1JNNL 5IJKA 4CGTA 4NQUA 3QXVA 4C56D 2W0PA 3MBEC 1MFBH 2PYEB 4JFDD 2AK1L 1FBIL 2Z93B 4KHXL 4PJHE 5ALBH 5I9QB 3O6ML 3WV0A 1HIMH 2QQLL 35C8H 1E4XH 1CGSH 2W38A 3N1QC 3JZ7A 1JZ6A 3L3OA 1QVOA 3VFOA 5JW4N 1U8NA 5EBMB 4ZUTB 4UOW0 4MD0B 2VH5L 2VLKA 4PJHB 4CMHC 2IAMC 3WFEH 4GO6B 5KZCB 4D8PB 4YE4L 4WWKA 5JHDA 1R5WA 1QBAA 4EN3D 3DVNB 4X7DC 1X3DA 1FNSL 5I1CL 4YDKL 4TSBH 1EFXA 3HR6A 4Y1AD 3L7EA 2HA1A 5HYQB 4GFTB 3SGEI 4F33B 4H25B 1ADQA 2XACC 5FYLD 3SDAC 4LCUA 2EDBA 1VESA 4PLKD 4P9HL 4XI5C 2FZ3A 4L4VE 3RVVC 5DMKB 1DCLA 4LSSL 3RQ3A 1F6LL 4KQ4L 1F02I 1KYOK 2D03L 1DJSA 5EO1B 5FOBA 1EGJL 2CLZA 3OF6D 1CE6A 3AXLB 5DD0L 3O6FA 1F5WA 4N5UA 4L4VB 2XZQH 4XHJC 1HINL 4X7SH 3B6SA 4J2XA 1L0QA 4LOUD 3VI3E 1U8JA 4PB9L 3ARGC 1S9VA 4D0BB 4J3SA 2KZWA 4ZFFB 1F3RB 5ICZA 4MXVF 4EIGB 5DRXA 4O58L 1JE6A 4NM8H 1RZJH 3NFSL 5FGBA 4KZDL 4TTDD 5D6CA 1K85A 4PUBL 3CPLB 2ORBL 1G9MC 4MA1B 4QRTB 5HYFA 4QRRD 4DTGL 4Q7DA 4PREA 1H3XA 5C3TA 4MSWB 3MLTB 2CKBH 4ZXBA 3X3FL 3IJHB 4ALAL 1PSKH 3BP4B 4RSVA 4L1DA 4HIJB 4MD5A 1P7KB 4QCIB 4EZMA 3C60A 2GW5A 3TO2B 2FB4H 3FKUS 2EXWC 4FP8L 5F1OB 1B2WL 4OZGA 2AJYL 1WV7T 2EDWA 5EZOH 4YHYC 1J1PH 3TO4B 4E41E 3GKWL 4ZAKA 3MV11 3G6AA 4KGJA 4Y4KB 3EOYG 1PQZA 3PWUB 1C5BH 3ZKSD 1A7RH 2Y7QA 2F58H 5GXBB 5D7IA 1J12A 2Y5TA 4HIIB 4JJ5A 1MI5D 4E41B 3MJ9A 1F3DJ 4WI3A 1NDGB 1DQJA 4KHTH 3CH1B 1INDL 1FYTE 4Y8DC 1KJ2B 4NYLB 5B4MC 5FYKH 5T3ZH 2EZ0D 2GCYB 2YUZA 2NQCA 3QG7L 4QOKA 1M7XA 4ZAKD 5C0JA 5HJ3A 4K94L 3FRUB 4RZCA 2W9LA 1IGIL 1QSFD 4ZPVB 1FYTB 1JFQH 2ZCKL 3FQNB 1I9IH 5I75C 1XGTA 3SBWA 1JNNH 3T0AA 2C4FT 1M6OB 1QD0A 4Z9KB 3BGAA 4YK4C 2BOBA 4QHLA 4TSAL 5F21B 4QOKD 1ES0A 4LVNC 5DZOA 1MCQA 1FBIH 4R0LA 3MSPA 4KHXH 5F9OH 3VFSA 4WFHD 3P3YA 5IW6A 4F2MA 3HE6B 1ZT7B 2NY0B 3VG0H 2QQLH 5FDWB 1AGFB 2AQ2A 3O2VL 1GL4B 3LN9A 5GRVK 3PGDB 4Y4FC 3MV8E 1FZMA 1DP0A 5FFLA 2OL3L 1UVQA 4LPXA 2VH5H 3WFCL 3S36L 1N0LA 5JZ7C 3IFNL 3CFKB 4BK4A 3MZGB 4YE4H 5C6WH 4X9FA 3P0YL 4RMWA 4DZBA 1F3JA 1DUZA 1WUNT 3MV8B 1FNSH 4X6CA 5B22A 4YDKH 2WIIB 5IVXE 5TGBB 3SE9L 1A7BA 1LP9B 1CL7L 2OTWB 1NBYB 1KTDB 4P9HH 1I8LA 5F6IC 2BSTB 2VSCA 4MAYA 1A1OB 1AD0A 2GJJA 4FXKA 3C8KB 3JUYA 4LSSH 5HVHB 5JR1H 1M7DB 4KQ4H 5BOPA 2Q8AL 2X4QA 5IVXB 5A1AA 5DHYA 1EGJH 1MRFL 3C09C 1CI5A 2L0DA 3FHAA 4TUJB 5DD0H 3PGCB 3EJJX 4RGNE 3AGVA 4IJ3B 4ODWA 2MSPA 1U0QA 2DRUA 4QT5A 4APQC 1CDUA 4PB9H 1CTOA 3EOBA 1CVSC 1PW3A 4MAYD 2P44B 4JN2B 4OZHE 4GW1B 4DCQA 4RGNB 3BP7B 3NGBC 1A3LL 2OCFD 4UT6L 4DGYL 4QYOB 3IFLH 4RGMB 4IRJA 5DHVA 4LEOB 3WNMA 4PJGA 3NFSH 4HK3N 1W72B 2CJUL 1H3WM 1D5MB 4KZDH 4OZHB 3BKJL 5F1NA 5D1QA 4PUBH 1VADB 2YPVL 4YHIA 4DTGH 4F15C 4Z5RB 2QL1A 3ARBD 3JV6A 1G7LA 4NUJA 5D9SB 3X3FH 2W0FA 2J8UF 5HHVL 4X0KA 5E24E 3WLWD 1IM9B 1A9EB 3HZYB 4KK9D 2E7HA 1N5AB 3NCBB 1NC2A 5AYQA 4FP8H 2YC1B 2Z92B 2UYLB 1B2WH 2Z91A 3D25B 3OKKA 5KVFL 2AJYH 1LO4L 3VXOA 2XZAL 2G75B 3GKWH 4P5TD 4XH2A 3BIBX 1EAJA 3ECBA 1OAUL 5CEYB 3HTLX 4ELKB 1PFCA 3V5KB 3V52L 1IEBB 4OIAA 5D7LA 3ZYIA 1BLNB 2H41A 4WW1A 1V8HA 3BP6A 1INDH 4XAKE 4WUUD 5J4MA 1NANI 3R06A 3ZDYE 4RRPG 3QG7H 2YA0A 2DWEA 4K94H 4PP2A 2VNCA 1UXSA 4JG0H 3U7AA 5BS0E 4OFPA 3PV6A 5DQ9B 3LCYA 3VMOA 2ZCKH 3QDGD 5IHUL 1R3HB 4O51B 1UJ3C 4HGKC 2GT9A 3OAUL 5D5ME 3PDOA 1C1EL 1FVDB 