2N4IA

The solution structure of skint-1, a critical determinant of dendritic epidermal gamma-delta t cell selection
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
b'MSSEPFIVNGLEGPVLASLGGNLELSCQLSPPQQAQHMEIRWFRNLYTEPVHLYRDGKDMFGEIISKYVERTELLKDGIGEGKVTLRIFNVTVDDDGSYHCVFKDGDFYEEHITEVKIT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Selection and upkeep of intraepithelial T-cells protein 1
molecule tags Signaling protein
source organism Mus musculus
publication title Characterization of a Putative Receptor Binding Surface on Skint-1, a Critical Determinant of Dendritic Epidermal T Cell Selection.
pubmed doi rcsb
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2n4iA00
5GGUA 3LV3B 3EJYC 4HD9A 4MNQE 2AEIT 2V5YA 1RJCA 2JELL 5IT2H 2HJLB 5DXWA 5D7IA 5D7JA 5DHYB 4P2QD 2AXJA 1U8MA 5TFSH 4FRWA 3AY4C 2B2XH 4KXZH 2MQ0A 2XACC 4NUJA 3KYNB 1AIFA 3GUTB 3RI5F 1R3HA 4PS4H 1H3XA 2IMNA 2M2DA 4PJ9B 1DVFA 3CXDH 1P9MA 4KJWC 4FQ2L 4KFZC 5E56A 1UGNA 5EORH 1VFBB 4UV4L 3QI9D 2Y7QB 1CT8B 1D3CA 3OPZH 4JHWL 1YNLL 4L4VA 1VPOL 3IDMB 5DQJA 4Y1AA 4KMQA 1BMGA 5MP6H 3TH2T 4EJ1C 2DWDA 4ZG1A 1T1XB 2AK1L 5HHMD 4RWHA 4P2RB 5LQBL 4OCYH 3IT8D 1IGCL 4LPWA 1XGUA 3CX2A 5GIRB 3T0WA 5T1DH 4RDQG 4OV5B 2EC9U 3HC4H 1JGVL 1XF4A 2VLKB 1U3HA 4QGYA 5F3BA 3T3PE 4KMTL 4F15B 3HNVH 1RI8A 5AZ2H 5HSFA 3D69A 5B22A 3D25A 2H2PC 2QL1A 4BQCA 1CLZH 4KK9C 1B6UA 1ZT1B 1ZK9A 3O8XA 3N1PC 3LDBC 4NRYA 1GGUA 2HKHL 3RWHB 1K8DB 3S37L 3MZGB 1ZXQA 1CQYA 4JKPH 2V2XB 2VDRL 3P11H 5T3XH 3GRWA 3LN5B 2VLRB 3QAZB 4JFEE 2X2YA 3OR7B 4NO0B 5BMFL 1EFXD 4XVJL 3Q5TA 5DJDB 4E41B 1JNHB 5C0CD 2XFXB 3I3EA 5E2WL 5EPMA 3RVTC 3NGBB 2OP4L 2OM5A 2BNQD 3FT2A 5C0RL 4U3XA 4IRZH 1FJ1B 4KVNL 4GW5B 2AEQH 3OAUL 1ED3A 4IIQC 4KZEH 4WUUB 1YEJH 4N1HB 1A1NA 2AEWA 3VFPB 1A7NH 1BQLL 3SOBH 1P5VA 1S9YA 3MV8B 5IV2A 3X3FH 3QDME 5IFAL 3H3BC 2E8ZA 5F9DC 3EFFB 4NRXB 1HZHL 3I75B 2GJ6A 3GNMH 5ELIA 4UDTA 1FV1A 4WV1B 3U0TA 5TH2B 1KEML 4M7LL 3KS0J 1F3DH 1NFKA 2BMKA 3TIEB 1QUNA 4CKVX 3VXMB 3DUUA 1T66D 1IJ9A 1X6LA 4UBDC 5EH1A 2GJZB 3G6AB 2YPLA 3EO1B 2AXGB 1HIMH 1RZJC 1KCUH 4QXTB 4XXCC 4NQEB 5HJ3B 4G8IB 3EYFB 3PGDB 3SKJH 3GIZL 3F8UB 3ZHKA 5BRZD 5ILTH 2B39A 3QSKB 3P73A 1S7TB 4L4TA 5JUEL 1ZWIB 4HXBH 3GZKA 4ODBD 5FB8A 1MCEA 4P4KA 1J1OH 1LNUB 2W65A 2PKDA 4LSPH 4Q2ZA 1BIIA 2HT3C 4GRWF 3I6KA 4GKOA 3QCUH 4QHNA 5JZ7D 3TH3T 4KMLB 3VRJB 3EDFA 1MVFA 1K9TA 4G8GB 3RTQA 3FL7A 4G8FA 3TNMB 3ULSB 4H1LH 1I7ZB 4L3CB 2NYYC 1V3JA 2IFFH 4UTAL 3T65A 1A0QL 3V8CA 4PLJC 1N4XH 4PV8A 1FVDA 4P4RB 2XQBL 3MNVB 3ZLQC 1G0YR 2C1PA 2BNQE 1FSKC 2HT3D 2VDLL 3CX5K 1P84K 1XT5A 3MGOB 3T0BA 2OTWB 4KAQH 4JFQB 2GJ6E 3MJ7A 5AZEL 1P7HL 4NN7B 2NPLX 4RGNC 4WO4D 2BNUA 3RY6A 2QKIB 3L95B 2IH3A 4I9WD 3PHOB 1VDGA 4JRYA 4R0LC 4UILL 2LAAA 2NY4D 5D96C 4YDJA 4R4BB 4PGCB 4HCRL 2DQUL 3IXTA 3CZFB 2EYTA 3JV6A 3ZE1F 4YBQC 3BUTA 5CJQL 3A67L 1FQ9C 4OAWA 3RKDC 3FB7A 5CJXA 4KI5E 4N8VA 2N56A 1FORH 1EJOL 1LE5B 1UA6L 2PYED 5CINL 2R29L 2WW8A 4WRLA 2EDKA 1KULA 2NTFA 3CSYA 4IRJA 5DJ2A 4TNWF 4FNLL 4JO1H 4NZTH 3SKUD 4ZXBB 2WAHA 1AR2A 4Z5RB 4QTHB 2HT2C 3IETB 3IDUA 4LLYB 1LP9A 5I8OL 1MFAL 5FUZH 3AAZB 5FYLE 2ZOKA 4N8PA 4XWGH 1BQHA 2XT1B 3P0VL 1S7UA 4O9HH 1JRHI 1NGQH 5J1AB 4P2QA 5BO1L 2CKBB 2AJUH 4AH2B 2QKIA 1KIUA 3GKWL 3MJ7B 1P1ZB 2GITA 4JFQA 2VC2H 5INDA 2OSLB 3B4NA 4JJ5B 1S5IL 4YBHA 5EOCJ 8CGTA 1TQCB 5HDLA 1BX2B 3OXRB 3QFJB 4U6HB 1BBJA 1MRFH 2VB5A 4L8BA 3VMPA 5DUBB 1SBSL 3KYMA 4OD2B 2O61B 5AG9A 1BZ9B 4KJPD 4Z7VB 1EA9C 4AIOA 4ZUSA 3QFDA 4DUVA 1TJGH 1WBZA 5HYSA 1L9MA 1A7PH 3C5ZB 2YEZB 1A1OA 5D4QA 5F72S 2XA8L 1I8MA 2H9GB 5E7FA 3UYOD 4L4TB 4ZNCD 3OAYH 4ZFGH 5BZDA 5GGQL 3OHXB 4ODVL 2LQRA 4MNQB 3GMRB 3QDGB 3O45B 4HLZG 1JYNA 1CLOH 2XOTA 3LKOA 4JKLA 3QUYD 4NOBA 3HHRB 2AABH 4L5FL 2BSSB 1A14H 3QZWB 4I4WB 4XPTH 4QRPA 2BMKB 2IGFH 3TIEA 3TJEH 4KZDH 2X9XA 3C09B 3EJYD 4K71B 4K3JL 3NIDF 1KIQA 3OXSA 4PTTB 2FDBP 4L5FH 4YDVA 2D31B 4X8JB 5HBBA 3T3MF 4NRXA 2HTLC 1AGCA 1FYTE 2VMFA 1II4E 1MCFA 4NN6C 1KB9K 4PLJD 1WITA 2NW2B 1K85A 4S2SB 2QSVA 3FO9B 4KK9D 1MHEA 4GAGL 5IBTH 2UVFA 4KJWD 4G6AC 4MDIB 4XNMA 4OLZL 4NNPL 1TVDA 4OTXH 2MNUA 3TVMA 1CE6A 3H9SB 1JPSH 2AAVA 4Y5YC 3REVB 4GRWH 5MEQA 2XV6B 5IESL 1FIGH 4XCYA 3V5KB 1PYWA 2PYEB 3SGDH 3RA7L 4BZ2H 3ILQC 3DNKA 4LOUD 4OZGA 2EDTA 1HHKA 2WUCL 4D9RE 1IGTB 2ZUYA 3WL9A 5FM5M 4PJXB 3TCLA 2VYRE 5D6DC 4EI6A 2IAMD 3J8F7 3O3BA 3HC0B 4E41D 4EZMA 3GSVA 1NBZA 5I71B 5C0ND 1N8ZA 2DMBA 2GTWA 1QSEA 2GQHA 3BD3A 4DKFH 2J4WH 4O5LH 2VKXA 2VLRE 2HLAB 4B7LA 4PJBB 4G8EB 4FMFA 4QHUA 1DQMH 3OB8A 4GRLA 3VJ6B 4LHQB 4I8DA 3O4OC 5I6XB 1TETL 3HG1E 5JOPD 4ZFFB 4IOIB 1UXWA 5HHPA 4KHXH 4JZOA 1M6OB 1XF2B 5KVDH 1BD2D 2A77L 1NAMH 5IIEB 1G7IA 3LKSA 3QIWC 1X7QA 1YEIL 5EO0B 3F6IA 1WT5A 3PNWA 3VFVB 4QOKD 3JZ7A 3UYRH 2BNRD 5HHOD 2P5WA 4ODHL 5TDOB 4M5ZL 2FWOB 4WW1B 5F1NA 3VFTB 2DQGL 5IB1B 1MIML 5CILH 1KCRL 1R3HB 2KQMA 4JPVL 4KZEL 5DEFA 5FAAA 2FL5B 1ZEAL 4HGWB 1GGYA 1CU4H 4CNIB 5F1OB 4HXBL 1R3LA 3RQ3A 2Z9TA 1W0VB 2A74A 4IDLA 4PJGE 5GSRA 4LSTL 2VR5A 4P5TD 1IAMA 4AEFA 4QHLB 2AI0L 5DMGC 4LNVA 3ZDZE 4RFOH 4JDTH 3WKNA 3A6CH 3WIIH 4MXQD 4GT7A 1GPOH 3BWAA 