1PZBA

The crystal structures of reduced pseudoazurin from alcaligenes faecalis s-6 at two ph values
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
120
structure length
120
Chain Sequence
ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transfer(cuproprotein)
molecule keywords PSEUDOAZURIN
publication title The crystal structures of reduced pseudoazurin from Alcaligenes faecalis S-6 at two pH values.
pubmed doi rcsb
source organism Alcaligenes faecalis
total genus 31
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 1994-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1pzbA00
2FQFA 1M57B 3NSYA 1KYAA 3NP3A 1BEXA 3TU6A 1KCBA 2FWLB 2ZWNA 3SBQA 2BO0A 2IAAC 4P5RA 3NJLA 4TXVB 4YSSA 1AG0A 1NPNA 2DWSA 4BK5C 5I6LA 3FYIB 1DZ0A 2PPDA 3IN0A 1L9QA 1AS6A 1WS7A 2UXFA 1BYOA 1IC0A 2BWDA 2I85A 2GC4C 2W8CA 6PAZA 2R7EA 5B3SB 4AX3A 1CURA 2GSMB 7PCYA 4M4RB 4A66A 3FSZA 1AANA 5IY5B 1E5YA 2BP0A 1MZZA 1PLBA 2XVBA 1BXAA 2ZOOA 4G7RB 1KDIA 1WAEA 5AFAA 2BZCA 3X2QB 4K9JA 4F2EA 3FSVA 1CUOA 3EF4A 3PPSA 1A4AA 4GXFA 1TU2A 2IWFA 1GY1A 1OCZB 3T71A 3TBCA 1NINA 5I6OA 2CBPA 4YSTA 1AZCA 1W6LA 4KO5A 3EH5B 2AFNA 2XYBA 3V9CA 2IWKA 4DP0X 2AZAA 9PCYA 2P80A 1OCOB 2UXTA 4UAHA 2HZHA 3UAAA 1NDTA 3IN2A 2IH8A 7PAZA 1AG6A 4ZK8A 1FWXA 1AZUA 2R7EB 4Q89A 3X1NA 3H4HA 1L9PA 1ET8A 3MX0B 3NJJA 5I6KA 4P5SA 4HZ1A 2BP0B 1L9OA 4DPCX 1BXVA 1IBZA 2PPAA 3FU7A 2QDVA 4L0PB 3NJHA 4GP4B 2FQDA 1GSKA 2GIMA 4E9XA 2P80D 2HX7A 3OQRA 2IH9A 2X88A 3RYMA 1T5KA 1TEFA 2DYSB 1JZEA 1RCYA 4HAKA 5B1JC 4UF7C 1J5DA 4BDVA 1SHWA 1WA1X 2CUAA 2YAMA 3X1FA 2H47C 1JZFA 1MZYA 1OE2A 1XMEB 1AS7A 4PAZA 2YAFA 3EHBB 2PPFA 3QJTB 1N68A 2BW5A 1AZNA 5B7FA 2JXMA 3T6WA 1WA2X 2EILB 1PAZA 2VSMB 3FU8A 3EH3B 2HX8A 2ZXWB 3C75A 2BWIA 2MRYA 1ETJA 1PLAA 2VW7A 1E67A 2XV0A 5I26A 4G70B 3QJUB 4W9ZA 2EIKB 1ET5A 3X1EA 4HCFA 4JKNA 3GYRA 1QNIA 1E65A 1SHXA 4E9QA 1JXDA 4KNUA 1ET7A 1A8ZA 1BQ5A 5AKRA 4F2FA 2YXWA 4WKXA 2I7SA 2E86A 2H3XC 1ZDQA 2JKWA 3NJNA 2YAHA 2CAKA 2IDUA 3KW8A 4JHVA 4BDVB 4ENZA 1J5CA 3AG4B 4HHWA 3EH4B 3ABLB 4JHUA 2QDWA 4E9VA 3DTUB 4BWWA 4CSPA 3NJFA 3WG7B 1A65A 1OV8A 2IDFA 3L45A 3PLYA 3DIVA 3NP4A 4KNTA 1DYZA 4YSRA 1NICA 2HLEB 3ABGA 4A2DA 1ASQA 2XWZA 4M3HA 1X9UA 1A4BA 3WNJA 3OD3A 1BQKA 1ILSA 5D4JA 1XB3A 1VLXA 2YXVA 1ZDSA 4KOBA 3NJKA 4YSUA 2GBAA 2HX9A 5B1AB 5I6MA 1BAWA 1PNDA 5AZUA 2YAOA 1PNCA 4EF3A 2AANA 2BW4A 3QPKA 3JTBA 2Y69B 3WNIA 