1PZBA

The crystal structures of reduced pseudoazurin from alcaligenes faecalis s-6 at two ph values
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
120
structure length
120
Chain Sequence
ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structures of reduced pseudoazurin from Alcaligenes faecalis S-6 at two pH values.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Electron transfer(cuproprotein)
molecule keywords PSEUDOAZURIN
total genus 31
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 1994-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1pzbA00
3NSFA 1XB6A 1SHXA 3FYIB 5PAZA 1M9WA 2DYSB 4A66A 1KCBA 1IKOP 1A3ZA 1V55B 3FSZA 1AZRA 4DPAX 2AANA 5I6LA 1XB3A 4YSEA 1NIFA 4E9XA 2QT6A 4E9VA 5I6PA 3N55A 2XX0A 2QPDB 1OOWA 2VSKB 4ENZA 1KCWA 3T6ZA 2GBAA 2FT6A 4DP4X 3WIAA 2UXGA 3FYEB 2IDUA 4DP2X 5I28A 1SFDA 1IC0A 3SBPA 2AZAA 9PCYA 1BQRA 1EZLA 2FQDA 1ASQA 1ET5A 5ANHA 4BWUA 1L9SA 5B1BB 4AX3A 4DP1X 4BWWA 3FU9A 1GS8A 1WA1X 1SFHA 3PXLA 1AANA 1VLXA 2DYRB 3NJKA 1AG0A 2FT7A 1AS6A 3IE9A 1CYWA 4GY4A 2BW5A 1HFUA 2OJ1A 6PCYA 4YSDA 1A4CA 3NT0A 1N68A 1SF5A 1L9PA 1ADWA 2XVBA 4BXVA 1NPJA 3EF4A 2VW7A 4YSUA 2X88A 3S8GB 1URIA 1GY2A 2FQFA 1KYAA 5B1JC 5I6OA 4YVNA 4TXVB 3ZIYA 4A67A 4KO9A 1WAEA 2FJSA 4FA7B 1BXVA 2E86A 2GC7C 2YXVA 2YXWA 1ZIAA 4KO6A 3NJIA 2HX9A 5I6KA 2YAMA 4E9QA 1WA0X 1L9RA 1PLBA 2HRGA 6PAZA 3ZBMA 3ABKB 1JZFA 4NAJA 4E9RA 2XV2A 1GYCA 2YAHA 4Q89A 1QNIA 1OE2A 1PZBA 3CG8A 1NICA 1IBZA 1QLEB 1J9QA 3OMIB 1JOIA 1KGYE 3TASA 2TSAA 2Y1AA 1IUZA 3T6VA 3X1EA 3UACA 3AG3B 2UXVA 4GP8B 5I26A 4YSAA 3WKPA 1SNRA 4YSCA 1KV7A 1IBYA 1OE1A 2JXMA 2IDFA 4QKTA 1BXAA 1AZUA 3FPXA 3H4HA 1NIAA 2DWSA 3FU8A 2IDSA 2MTAA 1JXGA 1AQ8A 1OV8A 3PAUA 4A68A 3BVDB 3GYRA 2J56A 4W9ZA 3NJGA 2BP8B 1TKWA 4KNTA 3TU6A 2EIJB 2J57A 4F7KA 2PPDA 5TK2A 3EH5B 1AACA 2W8CA 2FTAA 4P5RA 2YAPA 3L45A 2XWZA 1GSKA 4KOBA 4N4YB 2TSBA 4BDVB 2WO2B 2AVFA 3QJSB 1HAWA 2MRYA 1MZZA 2H47C 3FQ2A 1FFTB 4YSRA 3GDCA 1AIZA 3AG1B 4G71B 4YSPA 2YARA 4ZK8A 5F7AA 1NIBA 1A4BA 2B08A 4AZUA 4F2EA 2GHZA 4E9TA 2VN3A 3UABA 3UAAA 3WNJA 4DP7X 4YSQA 2CJ3A 2ZOOA 1NZRA 2QDVA 3AW5A 4G7RB 2YAOA 3MX0B 2GIMA 1UATA 2HX7A 4F2FA 4MFHA 4GP4B 1GR7A 5D4JA 3NJHA 4HALA 1WS7A 2BW4A 2BZ7A 5B1AB 5TK4A 1R1CA 3AG2B 3T9WA 3QJVB 4DPCX 1NTDA 4HHGA 1W8EA 1L9OA 3FSVA 1SDDB 2PP9A 1EHKB 2ZXWB 2XXFA 2OCCB 2WO3B 1FA4A 1W6LA 2FNWA 1KBVA 4BWTA 2XYBA 2AFNA 3S3DB 1JZHA 1OCOB 1OF0A 3QJTB 1YLBB 3FSWA 4AKPA 2HLEB 1J5DA 4A2EA 1J9TA 3NP4A 3D12B 2YAQA 2GB2A 2UXTA 3OMAB 3KW8A 1W6WA 1JXFA 2BP0A 1OCCB 2XX1A 3EH3B 3FU7A 1TEGA 1ILUA 5B1JA 2FWLB 4G7QB 3T6XA 1ILSA 5I6MA 2BO0A 1E30A 4YSOA 3DKHA 2FQEA 4A2GA 5AKRA 4AI7A 1J9SA 3SBQA 3QPKA 3U25A 1X9RA 1PF3A 4Q8BA 2R7EA 3JTBA 2NRDA 2X87A 3QJRB 3PAVA 1GS6X 1CC3A 2GI0A 1TEFA 2LLNA 2BP0B 2XLLA 4EF3A 1SHWA 2H5UA 3S3BB 3V9CA 3AG4B 4M4RB 1L9TA 5D4HA 3V9EA 3X2QB 3S8FB 1QHQA 1GS7A 1SF3A 3ABGA 4NB7A 5I6NA 2A3TA 1RCYA 3TBBA 3UADA 1NDTA 2HXAA 1PCSA 5B7FA 1I53A 3PLYA 5F7BA 1PZAA 4KOCA 3QJQB 4E9WA 5I5JA 3WG7B 3IN2A 5I5MA 4N8UA 1M56B 2PP8A 3ABMB 4HCFA 1JXDA 2DV6A 4DP5X 1SDDA 3NYKA 4X4KA 1AG6A 2EIMB 2IAAC 4BDVA 4HIPA 4KO7A 1WS8A 1PMYA 1J9RA 5A7EA 5E9NA 1PNDA 2CBPA 2P80A 1GY1A 4M3HA 2PP7A 2B3IA 4RH4A 1AZCA 1JVLA 3OD3A 1JZGA 1JZJA 1V54B 4GP5B 5B7MA 3PAZA 4DP8X 2GSMB 4YSTA 1ZV2A 4DP0X 1XB8A 4UAHA 4UF7C 1RKRA 3HEIB 1ETJA 3AY2A 2PLTA 2XXGA 5D4IA 3HB3B 2XV3A 4PAZA 1B3IA 2I7OA 1AS8A 4QLWA 2ZWNA 5LDUA 2I7SA 5EHFA 1RZQA 3CVCA 3SQRA 3KW7A 2Q9OA 2UX7A 2VW4A 1NIEA 3NSCA 3NJMA 1DZ0A 3ABLB 1PZCA 1ZIBA 1HAUA 4KNUA 1E67A 4YVUA 1TU2A 2CAKA 4UANA 2FQGA 3GXUB 5PCYA 2IH9A 1A8ZA 3RYMA 1PLAA 2WSDA 1ZPUA 3NJNA 3FPYA 4HCGA 4AKQA 1WA2X 1PNCA 3SBRA 2DY2A 2PPFA 1ZDSA 2R7EB 3WKQA 1KDIA 1OE3A 4CSZA 4JHVA 3ZDWA 4BK5C 4NERA 4GXFA 5I5IA 3PPSA 1BQ5A 4WKXA 2VM3A 2XU9A 4HAKA 1ET8A 5IY5B 1F56A 2BWDA 1AR1B 2BZCA 2IDTA 2W88A 2GC4C 5B1KA 7PCYA 5B3SB 1BQKA 2IWKA 3DTUB 2PCYA 1MZYA 2XV0A 1NIDA 2IH8A 2BWIA 1A65A 3EH4B 2PPEA 1RZPA 2JFCA 4E9YA 2UXFA 1ASPA 1MDAA 1AZBA 3EHBB 2YQBA 3UAEA 2IWEA 1BEXA 2BHFA 2I85A 4WTQA 3X1BA 4JHUA 1BYOA 4FAAB 4A2FA 2EINB 1M57B 1AAJA 1NPNA 2IDQA 1E65A 3ZX1A 3AZUA 4YSSA 4DP6X 3NSDA 2QDWA 1KBWA 4KNSA 3OQRA 4DP9X 3ASNB 3JT2A 3FU7B 3T71A 2HX8A 2HZHA 3C75A 2VMJA 4G70B 4G7SB 1PLCA 3FSAA 2PCFA 4G72B 3FQYA 1JZEA 3CVDA 3S3CB 3NSYA 1ID2A 1E5YA 3X1FA 4DPBX 1CYXA 3QQXA 2YAFA 1AOZA 2EILB 4L0PB 4JKNA 4K9JA 1PY0A 1X9UA 3DIVA 3TA4D 2JKWA 2EIKB 2Q5BA 3NJJA 4AKOA 2QPEB 2Y69B 1A4AA 1CURA 3ERXA 1NINA 2DWTA 1OCRB 5AZUA 2P80D 3CVBA 1BAWA 1N70A 3QJUB 4CSPA 2H3XC 2PPCA 1MG3C 3CZUB 3IEAA 2YAEA 1AS7A 3WNIA 2IWFA 3G5WA 4E9SA 3FS9A 4HZ1A 3H4FA 2CCWA 2AZUA 1V10A 1BXUA 2BP8A 3T6WA 1MG2C 1KDJA 5FC9A 1J5CA 4GYBA 1JERA 2CALA 3OM3B 7PAZA 3IBOA 1AZNA 2OV0A 4A2DA 1GW0A 3WI9A 1ASOA 3CDZB 1OCZB 1ZDQA 2J55A 3CDZA 2PPAA 3TBCA 1L9QA 2N0MA 2FT8A 3OMNB 1ET7A 1XMEB 1PAZA 4HHWA 4YL4A 8PAZA 4HCIA 1NWOA 5AFAA 1DYZA 4A2HA 2UX6A 2ZONA 3MBWB 2VW6A 4BXSV 2HRHA 2J5WA 1T5KA 3FT0A 1SJMA 3X1NA 3BQVA 1JVOA 1NWPA 3X1GA 4PCYA 2XUWA 1JZIA 1CUOA 3NJFA 5B7EA 3IN0A 3NP3A 3H56A 1BYPA 1FWXA 4P5SA 3UGEA 4W1TA 4KO5A 2VSMB 2VM4A 3FQ1A 3ASOB 3N2JA 2CUAA 1E5ZA 2RACA 3PCYA 3NJLA