5DURB 3U0WL 4KY1H 1QYGH 3BIKA 5JR1L 3FCTB 2K3TA 1TJIH 4L4JA 4UDUA 4JY4B 3HFMH 4E5XA 2A73A 2FX8L 3KPSE 3SKMA 2A6DB 4F9PC 1BFOB 5GPRA 1W0VA 3GRWL 4RGOH 1ZTXH 4XXDB 4CNIA 5M7QA 1T1WB 2OZ4H 4UAOC 1MPAL 5E1AB 3STZA 3QG6A 1U2CA 1J1OL 1EO8L 1S9WA 4AQ1B 5E4EB 1DLFH 4W4OC 5KVMC 4HKJA 2DQEH 1HI6B 3UPCA 4OLUL 3V0AC 1U92A 4JGJA 4WY7H 4U1GB 4GKZA 5IMKA 3SGEH 4HUMB 2QSCL 4UNTA 5IJKC 1U8HB 1ETZA 1HXYA 4WCYH 3MOAL 5A2IH 3V4UH 3LSOA 4LKXB 4YFEA 2BOBB 2OL3B 4HMDA 1WFUA 1WFTA 3FB5B 4PRHA 1NCNA 4D0DA 5JW4R 2RGSA 4Z7WA 4KUCF 4JANB 1EMTH 5IF0B 4MZ2A 4RMTA 1RZ7L 3RL1A 3CFCH 4XHJC 4QRSB 3GJFH 4P9MH 3KXFE 4JFFB 4LSVL 1FGNL 1RK1B 4CU7A 1XR9A 2VDQL 3UTSD 2EDXA 3MRFA 2GCYB 2V5TA 3QUML 4Q9BA 5FM5O 3KYKH 5K9OA 2DD8L 5TQ2H 1YEDA 3R0MA 5FEBA 5IOPB 1JYXA 1MAKA 1UVQB 3HAEB 1GSMA 3RWCB 1BLNB 3JWNC 3UMTA 3LMJH 4MNGA 4PGBA 4LCCC 1C16A 1FGNH 3KHQA 4WO4B 3AREC 4D9QE 4P9ML 1I1AD 3BPCA 5AUMB 4H1LA 2C4XA 5CINH 1Q8MA 4HKBB 4Y4HC 4NKMB 5FO8A 5EU6D 4WW2A 2NR6C 1FGVL 2D2OA 1NUDA 3PP4L 3OKEA 3V0VB 3WJJC 3P77B 4HS3B 1H3TA 1A9EA 4M5ZH 4KK6C 4P2QE 1U95A 1RPQA 3MRHA 1Q94B 2AXHA 4JDZB 3GSNL 3O3EB 4EDWL 2CR3A 4FQCH 2NX5A 5BVPL 1JTTA 4O2EA 4PB9L 1OP9A 2XG5A 1JK8B 3LKNB 1S7VB 3X3FL 2Y1VA 3K3QA 4I3RH 4OLWH 1KGCE 4MJIB 3LDBB 4ZUUB 2Z8RA 5DR5L 5HDQL 3UTPE 3VGBA 2V7HA 2AABL 3BH9B 4Q0XH 2R1WB 5KVFL 4PJEA 4I3SH 1A6VH 1ZANL 4KJYA 2YRLA 4Y89A 1MCOH 5T33L 2VLJA 3QDGA 1MELA 2XWTA 3KJ4C 2E6QA 5EWIL 4KRNA 4PR5B 3QQ3A 4M00A 4U1JB 3OJDA 1WCBB 1HIML 3OGCA 3HZKA 1QLFA 2FGWH 3GSUA 2JB5H 4KROC 1V3LA 1BWMA 2EKJA 3CPLB 1LO4H 2H45A 1F3JA 2IFFL 4UTAH 4IMLB 1KCVL 2Z92A 3BFOA 3WS3B 4MA1C 4JRYD 4DCQB 1UC6A 3C8KA 4F57H 3EDJA 1EAPB 4U6TA 3F7VB 4OZ4B 5GHWH 1CZ8H 4AJ0A 4PJHF 1UM4H 2BHZA 4L8DA 4HUVB 2HTKD 4O02H 4CMHC 2VZ1A 3RUGF 5GS0D 1QSFE 2VKWA 4IOFD 3OXRA 1KLUA 4JO4L 1S7VA 4W70A 3FRPG 4RWYH 1SEBA 3QQNA 1T0MA 4P99A 2DQEL 3FMGL 1CE1L 4YHPA 5GISL 2QQNL 4PRIB 5BOZG 4U49A 4Y8AA 3S98A 2J8UE 5L2KB 3MRHB 2ZUXA 5C0GA 5BOPA 5I1JH 4P49A 1JWMB 2W9DL 4JFHE 2PYEE 1C8PA 2J6EA 1WUNT 5LXGL 3SBWA 3KPMA 2VR9A 4CU8A 1QOKA 2VRAA 4WW2B 4XVUC 5TJWK 4NKMA 1G7LA 1JHKH 4LLYA 4Q7DA 5GGVH 3QWOA 4EUPH 1F4XH 3JVGC 1LEKA 3GBMH 1NUGA 5GRWA 3EHBC 1AE6H 3VXNB 1VADB 1QA9B 1FBIL 4YFLF 4PP2B 1EHXA 5JOEA 1G7HA 3CDFA 4PJCE 3EOBA 4R2GD 5KSBE 3FB7B 2W59A 2R8SH 3JSSA 2P5ED 3O9WB 4WNQA 2YPKA 3QXUA 1LEIA 2EYSB 1VEMA 5IB4B 1BQHG 4RCAA 4UNUA 3QXWA 2MCG1 3RL1B 1ZKAA 1U6AL 4JRYB 2HFGL 4MQ7B 4BFGA 2DM7A 5DDHB 4HX1A 2VUOA 5CGTA 4U7MA 2DM3A 5CP7A 3E2HC 3WDJA 5HYJE 1TZIB 4NQTA 4MJ4A 5EULV 3RBGA 1KEGL 4APQB 2MJWA 1ES0B 5DFWH 2DKSA 3CDGA 5ABDE 3T09A 5CZKA 1CXEA 4F9PA 4NQDB 5IHUL 3MV7A 3H42L 4HKJB 2VDOH 5IB2B 2FSEB 3O3UN 2E9BA 4Y2DB 4KPHL 8FABA 3ZHDA 3MJ9H 3V6ZA 5E08H 4MJID 1F6AB 4L8SA 3X14B 1UADC 4QXGH 1NGPH 5C7XH 2AJYL 15C8H 1XMWA 1AXTH 2I60L 3VWJC 2G5BB 2MKLC 4ONFL 5FB8B 1BFOA 5SWQA 3P73B 3QI9C 2GK0A 3EOAB 2CLZA 2CLRB 1C7TA 4OLVH 5FO7A 1ZT7B 3HC3H 2OQJA 3B8YA 3SDAC 1T2XA 3B2VH 4GG6F 4ZOAA 1TZHB 1IGIL 2P47B 2ZNWA 3ZDXF 2F54B 1Y0LA 3ZE2F 4YFDB 3QJFB 3VFOA 4WTZG 4OF6A 4EUPA 3HCVB 3KVQA 3G08B 4FXLA 3AB0B 3IRPX 1K3IA 3E6FA 2A74B 1MJ7L 3D39B 1DEDA 3MRRA 2EH7L 2UWEF 2Z91A 4I2XB 3QULB 3RBSA 3EFFA 2YBRB 4U2YA 1OLLA 3CFJB 1GH7A 1NUNB 1ZVYA 4TVPE 3V5DA 3S4SG 2UWEE 1CLYH 2BK8A 3LQAL 1MQKH 5FGBC 3TO2B 3VH8G 3U46B 1CWVA 4EBQH 1A1NB 1MHCA 1RZIB 3L3OB 3T8XA 4OF5A 3KAAA 4TTDD 2A6JB 3KPQB 3KS0H 2OS7A 3U36B 4DVRL 1EBPA 5J3HD 3HNVL 3TO4C 3FT2B 2HJFB 2FJHA 2VSDA 1M6OA 4WI9A 3UJIL 1XF2A 4G8GD 1JTPA 2QR0A 3LN4A 2FEDC 1J1XL 5KW9H 2M26A 4X6CA 4F37K 1OCWL 2V2XA 4G8EA 5CJOH 4KGLA 3EYUH 2OI9C 3IU3A 3HNTH 5E2UL 3MV7E 2FATL 4GG8A 4Z78A 1TENA 3HG1D 4GAJL 2UZYB 5CEZL 5IFHH 1P69B 1P6AB 1U3HB 2NY4B 1EEZB 1JZ3A 5L88L 1CBVL 2K9UA 5I16B 2BVUA 1PQZA 3FAWA 1ZGLM 4WJ5A 5A1AA 1Q9LA 4P2RA 1ZLUK 1MHHB 2NLJA 4L4VB 2AV7A 1CE6B 4HJGA 3WHE0 4M1GL 1IKFH 4Z7NF 1DUZB 4S1SL 5JXEC 1J5OL 4YPJA 3MA9H 5SWZB 3QZWG 2QLVB 1C5BL 3SBWC 1JZ6A 3MUGB 2NW2A 5EOTA 4D2NA 4X0KA 5I1CL 2RCSL 3GUTA 3VGGA 3ZT5A 3SJVA 4OZHE 1IC4H 1MCSA 2OI9B 2C26A 3NTCL 1T7ZA 4LSRH 3C9NA 1NANI 1EGJH 1HHGB 3ULVD 4JM2A 4NJAL 4HEPG 4OFVA 5EU3A 2A2QT 3BPNB 2X10A 3UDWA 1A7QL 2WANA 1A3RL 2YHGA 4N0FB 2DJUA 1BZQK 1M05A 4JFPA 3DARA 1K4DB 5ISZE 3MCKA 4G9DB 2J8UF 4YAQA 2BY2A 2BCKA 2EDEA 2CKBL 3V6ZB 5T1LD 5J9PA 1KNOB 3MX0A 1A3RH 5IB2A 2VLKD 4ZO8A 4Y1AD 5A3ID 3GJFA 2E7BA 5EIIB 1E4XI 5EFIB 4CRPA 1F02I 3ULUE 4JFZH 1RSFA 4MNGE 3W11D 5L0QC 3F7RA 1AO7A 4NQSB 1UM5L 2DQIH 1D5IH 3JVGA 1RAMA 4EUPG 3OB0H 5F96H 1JI1A 2VSCA 3LKPB 2AXFB 5DUBA 4KRPC 4FFWC 4OFIA 1AGFA 2BC4A 3ULUD 3QFJA 2JJWA 4WDIA 4QF1B 4JCMA 1YQVL 1LO0H 2HVKB 4OLUH 1AO7D 2F58L 3SDCA 5HD8D 3MRKA 4NYLA 3GBNH 4EBQL 4GKSB 1VSCA 4O02L 4R0LB 2D7PA 4R96B 3MNZA 5HHOE 5D96B 5E8DH 1X5ZA 2R4SH 4PGZA 4LDLB 2H32A 2BVYA 2NQCA 1MJJB 4KC3B 2YPVH 3FTGA 4DFIA 1JMZA 2YWZA 4NNYB 3MRMB 1VADA 5JPMA 2VZTA 4LOUC 4AEHL 5CJBA 3U82B 3QJFA 4LVNC 4QLRA 4WWKB 3SCMC 3MGTA 5GS0H 2YD1A 2E9WA 4PJ5B 1FSKB 3O0RH 1PKOA 1P6FA 3ZDYE 4MD0A 1CCZA 4QTHA 3L3KA 2XZQL 3HS0A 4K3DL 4ZAKA 2YKLL 5SWQB 4IS6A 4N8VB 2EIZA 5EUOE 1CD9B 1AXIB 1ORSB 5EA0L 5F1IB 2CUIA 2XNAA 4DZBB 