3CZUB 3UACA 4DP2X 1CC3A 3SBPA 1JVOA 3AY2A 4AZUA 1PMYA 2PPEA 5B1BB 3S3BB 3AG1B 2XXGA 5PAZA 4E9TA 2AZUA 2UXVA 2X87A 3BVDB 1SJMA 2FTAA 2FQEA 1MDAA 3OM3B 3GXUB 5B7EA 3TBBA 2B08A 4YVNA 2XXFA 3FQYA 3FT0A 1SF5A 2TSAA 1OCCB 3ASOB 3S8GB 4GYBA 2BP8A 1I53A 1GS6X 1AS8A 1AQ8A 3JT2A 4FAAB 1AACA 1EHKB 3T6ZA 2FT7A 1CYXA 4W1TA 5I5IA 5LDUA 1JZGA 2YQBA 1J9TA 3NSCA 3ZDWA 1CYWA 2LLNA 3QJQB 3BQVA 3QJVB 3SQRA 1OCRB 1OOWA 4NB7A 1OE1A 4UANA 2CJ3A 1ZIBA 4DP8X 1NIAA 3N55A 3AG3B 2HRGA 3V9EA 1E5ZA 3D12B 3G5WA 1V10A 2PP7A 2CCWA 5TK4A 4A2FA 2N0MA 1NWOA 3CVBA 2IDQA 4KNSA 2PLTA 2XX0A 2EIJB 1JERA 3HEIB 2VM4A 4YSCA 2VW4A 1GW0A 1M56B 1SNRA 2J55A 3PAUA 3T9WA 1HAUA 5I6NA 4BXVA 5B7MA 1YLBB 3PAVA 2WSDA 3TASA 2EIMB 1PZBA 1V55B 5I5JA 3NSDA 1NIBA 1WA0X 4DPBX 1BXUA 2GHZA 1NIFA 3DKHA 3X1BA 4BWUA 2DWTA 2DYRB 3ZBMA 1SDDA 3FU7B 3WIAA 4AKOA 1PZAA 1URIA 2PP9A 1SFHA 3QQXA 4BWTA 1AAJA 3FQ1A 2W88A 1HFUA 3U25A 1ZIAA 4HALA 2Q5BA 1AIZA 1AZBA 1MG2C 1PZCA 4Q8BA 1EZLA 4GY4A 3TA4D 2BZ7A 4E9SA 5TK2A 3NJIA 3FYEB 4YSAA 1KCWA 3ABKB 6PCYA 1XB6A 2GC7C 3FU9A 4A68A 3SBRA 1IKOP 1FA4A 1QHQA 2I7OA 4HIPA 3FS9A 4KO9A 2AVFA 5I5MA 2NRDA 2Q9OA 2UX6A 4QKTA 2WO3B 5EHFA 2FNWA 5F7AA 4G7SB 3FPYA 4DP7X 1PF3A 1AR1B 2XV2A 2Y1AA 3IEAA 3CG8A 1PLCA 1J9QA 2BHFA 4FA7B 1V54B 1SDDB 2WO2B 2IDTA 3H4FA 4BXSV 1QLEB 2OCCB 1GR7A 1RZPA 2ZONA 4E9YA 3S3CB 1W6WA 2EINB 4N8UA 3CVCA 3AW5A 3NJGA 5I6PA 5ANHA 2IWEA 1ADWA 4DP4X 1KV7A 2VM3A 2VMJA 1KGYE 4A67A 1OE3A 3ZIYA 4GP5B 2JFCA 1PCSA 4E9WA 1R1CA 1WS8A 3UABA 1ILUA 3ZX1A 2DY2A 2J57A 1N70A 2YAPA 3UAEA 2CALA 3AZUA 3QJSB 1ID2A 2FJSA 4KO7A 1IUZA 1GS7A 2XLLA 3KW7A 1PY0A 3ASNB 3WI9A 3ABMB 1F56A 2UXGA 3FSWA 3FSAA 4HCGA 3NJMA 1JXFA 1AOZA 1L9SA 2B3IA 3NSFA 2YARA 1HAWA 3WKQA 1SF3A 4HCIA 1GS8A 4RH4A 2J56A 1JZHA 2MTAA 4A2HA 1UATA 3FPXA 1NZRA 5PCYA 3S3DB 4YSPA 1A4CA 4A2EA 3HB3B 1J9SA 4G72B 1ASPA 4GP8B 1KBVA 2HRHA 1SFDA 2PCFA 1B3IA 8PAZA 4DP6X 4DP1X 3FQ2A 4AI7A 5B1KA 4YSOA 3H56A 4KO6A 1JXGA 3OMAB 4NAJA 1KDJA 2XU9A 1A3ZA 2FQGA 4YVUA 4DPAX 1NIEA 3GDCA 5FC9A 5F7BA 2PCYA 3PCYA 1GYCA 2XV3A 4AKQA 1JZJA 2VN3A 2PP8A 3CDZA 4WTQA 1BYPA 2GI0A 1JZIA 2XX1A 4G7QB 4MFHA 2BP8B 2IDSA 1ZV2A 4YSQA 2HXAA 1AZRA 5E9NA 1JOIA 3UADA 2GB2A 2A3TA 3WKPA 4G71B 1IBYA 4F7KA 3OMNB 1M9WA 4YL4A 3UGEA 4AKPA 1J9RA 3N2JA 1NTDA 2XUWA 3PAZA 4KOCA 1ZPUA 3OMIB 5D4IA 4CSZA 5D4HA 1KBWA 4X4KA 3CVDA 3AG2B 4DP5X 3MBWB 2YAEA 1TKWA 1ASOA 2VW6A 4NERA 3X1GA 2QT6A 2UX7A 3NT0A 1NPJA 1E30A 5I28A 2FT8A 3QJRB 5B1JA 4YSDA 1FFTB 1TEGA 3CDZB 2H5UA 3PXLA 1RZQA 5A7EA 2QPEB 4N4YB 3ERXA 1OF0A 1GY2A 1NWPA 3IE9A 3T6VA 2OV0A 4DP9X 4E9RA 4YSEA 1NIDA 1XB8A 2PPCA 2FT6A 3T6XA 4A2GA 1RKRA 2QPDB 2RACA 3S8FB 1JVLA 2YAQA 4QLWA 2TSBA 4HHGA 2VSKB 1L9TA 3NYKA 1BQRA 2DV6A 1L9RA 2J5WA 3IBOA 1W8EA 1MG3C 1X9RA 4PCYA 2OJ1A