5C6PB 5SV3A 3AU1B 5BS0B 3D69A 4NNYA 2QSVA 3CD4A 4TSAH 3WE6B 2E9WA 5DC9B 5KS9F 4KK6C 3OR6A 4R2GB 5IB4B 1GAFL 4HK3J 1TCRB 5D5MB 2QSCL 2A83A 1LEIB 1UJTA 1ZVSB 5J13C 4H0HB 5IQ7L 2VQTA 1S9WA 3TPUB 1WICA 2AXFA 3QI9B 1R3KA 3O2VH 1HWGB 1YNTA 4LAQL 1U95B 2Y9RT 4LVHB 2OL3H 3T4YA 3TVMA 4ZUUB 3HPLB 4HKZB 4KJPD 1JPGA 1BPVA 3S36H 3IFNH 2DMKA 4N0YL 4EUPH 1A3RL 1TPXC 2YD2A 2R0LL 4LGPB 1G7QB 4M5YL 3RDTB 2DM3A 4G8EA 5ID1A 2VABB 5MP6L 1BZ9A 3QRFM 1W0WB 1KACB 2RCSL 1OAQL 2P8LB 1B6UA 4WHYG 2VZSA 1RZIB 4F9PC 4JLRA 1CL7H 4DWHA 1N8ZA 1OWRM 5SV4A 3VD5A 1GIGL 2FR4B 3TVMD 3VFRA 4LSVL 3BD4A 1DLHB 4D0DB 2Q8AH 3WJLA 1QLEH 3UJJL 1KEMH 1JGVL 1MRFH 4JDVA 3ULUF 5CJBA 3WNKA 1UFUA 4GMTH 1L0XA 3TJHC 4Q6IA 4GAYA 1WC7B 3D0LB 4HT1L 3L3KA 4HV8B 5DDHB 3PG2A 1FPTL 5E4EC 4GG6F 5BV7C 4U7KA 1JHKL 4BZ1L 1A3LH 4NQSA 4UT6H 5CZXD 3GGWA 2HVJB 3IDJB 3SKJL 1J9CT 3RY6C 5JXEA 2CJUH 4D9QD 3Q48A 4M1CD 3WL9A 3UZVB 1DUYA 3BKJH 3J8F7 3ULUH 2R2HA 5KSBE 2E9JA 4G7YH 5E70A 3W2DL 4XMLL 1FVCB 4OLUL 3RWIA 4IOIB 4M6OH 5DRNB 1ZT4B 3DIFA 3I9GL 5F9DC 5HHVH 5JW3L 3E6FA 3T3MF 3DXAE 3GJFH 4V2CB 2H9GB 3ILPA 3BVNA 5IB5B 4CN4A 3RZCC 5BXFB 1NGQL 2H6PA 4JCLA 4LLUA 5KSBB 1HXYA 5F7DA 2R39A 1F6FB 2OQJB 5FF6A 3ESUF 5ID0A 1HHHA 2QSQA 2X70B 2Y25A 4JQIH 2VSDA 2GQHA 4W4NA 2XZAH 5GS1B 4J3WA 1IQDB 3DXAB 1J11A 1OAUH 3D3VE 5GPRA 5IKCA 4JFQA 4QKXB 3QUMB 3QZWG 5E1AA 5TQ0L 4K3JL 4KXZI 3FZUD 3OJDB 3V52H 1AIFA 4MWFA 1Z9MA 1T66D 1RZKC 1VGKA 2YD6A 4HKXA 4UDUA 3VFNB 1JN6A 1S7RA 5C07B 2FECL 4JY5H 4PV9A 3IT8D 3QUYA 1HI6B 4HGWB 3L5WB 5E8EB 5C0BD 1XGRA 4J12A 2MHAB 2JIXB 3EOTL 1LVEA 1MRDL 2WBKA 5IHUH 1N7ML 3T8XB 4DAGL 1PX3A 2VDQH 2DKSA 1KFAL 1LE9B 1C1EH 4L3EE 2OMBA 1FG2B 1T0PB 2K7QA 4B53A 3GSNA 4E42A 1QA9A 3KJ4C 2CXKA 3WFZA 5HHPA 2CD0A 3H9SA 4KKAC 1I9EA 4F9LA 1GAFH 3MOBL 2QSCH 1LHZA 5B38G 4L3EB 4OD3L 4JVWA 4MB5A 4MZ3A 5J0BA 5IQ7H 3A6BL 5TF1L 2HAZA 3QNXB 3L9RB 4MQTB 3LKNB 3QUZB 3BEWB 1H5BB 4J7RA 4CDGC 3JWDL 3E8UL 2BMKA 4NZUL 5C0FA 2BNQA 3VXRA 1IKNC 4P5KA 1DANT 4WWKC 4N0YH 3H9SD 2VXUL 1A3RH 1ORSA 3JXAA 5T3XL 2NY3D 2VLLB 3VFGL 5IHBA 2R0LH 4D9LL 3D2UA 4M5YH 2YD5A 4K3GA 3UTZB 4I0PA 5MP6H 4OGYH 4M7ZC 3R0NA 2RCSH 1OAQH 3MFGB 3QULB 3LZFL 1TITA 2CO6B 4W6YB 5DYOB 1GIGH 4L4TE 2PW2A 5ENWA 4LQFL 2BNQD 4G9DB 3VXRD 3LKSB 2XTJE 1H9VA 5SX4I 2ILLA 1JGVH 1YY8A 3LB6C 1BVLA 1CQKA 3AVEA 3PQYE 4KJWC 3M17A 2VAAA 4S2SB 4HLZG 4I0PD 4HWUA 4L4TB 4QRQB 4WDIB 3I6LE 2N1KA 2N7BA 5CIPH 3DWTA 3V5HA 4PRHE 2CMRH 1DE4A 1LEGB 3MRLB 3PQYB 1FPTH 4MJID 5F7HA 2H2SD 4OQTH 2VDLH 4U1SB 4LSPL 4WU5A 1JHKH 2IAMD 4S1RL 1CLOL 3BGMA 1HHGB 3IETA 2OK0L 4PRHB 3SKJH 3X12B 3GSQA 2BSRB 3QXAB 3VMNA 1EUUA 3SKNA 2HP4A 3CVHL 1MY7A 4LIQL 3VWJB 3U7WL 1A2YB 4XMLH 4JZJA 3FQTB 5F9JB 3SDAD 1OB1B 2WWKT 3EJZD 4OLUH 3I9GH 4XI5D 5JW3H 3RVVD 3C60C 4ELMA 1IFHH 3MRIA 5CD5C 3FONB 2J8HA 1V05A 2IGFH 3V6BR 5DURB 1OP3H 3FRPA 1ED3A 4P2QD 4UIMA 4FFYL 4BQCA 1VEOA 3HKFA 1LO3H 2X1PA 3Q6FA 3RP1A 4RQQA 3RUGE 1NFIA 1RK1B 4OGAC 1OT1A 3C6LB 1FP5A 1MUJA 4QHNB 2BOCA 4ISVA 1FCGA 4K3JH 3IXAB 3ULVL 1FDLL 2UVEA 2GSGB 4XWOD 1AGCA 2DN7A 2A74A 2OL3A 4JKMA 5DFVC 1X7QB 2ITCA 4WI7A 4YPGB 1JYVA 4HDIB 4Y4HB 4MNQD 4C4KT 4YHNB 1N4XL 2JKXA 3VXMA 3CDCA 2X05A 1LK2B 3ZTNH 3HUJA 1M7IB 2DQFA 4D2NA 3EOTH 1MRDH 