2PO6A 2VZUA 2EYTB 5E6IC 4F33B 1E4KC 4FG6D 4R4BA 4Y2DA 1EH9A 3G6DH 3LS5L 3AUVA 1B0GB 3FFDA 3BSZL 1DP0A 3B6SA 2FEDD 3JV5A 3FN0H 4X7CC 4Q97A 1HCVA 1ADQA 3T4AB 3DO3A 3LPGA 4FQLH 4PJ8A 2Y5EA 2HT2D 3LOWA 1B6DA 1WAAE 2OR8A 5C2BH 3MTRA 3QEHB 3SDDD 1RQ5A 1RVFH 4APQA 1FLTX 4BKLB 3C5ZD 4JVPA 4XWOD 1MWAL 1CGTA 4OCWH 2IAND 1A6ZA 5CP7B 1IM9D 4OKVB 4NZUL 3VCLA 3JV4A 4LF3A 3ARWA 3QCUL 4LGRB 4NQEE 1TFHA 3WFCH 4QRQB 3MRCB 3OKNA 4WNQB 4OB5H 1LEIB 3LIZL 4HLZH 2ZJSH 43CAA 4A2MA 1TJHL 1DBJL 1ZWIA 1UJ3C 3QPQD 3WLWD 1OF2A 4GG6B 4Y5XC 4Z9KB 1QVOA 4MAUL 4OB5L 4Y4FB 3ETBF 4YUEL 1Y6MR 1G7LB 3U4BH 3RL2B 1C12B 1FO0A 4PP1C 1IAKA 2SEBA 3VFNB 1KJVB 4XVSL 4WWID 2VXTL 1LO3H 4OCSL 1CIUA 2ATPB 4XC1L 1CFQB 5C0GB 3AREB 3MREB 4F7EA 3UJIH 4NNPH 5DMIH 1AQKH 2GUOA 2AERT 5CIPH 4H0IA 3D87B 1QSZA 2CJUL 3BPLB 2VXSL 3MRJA 3QQ9C 4M7JH 3Q3GB 4HS3A 3KPSA 5C0BD 4ERSH 5F96L 4UUJA 2YUVA 2C9AA 4HWEH 5F7HA 5MI0C 1E28B 4XP5H 1XFPA 5D5MA 3RVVD 3HB3C 3BGFB 5D7LE 2ZPKH 4TSCL 2DYPD 2AP2A 4AEHH 2YXFA 2F53A 1PZUB 1KBGL 1JZ2A 5I1JL 1KLGB 1B2WH 2FX7L 1GZPA 2QQLL 5DSCA 3UBXA 5I1LA 4IMLA 3WS3A 4NO3A 3BVNA 5CLTA 4O51B 2W0LA 3LN5A 3CPLA 1JWSB 1G6RB 2A6KA 4Z7VE 1VACB 5C0JA 4CVXB 3S4SA 4YBLC 1I8IA 1ZLSH 4JVUA 2PR4H 4KI5C 4XX1E 3NAAL 1DJSA 4P2OC 4EIGB 2NMSA 3L7EA 3H7BA 4QEGA 3VI3E 1FBIH 2OTUB 4JM2C 2JB6A 2WUCH 4Z7WB 1OQXA 1N2RA 2ED7A 4KJYB 2C3WA 3QHFH 3LSOB 4LKXA 5HGDB 1IAOB 5D2NE 1KYOK 4C57C 5KAQG 3VMOA 1I3RB 4WU7A 1ETZB 2APVA 3UDWC 4GKZB 3NIFF 4W81A 2R4RH 1JZ7A 1FGVH 3QEUA 3TBVA 1PY4A 3WJLC 4KTYA 2WLZA 2VDOL 4HV8A 2IPUG 4XB7A 3BKJL 4RIRA 3D5OF 3EFDL 4F15C 3NN8A 1IC5H 3JWOL 1XGTB 3CVHL 5KANI 5C0IB 2CIIB 3GMPB 3QIWA 4K7PX 2AKRB 1Y6KR 5IW1B 1KV3A 4MQTB 1IC7H 3KWWA 1KB9J 5IMLB 1QACA 2PTTA 2ZNXA 3K8KA 4KKCD 4NUJB 4ELMA 5EUKB 5GGRY 1LO5A 1X5HA 4OZIF 5ESVB 4JN2B 1TTGA 5FO8B 5LGJA 4I48A 1DN0B 3BPCB 4HUWB 1C5CL 1DL7H 3T04D 1GC1C 4YWGH 4QNPE 1WIPA 35C8H 2D7MA 2XZAH 1IC7L 3RIAK 5CEZD 2C3GA 4XP6L 1WBXB 1UYWL 3BYYA 5K9KB 1CI5A 1N5AA 3D0LA 1FCCA 4NHCL 4MS8D 2A9ML 3MFFB 3QFJE 1UCTA 2BDNL 1IZJA 3MRIB 4GS7B 4F7TB 4C56E 2FL5A 2ICWI 4HMCA 1F6LL 1OSPL 5FUOH 3U83A 1Z9MA 5CEZE 5D1QB 1BAFL 5IMLA 4PJ8C 4JREB 3DYOA 3QDMD 1QO3A 4OCMC 4PBVC 5J12C 5JIHA 3QA3A 3SDXB 2AKRA 3VXUE 5C0CB 2VWEC 4QWWD 1YY9C 3RDTD 1LEGB 3QDJE 4G6JH 3BO8A 1XGPB 1L7TH 4EXPX 2BVQB 4XRCB 4JVWA 1KFAH 3U7YL 3UEZA 4LK4A 3H0TB 4X6EB 3B5TA 1U8HA 5I71C 1RZFL 2R0LH 1NEZG 1OVZA 2ITCA 3BE1L 1NGZB 3PIQA 3GSNA 2CJUH 1UWGL 1N4XL 2XTJE 4JM4L 5C0FA 4GRLB 3O8XD 3UTSB 2WZPD 3DV4B 5DFVD 2YN5A 3X11B 3ARFB 1M7DB 3GSOA 2FBJL 3QG6B 3WS6C 5D72H 1KT2B 5B38G 4OKDA 3KHOA 4XXDA 4WW2F 2GTWB 1ZLVH 3B8SA 1T2QL 4XMKH 1A22B 3H7BB 4POUB 1MFAH 3Q5YA 2DI9A 4N0YH 2BNQA 5C0EB 1MCBA 1UQSA 3WL9B 1S78D 2UZIH 5EG6C 5CEXB 1EO7A 2XN9A 3ECBB 1PYWB 4OF3A 4JHAH 3QXAB 5ICZA 2MCPL 3TO4D 3BHBB 5KSAB 1CLZL 5C2BL 3DGGA 4GO6B 3VDAA 1IFHH 1IAIH 2H1PH 4OT1L 5I8KH 3HE7D 3NIGE 1S78C 4HBCL 1GGBH 4S2SA 4NQVA 2FLBT 1NMCC 1F97A 4NQXB 5A16B 4AL8H 1S9XA 2VIRB 4MXVE 4NO5B 5FM4A 1CXLA 4JDVB 1CFNB 3O2VL 1PG7W 4YDVB 4GW4B 2ZUVA 2MFNA 5T1KD 3T4YB 1J10A 5DJCA 3RJQB 1YEJL 1T22B 2C3VA 3MRBA 4HCRA 1X7QB 1GC1L 2SEBB 2Q3ZA 5DO2D 2NY0D 1P7QD 1L0YA 5C09A 1FO0L 2YD4A 2CMRL 4NJ9L 1KPRA 1W0WB 1DBMH 1G7PA 4P46D 1Q9WB 1B0WA 4NM8L 3KG5A 4LAQL 5HHVH 1JZ5A 3LQZA 5D6CA 5BZDB 4R8WL 4NZUH 3GMLB 2IGFL 5I8CB 3U30C 2WBJB 4HH8A 4OLXH 4Z7VF 4HWUA 3N9GL 4K2UH 4LQFH 4NBZB 3RIFK 3JBG7 4GMSH 1NBZB 3ARBB 1G9ML 2Z8SA 3QFDB 4WEBH 1NMCB 1T6VN 4N0CD 1ZA6B 1IGTA 4NFDA 4L9DA 3KYMB 2O61A 3Q6GL 5C6PB 1A6ZB 2DKMA 4KK6D 1R6VA 4I0PC 4K9EC 5KVEL 1DBBH 2FR4A 5FUCC 4F57L 4OZHB 3STBA 2BNRA 3T0EC 3KLHC 4PJFE 4GS7C 5GISH 1R3IH 5T5NG 3QEHA 5FECB 3UC0H 2DBLL 1VEPA 1RUQH 3V4PL 4XP1L 1J12A 3BZDA 3GMOA 1ZLWH 3CMOL 1CGUA 1AGBA 2NCMA 1V8HA 1CLYL 3LQAH 4NKOA 1ACZA 5KSBF 3QXVA 3ZYIA 1RU9H 1H8NA 5DC9B 1I8LA 1RZFH 5E2UH 4FQXC 5GGVL 5E2VL 3MNWA 4DZBA 3WBDA 2ICWA 2VWEE 4KDTA 5D1XD 4RWYL 5C92A 2IQ9L 3CCHB 4YIQB 1ZHNA 4KDVA 4S11A 5GSVA 3STLB 4JPIA 4XMPL 1A9BB 5INCA 5HHNA 3VXRD 2DL2A 3O6FC 3Q5OA 3PP4H 2BSSA 1DQML 1CLCA 2JK5B 3GMMB 2P8MA 3EYOA 3LQAC 4UINL 4HULB 3KPNB 4MNQA 4WWKA 4YHYC 1CTNA 4HUXA 1NCCL 3MROB 5FYJE 3L6FA 2HFEB 1G1YA 4YHML 4OGAD 4IMKC 1PG7H 2CXKA 3ROOB 4KGJA 1A5FH 4S0SD 3FTGB 1C5BH 3K4ZA 4D3CL 3RWFB 4LEOB 1F11A 1A1OB 3X13A 4GAJH 2UUDH 5CEYA 1IM9A 1G9MC 2BNUB 3EGSB 3QUXC 1WBZB 2XKUA 2FATH 4X80L 3WNOA 1OM3H 2CRIA 1WC7B 3D85B 2E7MA 2ESVA 3SGKC 3EDEA 1RIUL 5LCVL 1ULVA 4NQCA 2OL3L 1NGQL 2DQHL 4PGDA 3QI9A 3RZCA 3V0WL 4W4NA 1OM3L 3S35X 2YOCA 4PREB 3SE4A 1IQWL 3MUZ1 3OWEA 5CD3B 1MEXL 3ULVL 2GJJA 4MCZB 1V3KA 3QXDA 3FQNA 4HH9A 5DJYA 5E99L 3DURB 3Q6FB 4M1GH 4OUUA 4KVNH 4PB9H 4QHNB 5DQDH 3VW3L 1FVCA 3EOTL 4Q2ZB 2VABA 4PJHB 3NCYP 2A77H 1PX4A 3QUYA 3MRDB 4KUCD 5IROA 5GS3A 3UTPD 1S7UB 4UBDD 1SBSH 4UTBH 3SE3C 1UB6A 1ZT4B 4NPYB 3RFZC 4ZOBA 4G8IA 4QXTA 5FA3A 1CZ8L 2M1KA 4PJAF 3TBSB 1N3NB 2AJVL 3HUJE 2J8UA 7CGTA 4LGPB 1INQB 1KN2H 4OM0L 2FCBA 3OV6A 3L5XL 2ICEB 4D0CB 4K9EH 3DUUB 4ZXBA 4XTRD 1SYSA 4K7FA 4OM1H 5I1AB 2DF3A 5C0BA 5LWYL 4JPIB 3BQUB 1MCOL 3FFCB 4HT1H 2DTSA 3G5YB 1H3UA 4MA7H 2AK4D 4CVUA 