chains in the Genus database with same CATH superfamily
1QRNA 3VX0A 3PWPD 3OAUL 5AZ2L 3HI1A 1JZ6A 1KCBA 3OZKA 2B4CL 2CR6A 2Q7AA 4XN9A 1KIUB 1B2WL 1FAKT 4GAGL 2ZOWA 2F54E 4WFGE 5DJAB 3QEUB 1L5GB 3UYPB 2H26A 4M61B 4PMFA 3F00A 2VR8A 3WHE1 3FKUS 4HG4K 1SEBA 5EZJB 4XXCA 4Y2DD 5C09E 5JNYA 5IJVB 1F8TL 3HS0A 1FFPB 4X6EA 5J8OA 2F53D 3DJTA 2FX7H 4XB7A 2NDGA 4PWKA 2WGXA 3IDIA 1CR9H 2JKLA 2B15A 3BKJH 3AT0A 4Y4FC 4LLVB 2O5XL 2PWHA 4AG4H 5MENB 5AVUB 3B3IA 4ERSH 4JFDA 1N6QL 1T4WA 3L3IB 5DFAA 3EYSH 1YMHA 3MJ8B 5T3XD 5BVJB 4AT6B 4IDJH 1FVEB 4JDZA 4JZOA 4XNZB 1DJSA 4XMZA 4PREB 4XMKH 3CDGA 4GXFA 2IQAB 4A04A 4KVCH 3ULSA 5LXVA 3C60D 4UTAL 5HYSA 5EU3B 4HUUA 3OKEA 5B22A 1DFBL 2W07B 3TN0A 1NGWB 3MQIA 4K23L 1CTMA 3W0WD 1D7FA 2YR3A 4GBXB 1MW2A 4XE5B 43C9A 1MHHA 4PJBB 4X7FC 3T2QA 4TLSA 2JSFA 3L4TA 1NL0L 1R17A 5CN3A 3DSNA 1O7SA 1VKXB 2GCYA 3GTTA 3VWKB 1E4WL 4NRYB 5DMYA 3F7VA 3TFKC 2IALB 3RZCA 3OX8A 4P23B 3IRCA 1QHPA 4KKZA 1JD7A 1MI5D 3HAEB 3AY4A 3MNVB 4IK7A 4JO3L 12E8H 2K9FB 4OTXH 4OV5A 2EIEA 2OJZH 2ZWYA 4X5QA 3LIZA 1IE4A 4MAYA 5EUOA 2N0KA 3RL1B 1KULA 3IMSA 4M93C 3HAEH 1WA1X 4X8JB 3BCFA 5CGMA 1MZYA 4I0KA 2VERA 1VERA 4FTVD 3RVTD 1T0NA 4RMWA 1N6VA 4EVNA 2Y1VA 4D9RE 3GS7A 2JXMA 5HBBA 1T6VN 2UZPA 3TXAA 3CH8A 5EZOH 5KSAB 2VO5A 4AJYV 3OAYH 1PLAA 2MRYA 4K94H 2X9WA 1E67A 5AW8B 4ZAKC 1ACCA 1NAKH 1MXDA 3BRFA 3U7AA 1OD7A 4RAVB 1MVUB 3U6RA 1TZIA 4Z0XB 3P9MB 5DJYA 2NY5L 5I1LA 1MHEB 1AZVA 1YYMH 5DI8B 4JX0A 4PFEA 3WLWD 2F7IA 2OSYA 3MV8A 4JO1H 4X6DB 5CJQH 4ZO7A 3TCLA 4QTIL 4ZQKB 4A6YL 1JK8A 1FZKA 3HRZB 2OAAA 4IBZA 5BS0D 3CX2A 3KGTA 1KPUA 3NJNA 4NP4L 3BLBA 3SE9L 2DMGA 5I0VA 4OAWB 3PIQA 1QWUA 2VLJD 1TJHL 2FIRT 4PLKD 3AREC 4BFIA 5J11B 1M3IA 2CO7A 5ABAA 4KTGA 3DTUB 3U0WH 1OAQH 3TYGH 1MCIA 2FUTA 3P3RA 4GI6A 3SGDH 3F8UB 1E4XI 3KXFE 3HMXL 3MGTB 2JWYA 2MNUA 2HTKD 3BD4A 4UT9L 4DKAA 1E4KC 2AJSH 2L04A 4OF7A 4Z0BL 3M46A 3A6CL 4NCC1 3FT2A 3O3BB 3LH9A 2ZYRA 2EEDA 1JAEA 4IBUA 5IVXF 5B4MD 3NFNB 4EI5B 4LL9A 3MLUL 4IMLA 5B1AB 3QXTA 1L6XA 4NQED 1DVYA 5DHVA 3P9LA 2DWEB 3UTTA 