2N4IA

The solution structure of skint-1, a critical determinant of dendritic epidermal gamma-delta t cell selection
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
MSSEPFIVNGLEGPVLASLGGNLELSCQLSPPQQAQHMEIRWFRNLYTEPVHLYRDGKDMFGEIISKYVERTELLKDGIGEGKVTLRIFNVTVDDDGSYHCVFKDGDFYEEHITEVKIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Selection and upkeep of intraepithelial T-cells protein 1
publication title Characterization of a Putative Receptor Binding Surface on Skint-1, a Critical Determinant of Dendritic Epidermal T Cell Selection.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2n4iA00
1G9MC 3MOBL 1MCJA 3PGFH 4HT1L 4HXBL 5TF1H 4NO5B 5HPMA 4QTIL 1B0GB 4PUBH 3WJJA 5C86A 3VD5A 5BJTB 1CR9L 3WS6A 3QNZB 4Y5VC 1YN6B 4OZFH 2IBGA 3FQNA 2NY2B 5ECJE 4W4OA 2P8MB 3NCEB 4RMTA 3PJSB 3DVGA 1IGIH 1WLHA 4FQQA 4ZUVA 2A6DA 1R5WA 2H32A 3AVEA 2OK0L 3D39A 4HULB 2KQMA 4EDXA 3QNYB 1Q0YH 2DS4A 4YZFE 1IC5L 4K3GA 4PY8J 1JJUA 3NN8A 2OI9B 4PJ5A 2FSEA 3DX9B 4M6AA 1A7QH 1LE5A 5BZDA 3QPQC 2EE6A 1JNLH 3TIDB 1HDMB 2HTLD 3B2UD 3BUYB 2I9TB 1J1PH 1FVDB 4E41D 5CD3A 1FZJB 3BEVA 2VZTA 3UTPE 4Y19A 2CD0A 3DUUA 3LB6D 1QACA 1FVEA 2UYLB 3DYPA 2BNRA 4JDZA 1I9JL 4OCXH 4Y2DD 2KBGA 4Y5XA 2I07B 2NY1D 3PDGA 3QFJE 4OIIL 3TA3D 5BOPA 3M8OL 2R56L 3FQUB 3GJFA 4XNYH 4IRJB 2YSSB 1S9YA 3K4AA 3OKMB 4ONOA 2BMKB 2ZNXA 1CGXA 3V6OE 3S96B 3SJVD 1DVFA 3BDXA 1JHKL 5IKCB 3ES6A 1NMAH 5DEZA 1Z5LA 4W6YB 3T77A 3T2OA 1FZOB 1A2YB 4JFQA 1I7ZB 3RDTC 4HD9A 3SDDA 2NTSP 4JY5H 1MREH 5L8KB 5DSCB 4ZUUA 3EYOA 4GFTB 5JW4R 3MRQA 4HGKC 1Z9MA 3MLWH 4N0FB 3P0VH 4DN4H 1KB5B 3VXMA 1MVUA 4HKXB 1JWSB 1MLBB 5DGRA 1P9MC 4N9GA 4ZMAT 4YPJA 1NJ9B 3SDAD 3W0WA 1JZ8A 5IP4A 5IJVB 1KG0A 2JE8A 2F53E 3U4EA 4LDOB 4AEHL 5FYKE 1NCAH 2ICWA 1QRNA 3GSWB 1OP5K 1RZJL 3GBML 4EUPG 1KPUA 1CXLA 2Z0BA 1TETH 4I48B 1RZGA 3HMWH 4OM1L 4OFVA 3BVNB 4NQSA 1NSNL 4Z95H 35C8L 4NJ9H 2VDRL 3QXDB 3QP3A 4U33A 3ULSA 1OF2B 1SJEA 5DVOA 3IFLH 2APBA 1K2DA 1UWEL 1U8PB 1AO7D 2A9NH 2IWGA 2B8OT 5CZXD 1FL6B 4KKLD 3TBVA 2ZUQB 4CNIB 1A4KB 5DI8B 5GIRA 3RUGB 4D0DB 1N6UA 4Y4KC 4PRHA 3UTTD 1ZANH 5DMGD 1HH9B 1HK6A 5HYQA 3IXTB 1YMHB 2ITCB 1AXSB 4RDQG 2JTDA 1JNNL 2X41A 1ZS8B 4JZJB 5DHYB 4WO4C 4NZJA 1OGAE 3FO9B 3S35H 1PD6A 2ZUVA 5A2FA 4LMQI 1MF2H 4WHDA 1EMTH 1RJYA 4XCFH 1OVZA 1U6AL 4P3DA 4RWHA 4H25B 1LDPL 4KY1H 4AH2B 5EORH 5EPMB 5AYUH 1IAIH 1GYAA 1HXMA 4XPBL 2X70B 1UH2A 1A0QL 2CKBA 2PW1B 4D3CL 1T20B 2I27N 3EO1A 3PIQB 3NIDE 5D7JA 3G08A 1MAMH 4XT1C 2XZQH 5IVNA 3FRPG 3K81A 4XBGA 1BIHA 5B38G 3SDCA 4PJEF 3WFZA 3QHZL 3HC3H 2VLRE 1E27A 4OM0L 5J7CC 3C8KB 5C09E 3LMJH 1P7QB 5D96C 4BZ2L 2NXZD 1N2RB 3BPOB 4QF1A 4KFZC 2XTJE 3K2UH 4R7NB 2IFGA 2BHZA 5DRZB 1I1FB 5I1IH 4PJGA 4QRTB 4APQD 1FNFA 1NAMA 2B0SH 4JFZH 1D9KB 4F9PA 4MNQE 4HWZB 5EBLB 3QDJA 4GRWF 3RVTC 5J13C 3L3HB 3BGAA 1I9IH 1INEL 2HLAB 4NHUA 1BPVA 5FKAA 4M1GH 1LDSA 1G7HA 5CJQH 1IM3B 1ZHLA 5HYEA 3RJQB 2EIZA 1YNLH 4PR5A 3FFCA 1FLTX 1K8DA 4EI5D 4DWHA 2D9QB 2CO7B 2PXYA 4YE4L 2GUOB 3TN0B 4ELMA 4QXUL 1KCSL 2BFVL 4XZUA 1FN4A 5DK3A 4M7LL 2Y7QA 4XVUD 2EDYA 1BFVH 1AGEA 5TGBB 1OTTD 2APXA 4DZBB 2ZCHL 3EZ8A 5K9OA 3OTTA 4FQCH 1IGYB 3JUZA 3EYUL 2MOVA 4CW1B 1E4WL 3RIAF 3HR5A 2KDGA 3INUH 3CUPA 4LCWA 4LAQL 4I4WB 4HIJB 1UM5L 5E8NA 2BZDA 3EIFA 4GW5A 5D1ZB 4IHOA 4R8WH 2DQDL 1DQJA 3EDFA 3LRGA 1BEYH 4LASH 4RISL 4TUOB 5HHOD 1A6PA 2BVOB 1KCUL 5E95B 4Z7NE 3FN0H 4MQXC 4OZGF 3WN5C 3PQYE 3EHBC 5L2JB 2J8UF 2F5AL 2R29H 2P47B 1N6QL 2LVCA 5J1AA 2FJHA 1IZJA 3D48R 3HNVL 4HUWB 4U3CA 2V7HB 5I1JL 4YDJB 3ARDD 5LXGH 4LLWA 5CCKL 1AKJA 5GQBA 4CMMB 1FFOA 1ONQB 1BWMA 4UIMB 4I77L 5DTFB 1XGQB 4Q9RH 4JRYD 3BHBA 1LNUA 4YO0A 5C6TH 3O2DA 1F42A 4WHTA 1FPTH 1U8IB 5EU6B 4B53A 1JHLL 4RZCA 4MJ5A 5C1MB 2ZOKB 2DQHL 2JJTA 1ACZA 1UKTA 5F21B 3D85B 1CT8B 4KKAC 1LP9A 4NKMB 1KB9K 1JZ3A 3B9KB 5EO0B 1G6RB 4JANB 4BFGA 2UVFA 3P11H 1F4YL 5C08A 5LG1A 3AB0B 5T3ZH 4BK4A 4BFBD 5ACZA 4XX1G 5DRXB 1OTSC 4LIQL 1NDMB 4O2FA 3V6OC 3DXAB 5DVLA 5SWSA 4MA3B 3KXFE 4OGYL 4QGYA 5DLML 2P4AB 3TVMA 3X3GL 2YPVL 2Q76A 1OLLA 4CKVX 1MHHB 5AEAA 2UUDH 2GSIA 2MQ0A 4LSUH 1U8NB 5F7HA 4R7DB 1J88A 1PYWA 1S7VA 4U4BA 3LEVH 3SDXF 2XY2A 4L4VB 2UZIL 1T0MB 4ZFOA 3D2UB 3QH3A 4QCIB 4TQEH 1U3YA 3BSZH 2A77L 2C4FT 4FFZL 4KKCC 3DX6A 1I7RA 3WJJC 4AMKH 4HS8H 2VOTA 4NDMA 1T6WA 4X7TA 4BZYA 2HVKB 2BY3A 1LEKA 3A6BH 2YPLA 2CXGA 1UKQA 2BSSA 2X4OA 1A6WL 1J0HA 2CPCA 2GHWB 1H3TA 2FIKB 1JPGB 2CIIA 5D7IA 2UY7A 5HI5C 5ENWA 2DBLH 4MB4A 5IB2B 1CZ8H 3K8LA 2J4WH 1RD6A 5L0QC 4J3SA 4U1MB 2HH0H 5D2NC 4IOIA 5MI0C 5IHUL 1A4JB 1PGRB 3QCTL 1X5GA 4V1DB 4WUKL 4KU1A 2Y36L 4HFUL 4YXHH 1WBZA 4MD4B 4OF3A 3VXTB 3AGVA 5GGTH 3J8F7 1CFNA 5C07B 1FLRH 43C9A 4AJ0A 3D18A 1C16A 3AREA 3LKPB 1KTLB 2DQUL 1JI1A 3FB7A 3EDEA 4K2UL 2GJ6E 4NC1C 4AEFA 5E2JA 5HPMB 4Y5XC 1QLRA 4JQVA 2GEEA 3UJTL 2H2PC 4PP1C 3MOAH 4PS4L 3OBAA 4Q9QL 1IAIM 4OGAD 3OV6A 3V5KA 3FQNB 4U6XA 1FYHB 4Y2OA 3U79A 2CDEA 2XFXA 5EOTA 3DVGB 2VXQH 4ZUVB 5I1GL 2A6DB 1R5WB 2H32B 3MLZH 1RV6X 3D39B 1MI5E 3DMMD 1E4XH 3RVVD 1AR2A 5D8JH 4PB0H 5LAXA 4EDXB 2VLJD 3B5GA 1TVHA 4ZFGL 1VADA 2BY1A 2GFBA 3NN8B 4PJ5B 4P3CL 1TCRA 5DMIL 