4XNZC 4MWFA 1C1EL 2HKFH 3L5XH 2QQKH 5C07A 5DZNA 3K2MC 2R2CA 3ZE1E 1YECL 5J57B 1AHWB 3FRPA 3TN0C 4CAGA 5B39B 5J1TC 1F58H 4RFOL 4PGCA 2WIMA 4FTVE 3D39D 1XGRB 3OX8A 4HUKB 4EQ3A 2O93L 3OKOB 5L7XH 5IK3A 1PGRB 4MA7L 1WZ1L 3QO0A 5IBUG 2R1XA 1EMTL 5GGTL 2EECA 1MCCA 2X70A 3W81A 2VAAB 1F2QA 4HIJB 5EORL 3PWLB 3QCTH 4P2OB 3MGOA 2YA1A 4PRAA 1MHHA 4OZHA 2G60H 5H94B 4E41A 3BN9D 5T1KA 3SGJA 5EUOA 4M1CD 2VLJE 1FC1A 5JXAL 4M6MH 1Z0MA 1NL0H 1ZA6A 3RP1A 5IMOA 1KC5H 5D8JL 3U4EB 3VD4A 1RIVL 1QSEE 4G9FD 4Y19D 1GGIL 3GSWA 1ZA3A 3VRLE 3BPLC 2BERA 2NXYD 1C08A 2BSED 1AQDA 3V4UL 1QQDB 3N1MC 4H5SB 4GBXB 4G9FB 1EFQA 2XZZA 2V17L 2W91A 2EKSA 3GHEL 4Q9RL 4PJGF 3VD3A 1E0OB 2J4WL 2IALA 2R29H 3G6AA 5E1HB 4GKNB 4DN4H 5JDSA 4Y1AB 4XBEL 1LK3H 2VDQH 3T08A 5ISZB 4ISVB 1T22A 4JKWA 3QNXB 3TCXA 1UKSA 5TDNB 3KPRD 4FFVC 3DMMC 3T2PA 1KUMA 4A2LA 2CMRH 2DB8A 4HK3N 4JFFE 5EIVA 2B7DT 2NY7H 3L3IA 4HIXL 3TO2A 2KZWA 5DQDL 3VW3H 4P3DB 4HMEA 1CDYA 2EDNA 1YEIH 3C60A 2X4PA 5SWSA 3B2VL 3FB8B 5JQ6H 2I07A 2VC2L 1BZ7B 4LAJH 4LP4A 1ED3B 4ODHH 5HVGB 1S8DA 1WJ3A 2HFFA 1IBGL 1D9KC 3WCYA 1S3KL 2F9BT 5EDXA 4WEMB 5GGUB 3MLTB 3D18B 3UPRA 2PW2A 1QFWH 4EDXB 2XXMB 1HEZB 4FQXD 4H20H 2C4FU 4ODUA 3B5GA 4X99A 2VLRA 4KPHH 1RJZA 4IRJD 4PY7A 4W6XB 2LU4A 3CVIL 4R7DB 2GK0B 5B3JF 3TZVC 5GHWL 4N1EA 1MF2L 3NCYS 4ODWB 5D1QD 2IADA 5JOFA 2ITDB 5B3JE 4L8SB 4W4OA 4OF7A 1M7DA 3A6CL 3GSOB 4WTZA 2HJKB 3GB7B 4ONGH 3MLUH 4X4XB 2FSEA 3RVTD 3V8OA 3WXWL 4ZFGL 2PXYC 2FIKA 4OV5A 3MV7B 4G7YH 4JEGB 4PRHD 3INUH 4NQDA 3BAEL 4TQEL 3I3BA 2IH1B 5CUSL 5ADOL 2Y25A 1BPVA 1J8HD 4TUOA 1XGUB 4PJFB 4HC1H 2YC1B 4XI5D 3CFKB 3MA7A 4JY6A 5FM8A 4NRZA 2Y72A 1KB5H 3L7FB 1T21B 3HE6B 2VDNH 2R4SL 3RZCD 3ZO0A 4YJZL 2Y7QA 4HAGA 2ERJC 2A83B 4DZ8B 3P30H 1DLFL 1U9KA 3ARDB 1Z9OA 2ED9A 2CUMA 5C0CA 1AXSB 1V05A 2DLTA 1DDHB 1PD6A 3GGWA 3MLWL 2D9QB 3PWNA 2B5IB 2Z0BA 1WAAF 1OL0A 4R2GC 3GBML 4XP1H 4F9LA 1T3FB 3HR5A 1FYTA 1B4JH 1JPGA 1PG7L 3RDTC 2UZIL 1AD9B 3BN3B 3ZE2E 3NPZB 3MLZH 5DRNB 3NZ8A 3O3DA 5DHVA 5IJKA 5D7KD 1IEBB 4FQQB 3IDJA 2GAZB 5FYKD 1RZ7H 4XMKL 3SDXE 1DVFC 1RJYA 1S7XB 5CWSB 5E94B 1GGIH 3O4LB 3D2UD 1MQ8A 1WZKA 3DYMA 4I48B 4XH2A 3UTZA 4I0KA 1Z3GL 1BFVH 3KJ6L 4XT1C 1QSFD 2GTZB 1F4YH 4LSQH 5I6XC 2W0KA 3BZFA 4WFHE 2EDLA 4L3ED 4ESKA 4XP4L 2VERN 3GMNB 2CDFA 2EDRA 4WHYH 5JORB 3DVNB 4YHOH 5JPNA 5HI4D 5JW5A 4PRIA 1CF8L 4PRPD 1S7SA 5FO9B 2DQFB 2ZOLA 3ALXA 3CFDA 5FKPA 5F6IB 4LRIA 1MI5B 2X4OA 1N5YH 1EEYA 2O5XL 3TNNA 1S7WB 5DJ0A 1I7TB 3HZMA 4PJ7B 3IFOB 4B0MM 5JO5B 1N6QH 1EHLL 4U05A 3UTOA 4X6BA 5TPWL 3FO1A 5DJ8A 2NZIA 4KHXL 3M07A 4R4NC 5E2JA 3TFKC 1OTTC 1S9KC 1D5XB 4UOJA 3BKJH 1KLFA 1ZMYA 3L9RA 3ZKMD 3F65A 1NLDH 1N2RB 4G3YL 1IQWH 2VQUA 2HTLD 4V2CB 3P0YH 3BKMH 1N64H 1LILA 1FZMA 2AJ3A 3E8UL 1EEUA 3THMH 2J2ZA 4JY5L 3G9VA 1YYML 3VXRE 3S4SB 1A2YA 4LSRL 4BZYA 4UQ3B 3MUHL 4AQOA 5GRUH 3UAJD 4WFEE 4HPOH 1A02N 3WFDH 3FN9A 4Y0GA 1KCLA 3DX6A 1GZPB 4P48A 5TQ0H 5DWUH 2ED8A 1HQ4A 1Q9KA 5F7DB 4PJEB 1CLOL 1NBVL 2K7PA 2VISB 5B4MC 3OKYA 4XNXL 4MJ2A 2H32H 1RULH 1UJ3A 2WV3A 3DRTB 4OCLC 3U1SH 3UC0L 5KSBB 4KY1L 5JO5A 4M7JL 4P4KD 4W6YB 3T0AA 1SBBA 2UWEB 2OZ4A 4YX2L 2V5MA 4H25B 2XA3A 5FKPB 3R0NA 1YECH 3UBXG 1C1EH 2HKFL 1HSAA 1VFAA 4HHAA 1H15A 1YC8A 1RULL 3U1SL 4Y5XB 2FO4A 3EYQC 5KVEH 4LCUA 2N7AA 3HZYA 3VFNA 3HLAA 3MXWH 3C6LD 3TM6A 2X05A 3RGVB 2NY1C 1UH3A 4XPBH 2VL5A 3ARGA 4H1LB 2MCPH 4YC2C 3O4LA 2F8OA 3WHXB 1A3QA 1SVCP 4HXAH 1E6JL 1XIWD 2LFGA 1BLNA 5BS0D 1NAKH 1FIGL 4AIZA 1R5VB 2F74A 1KPUA 3IKCA 5JXAH 4HPYH 1I1FA 4UQ3A 4LLVA 1T2QH 2OJZL 4JFFA 5I73B 3TF7C 4C54A 3CDYA 3QNZA 4GLRH 4G43B 4K23L 5F6IC 3O2VH 3U2SA 3ARYA 4NZTL 4OKVA 4IRSB 2ZUUA 5E8OB 2A6IB 2X1PA 1K8IB 5DHXB 5E5MA 2YPLE 4G7VH 1WBYB 4XBPA 4ZTPL 5H37H 5FYLL 5CZXD 5KANG 3WEXA 4M6OL 2NR6D 4WWKD 5B38A 4XNYL 3CFEB 3NCMA 4G6KH 4OT1H 4QRUA 3SN6N 1D6VH 1QR4A 1J8HA 4X6BB 3U7AA 4D3CH 1FHGA 4G42A 1ZV5A 2O26U 4DQOH 3IDNA 3W9EB 4LDEB 5GS1A 3A6OA 4QRPD 4FZEH 1TJHH 5EOQL 2YMXL 5C3TA 1ZLWK 5JZ7C 4YDLC 1BFSA 2XY2A 2XWBA 5C08A 1IL1A 4YH6A 3V4VH 3ZL4L 3I9GL 4MAUH 3NBNA 4MJ6A 5CAYB 4BFBD 5JORA 4ODWA 3ZE0F 4KRPD 1UXSA 5T1LA 5GJSH 3U0PB 2A73B 4R7DA 1RMFL 1L0QA 5J7CC 3DXAE 1FNSL 3BUYA 5F7KC 2P5EB 2P49B 1MWAH 5F1SA 5HI4C 4UTBL 3MJ9L 1FO0H 3NACH 4OD3L 2Q8BH 2IBZY 3E8UH 4BFEA 1NDGA 2J88H 1SM3H 1PJ9A 3BRGC 3MODH 3PABA 3WIIL 4F9LC 5D7SL 3SKOA 1ITBB 5TF1H 1BHGA 1W2KT 4NKQB 4Y2DD 2FD6H 5IM7B 1IEBA 1BZ7A 4DN3H 4LCYB 3JTSB 5DRNA 3SCMD 5SWSB 2HN7B 1JPGB 1YPZE 5E95B 3RUGB 5GRVL 5KVGL 4ODVH 3RX5A 1AGEB 1NCBL 1KG0B 5I74B 4BSWA 4HW6A 2B1HH 3SE8H 3AC0A 4YUEH 1FP5A 1JI2A 3RIFF 3F7YB 3FQUB 1QBML 3LB6C 3UROR 5IT2L 1MFBL 2P5WB 4K3JH 1FAIL 3ARDA 1VFOA 2NY1B 3W2DH 3GM0A 1EXUA 1ROWA 4AG4H 5ERWA 5KVGH 4YC2B 1EVUA 5DD5H 4GUPB 1R3KA 3BPNC 5ISZA 4OGXH 2ZWLT 2DKUA 3LH2L 3ROLA 1OGAE 1T7VA 1A7OL 1KIPA 2UYLB 1J05B 2AS5M 2PETA 2IH1A 2VXSH 1JUFB 3IFPB 4N0YL 1OAZH 4Z7NE 3VJ6A 4S1DC 3FB6A 5B4MD 4JFHD 3MRGB 3EYQD 1RY7B 4H5SA 3MO1B 5F9OH 5ALBL 5CBAA 4NP4L 4BSJA 1RHFA 1QQDA 2NY6D 2V2WB 1FYHB 5J13B 3A6BH 2P8PA 3R8BB 1A4KB 5F1KC 3GO1H 2W9DH 1FZOA 5IFJA 4LASH 2VOTA 4KUZH 5JHLH 3LD8C 3SQOH 5CMAA 3OBAA 3SDYL 