4RQQB 3M07A 1CICC 3KPSD 4MJIE 1TJGH 4Y2OB 3C6LA 4AW7A 1N5AB 3FCSA 4NNPH 1T1WB 1HL8A 5L0QB 1VFAA 1SMDA 2ZUSA 4TUOA 4PS3A 3H9SD 3QUZA 1ORQA 4HXAH 3FCGA 2BY1A 4D94A 2BXYA 4ZX4A 5T1LB 4OFDA 1LEGA 1UJTA 5E8DH 3SDAD 4F9LC 1C08B 2RGSA 2V7NA 3GXUB 2Q6WB 5B7EA 1MFDH 2N59A 4X80H 3MBEB 3VQMA 1HC1A 3NAAL 4MXVE 1W0YT 5AAWC 2QKIA 4I0PB 4AIXA 4UQ2B 5JR1L 3NSXA 4ONFL 1Q9LB 3IJYB 4Y16D 5LXGL 3B3BA 4Z78A 4BQCA 1LO0L 2QHRL 3F64A 4YEEA 5T5FH 2VLRD 3VQ2C 4ZX3A 3LZFH 1VDGA 3LHAA 3HI6H 4BFKA 4QAWA 2Q7YB 4OGAC 5JW5A 4GKOA 3FO0H 3GHEL 2QVFB 4FQ2L 2RQEA 3UZQA 4NBXB 5K69A 1RUKL 2E6JA 4OLYL 5HGDB 4G6JH 5I17B 1QI5A 1Y1UA 2YWYA 4GRMB 3T8XA 3KL0A 3RFRA 4Y5YA 4N3UA 4HIIB 3WJMB 2DKSA 4XPAL 3V6FB 4ZFOA 1U8NB 2B20A 3MREB 1AMXA 1XAUA 3BQUA 2QGBA 5J6GA 2XN9B 5AVQB 5EIIG 1KB3A 3S37X 1V55B 5I5JA 1CF1A 5IUSA 1J12A 1OB0A 4NM8H 4B53A 3M7FB 4O02A 5FK9A 3CH1B 2WLIA 1XIWA 1JGUH 5EIIA 3HPJB 4APQB 4ZD3H 4AYFA 1LO5B 2DYRB 3GMQB 5FYJD 3SY0A 5C3IA 3RIKA 3CVHA 4PY8I 3SCMC 1V27A 4DVRH 1K4DA 4XVOA 5ETUA 3BCDA 1OGAE 3D34A 1K8DB 1QLEL 4F24A 3Q48A 3ZR6A 1HZLA 2KKQA 4Q8BA 5LGHL 5BUAA 1D6VH 3TA3D 2LU7A 4XCCL 1XR9A 3RIAK 3NFSH 5E5LA 5SX5H 5MHSE 1GVIA 2C3VB 5DWUL 4FG6C 3SYQA 2J4WH 5HVHC 2AXFA 3SYPA 3NN8B 1NC4A 4R0LC 1KJ2B 3P4OB 4X7EC 3O3AB 4XMWA 1THCA 4A37A 2XWBB 1RURH 3RU8H 4NFBA 3VI3E 4R4BA 2HFGL 4KQ3L 2I07A 3VFMA 5KJRH 3F6JA 2NYYC 4M5SA 3H3PL 1UA6H 4RWYH 5DD5L 3QZPA 4WI6A 4JFOB 4TNWF 5J9PB 1SDDB 1H5BA 3DPDA 3CU7A 4RVBA 5D7HA 1IM3A 4XVUD 4PRNB 4DN3L 2X44D 3SO3C 1GR7A 3EF7A 2YD7A 3FOLB 1SBSH 3L54A 3QDGB 1RVFH 3NK3A 3VXSB 1GPOL 2QPFA 4WY7L 3LD8C 3T65B 3WEOA 5TQ2L 4MD0B 4C55A 3ZW3A 4XCNB 2WP3O 2MEJB 1XF5B 1ZLUH 3UTZA 4HQQL 1CB4A 2NY1B 4GP5B 2JTYA 1K4CB 1BVLB 3T3PB 3N40F 5INDB 4ZO9A 3LPWA 4LIQL 5J1AA 3U30B 3EBHA 2WUCH 4UIKH 1BZ9B 3X17A 4ZQTA 3VAEA 4PTTA 3KW7A 4FNLH 3UBXG 5J12B 4LNRA 1U3NA 4WJ5B 5IB5A 5B38A 1A7NH 1WEJH 2X4SB 1CL7H 3RX9A 2R0KL 3NSFA 4XRCB 3VGGA 1MHCB 3BE1H 1GS8A 2EVGA 3UBHA 5JIDA 1K8IA 4AENA 3KYKH 1UATA 3FPXA 4HC1A 3BZEA 3IKCB 4M6OH 1MNUL 1JV5A 1U8KA 2E6QA 3VYOA 2ORBL 2DBLH 3HB3B 5BW7A 3BEVB 3DUSB 4RZCA 4BM7A 4LCWD 3E38A 1RZ8A 2UZIL 1JPTH 4LESA 1J18A 1OB1B 5I5RA 3I3BA 1IAIH 5DEZA 1CXLA 5ITFB 3K8LA 4NUPA 1SMAA 3UPCA 2B2XL 1P5UA 3GDCA 4XC3H 3EGXB 4W9KC 4BRJA 1B4TA 1U93B 3DO4A 4EN3B 4NO2B 3VYPA 2APTA 2X2JA 1WFNA 3FB5B 4JY5L 4H2AA 2QSVA 2VMEA 4GAYB 4PJCF 4L3EE 5CGTA 3CDZA 2ZJSL 3M7OA 3W56A 4POYA 