chains in the Genus database with same CATH superfamily
3VUAA 3UYPA 1KIQA 4HJGB 5BXFA 2DI7A 1H8OA 3OAUL 1V55B 4OLUH 4XNZB 1RUPL 3DV4B 3LQAH 4GUQA 1SN5A 3C60A 2XICA 1MEXH 1F4XL 3B43A 4KDWA 4XNQA 4JS7A 5CFHA 4LOUD 1K2DB 5ELIA 3ZDYB 5E1AA 3RBSA 1FIGL 2BINA 3RWEA 2WN2A 1T2JA 1B4JL 2BVPB 1NFIA 2UXGA 2R0ZL 3CFKB 3A6CH 4D0DB 1AIFA 1ACZA 1NEZB 2AZAA 3WY2A 2MOGA 1JN6A 2VLRB 5GXBB 5JW4N 2EE9A 2EDFA 2DLGA 3HE6A 4PGBB 5F0MB 4BWUA 1EJOL 4Q14A 4BZ2H 1L9SA 4GIPD 1AO7E 3SB3A 1CD8A 4N6RA 2EE3A 4UB0L 1GS8A 2GITA 1SFHA 3HC3H 3SGKA 3ARWA 1KELH 4ICWA 4MA3B 2ZCHH 3IPEA 4I2XE 4JO4H 1L9PA 1ADWA 2VAJA 1ZXQA 4ODXA 3SE8H 4BKTC 4YOKA 4EXKA 3MMEB 2DN7A 4YSUA 2D73A 4MQTB 1KUMA 5EMYA 4O5LH 5B1JC 3PDDA 4M6ML 5AOKA 1QTSA 4JJ5B 4UQ3B 5I1GH 1XGTA 4H7VA 4NRXB 4QY8B 5D2LE 1BXVA 2JLLA 4MKMA 5F89A 1JGLL 5HTSA 2VC2H 3CDGB 4AJ0A 3WV0A 1K6QH 3FCTA 1W0WA 4PRHB 5GZOC 3WFZA 4TQ8A 3EYQC 1GZQB 1E6OH 4HFUH 3ROOA 4OCRL 1Q0YH 1TTCA 1A25A 4HWUA 3QFDA 1J48A 4BE6A 2AXFB 4I8DA 1MFDH 1F86A 2WLKA 4NAJA 4UQEA 2ENPA 4WCYH 3OG4B 4I85A 3KPMA 4KZEH 2E6JA 3UTQA 1KPRB 4P3WA 5CD5C 4LMQI 3FU5A 1KSRA 3P3TA 4LHUA 5GRVK 1JBJA 4FOMA 1YEGL 3GSOA 2Y1AA 2NT0A 2NY3B 5J11B 1UJTA 3N3EA 3GMPA 4HWBH 4BCXA 3BOVA 3MRGA 4NQQA 5ALCH 5D7KE 1MRFH 2W0KA 3R8QA 5D9SB 4M7ZB 1MWAL 3K6NA 4FHBD 4N68A 2FO4B 5FUOH 5GISH 5EBMA 1TVBA 2F61A 3INUH 3H4HA 3L81A 4YL9A 8FABB 4PM1A 3UJJL 4YXLL 1UWFA 2MMXA 4ALAC 4JL2A 3RWCA 3EDKA 4LIQE 1J0YA 1LLAA 3DV6A 3OTTA 4YN3A 1AQ8A 1ETZB 5TQ2H 3GJEB 4MKTA 4JPIB 2XXCB 2CE6A 4NJAL 1T7WA 5AKVA 3PWVA 4IEFA 2ZWLT 4CW1A 3BFOA 2XA8L 2ROYA 3QFJD 4N3TA 2AC0A 2JKTM 5GGSB 1KCRL 1I3UA 1HYSD 4PG9B 3ZQWA 2CPUA 3V4VA 5KN5A 3OAUH 3QXVA 3RGBA 4EKXA 3HHMA 4FI6A 1V7MH 2TSBA 5J9PA 4HUNB 5JIIA 1C08B 3IYLW 4XP5H 4XBEL 2WW8A 1IRAY 1FBIH 2QVKA 1NCAL 3DSFH 1J5OL 4G8EA 1JXKA 2R1WA 3N6YA 5IWLA 1TITA 2FWSA 5L2KB 4E68A 4MX7B 1A14L 3EJJX 1DDHB 2P24A 3WLBA 1MH5B 1VZIA 4E9TA 3U6RB 5GJTL 1JFQL 1MI5A 3MTRA 3HJ0A 4BFIA 4YDLC 4AH2A 2EEFA 4PD4J 5FO7A 4F9PA 1UATA 5K9QI 1Q90A 4OIBA 4D94A 1NGYB 3IJHB 5HYJE 1HXYA 4HLZH 5CZVL 5DDHA 1CXFA 4NO5A 1LEKA 4FNRA 4OF6A 5I71B 1QR1A 4OBRA 1QSFE 3V0HA 4X6BB 3FSVA 4IOFC 3BCDA 1JWUB 2PP9A 3GMOB 5JPMA 3E7JA 4AEFA 2YD8A 5AVVB 3J07A 1G1YA 1L9NA 3V6BR 1TCRB 2H9GA 2FZ3B 2RGSA 4N8VB 2YZ8A 3MREB 3N1PC 3REVA 2OXGB 2CSPA 3WO3B 3I75B 2C1PA 1O6VA 4HEMA 4MB3A 1TOXA 4GT0A 3US0A 1KYOK 3DROB 4P2RD 4TTGA 2NUPB 2ZUTA 4QOKB 5SX5H 4JK0D 2OL3B 2A1WL 3S3JA 1NGQL 1B9ZA 4WEBL 2ERJB 3VI4E 1B0RB 1J0JA 1M6UA 4MXQD 4XOEA 4MSWB 5DLML 2AKRA 3BQUA 3BAJA 3W56A 5C97A 4DESA 4N0CD 3QPKA 4PJAB 5KVFH 5EBLA 2X89D 1WF5A 2XT1B 4Y4KC 1A6AB 3ZHKA 3MNWA 2DQCL 2O5NA 4NENB 3GSUB 4FQXB 4AUUA 4DQOH 1FFPB 5H4YA 3BI9X 4NUQA 2FIRT 2NY0D 1YN6B 4IGBA 4FP8L 4ZOCA 3E6HA 1RK0B 2PYEA 3Q6GH 3INUL 2GJ6B 3NAAH 2Z1KA 2W0LA 5F7BA 4OZ4B 2G0LA 4MVBD 4Y2LA 1HXKA 2WBJC 3HAEH 3MUGB 3NGBC 4N8UA 3EOBB 3ABMB 3QJFA 3VI3E 5EO1A 4AYFA 4IOSA 1E9OA 1N18A 1JRHL 1B0GB 3U30B 3T0EB 4O2EA 4JQVA 1IE4A 4UOZA 3T1WA 3HR5A 2O5ZL 1FNHA 3L1OL 1MRCH 2E8YA 3EFFA 1PKQB 4FQIL 3ML9A 3WXWL 1A4JB 2ZOLB 3DTXA 5GRUL 2NY6C 1WFTA 4JRFA 3SCMD 2EDLA 4PJBF 5E9DA 4RRPA 1FG9C 3WDJA 2P47B 3KH4A 3BAWA 4Y1AA 4PJCE 2Y25A 1KGCD 1DL7H 5AL8A 2IPUG 2VABB 4OJEH 1AOHA 1RIVH 4U0RC 3QCVH 4JN2A 4TNEA 3T65A 3THMH 4PP2A 3C2AL 4JG0L 2B2XL 5GIRA 4MAUL 1AXIB 4G5AA 1GCFA 2I7SA 3VRLE 3QFGA 4W4OC 3T8MA 3MR9B 1JNHB 1VFOA 4YEFA 3UERA 1NJ9A 2Q9OA 1NCNA 1JNHA 4LEBA 1KY6A 3MUHL 4OIIL 2F6AA 5JA9A 1EMTH 2NW2B 4PTUA 1SQMA 4IRJA 3W11C 2NLJA 3QA3B 4Z7UB 4OZ4A 3KPOB 3WN6A 3VWKB 5AUMA 1JGUL 1SXBA 4FG0A 4DGVH 5B38A 1CFMA 3CN4A 3HMXH 4KKLD 5AOIA 2Z8SA 2NY1C 1XGPB 4YWGH 1G1KA 5HI4D 3SJVD 2F8IA 2RALA 3NJNA 4X6DE 3UDWA 1I8AA 5GRZA 3KLAA 2X44D 4G6FB 1OF2B 3CVHH 3TC9A 2Y7OA 3PHOB 5L9DL 3AABA 8CGTA 3M8OH 1FL6A 1OARH 4ZUVB 2GTWB 1QQDA 4KBPA 4TQPA 1FYTB 2PYFA 4KK6D 4CSZA 5JOFA 3G5ZA 5C0NC 3KR3L 5D6CB 1D7FA 3D30A 4XO4A 3P4MB 4ZO7A 4KUCD 3HG2A 1AD9B 1YYLH 2RIKA 1E2VA 3GBNL 2WLIB 2R4RL 4GAYA 1UFUA 4Q56A 5F0JB 1MIEH 3QJHA 4DVBB 5DK3A 1MAMH 2AJZB 4A7VA 4Y4HB 2IADB 4Z0XA 1LP9E 2BWIA 1A6WL 1DR9A 1KYFA 3QXTA 4N0RA 1G84A 5AW7B 4W6XB 3EGSA 3ZT6A 3S5LA 3LZOA 1N26A 1A6AA 1OPGL 2YPLA 3UTTB 4PRPB 5LCVL 1HDMB 5KW9H 1V3JA 2MQ0A 2AXJA 4P8QA 2PR9A 4GSDH 1NAKH 4TULH 5DJAA 4C55A 2I85A 5GZNC 3OJMB 5EBWA 4NQCB 3X3FH 4N2KA 2HLFD 4U7MA 3RB7A 3ASWA 4APQA 1NCOA 3GQFA 3NSDA 4PJ6A 4WHYG 4OTXL 4LPXA 4YK4C 3WEMA 3LMJL 4X7SH 1KBGH 2DLIA 2HVJA 3NRFA 3UPCA 5AD0B 1NEUA 2N01B 3TT1H 1ZHNA 2WWMD 3AROA 3MRPA 4ODWA 4WUKH 1NOAA 3QHFH 5ICZB 4JO2L 4UQCA 5ADOH 1U3HC 2A9CA 2OYPA 2X4QB 3JWNE 5EPMB 4TVSa 1SBBA 3RUGE 1IV8A 4G9DA 4UB0H 2WGNB 5I2IA 5LDSA 2JKJA 4P2QB 3ZL4H 1J0ZA 3K1KC 2DB8A 2ZJSH 4JM0A 4Z5RA 2PUQT 4QYOA 1LWJA 2ZTBA 3ESUF 2VDML 2SEBA 1S5IL 5HGGS 5KYNA 4P9ML 4AUJA 4YEEA 2WB7A 2BCMA 4LSRH 4GT7A 3U7WH 2OSXA 2W9EH 3IXTB 2WBJA 4QTIH 4OF7A 2KPWA 3E1F1 5IEHA 1E5BA 1CD1B 4PR5A 3CZUB 4HULB 5LWYH 5GGSA 1BZEA 1YQ2A 1PIFA 1FE8H 4ABQA 2MH4A 1I1AD 4EXPX 5IBLD 5IW1B 1XL6A 3QWRD 3U0PA 3L4VA 2DIBA 2CALA 2O5XL 1INDH 5CR8A 3VWJC 4K73A 