2FX7H 2BHYA 2KDGA 4XPHL 4PJBF 1TMCB 3ESUF 1I7UB 4WI4A 2R2HA 4X98B 2BOCA 4X9IA 2P5EE 4PJIE 4XCYB 2HKHH 3BIAX 3FZUC 3GI9L 5MEQB 1WIOA 1JF1B 5H94A 5BVJB 1QSED 3TPUB 5TPWH 3WNKA 1DEEB 4JFFD 3OKMA 4N0UE 3TVMB 1S8DB 2HFFB 2ZUSA 5GRJL 5C2UB 5T1MA 4X0KB 4DEPB 5BO1H 1XCQB 3HPJA 5JIIA 3BKCL 5KOMC 1CS6A 2X4PB 3G5VA 5F7WC 4CBPA 4GAYA 4J3VA 5HGGS 4GXUN 2PUQT 5CS7A 2IPTH 1YNTB 3HZVA 2RFXB 5ALCL 2YUZA 1T1YB 5DMJB 1Q9LB 2ARJB 5EN2B 3DV6B 3IDXH 2R2HB 4X98A 5TDNA 2XZCL 2NXZB 1X5XA 4N0UA 4NGHL 5TE4H 3QNXA 5E9DD 4OM1L 5T3ZL 1XF1A 3EIFA 4QRPB 5JDSB 3N9GH 3NABL 2LTQC 3PE9A 3O2DL 2X4RB 4FS0A 4Z95L 2ICEA 4RAHA 4LHUD 3S3PA 4FA8A 1CXIA 1FZOB 1AP2A 1IC4L 4GG8B 4Z78B 4LAQH 1E27A 1N0XH 3BWUC 3H9SD 4HIHB 4LCWD 2AJUL 1GYAA 3BKML 1NLDL 5KZCD 3NZHL 3NCJL 2YEZA 1PDKA 5GGQH 3QUXD 1FL5A 5FYKU 5ID1A 5KG9A 3LN4B 1ZA3B 1FVCB 3MOQA 1KJMA 5E8NA 2Z4QA 4M8QB 4ZUSB 4OM0H 2A9MH 3OKDB 1RV6X 4FQXA 4OZFB 4M93C 3PGCB 3C5SB 4XP6H 3ZDYF 4YR6A 4KDWA 3EJZD 1G9NH 2N1KA 2JJVA 3E0GA 1PAMA 1RD6A 4M5YH 1BAFH 3D3VB 1I1CA 1L7IH 1T66C 3UTTD 5J11C 4F37F 3LB6D 5DD1L 2GITB 3T0EE 3RGHA 3L3GA 3UP1A 4J1UB 3W11C 5D1XB 2CDEB 3CFJA 4M62L 2HN7A 4LVNB 4WWKC 4ZDHB 1CICB 1QSFA 1HWHB 2XPGB 4I18C 1F8TH 3Q2CA 4A6YB 3ARVA 2NY5H 4U7KA 5ACZA 3SKOB 1LO2L 4MS8C 4NUGH 3DX9B 3RIAF 2YN3A 3AAZA 3C6LC 3LRSA 5C07B 3RVWC 2G9HB 2Z31D 1F6FB 3C08L 3QIBC 4U3CA 5F9JA 1RZ8A 4N0CC 1CXKA 3QUXB 3H8NA 3BQUA 1ZT7A 4X5XA 2NTFB 2PXYB 2ZSVA 4XHQA 1EZVX 4L3EE 1I8KB 4XAWL 3HTLX 4MA8H 1B4JL 5DRXB 2QSQA 3U6RB 5KAQF 1KBGH 3X14A 3MNWB 4ONHB 1IGML 3RAJL 1FORL 1FIEA 1M7XA 5IVNA 3K74B 1FG2A 4ZS6D 4NKOB 1JFQH 3DIFB 2DJ4A 4PTUB 2C1OB 3NA9H 5F7NC 2P8LA 4IMKA 5GGSA 4DGYL 4EI5D 4S0TD 5I1GL 2IWGA 4K07A 3ZYOA 3BEWB 5E00B 1JCKA 1FFPB 4LGSB 4F2MA 1UENA 5GJTH 4UQ2B 4HIEA 2RQ8A 2BFVL 3LS4H 1MSPA 3GKZA 4LPYA 2DIBA 2NTSP 4S1RL 3OKLB 3FN0L 5I8KL 4JE4B 2VQTA 2C1PB 2B4CL 3HN3A 1J8HE 1ZE3C 3G5ZB 5E00A 3WIFB 5E8OA 3P4NB 2EEBA 4LBEB 3ZKSD 1QBAA 3RTQB 4ZXBC 4R26L 2EDOA 1EZVY 2YRZA 4M43L 3MR9B 3SE4C 5ID0B 1U93A 5C0NC 1IKFL 5EBLB 3T1WA 5DRXA 3BX7C 1FH5L 1P84J 1YY8A 2P7TB 5HYJB 1BEYL 3ROOA 2CIKA 4K8RC 3WUZA 3BP7B 4D0BA 3NCJH 4PLKC 4APQC 1NGWB 3AGVA 1KOAA 3LQZB 1JHLL 4HUXB 3LIZH 5CKGA 3P4MB 4RMUA 5DFVC 2L7UA 3H7LA 1W0WA 2IBGA 3WXVH 2P46B 1P4BL 2AQ3A 3SPVA 5J1SC 2E7HA 1I9EA 2OXGA 2VR4A 5IFAH 1ORQB 5HGAA 3LRHA 3W0WB 4ZOEA 4GXUM 4PJIF 4OLXL 4Q6YA 2C3VB 4LCUB 3STLA 3ZKMC 4DK3A 2F53E 4JKMA 5TH2A 1QSFB 3HPLB 3LH2H 5JIKA 2K1MA 3O8XC 1CFNA 3QCTL 3WNPA 5IHBA 5BXFB 1JN6B 3I02B 3V5HA 1WFOA 3L3GB 2XKSA 5TFSL 2C7UA 2P45B 4M62H 1SEBB 4XAKE 3S7GA 4ZMAT 1NDMB 1KLUB 3WXWH 3ARRA 1KIRA 3SE8L 2R0ZL 2V6HA 1T5XA 1BQSA 3S96A 4K8RD 5C8JB 4X7SH 2Z31B 4TUJA 3F12B 4KQ4H 2YSSA 3VRIA 3CXDL 1JPST 1QZ1A 5HVHB 1P5UA 3G6JE 4UT9H 3OKDA 1N0LA 4G5ZL 5GS0C 1OB1A 4U1HA 2CLVB 1LO0L 2DM2A 3V79C 3ECBA 3W39B 1CICD 3ZKNC 1QBLH 4XPAL 4CJ1A 5DGQA 3P40A 2BNQB 4Q6IC 4YXKH 4QXUL 1ERNA 4OZGE 5JW4Q 3DO7B 5T1DL 1FZMB 4O4YL 3QQ3B 1UKTA 3LVEA 1W72B 3D25B 5GZNC 4PJFF 3N50A 1I1AC 4OZIE 5DQ9B 5F3BB 3BDBA 1NBYA 1A1MA 1D6EA 3WFHA 4HWZA 1BREA 1XF4B 2HWZL 2VLKA 1SY6H 4YXKL 4FQLL 3BT2L 4HS8H 2A38A 1NMAH 1KPRB 4XC3H 4P5TA 1A6AB 3SGDI 5GRZA 3TNNB 4M6NL 5E03A 1RZGA 2PTVA 4RA0C 5FHBL 1X4YA 2BSTA 4FP8L 4HFUH 4XNYH 5FK9A 1OAYH 1D5MB 2VJXA 1Q94A 4CGTA 4HKXB 1MRCL 2VDKH 4YHZL 4QT5B 4PJHE 3S97C 1RUML 3V0VA 4NQXA 4FP8H 4PRID 3RWDA 4GMTL 3FHAA 3EYVA 1JF1A 3K4DA 1NEZA 2PW1B 1IT9L 4B5EA 1GAFH 1JHTB 3O41B 2MPAL 3BDXA 5HDQH 3NFPA 4LKCB 4PUBH 3PL6A 1QFPA 4X4YB 3CSBA 3CGTA 3I6LD 5D7SH 5D7LA 5FDYA 1T89A 5IOPA 2Y9RT 4P23A 2UV3A 4ODSH 1RZJH 2F5AH 1A7QH 1DQDL 3MRFB 1A4KA 3V95A 4CL7A 2HP4A 4X6DF 4I18A 3IFLH 3FQXB 3P0YL 1DBML 4JO3L 2FH6A 4ELMB 4QCIA 5ANMA 2H26B 3I6LE 4JHBA 4FQCL 4L4VD 1HSBA 2ESVE 4PV9A 3H3KA 3B2UD 2CUHA 4JFEB 1I9JH 1G0DA 1H5BC 3OG6B 5F6HJ 3C6LA 4Z7UA 4ZO7A 1J05A 3NN8B 1DQTA 1YEGH 2O5ZH 1QEWA 3G04B 4KKBD 4PJ9C 1JWUB 1Q9OB 5CJXC 4AG4L 3S35H 4JRXB 1NGYA 3SCMB 1FRGH 1CXHA 3H9ZA 3SO3C 4LLDA 3IJYB 1J9CT 3GSNB 1VENA 4I77H 4P57B 4C4KT 1DQJB 3OJVC 5DRZB 2VZOA 3I6GB 1UH4A 4BH8A 4YDIL 3N1GC 3U4BL 4WI2A 2AK4E 2EDYA 3KPOB 4JQVA 2ZCLL 4FMKA 1QEWB 3C87A 3DVIA 4ZPTB 4ZFZB 4RISH 5E24E 1T1WA 2QBWA 4F58L 1A6TA 1SVZA 3RWEB 5IM7A 3NA4A 1DANU 1I8IB 5C07E 5ANMB 2QV2A 1NAMA 3VFRA 1W72H 2A6KB 4PY7B 3KDMB 4QWWC 1JRHH 3BWAB 5CSBA 4NO3B 5FHAL 4WFGD 3L3DB 1SHMA 4NFBA 4U0RB 5C07D 3MLTA 4BH7B 2X1XR 4OZFH 5A2KH 3VWJA 4LKCA 4XNUL 5I30H 3T0EB 3OAZH 5ALBH 4HUWA 2X4QA 4Y4FD 3T1FB 1VKXB 3V52L 5F88A 3IGAB 4QHMA 4QRRD 3QUMH 4N0RA 4RAVB 2NY0C 4P3DA 3RWDB 1F2XK 3PQYE 3EO0A 2PTTB 3KPSB 2Q6WB 3V6FA 1QFWI 3CSPA 4QY8A 5FF6B 1N6QL 1EHLH 2ZSWB 5C1MB 4R26H 4JFYA 3FO0H 5TDOA 5C6WH 1QNZL 3U30B 3BH8B 3MLRL 3K2UH 3HAEG 2E3VA 7FABL 3MC0A 4O00A 5IG7B 3VGFA 4NT6A 4RIRB 2DJSA 3TZVB 2RIKA 4NWUH 1X4XA 4FQJH 1MIMH 4M6OH 2ZG1A 3VMNA 3K81A 4RA3A 4EEEA 3ZZ1A 4Y19E 1CG9A 1HHJB 2V5SA 3FO2B 1HYSC 4WVRA 5HHQB 1EGJA 2I9TA 3QIUA 5EOQH 4R97B 5D9SB 1A1MB 1D6EB 3TC9A 1NJ9A 4DQOL 5KZCB 3PJSA 3W9DB 2L0DA 1I85C 3CU7A 1G7JA 3F6LA 4HJJL 4JZJC 5C0RH 2EYRB 4P9HC 4U1KA 3GSWB 5IGXH 2AVGA 4LSDA 2ZKHH 3M8OL 3SKNB 1SMAA 1QSVA 