1LE5B 1NBQA 1CDJA 4G7YL 1WICA 4JM4L 1EUTA 4NN5C 1ND0A 5SX4I 1PSKL 3TH2T 5CD3B 1X6NA 3BEVB 4Y19B 2FH8A 4P46C 3KWWA 4LLMA 4XC3H 4M5ZH 5JIHA 4CVXB 5IWLC 2BNRB 4JDZB 4GAJL 5GRUL 2DKMA 1ZWIA 5C8JA 4D9RE 4R90H 2Z91A 1UWGH 3I02A 4KI1A 3GJFB 32C2A 1S9YB 4FHBD 1A1OA 4YUEL 2UZYB 4GRWH 4X5XA 2X9WA 1UG9A 4XMKH 5I8EA 1L0XA 1BQLH 2DTML 1DVFB 3MOQA 5HHNA 4CN6A 1OAZL 4G3YH 2P5EE 4GUPA 2X4TA 1Z5LB 1A5FH 3T77B 3EYSL 3BO8A 3WHE0 3ZYOA 1AP2A 3JV5A 4JKPH 4JFQB 4U1KB 1G9NH 3N1GC 3SDDB 5HDBE 3AROA 2E7MA 1I8IA 3EYOB 1FDLL 3GSNH 1LD9B 3MRQB 4KTEL 2VKXA 3U1SL 3LIZL 1A3RH 1CXIA 2CDGA 4L3ED 2FL5B 1IKFL 4OIBA 4I2XA 3VXMB 1MVUB 5ADOH 3FAXA 1LE9A 4YK4C 5I30L 3ULUF 2UY6A 3W0WB 4X80L 1L7IH 4M7ZC 5C0CA 3CFDA 1KG0B 2PYED 3DVIA 1ZSDA 2F19L 5LCVL 2X2YA 2Q1EA 3C5SA 2ICWB 5AG9A 1QRNB 2RHEA 1E28A 4KTYA 4X9GA 3PP3K 1KPUB 3AXLA 2BY0A 4XP5L 2MCPL 1RZGB 4P4KD 2P44B 4U6HA 4NQSB 1RZKL 5D1QA 5TF0A 2V2XA 4CDHA 4HUVA 1XIWA 1DCLA 3MV11 4PB9H 2R1YB 2ZKHH 3ULSB 4UV4H 1SJEB 5F9WB 1PVHA 5I19L 1K2DB 4QXTA 3JWOL 3I50H 1W2KT 2XI9A 3BPNB 4NUJA 5FCUH 3HZKA 1KXQE 5GIRB 1U8HA 1XGTA 1VEOA 4PRHB 1BX2A 1TITA 3CVIL 5E2UH 3LV3A 4FQ1H 5HYQB 4ZD3H 5DMJB 1NL0L 3L3DA 1X5YA 1YN7A 1CLZL 2VKWA 4H20H 3ULUD 4KQ4H 3TBTB 3HRPA 4YHMH 4FRWA 1TJGH 1OAXL 1NFDF 3PGCA 1J0ZA 5IW1A 1FAKT 2A6IA 3TH3T 5JW4Q 5HD8D 3HFMH 4FQPA 1FC1A 5KS9F 4P5TD 4LHUA 4P3DB 1TJHH 4NOBA 5D7SH 1HHGA 3QWQB 4JFDE 4XCEA 1DQLL 4QGTA 3U0WL 2Y07L 1IGCL 5J57B 2C26A 2CKBB 3EO1B 4G6KH 4UAOC 3NA9L 2G75A 5D7JB 3G08B 2QHLA 4LGRB 3ARFD 4XBGB 4PV9A 2WBJC 5EB9A 4O4YH 3SDCB 4O02L 1SY6H 2J6EH 4OCYH 4O5LL 4ZO8A 2QKIB 5CEZL 1E27B 2W60B 3MOBH 4NZTH 3IS1X 4NWUH 3HC4L 2WLZA 4HT1H 4HXBH 4L4TB 4QTIH 1D6EA 4PLNC 3RFZC 4M7KL 4QRSA 2FO4A 5F7YC 1CR9H 4QF1B 2E8YA 3U4BH 2X7LA 2YZ1A 1IL1A 1NAMB 4JKMA 1Q72H 2IAMC 1JIBA 1DE4A 2OK0H 4LAJH 2J5LC 5A16A 1UQSB 1MFAH 3C60C 5DDHA 1SBSL 4NHUB 3S3SA 5EWIL 4HKBA 5GS2H 5DO2D 1IC5H 5IFHL 1G7HB 3QG6A 2XOTA 1ZHLB 1MCCA 1YMMA 3T04D 4PR5B 3FFCB 1VDGA 3PL6A 1K8DB 1FE8L 4Y4FC 3Q5TA 2O61A 3AS0A 2PXYB 1GGCH 1TVBB 3FCTA 4ELMB 3GJEA 5B22A 1XZ0A 2Y7QB 2C3WA 2ARJA 5GGQL 1EBAA 4P23A 1I9JH 4XP9L 2X1PA 3LQAL 4OIIH 5K9OB 3M8OH 1QSFD 1J10A 3LN5A 4LFHG 3TO4D 4K7PL 1KJ2H 2X9XA 4HBCL 4M3KB 3HR5B 5ALBL 5D7KE 3H7LA 4N8CL 5C3TA 5TE4L 4GW5B 4GRLD 3WNKA 1DQJB 3KJ4B 4Z5RA 1JHKH 1NCCL 1MRFH 4YC2B 3U2SA 1YPZA 2NX5D 1SBBA 3STBA 3P77A 3MQIA 3SO3B 4PGCB 4MNGE 5J1AB 2FJHB 1TPXB 2J1KA 3V0VA 1RIVH 4JVUA 4QYOA 3EYFA 3IKCA 5IFAL 3ZT6A 4X4XA 3TJHD 1CXHA 4JCLA 3T0EC 2R8SH 4LLWB 1AKJB 5GGSY 1CU4L 1FFOB 1U8KB 3D3VE 4WFED 5D6DA 4RA3A 3CC5A 4HGWA 4N9OB 3BHBB 1LNUB 4YO0B 5JW3H 4NRZB 4WHTB 3V2AR 4MJ5B 1XCTB 3VG9B 2HRLA 5C9JA 2HFEB 3MLVL 5MP6L 2F74A 4AEIL 1LP9B 1K85A 5D5MF 4AEHH 2NY0D 3MMEA 5MEPA 1WK0A 1PJ9A 2VDOL 4FFWD 5C08B 1RZJH 3GBMH 5C3LD 4X4ME 3U0PA 1JV5A 3BI9X 1Y18A 5ACZB 5IV2B 4LRIA 1OHQA 4OM1H 3BE1H 4O2FB 2FJGA 1NSNH 2QEJA 2VDRH 3I6LD 5SWSB 3KLDA 3BPLB 3NTCL 3RVWD 4JO1L 3TVMB 2AK4A 3T0BA 1J11A 2Q76B 1UWEH 2GSIB 1DLHA 3H9SD 1I8KB 1PYWB 1S7VB 1S7RA 4MD0A 1I4FA 2QV2A 2HN7B 2V5RA 1JRHI 1FYTA 4MA8L 4ZFOB 2JELL 3QH3B 3CX2A 3ZE0F 2NZIA 5C6PB 2ZCLL 1JYVA 1T04B 5HYSG 4IEFB 2PYFA 4DKFL 3QCVL 3DX6B 1I7RB 2QSCH 1FNEA 1AC0A 4NDMB 4YXKH 4X7TB 3LQMA 1T83A 1LEKB 1P4IH 3BQUC 2OZ4L 2YPLB 5D70L 5DFTA 2BSSB 2X4OB 3UBXI 2X89A 4IS6A 2CIIB 5D7IB 1UEYA 1U6AH 4OJFL 1LDPH 2O26U 3MUGA 5K59F 2FYYB 5J1SC 4RFEA 3VRJB 4RQQA 1J18A 4IOIB 2C1PA 3NACL 4D3CH 1F00I 4MXWL 5E5MA 1WBZB 5E6IA 1XMWA 1ZXQA 3VFTB 2YZ8A 1OAKL 4BQ6A 1CFNB 3P9MA 3BJLA 3O4OB 3HN3A 3D18B 1C16B 3QHZH 3AREB 4R9HA 3DUSA 2OTWA 3FB7B 2ED7A 2ICWJ 4BZ2H 3OKOA 4KRPD 3LKQA 1QLRB 5ISZA 4BUGA 1P6FA 4ZNCD 5IQ7L 2GTZA 3RAJL 3B4NA 3REWA 4HAFA 1AGBB 1ZHNB 2JB6A 2LTQC 1UJ3A 4L5FH 4U6XB 2CDEB 2XFXB 5EOTB 1C12A 4NGHL 4UINL 2R0KL 4TVSa 1INEH 4C57C 5LAXB 4PRNA 1TVHB 3TCLA 1AD9A 4G9FB 5EOQL 2X4NB 1TCRB 5KOMC 3AAZA 1INDH 1ND0B 3PE9A 1J12A 3P0YL 4NZRL 4LCIL 4K7PX 2C4XA 4OFKA 1ROWA 2W92A 4YE4H 4LOUD 3RVUC 4HIXL 4PFEA 3Q0HA 1KCSH 2HKHL 3WL9A 3KWWB 2J8HA 4LLMB 3RIFF 2FWOA 3NPZB 5E7BA 2ZCHH 3FO1B 4C58B 1BWWA 3EYUH 1P5VA 1WZLA 1ZWIB 3STLA 3BJ91 5C8JB 2D03H 2Z91B 2XKNB 1IM9D 3I02B 2EH7H 3O3EA 32C2B 1NCWL 1UM5H 1A1OB 4RISH 3DX8A 4PBVC 1AGFA 5I8EB 3TYGL 1E6JL 1PW3A 2W07A 1E6OH 5D1QC 1MCDA 5HHNB 4W81A 1G6RL 2F5AH 1ZHKB 4P9HH 3I6KA 2X4TB 4GUPB 1N6QH 3W9EB 3QO1A 5C0AD 4RGND 3BO8B 1KXVC 3BKCL 2QQLL 1AP2B 3QUYC 5I1JH 4O51A 1G7MA 1T5WA 5IHLB 4TPRL 1UADC 5CCKH 5L7XH 1I8IB 3QIUA 4I77H 3QDMB 4M4PA 1HYRC 4MLSA 1A6VL 4OUOA 4LVOC 4FZEL 1RUQL 1WWAX 3ZE1F 4RRPA 2CDGB 4XPAH 4I2XB 2Y5TA 1OY3B 5KANG 4OFPA 1LE9B 1RAMA 5JW5A 5CMAA 3FQWA 2QSTA 5EU4A 3ZTJH 1QOKA 5C0CB 3WKML 3ULVE 5GSRA 3CFDB 3IDUA 4X9IA 2ID5A 1MNUH 3IDNA 5IBUG 2CLVA 1ZSDB 1F11A 2R0ZH 3WHE1 2CRIA 1E28B 3F62A 3GMQA 1I7TA 5E2VL 5BVJA 1JUFA 3ZKMD 3AXLB 3L7FA 4LIQH 1DDHB 4JKWA 4U6HB 3VXSE 4JR9L 3ZDXF 2DD8L 2V2XB 2CIKA 4OGYH 4HUVB 3T1WA 3LD8C 3QFJA 3GI9L 1XIWB 2YPVH 1I3VA 2DM4A 5DQ9B 2EKJA 4QXTB 4LDEB 2NXYC 1X5ZA 4F7MA 1Z3GH 3UPAA 3W5MA 2OJZL 2UZIH 3DRTB 5FM8A 5D7LD 2XG4A 4AL8L 2X1XR 3C5ZD 1BJ1H 1TDQA 3E0GA 4DQOL 2V17H 2A77H 