1K9TA 1T1XA 4Y1TA 1JZIA 3GMPB 1F4YH 4JPWL 3GSUA 3VXNB 2E7BA 1IFHH 3S9DB 3IK2A 3FFCB 1WDAA 3QNYB 3SBWA 3MAWA 1BBDH 3MPCA 2GB2A 4H8VA 1U8IB 3QI9B 1II4E 1KXQA 3MRMB 3EOTL 5FYLL 2P8MB 3ARXA 3RDTB 4FQXD 1NTDA 1ZOXA 4PW3A 3MMEA 1KCVH 4YS4A 1HEZB 1I9EA 2D7OA 2H45A 4CSZA 5D4HA 2BOLA 3LZOA 3SO5A 1A4JA 3VFPB 3OV6A 3RZWA 4L9LC 3S98A 3V5KA 3O3DA 5FO9B 3MJ7B 4HH9B 3F7LA 2F7PA 2UX7A 3NT0A 2MNWA 2Z7YA 4UV7H 5LG1A 3ZSTA 4LGSB 3BAEH 4X4ME 2O5YL 4HKBA 4NO3B 2MCG1 1WFOA 3SJVE 1VADA 3G5YA 3IAGC 1IKFL 2OTUB 3ROLA 2QLVB 4JO2H 3T77B 2KBGA 1WHPA 4R97C 2V5SA 4Y2DC 3QIWB 1TETH 5A2LH 4TNFA 5IIEB 4QJ5B 5C0EB 2ETWA 3IE9A 3PWPA 4QXTB 3GK8H 2X4TB 1NGZB 4CUCA 1TTUA 1BF2A 4YSEA 4IS6A 3BISA 3BW9A 4XC1L 4G7VL 3ZJAA 3FRPB 1YJDL 1EJ8A 1JVLA 1NCOA 1W0WB 2BINA 2MNJB 3CN4A 3MLZL 3RWDB 3VU2A 1VACA 2KQNA 2OMVA 3HLAA 1PKOA 4PJGA 1L9RA 4Y2DA 4P9ML 3ULUH 1DQJB 5C0FB 3EYOB 4WGVB 4B9YA 2F53A 5CZVH 5E5MA 1TVHB 4LSSL 3WFBL 1YY9C 1T0OA 2VTFA 2NTFA 2QGDA 1WFMA 1E3FA 4DQAA 3QFJE 3EFDL 1FH5H 1EEZB 2WNWA 5AW1B 3IETB 1LXMA 5L88L 1AG0A 3WEBA 1WAPA 2QQKL 1S9YA 5MEND 1E50A 1OAZL 3QQDA 2TAAA 1F11B 2YSSA 4YDKL 3M45A 1ZT7A 5HJGA 2VDMB 2MPVA 2I85A 3LRLA 4G9FE 4Y1SA 3C60A 5GJTH 1NSNH 2IBZX 3RWHA 1CT8A 2HWZH 4YO0A 4AXWB 4I2XE 4A66A 4QRFA 4Z7WA 4QHUB 4JM4H 3W0WA 2XPYA 5IBTH 3QEGH 3QHFH 1NEZG 1O5DT 2PO6C 3IWVA 4LCUA 3C2SA 1ZLSL 1DQTA 1F2XK 5EORL 5T5NF 2NCMA 4GBXD 1TIUA 3CXDH 3ZL1A 5JO5A 2ZYSA 1Q0YL 2VZTA 2Y0SA 3X2QB 1HKLH 3GIZH 4F15C 4E0RB 1AHKA 4R5TA 2VN5A 3NCYS 2X9ZA 3E3QC 3VGFA 2YGVA 4EQ3A 2L4OA 5D70H 1GY1A 1XR8A 4QRSB 2KLRA 4PD4K 5SWZB 1D5MB 3HG2A 1MI5A 4EZLA 1S7SA 2D7NA 2IWKA 2NY4D 3HG4A 5F0JB 4DP0X 5B8CA 3KPPA 1ETZA 4P23D 2R0ZL 3MOAL 3A0OA 4HF5L 4XNDA 3LXAA 5CMAA 5IW6A 4FFYA 3P0VH 3Q2CA 1PYWA 1ADQL 4PJ5E 3KPTA 5G2NA 5CR1A 4UZGA 2NX5A 1BZDA 4XXWC 7PAZA 3LMJL 3DI2B 1J9CT 2W80C 3O11B 3BZ5A 3TV3H 4X98B 4P06A 1GRWA 2C5DC 1XEUA 2WLHA 4FTVA 1L9PA 1ET8A 4LSRL 2FBRA 3QAZB 4NWUH 3V6BR 3SE6A 3WTSA 1E3XA 2GSGB 2X4OB 3NJHA 3FRUA 4NT6A 4OT1H 4RCAA 5IGXL 5ID0B 3T2LA 2PW2A 4NYLA 5DZOA 2GITA 4BIKA 2AV1B 3K6SA 1Z9MA 4GXVL 5KSAD 4J3UA 3EDJA 2XA8H 1JF1B 2ENPA 3G6AA 3O8XB 4WUUE 5EPMA 5C1MB 2X6VA 4GG6A 2Y2TA 3IMUA 1I4FB 4PG2C 2EUVA 4WF7A 3RP1A 4NQVB 3D9AH 1RQ5A 4Q2ZA 2VE6B 4XMPH 1CBJA 3C08H 3WLBB 1H3TA 3EO0A 4XHJD 2IPTL 3BVVA 3VNZA 5EO1A 2BIPA 4NHCL 1IGCH 1KLUB 1NPUA 1WA2X 4MLIA 1OQXA 3C9NB 4GXUN 1ONQA 4ZTPL 2RCSL 3UTQB 5BS0A 