4HWBL 4I0PB 3T2NH 3QXTA 5B3NA 4LHUB 1KEMH 4F3FB 4NM8H 1LHZA 1KPVB 1XZ0A 2XICA 1HILA 5BJTB 5CIPA 1P7QB 1PKQA 2VDPL 4Z0XB 1FC2D 1E4XL 4Q6IB 3SO5A 5I1LB 2VLLA 4RZCA 3RGVA 4OGXL 2HG5B 1MCHA 1WWWX 1YMHA 4U1LA 4IRSD 4BUGA 3H9SA 4YEEA 3WFZA 4RGNE 1DSFL 4WEUD 5IQ7L 1H8SA 3JTTB 5D6DA 2EH7H 2FO4B 1J86A 1NCUA 1V7NH 4XMLL 1CD0A 5HI5D 2VXTH 1F00I 3VG9B 1WVZA 3PV6B 5D2LE 5IKCA 2IPUK 2AJYH 2X6MA 4HC1L 4I0PD 3INUL 3V7AG 4BJLA 3BP5B 1AHWA 3TV3L 4M61B 1QRND 3IKKA 1OTTD 4X7TB 5TGBB 4J4PC 3MV8E 2H8PB 1UWXK 1HH9A 4IJ3C 4U33A 1U3ZA 2VDMH 4JCLA 3REWA 4UV4H 3AS3A 3NFSH 1MAML 1JPFA 3BKYH 3FMGH 1WT5C 4TUKH 1SYSB 4I5BB 4K7FB 4OBRA 4PY8I 4QOKB 5CBEB 3SPVB 4R4FL 1VGKB 4S1QL 4XAWH 4LLUA 2B0SH 4D9QD 2IQAB 3DVFA 1JGVH 4HXAL 5MENB 2W0FB 4ZOCA 4BA8A 3MFGB 5J12B 5D72L 3BP7A 2QQLH 1I8MB 1ZVSB 1A7RH 4ZTPH 2R9HD 4DOHE 1WLHA 4OUUB 2YZ8A 5EOCH 3MR9A 3ULVC 3V9FA 1IVLA 1CTOA 3SDCB 2FJGB 4PJDA 1KN4L 1CYGA 3CFBA 4WUUD 3ZDZF 4QF1A 5B21A 1P4LA 4XPHH 4JQVC 5IVXA 3DX7A 3GEWB 4XHJD 1HH6B 1BX2A 1MUJB 2DLFH 3PDOB 3O3AB 1KJ3H 1NMBL 1Q0XL 4P3CL 2FJGA 4W6WB 3VXTA 3GJFK 4YHOL 3CFDB 1FDLL 1RHHB 3D85A 1HN1A 4O9HL 1QBBA 3ORJA 4EN3D 1PLGH 2APFA 1X5AA 4MB4A 2C1OA 4OF0A 1CDIA 4MLSA 3B6SB 3CH8A 4QKXB 2CDFB 1KNOA 4R6UA 1I9RL 3X3GL 1BQHB 3D85D 3MROA 3O2DA 2WK2A 4AK1A 4O2FA 3GJEA 1OQOA 4JGUA 1MCRA 2KH2B 4G6FD 3KPNA 4TNVK 2VXVL 5EU5B 3EO9L 4XBGA 3D2UA 4LLWB 4GG6E 5DURD 1C7SA 3CSYB 4IRJB 4NKDA 4G3YH 2YD2A 4ELME 4U1IA 2Q76B 1YMMD 5F9JB 2XG4A 3QB7C 4X7TA 1S7RA 5D5MF 1FNHA 3VXUB 2A0LC 3BP5A 4ZO6A 3VXSA 1U91A 4UT6L 3K1DA 2VLME 3M17B 1AI1L 5ANME 3ZYZA 1ND0A 2WINA 4K7PH 5I8EA 4ZUWB 4YHIB 4RQQB 5EOTB 1MRDH 5HPMA 2AEPL 3FQWB 4PJGB 2C4FT 2DQGH 3IDIA 1NGXB 3GM8A 3WO3B 5SWZA 3TFKD 2W0PA 5BW7C 3VXMD 2BNRB 3UZQA 5L7XL 1X5JA 1AFVL 5C0AE 3S9DB 4JFXB 3WNNA 5DD5L 3ZSSA 4G80B 3T65B 1P7QA 1PKQB 1U8KB 5C0DB 5HI5C 4YR6B 4MHHG 5HDBE 5KS9A 4G8FB 3TNMA 3SDAD 4NQSA 4G6AD 4DTGL 5C09D 4OZFA 3MRNA 3VGAC 4LEXL 4MJ5B 1XAUA 5F93C 1KJMB 5E8NB 3NIGF 4DVRH 2EYRA 1MCNA 4HUNB 4MAYD 1U2HA 4OFDA 2D4DA 1CFSB 3O2WL 4ZTOL 1NJ9B 1AD0B 1YEKL 2DRUA 5SX5K 3EYFA 3PGDA 3TBWB 4YAQB 2YUXA 4DGIL 2Y07L 3LKQB 5KOVC 1MPAH 5FYJU 3JWDH 4KUZL 3O2WH 1P7KB 5DF0A 5DVNA 4POZC 3X17A 4AEIH 1HOCB 4ZSOB 1M7IB 2RR3A 5D70L 3FAXA 1DBKL 1C5DB 1SJHA 4M1CC 3LAFA 2I07B 1KTLA 3FONA 3QWRD 1YEHL 2EE6A 1MNUL 3IS0X 3BOVA 2WNGA 1I3GL 3C60B 4WFHD 3SJVB 2VITB 1LQSR 1L6ZA 1J11A 4NBYB 4ENED 5KTEL 2APWA 2I5YH 4HCRH 2LTQB 4M9OA 3G5VB 4NQVB 3KPRA 2PXYD 3QPXH 5K9JH 2Z91B 4I2XA 4MJIE 3ARBC 2WWMD 1TTFA 5FYLH 1J0HA 1DUZA 4P4KC 2KKQA 3MLRH 3OKMB 4H8WH 4S1DD 5IHLB 3HI6H 4Y4KB 4JFOA 4WI6A 1S5HB 2F54A 3CAFA 3U9PH 5D2NB 2EKSB 1GOHA 2ZP0T 4JQXC 1MCKA 3TBWA 1INEH 4K8RL 1U8OA 1N6VA 3MV9A 2CLZB 4MNQD 3QP3A 4NRYB 1MHPL 1NGPL 3EYSL 4P59H 4PD4K 3WUWA 3G5XB 3DGCR 1LK2B 3PWUA 2F8VA 4WTWA 2GFBA 2PCPB 5HHVL 1EAJA 3MZTA 4ZODA 4ZFZA 5GJSL 3SGEI 3B5HA 4NJAH 4L8CA 2UVEA 4OD3H 1MHPH 3MRGA 5FKAA 1J18A 1UG9A 2WUBL 1VGEH 4OSUH 4M7LT 2JCCE 4BH8B 2W60A 4XCNB 1TITA 5AD0B 3IJYA 3HUJA 5JLZB 1ES0A 4QHKI 5CCKH 4FFZL 4KI5F 1JV5A 4DAGH 2J8OA 3RX7A 5E08L 1CT8A 2YUWA 5KJRH 3U36A 1JWUA 2BVPB 1PEZA 1TZIA 4KU1A 5FYJD 3T8XB 3C6LB 4DOHB 2UY7A 4PY8J 5JMRA 1Q72H 3FQUA 4IRJC 3BRDA 1NCBH 2CR6A 4YHNA 1G6VK 1H3PH 3RDTA 4BSWB 1UH2A 2WINB 1NQBA 1VEOA 2H26A 4N5ED 5JW4M 5FGRA 1U91B 4I18B 1IGIH 1S9VB 1EJ6A 3MCLH 4OLZH 4LCYA 4ZTOH 3T77B 2RBLA 4KH2A 3HRZB 2Q76A 4WFED 5I15L 3MJ9A 2EDBA 2EEDA 3G5YA 4QOKE 5L6YL 3QQ4A 4NKDB 12E8L 3PL6B 4Q9QL 4HKZA 2X41A 3LV3A 3P9LB 5C0BB 2GYSA 1Q1JL 5FDWA 3DPBA 4HG4K 3MLZL 4NCC2 1OAXL 2OMNA 4CMMB 4KMTH 4WENB 1INQA 1JGEB 1J88A 1TZHA 1QG3A 2FJFB 4HF5H 1EFXB 1UM4L 5TE6H 3UBXI 3RNQA 1JWMA 4M7ZB 4FQ2H 1VA9A 4EI5B 4YPGB 5ETUB 2D0FA 5L2KA 1U8NB 1U36A 4HQQL 3WE6A 2CIIA 3GMPA 1E6JH 1BOGB 2ZCHL 3N85L 1MVUB 1FNGA 5FYJL 1XGTA 1INDH 3QIUD 4N8VG 1QR1B 2KL6A 1BD2E 2BSTB 1AGDB 2H3NA 5BRZA 3U9UA 3HE7B 1SMOA 1O7VA 1CD1A 4JAMB 5BMFH 4EOWL 4PREA 4TNVF 3K1KC 4O58L 1K6QH 3WO4C 4NQCB 1NC4B 3CDGB 3ULVF 2EIBA 3EO9H 4MVBD 1PEWA 3QO1B 1RZJL 4M6NH 4NOFA 2H2SC 1A8JH 4UIKL 3P4LA 2IANB 2DLFL 1IM9B 5HPOA 1K6QL 1KCSH 5FOBA 4HIIB 5DDHA 5KS9F 2BRQA 4RMVA 1BF8A 3S34L 4JM2F 4N5UA 4G43A 4LVOB 4XCEB 2WMPA 3OGCB 1CXFA 3T3PF 3HG1A 3MLSH 2HFEA 5BW7A 3GHBH 3W39A 4GMTH 5F3HB 1ZANH 2VLJB 4NFCA 5H2BA 2XQYG 3KPRE 2P24A 3O9WC 2I60H 4I5BA 3VXNA 2YSSB 3VRIB 4QRRB 4C55A 1G1CA 2DQTL 4Z8FL 4PJ5E 3AXLB 3T0VA 1P53A 5IEHB 4NKIH 4RBPH 5D7LD 1B4RA 1IGYB 1JK8A 3IFLL 4LLAA 4JG1L 2FECL 1WFNA 1VGEL 2JJSC 3SE9H 5J6GB 4Y16A 5F7UA 5HHOA 4Z7QF 1Z5LB 5BXFA 4JZJB 3S36H 1WTLA 1VFAB 4D9LH 3MV8D 2HTKC 4P2YA 2XQBH 1T5WA 4H25A 1A0QH 4G7YL 5CZXC 5BS0A 4U1LB 1R3IL 4RRPG 2FR4B 5DT1H 4CUCA 2RAMA 3MMEB 4LFHD 1UJ3B 3ULUC 5DD6A 5CIPB 1GPOL 4MNGB 2Y5TA 1D5BA 5DMGD 1NANH 1NGWA 5IBUB 3QQ9D 1Q9KB 3MOAH 2CIKB 4I0PA 3DXAA 3MCLL 3LY6A 2LE9A 1UT9A 3ARBA 2GCYA 5L8KB 5EBLA 1XR9B 1AKJD 2F19L 4XGZA 1J1XH 2P48B 3GMLA 5E6IB 3PJSB 3W9DA 4L1HA 3HE7C 2Q8AL 1WTGT 4HUUA 4ODTH 3AS1A 5HHQA 1VFUA 4U1JA 1SJEB 2OBGA 1YJDC 5CJ5A 4U6YA 2JJTA 2OCFD 3IDGA 4R3SA 1YQ2A 1T03H 1FNEB 3SDAB 5F7EH 3ZT6A 1I8LC 4FQHA 3QEQD 1HWGB 