4WDIA 1KLFB 3HFMH 4WUUB 3WD5L 1T20A 3JWDL 4RCAA 3PFQA 4J39A 3E1ZA 5I1KL 1MCCA 1GOGA 3DGGA 3ULAB 3CX5K 5I9QC 5FYKL 4DW2L 5J7CC 2FATL 3QUZD 4YO0B 4BFJA 5EWIH 3QXAA 2XTJD 3CZFA 4GQRA 4DHLA 4IKJA 3Q5TA 4U6YA 5DS8A 4PJHB 1WBXB 4PWKA 4BINA 5E4EC 2WZAA 4N0YL 3D2UA 1Q9WB 3K5RA 2KC0A 1SMOA 1PBYA 3P73A 4QTHB 5MENB 5GISL 4MYWB 5T5FH 4BUGA 4QTHA 1CU4L 1E9PA 3UO1H 4C83B 5H8DA 3OHXC 1U3ZA 4IK6A 4F3FB 1WT5A 5EEVA 4K3DL 5KEZA 4HXBL 3TBYA 5C08A 1IGIL 3MLWH 4J4PD 1BD2B 2HWZH 5DWUH 3VXMD 2HFFA 3FUMA 1E5AA 3L13A 4HBCL 5IMKA 3NZSA 5EU3A 3UAJA 4A6YL 3ZT5A 4NZDA 5AB9A 4HK3J 5D5MB 4AEHL 3H7BB 1EXUA 3BEVB 3VI4A 2Z64C 2WIIB 4F9LA 1AZRA 3GEFA 3B8SA 4XN8A 2WYIA 4LL9A 1MJJA 2X4PB 3VFMA 4X6CF 1I8KA 3FT3B 4KRNA 1OOWA 1QKZL 4QT5B 4P2OA 1WCBA 2HVJB 1C5CL 3BDXA 3QQNA 5AD0A 3VFUA 5J6SA 4BQ6A 5I71C 5LCVA 1TQUA 5ADOL 2BY2A 4PRDA 3VCLB 1OK0A 2FWOB 3SJVE 4PRDB 3VCLA 2XBZA 4EI6B 1JWUA 3WNNA 1IQWH 4ANXA 5DRNB 1IM9A 5BO1H 3EFDL 5KBNC 3V5KB 1ZANL 1DLHA 4P2QA 5C9KA 3KD4A 3AREC 4PJEF 3MA9H 3UO8B 3QNXA 4DNLA 2AJ3B 1KOAA 5INDA 3U2JA 3TFKD 3GSQB 5D7SH 4ETYA 4XNBA 1OKEA 1ZPLA 5D1XD 1IBHA 1MVYA 4AE1A 1SF5A 4LVNB 1CGUA 2W9DH 4A7GA 4BXVA 4LAJH 5IQ9B 4LP8A 1UGNA 43C9B 2FQFA 4JG1L 3CTTA 2FR4A 1Z9PA 3IRCA 5F9JB 3QC6X 4FA7B 2RR3A 1OCWH 2P8PB 1DQQA 5C08E 1BQUA 2GC7C 4NUMA 2XTJC 3X3GL 4HIEB 2OMWB 3KJ4B 2PYFB 1DQDL 4YAQA 1FHNA 3UYRL 4CAGA 5I6KA 2AQ1A 3LQMA 1R5IB 2IAMB 1L9RA 4L5FE 5KBMA 2G0KA 2R8SH 3MBEA 4MJ4A 3EADA 1FNFA 3DI2B 2A83B 4PJ5E 4HC1H 3WUWG 2OSLA 5KUMA 2BSBA 3GSNH 3VGBA 4PGCB 4WO0A 4C56E 4EUPA 3O4LA 4WRLA 3CN1A 4X4YB 4XPTH 1Q9WA 2H26A 4DQOL 5I18L 3V4LA 2YQ2A 4TQHA 2DTSA 4U6YB 3V4PH 1HZLA 5AYUL 3V8CA 2A6KB 1BVOA 4NQSA 1RZ8A 2RQ8A 1RY7B 4L4VB 3LV3B 3AG3B 4WGKA 5F1NB 1RMFL 1PQZA 1YMME 3R4DA 1S7WA 4NQCE 2NXYC 4H8UA 1IBYA 4YSCA 1H3XA 1T6BX 3EYUL 3NIFB 3AITA 5E5MB 4ZFQA 5IW6A 2Q7YA 1OP5K 4L5FL 4OKVB 3G6JA 2XPGB 1AGBB 4Z3EA 2MKWA 3WO4C 3S34H 4M3KB 5F3HA 35C8L 3MYJB 4L0YA 2VO5A 1AE6L 2QVIA 4UT6H 4L1TA 4FNSA 4N22A 1KCSL 4RQQA 1AKPA 3VXUA 3GRWH 5J89A 3DX6B 4N2EA 4PLJD 3U0WL 5E9DB 3PL6B 3D3VB 1TSHA 3MKGA 2BIMA 5CBEA 4H5SA 4KDTA 5AOZA 2FJGA 3O2VH 3ME0B 3MZTA 1A5FL 4PW4A 5DLLA 1FN4B 4KJWC 2WXIA 2FX8H 3QJSB 2MRYA 5DJXB 3TBVB 2JXMB 3OPZL 1NLDH 4RGND 2V2XB 3SPIA 3WEBA 1C5BL 1F18A 5IFJB 4CGUB 3CWGA 4J7RA 1IC4H 3DVIA 3FU0A 3B56A 1JHTB 5FYJU 5A7BA 2DQFB 2XQYK 3O4OB 1A9VA 4MCZB 4YSQA 2R2CA 4X6DB 4G7RB 3WFEL 5JUEL 4U1GB 2X6AA 3B7UX 4L37B 4YHZH 4JO1H 4ES9A 4HS6A 4AVHA 5DD0L 3WIHA 1TQBC 4MNQB 1IILE 4MZ2A 2QSTA 3EFOB 1WUZA 4QRRB 4YFEA 1L9OA 4ATTA 3MHZA 1GHFL 1IKFH 1D5MA 1QHOA 3WUWA 2OK0H 4KXZI 5F3FA 4FERA 2DIJA 3QQ9D 1OHQA 3APMA 3AXIA 3PHSA 3U2SA 2F74A 1M4KA 5D2NC 1N6QH 1CDUA 2FSEB 4WNSA 3QARA 1Z32X 5TQ0L 4LVHC 3DIFB 4JFTA 1RH8A 4U4BA 3RWDB 5K59F 2AV7B 2K70A 4YDVB 3RWDA 2K4AA 1UWXH 1RU9H 4E41A 3LPPA 1ADQH 4DVBA 4NENA 1CGVA 1MLBA 4UZGA 4BKLB 4DKAA 4EZJA 3DVGB 9CGTA 5FYLD 3RVVC 5DZJA 5IQOA 2DQUL 4B7LA 4FKEA 2ENJA 5C0JB 3QVAA 2CO4A 2COVD 3RWFA 1LYQA 2EP6A 2DMKA 2BSTB 3HHRB 3MNVA 4I18B 5DJ8B 4XO8A 5D70L 4FYRA 3L3IA 2EH8H 3JXAA 5TF1L 3TZVD 3OXRB 4JFOA 4XN9A 4KGJA 1B0RA 3FBKA 5BOJA 2WQWA 2ATPA 5IJKC 2BP0B 3VRIA 2O5YH 4DKDC 3HHSB 3QIWD 2BP5M 3V9EA 3S8FB 2I5YH 4HGWA 4IBTA 2FGZA 4A6YA 2VXUL 2X6UA 1EO8H 3PJSA 3V2AR 1NBVH 3QXWA 1HIMH 2I26N 3T0ED 3W9DB 1MRDH 1OGAA 1T3FB 3TNMA 3EJYD 2D4FA 4LKXB 4XMLH 2IALA 3DETD 2P5EA 4FNTA 1TFPA 2WV3A 3WFHA 5M94B 3EG9A 1OAJA 3MCLL 5FHBL 1DUYA 3HI6H 5DURB 3AGWA 4ZS6D 4BH8B 4IS6B 3S88H 3GRWL 4HIPA 1CZ8L 3Q8CA 4ERSL 3QUYA 3B1TA 5E51A 4DVRL 1GY1A 2FH8A 5KN5B 2NNFA 3BH4A 4BV1A 1N6VA 1UWGL 4G83A 4HBCH 2BNQD 2BVUA 1A7OL 2XQ0A 1KB5L 2XTLA 3A6BH 4UM9A 1XB8A 4R83A 2VXQL 3F7KA 4JKWA 4KVCH 3D87B 4LLUA 1T21B 1QA9A 4G8GA 1J9CT 2P49B 5G5DA 3T3ME 3GRGA 2FBOJ 3Q2VA 1EJ8A 4OZGB 4YE4H 3RZCA 3T0BA 1AZZC 2RJMA 3G5XA 1YNLL 4GBXC 2GK2A 1FLTX 2ZKMX 2W59A 3L3KA 4O51A 5FGBC 4DPRA 5C7XL 1UURA 5CP3A 5K9JL 5GQBA 4TLKA 1NUDA 2Z31A 3H9HA 1E28A 2WQVA 4UT9A 4RISL 3FW6A 3L9BA 4PW3A 2BSDA 4LSTL 3SIKA 4GRMB 1S5HA 4DW2H 5IFHL 1XH3B 3DX7B 5D7LB 4LDOB 4P9MH 5HD8D 2QLVB 1CBJA 1CFSB 3KPNB 4NQCD 2WXFA 4WWID 2IAMD 3FT4B 2R29A 4WWKA 2W92A 2EXYC 3O6LL 5FK9A 4LVEA 4MBOA 3S96A 4PJFE 3QDJD 1HESA 3LAFA 3V55A 5KYYA 3SE6A 5FWQA 4FZEH 3KPSA 3MJ9L 1MY7A 2JTDA 1VPOL 1QLRA 1O75A 4JRXA 3IFLL 2GIXA 1QI5A 3FO9B 1A7RH 5I5IA 2V37A 3H0TB 1RUMH 3EDDA 1TVDA 3UTSB 2C3VA 3L3GA 4HAKA 3BMWA 3QQ3B 4HXBH 2A74B 5E4AA 4ABVA 2VLKD 3S98A 4Q0XL 3NFSL 2Q0ZX 2OW6A 1DO6A 5EZJB 1MZYA 4FA6A 5EU7E 1URZA 3VO0A 1A65A 4RGNE 4DKEH 4IDLA 3QFDB 4MQ7A 3CFIC 1QPKA 1U8LA 2XN9D 3S5LG 1TZGH 2Q7AA 3Q5YA 3M1CA 4CU7A 3GSVA 1H8LA 3S3SA 3FF7A 2K0RA 3DSFL 3L95A 2YQBA 4OD1L 1BEXA 4R4BB 1RK1A 2QEJA 4MDJA 3O2WH 4LEXL 1FPTL 2A7BA 4ACPA 4KI5E 5BRZD 1H5BC 5E6YA 1PW3A 4OD3H 1WWBX 3VFUB 2VCOA 1KBPA 1GPOL 1UM4L 3QS3A 4JN1H 1BEYL 4DP9X 1UACH 2NNRA 5EO0B 2CRIA 5K93A 3MMEA 4MZ3A 2VR4A 4F7CA 1EVTC 3TA3C 1NCIA 2Q7NA 3DXAB 5EU6B 2F9BT 1BQHG 3E2HC 2A9NH 4N90E 1L3WA 2WCGA 3EYUH 5EA0L 5C0AB 1IGCH 4UAOC 3WS3A 4FXGB 2J6EL 5DJCB 3K8LA 3RWJA 2B1AH 5DMYA 4JFPB 4LVNC 1I75A 4Q2ZA 4FGMA 5T3ZE 1AQKL 2VZTA 