1A9BA 4KH2A 5B39A 3MV7E 4FQXC 3GRWA 4DAGH 1MVUB 3U83A 4LSTL 3MGTB 3RNQA 4BFEA 5D2NA 5FO9A 3RVXD 1KFAH 2DMBA 2J2ZA 3IS1X 3X17A 1XGPA 1P53A 5DD1L 4CVUA 4CADA 4NC1E 2EXWD 3CU1A 1TZHB 5DJ8A 1KUMA 2R4RL 1E27A 1XF3A 5T5FL 2G60L 2FATL 1AC6A 3WJJC 4EI5C 3RWEB 3F7YA 1DN0B 4OD3H 2VN4A 1SQ2N 5TF1H 2X7LA 5HYJD 4FNLL 1R5IA 3IKCB 2FDBP 43CAA 4MHHG 2CDGA 3JWDH 1F8TL 1P7HL 3E8UH 4YBQD 2V2WA 4NZUH 3I02B 5ADPL 4B7LA 4XNQA 1BBJA 3OR7A 4GAJL 5FA3A 3ZE0E 4Z7VA 2A9NH 2VXUH 4JHBA 2V17H 5FHAH 5T3XH 3VFGH 3L3DA 3ES6B 1I9RL 3KPNA 4JFYA 3SCMB 2ZSVB 3LZFH 3WFDL 2N7AA 3PHQA 4NO3A 2BVQB 3V8OA 3S4SG 2ZZUT 3QWOA 4R97B 3TNNA 1DBKH 1SBSL 3DV4A 1TQBB 1K5NB 5HHNA 1U41A 1S7VA 1XIWC 3REVA 2LAGB 4HWNA 4WNQA 1FZOA 3PNWA 1MPAL 3MGAA 5GGUB 4K3HA 4ZUWB 3RX5A 1CTNA 1U3HA 8FABA 4CU7A 1KB5B 1UB5B 3FHQA 1JGEA 2Q76A 4UDTB 4M1GL 4Y4FD 2OYPA 1K4CA 4XP6L 3KPLB 3NFNA 4K8RL 1Q9LA 4LSPH 1VACB 3ZDZF 4ZUSB 4O2CB 4AEFA 3FT4B 5JOEA 4HX1A 1E6OL 4S1RH 1CLOH 3HB3C 2FH6A 5JZ7D 4H0GA 5LCVH 2E7LC 2GSIB 3GHEL 3MUGA 3RY5A 1JMZA 3LVEA 5CBEA 3RWFB 3CSGA 3DI2B 1BFVH 2VDNH 5HTSA 2VRAA 3VRIA 4XGZA 3BOVA 3CVHH 4LIQH 5F8RC 3PWPE 3U7WH 4NQXB 2WNGA 4N9OB 1VFBB 1OW0C 1LILA 2FJFA 4H1LB 5IF0B 5JUEL 5EC1A 2AJSL 1J0KA 2Y36H 1BMGA 2J6EL 3HPJB 3PWPB 4KTDL 4JANA 3ZKQD 4FFYH 1FE8L 3RHWK 4JFZL 5GRZA 5FB8A 3U9UB 3EOAA 2BC4B 5F96L 5EU6D 2CR6A 2MQCA 5FM5O 3ZE2E 2XPGA 2YOCA 5LVEA 4DGIL 3O11A 4L9LC 4HKJA 4APQD 3T0EA 3SDXF 3KNBA 4QXGL 2C1OA 4GKSA 1WQVT 1QQDA 2CRYA 3DTXB 3ULVH 1FDLH 5E2VL 2IH3A 1T20A 2ZJSL 4C83A 3BH8A 2X4UB 1FGNL 2O5ZH 2RQ8A 1P7QA 4G6FB 3CXHJ 4PJ8B 4QWWC 4IHOA 1N4XH 3MCG1 1JWSA 1UG9A 3B2VL 5I15L 1WEJL 1NGPH 3RWDB 2FBJL 4BFGA 1NGXA 1BIHA 3LN5B 3T0ED 4K71B 3U48A 2WQRA 3LMJH 3RIAF 3W0WE 4LSTH 5I1EL 4P2OC 3T08A 1ZS8A 4TN9A 3N50A 4LLVB 4UOW1 2R29L 4V1DD 3AUVA 2DQGL 5DUMH 5ACZA 5DD1H 4JFFE 1JRHI 3ARUA 3IDMA 2I9TA 2DQDL 1CD1B 5MEPA 2R4RH 1B4JL 3WMSA 4I3GA 3W0WB 2R1YA 4NCDA 1IQWH 2G60H 4R90L 2VO5A 2FATH 5CJ5A 4Y5XC 4XCYA 1HKLL 5CGMA 1I7TA 5DEFB 4NN5B 4JFFB 3QISA 1A7PL 1GGCH 1GRWA 3BHBA 1RURL 4FNLH 3F7QA 3HNTL 1PEWA 3N1MC 3TN0C 4KI5E 1ITCA 3C6SB 3C2SA 2P8MA 1F8TH 4XAWL 3TYGL 5HDBF 4MXQC 1KOAA 4WU7A 2RFXB 3RWJA 5ADPH 2P46B 4ERSL 2ATKA 4OCRL 5BRZD 5KAQG 3P4OB 5DRZB 2NY7H 1RZJC 5J12B 5E6IC 4LCCC 3ISWA 2EYRB 2PXYA 2WBJA 5FCUL 2W59A 3LH2L 1I9RH 1V3MA 2OTPA 4HUMB 4WCYH 1RUQL 4OUUA 1E28A 3WFDH 3X13A 3G6JA 4N0UA 3ULSA 1S9KC 4NO0A 3BXNB 4P46C 1NCAL 1NQBA 4AL8L 3HI6L 4ZOEA 3OKLA 5GISL 2C9AA 1H0DB 2V7HB 5A2FA 4PTTB 1OP5K 1ZANL 4FQJL 3UBXA 4KK6D 2OZ4L 1MSPA 1QP1A 4LP5A 4Q6IC 1T2QL 1MPAH 2EYTB 4R9HA 2D0FA 3TESA 3QFJD 4FXGB 3MODL 2X4NA 4G43B 2EIZA 3L7FB 3E6HA 4RMUA 3PL6A 2DKUA 3QO0A 3PWJB 1KJ2L 4XVSH 3VCLB 1QTYT 4M1GH 5F6HJ 5DSCB 2AKRB 1T3FA 2ZUVA 1MFCH 3QDJA 1E6OH 1AI1L 4UQ2A 1CF8L 3DUSA 2LU3A 3IDYC 3W5MA 4G9FB 1FN4A 4BQ9A 5ESAB 3IU3B 3GSRA 5I8EA 2WANA 4XNXL 3VD9A 4PJHF 4A6YB 1NUGA 5SWSD 3VXPB 2V5YA 2ADGB 5DS8B 5B8CC 3EIFA 4LDEB 2VLJA 4HWEL 4JGUA 1R0AL 2GAZA 5JUEH 2VWEC 1F2XK 3DNKA 4Q6YA 5TPWL 1JNJA 5FUOL 1IM3A 2HTLD 1FE8H 4JFZH 5DWUL 2J4WL 3IAPA 4KWUA 4YPJA 5F96H 1W0VB 5IR1A 1HH6B 4DGIH 2FO4A 3MLWL 5FYJD 3LV3B 4QXGH 2KUTA 5E94B 5DEZA 1DVFA 2ARJA 5LXGL 1U8LB 4WV1B 2R2EA 5E2VH 2ZJSH 3QUYC 