3H3PL 4JGMA 5K9QG 1RZKH 1LDSA 4NT6B 5EZOH 2VUYA 2IBBA 1IKNA 4TSAH 5J13C 4Y5VA 5LBSH 5CFHA 5E8PB 2HRPH 3CVHB 4L29A 3PP3K 4FTVA 5ESQA 1IRAY 2ZSWA 1T89C 4NO5A 3C6SB 3BPOB 5CJQH 5BRZB 2ZOLB 2X40A 1QR1A 1HINL 4ENEC 3LS4L 4ONHA 1RIUH 1JHLH 3WE6B 4OLYH 1ORSA 2C3XA 2BFVH 1XGYH 5D71H 2DIAA 3T1FA 1VKXA 4UT7H 5ETUA 3FO0L 3GMNA 3LEYL 5GGRA 1SYVB 4YK4C 2P44B 4P2RE 2GJ6D 4PYHA 2I5YL 4WHTB 1HINH 3DGGB 3BQUD 3DUSA 4Z0BL 2FJFA 2AV1A 5LGHH 4BH7A 3QUXA 4LLQB 1JGEA 4X5WB 1MREL 4ZNEE 2G9HA 2FYYA 4H8WL 4NIKB 1UZ6F 4NO2A 1AXTL 1QPPA 2WBWB 4GLRI 1FL3A 2N4IA 2YD6A 2DL9A 2W9LA 1A6VL 1T7WA 1R5WB 3RWEA 1BEYH 3PL6C 3M8OH 4BZ1L 3O6FA 5EZLA 4Z7OF 4ZPTA 4KHTL 1KCRH 3MNZB 3DROA 3QIBD 2V7NA 1BBDL 3VXOB 4X6CE 3ZTNL 2DYPA 3KPPA 4WO4C 3S36L 1HQRA 5BV7C 3RDTB 1LD9A 1RURH 3PIQB 3RX8A 3I6GA 3B43A 3C8DA 1N6UA 4MAYA 1V3MA 2AXFA 1GIGL 4MDJA 1BVLA 4N90D 5FOJA 3MACH 4YBQD 1DBBL 4JRXA 5K9QI 1AO7B 3HUJB 4JY6B 3VXSD 5JLZA 4DTGH 5C09E 3CFKA 1EUUA 4M8QA 1CGYA 1GL4B 2R2BB 4W68A 1OP3H 5EIIA 2W60B 1F58L 5ID1B 5KG9B 4YX2H 4U3HA 3VFGL 4X9HA 1LD9B 4PV9B 1QO3B 3KPPB 4QHUB 5AWNH 4PLNC 3GB7A 43C9B 1G9MH 3VXOA 4MA3B 4M6AA 2BCKB 3FQXA 5IR1A 5MEOA 4HIHA 2EXYD 3UZEA 5LJYH 2R0LL 3VXQB 2W92A 1WISA 3EHBD 3WJJA 1CDJA 4XX1G 4MNHA 4NWTH 2ZUTA 3LKRB 3PXJA 4ORGA 5CGYD 4L4TE 4LSSH 4AT6B 4P2CG 3B9AA 5MI0B 3IU4L 3K7UA 2PYEA 4QXUH 1DN0A 4LLQA 1L4IA 2NNAB 2ATKB 1NMBH 5DI8A 4QHLA 5C86A 3BW9B 3L5IA 3RHWK 1JRHL 4XNQA 4X9GA 1UWEL 3E6HA 1EBAA 5GSRB 4GAGH 4LIQE 1BP3B 1YEKH 4MDIA 4X4ZA 4LSUL 2AK1H 2R15A 1LVEA 1MHEB 5C0IA 3KPRB 4OCXH 1XCQA 3VFSA 3L5WB 5E9DA 4N68A 2NY3B 2AV7B 3LRGA 1AGCB 4PBWD 5HVFB 1ZHBB 4ODXB 2RJMA 3MBED 3MQIA 4WJ5B 2ADJA 4YE4L 3KJ4B 4XBEH 4Y2OA 1AC0A 4QGTA 2FNBA 4Q9CA 2VL4A 5EO0A 1VB9A 3RWGA 1U3YA 2BVTA 2EIEA 5I8OH 1FDLH 3NA9L 4RDQF 5EBGA 3QZWA 4I4WA 4FQHB 1T20B 1OW0A 3EOTH 4J3OC 2PF6A 1KENL 2D0GA 4KVCH 5DJAB 4ZSOE 2F15A 2VNCA 2V2WA 2XY1A 1RUMH 4YEFA 3QEGH 4GW1B 5F6HI 5CBAB 4F8TA 1AD0A 4NGHH 1C5CH 1DL7L 5KSVA 4O2CA 4YGVB 2MHAB 4PJEE 1KTDA 1JWSA 4NJ9H 1OY3B 4BFIB 1C08B 5DR5H 1U8JA 5LCVH 5C08E 2QR0B 2CLVA 2HH0L 2L7JA 2VXVH 3TPKA 1MWAB 1KN2L 3VFUB 2DTML 2FJHB 2NW3B 4PJDE 2D9CA 4R8WH 4M3JA 5FUOL 3QJHA 3QHZH 1EHAA 2UY6A 5I74C 4AY0A 5EUOB 3MMEA 4KK8D 1U58A 2CO6B 4XCFL 2D7NA 1OARH 4TULL 4DKDC 1RZIA 1MHCB 1CGSL 4LCIH 4OFKA 1JZ4A 5DUML 3F7YA 2CDGA 1NDMA 5A2LH 4UUJB 3U46A 4P2OA 4GXVL 1KG0A 4N9GA 3OF6D 3Q3GA 1G7QA 2X70B 4ZFOA 3V5HB 3I02A 4XNMB 3IAPA 2GUOB 4AH2A 5H35A 4PJ7F 4Y5YB 5JA9A 3U4AA 3D39A 3UJJH 4X8XA 1QBLL 1TNMA 5JDJA 1I4FB 1RUQL 3M17A 4I77L 1QBMH 2Y07H 3VXSB 5B39A 3GSQA 1IC1A 1S7RB 2DLHA 5A2FA 1ONQB 1D7FA 1KIQB 4U1IB 4PRPA 1OSPH 4MB3A 5TDPB 5E70A 4OQTH 4Y5VC 4ZQKA 5DJ2B 2NY6B 4JPWH 5ADPL 2BY0A 3EOAA 5FYKL 3ILPB 1KGCD 2HWZH 1LE5A 5LAXB 3WFEL 4LEXH 4UT9L 4R9HA 3OKNB 4K3GA 3O0RL 5DA4A 3ZHLA 4YNYA 1DQLH 3RPIA 1HE7A 1MCWM 3TBTA 2ID5A 2X44D 4FQIL 3HUJF 25C8L 5DD0H 3QPXL 5K9JL 5GRXG 3FZUD 4C4KO 2HT4D 3I2CH 3P4NA 3C5ZA 4AEEA 1QLEL 3LHPL 3UTQA 3LEXB 2IANA 1ZVHA 3OQ3B 4GH7B 3FQNB 3QO1A 4HH9B 3CFEA 5DJYB 2OTWA 4X7FC 4AIXA 4MXQC 1Z9LA 5FXCH 5JHLL 2VXQL 2XWJA 4X6DA 1URLA 5CD3A 4LSUH 1U8PA 2WWMC 1HH6A 3DRQB 4C58B 4L8BB 5E5MB 1K8IA 1P4LB 5FV2A 4PTUA 4MQ7A 3BXNB 2G75B 2E9JA 4X80H 2OSLA 3ZE0E 4G6KL 2ZKHL 5F9WB 3VD5A 5INDB 2NZ9D 5BV7L 4F7PA 4C56A 3HNSH 3UO1H 4J6RH 4KKNA 2GSGA 5IHZB 1X5YA 3ULVE 2F74B 1ZVSA 3RHWF 5E2TH 5LAXA 1RJLA 3D1MC 1N59B 1EFXA 1ADQL 1IAIL 4LL9A 2WUBH 5C70A 5MENA 4HZLA 3T2OA 4AMKH 5TDPA 3BP4B 2VO5A 4M43H 3VG9C 1A7NL 3GMMA 5ECJE 5ICYA 4BQ6A 2UUDK 3KPSD 3O81A 2EH8L 35C8L 2FHBA 3D3VD 4X7DC 3T77A 2BXYA 1FPTH 4ETYA 5I2IA 4OAWB 4HWBH 4Y4KD 1G9NC 3SKJL 5H35B 3T2NL 1DN2A 5CSGA 5FCUH 3KR3L 2G2RB 4GKSA 2VN7A 5HTSA 2RCSH 3D3VA 1FPTL 1Z6JT 1AY1L 3MJ8A 5FA4B 4WDIB 1FFOB 1B90A 1BBDH 1AI1H 3LEVL 2OZ4L 4PJ5D 3W2DL 2BVEA 3CLFL 5EC1A 2IG2L 3C5SA 1YMHB 3BMVA 4FQXB 4HLJA 2W38A 1D5IL 2YR3A 3PWVB 2AJZA 5DVMA 2Z4QB 5FGBA 4Q6IA 3BZ4A 5AAMA 3CC5A 1YYLL 2IBZX 1G9NL 4XPTL 4BFIA 3GBNL 5IJVB 5FKAB 4O2CB 2DDQH 5EBMA 2EE2A 4M9PA 2KUTA 5J9PB 1LO4L 3HZKB 3OSKA 3MJGX 4CN4A 4LHUA 1BJMA 3SKNA 2P5WD 4CADB 4LQ1A 4PG9B 3NGBC 1LK2A 4LDOB 1LNUA 3TVMC 3RA7H 4BZ2L 3P2TA 3IJHA 3BH9A 3AMLA 1JHKL 2F5BH 3NPSB 4ZFOL 3P9MB 3EO1A 3ULUL 4NM4L 1FFQA 1T1XA 3LKNA 3TYFB 2OJZH 2X4OB 3C09C 1F90L 1J1PH 2EE9A 4V1DB 3FOLA 2V9TA 2D4FA 2DQFA 4TRPH 4B7IA 1YEHH 3T4YA 1TXKA 4JQXA 32C2A 3NH7H 5JW5B 1S7QA 2FGZA 1DVFB 3DVNA 3VD7A 2VIRA 2R4RL 3ARQA 1WWAX 2QJDA 5BVJA 1F90H 1J1PL 1W8OA 4P23D 4TVPD 1T4KA 3MBEC 1I7UA 5JXEA 3PQYA 4O5LL 1MCIA 4XWGL 3T0EA 1PLGL 5IGXL 2V5RA 3WSQH 4DVBA 4WUUE 1E6OH 1RJYB 5TE4L 3LKRA 3T3ME 4FQQA 1R3JA 3GMQB 3S37X 5DHVB 1AD9A 3T0ED 1I9RH 3X3GH 3KDMA 5IR1B 4B41A 4MA3A 5SWZD 5IB5A 2EC8A 5HGHA 1M4KA 3OKKB 2LABA 1E4JA 4Y4HB 1YYMH 4I3SL 1ZT1A 3GGWB 3EBAA 4IHOB 4OZGF 5D2LF 5E6ID 4D0DB 2ZJSL 4DW2L 4GFTB 1MAJA 2VLMD 3MUY1 4OLWL 1BGXH 2HJFA 1OT2A 5DWUL 3P3YA 4P23C 4NRZB 5I75B 5C0FB 4OI9A 1JPTH 3O6ML 2WP3T 2ITCB 3ILQD 2DN7A 1UEYA 1PG7X 2IAMB 5D5ME 1BGXL 3K80A 2OTPA 3SCMA 3R06A 2F54E 4NKIL 4TULH 1AGEA 2HJKA 2V7NB 1UB5B 1Y18B 1YYLH 5DRWB 3QDAA 4MX7B 4Z7UB 1LP9F 