4OCSL 5GS1A 3DI3B 2XN9A 4MJIE 2OSWA 4FJYA 1UQSA 4JM2B 2FL5B 3VX1A 4FNLL 2PW2A 4YDMA 2OTPA 2V9TA 1H0DB 1P4IL 3G5XB 4P3DB 1A1MB 3CVBA 3H2PA 1A7PL 3BAYA 3H9SD 1OB1A 3ULVC 3FT4A 5HGDA 4P2QE 5FDWB 5DHVB 2GEEA 3CVHA 1HHKB 5FO8B 3U7YL 5I8CA 3VFSB 1BMZA 2AJVL 4NCC2 4NWTL 1LGVA 3P9MA 2C9UA 5K9JH 4I48B 2PWGA 4U1MB 4DKFH 5KJRL 2H0PA 1MWAH 1J5CA 5JPMC 2ZP0T 3B6SB 1XAKA 1NC2B 1AZNA 3KPOA 4YZFF 1XTMA 4EBQH 5ECJE 5IFAH 5DS1A 3LKPA 4G1MA 4PWFA 2OMVB 3MV11 1CVRA 3BVVA 3MV8D 3QUMH 1OGTB 1V27A 4F2MA 3TBCA 2QFPA 4NP4H 1YA5A 1QVOB 2X4UA 1F3JB 5CHNA 4DZBA 5KVMC 1I9IL 3K91A 4HYTB 1RP9A 4UNIA 3I2CL 3D2UD 2VAAA 4K3JL 4R97C 4QIRA 4OGZA 3V6OE 3FO0H 2WVVB 1KEMH 1P4UA 4OV5B 5F7YC 1OPGH 3ABZA 2X6CA 4TL5A 4NBXB 2OJZL 5ALBH 4KAQH 3L17A 3L3OB 5JIHA 3A6CL 3S36X 3BUPA 2GYSA 2CIIA 3AQXA 3BQVA 4HGWB 4PVMA 1GGIL 1LVEA 2D31B 5B1CA 3ZU8A 3FUFA 4FQXD 3B9KC 2X9XA 2FYYB 5DMIL 1LO2H 1I7RB 2XUWA 4G42A 4NYLB 3E8UL 4NAMA 3TZVB 4ONHB 2YLHA 3LHPL 5D2LA 5LBSA 1DHKA 2FUQA 4GI6A 3TURA 3I6GA 4P23B 5HHOD 2WBXA 2CR6A 1FYTE 5J1AA 3ZPDA 4M6NH 5CZVH 1MXGA 2YPVH 2VZOA 2I69A 4P5MA 3ZL4L 2QL1A 4WW1B 3B8YA 2PTTB 1EFXD 2F53B 2WNGA 4OSUH 4YSEA 1KN4L 3IF1B 4R96B 1DE4B 2XPZA 2P5ED 4G7YH 4XBEH 3OLEA 4ADJA 3IJ9A 4I13B 2WINB 3HCVA 3TV3H 2QPDB 1K6QL 1MW2A 5F97E 1AD0B 5FM5M 1T6VN 1YPZB 4K7PH 3BDYH 1EO8L 2QV2A 3L3IB 5J06A 4OJFH 4QO1A 4KUZH 3KHQA 3SEPA 3HPLB 2XWXA 5E56A 3QBTB 2E6QA 3MXVH 4AV4A 5CCKH 3F83A 2XVKA 5C92A 4KZEL 4OY9A 5E8NA 2KT6A 4Q2ZB 4AXWB 2FBJL 1H15A 4ZQKA 3TBWA 5B7FA 5T1KD 3NJKA 3LEYH 4ILDA 3D05A 2ADIB 1L0QA 1NGWA 3CVIH 2N7AA 4JDEB 3LXAA 4JM2D 4OFYA 4FABH 4JDEA 5JHLH 2JJSA 4JFZL 3SDAD 3T0VA 5LGYA 4AGNA 5ALCL 5F7DA 4PV9B 5FYKH 3EF4A 5E8OB 3T3PB 1KJ2B 5D8JL 3L3JA 5GHWL 3RKDD 2CKBH 1GJUA 3KCPA 2PWEA 3IJ8A 3QZMA 3ZIYA 1BOYA 2OXGA 4X9FA 1HNFA 2CRMA 1F1GA 1JS4A 5CGYC 3JZ7A 5TQ2L 1RURH 2QSCH 3GSRB 2YXVA 5DJYB 1UB6B 1MHEB 1WFNA 3VQMA 2Y6SD 3UGXA 5A1AA 3L7EB 2J5LC 3PUUA 3FQTA 4L2LA 3VXSE 5HYQB 3EYVB 4ZQTA 4D7BA 3O3UN 3O9WC 5E9DD 1S78C 2CUHA 2HRGA 1SUHA 1MFVA 3D3VA 2OK0L 2JMRA 5AW8B 5KW9L 1JZFA 4P05A 1A64A 2QR0B 4LVOB 4GSQA 3HE6C 2DD8L 1QFWL 2Y06H 4QJ4B 3QFJE 5L7XH 3CC1A 1DJGA 3JUYA 3CH8A 4HPYH 5IFHH 1MRCL 1TETL 3WAKA 1OD7A 4BRJA 3ZTJG 1F90H 3W3BA 5T5NF 2K9FB 1F00I 3IJEB 4HJEA 4N90D 3W9EA 5JQ6L 1S78D 3WL9A 43CAB 4ETQA 5IHLB 4XP1L 3EO9H 4ETQB 1DL7L 2R0LL 2VE6B 2X0VA 1IX2A 2YHGA 4XBGB 1NCUA 1TQCC 1U2CA 1RJYB 1UM6L 1CE1H 5JQHC 1NIAA 4B9KC 3LRKA 2BFGA 1KPUA 1U92B 2Y9RT 3QCUL 4B95C 2KZ1B 2I9LB 1CFSA 3QH3A 5DZAA 3RDTC 4BSWB 3KDMA 1ACXA 5DK2B 5HI5D 1ANUA 3HMWL 1JUFB 2DEYX 1KJVB 5DK2A 1TVHA 4B60A 3TU6A 1QFUH 2J57A 5E5UB 3ZZQA 5C6WH 2ED9A 5AVWB 3V6ZB 4JG5A 2DJUA 4MMXC 5GRWA 3MRNA 3NH7H 4PRHD 1QHPA 4O2EB 3S2AA 2RD0A 3MCKB 2Q87A 2PN5A 3MLVH 2X1QA 4L4VA 3IWVA 4XNYH 2GY5A 3GIZH 4F7MA 1DQQB 3LVTA 2OMNA 2C9VA 5A2KH 2YARA 2A6DA 1BIHA 3GJFA 5AW5B 1J1OH 3WFCH 2QKIC 2Q8AH 3UABA 2MCMA 4OUOA 3SGEI 4LCCB 3K7UA 2WLYA 4XOCA 4MZIA 3IMTA 1CL7I 4QRPE 4XPAH 5I8CB 3MRLB 5HGBA 3BPLB 3QZOA 1M3IA 3LIZL 1EO7A 3ARBA 5KSAA 4OQTA 1YEIL 3T3PF 1WS7A 5FFLA 3SKOB 2WAHA 2DTMH 1L6ZA 1FJ1A 1YAZA 1U3NA 1P84J 1WZLA 1VGEH 5IQLA 4BH8A 4HJ0D 1QR4A 3FB5A 5B3JF 1RHHB 2NYYC 3JSSA 1R3JA 4NN6C 4WW2F 5D7IB 4NFCA 2BVOB 2EC8A 1KBVA 5KS9E 2M1KA 3STZA 1IBFA 4L3EB 3S3DB 1OF0A 3D50A 2NX5E 5KBPA 1I1YA 1L7IH 4JFPA 2XRAH 2WUBH 3ES6A 1JHLL 1DANT 3BP6B 4NHUB 5CJQL 4FQ1L 3V4PL 2DW5A 3FUJA 2QGCA 4JFSA 3RHWK 4O02A 5CEZE 4PG2A 1FYTD 2NX5A 3QEQE 4JCMA 5E2WH 4GRLB 3ZQ9A 5I30L 2BP0A 1T89A 4Y5XB 4E41D 1SHMA 1Q0XH 3QI9B 3FAXA 5CSGA 5AZ2H 1MFAL 1YQVL 2X40A 4GEIA 1FFNB 4AQ1A 2J88L 1MOEA 4TUKH 4A2GA 4HMDA 4OQTL 1GMIA 4P59H 5F21B 4N2LA 1N0LB 1RK1B 4MDJB 3U25A 4EAEA 4GSUA 1BBJB 4IRSD 4JKMA 3T2OA 3C6SA 1NGXB 4K07A 2PYEE 4PJ8B 3U0WH 7FABH 1U8IA 1VGKA 3SDXE 2XLLA 1P6FA 2IGFH 2EE6A 1G9MC 1NFDE 4LHJB 4BZ1H 4CC0A 2AAAA 2P26A 3F05A 2ZD0A 2J71A 5F6IB 4MNHB 4FXGC 5DUMH 2YZ1A 1RCYA 3PV7A 2XWEA 5DGQA 3U7WL 5L2KD 4JUSA 2NY3C 2YK1L 5D1QB 4F9LC 1YRKA 1QPPA 4HJSA 3DRTA 4AYDC 3GJFB 3I9GH 1X7TA 1RHFA 1ZANH 4HH9B 5C0AD 4EPSA 3LPGA 1YYML 1D5MB 3FN3A 4I0PD 4Z7WF 1F41A 2GTWA 5T5NG 4ONFL 1PMYA 2ADFL 4PJDE 4JM2C 4LGPB 4GBXA 1U58B 4UNUA 4WLCA 4HQQL 2P80A 1I8IB 2X09A 3LRSB 2XVGA 3ORJA 4M93B 1IKNC 2FYYA 4DP8X 1UWEL 4DP0X 2QGBA 3VMOA 2JCCA 3MV01 1P4IH 2YSSB 4FXKB 1ETJA 4GQ9L 2QHRH 3BUBA 3VFSA 3FO2B 4XGZA 2XXMB 2DQEL 4WK2B 2HT2D 3VXSD 1BGXL 5K1VA 1MWAB 1AS8A 3TCTA 4QLWA 5HVWA 3PP3H 5HJ3B 3PP4H 4YC2C 3NCYS 5EHFA 1RZQA 4GLRI 4PJCA 4N24A 4XR8C 2Z8VC 1HZHH 2FJFB 1UADC 3QUXA 2A1WH 1BQHA 2X6MA 3FKUS 3V10A 2SEBB 3RX8A 1IC1A 2YD1A 4YPJA 3KPPA 2ORBL 1FZJB 5CILL 4PB9L 4Z7WE 2ZKWA 3HG4A 1M3JA 2O5XH 1S9WA 4EDXB 1XR8B 3QORA 4A2HA 4OZHB 3QHZL 3U0PB 3KPMB 4K3GA 3STLB 4M29A 1V8HA 3SKUD 3GXUB 1P9MC 5SX4I 2DQHH 5DJCA 5JXED 4RWYL 1JZ3A 5A16B 3IJSA 2WPGA 5IB3B 2JK5B 3O2DH 4HCGA 1CLYH 5ESAB 4AK1A 3NQKA 4FFVC 5IW6B 2L8AA 1YEJH 1CFNA 3KGTA 4PTTB 2OI9C 1U9KA 3B2PA 5IESH 1RAMA 4IRZA 2WYZA 2AJXL 4WU7A 1PG7H 3VRLF 5JR1L 2KLTA 5E8DH 3VACA 1NGPH 2DQTH 3MJ6A 5IREA 3GGWA 3BIBX 4GKLA 1O7VA 2GUYA 2JKIS 3EG9B 3R19A 4BK5C 3LZNA 5E2WL 4N2AA 