3LV3B 4FFZH 4OZHF 5BS0D 2I9LA 3WBDA 4NN7C 3L3DB 3R0NA 2AK1L 3DV4A 1YN7B 4KK9D 3RZWA 5C0IA 2NZ9C 2O5ZH 2X09A 4XAKD 2YC1A 5F1KC 3FB5A 1WAAE 1J0IA 1MCNA 3U48A 3IDXL 3PGCB 1A6WH 2PTTA 5IW1B 1U42A 4RMSA 2A6IB 3L3IA 3V52L 2DQFA 1SMAA 1JTOA 1C8PA 1DBBL 3SKJL 2J12B 4LHUB 1TNNA 5CUSL 2HFFB 12E8L 1N5AB 1WIOA 4HH8A 3HI1A 1KIRA 2IPTL 4PJ9C 4XCEB 4XNQB 4WU5A 4X6EA 3QCTH 4WUKH 2Y36H 1UB5A 2EXYC 3CGTA 4HFUH 1Q9LB 5GRZA 1T7VA 3QIWB 5L2KD 5KSVA 2G75B 4LMQE 3RL2A 4M8QA 4PV9B 5TE6L 4KK5D 2DQUH 3GIZL 5FB8A 4K2UH 3GMLA 5JHLL 4P23C 2QADC 4WFFE 2PF6A 4DEPB 3VWJC 1JP5A 4AIOA 1D6EB 1YEJH 4XPGL 1NUGA 2QR0B 1DBJL 2BVQA 3NCBB 4QRSB 3UJTH 2FO4B 3OJDA 2GCYA 5CEZD 5C0JA 1WIPA 2DQEL 4PS4H 4Q9QH 1MWAA 2X7LB 1NCDL 4P2RE 3KR3L 5FHBL 4JREC 1X4ZA 4WVRA 5IVXB 2DIJA 4I3RH 3MACL 4FMKA 2P5WD 4I18C 5I1GH 1DE4B 4FXGA 5GJSL 5A16B 3O9WA 4U1SA 4X7EC 4IJ3B 5DDHB 1L9NA 2IFFL 4HKBB 4YHLL 5FV1L 1FNAA 1TIUA 3QG6B 5FO7A 4P3CH 1YMMB 3ABZA 2VTFA 5DMIH 4XHQA 5FUZL 4G7YH 4JM4H 1IILE 1ZKAA 1FCGA 1IAKA 1PSKH 3VFRB 4GKSA 4ZPTA 1NMBL 1WFOA 2Y25A 1T1WA 1UJTA 2EC8A 3GJEB 1XZ0B 5LGHL 4PJAA 2ARJB 3MR9B 4JZOA 3NAAL 2Q7YA 2VL4A 2X9YA 1I85A 2F58L 2DYPA 3LN5B 3QPQD 3X11A 3RUGF 4YHIA 4YUEH 1WT5A 2WLYA 4K71B 2VLRA 4PJBA 3ZKNC 4Z5RB 2VXUH 5C09A 1OAZH 4PY8I 1ZLVK 2PO6A 4ODSL 3U2SB 1S5IL 1YPZB 3NCYS 4LLQA 2HRPL 5FGRA 2KZWA 5DD3L 3V0VB 4QOKE 1JPST 4QYOB 3EYFB 1QFUL 4ODBD 3IKCB 2F54E 1CIUA 4CBPA 5FO9A 1CGUA 5MEND 1A9EA 3C08L 4H1LB 1FDLH 2NY3B 1NCBL 1I75A 4NN6B 3U1SH 3LIZH 3QR2A 5F96L 3CC5B 4HGWB 3MBEA 4X7SL 1IKFH 5KSAC 4F80A 1JHTA 5JORB 1EHXA 3MRKB 4X6DF 1HXYA 1OQOA 5I30H 3E3QE 2WWMC 4X80H 3FB6A 2MKWA 1NUDA 5C9JB 2P49B 1KIQA 1RVFL 2VUOA 5EO1A 2F74B 3WNPA 2IPKB 2R1WB 4ZUWB 3RDTD 3MMEB 5LCVH 4CL7A 4LNVA 1ZLSL 4MX7A 1GOFA 4JE4B 3U0PB 2VDML 1JV5B 1Y18B 4RBPK 2MCPH 3Q3GA 1RZKH 2FJGB 2WP3O 4ZSOA 5CEYB 3MV9E 3HZMB 1GH7A 1H9VA 1KFAL 4DCQA 2D2OA 3GM8A 3L1OH 2CRZA 3PWNA 2AK4B 1AE6L 2FBOJ 4ONFH 1H3XA 3CSGA 2WW8A 3AY4C 3JWOH 2XQBL 4KV5E 1DLHB 1YECL 3AS1A 2Z8RA 1S7RB 3Q1SL 2DAVA 4MD0B 1NKRA 1I4FB 4LRNH 4WW1A 3LEXA 3TESA 3MCKA 3IFOA 2YRZA 2CKBL 1CFVL 2JB5L 1EV2E 1IFHL 2I24N 4OFYA 1BGXL 1U8JA 3V7AE 2PYFB 4Z0XA 1WWCA 3KYMA 1NL0H 4Z7QF 1CLZH 1FNEB 4S10A 2ZOLA 2O5YH 4C4KT 4YQXL 1OAXH 3HE6C 4PY7A 3CFBA 4UDUB 1Z6JT 2R4SL 1AIFA 3RQ3A 4NUGL 1ADQH 1B2WL 4IS6B 3B9DA 4M6MH 1LHZA 2DDQL 4Y4KD 4KZDL 3MUGB 3EJJX 5C2BL 4RFEB 4C56D 4Q0XL 2ICES 3U0WH 2Y1VA 5EBWA 2Y07H 1CF8L 1IGCH 4Z6AT 1NAML 5HGHA 1LMKA 2C1PB 3QO0A 3ZKQD 1CFQA 3NA9H 3B83A 5E6IB 4LFHD 3SCMA 5ICXB 4WO4D 4YDLB 5I71C 3C2SA 4D2NA 1YEFL 2KPNA 2WM0A 4O02H 3P9MB 1IGJA 4RAUB 5F7DB 2G2RA 3SDYL 4O5LH 1D5IH 3DUSB 3WD5L 3FQRA 4YEEA 1EFXD 2OTWB 5F1NA 1P5UA 2WUBL 3HC4H 4QTHA 3KXFA 5GRVK 3LKQB 3ZHDA 2IH3A 1HNFA 2BVTA 5ISZB 2CR6A 3KLHD 4N68A 2BJML 2D7QA 4QXWA 4EN3C 2GTZB 4DK3A 1A6TA 4JO3H 3MJ7A 2JB6B 1UJ3B 1LO2L 4E41E 1HNGA 3O11A 3TN0D 3V5DB 1MCPH 5HGBA 3EYVA 4L9DA 1C12B 1MHCA 1N26A 5AAMA 1NCUA 4M62L 4LSTH 1SBSH 2QL1A 4K7FA 4DGVL 3BKYL 4XXCA 3B2VL 3QUZC 3UMTA 3VD7A 2DLFL 4C54A 5IFHH 4PRNB 3TCLB 3OAZH 3HB3D 4GT7A 3I75A 4Q58C 1YY9C 5C0EA 2J3SA 1IQWL 1QBLH 5K9QG 3AAZB 3WE6A 2DM3A 1FE8H 3QIUC 4DTGL 4JO4L 5D1ZD 2AEWA 1M7DA 4Y16A 1V3LA 4GBXA 3WL9B 2CSPA 3RVTD 4L1DA 2EO1A 5FA4A 5GGQH 4OZIA 2FWOB 4XP9H 2C4FU 3LQAH 3VI4F 3U0TA 4J3TA 2D4FA 1F8TL 2YKLL 3STLB 3Q6FA 3HLAA 1CXKA 4K7PH 5EFIA 1KB5H 4HBCH 1WCBA 3O3EB 1TQCC 3O2DL 5ALBH 1QPXA 3PDDA 4ELKA 4N8CH 2YD3A 4JY4A 2NW2A 3DX8B 5KVEH 1AGFB 2WAHA 4IRSC 1OSZA 1NCCH 4IIQA 2GJ6A 1II4E 2E7LA 1IC7L 1Q9KA 2YXMA 2Q6WA 4JY6A 2ERJB 3I6KB 4K7PY 3QO1B 1OAUH 4X0KA 3B9KD 5IFAH 1TZGL 1AFVL 4O51B 3IU3A 1G7MB 1T5WB 8CGTA 3CK0L 4KI5F 4ODVL 3VDCA 4Z8FH 3VW3L 3G5YA 4PJFE 1CU4H 3MGOA 3O6FA 1JGUL 1FBIL 2ESVA 1NH6A 4MQXD 4PG9A 1MCIA 4LLVA 2Y5TB 1QFOA 3EHBD 3DROA 4GW4A 1EDQA 5L6YL 3GHEL 3MLVH 5JW5B 3VH8A 1SYSA 5CMAB 4HSQA 3RX5A 4HIHA 5GSRB 4EIGB 2B39A 3DOSA 5JR1L 2P8LA 3SY0B 4ZFOL 2VDOH 2CLVB 1J87A 5ICYA 1F11B 3VD4A 4OV6F 3TJEL 3NZHL 2B4CC 5CSGA 4L4VD 3QUXC 3GMQB 3JVGA 3WO4C 1I7TB 1S7WB 5BVJB 3D2UD 1JUFB 3TIEA 2OJEA 4OD1L 1J8HA 3RBGA 2YR3A 3UTTE 3NTCH 2CIKB 2EDQA 1RHHA 3QFJB 4JO1H 4PGEA 1RU9L 4XXDB 3S36X 5M7QA 4Z77A 3TWCL 3N1MC 5FGBA 3V4VL 2BDNL 3T3ME 2PTVA 4IRZH 5J12C 4F7MB 1RK0A 3EJYC 2PTUA 4HG4J 4KI5D 1K8IA 5MEQB 3ETBF 4MA8H 4UT6L 4C55A 5CILL 3IGAB 5F1SA 3CXHK 1OTSD 2ZCLH 1DBKH 1U58A 1NLDL 2P5EA 1R3JB 2I9LB 3QCVH 5IHBA 4EEEA 3DV4B 4E42A 2XWTA 4L8CA 5C0IB 1Y0LA 5SX5K 3FB5B 3G04A 3RKDC 2O93L 4KROC 2OZ4H 5C07D 5DUPL 5D70H 2IQ9L 5HHVL 2EDDA 2PTTB 5IUSA 3PUCA 4PJXE 4ENEC 7CGTA 1WZMA 4PJDE 1Q0XH 3L3IB 1YDPA 3HI5L 2DQFB 5HDLA 4OJFH 4DVBA 1F3DH 1ZHBA 3IDIA 2GYSA 3RHWK 3QDGD 3F5WA 3HI1B 1KIRB 4WGVB 5C70A 4X6EB 3CFCL 3NACH 3C6LA 1YEKH 5EA0L 1UB5B 2F53B 3KYAA 1H3GA 5KSVB 1A7PH 1KGCE 1OAKH 3RL2B 5DMKB 5FECA 3R1GL 4M8QB 4NQDE 2VQTA 1JFQL 5GGUA 3D39D 4J12A 4LCYA 2QJDA 5JW4M 1QYGL 5FB8B 3GMLB 1YC7A 4OGXL 3SBWA 2AJVL 1JK8A 3PABA 2BVQB 4PJ5D 3OJDB 4BH8B 1YNTA 5DUML 4R0LA 4S1QL 1HHKA 5C0JB 5IQ7H 2BNQD 4M1CC 3RAJH 2LQRA 1MWAB 2GY5A 4Z7OF 4Y4HA 4MZ3A 4Y19D 4WI2A 5HHXL 4NGHH 2DTSA 4FXGB 