3HE7C 1GC1L 3B37A 5JQIB 5I26A 1WBXB 4PJDF 5D5ME 3GSQB 2VLJA 4MWFA 4W9ZA 3Q06A 1KXTB 1UCTA 2YHGA 3GSXA 1QPPA 3HNVL 2M8XA 4JKNA 2QTEA 4LKCA 2X2UA 3STLA 1AI1H 3GRWH 2WIIB 2QSCL 1A8JH 4JY4B 2KZ1B 2BNQB 4Z3HA 1CU4H 3BP4B 3S96A 5FXCH 35C8H 1A7QH 4KJWC 4PYHA 4B5EA 5C97A 5KJ7E 1AGDB 4OGYH 4XN2A 2CDFA 1Q72L 2Z8RA 3S4SG 2YIHA 3RJQB 4FNTA 4Y5VC 3VTMA 2EYRB 5CILH 3WEXA 5BPPA 4BDVB 1YYLL 1OP5K 3VI4F 3BIAX 5F70A 2FEJA 3P4MB 4YC2C 2BMKA 1DQML 3KPRE 3S4SA 1JPGA 3MRFB 1DUZB 2VQ1B 3EJPA 1J8HE 3C5ZD 1OV8A 1TKWB 4HPYH 4NQEA 4QJ3B 4YLQT 5EBLB 3FAWA 2OSLA 3KPSA 5EBWB 3WSQH 1C12B 2VR3A 4ODWB 4IRZL 4OLVH 4PWHA 3ALXA 4Y5VA 5KUKA 3TONA 4MMYA 5ADPL 4PHXA 4YBHA 1CXHA 1IVLA 4E42B 1XB3A 4Y16C 2DPKA 4M9OA 3SDAA 3VCLA 5T1LD 3VD1A 3MYJB 2BS8A 3HUJB 1BFOB 3DUHA 4MA1C 5BZWA 1WUNT 4P0DA 5FKPB 1HHGB 4ZYKB 2JKXA 3PAYA 1NGPL 2YUXA 3IFPB 5ICZB 1DO5A 2CDGB 4WFEE 1OHZA 3PUCA 1QA9A 4DESA 1JZ3A 1OAXL 3MBED 4MS8D 1UQSB 2ZCKH 1FC1A 2HT3D 2Y5EA 4P4KB 2VCOA 3HA0A 4WU7A 2FK9A 4JFEB 4JJ5B 4I0PD 4Y16A 4ABWA 5E7FA 5FO8B 4FG4A 1WIOA 2VLRA 1UWFA 1SY6H 2WLLB 5D1ZC 2BC4B 1FL5B 2OXGA 4XWGL 1DBAH 4WEBH 4J1UB 3UYRH 5IKCB 4XVSL 2A83A 5FM5M 4K5LA 4WV1C 1FL3A 5I8KL 3KHQA 1F90H 5FOBB 5DSCA 5HDRA 3CHSA 2EDJA 4OCLC 4JAMA 2YPVL 2R2BB 4LVHB 3NCXA 4HMEA 5IMOA 1VEOA 3SE4C 2W60B 3LXUX 1OE1A 4U1IA 5TTRA 4N6RA 1UM6L 2GJZA 3VSQA 3C2AH 2MKLC 3N55A 2XN9D 3AUWB 4PS4H 5T1DH 5IB2A 3R4DA 3BSZL 2PP7A 4YGVA 2WQSA 1XF2B 1MWOA 2UY7A 4DN4H 2EYTB 1NBZB 2AEWA 3RVWC 2XKNA 1IGYA 3CVBA 3LQZA 3TESA 2BCKA 2XX0A 1E42A 1AQHA 1Z9OA 3BKCL 1XCQB 4APQD 4MCZA 5I1HH 3NFPA 1GXEA 2YJLA 3IGFA 2ZG3A 1HAUA 1UYWL 2IGTA 3IB4A 4NM4H 5CZKA 4BXVA 2ICCA 4FMVA 5A6IA 5BRPA 4IKNA 4HCRL 1T04B 3GXMA 1BQHB 1CLOH 5C0RL 1G87A 3LRMA 5K1JA 3TA3A 1PKQE 2ERJC 2X2IA 3P0GB 3QS3A 4NQCE 4ELMB 2HFEA 4AE1A 3MV11 1MF2L 2CU9A 4GQPH 2QZQA 2NZIA 2EDTA 2Q86B 2ARWA 3OKMA 4FKHA 1D9KB 4NPYA 5DS1A 1EV2E 3RHWK 3U0TB 2GIXA 1UUNA 2CJUH 5K9OB 4ATTA 4POZC 4N0FB 5A3IC 2FE0A 3FAXA 2R2CA 4HS6B 4NQDB 5FUCE 4Y4KB 5DK0B 3V7AE 1PZCA 5DLMH 2A74C 5G5DB 5D7LE 1LEKB 2NSXA 1BD2B 1KELH 4PRHB 4ZG1A 1BZQK 1XSOA 1IL1A 1NFDA 3BXNA 1WD9A 2KZWA 1D2OA 2V8MA 4P2AA 1UXWA 3LN5B 4N85A 1FDLH 4EDXB 5I5MA 2NRDA 1OTSD 3QW9A 5EHFA 3QDGD 5C0AD 3K71A 3VXSD 3D09A 4QNPF 2F7RA 1MUJB 4PGZA 2FJHB 2X41A 3POCA 4N2HA 4YHOH 4OCMC 2DWYA 4IBWA 2NY1D 1DBMH 4LKXB 1YMMB 2VLLB 2KPWA 2CDEA 2V2WB 3FB6A 3W9DA 4YIQA 5D1QE 3GJEA 3RUGE 