5I30H 3QI9D 4F91B 3PWNA 1X5GA 2XU9A 3A67L 1AE6H 5D2LF 4WI8A 1G87A 1VEPA 5C0FB 1PY4A 2F1AA 3QO0B 3UZQA 4EN3C 5AOMA 1BQKA 1KJ2A 1BG1A 5C0CA 2HTKC 4IGBB 1WTLA 3ULUC 3VD5A 6CGTA 4AV5A 4KI5C 4Y2DA 1W72L 4HGMA 5IMMA 3OR7B 4DGYH 4KTDL 4XPGL 3C5ZD 3CZKA 3DXAA 4Q9CA 5SX5K 2WTRB 3R1GH 4F15B 2XKUA 4ZUSA 3KXFB 1KGUA 1Z9SB 2NR6A 4GRLC 1X7QA 4XP9L 5IVZB 1IM3A 2HPOA 2JB5H 3HE7D 4RGNC 4F7TA 2NSXA 2I60L 1OSZB 3H3PH 1OTSD 3DWTA 4QHUB 3OJ2C 1F6LL 2ZUQB 1BFVH 3THML 4N1EA 4I18C 3B9DA 4U0RB 4ONOA 3NCEB 2FD6H 2P4AB 1QEWB 3JWOC 5TH2B 5IB1B 3WHXA 3DV4A 1JHKL 1WHPA 5BNXD 1JZEA 1XF2B 4X6CB 3SDDA 2KBGA 1IBBA 4M1DL 3LKOA 2FBJH 3MROB 5C7XH 2OR9L 2PTTA 5BO1L 4HQQH 1ZVHA 3ARSA 4L0PB 4K9JA 4NO3A 3RVTD 4LPWA 2JKWA 1KPVA 3IJYA 5E9AA 4JPWL 3GKZA 4X8CA 2EIKB 2CDEA 4JJHA 3P11H 5LN8A 4B96A 4ZX3A 2ZKHH 5B8CB 3BISA 5JPMB 4Y5VC 1A0QL 3VG0L 3MV7E 1OAUH 4OLWL 1FC1A 4WZ9A 2BCKB 5FCSH 2H6UA 2A6JB 3GK8L 5DJXA 3MR9A 3ZVVA 1MFCL 1G9NL 2Z65C 4GOSA 1YJDC 4CSPA 3UC0L 1FO0A 1RZ7H 2XJLA 4GXUM 1KULA 3O6LH 2P48B 1XCTA 4H20H 3RU8H 3WNIA 1TPXC 1CICB 2VRQA 1INQB 2ZCLL 1Y0LA 2R9HC 4GAGL 4NPYA 3VD9A 2WIIA 3VW3L 4N25A 4U1JB 2JWYA 4H0LC 4DK6A 4QOKE 1DDHA 5IEKA 2YEVB 1S9WB 1MCPL 2IBZX 1JMZA 1OGSA 1H9DA 4GRMA 2RMNA 3QORB 4A2DA 4LLWB 2R8SL 4S1RL 3JTSA 1Z5YD 1QASA 2J1XA 1M05B 3EYSH 4P5TA 3U48A 5FA3B 2J55A 3TJHD 3VQ1C 1L9QA 4HPYL 4NQED 4XZUB 5E8EA 4B3VA 3BLPX 1F3DH 2DJ4A 5D8JH 3TBTA 4E0RB 4JAMB 1CLYL 1ZLUK 3LKPB 2A73B 4FL4C 4N2GA 1EEUA 3BP7B 3QIBD 5AFAA 3GXNA 4ZSOB 4UU9B 4M3JA 1P5UC 3RUGB 5IB2A 1RUKL 2JIXD 5DEZA 3FTGA 3O4LB 4X4YA 1M2VB 4WKZB 2CGYA 2G3MA 1QSFA 3F7VA 3E6HB 2XIDA 4I48A 1U41A 5KANI 1RMFH 2NR6C 5E23A 4O5LL 3FK3A 5JMRA 3D4GA 2BDNL 2XRAL 3C9NA 5D1ZB 3X1GA 5LQBL 3QWRA 5C6TL 1YN7A 5C07B 3VFTB 4JFDB 1ZGLA 1IQWL 4KXCA 4LPCA 3I9IA 4L3FA 4W6WB 4JFYA 1XGRA 4JPQA 2APSA 3H56A 1FWXA 4LVOC 4P5SA 5F1NA 3QQDB 3EGDB 4ZD3L 2BP3A 4DAGH 4BGDA 4BIKA 3N50A 2BSTA 2L3BA 1ZA6A 1F90L 5TPWL 4KV5E 1P7BA 4L23A 3WLWC 3Q8EA 4ZZFA 1FNSL 3FYIB 5F6HJ 2EDBA 1FFOB 1M9WA 3UYOD 2QMKA 2YRPA 5IT2L 5MEOB 1A5FH 1GIGH 4KRPD 4DPAX 5C3TA 2EDTA 3N40F 1BFOA 3QE5A 3P4OA 3OB0H 1NIFA 4IJTA 3F04A 2KKQA 1DSFH 1QUPA 2DQJL 1KF9B 1MFNA 3MNWB 1JMXA 1WH0A 5CGBA 1DBBH 1X5LA 3CQPA 3L5XH 4N0FB 2AXWA 1YMHB 4RRPG 1Z1WA 5B3NA 4QY8A 2Y1VA 3N04A 4F7TB 4H1LB 5IVXF 3VFWA 4XN2A 2XQBH 2WP3O 3SZ6A 2EVJA 2WXJA 4PCTA 3SHSA 4PBDA 5I0XA 3AT0A 4BWWA 1WA1X 2JQAA 5IMMB 4U7KA 5FO2A 4AC2A 2N59A 4F57H 2ZKHL 2Z7ZA 1MREL 2HJLB 3DPBA 4KPHL 4CADB 1DBJH 2HJLA 2ODIA 1A4CA 1CJYA 3HN8A 1N68A 3ES6B 3QDME 2EH8L 4OFVA 1MJ8H 4C56D 3F7LA 3MI6A 5JOEA 2EABA 4I9WD 1K4DA 1VADB 4UCFA 3HLKA 1TO4A 3S8GB 3NIGE 1IC5H 4CMMB 2AF2A 4H88H 4OCXH 3OGCB 5T5FL 5E4EB 4CJ1A 3KYOB 2YMXL 1PG7W 4GMTL 2X4RA 2HT4D 5AVXB 3VI3B 4WW2B 2YAMA 4I3RL 2Y2WA 5KBDA 4YR6B 2P5WB 3DUSA 4CC4A 3DNKA 3VJ6A 1Y1DA 5FK9B 4YFDB 1QFOA 5GS0L 1JGDB 5F3BA 4GG6F 5DVNA 3ARUA 5DEGB 4QF1A 4QRSB 5ESQA 3LSOB 5HHOA 1ZLUH 3P73B 5TFSL 4ZFZB 1UC6A 5MENA 1G7MA 1AQDA 1NICA 3NA9L 3DSNA 1ZTXE 4PV8B 1OAKH 5ANMA 5HGAA 3ULVE 3ZDXB 1AP2A 3MLTA 5EEXA 3P3SA 4JN1L 2WQXA 1SXNA 2ZSWB 1NBYA 3LNEA 5EIIB 4PS3A 5HHNA 4EKJA 2UXVA 1CGYA 1JK8B 3BWZA 3M7OA 1B2WL 4WEEA 3QUHA 2E7HA 3JWNH 1DVYA 2YWZA 4EN2A 1AZUA 3CSPA 3VE0B 1YJDH 4MCYA 1IIKA 1FVDB 1TLMA 2ID5A 2CRZA 3HTLX 5IBUB 2HH0H 3ILEA 1YNLH 3FONB 3TEWA 2P5WE 3LNGA 2J56A 4PJ7F 5GGTL 5C86A 2X4TA 4M61A 2HA1A 2CXKA 4KUZL 4XCYB 2B1HH 1O6SA 1QPXA 4IRJB 3DUSB 5H37G 1NOLA 1GSKA 3VGDA 4KOBA 1B90A 2X2UA 3AMKA 1ZHKB 4FQ2L 4YAQB 4LCWB 43CAA 1ZT7B 4PJEE 2H47C 5LXGH 3RL1A 2W9DL 1HC1A 3OAZH 2HFEB 2ITDB 3F65A 2DIAA 3C2AH 4HGKC 4QOKD 2DL9A 2VLKA 3BT0A 5E6ZA 3FU3A 2R56H 4P5KB 1IJ9A 3I9GL 1ORSA 2X9WA 4OJDH 1XGUA 3CFQA 1WVZA 1X5JA 1AJ7L 4UDUA 4QXWA 1EMTL 1PFCA 2AXFA 3O9WB 4R8WH 2OR7A 2QR0A 3TVMD 2AJ3A 2VXSL 5D4JA 1R3KA 5D5ME 4PJGA 2BW4A 2QPFA 4YUEH 4BZ2A 3ZDZF 5DA0B 1TJHL 1U4FA 4JUTA 5FYJL 4RX4D 4MA8L 3BKCL 3BSZL 1G1CA 5F9AC 3WJLC 2OCCB 2YUXA 4PRIE 1I82A 4ZNEE 1A3RH 2ZYSA 2EYTA 2P8PA 2XYBA 4KY1L 4G6JH 3BKYH 3IDJA 5A2FA 1JZHA 1H9VA 3WY4A 1HIML 5IHZA 1YLBB 4WNQB 3F12A 4N2CA 3L16A 2OJEA 1GGIH 2IPUK 3K3QA 4XHJD 2HLEB 3JWNG 3SDDB 1BVNT 2R2BA 3QCVL 4TVPE 2EH7H 4XRCA 2IMMA 2Z4QA 2Q3AA 4NZRH 1B2YA 2I32A 3IDNB 4BK8A 4ZFFB 2J4WL 2DWEA 3MRBA 1L3NA 1MLCB 4FTVA 3VG9C 3DXAD 1FC2D 3G6JF 4OGYH 4ZTPL 3MRDB 1KJ3H 3O3DB 4QRUB 1OSZA 3WELA 4KKCD 2APVA 4ZO6A 4ZAKC 2DH2A 4I4WA 4XP6L 1RERA 3CFKA 5EF1A 3JTBA 3OVUB 3AB0C 3QJRB 3RILA 3D4YA 3FN0H 4QGTA 2GI0A 2LLNA 3H9YA 5TF0A 2CO6B 5ICXA 1SHWA 3ALWA 4HS6B 2DM7A 2IADA 4Z0XB 4LNRA 4C8XA 5KVEE 2AI0H 3ABGA 4MMYB 3SCMC 5I6NA 5FLVA 3NDYE 4LHUD 3V52L 1NMAL 2J8UA 4NSKB 1KV3A 1UYWL 4NKDB 3WXVL 1X5FA 4CMHC 3QJQB 4BQ8A 1JPEA 3MXVL 1UD8A 3TBTB 4LLQA 2O6CA 3ISYA 2A74C 2J3SA 1CVSC 4UOQA 3GSNA 3BDBA 2Y2YA 2V2XA 4DP5X 4KTDH 4XPGH 2R4RH 4X9HA 4Z7QF 4YHOH 3HBQA 4JZOB 4ZPTA 4LOVA 5I5RA 5IF0B 4R7NB 2R15A 4FFZA 3TBYB 2NYYD 4LLDB 2WWKT 1CYGA 1H3GA 1OAQH 4GP5B 5B7MA 3ZE1E 3NCMA 2IG2L 3QULB 4F8TA 3L3OA 2AQ3A 4UF7C 2CMRH 1RKRA 3CQFA 1MCNA 1LNUB 4Q9BA 4I3GA 4AQEA 2XHNA 2YEZB 4S10A 1EGJA 1A22B 1W0VB 5DJDA 3MRMB 3AVEA 5DS8B 5INCA 