1KTKE 2RR3A 4PJEE 4YGVA 3O9WB 4U1SB 4JN1L 5B21A 1CK0L 4AT6A 2V5YA 4Z18A 2VDNL 5JHDD 3W82A 3ELAT 4FQXC 4XMPL 1QP1A 1DLFL 2JK5B 5FO7B 2FX7L 1RJCA 5F7EL 5CEXA 3ARPA 3BW9B 4QKXB 2H2PD 4PP1D 5ICZA 4HUXA 1TTGA 4DFHA 1MCOL 3LQZB 1IAKB 1OGAB 4D8PA 2FECI 3P0YH 4GKSB 5I9QB 4NZRH 4LCIH 4ZPTB 2CMRH 4EVNA 1OAYL 1OM3L 3LH2H 3F7RA 1T1WB 4NOFA 2HAZA 4LSRH 4JFDA 4AENA 3N1FC 4PJAB 1FFNA 4JZOB 5HI4C 3DHMA 2R9HC 2Q7YB 3GDBA 4KDTC 4LCUA 3SDDD 3AUVA 2DYPB 1U8OA 3QEQA 1NCWH 4NWTH 4YHIB 5ANMA 2EC9T 4MMZC 2VDQL 5F7LB 1F5WA 3TYGH 2VLRB 3DVNA 3RJDA 4BQ9A 4P46D 4JRYE 3VXMD 3WIFA 2AJYH 1G6RH 5C09B 1PY9A 2MSPA 2PO6B 1VSCA 3LB6C 2X4SA 1XGYL 4NJAL 1FRGH 3W0WD 4LLQB 2XTJB 3BKCH 2QQLH 2A6JB 2J6EA 5ELIA 5ABDE 5DJ8A 3EW3B 2KUTA 2MHAA 3KJ6H 2NY1C 5FO9B 4TPRH 3HNSH 4K23L 1QFHA 3TA3C 1J0KA 4WNQA 1A9EB 1QRND 2VR9A 2XXMB 3VGEA 2BNUA 4HPYL 3N1PC 4FZEH 1RUQH 1C1EL 3MBEB 1OB1A 1JHTB 4GAYA 5E08L 1HXYB 2LV4A 1Z9SA 4OZGE 3FB6B 1U8QA 3U46A 3WKMH 5J56B 1KIQB 4JFHD 5EO1B 1PG7W 4J7RA 1OT1A 5KSBE 1ZLWH 2WANA 5EOCH 4MX7B 3ARGB 4O58L 2FATL 5E2VH 3LAFA 5ETUB 4LPUA 4ZTOL 4PRHD 1O5DT 2WMPA 3Q3GB 4JR9H 2DD8H 4ZSOB 1X5HA 2HG5A 4DCQB 3QEGL 1AHWA 3GI9H 2DLGA 4GO6B 4Y89A 5H2BA 2W38A 4PJGF 3CLEL 3PWNB 1EX0A 3SDAC 1A1MA 4ZFFA 4HEPG 1HINL 2NY6B 3ZHLA 2EDFA 2OJZH 1KF9B 2BRRL 3LEXB 2NPLX 2P42B 2RJMA 4X6FA 3MCKB 3IFOB 1DQQA 4DQOH 1AQKL 2ADGA 3VD3A 4AIXA 4OCRL 1Q94A 4F33A 2YD2A 5I1CL 1U8JB 3NABL 1KJ2A 4Z0XB 4MNGA 1GCFA 2AJSL 3RGVA 2AK1H 4POUB 4GQ9L 3RY6A 3WIHA 2ZOLB 4M93C 3OX8A 3HS0A 3ILQC 4PTUA 4PY7B 1IC4L 3CFBB 3GBLA 4Z78A 1AIFB 3ESUF 4ELMF 4OLZL 3D3VA 3V52H 2IPUG 4TUJA 1DBBH 3E1F1 3SKJH 4KKLC 2ZSVA 4M61A 5IF0A 1NGQL 5CUSH 2Q7NA 1D6VL 2IPTH 3KLAA 4URTB 5EBWB 3NGBB 4JJ5A 5HGHB 3RZCA 4XCYA 2ZG2A 3QO0B 2DM2A 5FDWB 3ZHKA 2H32H 1CFQB 1CXEA 2QQQA 3C5JA 1MCSA 4HUKB 4JHBA 4M7LT 3SCMB 2Z9TA 3WFDL 1JTTA 4IMKA 2F8OA 5TE6H 4NO0D 3WJLC 4P2QA 1WSST 3ZSTA 3L7EB 1YUHA 3QDJD 3GIZH 1B0RA 5F1NB 2MNUA 4MSWA 2BVYA 4QTHB 3KXFB 1OD9A 1DBJH 2FH6A 2VLJE 2IH3B 2VXSL 4G6FB 4QRUA 4RGMB 1K6QL 1RUAH 2A38A 5HGDB 3ROOA 4KHTL 2VIRA 5FHBH 3KR3H 3UTSE 1A3QA 1A6TB 1ZEAL 2E8ZA 2WBJD 3MACH 1WZ1L 2PXYD 2W9DL 4J4PC 2ARJQ 1R3HA 3O11B 5GJSH 3GMMA 5HGBB 3U30C 3CSBA 1WJ3A 4WWKA 4M7JL 5JOFA 2VSDA 3IDGA 3GJFH 3MCLL 3DETC 3OHXB 4K7FB 2IFFH 1S8DB 3QT2A 1LP9F 1E0OB 2GJZB 1J86A 4YHLH 1FO0B 3LKRA 5HYIA 4MJ6A 3WXVL 4XB7A 3MRFB 3I75B 2IAMB 3K1DA 4F7TA 5C0EB 4LCWD 5E4EC 1M4KA 1JI2A 4S11A 4APQC 1B3JA 2D7MA 4Y16B 2XKSA 2VLLA 4GBXB 5LGHH 4NNPL 2LABA 3C60D 3K1KC 5FA4B 3UO1L 5HI3D 2EDJA 4JO2L 1FGNL 3MRDA 3NAAH 4ZOEA 1P84K 3U0TB 4RX4D 3DSFL 1MAKA 3Q6FB 2DM7A 3HLAB 5EFIB 5B3JF 3O8XA 2AQ1A 4PBWD 1WCBB 3UZVB 1AKJD 4XBPA 1F4XL 4ELKB 2D7NA 1BBJA 4JY4B 4NQXA 1OSZB 2A6KB 5EU7C 4IIQB 2GJ6B 4L3EE 4ODSH 1Q9KB 3OL2A 1S5IH 5J06A 2Q6WB 4JY6B 2RB8A 2HRPH 2NR6D 4N8VA 5DD3H 2BOBA 5FGBC 1QFUH 1H5BC 4NNXB 5GS0L 2PYEE 4OLUH 3IU3B 4LU5L 4PGZA 5C08D 5D7IF 4FFVC 3G5YB 1NCBH 2VABA 4HS3A 3MGOB 1ZT4A 3O6FB 1V8HA 4LKCA 5F96H 4H26A 4S0SD 4X9FA 1MI5B 2V2WA 2XWBA 2ESVB 4PG9B 1KJ3L 4LLVB 4GW4B 1IRAY 3VH8B 1EGJA 1QBAA 4O00A 3G6AB 4JZNA 1BECA 1RVFH 3UZEA 4HIHB 1A21A 2P8LB 2Y06L 5ICYB 3T0ED 3IDJA 1LGVA 1MFDH 2VXVL 3DLQR 2FEEL 4Z7UE 2VDMH 4C4KO 2DQGH 1WTLA 4RWYL 4H0GA 1T1YB 2OJEB 3CXDL 1B6UA 1J8HB 3ZO0A 1G9NC 2AERT 5AWNL 5IR1A 5DFVC 3NPSB 1KFAH 4AIZA 5I8CA 2FGWL 4PTTA 2F5BL 1OPGL 1RHHB 1KYOK 4PGEB 1AE6H 5T1KA 3TT3H 1ETZA 4Z0BL 3ULUE 4L29B 2XQBH 4KDWA 1YECH 3TBSA 1U95A 1C08A 4LPYA 1JWMA 3Q1SH 1K8IB 2Z35A 5A2JH 2CKBH 1H0DB 4BSVB 1CFVH 2JB5H 1IFHH 2B5IB 3S36H 2P5EB 4HZAA 3SKNA 1YEEL 2VZSA 4JKKA 1E4KC 4E42B 4YQXH 4L8CB 4UILL 1Y0LB 2Z8VC 4JLRA 3G04B 4WV1C 4M4RA 4PREA 4FP8L 5FYJH 2R4SH 4NUGH 4ERSL 5BVPH 1B2WH 3ARED 4K8RL 3L3JB 3LCYA 1YDPB 4LVHB 2HFTA 4MD5B 3LS4L 3ZDYF 2DDQH 4DVBB 1ZHBB 1BZ7A 3IDIB 3THMH 5C2BH 4UV7L 4Q0XH 4MDIA 3F5WB 1CF8H 1KPRA 1P4LA 1NAMH 1BFOA 3C6LB 1L6XA 1LK2A 5IT2L 5IBLD 4PRID 5KANI 3SGJC 5KZCB 2GY7B 2F8VA 4FQLL 1NBVH 1YEFH 4HAGA 5FECB 3UDWC 4K55A 1CLYL 3SDYH 1NFDE 2AI0L 3F6IA 3WD5H 1S7QA 4LLDA 5GGUB 4OLYL 4LCYB 5J9PA 2WUBH 3VXSA 4JRXA 1MLCA 4MB5A 1EVUA 3RU8L 4IMLA 4JB9L 4F7PA 3C2AL 1KEML 3PABB 1PQZB 2BJMH 1YNTB 4R0LB 5H94A 1HHKB 3H7BA 1J05A 2ZUYA 1U3HA 4W6WB 4LCCC 4Y4HB 3CDFA 5D93B 1LO2H 5IIEA 5GGRA 3VRLF 3VWKA 4TOYL 2DLIA 3OZ9L 5C0RL 1RIHL 4YGVB 4U1LB 3T8XB 4M62H 4AT6B 3S88H 3Q6GL 5DVNA 1VKXA 4JFXA 4DGVH 4M1DL 3BKYH 3B2VH 3IJSA 2DLFH 3KYNA 4NHCL 1XF5A 3E2HB 3CPLB 3SGKA 3VGHA 3GNML 2DRUA 2XWJA 5CEXB 4R2GB 1QSFE 4KUCF 3RA7L 5K9KA 3TH4T 1IQWH 4HUXB 1I3UA 2D7TL 3BIBX 4D8PB 4JO4H 4EVNB 1U3ZA 4LQFL 3L3GA 3QPXL 1WTGT 3TNMA 3VXRD 5AUMA 6CGTA 15C8H 2ICWI 5D4QA 3MV8D 3BDBA 4JFDB 4AENB 1KSRA 4S1DC 3OF6A 2NX5E 1FFNB 3L5IA 4LSDA 4ZS7H 3RVVC 5FOJA 2JJSA 1T1XA 4NRXB 4U1HA 4LPXA 2ZNWA 4LCUB 1QTYT 3ARBA 5I1EL 4RNRA 1U8OB 3O2DH 3QEQB 4FMFA 1GOHA 3RVUD 4WFEE 2XZAL 4F15B 1BZ9A 4P2OA 3WIFB 3PWLA 4G9DA 4UNVA 3HPLA 3U7WL 2X4SB 1NEZA 5JXEA 2WQRA 1CL7H 2WNGA 4EOWL 5C0CD 4LQ1A 5JO5A 4YX2L 1TZGH 4NQUA 1AFVH 4HF5H 1FFPA 4E0RA 1Q0YL 4P2RA 5DJ8B 2P8PB 2MHAB 3CK0H 4X5WA 1ZT7A 4KUCD 4F37F 3VW3H 4WNQB 1A7QL 