3U4BH 3MRHB 1U91A 4YUEL 4CNIB 1KJMB 1ZD6A 3GHBH 2GSIB 2VC2B 1KGWA 5I6PA 1SHMA 2CKBL 5T33L 1QBBA 2VMJA 1E8WA 5I9QC 1Z3GH 2ZICA 2CQVA 4X9GA 3VXOA 1OE3A 2YA2A 2ZWKA 4XCYB 4ANKA 5GIRA 2JFCA 3N40P 1E0OB 4M8VA 4HWEL 3WS6C 1SZNA 1KCSH 3KPOB 3X13A 3IJSA 1S7QB 5F3HA 5CCHE 1EZUA 1KV3A 1FF5A 4LCWA 3GEFA 2WK2A 2QBWA 2Z7WA 4PGCA 3SYAA 1IUZA 4U6YB 4WFHD 4XPHL 3L48A 3MRBB 2XLLA 3ES6A 3WI9A 3HZKA 4PVBA 3DRQA 4GB9A 1C16A 3RKDD 4CVZB 3L13A 3W39B 2ZIDA 4RIRA 2WNXA 1NGXA 2Y25A 4R84A 3WS6A 1DO6A 3GJFH 1ZMYA 1RPQA 2DWXA 3G5XA 2AVGA 4XCEB 2MCPL 1DQLL 3LYRA 1MIMH 1J9SA 1H8LA 5TJWK 4EN3D 1SLUA 1KBVA 3WFDH 8PAZA 2AJVL 1BJMA 2B59B 5GGTL 1VJSA 2XQYG 4KZ0A 25C8H 4JM2B 3BZ4A 1YEHL 2YMTA 4A7UA 4EIUA 4JKLA 2XU9A 3EJYD 3FFCD 3R0NA 5I1AB 2OS7A 4MJJA 2J44A 4RDQG 1XSKA 1UZ8B 1ZSHA 2BLFA 5F6HJ 3RFZC 2NUTA 3L5HA 4GAJL 4HEPG 2F19L 1UWEH 3DGGA 3QI9D 5F7NC 3UZVB 2OMZA 4FQXA 4ABQA 2EO7A 2OMUA 3RWCB 1AR1C 1PEWA 4FP8H 3OKLB 2F74A 2D7QA 3DVNB 3OR6A 3RWFA 2ZT9C 3KDMB 2EYSB 1D5ZA 4L4VB 4KJQC 1F3RB 3UOAB 1LP9B 4PLOB 3STZB 5LAXA 2X1PA 3D30A 4AGPA 2O6DA 4FZEL 3DSFL 3UGEA 2E76C 1YEIH 2X89D 1WZ1L 3L4XA 1XL6A 3MHZA 4WO4B 1LNUA 1IGMH 1R75A 5TQ0L 1S7XA 3QIWD 1YNTA 5SWSB 4DP5X 3QEHB 1CE1L 2AK1L 2F1AA 2WQWA 5FYLE 1ASOA 2VW6A 3H9HB 2LR4A 3DX0A 3H3BC 1WVZA 4NZRL 4A7GF 3ULUD 1Q9KB 5AOZA 2VXQH 1KIUA 5DJAA 4PP2B 5B1JA 2JJVA 3UYPA 3QEUA 4M61A 1O5PA 1VIWA 5I76B 1MWAL 2OULB 2QV4A 1KN4H 1ACXA 4P3WA 4ETQB 5IJVA 2ADFH 1RERA 4WK0B 4DIXA 1J7VR 2VITB 4NUQA 3V95A 1U95B 5EUKB 4ZX5A 2B1OA 4E9RA 5JPNC 5B3JE 1U8JB 1ZT1B 5C07E 3WN6A 2ZG1A 3NIDF 1P7KB 2QPDB 4XAKD 1WC7B 3UO1L 1AVAA 1U2HA 5B3NA 5B39B 1M7IB 2ICWJ 1RUMH 5MENA 4FQIL 4UAOB 2DV6A 3L3IA 3IJ9A 3T0EE 2WZ6A 1FRGH 3U82B 3ZIMA 4JUSA 1PW3A 3MJ8A 1F6AB 3MLYL 4N0CD 4AT6A 1EFXD 4F7PB 4YE0A 5BVJA 2D3VA 3ISWA 5IMKB 1FVEA 4X2UA 1LYQA 3QR1A 2NNCA 1CGWA 1UWGL 2GTQA 2OMXB 4NC0B 1HHKB 2IQAA 4ZBJA 3D4ZA 4U3HA 2JB6B 3VWKC 4OH2A 4P5RA 3I74A 4PD4J 2Y5QA 3NPSB 5EU3A 3S7GA 3ZO0A 3PHOB 1NGWA 4TXVB 4P23C 1A9EB 3IS1X 2DWSA 2VXSL 4BK5C 1T2JA 4GBXA 2O61A 2XN1A 4PJBA 4XCFH 1WS7A 5AW5B 3G6JB 2QLYA 2VJ8A 5IWLC 2VXVL 1Z2KA 3FO2B 2GJ6E 4L0ZA 1VKXA 3DA0A 3L5IA 1BGXH 6PAZA 4WI3A 1YEEH 4NRYA 4UZSA 4PH8A 3WD5H 5I1KL 2DTMH 2IALA 3CPUA 4P23A 1QKZL 5IFJA 3L4ZA 2F54B 2R0WH 3PF2A 4OJYA 3P77B 3HAEA 3FT3B 4AEHH 3RGVC 2ALWA 2VN4A 1L6PA 1ZV5A 4JFXB 1DCLA 5BMFL 5C09B 3MFFB 5IWLA 2AJ3B 1CFQB 2CO2A 1CUOA 