2V8LA 3VE0A 4AYBA 4R6UA 4JRYB 4XZUA 3LQZB 1U93B 5DTFB 3RX7A 5GGUA 1AVAA 4TMPA 1AC0A 3GSXB 4Y0GA 3ABLB 2DQUH 4XN7A 4L18A 1E67A 2WQAA 4JZJB 4B9YA 2XWRA 3HN3A 1FUNA 4GNKB 4MNQE 4XCYA 2EEDA 4XMPL 4Z0BL 2GJ6A 2EYSB 1TETH 3B6SA 5HDBE 4EUPB 5IUSA 2VR7A 4X6CA 4Y19A 1ID5I 5TF1H 3LKRB 5I24A 2YUZA 3WS6C 5IW1A 3BD5A 1ETZA 4QI3A 3HB3C 1VZGA 2R69L 1L5GB 3HBPA 1N5AA 1L6PA 1RUKH 3FQTB 5HYQA 4UOW1 5D2NE 1CDIA 4IKNA 3CFCH 4X5PA 3U6XA 3QPXL 3ARGA 3CMGA 4KI5D 3T1FA 2Q6WA 1UM6H 1IEBA 2P5WD 1OE3A 1ZAGA 1U8NB 3MBED 4PD4K 2I9TB 3O3AB 3VWKD 3DK2A 4IGBD 4NERA 4GXFA 3PPSA 5JHDB 1BQ5A 3IFOB 4QAMB 4X7FC 1DCEA 4RDBA 5D1QA 5IVZA 2GY7B 5IY5B 5IWLC 1AR1B 3LIUA 4ODTL 2QQKH 3QNYB 3RVUD 4GMTH 4Y16D 4OCLC 5K5YA 4QHNA 1M6OB 3LN5B 2E7CA 2JI2A 3RIFK 3NZHL 1E90A 4LCVA 5T3XD 1J12A 5CR1A 4I87A 4LSUH 1UD5A 4QXUL 1OAZL 4R97B 5IUCA 4K23H 1NGXA 4FX5A 4N5EC 5IB5B 3V0VB 4B9GA 1IFHL 3TEYA 2OXHB 5T3ZD 4QMEA 2YPKA 4G3YL 5H2BB 1MJUH 1QBMH 3VI3A 1GGCL 5GS0C 3BQUD 3P4MA 1G6VK 3QRGL 4WTQA 2NXZD 4Y5XC 1UXMA 3TIDB 1NPUA 4MXVF 2FSDA 3O9WD 1E65A 4RGMC 2DDQL 4Y89A 3IU3B 3S5YA 5KVEH 4RAUA 2Y1YA 2NNXA 4JCWA 4F37F 2J72A 3L5JA 2AK1L 4ZUSB 3HI1A 1HSAA 4YE4L 3L3OC 1WGOA 4IHOB 2QJDA 3L3DA 3T71A 3DOSB 2B5IC 4PY7B 3FT9A 4P2QD 2PWFA 3FRUB 1F58L 2EC9T 5FUZL 1WFMA 5DA4A 2W80C 4HLZG 4YHOL 1JGLH 1SBSH 2O93L 4UDUB 1CYXA 4MNGB 3EAKA 3WMSA 2VSDA 5A6IA 3QQXA 4ALAL 2BFVL 4G80A 4M1CC 2V2TB 2ZZUT 1ZA3A 1TPXB 4HJJL 2L0DA 4RRPM 5EULV 5GGTH 4B97A 2VMDA 4JM4L 1FYHB 3BSGA 5AAMC 4AENB 5E7BA 5DT1H 3UTSA 4KJWD 5B21A 4G8EB 4BCYA 4NHCL 1DVZA 4JO5A 1TIUA 1Y18B 5EO9B 3AWEA 4Z3HA 3L9RA 1WISA 1CDGA 3IJ7A 3IXAB 1MDTA 4AZ8A 1AYOA 1HN1A 3MACH 4HFWB 4KHTH 3OKMA 4GFTB 4XXWA 3SY0A 4TL4A 2YN5A 3DDFA 2CD0A 4UM8A 2VLRD 5JR1H 1DQIA 1BM3L 1BMGA 5DZNA 3S37H 1EPFA 3H42H 3GWJA 5KSBA 2Y3AA 3H55A 4M62L 5H35A 3C08L 4L3CA 5GS0H 3QEUA 4L8SA 1BF2A 2AABL 5J1SC 1ZA6B 1F3JA 5CHNB 4RFNC 3POCA 1MQKH 1TNMA 3NRQA 2E4FA 1C08A 1G6RA 2AEPL 5D1XA 3JQOB 3Q5OA 5SWQA 3SE9L 4YMPA 4GRWF 4XPTL 5EC1B 1TUPA 1P5VB 3EBGA 4K3EL 4HHAA 4OGAD 1WZ1H 4N2DA 5DC9B 4OZGA 3RZCB 1T5WA 5EUOF 4MAZA 3TYGH 3LEXB 3KXFE 3QUZA 3BKMH 4KK5C 4ZOAA 3G5YA 4YFLI 1NC4D 1DJWA 1Z9MA 4HS8H 4N2MA 2BSSB 1JPTL 4F58H 4BXSV 4G6JL 1X5HA 4NPYB 3CVHB 3DBSA 4QWWD 1FVEA 1IGYB 4FMFA 3VXRB 1AXSA 5MI0C 3U82B 2C7FA 2A38A 1DVTA 1G7LB 4G7VH 3X17A 4ZMWA 2VZ1A 2BOBB 1KCSH 3HI5L 2H45A 3GTNA 3MRQA 5CS7A 4JRWA 2ZG2A 4W1TA 5FA3A 2J4WH 4KO5A 4NGHL 4PGEB 1LK3H 3V5DB 5FGRA 3N2JA 4K5NA 1ROWA 4OZFG 4Z77A 4I3SL 1PZCA 4FJ6A 1S7QA 2AXHA 2IO5A 3QJFB 1SHXA 2WLMA 4FQ2H 1MJUL 1QBML 3GSNL 4M02A 4ELMA 1U2YA 4NLHA 3WS3B 4HWBL 15C8L 5AYUH 5I6PA 4BKSC 3ZR5A 4ORGB 1DLFL 3FRUA 3MLYH 3MSPA 3WFBL 2EZ0C 4IHOA 2F7RA 5IJCC 1PX4A 3PWLA 1CT8B 1S3KH 3Q06A 2CKNA 3IKCB 2CJUH 3MCYA 3WSQL 2AJVH 3DA0A 1SY6L 1B6DA 4J27A 3ARFB 3P4NA 4OVVA 9PCYA 1T03H 1RZIA 4WHCA 4Z8FH 3DVGA 1HHIB 2R29H 2CHXA 4Y5XA 5DMJB 4DF9A 4JNXA 3PXLA 1TQSA 1M7IA 1N8ZA 5F7DB 5HVHC 4TUKL 3MLRL 3Q9QA 2NTSP 4LKCB 4AJYV 1NANH 1KGJA 2R56L 1C7TA 1O5DT 1OAQL 3T6QC 1KTDA 3IDGB 3IFNH 1JPGA 1NCWH 4AQAB 2BS8A 2XETA 1FL3B 3L3HA 4QTFA 5C0CD 4JFFE 1J1PL 3EJRA 5L4JA 1XF4A 1RLBA 3WJMB 1MHHB 2GAZA 4B27A 1UH4A 1ZIAA 2NTFA 3QEGL 1EX0A 1M2OA 2ZP9A 5FS5A 3MCKA 4HKJB 5FB8B 4KQ0A 4GAFB 4BQBA 4EIGB 3KPRE 3KYNB 3NTCH 4OV6F 5BV7H 3C8KB 3BPLC 1EH9A 5DI8B 2HRPH 3RGVB 2RFXA 4IQHA 4ZW5A 2RHEA 3TESA 4LDEB 1VENA 1QLEL 4NOFA 3CIAA 1NFDB 1TU2B 4MD0B 1QNIA 5DMKB 3NCJH 4H1LG 3EHBC 2XG4A 2EDDA 3SPCA 1R5VB 2I60H 1PZBA 3KYMB 32C2B 3LKNB 1HL8A 1SXSA 3RY5A 2O5YL 3HAEA 3RWCB 3FTUA 3UYPB 3BP7A 4JZNB 3FB6A 1VFBA 1YSOA 1A14H 2ZSVA 1IUZA 3T6VA 4ZUTB 3GPSA 3X1EA 3TBVA 2H1PL 1YNTB 4P07A 4Z7OF 3GRBA 5MEQA 2IDFA 3VG9B 4OGYL 4QRRD 2EDKA 3RWHB 5C2BH 2UUDH 4PGZA 3E2HB 1XR9A 3QEHB 3ZW3A 2R0ZH 3VXPB 1G9EA 2DWSA 2HJKA 4BA8A 4BZ1A 2Y6SC 4PSPA 1KJVA 5I1LB 3RZCC 1EJFA 2N7BA 5MHSE 3H53A 3QI9C 3UTQB 2WJ7A 3GM8A 1QMUA 1PS3A 3OHXB 2V3FA 3MA9L 4MGXA 4N8PA 4FKKA 3BESR 2XQYG 4J3SA 2X7LB 2DM2A 1B3JA 2XWZA 4DETA 5KAQG 5CWSB 2BIQA 2AVFA 5ITFB 4NBZB 4U3XA 4XVSL 2VLRE 4QGYA 1LE9A 1FFTB 4N28A 1R33A 1G4MA 5L2JA 3T3PE 1JK8A 1EAJA 1NGZB 3NJVA 1OCWL 2DBLL 3HAEB 1MJ8L 2F54B 2NY2C 3KCPB 3MUY1 3LZLA 5SWSB 5EEWA 2G60L 1BG9A 1JDDA 5F6IC 5B3JE 1D9KD 3WNJA 3IMWA 3QJOA 3PL6D 4KI5F 3L2NA 4J5VA 2CKBB 4MMYA 5BRPA 3D1MC 2WXMA 4IMKC 3LD8C 2EXWC 1AHWC 2OQJA 4MFHA 5AYTA 4P59L 1FDLL 3FSOA 4LE8A 4OZIA 1F58H 2Y1ZA 4FQQA 1WBZA 3TN0B 4HKJA 4HHGA 4APXB 2RTTA 4PRHA 2HVKA 3G6AA 3NDZE 4ONGL 4LPTA 4PJFB 3QR0A 3MRDA 4PCKA 5J0BA 4D0DA 4BELD 4ZFOL 2XKSA 3O3DA 4U1NA 3QJTB 3MVSA 4AQAA 4EJ1C 4B5ZA 5C07E 4L8CA 1HEHC 4AKPA 3NEOA 4NQEB 1JWSA 1UXWB 2IANB 5IESL 3S8WA 2E46A 2XNAA 2K4WA 4YX2H 4GKSA 1ZGLM 3JVGA 1X6LA 2OMYB 1FORH 2ZUUA 1LDSA 5IOPA 2VKWA 4WNQA 1LP9F 4R2GD 3MODH 5JYLA 4HUWB 3FU7A 5EOQL 4ZPVB 3N91A 1P5UA 1F2QA 4YDNA 4DAGL 3VB9A 1CB4A 1JFQH 1PPIA 2LABA 2WGXA 3V0EA 1CLOL 4JO2H 4Z95L 4OZFH 5C0DA 1FAIH 2Y7SA 2XKNB 5AVSB 4X50A 3ZMEA 1JK9A 1MVUA 3FFCE 3KBHE 5HHVL 2Y07L 2YBRA 4MHHI 3EDEA 5D4QA 4HPOH 5HI4C 3N85H 4ENEC 2V7HB 3E38A 4KKBC 1JWMA 2VQ1B 1E50A 4G9FA 3IS1X 4ZJ9A 1GJIA 5JDJA 3FB7B 4YNYB 