1NUFA 1EHAA 3N06B 2BNUB 3U7YH 1JGUH 1JNLL 1FBIH 3HKFA 4TSAL 5D1QD 3D0VB 4ZAKA 3UROR 4X9HA 4QO1A 1OB1B 5TQ2H 2UUDK 5L6YH 4GAYB 3GHEH 3I6LE 2R2CA 3TFKC 2BC4B 5IG7A 2E7CA 2C9AA 3OAYH 1N0XH 5JR1H 5AYQA 3QUYD 1SEBA 1OOAA 2YN3A 2EE2A 3TJEH 3CD4A 3S4SA 1CYGA 1XF4A 4UNTA 3H6JA 1BD2D 4JDVA 4AM0A 4XNYL 2ZUUA 3UTOA 5F9AC 4OD1H 5DJCA 2APVA 4TVPD 3B43A 5F3HA 3B9EA 3LN4A 1CGWA 2HG5B 3RZCC 5IFJA 1AHWB 4XMLH 4KJQC 1RU9H 5H2BB 2OTPA 4HJGA 3TWCH 2PCPA 3V4VH 2IADA 4LVNB 1A1MB 2BDNH 2DJUA 4MAUL 4ZFFB 3O4LA 3N9GL 4BFIB 1R3LA 2WUCL 1OSPL 3JTTA 4UT6H 5CILH 1NBZA 2NCMA 4QHLA 4X6FB 3JWNC 3MBXL 1NLDH 1DQQB 1MJ8H 2ADGB 5FYKL 3BOVA 1W0YT 2XN9A 1Q94B 3A6OA 4MNGB 4B5EA 3ZE2E 1RZJC 3I3BA 3RGVB 4QOKA 1T4KB 2W65A 3RTQA 1PEWA 3OX8B 3HS0B 4HK0A 4PTUB 2IQ9H 3W11D 4JFYA 5HHVH 2NXYD 5B39G 3MREA 3M1BA 3D3VB 3HI5H 4R26L 3L95B 2XNAB 4TUJB 3MRLA 3VXUA 1P69B 4JGMA 4EI6A 5JLZA 2CQVA 2ZSVB 4M61B 1FSKB 5IF0B 3QXAB 3MRGA 3KLAB 1MWAL 3BRGC 1F58H 3CAFA 4JJ5B 5EA0H 4XCYB 3MRIA 2CDFA 4UZGA 3C5JB 4Z7VE 5FYLD 4QRRE 3R1GH 3FOLA 4P2QB 5IEHB 2AABL 4OZ4A 2A9NL 1JFQH 1YUHB 3TBYA 1YPZF 1B0RB 3WMSA 2ZPKL 4WUUE 4HZLA 4OGXH 2PNDA 5HD8C 3HTLX 4MSWB 3MJ9H 2AJVH 5I73C 4OUUA 2VISA 1NFKA 1FJ1A 2WIIA 1UKSA 3JBG7 2GKIA 3GI8H 1YMMD 4S1QH 4QRUB 5D2LA 5B8CA 3OR6B 2OYPA 3O8XC 1N3NA 4GQPH 2K1MA 2VIRB 5SWZA 3PL6D 4P0DA 1U2HA 1G0YR 1TMCB 3T2NL 5HHXH 1R3HB 3RHWF 1QEWA 3ARFC 2MMXA 1LEGA 2LFGA 4XX1E 4WWKB 2CXKA 1CK0H 5JOFB 4P23D 3IDGB 2WBKA 1EMTL 3CSPA 2VDNH 5I74C 3VDAA 4G7VH 2Q8AL 1DLFH 3BIAX 3U7AA 3LKRB 3FT2A 5F7EH 4MJ6B 3QIBC 4GXVL 3P73A 4L3AA 1MCOH 3X13B 5GRJL 3S97C 4UTBL 4GXUM 3VMNA 1OAYH 1MAML 5FO8A 1I8MA 1JF5A 2AXJA 5HSFA 2EEBA 2VLLB 2ENYA 1PAMA 2YD5A 5EC2B 2QQNL 2RCSL 4KKNA 3RWFB 3KS0J 1ADQA 2D7OA 4RGNE 1DR9A 4NO5A 3SGEH 3CLFL 4OKVA 2BOCA 1CFTA 4BYHA 4ZXBB 3SOBL 1BBJB 2VDQH 4ODXA 3L3KB 1J7VR 4R4NC 3S5LG 3BDYH 2B0SL 5JPNB 4JFZL 3PJSA 3RIAK 1CWVA 1XGYH 4NJAH 4N8VB 4QRQA 5EBGA 5FCSH 2BOBB 5D71H 4M1GL 4X6BA 4F2MA 1JF1A 1OARL 2EYRB 3S98A 4Z7WE 1EJOL 4LDLB 1ACYL 3TO4C 5BW7C 3Q5YA 1H3VA 4HS3B 1ZT4B 3TIDA 2GT9A 4LKCB 4PG2C 1CI5A 1D3CA 4WI4A 4JEGB 3LDBB 3GSUA 3ZKND 5E6YA 4PPTA 4JGJA 5HHQA 2RIKA 5E08H 5D72L 3X14A 1NPUA 1NANH 2AK4D 4JZNB 3EDDA 1J9CT 2VLKE 2DOCA 5HGAA 1EHLL 1T0NA 1XFPA 4YPGB 1CQKA 3DUHA 3TZVA 1NC4A 1RUPH 4O58H 2FATH 4KC3B 3FQUA 4P9HC 4XBEL 2YSSA 1FYTD 5D7LE 4ZTOH 5K9QI 5A3IC 3NFSL 3T65A 5IR1B 4I0PC 5BS0E 4AIZB 3QEGH 1BVZA 5I8CB 5KW9L 4PTTB 5J6GA 3CLEH 2CUHA 1ETZB 3HE7B 1O0VA 3V79C 4XAKE 1A2YA 4H88H 2XXCB 1HINH 3ZSSA 3OXRA 5FK9A 3TBSB 1U95B 1C08B 2X89D 3QB7C 2NY0C 1JWMB 8FABA 2BRRH 3RX8A 2HJKA 2Z35B 1XR8A 4FFWC 5DSCA 2SEBA 4G6JL 3SE8H 1AQKH 4OCRH 3KPMB 3UCRA 2X5PA 3NABH 1KB5A 2AJSH 3VH8G 3SKNB 5J11C 1JCKA 4S2SB 1CD8A 3ISWA 4GQ9H 3ZDXE 2CH8A 1FG2A 4POYA 2NY4B 4PYHA 5E6ID 5I6XC 1P1ZA 2HT2D 3RVWC 5L2KE 1OCWH 4JLRB 1IC4H 3OAUL 4PREB 4PJFA 4OLZH 4XNZC 3VWKC 1CGVA 4KK8D 5DJ2A 2ILLA 1S9VA 1T7ZA 3TPUA 1D6VH 4K8RD 1KPVA 3RWDA 3PXHA 5FKPA 4FQ2H 1KPRB 2RAMA 1P4LB 1A6UL 1BFOB 5ISZD 4OZHE 5CEZE 5FM5M 2DL2A 5C0DA 3WFDH 4JQXC 2XYCA 3L5HA 5E7FA 2OXHA 4OB5L 1VFOA 2R2EA 4KJYA 2P5WE 1S7QB 5DJ6A 4LLDB 3FN9A 3MJ8A 3UTTA 3VXSB 4HLJA 1LO4L 4JRXB 1MLCB 4CNIA 3MPCA 4D0DA 4IMLB 4F7PB 1HH9A 2VXSH 5F9JA 1K6QH 3OB0K 3IXTA 4KHTH 3H7BB 1YMHA 4ORZC 1J05B 2ZUSA 5JDSA 1ZEAH 1U3HB 5CIPA 4CMHB 5DHYA 1WZ1H 2W9DH 3WUWA 2DQJH 4AG4H 2FJFA 2G60L 5GGRB 2F9BT 3TT1L 3A6BL 1OW0A 3PDOA 2GW5A 2VZ3A 4MAYA 4YZFF 4H0IA 4GH7B 5TPWL 3MCLH 5DVKA 1Q9OA 1VKXB 4JFXB 1ZV5A 3SGEI 5JIIA 5JXEC 3KYNB 3BKJL 3FQXA 3WXVH 2XWJB 5EPMA 5AD0A 3TGXA 2HH0L 4TYUA 5LVEA 5KTEL 4PJXA 4PJDA 1MRCL 5CINL 4NQVA 4X98B 3TNMB 1FLRL 4KAQL 5CSZA 3UO1H 5C0FB 3MROA 4WHCA 4JO2H 2AV1B 1FGNH 4H1LH 2XICA 3T4AB 3RGHA 1T1XB 1NEUA 3DSFH 1P7QA 4F9LC 4PLOB 1YY9D 4POZD 3ARBB 1R0AL 3HAEA 1IARB 5MENE 1F4XH 1BF2A 3QIUD 4NQDA 1HI6A 1ZA6A 1PZUB 4ZO9A 4G8IA 1D9KA 1NANI 4KXZI 1BZ9B 1M6OB 4LOUC 4P2OB 3PWVA 1DEEA 3ZL4L 4G9DB 2CLZA 2X1OA 5JOPD 1NEZB 2VRAA 5JO5B 1E4XL 5T3XH 4ZTPH 4JM2A 5GS0H 3U6RA 4E0RB 1FFPB 4PB0L 4Q2ZA 4P2RB 4LU5H 4CU7A 3W2DL 3G6JE 2CRMA 4EI5A 3WDHA 1LK3H 1FFQA 3E6HB 3QI9C 3IJYA 4LHJB 1F6FB 4IRSD 1KJ3H 5CGTA 1JPFA 3SKUD 3OKDA 4ZAKB 4W6XB 2GTWA 1IAOA 3CX5J 4XPHL 4PYGA 3SHSA 4MQTB 4YDKL 3VFWB 5IG7B 5CJXA 1X5XA 4DZBA 4HKZA 2Y06H 3LKOA 1BFSA 3EDJA 2E3VA 3S4SB 1RFDL 4Y5YA 2VXVH 1XF4B 3L5WA 3HUJA 5I0DA 4JDVB 4RWYH 4AM0B 3CXDH 5I0ZA 2HJLA 5DJCB 5I75C 3P40A 2WINA 1U8LA 5AWNH 2YD7A 4OCMC 3T09A 4KKBC 1BFTA 4XMKL 2FGWH 1I1AA 1IKNA 3LN4B 2F5BH 3PV7A 1OPGH 4MA7L 5IFJB 3RP1A 3WNNA 1DN0A 1T2QL 4X6DE 4G3YL 4Z0BH 2PCPB 2IADB 2A74A 1A5FL 3NA4A 5DEFA 1KACB 3KVQA 3O4LB 4LF3B 3UBXG 5IQ9A 4TUKL 5DA4A 3QUXD 1R3LB 4DAGL 2VZVA 2Q86A 3H9ZA 3JTTB 1Q1JL 1Q38A 3MRJA 2VXTH 1RZFL 1NBZB 4QHLB 1I1YA 4YHYB 3D1MC 5DTFA 1XGQA 4C56E 3UPCA 4HUUB 3RI5K 1A3RL 4HUNB 1A7NL 5ADOL 4PBXA 4QOKB 2FR4B 5EU6A 5FYKD 4UILH 1U92A 2W65B 2F54B 2ZOKA 3RTQB 2NY7H 4FP8H 1J1OL 1CT8A 4JFYB 1FL3A 1RZKC 4K8RH 4LPTA 3MREB 5EO0A 1I8LA 3EJYD 4JANA 3MRHA 3MRLB 3LS4H 4PJAF 4G8EB 2DLHA 4B7IA 4EI6B 5JLZB 1JGEA 4ZPVA 2IMMA 3MRGB 3C5ZC 3BMWA 3JWOC 3PP3H 