3G5XB 3MLRL 4I18B 1YNKL 1U91B 1Q9WA 5ISZD 1FGNH 2AVGA 3D39E 4HIEA 2E7CA 1MFDL 3LOWA 1UT9A 4NCC2 2EDFA 5I1DA 3BMVA 4NO5A 1CGWA 5A3IC 1AXSB 3B2VH 5I15H 5FM8A 1WEJH 2XKNA 5TDOB 2FBJH 2ZUYA 1T7ZA 3KYMA 1WT5A 4IMKA 4HS6A 5F71A 1XR9B 1ZHNB 4IRZH 4GXUN 2NLJB 3VI3F 3DSNA 1YQVH 3D39B 2BFVL 3EJYD 5I1EH 4L3AA 4P9HC 3I6KB 4JFOA 3ZL4L 3RZCD 4U6TA 2DQGH 2OS7A 5T1MA 3LEXB 1EZVX 3BDYL 3KXFA 2DQDH 4ZTOL 4OF3A 1B4JH 3RGVC 4NQTA 4PD4J 4R90H 3C08L 2XOTA 4PG9B 3QQNA 1HKLH 4CU6A 4G3YL 3OGCB 1U93A 4Y5YB 1LO0L 2DYPB 3HZKB 1RURH 3HNTH 1W72L 1FLTX 4XAWH 5GGSB 5ESQA 4OZFB 4WFEE 5EIQA 3KLAB 4MXWH 5E2JA 3KXFD 4ERSH 4JFXA 2X42A 4OCRH 4PRNB 2QADB 5KJRL 2I5YL 3TF7C 3KLDA 4LDOB 5KG9A 1NC4B 4DKEL 1J0JA 2V2XB 3QXTA 4XRCB 3LPWA 4YO0B 5C71A 5L7XL 2YSSA 5FCUH 4RIRA 1CT8B 3L5IA 5E7FA 2FLRT 1JI1A 2M2DA 3F6LA 1R5VB 4P99A 1AGDA 4NO2B 4WHCA 3I50H 1RUQH 2BY1A 3ARDD 1A7NH 4CBPA 2VKWA 5K9OA 4QRSA 1IGTA 5F1SA 4M48L 1XF4A 1IC7L 3HI6H 2ED9A 3HS0B 4U6VH 2WZPD 5GISH 5EZJA 5SWQA 1MJ8L 1ZANH 4FQJH 3N1FC 4X9BA 4NN6C 1WBXB 4KKAD 1I1AB 4OF0A 1T2QH 4NKDA 4P9ML 3KYOB 3D85B 5E8NA 3ARTA 3O3AB 3MA9L 1J7VR 4J1UA 2OXHA 3VRJB 2DQIL 3CFJB 4M62L 1KJ2H 1QEWB 3H9HA 3MV9A 4GRLB 4OV6F 1KV3A 3OAYK 4HJGB 5EZLA 5JPNA 1IMHC 4LCWA 4EUPG 4CVZA 3HR5A 1YPZB 1CF8H 3LEYH 1ZLWH 3HLAA 3LIZL 3DMMC 4S1DC 2H26A 5EPMA 1BWWA 2ADJB 5JIHA 1U58B 1QSEE 4K94C 1MLCA 4P4KA 4XNXH 5DJXB 1X5ZA 4YFLF 4KFZC 1I4FB 1T04A 2R23A 3C87A 4FQQB 5CMAA 1MJJA 5B3JE 5FUCE 3OHXA 2AXHA 4PYGA 1AQDA 5IEKA 2X4SB 4J3UA 1IL1B 1QSEB 4HWEH 3DUUA 4DKFL 1R0AH 1LP9F 5TPWH 2NY1C 4MA8L 3FB6A 3LAFA 4E9LA 3DO7B 4KJWD 5DWUH 2J4WH 4XXDB 1Q9OB 3WHXB 4OZIA 1IEAB 2PO6D 2MPAL 2AI0L 5IVXF 1P6AB 3PDDA 1NDMB 4Y19A 1Q72L 1S8DB 5EBWB 1PYWB 3K8KA 3WXVL 3MLWH 3CXHK 4EIZC 3VFVB 4V2BA 3MLSL 3MNZB 5J1SC 1A4KB 4NQCE 3D0VA 1ZVHA 5JIIA 2ESVD 2JJTA 4X4ME 5ANME 4B7IA 1SEBA 5BO1L 2X1WL 1SJHA 3MLRH 1YNKH 1Z2KA 1H3TA 2AJUL 4JRYD 1MFDH 4ONOA 4PGCB 3B8SA 3HE7B 5I1GL 1JWUA 4NQDA 3IGAA 1MCWM 4NPYB 2RJMA 3GSVA 2FRGP 3QFDB 4NQCB 2BVTA 3RNKA 3OSKA 5DK3A 2QHRL 5ANMB 3KPOA 4XCNA 5GJSL 4IS6B 5E9DE 2P5ED 1EEUA 3QPQC 2NTSP 4TNWK 4MA3B 5D7SL 2HKFL 4PJFE 5BVJB 3ZKNC 5D2NC 1JF6A 1Q38A 5A43C 2BFVH 4OZHF 3ARRA 2RR3A 1J1XL 3QEUB 5CD5D 2I60L 2F8XC 1EXUA 5C0DA 5FYKU 5FEBA 5E9DB 2X1OA 4ZTOH 1RK0B 3MRJB 3RBSA 4D3CL 1UGNA 4PJFB 4BZ2L 3QUKB 2P24A 1HNFA 3C08H 3H3KA 3KLSA 4OGAD 4G3YH 5I1IL 3WNPA 3VE0A 4DFIA 1F45A 2ICEA 3DLQR 4PJ9B 4HWZA 4HXBL 3MREA 3QWQB 4JCMA 4OCSL 3P0GB 4G8FA 4ZQKB 3BJ91 2FL5A 4LF3B 4MNHA 5KJRH 4FQIL 3ILQC 4DKEH 5CLWA 4J3VA 1J05A 4HMEA 3ULUC 1LO5A 1PG7X 2MTPA 5MENA 1T1ZB 4I0CC 3FOMA 5DJZA 2W91A 4FQXD 2OR9L 3C8HA 4NC2B 2XICA 3G5YB 1UKTA 1QYGL 4M48H 3VH8A 1GZQA 1WTGT 1IC7H 4HAGA 3ZHLA 1S5IL 5EFIA 4IRSB 2PYEA 2P47B 1H8OA 2NTFB 3DECA 3L3HB 2J6EA 4PR5B 4LL9A 2XRAL 4UU9B 1U8HB 1X5YA 1HHJB 3QUML 3BSZL 4P3WA 1RZGA 3MA9H 1K4DB 4C54A 3LEVL 2VL5B 2MCG1 1T22B 5D5MF 4DN3L 4FQHA 4HHAA 3MCLL 5DI8B 3M1BA 3QQ3B 3DVNA 5GGQL 2B1HH 3BZ4B 2IF7A 3QEHB 3T4AB 3KS0H 5IIEB 3PXJA 2K7PA 4PJ5A 4X6EB 5D1XA 2GK0A 3K2MC 3VXNB 1U8IB 2BJML 3SDDC 3SGEH 3W11C 2WIMA 4LLQB 2X1QA 2P43B 4H5SA 1BQHG 1RUPH 2I25N 3O3DA 2R0ZL 3MA7A 4M3KB 3F8UB 1NMCB 1NPUA 32C2A 4RAUA 3THML 3NBNA 3MX0A 2IH1A 