1KXQE 4OLVL 3M6DA 1NBQA 1UM4H 4GW4A 3DX2A 4RZCB 5EU4A 5DYFA 1N5YL 3BP6A 3DUUA 4F2ME 1EXUB 1DEEA 2NUTA 4XCCH 5AB1A 3GC3A 4LSVH 2W9EL 1R5WA 1MCKA 4KJQC 3L4WA 1E2ZA 5BS0E 3JV5A 3APDA 3EYOB 4GAAA 3U1SL 5D72H 4XMZA 3MV7B 1OM3H 1ROCA 4F7MB 4KKQA 1AG6A 1QWNA 4L9LB 5ID1A 4KO7A 5HJGA 2BOLA 2OP4H 3P3YA 2X3BA 1C12A 2DWYA 2FHBA 2VXSH 2WNXA 1NMBL 3BGMA 4U6TA 5C0CE 3RAJH 2DYPB 2VH5H 2Z0BA 4RAHA 3FO2A 4XGZB 5I6XB 1GKEA 4RGMB 4TOYH 4UAHA 1R17A 3HEIB 4KZ0A 3R0MA 4BE5A 3CFDA 2A9AA 2C1OA 1YUHA 2PLTA 4EZKA 4IU2B 2WKGA 3CH1B 2JVUA 3UTOA 2F54A 1BFSA 4TNVF 5CO1A 3LMJH 2WUBL 4NNYB 2W91A 1TZ8A 5MEQB 2A73A 2OAAA 3L08A 1RUAL 4JDVA 1BLNA 1DQJA 4IW4C 4KROC 4LOUC 4TM9A 1E4WL 3SQRA 1KB9J 2ICES 4Z76B 1BIIB 3UTSE 4YHYC 2QVFB 3GBDA 3NAAL 3NIGB 3NSCA 3NJMA 4UV4H 1IEHA 4IK7A 1DVFA 2WZPD 2OL3H 2NZIA 3WTWA 4G6KH 1BD2E 1LO3L 1UCTA 4BFBD 2ZJSL 3B9VA 2NQDA 3DHPA 2DLTA 4H8WC 1MIML 1QRNA 2X41A 2RFXB 3AMLA 1NM9A 3ZKSD 4ELKA 5KVFL 5BRZB 4M7ZC 4OZFB 3TYGL 1CGXA 2F53E 1SHSA 4R7XA 4XOBA 3K8KA 1B2WH 4HKXB 2DEWX 2P5WA 2IXQA 2PXYB 4FNLH 5AW2B 3GB7B 1UG9A 1FH2A 4KDTC 2F8XC 2IGTA 5T1DH 3WBDA 1C5DA 3LS5H 4Y8DC 1BJ1J 1JXJA 2D7TL 3WFHB 2YN3A 3OGCA 3CBRA 4G5ZH 2BY1A 3CNKA 4X5RA 3RDTD 2F19H 3LCYA 4L29A 3KS0J 4PN6A 3KPTA 2WZPA 1LO5A 2AVGA 4JR9L 3APCA 2NUTB 4MNGA 3H1ZA 1QAWA 2E7MA 2ROXA 5E6IA 2DMBA 4X98B 5B3SB 5I19L 2RA1A 5JIQA 5JW3H 3RGHA 1T1XA 2GJZB 1FAIL 2ITFA 4CADA 3QJZA 1I7TB 3EH4B 3QCTH 4C4UA 1YECL 2VQ1A 3ZTNH 2APTA 2Y4SA 3ZYJA 2YBRB 4LSRL 1ASPA 1OK8A 2H0FA 2VL5A 4CDGC 4FNPA 2JLPA 4Y8AA 2HSIA 2NTFB 5IHBA 4EZLA 2WXKA 1WK0A 4A2FA 5KYWB 3K6FA 3LS4H 2D7MA 4AY0A 5E0FA 3P2TA 5H4ZA 3IFPA 4G59C 3ARFC 3ZOAA 1HI6A 3DHJA 2OXHA 4UIMB 4JG0H 2PO6D 1F2XK 5LGHL 1FNGA 3JT2A 4PRBA 1XTLA 3GMQB 2AAVA 3QK0A 1U8LB 3KWUA 1IQDB 5FV1L 3P4LA 4HZLB 5EIVA 3AU0A 5AVZB 5I0YA 4W93A 4G72B 2BC4B 1KTCA 5I1CH 3MRLA 3PV6A 3V7AG 2YGQA 3TTYA 3DIFA 3ZE1B 1CD0A 4DPBX 2B9AA 2MPAH 2X4OB 2V9UA 1JZ7A 2EILB 3BPCB 3P40A 1HEJC 2IAND 4L48A 1MHCA 4AEHH 1QI4A 2JELL 2XWBA 2G3NA 3PWNB 1NA8A 1A2YB 1P7QD 2BHUA 3G9VA 3MOBL 3MC0A 3MXWH 1S9VB 2DWTA 1XGRB 4LZKA 2NW3A 1YO4A 1B4RA 1UT9A 2F1BA 3L2LA 4UTBH 4WU7B 1ZLVH 4KMQA 1F97A 2VLME 2H3XC 4XNAA 1SY6H 3BH9A 3PWPE 5T3ZH 1QP1A 2GSIB 4WEUD 2IWFA 2FH6A 3GBML 3QDGA 1OTUC 2AQQA 3H3KA 1N2RA 3F5WB 2XBDA 4YLBA 1MG2C 3CFTA 4MJ2A 3M1BB 3EJZC 3FFCD 3VXMA 1IAIM 2DYPD 4GYBA 4TLTA 5E8PA 4QHLA 3CZFB 4X6FB 3SDXB 4G6KL 2Y0SA 2QKSA 2F5AL 3ALXA 1NGZA 1SJHB 3TZVC 3QQ4B 1U8KB 4U31A 3X13B 2GUOB 1FDLH 1OCZB 3BZ5A 3HRZA 3QIWC 1MCFA 4KJPD 4PJHF 5F7NC 3WL9B 1FN4A 2XY1A 1FSKB 1RUQH 5DZVA 4NIKB 4PHZA 2FGWL 3DX9B 2WWOA 1BVZA 4JO4L 1U95B 4HWZA 4C57C 4NM4L 5CJ8A 4LB8A 2NDGA 4U1SB 4OD2B 4JHWL 1ED3A 2EXWD 2HJFA 3P0YH 2D0FA 1ED3B 3BMVA 2ZXBA 5ICYA 4Y9BA 3QUYD 5FGCE 1JVOA 1DN0B 5KAQF 4M8RA 1CICA 3G6JB 1D6VH 4AYMC 4R0LB 3HR5B 1MW0A 1F3DJ 5B7EA 2ZPKH 1FORL 3T4AB 4TSCL 3MZGB 5FECB 1JHKH 2ATKA 1IEAB 1SZNA 3WCYA 5D7LD 4QEGA 4V1DB 1TT6A 5LVEA 1AMXA 4JPKL 2DAVA 4Y16C 4NQUA 5E03A 4NNPL 4HIJB 2D3VA 3NJLA 4NO3B 2AV1A 3HNVH 1ZA3B 4JY6B 4A1RA 4PMFA 3BSHA 1CLOH 2DWDA 2CDEB 3B83A 5CU9A 1O9ZA 3BO8A 4RMBA 2BH0A 5DRWA 4LIQL 2R4SL 1T1YA 4N20A 3ETBF 4JL1A 1WYJA 4UM8B 2CA3A 5ILTL 5ICXB 1K5NA 2YKKA 4F9PC 1KIRB 4LPYA 4PQXA 1G9NH 3TT3L 2G60H 2ALAA 4JE4B 4X5XB 4HDIB 4PUBL 2K9UA 4U6HB 3VGAC 4FG2A 5EBLB 2WQ8A 5FB8A 3OJVC 2J7LA 3II2A 2BIPA 2KZKA 3KYAA 3TN0C 5I28A 5EU7C 4WO4D 2IBZY 2ZX6A 5DD3H 3VW3H 1DVQA 3UX9B 4U3HA 3QZBA 2CG9X 2FQDA 4HC1L 2F53D 1CS6A 2QTEA 1I7UB 1ADQA 3BUIA 3KH3A 5B1BB 3U1SH 2JSFA 3WGUB 3O81A 2HT3C 1XGYL 5CEXB 1NAKL 3H85A 4OFYD 5F7LB 1J0IA 3IE9A 5AKSA 3EHBD 1BZ7A 1SOSA 1ES0B 4R9HA 1UD6A 1QX1A 4NFDA 5HDOA 3HVDA 1C16A 1U21A 3BP5A 4JGUA 1VEOA 4KAQL 3X11B 3RP1A 1T22B 3GIZL 4U7SA 1HI6B 4TXVB 2NNCA 4LBEA 3QHFL 2FWOA 2NY0B 4Y2NA 2ZWZA 5DRXA 2Z31C 3S34L 3FFCB 2BDNH 1WJ3A 1E42A 3FXIC 4KNQA 3WFEH 4NZRL 5DSCA 5FHAL 4QT5A 2JKXA 1LEIB 4NQDB 4RNRB 2AQTA 1K3ZA 4W9KC 3ZBMA 5I1JL 2D3NA 4QAWA 5C09A 1W2KT 2YLKA 5HGHA 5IJDC 2BY3A 3TONA 4D3CH 5KYXB 1YPZF 3ZLQC 4PREB 1XR8A 4W70A 3RWGA 3B3IA 4MMXB 2XPGA 3F7RA 4RGNB 4BUHA 3DX9A 3P69A 1TJXA 3D85D 2OM5A 3EGXB 2P9RA 1SVZA 4Y4FD 4MX7A 5HJBA 1LQBC 1DVFB 3EO1A 4C56A 2VZSA 1ZLVK 1U3HB 3MRCB 4GP8B 1ACYH 4R4NC 1QKZH 2ZF9A 4Z7UF 5C0RL 4JJOA 3OZKA 1WFIA 5C0ND 5GS1C 1SBSL 3W0WA 2D7TH 2IDSA 4JQIH 3SDXA 3QDMB 3QG6A 1A7NL 4GSRA 3CFDB 1ZS8B 5I1AA 3MYJA 2ARJA 1NFDA 1EHXA 1BLIA 1J8HB 3PWVB 2GCYB 2ARJB 1KTRL 2Y07H 2EIJB 5AALA 3QJXA 2W38A 1C8QA 2ZXCA 2HB0A 2P52A 4XC1H 4Y5VB 3PWPD 5IROC 3ET9F 5C09D 3NCWA 3QUYB 4NXSA 5B39B 1HWGB 4XXDA 2BRRL 5EFIA 2XWDA 2PR4H 2HMID 1OXYA 1A2YA 3LQAL 3C6LD 4XHJC 3DYPA 5JYMA 2B59A 4LFHD 4PJ9B 1EUUA 2B08A 3D39D 3TO2A 1A6UH 3LS4L 5T3XH 4CBPA 2GHZA 2V2TA 2VN3A 5DEJA 2MPVA 4TVPD 1MPAL 3RWJB 4FQCH 3DUUB 4KKAC 3X3GH 5DUBA 3MX0B 4XB8A 4CN1A 1Z5LB 1WE5A 1ZVSA 4JANB 5D70H 3I6KA 4Q58C 2AEPH 5B4MC 2EO7A 3JT0A 1I8MA 2BSRB 1UB5B 1PSKH 5MERB 4MAYC 1GGTA 1BHGA 3FN0L 3CJJA 4Q0XH 2X70B 4IKLA 5DJ0B 4I1NB 4N3UA 3QB7C 1U4EA 4KXAA 4K71C 4FNUA 1FA4A 3N44F 1DFXA 4KKZA 3HZYB 4LSDA 2IQ9H 2JKLA 4X9IA 2CA4A 5EZLB 3VFVA 3CN3A 4LBEB 