5DRXA 2DIBA 3NIDF 1OGTA 3QZWA 2L0DA 2X44D 5IT2H 1CGTA 4MA3A 1IEAB 3MJGX 3MRIB 1P53A 2CDFB 4XHJC 5KSBA 4FQLH 2Z8WC 3RKDD 4KK9C 3W39A 4KGJA 3FOLB 1CLYH 4PJBF 4ENED 1U8NA 2AI0H 4R7DA 4OZ4B 4OLYH 4NYLA 3TBYB 3I50L 2AJXH 4KDVA 3MV9B 4HZLB 3ZKXC 5DJAA 1OTUC 3RU8H 2FHBA 4JB9H 5HDQH 4OUUB 1KEMH 3C2AH 3HG1E 2WIIB 1I1RA 5E2TH 1IGML 1RUML 5B8CB 5D2LB 4PJIE 1N3NB 4R97B 2IANE 5SWZB 1CS6A 3B8YA 1MUJA 2HTKC 5BCAA 4YHML 3OKEA 2JJWA 1TJGL 2OXGA 4TOYH 5C0GA 2NY2C 5C0RH 5CAYB 1RIHH 1LEGB 1JTPA 4QHMB 3U4AA 2PR4H 5F8RC 3Q6GH 1PX3A 1ODAA 4M1DH 2DJ4A 3QRFM 2B20A 1V5JA 3C09B 1DBMH 3GNMH 3KPNB 4WWID 1KTDB 3FT2B 4XAWL 3RA7H 5FGCE 3P73B 4NRYA 2OI9C 2Q20A 4LGSB 4M1CD 5L9DH 1QSEE 3MXVH 1UM6H 5EIQA 4LQFH 3QPXH 5FO8B 1QFWM 2J6EL 2PO6D 1T0PB 1AJ7L 4LK4A 1NMCB 4XI5C 3BYYA 4FQXD 4NZTL 4NWUL 5C71A 5I1EH 4OKVB 2BOCB 1CFTB 4Z7NF 5L88L 1WEJH 3MX0A 4IRJC 4YGAB 3U4BL 4XPTL 3FKUS 3KYKL 2XZAH 3BWAA 2L7JA 4ODXB 4ZUSA 1EUUA 3MBED 1JYNA 1EFQA 1ZTXL 1Q72L 1YY8B 3DMMA 3UTZA 3KPOA 4MYWB 3X3FH 3U7WH 5EDXA 2EYSB 2VLJA 5HI4D 1MFAL 4EOWH 2R9HD 4YX2H 4QRQB 1B88A 2FEEI 3UTSA 4XWOD 4X6BB 4F2MB 2GK0B 5IJKA 5JZ7C 1JF1B 4NT6A 3LVEA 2HT4D 4YBQC 4F3FA 3LQAC 1CDYA 2GT9B 4TSAH 5I1LB 3GSUB 2YA1A 1W8NA 5HHQB 4I8DA 3BH8A 1GGCL 3X14B 1MFBL 4Y2DB 4CVXA 1GGTA 5HVFB 3V5HA 5HGAB 1T0NB 5FGSA 4K3DL 3TZVB 1NC4B 3PG2A 4YHZH 1J5OL 5CS7A 1KJ2L 3DYMA 4GG8B 5E9DE 4ZOBA 4D0BA 3WIHL 1QQDA 1X5JA 1BJ1J 3VRIB 3A0OA 3T65B 2BSRB 4N8VG 5J6GB 3WEXA 1MRFL 1C5DA 4MAUH 1KELL 1N7ML 4JHWH 4MJID 3IDYB 3OXRB 2R69H 1MCKA 1RIVL 3N9GH 5FK9B 3EOAA 5AZ2L 4U1KA 2WUCH 1OSPH 3VFSA 8FABB 3FHQA 5DEGA 2HJKB 1XR8B 2ZUQC 2SEBB 3MBXH 4L3EA 2R8SL 3WV0A 5FYKH 1YQVH 1LD9A 4EKXA 1RZ7L 3QDGE 1MQKL 1HIML 4OBSA 2FL5A 3SDAB 3QISA 5JW3L 5C0BE 1FG2B 2PYEA 3SCMD 1P1ZB 2FX9L 4JZJC 2APTA 4PJFB 4R26H 4M6NL 1CE6A 5F9DC 3MYJA 5JIKA 1W0WA 3D39E 5DJ2B 4OZIF 1D5ZA 1S9VB 4P4KA 4JQIL 3H3KA 3V4UH 3TPUB 1KPVB 3RWDB 3ARXA 1MWAH 3KXFD 1VGEL 1IGFL 1XGUA 2DI9A 5FKPB 3ZDZE 5J4MA 3RWIA 3N85H 1MRDL 5DZLA 3BE1L 3H8NA 5D2NE 3V6ZA 5T3ZD 1X4YA 5CJOH 1R6VA 2P24A 5C0DB 2BNQE 3ILQD 3RVXD 2DB8A 2R1YA 1T21A 1SM3H 4Z7UA 2AABH 2MJWA 2R2EB 4KJYB 1N6VA 5DJ6B 1OD7A 3K4ZA 2ZPKH 3SGDI 4L8SA 3MJ8B 4IDJL 3UTTB 3FT4A 1VEPA 2DQTL 4NC1E 2Z92A 5H8DA 5JHDE 1JVKA 2H3NA 4GSDL 5F9JB 4XCNA 3BPOC 1HHIA 4K9EL 2ICEB 4HEME 2QSCL 5JDSB 2UZXB 5CIPB 4YXKL 3TBTA 3HC0A 3KPQB 1VGKA 3T2NH 3WUWB 4DKEL 2FJFB 1P4IL 1D9KC 1QG3A 1T5XA 4H8WL 3OJ2C 3PDOB 4GBXD 1B4JH 4P5TA 4MAYB 5IB4A 4BQ8A 4PRDA 2X6MA 2DI8A 2G9HB 1Q9OB 1ZMYA 2E27L 3QAZB 2Q8AH 2EEAA 5JXAH 3FQXB 3GSOB 4JPIA 4YDIL 5AD0B 1UCBH 4GXVH 3OXSB 1D5XA 5GRJH 2Z31A 4UTBH 4K94L 3KLHC 4N1EA 4YR6A 1CFSA 25C8L 1CDCA 3KPSA 4MXQC 4PJXB 4PJDB 4Z7OE 4J4PD 5CP3H 4TSCL 1G7JB 4TNVF 4NQVB 4JVPA 3ZTJG 1G9EA 3PP4L 4MGXA 4WW2A 1CICA 4PGBA 5CSZB 3TN0C 1F97A 3MROB 3VGFA 3DETD 2QKIA 2QQNH 2RCSH 1ZOXA 2NXZB 2W60A 2VNCA 4L4TA 3IU4L 4XTRC 5HYJD 3CLFH 3BAEL 3RIFK 3HB3C 5T33H 3HAEB 9CGTA 1XT5A 1QRNE 4NQDB 4OT1L 1NFDA 1HI6B 4HWEL 3SOBH 2BVEA 3QXTA 1ZA6B 3ZT5A 4G8IB 1EGJL 4U1NA 3CMOL 5D1ZC 2ESVD 2B7DT 4MWFA 4L5FL 3C8HA 5GSVA 2DN7A 3PXJA 3PWVB 2A1WL 3AS2A 1DEEB 1EZVY 1UQSA 2CLZB 4R4BB 5HDBF 3K0WA 3D0LA 3DI3B 4JM2B 3U6RB 1S3KL 3S3JA 4JFHE 4Q2ZB 1V7ML 2HLFC 4FFYL 1OARH 3VGGA 5IB5A 1F90L 2OLDA 3LEYL 3O3BA 4EI5B 1EJOH 3BP5A 5D1XA 1ACYH 3X12A 1JZ4A 4EUPA 3IJYB 2FZ3A 2FBJL 4U7SA 5I16A 1INDL 1NC2A 2EDRA 1J8HD 3DV6A 4UQ2B 1JPFB 3OKDB 1TVBA 2GTWB 1IAOB 5D72H 5B4MD 5F6IB 5TDNB 3H2WA 4A6YA 2ZZUT 2EH8L 5KVMC 1IE5A 3BX7C 4P9ML 3S34L 1QSFA 2HFGL 2Y9RT 4U0RB 1EHLH 2GK2A 4HKZB 1P4BL 4WDIA 2HJFA 3LKOB 3BP4A 1V3KA 3B9KC 4Y5YB 2D03L 4FFVD 3L5WB 3HUJB 4XBEH 4GRLA 1ZAGA 3ZT7A 2EH7L 3AB0C 3TNNA 1X6LA 3BUTA 2HJLB 3NFSH 3GFUA 3S7GA 5F9OL 2P5ED 1U8LB 2WINB 1HCFX 3ESVF 2C3XA 2NX5A 4YWGL 3PWPE 5KW9H 1I1AB 4FQIL 5CKAA 1E6OL 4XWGL 2CK0L 3HHRB 1DN0B 1AC6A 3N0PB 4LARL 4P9HL 2A74B 4PGCA 4UOW0 3RPIB 3ARDB 5DEFB 5IQ9B 4PJ8A 5E8PA 3RWJA 4ODUA 2OMBA 2Q86B 2VDLL 3M07A 3MRJB 4G6JH 2H6PA 4BZ1H 3ULVL 5L7XL 1I1YB 5IEKA 1U8KA 1JZ5A 1UXWA 1F4WH 4U1GB 5DFVD 3W9DA 3BZ4A 4X7FC 5IW6A 4NRZA 2IALA 1UYWL 4XPAL 4MB3A 5KZCD 1U92B 1KIUA 1XCTA 3IFPA 3GM0A 2WK2A 2HFEA 3OAUH 4PJGE 1FL3B 3D69A 4J3OC 3V4PL 1MNUL 2DLTA 4XP6H 2HWZL 3MRHB 2R0ZL 4DK6A 3QDJE 4KI5C 1RPQA 1JGEB 4ZPVB 1MIML 1GGUA 2ADIA 5JUEL 5IV2A 1UWXH 5DA0B 5DRWB 1A6UH 1OGTB 2VQ1B 1AI1L 3QZWB 3LN9A 3P4LA 1ZGLM 4NKIL 5JDJA 3BP6B 3MRBA 5KSBB 1K3ZA 1FZMA 3KHOA 4JFEE 4Y4HD 2PETA 4DOHE 3W39B 1T1ZA 3CCHB 1S7XA 4OB5H 5INDA 1FO0H 4XP4L 4NYLB 3P0GB 1I8KA 1Z3GL 3OAZK 4PJ7E 1LO4H 5CSBA 2HN7A 4PJHF 4IM8A 4NP4L 3UYOD 5DJAB 1IAII 2CJUL 1QSZA 3R8QA 4I3SL 4ZYKA 3L9RA 4O2CB 1T04A 4YNYA 3NIGE 3SQOL 2V17L 5IVOA 1GJIA 3LS5L 1RMFH 1BIIA 3O3AB 3WS6C 4GJTB 4LCWE 2XRAL 2O5ZL 1MUJB 2G60H 3TT1H 3OKEB 4HLZH 5C0GB 4W4OC 4TNWF 5KSUB 5TPWH 1C7TA 1X4XA 3ECBA 1S7TA 1F3RB 4Y1AD 4YHPA 5DC9B 1HKLL 1GGYA 4LPVA 3BKJH 2FYYA 3EAKA 3VRJA 2N4IA 1REIA 4N0YH 3UYRL 2EIEA 5IJKC 1A1NA 3QEQD 4NRYB 3GHBL 5KTEH 3GKWL 1MRCH 3VFTA 1HHJA 2FB4L 5CINH 1HQRA 3MLUH 3MRCB 3WLWD 4KAQH 4U1IA 5HHMB 1QA9A 2AVGA 2BSTB 4Z7VA 1YEJL 4MQ7B 