5DK0B 5EUOE 4HD9A 4L8BB 1BZ7A 4PJ5D 2I07B 4AT6B 5D1XD 5HI4C 2EYSA 4LAJH 4HMDA 4ZO6A 5MI0B 2MPAH 2AI0H 3DX6B 1Q72H 2CRIA 3LQMA 5FECA 4ZOAA 3Q5YA 5EUOB 3WXVH 2EDYA 3VXSD 1EHNA 4ZFFA 2AJVL 1G7PB 2E8YA 5I1AB 3MLSH 3MUZ1 1LDPL 4IMLB 3C5ZB 1A4JB 4Z6AT 4NQVB 4HCRH 5EBLA 5EU7E 3HB3D 2MKWA 4XWGL 1AKJA 5BJTA 2ICCA 3KDMA 2AJUH 2WV3A 3HAEB 5T1LB 3TBYB 4MSWA 3BH9B 2QHRH 1BX2B 5AUMA 5GJSH 4G8IA 1GC1H 5IMKB 4KJQC 2HKFH 4OKVB 1VFAB 5TFSH 1JHTA 4PD4K 3X11A 5C0NC 4JZNB 1J1XH 5F89B 1FNGA 2I60H 3A6OA 4XC3L 3WLBA 1AKJD 1TVDA 2HLAB 5C8JA 3GMPB 4FQPA 4OLWL 3TO4A 2R1XB 4OT1L 4KJYB 4BZ2H 2HJKB 4JQVA 3D6GA 2NY6C 2GTWB 3BO8B 2EDLA 2OZ4A 5KSBF 5I1IH 5DVKA 2F54B 1NUFA 3V6OC 3ORJA 3M07A 3CIQA 3SPVA 3UCRA 1MHPH 4HXBH 3UP1A 4FXLA 2HFFB 4G8GA 4KUZH 4X6DB 4OD2B 3BPOC 3FRUA 3T2QA 1KJ3L 4FQIH 2QJDA 1WIUA 4YDLC 2XWTA 4U4BA 3S37X 3MRDB 5L8LB 2UZIL 4ZPVA 3ARZA 1JNHA 4U1JB 1XF5B 4YH6A 3G08A 1EHXA 1YEEH 2GKIA 2OR9H 3TNMB 3A0OA 2D9CA 2RIKA 4G8GD 3E3QC 3FQRA 5CUSL 4NT6A 2C1PB 4LGRB 1KPRA 5HGHB 5CHNA 5I73B 1HCFX 2XRAH 5FYLE 4W81A 3QUMH 5J7CC 3NA4A 1BJ1J 4WUKL 4EN3B 5FDWA 2HLFC 3WS6A 1KJMA 2LV4A 3PL6C 1Z6JT 4ZFOA 1SY6L 3LEVH 3TN0D 1C5DA 1Z9SA 2IPUG 1HILA 4DN3H 2FNBA 4MXQD 3L3OB 1QVOB 3MCLH 3CFKA 5E4IA 5IB1A 1KCSL 4QF1A 4Y2DD 1U8NB 1FL6B 4MLSA 3QAZC 2CUHA 1R5WB 1KIQA 2EXYC 5TGBA 1HE7A 2BJMH 1NBYA 1EFXB 3L7EB 3QDMD 3TT3L 2BSTA 1L9MA 5BVPL 3ZTJG 1XEDA 2R0ZH 4LCUB 4BFBD 4P46D 2FZ3B 2NXYC 4QRUA 4I8DA 4F7MA 4QRRE 4TUJA 3PGCA 1WTLA 4FMKA 1SHMA 4S1SL 4NSKB 1JZ3A 3VGEA 3BQUD 3DJ9A 1CFTA 5HDQL 5JNYA 1CE6B 5C09A 5I6XC 3O6FB 1X4ZA 3NAAL 4JN2A 1DBAH 3B6SB 4QRRB 4U3CA 2A6JA 3O45A 4HPYL 5JORA 1DVFC 4YC2C 1U8JB 4NGHL 1KBGH 1ZLUK 1S9VB 3JWDC 4QYOA 5CP7A 3VRLE 4ORZC 1F97A 1W72A 5ICZB 4XWGH 5DRXB 3QHFH 5FYKD 4PRBB 5C09D 3QWRD 3ZKXB 1MI5E 5EG6C 3UTTD 3IYLW 1U8MA 1D9KA 2AK4D 1D7FA 3GIVA 4PREB 4OZGE 3O9WC 4ZXBB 4Z7QF 4FQ2L 4UAOC 4XC3H 5M95B 1FIGH 2UYLA 5GSRA 3D25A 5DXWA 2FO1A 5HYSG 1RUKH 4OLWH 2BSED 1QSFE 4N9GA 1MCEA 4OZGB 3S35L 1KB5L 4ZAKB 1AHWA 3G6AB 1AQKH 4JFED 4KV5E 1PQZB 2ICWI 2J1KA 4HJJL 2BVOA 2ZUTA 1BLNA 2Y7QB 4ODHL 4QOKE 4N0FA 4QXUL 3VI4F 4YHZL 2PTUA 1X5HA 1DQJB 5D93B 4WFHE 1H15A 3WFBL 3QHTC 1NANH 3ZT7A 3DV6A 2UZIH 4QOKB 5SWZA 5C0JB 1P84J 1I3UA 5HJ3B 43C9A 4RZCB 4R7DA 2PTTA 5JTWA 3WD5L 3MBXL 3EYVA 3O6KL 1VEMA 3WNNA 5B21A 2IAND 5HSFA 3PWVA 3AU1A 4JDTL 1MHCB 4P2RA 3MACL 1MNUL 4U7SA 5CUSH 4Z78A 1XGTB 3KJ6L 2XG4A 1N64H 3KPMA 4WFFD 5GS2H 4QHLB 1ZT1A 1TCRA 1GJIA 3VGAC 4LLYB 1ES0B 2F53D 1KCVL 2EKSA 4WUKH 3VXTA 4R0LB 3KG5A 4HBQA 3VFSB 4BSJA 3LD8B 1F6AA 3UPAA 4F2MB 2COQA 5IW6B 5LJYH 1HDMA 4P2RD 3ULVC 2PNDA 1FZMB 1KCSH 1T2JA 4X6CE 1UVQB 4BM7A 1JPTL 2XA3A 3UPCA 3ZKMC 5J6GB 4HKBA 2VABA 1NCCL 3MLUL 3OKMA 5CEZH 1P4IL 1MCFA 1RZIA 1BREA 3QH3A 1DUZB 1ZK9A 1FFNA 3B9DA 4X6CB 4O2EA 3FB8A 5ILTH 3TT3H 5L8JB 5K9JH 1LD9A 2YMXL 5BVPH 2CPCA 2NR6C 1DLHA 1EMTL 4MAYB 4FXKB 1AD0B 3UTQA 2EEBA 3IU4L 1RZFH 2X4QB 3ZE0F 4LCYA 4S1SH 1P9MC 3BW9B 3D0LA 1A3QA 4JN1L 1FORH 5HDQH 3V7AG 3U4EB 2DM7A 4S0TD 3ALWA 3KPSD 3ALPA 1FAKT 3NAAH 2ATPB 1Z9LA 4ODUB 4EQ2A 4ZUVB 4HPYH 4QT5B 4PJAE 4PJGE 5HYIA 1WGOA 3ARBB 3U7YL 4U31A 4DCQB 4MMXC 3IDJA 3EYFA 4KMLB 1ZLSL 4IRJB 4S1DD 2VL4A 5DHVB 1Z9OA 1EEZA 4PJAB 4PJGB 