2R69H 5ID0B 1DTUA 5AW1B 4G8AC 5HYSG 1A8JH 5C0JA 3QO1B 5L8LB 5B22A 3I50H 2B0SH 1L9MA 1DEEB 4XMWA 3QUMA 2Y24A 2DQEH 5AYQA 2NUPA 4J4PC 3W37A 5IJKA 5G55A 3LY6A 4I9XA 3QUKA 4YIQB 4FYTA 4D0BA 1JWSB 1TEGA 3K46A 1HSAB 2XN0A 1P1VA 1TZAA 2DMHA 4H44C 3QUZC 5IJBC 3L3GB 4ZG1A 4B7IA 1LO0L 4YXKH 3MNVB 4DEPC 2O26U 4G6ML 4XBPA 3MV9B 4LP4A 2BNUA 3M17A 4QO1B 1KB5B 4ALAH 3GB7A 2R2HA 2ZX8A 5E94A 2BSRA 2NRDA 25C8H 2DEXX 3ZSSA 1Z0MA 3Q7JA 1GS6X 4PIBA 5C9JA 3FT3A 5LKNA 4JG1H 4DKTA 1KXHA 1I31A 3B7SA 3OF6A 1R3LB 4PPTA 3T0EC 2X05A 3AG4B 3OKNB 4YQXL 3P4OB 3HLAB 1J8SA 1M6OA 2B15A 2FGWH 1JPSL 1YEKL 2R2BB 4GAYB 3D6GA 3RDJA 1WEJL 1BZQK 1FZKA 3MO1B 5DGRA 4RDQG 1WPCA 4KKCC 4NCDA 3PHQA 4IBSA 3FHQA 4HG4J 4NZJA 5EDSA 4DT2A 2Y7QA 3Q2WA 5JUEH 3HG1E 4JFHD 5E1HB 3A24A 1F4HA 3ZTNL 2FUTA 3FQ4A 4YLQT 1EA9C 2E75C 5JOPE 2GJ6D 1SJXA 1LMIA 3RQ3A 2APFA 2ZPKL 5JZ7D 3V0FA 1MAML 1IBDA 1WBZB 4JQXA 3T2LA 3UG5A 3DURB 4ISVA 3VFTA 4WUUD 1ZGLB 3SYCA 3HG1A 4MNQD 1NCHA 3BGAA 1AZCA 5CJOL 4E42B 1PD1A 4AQEB 2W07B 3CX5J 3FFDA 5DT1L 4FHJA 4FFVD 3QG6B 4NUJB 2CIIB 1WFOA 1N4XH 1OANA 1VFAB 1ICTA 3ZDZB 2DYPA 5SWSA 2GIYA 2Z8RA 1NANI 3MACL 4EVNB 2I5YL 3GSXA 5DMGC 5BZZA 3VXOA 2PMZA 3HUJB 4POUB 5ALBL 5FV2A 2ED8A 3BT2H 3HUJA 3C5ZB 1Z9OA 1CGTA 1SOQA 1U91B 2ENQA 4FFTA 4LLQB 3P54A 2F5AH 1DBKL 3VFGH 3ZN6A 1GC1L 4G1MB 4M62H 1WO2A 2HG5A 4JZNA 4BSVA 1JTOA 3O11A 4J1UA 5IR1B 3HB3D 3DIDA 4XN1A 3V4PA 1OP5H 3TH2T 2BNQA 4EIZC 2HKHH 4PSRA 5HDRA 1UOWA 3OKLA 1CF1A 3RLSA 4XT1C 5KYUB 4A39A 3CX2A 1HL4A 3QHTC 1WA2X 1JWMB 3FCTB 1A7QH 2BVQB 3G9AB 4WAFA 5LBSH 1HKLL 2J8UE 5K1JA 3WIHH 3GSRA 5FF6A 3WEXB 1N19A 3U7YH 2NW3B 1NC4B 5EO1B 4CRPA 4Q9RH 5DVLA 3T5WA 3BP4A 3PQYB 2CXGA 3VA6A 4PP1D 1M7DB 5B1KA 3MLZH 5FGCB 1E8ZA 2IWKA 1NFDF 2H6PA 3L1OH 1IKFL 1OALA 2PCYA 2JI3A 4FQIH 4A2LA 3BIKA 1I9JH 2YA1A 4OIFA 3KJ4C 1MFMA 3RGVA 1QACA 4YDVA 2B8OT 4B6ZA 2EO1A 5AVYB 1ZD6A 4OGQC 4QRBA 3MRRA 4K15A 3GO1L 3O6MH 4H25A 4K9EH 4X2UA 1IZJA 5IHUH 2J6EA 3BXNB 3W1ZA 3LN4A 1MHPH 4ZYKB 1PGRB 2EINB 4FL4B 4EI6A 1MHHA 3MLRH 5EEYA 1XBRA 3LNIA 2AJUH 2GABA 1CXIA 1V05A 15C8H 1ND0A 3N0PB 4HIQA 3UCQA 3T1FB 3CK0L 1AD0A 5CMAB 5EBGA 3FB8B 1K4DB 1YPZA 2KMWA 3GM0A 2SODB 3OR7A 4FQQB 3ZYIA 2VISB 3RTQD 3OC5A 4P46D 1MCEA 4IU3B 1RXLA 4HUCA 1HCYA 2X3CA 4MQ7B 2Z35B 4XTRC 3GLAA 4CVXA 5KSUB 4RISH 1E27A 3BN9D 3NZ8A 3D0LA 5F0LB 3V4UH 5T1KB 5D1QC 4J3WA 2YD7A 4XPBH 3QR2A 4ECNA 5IV2A 2G3XA 2OULB 3SO5A 2B14A 2YFNA 1Q9KA 3NIGF 1PJ9A 5I0VA 3SO3C 3I6GB 4JFDD 4P23A 1OARL 2WBJD 3HG3A 3N1MC 1WIUA 2R27A 4YDJB 2ZXGA 4NM8H 1BAWA 5HY9A 3IDIB 4ZUWA 3S0PA 2PXYA 3MGTB 5GIRB 1EHLH 1IGMH 1DN0A 5FAAA 4TSAL 1U3YA 4WHYH 5CKAA 1KXVA 3SDXF 4C83A 2NXZB 3SE3A 1FVCA 1IAII 4LP5A 1T1WA 1PFOA 1UXSA 3K72A 1CZ8H 4IRSA 3RVTC 5F3HB 1BCIA 3GMMA 4Z7UA 1K8IA 4QXTB 1JTPA 3IBOA 5M95B 2YC1B 3QCUH 3WEAA 3DJSA 3OR6B 3GIVB 4JR9H 4PHXA 1ASOA 4NKIL 1MCJA 4N0CC 3CDZB 1T4KB 3Q2CA 5DFVC 4PFEA 5AB2A 2VDKB 3MJ8B 4Y4KB 5JHBA 1KJ2H 1KIUA 1IT9L 4NQXA 4U2YA 2ZSWA 1EGJH 4G7YL 2DI9A 3C2SA 2W94A 1UZ6F 5IMLA 2DWXA 2Y7LA 2AEIT 3EJQA 1O6SB 3SE4C 2QVTA 1SXAA 8PAZA 2LTQC 3HC2A 3L4YA 3O6KH 1S3KL 32C2A 1NL0H 4YHPB 3P9MB 2XG4B 1IAOB 3MLVL 4NKOB 4QCIA 5E2UL 4MA1C 2CBOA 5B4MD 4IJ3B 1RURL 3KEDA 5LNEA 2X0UA 3SYOA 1WBXA 2ZYIA 5D6DC 3WNOA 1CMOA 1EFQA 1OB1B 4P2AA 4JHAH 4P2YA 2YMTA 4XXWC 5DD1L 2BCKA 3ECVA 5T1LD 5JMOC 1I1FA 1IGCL 2QQLH 3JWNC 2C3XA 5KG9B 3DRQA 2LR4A 3V8OA 1Z9LA 3RAJL 1F8TL 4MRCA 3D33A 1QD0A 4RFOH 3EGXA 3LNFA 4GAJH 3LXBA 5I1CL 4DO6A 2UZIH 1TTUA 1HU8A 3WTXA 1NC2D 3EBAA 3VMNA 2AGJH 3KGSA 1RZGB 4K3HA 4KTEH 4DERA 4XCEB 2QADD 5D93B 3EJSA 4E9XA 2VGLM 4A6YB 1MRFL 1XGQB 3SY0B 4GW5B 1JZ6A 4KJYB 3X14B 1GZPA 4M7JH 4U1IA 2Q76B 3L9EA 4Y2OA 1AKJB 3OC8A 5IHZB 4JFFD 4YDJA 5C0BE 2PO6C 4X7SL 2P8MA 3ZDYF 2HN7B 3NFSH 2XJKA 1YJDL 1QFWM 1MJ7L 3KYOA 5DHVH 2R23B 1GYVA 3CN2A 4JJ5A 4JRYE 1U33A 2X70A 3DUHA 4IMLB 4OT1H 4AX3A 3FRPA 3NCJL 5FO9B 1MF2L 2EIZB 5GGTA 5MEPA 1SXZA 3MNZA 1MCRA 1AS6A 3VA2C 4HCRA 5IIEB 4TVPL 1XSKA 3BEWA 1QFHA 3QUMB 2H1PH 1HEZA 3H8NA 1YAIA 4V33A 3LS5L 3VU2A 1JNJA 1BEYH 3P0VH 1ZOXA 4BQCA 3PXHA 3IWUA 1TCRA 2ZICA 1OB0A 1PKQE 5TGBB 1J1OL 3QIUD 3QQ3A 4LLVB 1B0WA 1HWHB 3HE6B 2V9QA 5C6TH 3KPRB 1IVLA 3LD8B 2QFRA 1AGDA 1BAFL 1TTFA 2OR8A 4PJXB 5CEZH 5JW3L 1IM3B 3ULUE 3O2DA 2R0WH 2I07B 2HX9A 3RNKA 3DO4A 4LSVL 4LAQH 1KJ3L 2OX5A 3LHPH 4OBSA 3TBSB 4LSSL 2FWUA 4UI2A 2X38A 3TCLA 3NH7L 3HZKA 3HFML 1SJVA 3KPQB 1RZKL 3P02A 2Z9TA 4XODA 1E9PB 1ZK5A 4RFEA 1NH6A 4JLRA 1CR9L 5I1KH 1A21A 2H6PB 5EN3A 4BZ2L 1U3HD 2HLFC 1M2VA 4WKZA 2BSSA 1OTSC 5EU5A 4DN3L 5JTWA 3LEYL 4PJHA 3HMXA 2J25A 3MLUH 1KN4H 5L6YL 2EKSA 3EXLA 3BKYL 3L7FB 4LSPL 3KM2A 2VN5A 3UACA 2DIEA 4IRJD 1NUGA 3IDXL 3WHE1 2KHAA 4Y5VA 3RJQB 5GHWH 1L4IA 3EIFA 4H4NA 5JHDE 3O6FC 3SODB 5HPMB 3CLFH 4WDIB 4WUUA 4EBQL 3PP4L 4FKHA 1V3KA 1OV8A 4LEOB 3EFDH 2A0LC 3A3YB 7CGTA 1XGPA 4HJUA 1A6ZB 4LGRB 3GDBA 4KRLB 4JFDE 4RQQB 4LDCA 1FRGH 2ZCZA 2X2YA 4OZHA 3SDCA 1OWWA 1GOHA 1EDHA 5DJ2A 5C70A 3HBGA 4R90H 3L9RB 2IGFL 3FT2B 4JDZA 4UINL 3MFGB 2HKAA 4DO4A 4LCIL 4LCUA 4XI5C 2GKIA 4UQ3A 2P5EB 3AQZA 3T2QA 4M7JL 1MWAA 3RIKA 1RVFH 3JV4B 3DO7A 3D08A