1R0AH 4QRRA 5C08E 3EFDL 5SWQA 4Q6IA 3BN3B 5I2IB 3BWAB 1AGBA 1ZHNA 4ZUSB 4WUUA 3QG7L 3DMMB 3UTZB 4I3RL 2FHCA 3KPOB 1FIEA 3PWJA 2JIXD 4NBXB 3G5ZA 3ZL4H 3EDKA 4NCC1 1DVFC 2EDHA 4LNRA 3IYLW 3QJHA 4S1DD 2VLJB 5MEOA 2H9GB 1YEGL 3T2PA 5IOPA 3UTSB 1CIDA 3W2DH 4G9FA 4MJ4A 4XB8A 2C7UB 4NT6B 2X4NA 1KXTB 2ADJA 3T0EE 3SDDC 1WFUA 4NNYA 3MJ9A 4F3FB 5GS2D 2FCBA 5EH1A 4CU8A 3E8UL 2EDEA 2D3VA 3BH8B 5SV4A 4XPHH 1HWHB 3TEUA 4YDKH 3LHPH 1N64H 1YJDL 3U9UB 3V6FA 4PJCE 2V7NA 4UQ3A 2NTFB 4ZFZA 3V5HB 3FO1A 3EOTL 2VN4A 1RFDH 4NCDA 4ESKA 2XKNA 1OWWA 1PKOA 2JCCE 3OGOE 1CXFA 4MA1B 4D0BB 1VERA 2JF1A 1QQDB 2KL6A 1URLA 4H5SB 5HVWA 5K33A 3EO9L 1K4DA 1ITCA 4IDLA 4MA7H 3RGVD 2VXUL 5BQ7A 1T2QH 3TFKD 2YMXL 1ZHKA 1BJ8A 3WEXB 1C5DB 1TTFA 3KS0H 5IROA 3W9EA 4GG6E 1G84A 5DT1H 2IF7A 5F9WC 2VDKL 3IF1A 4TUKH 3AM8A 3EOAB 3BZEA 4DAGH 2EIDA 3VFSB 1Q1JH 5DEGB 1RZFH 3BPNC 1TXKA 2YWZA 4X5LA 4L3EB 5DURB 3QDMA 3H9YA 2DKSA 1F3DJ 5FOBA 1GC1L 5GS1A 1A7NH 1MHEB 3RZCD 2JKXA 2EDNA 4KJQD 2PYEB 4J8RA 1SEQL 4PRIE 4G6AC 1QVOA 5GGVH 1J1OH 4EIZC 4Z7WA 1I9EA 4P2QD 4M02A 5M95B 3UJIL 2YRLA 4JFFD 5I8KL 1MIEL 2UWEE 1JNHB 1CE6B 2APWA 3MYJB 1W0WB 4PGDA 1D5ZB 4P4KB 1U0QA 4HC1A 3F7QA 1QD0A 1XGUB 1DDHA 1RULL 3RWIB 3P9LA 1FGVL 2VLKA 5EC1A 1CGSL 3V6ZB 2E6PA 5LWYL 2P24B 1YQ2A 2YS4A 2AP2A 2LVEA 3L1OL 1T21B 3MC0A 5D7JC 4ONFL 5DQ9A 4Z7UB 2YK1L 3MRPA 1T89A 2AW2A 5D7LA 3SDCC 2DF3A 5EZIL 2IEPA 5HVHB 3FTGA 4P49A 3DRTA 4L8SB 3RI5F 4LRNL 5BS0A 3ARYA 3FT4B 2YOCA 2Z92B 1IGMH 3V7MA 1RUMH 3TCXA 2H3NB 1U9KA 3LZFL 3FQTA 4XCNB 1MEXH 4L9LA 1HHIB 5F8QC 5IB3A 4HJJL 1YNKL 3CMGA 3HC0B 2O5YL 4NQEA 1VGKB 4QNPE 5KAQG 1AQDA 1T5XB 4F9PC 2WP3T 4J2XA 3TM6A 5I73B 4P5TB 3VXRE 5IB4B 1ADQL 4WTXA 3MV8E 1ZLUH 4PRDB 4M6ML 4PP2A 4WGWB 3ARVA 2OBGA 2HFFA 1N5AA 4ODHL 1MCWW 4XAWH 1NGYA 2Z4QA 4E9LA 4JPIB 4XNQA 5L2KA 5CGYC 5IBTH 2MPAL 3O8XD 1D5XB 3MA9L 2Z31B 4HMCA 2CRYA 1Q9LA 1CQYA 4YBLB 4YR6B 3QIWA 4HH9A 4YLQT 1CFSB 3KPSB 7FABL 2W0PA 2OS7A 1PEZA 4RAVB 1L4IA 2PXYC 1E4XI 4WW2B 5F88A 2A73A 2D0GA 1CICB 4PGBB 1AJ7H 1D5IL 3CH1A 2V9TA 4HJ0C 4NBZB 3QIBD 2QR0A 3GBNL 1IJ9A 4Q6YA 5E8DL 3TPKA 5L88H 1CBVL 2YBRA 3WUWG 1HCVA 1NFDB 4NPYA 4XPTH 3KYKH 5IVXA 4JO3L 1ZTXH 4U1NB 4MWFB 3KJ4C 5GSVB 3DJ9A 4JHZA 3TYFA 1MCPL 1ZLWK 2MQCA 3F7VA 3VFPA 4YC2C 3B9AA 4OLVH 5HI3C 3CJJA 4LSTL 4NO3A 3D0LB 1CTNA 3SO3C 4Y5VA 1A02N 1TPXC 1N59A 5IB5B 4OQ1A 4CRPA 2XQYK 3O3BB 4RFNB 5D1XB 3BP5B 3C9NB 4GMSH 5EOCJ 3X12B 5T1LA 5BV7B 4EUPB 4DUXA 1BD2E 1QBLL 2FZ3B 3VFRA 5I16B 4R4ND 1NC2B 3DV6B 4JG0H 2M26A 1KJVA 5DYOA 4LPCA 4DGYL 4TVPE 3ULVF 3QHTC 1EO8H 1YC8A 1MFBH 4OD2A 5INCA 4A6YB 3CFEA 2W91A 3HA0A 5T1KD 3MR9A 1AGCA 3VG9C 3AMLA 1QSFB 4C59B 2JJTC 3PF2A 2NR6C 4WDIB 5DVMA 4K3DH 2HJFB 2CGRL 5CHNA 3BP4B 4KMTL 1J5OH 2BVUA 3FJTA 1JZ2A 2VLMD 1KB5L 3LKNA 1JGVL 4GRLB 1WFTA 3TNNB 3WIHH 1KLGB 1KEGL 5KVEL 2NX5B 3UP1A 3NIFE 3FZUC 3BPLC 1XEDA 1LO0H 1KELH 4TN9A 1N7MH 4LSQH 5DHVH 3TVMC 2X40A 5MENA 4ZS6D 4LKXB 5AZ2H 1OAUL 3V0AC 3IXAB 3Q2CA 4PJ8B 5E8PB 3RWJB 4ODUB 4ZNEA 4OF7A 4Z8FL 2H6PB 4H1LA 1SJHA 5A3ID 5IEKB 1H3PL 3DVFA 1RZ7H 1UXWB 1WV7T 1MFCH 2UV3A 4AQ1B 1MQKH 1HIMH 1A14H 4I0PD 3W9DB 3BZ4B 3O6ML 5IW6B 3ULVD 2E7BA 2IALB 2EDTA 5JORA 3MRKA 1MOEA 2FX9H 3IFPB 3RDTA 1UA6H 3G6JA 3SE4A 2XTLA 3SPVB 5FYLE 5B38B 3D69B 4Y7MA 2BERA 1DANT 2IPKA 2ED9A 2R1WA 5FDYA 1DUZA 4ZUWA 5LGKA 2Q3AA 4AQOA 4M6NH 1NGWA 1XCQA 2CLRA 4UOW1 1JPSL 3BGFB 3VXSD 4JRXD 4JQIH 2X42A 3VFOB 4TTDD 1P9MA 1IGFH 1TZHA 1VGEH 2ADIB 3EUUA 4N0CD 5I76A 1MRDH 4U6VL 3IAQA 3ARZA 5CEYA 3HZMA 2QTEA 2VWEC 1YMME 3MRBB 4X6CE 4MJ2A 1U3HD 1FZMB 1L7TL 1UGNA 4WI9A 1T1ZB 1VA9A 1S7XB 1HYSC 3GJFK 2O5XL 4NFBA 2FO1A 5HPOA 3VWKD 4JPWL 3O4OC 5INDB 4IRZL 2R23A 3AREC 4F8TA 1E4JA 4IDJH 5ITBL 1VENA 2DQTH 1IMHC 4ZYKB 1ZVSA 3H0TA 1DUYB 3L9RB 1DBKL 4GSDH 4NQCD 4YNYB 3LPWA 4JQVC 1BIIB 4K9EH 4JAMA 5DJDB 5IBLC 3HMXA 2VN7A 4DKEH 3IJHA 4UDUA 4H8WH 1X5LA 4Y4KA 4WTZG 3WSQL 4C56A 1Q0XL 3K46A 3ECBB 1S7TB 2JJVA 2APFA 2ZSWA 4YHPB 3OF6D 2E27H 4GS7B 2BHYA 4YDIH 3CDCA 2EZ0C 2E7HA 4WO4A 3S9DB 1A1NB 2Z8SA 4K94H 1YEKL 25C8H 5EUKA 3GSQA 5ICXA 3TP4A 1A7PL 1HHJB 4TSCH 4G8GE 1CLOL 1HQRB 1TQBB 1BVKB 1EFXA 1A22B 2Y5EA 3PP4H 4RAUA 2P48B 4FS0A 4WFFD 5F7DA 4U1IB 4XH2B 2K9UA 2XG5A 3TF7C 4K3HA 5FXCH 1TTUA 5CGMA 4P5MB 3GMOB 2N56A 5JXED 4KRPB 5TH2B 1QA9B 1T7WA 3MUJA 2NY5L 2EDKA 3IU4H 3ET9F 1RUKL 4JFOA 4P2RD 3BAEH 4Z7VB 3MZGB 4QRRB 2XQYG 4OT1H 4HWEH 5SWQB 4N5UA 4Q6IB 1EGJH 1X5FA 3CMOH 1QSVA 4WUUB 4EJ1C 1TZIA 1MCBA 2A1WH 1YYLL 3V5DA 1A8JH 3PWJB 3G5ZB 2OTUA 4ORGA 3HG1A 4LNRB 3QJHB 1G7IA 4PRPD 5MEOB 1OT2A 1RZ8A 4PJIA 5IROC 1S3KH 5IOPB 1V7MH 2IANA 4FFYH 1FFRA 2VO5A 3B9VA 1F90H 5DD0L 3LEYH 3VU2A 5CLWA 3PGDA 2ADJB 3VGAB 4NNYB 1AD0A 2FBJH 4HCRL 5D6CA 1FYTE 5F3BA 1HOCA 4U31A 5DF0A 3FT3A 2CMRL 3LH2L 2QLVB 2EH8H 4EQ2A 4LSRL 4P9MH 1RJLA 1PLGL 3S34H 3V6FB 2GI7A 2V7NB 2HFGH 4UQ3B 4ZFZB 4NM4L 1P4BH 5C0ND 1QSEA 1FC2D 5CJ8A 1BF8A 3O4LD 5DQJA 5EZLA 5F71A 4X7DC 3BMVA 2VAAA 2IGFL 3QI9D 4NWTL 4IOFC 1BMGA 5F9OH 5HYSA 5DD5H 2XN9D 4YWGH 5JW4N 5D2LF 1K4DB 4FQIH 3B6SB 4XWGH 4RGNB 2CK0H 5BQ7B 2AJYL 4UU9A 4LARH 4NIKB 3RTQD 2ATKA 4FN0A 1FRGL 1XIWC 