4LPTA 4XPFL 3T0VA 5F1NB 5D1QB 4IOIA 3BYTA 4YHIB 3TA3A 4NM4L 3JV6B 1TCMA 4WUUE 1S7QA 2W0FB 4PY7B 5H2BA 5BXFA 5GRJL 4X0KB 1DQTA 2X70A 5D96B 1YUHB 2LE9A 2NY1D 3RJQB 4JEGB 1NC2B 4FQCL 5GS1A 3NVQA 4GUPA 5E56A 2Z91B 3VG9C 3S35H 5D7LE 1KB5H 2YBRA 4XH2B 2F5BL 1J5OL 3QUMA 2R4SL 3QP3A 3RWCB 3OJDA 3HI5H 5KVGH 1WSST 4HH8A 4ODHH 3D3VA 4QXUH 1T0NB 5D7LB 1HI6A 1LNUA 5GZNC 3BP6B 1GPOL 3WFBH 4K2UH 4F3FA 3UYOD 1FO0A 2AEQH 2MHAA 2DQTL 4M9PA 3AY4A 3R06B 2JIXA 4YX2H 5IMOA 2WW8A 3O4LA 4M7LH 3ARSA 2O61B 5IV2A 4MB4A 2X44D 4N8CL 1UXSB 3WD5H 4H1LH 3QPQD 5KOVC 1CZ8H 1IC4H 3O6KH 1LE9A 2GT9B 4JDTH 3MACH 3CMOL 3PDOB 3HA0A 1RJLA 3KJ6H 1MCKA 3D69B 4NNYB 5I9QC 1KJVB 3MJ6A 1B0WA 3O4LD 1EO7A 4G6ML 4L3EA 3UROR 4KROD 1KCVH 3OR6B 5DJYA 1J8HA 2Y06L 3CZFB 3QXUA 2GJ6D 5EO9B 1PAMA 1Z5LB 3L9RA 4ETQA 1CXHA 1H5BA 3IRPX 2A83B 4XPBL 1S9WB 5HBBA 3RTQD 1WAAE 1AY1L 4UTBL 1R3KB 3KYAA 5BQ7A 1YNTB 4FA8A 3WNOA 3CFBA 3T4YB 3TVMB 5EH1A 1JPGB 3B43A 3UTZA 3MLUH 1P4IH 1CLZH 4HWBA 5AD0A 2C7UB 4YEEA 3ULUD 1TXKA 4G8EB 1CFBA 1BZ9B 1I1FB 2QQNL 4NC0B 5DYOA 4OIIL 3RHWF 2YMXH 4G9DA 4JLRB 3SE3A 2YD8A 3O8XC 1EMTH 1MCJA 3IU4H 4S2SA 3P30L 4X7EC 1QRNA 3IDNA 4WDIA 4QHMA 5MHSD 4JDVB 5DC4B 1NAMA 4JN1H 1IBGL 2A38A 1SVCP 1NBZA 3CSPA 3MRLA 2X4RA 5JPMA 3L3KB 5DF0A 3BUYA 4PV8A 1UQSA 5E7BA 2ICWB 4PRHA 4N8VB 4TVPH 3RKDC 5CGTA 3L3JB 4NQSB 2HT4C 3S7GA 4Q2ZA 4MA1C 3GGWB 1T6WA 3RFZC 4TPRL 2HJFB 1MCWW 3UTSD 5TQ2L 2VTFA 3WL9B 1S9YA 5HGAA 4XPFH 3LS4L 3W11D 3WO4B 2VDPL 4NKIL 2R2HB 2DAVA 1QFWL 1MHHA 4MGXA 3V7MA 3BESR 3T2PA 3RWIB 3W81A 2WBWB 1A64A 5AWNH 3DIFB 3V6FA 5GRJH 3CMGA 3E6FB 3WIIL 5HD8C 5C0BE 3ILPB 3MRKA 3TO4C 3BVNB 1WFTA 2JB5L 3DYOA 4Y4KC 4FQCH 5F7DB 1VFMA 3V2AR 4JRXD 5CP3H 4OLZL 5FF6B 4KPHL 1HHHB 2YZ8A 3PGFL 1SYVB 3FMGH 3UJTL 3MYJB 5CILL 2F5BH 4YBLB 1J5OH 1JPSH 4RX4A 3LRHA 2UY7A 3H7BA 3IXAA 4JFQB 4MJ4A 4Z7NF 4JM2F 3RUGA 1SY6A 5E1AB 5HYEA 1P84K 2YK1H 3UTPD 1AIFB 1X7QA 4MWFB 2V9QA 4EBQL 1VGKB 4UDUB 1TTGA 4HDIA 4HKXB 4YHNA 1JN6B 3EYOA 5DZNA 1GPOH 5FO8A 3WUZA 4A6YH 4PV9B 3QDHA 2DQTH 2AQ1A 3SDCA 3V9FA 1SVZA 4RX4D 3MYZA 3MGTA 3EGSA 3HFML 1F4XL 1RUML 1T03L 5C0ND 3H9SE 4UNUA 2W65A 2IQAB 4UIKL 5EORL 2NX5D 5DMGD 2DQHL 3CMOH 1TZHA 5E8OA 1QNZH 1JRHL 3MV7A 2EDDA 1S7SB 1WWCA 3GSNB 1Q9KA 3BRGC 3LKPA 3RWEA 3N06B 4GKOA 3HE6C 4G6MH 2NY0C 4J23A 4BZYA 5HHPB 3GIZL 3H9SB 1MIML 2Y06H 5H94A 1AC0A 2NY3B 4PRPD 2BNQE 3IKCA 3VXRE 3EKCA 3KPQA 1TNNA 4PTUA 3DO3A 2W60A 2YN5A 1LE5A 1HOCA 2L7UA 4NUGL 3P0VH 4KUCF 3PV7A 4PGEA 4LLMB 2BNQB 3VXRB 4XNYH 3T65B 2JCCE 3F12A 4P5KB 5ITFA 3ES6A 2Z31D 1ORSB 1IGML 1XGYL 3WN5B 3IDUA 3SCMA 3D2UB 4I0PB 3OQ3B 2XA8L 3P9LA 3RWGA 2QQNH 4OIIH 4GJTB 5HVHC 1A7OL 4XBEH 3SHSA 3MRFB 1CS6A 1K5NA 5AZ2L 3BYYA 2JJSA 4I77L 3DX7A 5ENWB 5DLML 1FVEA 4TOYL 3ZLQC 3FB5A 4IJ3C 3P30H 2IAMB 5GGUA 4F58L 1KCRH 1YY8B 1BD2D 4LPVA 3G04A 3M17B 2VAAB 1IBGH 2PETA 3QNZB 1EUTA 4KK8C 1INQA 2HLFD 2FX9H 1BFOA 3MRRA 1KTKE 4JY6B 3V5HB 1DE4B 4P2QE 1OL0A 4MD4A 3FB7B 4RGMC 3SDAB 4A2MA 4XNZC 5C08D 2GSIA 4WU5B 1ZOXA 3WO3B 3BDBA 3V0VA 1OQXA 3BGMB 3F6IA 5ESVA 3IETB 4TPRH 1GYAA 5DRWA 3TCLA 1XT5A 2EXYD 4WW2B 3GSQB 5T5NG 2AV1B 5TQ2H 1KPUA 4ONFL 1YPZF 5KW9L 1VFBA 5DMIL 2VDPH 1CDGA 2R56L 1QFWH 4LKCA 3VU2A 4JZJB 4H1LA 2EE2A 