1NGXA 3S88L 2RB8A 1X4ZA 4K3EL 1MCQA 3RY5A 1EHNA 3FQWA 4PJ9A 5JOFB 5LVEA 1FAIH 3C5ZC 5DUPL 4Z6AT 4RQQA 3CLFH 1JGDB 5I8EB 1JGUL 3HCVA 3DX8A 4QCIB 3PABB 3C2AL 1CGWA 1YDPA 1CDBA 1U8MB 2JE8A 3QEQA 4RFNB 4TN9A 4ZXBD 5HYFA 1E4WH 1T1ZB 2YS4A 4KKBC 4P9HH 5I15H 2J5LC 4F7MB 1JGUH 1TIUA 3DLQR 4F58H 3BUYB 2X1OA 1JNLL 2V2TA 2F8XC 5MEND 4WHTA 4NDMB 3QBTB 4KI5D 3FB8A 2PW1A 4XC1H 4RNRB 1WCQA 4JN2A 4YO0B 1N7ML 4QNPF 3GO1L 1A21A 1NFDB 1NCDH 5GS0L 1P4IL 4LMQI 4KRMB 5IROC 3L3IB 3C6SA 3KWWB 3V6BR 1GHFH 2WQ8A 1HHIB 4NN5B 3W9EA 3IDNB 3QNYB 2X9WA 5GS1B 5I1DA 2V9QA 4KKAC 3SE3A 1OPGH 3QIWB 3PWPA 4C83A 1J8HB 5EU6B 3MBEB 1YN7B 1WSST 3VXTB 4TSBL 3O9WD 5B38B 1IGFL 5EZOL 2Q7YA 4JZOB 3TBVB 1MUJA 4GKNA 1RZKL 4MYWB 2BSRA 2VXQH 4ZFFA 4ZPVA 4R3SB 4U6YB 5MHSD 5F7YC 3CFBB 4G9FA 3U2SB 1T04B 2PNDA 1NBYB 3BKCH 3IDYC 2PN5A 4LARL 1XR8B 4OCWL 3S3SA 2YPKB 2DLEA 2JB6B 3SJVD 2ENYA 4CDHA 1IBGH 1RVFL 3DO7A 2BVOB 3I84A 4PJXA 6FABL 2CH8A 2Y5TB 1KEGH 3DI3B 5DEZA 1HK6A 5IJVA 3PXHA 1JNNH 2AQ1A 4LARH 1ADQH 4I13B 3BVNB 3QWOB 3CC5B 5FIEA 3O4OB 1K2DA 1OB1B 2ADIA 3THML 5EWIH 3CH1A 4KVCL 3AROA 4QOKA 3ABZA 3NACL 3WXVL 1FL6A 3KPMB 1I85A 4FFYH 5SX5H 1BVKA 1JPFB 1F42A 2VAAA 2H6PB 5C9JB 1YC7A 4PPTA 3S96B 1MCPH 2FD6L 1FE8L 3WD5L 3OKOA 1Z5LA 3C60D 3PGFH 5J6GA 1XGRA 3OX8B 4XCFH 1Z2KA 2ICCA 3QPQC 3WLWC 3SQBA 1MCPL 2FIRT 2DQIL 4DJMA 2VDNL 1CDCA 2HAZA 3J7HA 3AXLA 2H6PA 4L8DB 4JN1L 2A1WL 1FL6B 3B9DA 3CD4A 3RJDA 3SEPA 4PJ7E 3GRWH 3AU1A 2P24B 4LU5H 2JB5L 1K4CB 2JELH 3N1FC 4M5YL 5F89B 4RAUA 2CKBH 2R56H 2X1QA 5DK0B 2DQDL 5L2KD 5FA3B 3P4MA 5E6ZA 4J4PD 3UPAA 1X5IA 3D0VA 1TNNA 5D93B 5CZVL 1N59A 1CL7H 2NX5D 3OJ2C 4JPKL 1X9QA 2AJ3B 3O11A 4KV5E 3QWRA 3QUYB 3MV7D 3MYJB 1DQQB 4FHBD 5E4EC 3MRCA 2FEEI 3LHPH 4XPGL 1D9KA 2BNRE 3L9RB 5DJXA 4F7PB 1CR9L 4RBPK 2V7HB 4FOMA 3O6KH 3OB0K 3OG4B 1DVFD 1CE1H 2I9TB 3LN9A 4LBEA 1W72L 5MP6L 4Z7UF 1V7MH 2LAGB 4EN3A 2X4TA 2V17H 4PGDB 2WWKT 4YDKH 4YXLH 5SX4H 4HWBA 4BKLA 2APTA 1U8PB 2VE6B 4NSKB 4J7RA 2QSTA 1CD1B 2A9NH 1EEYB 4JAMA 3TZVA 1IGMH 2ESVB 1CN4A 5DZOA 4IEFB 2H3NB 1AGDA 3QCVH 1Q0YL 1S7SB 5FO9A 5AYUL 3LEXA 3T0DA 3BSZH 1F4XL 5GGSB 2P8LB 1U8NA 3LPFA 2APBA 5J1AA 1B0GA 3V6OA 1KF9B 4R7NA 3EO0B 3GK8H 5ALCH 3TBTB 5I0DA 3BD5A 1D6VL 4Z7OE 2GTZA 4JLRA 3WFBL 1J0ZA 1B3JA 3P11L 4X4ME 4U0QB 5F1IA 2CK2A 4K7PY 3BN9C 1FG9C 4RGMC 5T3ZH 1DFBL 2IPKA 4NDMA 1C16B 1QHOA 3BGAA 5INCB 5E2TL 2L4OA 3QQ4B 4F7MA 1FAKT 1NUFA 4H26A 2GT9B 5E99H 4RX4D 1GVIA 3L3DA 2H2SD 5JHDE 1T1ZA 1RUAH 5DUMH 3UO1L 5T3XD 1CFTA 3B3IB 3ESVF 1E6OL 3VFMB 3MGTB 1RFDH 2MKWA 3VWJD 3WYRA 3SO3B 1DE4B 5FGCB 1UACH 2VXUL 5M95B 1SJVA 2JCCB 1AXSA 4N1CA 1AGBB 2HH0H 4JANA 5BV7B 3MACL 5JOPE 3GMOB 2OL3A 1QPXA 4PRHB 4ZFOB 5I1EH 1UB5A 4R96A 4AYFA 1G7QB 3QIBB 4RMRA 2YK1H 2IFGA 4POZD 4RGND 3D6GA 3JV0A 1T21A 3HE6A 1MLCB 3R06B 4WU5A 5C0AA 3MA7B 3MLUL 1FVDB 3AM8C 1U92B 5C6TL 3C5JB 4WHCA 4RGMB 5B39G 3PGFL 4LLDB 1I7ZA 4U1MB 1CGSH 1NGYB 2DBLH 4LCIL 3ARSA 3PGCA 1EPFA 3V4PH 1YEFL 4QRRE 4B50A 5J4MA 3OTTA 5L2JB 2GFBB 2PCPA 5TE7L 2IADB 1TCRB 1T03L 2AQ2A 2BRRH 1HSBB 1LE9B 3P9WB 1X5FA 4G9DA 2ICES 1E27B 1CGVA 5ACLA 1LO2H 4G5ZH 5JNYA 2MMXA 1MAMH 1NKRA 5FUCE 1EO8H 3ALWA 2I9LA 4DVBB 1MFEL 2H41A 4YZFF 1ZGLA 4B53A 3CSGA 3DBXA 3EYUL 3PQYB 2X1WL 4M8VA 5DD1H 1HHGA 3QAZC 4G6ML 2EXWD 3TJHD 5DGRA 4GW4A 3TESA 4M7KH 4JDVA 2RFXA 2LV4A 1EIBA 1YNTA 2CK0L 2HA1A 3PDGA 1OHQA 4G7VL 1QLRB 4LSQL 1T2JA 5AYUH 5IB1A 1QFUH 3L5WA 5E9DB 2VITA 2J7LA 4F7CB 4YQXL 4PJDF 3QDJA 5T5FL 1D5MA 1SY6L 1S7QB 5IQ9B 3RNKB 1YPZB 3H3PH 3WN5A 2HVJB 3RUGE 5JHDA 4LPTA 1KCSL 3DBXB 4U0RC 5T1MB 1I9IH 1ZGLB 5FYJH 1M7IA 1DLHB 1CK0L 1DEEA 1QFUL 4ZSOA 4F8QA 4GJTB 5DD3L 1M1SA 2OL3H 5ITBL 1QKZH 2NY7L 3QDJD 1EV2E 1JNHA 1GZQA 3S5LA 3F58L 4LHUG 4C59B 4NC1C 5JNYB 5I17B 4GRWB 4APQD 3LKQA 4O58H 4BZ1H 5FUZL 1UQSB 4J12A 5CEZH 3O6FD 4ELKB 1OD9A 2HFGH 1AKJA 1CDGA 2H1PL 2PTUA 4MSWA 4KJQC 4FQ1L 1AQDB 3KPTA 1QKZL 3ZKXB 4DKEL 4TVPH 2X09A 1RURL 2XN9E 3WO4B 2Y6SC 3U4EA 1R5IB 3X11A 43C9A 4WI7A 1CL7I 5KSAC 5EBMB 4Y4FC 2B8OT 4BELD 4OZGB 4MD4B 4X6CB 3WFCL 3CXHK 4PJCF 3RPKA 4OFPA 4JFXA 2J88L 2IF7A 3OZ9L 5T1KB 4D9LL 4Y4HD 4G9FE 3H0TA 2W07A 5T3ZD 1DLHA 3HFML 3HMWH 4GMSL 4Z76B 3WN5B 4J3UA 3QO0B 2J5LB 3IDIB 3MJ8B 1M71B 4OIIL 4PJGA 5IK3B 2ARJQ 3ZTNH 3UTSE 4JO2L 1VERA 1ND0B 3DECA 1F4WL 2VZSA 5H37G 3O6FB 5C0AD 2D31A 4X8JA 4F7TA 3FOMB 3CK0H 3ELAT 3MFFA 5GS2D 4XPFL 2B20A 2MOVA 2HJLA 1WAAA 4H26B 4EN3C 4LRNH 1FL3B 1EX0A 3DSNA 3W0WA 5J3HC 5I1AA 4WFFD 5MENE 5IWLA 4R4ND 3TJEL 2Q8AH 4KZDL 2RHEA 2IAMC 3C2SA 4YHKL 3GMRA 1IEHA 3TBSA 4UNVA 3SDCC 3V6OC 4WTXA 1DBKH 4EVNA 2R56L 4ONOA 4S10A 3CFCL 5F7FA 4RISL 1MJ8H 1TZGH 1LE9A 3I3DA 1AR1D 4Q9QH 1XEDA 3KYOA 1UA6H 1BM3H 1WWCA 1LP9E 3TT1H 2Q7NA 3DURA 4YE4H 8FABB 4DGIH 4NZDA 4MCZA 4CW1B 1F3RB 5LQBH 4Z7WF 4WI8A 1BWWA 3QUZD 3CVHA 4U1MA 5IW3A 4Y5VB 2KPNA 3GHEH 4JM4H 2OYPA 3FQRA 4QRUB 4K23H 4TOYL 2EDQA 5T3ZE 2ZCHH 1YNKL 4PJDB 3RAJH 3NOIA 1I1RA 4PRDB 3RVXD 1KTRL 3RKDD 3G6JA 4QRTA 1FFNB 2YWYA 1JBJA 5F9WC 5DK2A 1OTSD 5DLML 3AY4A 5I66A 3MYJA 1NCCH 1RK0B 2JCCA 5CHNA 3VRLF 3QNZB 5E6IA 2Z93B 3X12B 4JG0H 5C0JB 4YXHH 1N5YL 4YNYB 3RPIB 3ULUF 1BOYA