4HPOH 2YUWA 4OTXL 1HSAA 3WNMA 3MV7E 2AXGA 4FTVE 2BP3A 3IF1B 3PHOA 4U6TA 3MLXL 3QXUA 3BZEB 3KJ6L 3VXUD 2VDLH 3HNSL 1NUNB 3ULVH 2ZG3A 1V3MA 4YHOL 3P2TA 3WN5A 4B7LA 3WLBA 4RMQA 1CLCA 2V5MA 4M9OA 4KKBD 2AGJH 4R4FL 2NYYC 5FOBB 5ITFA 5MHSD 1UYWH 5GS1B 1I1CA 4J3WA 4J8RB 4PRAA 5HTSA 3QQ4A 1QVOB 1U36A 3QHFL 1N4XL 1X5AA 2PN5A 4Z7WB 3V4PH 3SY0A 3UZQA 2HWZH 4LLUA 1D5MA 3PV6A 4MXVE 5DK2A 5EOCL 1T03H 5JIPA 3B3IA 3BEWB 4PGDB 1V3JA 1W72A 3OKNA 1MIMH 4IBLT 1S7WA 2BCKA 4K3EL 1CDUA 3U83A 5JUEH 2ZUWA 1AI1H 1AXIB 3P9LB 4U2ZA 2VLKB 5EC1B 5K9JL 4NKIH 4J6RH 2M8XA 5SWZD 3VMOA 4XXDA 3QIWC 1ZVYA 1MAJA 3MRPB 4ODTL 2VUYA 3W11C 1KLUB 5D7LB 5E9DA 4XP4H 3MRMA 5ACMA 5J3HD 3FTGB 4NP4H 3V6OA 3RX7A 5MEQA 1EIBA 2CJUH 4I3SH 5BS0B 3GRWA 4QRPD 3IGAA 1YA5A 2WV3A 3SQOH 4DEPC 1IQDA 1R3JA 3LS5H 3FQTB 4BH7A 2VZOA 4XHJD 4L9LB 1XR9A 4HGMA 1F2QA 5IB3B 4EBQH 3T0XA 2XRAH 4RSVA 5I1HL 4NQEB 3KPRD 2BHUA 5BRZE 2AQ2A 1NGZA 1AQDB 4LGPB 4FQHA 3HI6H 3QDGA 3IVKA 1HKLH 3JV4A 4WTWA 1OTUD 5SV3A 4IJ3C 5F44A 4PP2B 43CAA 2B1HH 5C0BA 5C2UB 2H26A 3SE9L 1NGYB 2BXZA 2Z4QB 3UYRH 5L2KB 1WWBX 4RFOL 2UVEA 3GHBH 4QLRA 1K5NA 1MJJA 2F53A 3VJ6A 1ZGLA 1FORL 3GKWH 4HH9B 4WFGE 1RZIA 2HTKD 3VI3E 2FB4H 3PL6C 5DMKA 2XACC 1MSPA 2NY2D 3AU1A 3KPPB 5F88B 2A73B 1N8ZA 1KTRL 1FCCA 4UTAL 4F8QA 5D2NA 4DGIH 5JOPE 3CH1B 4OZHB 5F7MC 1VFBA 1EXUA 4QHUB 5I66A 3QUKA 4RMUA 5EG6C 2BNQA 4BH8A 3EFDH 4DW2L 1BQSA 4IOSD 4MQSB 1RUAL 2YBRB 1S9WA 1BAFL 4NPYB 3MUHL 2P5WB 5C6WH 5E24E 3QG7H 2R2HA 4P4RA 4K71C 4QWWC 3OAYK 3DURA 1X5IA 4U7KA 3TYFB 5JHDA 5ESQA 2HMIC 3F7VB 3QQ9C 3VFPB 1YEGH 4NZUH 4XI5D 4NO3B 4LLYA 1MH5A 4PJFF 4Y5VB 3TZVD 1KULA 1NC4D 2F15A 1N59B 2JK5A 1DQMH 2OQJA 5KAQF 4TSBL 3BW9A 1NQBA 5I18L 2VR5A 5HDOA 4IRJD 5T1LB 1O7VA 1ZT1A 3DX7A 1ZGLP 3LQZA 1OGAA 4WI8A 2NY3C 1C7SA 2IH1A 5DC0A 2B4CH 3E8UH 3GK8L 5D6DC 1KJVB 5DYOB 4NN6C 4Q74A 1UFUA 4WI6A 4RMRA 4OD2B 5INCB 3CFEB 1YJDH 1ZVHA 3MTRA 5HYFA 1AGCB 1VACB 1WF5A 3GEWB 1RURL 1VFAA 3EOTH 4UNUA 4MS8C 3SE4C 2R0WL 3LRHA 5CHNB 4L8BA 5JZ7D 1GHFL 4OQTA 1IZKA 4FQJL 3FO0L 4OF8A 4UT9L 2D4DA 4L3CA 4YBQD 3LKNB 3WKNA 4P46A 5GS0C 2B1AH 3EO9H 4LRIC 1R3KB 2H2SC 1HEZA 5IWLA 3T3MF 2YMXH 2QQKH 3GGWB 4NC2B 4QY8A 2R39A 5CP3A 2H8PA 3KG5A 4MVBD 2VDKH 5MENB 2A6JA 2ITDA 4ZUTA 1G6VK 2DKUA 3HRZA 4OLUL 3NOIA 4NM8L 1DTUA 5E1HB 2FD6L 4MNQA 2X4PA 1S78D 4GKNB 1SJHB 1X44A 1L9MA 3SQBA 1GC1H 4NSKA 5E5UB 1FNGA 3NCJL 1SEQH 4U2YA 4PJXF 4U3XA 5GRXG 4PJDF 2VR4A 3RDTB 2VSCA 3G6JB 3DRQA 3GIVA 3UJIH 1T83C 5I8KH 1MIEH 1DUZB 5K93A 3OKKA 5DMYA 1NGWB 4NC0B 1XCQB 2CLRB 3KLSA 3ARGA 3SKMA 1EK3A 3ULUL 1MFDL 2OL3A 5ETUA 5F7FA 1EAPA 3M17A 5EZJA 1T6VN 1TZHB 2DQGL 1RULH 5I76B 1FGVH 3CU7A 1MVFA 1CGSH 5A40E 3K3QA 5LWYH 3NVQA 1F2XK 3CDYA 2B2XL 5DWUL 5KJRL 2AKRA 2G5BA 3TT3L 5E6IC 2YK1H 2HT2C 4U0QB 4YDLC 3MLSH 5EZIH 1SJVA 4MAYD 4ZO7A 3A6CH 2R23B 4PJAE 3PWPA 4KK8C 4EXPX 4JM2F 2ZWLT 1ZVSB 3H0TB 4XNXH 3PQYA 4U05A 4K8RC 4X6DB 3LZFH 3S36L 4FNLL 5IESL 3QWRA 4HJJH 4HWUA 5E00A 4MCZA 1YNKH 5CJBA 4JAMB 2AEQL 4AY0A 5EUOE 1CGYA 3FMGL 3IJHB 4KRLB 1UJ3C 3K80A 1SYVA 3O2WL 5FYJL 3DHJA 1BHGA 4PJBE 1PKQE 5BVPL 4Y4KB 3S37L 4C56B 1A6AA 2ZSWB 2L4OA 1J0JA 1UACL 3QJFA 4ODHH 5EN2A 3THML 1P7QD 4ONHA 1KGCD 3V9FA 2MPAH 3MA9H 3HUJF 2V9RA 4UIKH 4WO4B 1XF3B 5FDWA 1QR1A 4NO0A 4NQDD 3TLRA 1GGIL 7FABH 5EUKB 3GSQB 5FFLA 2PW2A 1NBVL 4FOMA 1D9KD 1VPOH 5CZKA 1EFXB 5ILTL 3L7EA 4Q7DA 2R1XA 4JHAH 4O9HL 2HVJA 4OSUH 5F7KC 2HKFL 2N7BA 5BV7L 4JM2D 4BELD 3HCVA 1D5BA 5DK0B 4JFOB 3GBNH 3FO2A 4JFEA 5E8DH 5KG9A 4ODWA 5KVFL 1CBVH 3K7UA 3RY4A 3CVHA 5HGDA 2WBJA 4MXQD 5FUCC 1K9TA 4A6YL 1KCKA 4U1JA 1UCTA 4PJ7A 3MYZA 1TZIB 4I5BA 4D9LH 5KN5A 2ICCA 3C6SB 3OB8A 4ZSOE 4BUHA 1HKFA 4LEOA 2E9BA 2OTUB 3V95A 4ORGB 5JA9A 5D96B 3T1FA 2AS5M 3HG1B 1G7IB 3S88L 3OHXA 2ERJC 1S8DA 5LQBL 1RZ8B 4PJIB 4XTRD 3WYRA 3LSOA 2GJZA 1VHPA 3FAWA 2IANB 4WI5A 1FO0A 4OF6A 1FIGL 2EDXA 5JMOC 3ALWA 3MRFA 4KPHL 2IAMA 3PGDB 4POZC 1AD0B 4OF0A 5D6CB 4RIRA 5F3BB 1HOCB 4XVSL 5SX4H 5EO9A 1IEBA 3C60A 3T4YA 3FT3B 4DGYH 5J13B 4F37K 2OM5A 1I1AD 2AAVA 2C1OB 15C8L 3SJVE 5KSBF 1OP3H 4RX4A 1RJLB 4XNMB 5EIVA 3I3DA 4UUJA 5FGCB 1QSEB 2CGRH 4MJIE 2HLFD 2N1KA 4ZS7L 4LSSL 4KMTH 5DQJB 2H1PL 5EZLB 3UTQA 2ZJSL 4Y4FA 3T3PF 2VAAB 1JGVH 1WIUA 4HK3J 3B8SA 5FF6A 2AJUH 5AAWA 1A64A 1KEGH 5HYSB 3QFDA 3VG0H 2A6KA 2MKLC 3KPLA 5EU6D 4WHYH 4UU9B 1GAFH 2ATKB 3D85D 1C5BL 3EGSA 1CL7L 3BFOA 1HSAB 1F3JA 1LQSR 2AXGB 1KT2B 4NNXA 3PHOB 3WHXA 4HF5L 5J89A 3RNQA 1KB9J 2NLJA 1HH6A 1IT9L 1H3PH 1HILA 2GJJA 3IFNL 3QUMA 5LKNA 3O2VL 3WN5B 5ACLA 3U7YL 3WLBB 2VYRE 1MI5A 1WVZA 5GRWA 3O6MH 1PZ5A 3DXAD 5ITFB 5ALCH 4NO2A 1ZE3C 5TQ2L 1M05A 5T3ZE 5ERWA 5A2IH 3V0WL 3QWOB 4PRAB 3QQ4B 1H15A 1RIUL 3HZVA 3G6AA 4M8VA 3T0EA 4FXLA 2Y72A 4ZOAA 1N0XL 1TJIL 4LLUB 1D5MB 1AO7E 2AQ3A 1JPSH 3PV6B 3O81A 5H35A 5DK2B 4HWBH 1YZZA 5ID0A 3B3IB 3T2QA 3OKNB 1W72B 2BCKB 5ADPH 1T1YA 4U6VH 5CIPH 1PY4A 1JGLL 1R3IH 3ARQA 4PJCA 3VXOA 4HG4K 2DBJA 1L7TH 4XMLL 2ADFL 3GSVB 1CN4A 4J1UA 4LLAA 1I3RA 2O5XH 4L29A 4JPWH 2JCCA 5E9DB 3MRMB 5LBSL 5ITBH 2XKUA 4XVTL 4I9WD 3MNZA 3I6GA 2XT1B 4BSVA 1H0DA 1I9RL 4OZIE 1CDIA 3S37X 1IBGL 1MJ8L 3PWUA