2WINA 1OM3L 4IIQA 3TFKC 4MNQE 3PWPA 3HPJA 4ELMB 2BVEA 3MRIB 4JR9H 3SOBH 3U9UA 5IB2A 3HC3H 2JB5H 3CVIL 4UIMB 2FEDD 1JMXA 4KPHH 4WEMB 3PGFH 3K7UA 4MNQB 5CILH 1DDHB 2YKLL 4Z7WA 3Q6FB 4RQQB 1MFAH 1CE1L 2BOCB 3AROA 4ISVB 4Y16A 1AP2A 4PJDF 4HUXB 3HUJE 5HI5D 4EBQH 3GJFK 2A74B 1AO7A 3MZTA 5HYJE 4NQEA 5IWLC 1RSFA 1DTUA 3LN5A 4YHYB 3HUJB 2DL9A 4NKOA 3DHJA 1BQUA 4JVPA 2DQFB 1A9BB 3HFMH 3O9WD 4Y16D 1F4XH 3RPIA 5EOQH 1T03H 1CIDA 4ZS6C 5EORH 4UIKH 1XZ0A 3RNQB 4LVEA 3T0XA 1XGPB 5F6HI 1G7HA 1C12B 1AH1A 1GGBL 3BKYH 4CADB 5DVNA 2KQMA 5C0GB 5GS0L 4PJEE 5INCA 5DJ8B 3B2UC 2Q1EA 1E27B 3DGCR 1XF3B 4ZFZA 1DEEA 4JFFA 3U6RB 3QI9C 2EO9A 5GRVL 2K3TA 3F7YB 3Q3GA 4X6BA 5INDA 2WUCL 4LVHC 4ZOBA 5JW4M 2AEIT 5DVOA 4PJFF 4Z7VE 5KSAA 1R5IB 4PJEB 3MQIA 4LLDA 1MJ7L 43CAB 2CDGB 4OGZA 1DN2A 1FNAA 2V2WB 4PLJC 3RDTC 4W6WB 3S5LA 3P77A 1BBJB 1MCRA 1MCCA 2EYRA 2XN9D 3OR7B 5FA3B 2BY3A 5T1KA 4Z7VB 2JLLA 3OZ9L 1IGMH 1XGYH 1U8KB 3LS5L 2ERJB 2YD9A 4HIXH 5HYSA 3GO1L 4NBYB 4YIQB 2XA8H 4GW5B 3P4MA 3KPNB 1GC1C 3BXNA 3STLA 2JK5A 1F00I 5AZ2H 4W68A 3BE1L 3MRGB 3PHQB 4NO3B 4P3DB 4OFKA 4I77H 3QWOB 3G9VA 4BSVB 3TNNB 3DV4B 5DLMH 5JOFA 5HHNB 4EKXA 2NY2C 1T21A 4PJIE 3REVB 4F58H 4LNRA 1W8OA 4WNQB 1WJ3A 1IAOA 5A40E 4K7PL 3MXWL 4NWUL 1FZOB 2EDOA 3PNWB 4RAHA 2Q87A 3VCLA 5B3NA 3ARFA 4PJIB 1U3HB 3RVWD 5CWSA 5I66A 1JGEB 2YD4A 1K4CB 4P48A 5F6IB 4PP1D 5EU6E 2ZUSA 5HY9A 3GI8H 3ZKMD 2DLTA 5D6DC 4LBEA 1C8PA 4U33A 3MUGB 1EEQA 1AXIB 3BPLB 1QFPA 5CBEB 2Z4QA 5KW9H 3VRIB 4Q74A 5EU6B 2PW1B 3ARFD 5E8DL 2MCPH 3DRQA 1TTFA 1OM3H 4APQB 1B6DA 1V3KA 2CIIB 4HBCL 4KKNA 4CMMB 2FJFB 5IVOA 4JY4B 4O2FA 4PPTA 5CJQL 4EOWL 5GS1C 5E00B 1CGVA 2CR3A 5EC1B 5IG7B 1CD0A 3CVIH 3T0EE 1G0DA 2IMMA 1HH6A 4IDJL 1NGWA 2YKLH 4HK0A 4O5LH 1FHGA 2HVKB 2ZSWB 1KGCE 5FYLL 5I18L 1FLRL 1CE1H 4V1DE 2E3VA 5FCSH 3O11B 1U8LA 1WIOA 2EH8H 3T0EB 3KNBB 2C1OB 3GI9L 4GKSB 1KCLA 1HXMB 1QQDB 3G5XA 4I18A 2J5LB 3SY0A 2F15A 4KZEL 1IGJB 2IH3B 4TVSa 4C83B 5IROA 5DGRA 4V1DB 4Z7UA 3Q5OA 2KL6A 3HZVB 4IHOB 5HXMA 1JWSB 5GGRY 1NMBL 4M03A 1GZPB 5FKAA 4Q9QH 3IDIA 3D39A 2I9LB 2JJUA 2NZ9C 1NGXB 5DJAA 1U3YA 2EDEA 3AM8C 1CK0L 4GAGL 1LEKA 2OMNA 5BRZE 1J0HA 2B0SH 3LEXA 3GMLA 1MOEA 3P9MB 4WTWA 4M00A 1ZS8B 3UPRA 1Y0LA 5DD6B 1SJXA 5CGYD 2B2XH 3LKOA 1CN4A 5ACZB 2VZOA 1GGBH 4WTZG 5L8KB 5GZOC 3EO1A 2I9TB 3I6GA 3QUZC 1H5BC 2CH8A 4JHWH 1I7TB 4L3CA 4MJ5A 2WUCH 1T7WA 3DYMA 3U46B 2DQJL 5GGSA 3BHBB 2P8PA 1A6AA 4OZFA 3REWB 1MJ7H 4RNRB 1GOFA 3HAEH 5GZND 3GBML 4WU7B 3RWJB 3QFJE 2V2XA 4XRCA 4FFZL 1TDQA 2ZUWA 1A8JH 3BPCB 3IDXL 3OZ9H 4N0UE 3LS5H 1Q0YH 1UWEL 2PXYB 4X6DF 4K3DL 1G0YR 3QFJB 4KAQH 4NKMA 5EIVA 1ND0A 3H42L 2VLRA 1E28B 3X13B 3BE1H 3GNML 4N0UB 1CU4L 2XZZA 3ULSB 2XQBL 4NO0B 3UZQA 1PJ9A 3NOIA 4MX7A 1EBPA 5JO5A 3OKLB 2XFXA 2D31A 1KT2B 1PLGL 3KYOA 1OAZH 3AREA 3UBXB 4HC1A 1TETL 3O3AA 1RQ5A 4K7PH 3MXWH 4NWUH 2ENSA 2AGJH 3QDJE 2X4NB 3MJ9L 2EIZB 2X9YA 2VLRD 3JTSA 4UT7H 1UZ6F 3V4PL 4DK3A 3MCKA 1T3FB 1QOKA 3QDJB 1I3VA 3B5GA 4UQ2B 3ARED 5IBLC 3VWJC 3DUSB 5FYJE 2AAVA 4DOHE 5I8EB 2EEDA 3UC0L 4M61A 4OCNC 2VLJE 1UCBL 2NNAB 2D7PA 2C4FU 4M7JL 2ZWLT 5H37H 1IL1A 3DROA 5I16A 2JELL 5ISZE 3O8XD 3X3GH 4HBCH 4DOHB 1S3KL 4ZOCA 2DD8L 2VLJB 2ZUQB 4P0DA 4EVNB 1CXIA 1Q9OA 3A67L 1RI8A 3C6LC 1IM3B 2XT1B 4YGVA 4LHJB 5D2LA 1JGUL 5EBWA 1PYWA 4IDJH 4ZO8A 1A14H 5IR1B 5FYLH 2AERT 5I18H 1FLRH 4FZEL 1A4KA 4GLRH 5GGTA 2FO4B 1OVZA 3CU7A 3WUWG 3WYRA 3T0BA 4XP4H 4Y4HC 4KZEH 2AQ3A 2R2EB 4BKLA 4G6KH 2ENYA 4D94A 4NPYA 1Q9WB 4ZYKA 3E2HB 4HIEB 4X4MA 5D4QA 3LQZB 5I1DB 1HQRA 3BWAB 4NO5B 1ADQH 2ZG1A 5DQDL 1NMBH 2VZ3A 4O9HL 2GI7A 4TNVF 3KYMB 4HS6B 1KPVB 3KXFE 3QEUA 4DJMA 4GAGH 4M5ZL 1RIUH 4S1QL 4W6XB 12E8L 1INEH 1F42A 5E9DA 2VR4A 5HD8D 3K2UL 3MUJA 4MHHI 1U8PB 1ZKAA 3QIWA 4JFOB 1OD7A 1XGUA 4Y4KD 4PJ7A 5T1MB 3U1SH 1KTLA 2EIDA 5F3HB 3KXFB 4RWYL 1I3RA 2V7NA 3GM0A 2BCKA 4Y5VA 1QR1A 4F7TA 1IAII 4PJCE 3PWNB 3KR3L 4OM0L 1XH3A 1BQSA 2G5RA 1U93B 2DQJH 4OZGF 5DJDA 1ERNA 4ZQKA 5I17A 2W9EL 3ARDB 3QIWD 4JDZB 1DQDH 4I9WD 1H8SA 4PJCB 4JFXB 2P5WA 5D7IF 3WHE0 3CC5A 3SCMC 4ZDHA 4XT1C 3P11H 5KG9B 2DM4A 1KXTB 4JQXC 4KV5F 4XTRC 4K3DH 2EC9U 4I0KA 4FG6C 4FTVD 1E4XI 1X5JA 2X9XA 3GJEA 3G5YA 3QPXL 1TQBC 1AGDB 3H42H 3KPRA 4FFWC 3ROOB 5K9OB 1EAPA 2PCPA 3GNMH 1CU4H 1IGTB 2XQBH 2JJWA 2D0GA 1XF4B 3OG6B 4PR5A 3RIAK 5EZJB 1HHJA 3GM8A 2ZCLL 4URTB 3HE6D 4UV7H 1ODAA 4YHKL 1TETH 1N5YL 4NKDB 2Z8RA 2VL5A 2VR9A 5FIEA 5E8NB 3S97C 1T22A 3MJ9H 2HFTA 4L8SB 3HZMA 3H9HB 5DI8A 1YA5A 4YBHA 3QQ3A 3V4PH 4BELD 2X89D 4P4RA 3QEHA 1NLDL 1OPGL 3HR5B 3MV8D 1G9NL 2X4TB 4J4PA 3HLAB 4X6EA 1EVTC 4LKXA 5EPMB 4IOSD 3MRQB 3JWOL 3UC0H 4QRPA 1UCBH 2CIKA 1MLCB 4P4KB 6FABH 3GHBH 3QIUA 4M7JH 1NJ9A 2PO6B 2R23B 4ESKA 1HQ4B 3DETD 2M1KA 3L5XL 1MJJB 5JXAH 3OHXB 4B0MM 5DTFB 3OB0H 1JK8A 4RBPH 1AQDB 1S3KH 3FN3A 2DD8H 4X6CF 5IEKB 2DQUL 4OZIE 1BOGB 2FD6L 3DUUB 4MLIA 5IHLB 2P5EE 1YN7A 3A67H 3FB6B 4XB8A 1Z0NA 1I7UA 1JGUH 4KK8D 2C3GA 5EUOA 1D6EA 4OZIB 4XVUD 3HI1B 1BFTA 4FZEH 5D7JA 4ZFGL 2Z8SA 1ACYL 2NCMA 3C5ZA 2P5EB 4NQVA 1SJVA 4JB9L 4PJ8C 3D0VB 1VKXA 3KS0J 1BBDL 1SEBB 4PG2C 2CDFA 1SJHB 2VJXA 1XGQB 3TBYA 4JGJA 1IC5L 3TWCH 2GITA 1BX2A 2VYRE 1JWUB 4KDTA 5DQDH 3GSVB 3RNKB 1T0MA 3GMMB 1WFUA 4XCCL 2VDKL 1IM9D 1CWVA 3KPOB 4XCNB 4NN7B 4JZNA 5FK9A 5GRXG 5F89A 4PJGF 2AP2A 3MXVH 2HLAA 12E8H 3TFKD 2YA2A 1YY9C 1T1YA 3K2UH 4LRIA 2C4XA 1EXUB 2LAAA 4LVOB 3BIAX 4UMGA 2DB8A 1CBVL 4RWYH 4X4YA 2R0WL 3F58L 2P24B 3OJ2C 3NABL 4PJXF 4BH8A 3BZFA 3QHZL 4ZMAT 3MOQA 3KR3H 4OM0H 4Z0XA 5GRWA 4O4YL 3EFDL 1U8QB 1F4YL 3MRMA 3P4NA 4HWZB 4TYUA 5DHVH 4CN6A 4RFNB 5J12C 3MREB 2XTLA 1RU9H 3HC4L 1JL8A 2W92A 1BIIA 4G8FB 5MENE 4C56A 2FL5B 3QUXC 3AFLA 4MNHB 3FCTA 1DEDA 4JFDA 4Q58C 1FNEA 3EHBD 5KVEL 2CKNA 1J05B 3BN9C 3TNMA 1LO5B 3LKRB 4H0IA 4Y88A 5MENB 5KSVB 3FOMB 5DJZB 5BS0D 2C1PA 2E6JA 1OQOA 5LQBL 5HGHA 2HH0L 3BFOA 2AJXH 3VH8B 1GZQB 1ZXQA 4JKPL 3K1DA 5EFIB 2EKJA 3QJHB 3B2UD 4EN3A 1WBYA 4NCC1 4OJFL 3EW3B 3QI9D 5HGBB 1N5YH 3HMXA 4L8CA 5IOPA 3U4AA 4Y1AA 5C9JA 5HGDA 1RZGB 2EDKA 3DVGA 3ETBF 3GMOB 4HPOL 1NFDA 4IM8A 4UT9L 1XF2A 1MLBA 1H3UA 4PJ5E 1FL6A 4X5WA 2QTEA 4FQHB 4HHAB 4PLJD 3RDTD 5FOJA 1NLDH 3DVIA 3M1BB 1G9NH 3OF6A 3DYPA 1U2CA 3VXSE 1JZ2A 1UKQA 3VA2C 1MAJA 1KLUA 3JWOH 3O3UN 4PJ5B 2UZXB 5D1XB 2GK0B 3ET9F 5CAYB 3UX9B 3K81A 5M94B 4H5SB 3L5XH 5L9DL 3O3DB 4PGJA 1QLRA 3MA7B 3GSNL 2OTUA 4UBDD 3EZJB 4R96A 2L4OA 2DQUH 32C2B 4RAUB 4JM2C 3SKUD 3CDGB 4NSKA 2FD6H 2NY2D 5KOMC 4PGZA 2IH1B 5E2TL 1IC1A 1RHFA 1KELL 1QFUL 1BZ7B 1Y18B