1HWHB 2NR6A 3EF4A 4ZOEA 2D4FA 3RL1A 5CBAB 2BSTB 4QHLB 1RJZB 1YY8B 1CDJA 1RIVH 4X8JA 4EUPH 4U7MA 2VR5A 3LRHA 1AZCA 4DO4A 5FOJA 2XYBA 5C6TH 1C7TA 1XGZA 1JGVL 4KK9D 1IBGL 2E8ZA 2WXIA 4PRAA 1E9QB 4TN9A 1OCOB 1RL1A 2KDYA 5KSAA 3UL4A 4U4IA 1UM4H 4F58H 1MIEH 3RURA 2FD6H 5HDQH 3TBWB 3QZLA 4XO9A 3BFOA 3O8XD 4DOHE 3GI8L 4E2OA 4KI5C 4YDIH 2FL5B 3QDME 2W9DH 4Z0XA 3GRBA 1HCFX 1N10A 2PXYB 3P9MA 4HXBH 4ZNEE 2VDLH 2D9CA 5J11C 4AQOA 5DI8A 4PJEE 4GQ9H 3WIHL 4X6DA 4ZQKA 5AW3B 1X4YA 4LSTL 4CDGC 2WXPA 3HRZA 3SYOA 3LS5H 3OQRA 4N28A 2X88A 5KVEL 1KLGA 1AQDB 1U8LA 3MUZ1 3NIFF 5DD0H 2D7PA 4OAWA 3FO9B 3LB6D 4UQAA 1U8QB 1LK3L 2W0FA 2CUAA 1JL8A 4TULL 5T3ZL 3TTYA 3RNQB 3NRPA 2Y6SC 5LHDA 3T0XA 4EI5C 1Z5HA 2FX9H 4CRPA 1PZUB 3ZKMD 4HWBL 3O6KL 4MBRA 5C7ZA 3ZE0F 4PJ8C 32C2B 4WEUD 4GQZA 3AXLB 2BWIA 3KL3A 3MJ9L 5DYOB 1BMWA 3Q05A 2CGRL 5L0QC 3O4OB 3MRGB 3MLRL 1QFUL 4PB0H 3IDUA 3O3BA 3O3EB 5I15H 1G0XA 3C5ZA 4UTBH 1J1PL 2DQGH 4LXFA 2CXKA 4HLZG 3L9YA 4WKXA 3BGAA 2DWEA 4AYSA 3KBFA 4RQQA 2Y7MA 4Y2OA 1QLFB 5E2WL 5F2FA 4MS8C 4N8VB 4G8AC 4J4PC 5F7DB 5I1IH 4G82A 2WLMA 3F62A 5T1LA 4BWWA 3GBDA 5JQ6H 1A65A 3K2UH 3V5HB 1C08A 5E9DD 4RAUB 3EUUA 1W91A 4HA1A 3US9A 4CW1B 2Q6WA 2P7TB 3Q01A 4JPVL 4X8XA 4YSRA 3WHXB 3D7PA 2WANA 2V17L 3WAKA 1BVKB 3MBEA 3FTGB 4JKPH 1ZHKB 1CGTA 5FCSH 3GNMH 3OD3A 4R4ND 1O6VA 2I60L 3C8HA 3D1MC 1MCNA 4NQSA 5DEJA 1H19A 3CHRA 2C9UA 4J3BA 4I0PA 5G4MA 1R3JA 4UQ2A 5AYUH 5L8LB 4P4KD 1Q9LA 3IJYA 4IIQA 4JFED 4EPSA 4HVBA 3VXUD 5KAQG 4PLNC 3JWDH 4O5LH 3KXFB 1F4XH 5HHPB 3MUY1 4ZS7L 1XF4A 2CK0H 3S35L 3TV8A 1TR7A 3KM1A 5D72H 4NDMB 3ZMRA 1REIA 3A24A 3WE6B 2IGFL 5HGDA 2VLKB 2O1AA 4PJDB 4GRMA 3VDBA 1XGYH 2NT0A 3P30H 3H54A 1ZKAA 5EU7C 1QSVA 4MA7H 3TNMB 1DSFL 4OSUH 4HIIA 2DQUL 3UZEC 4YVNA 5DUJA 3FQYA 3WJMA 5KW9L 5AW0B 4APQC 1U8NA 3O2VL 3WTVA 1I53A 2VAJA 4PRID 3ZHKA 3MREA 2YD6A 4W9DC 4PJIF 3HI5L 2AQSA 2KH2B 4LLYB 2XN9A 2OTWB 2KZBA 1I3GH 4S2SB 2V6HA 3DPBB 1XF3B 4W1TA 4NI3A 1UOVA 3WKNA 2VXUH 4JRXE 1R5VB 5ALCH 5CEXB 3UZEA 3CH1A 5DS2A 4QXVA 2G0KA 4APQA 1I3VA 5BOPA 1A6VH 3BYTA 3QGVA 4R3SA 3MRDB 2MH4A 3TBVB 1BZEA 3AB0C 3V10A 3L9EA 4WZ9A 3SPHA 4I13B 2C9QA 5DD6B 2V7HB 4KMQA 4MJ4A 4KUCF 4UYPA 2A7BA 1QSEE 2E6PA 5CFHA 3EYUL 4WNQA 4YWGL 1GL4B 3TX4A 3HEIB 4AEIL 4DZBA 3BAIA 1X5ZA 5J57B 4LSUL 1KEMH 5GGSB 5KBKA 3NN8A 1D9KD 1GAFH 1KJ2A 3P4OA 1EAJA 3O3AA 3ZLQC 1CPUA 4Z7QB 5KVGL 2XWBA 1OTSC 1MRFL 4UOZA 4NQDD 3TJHC 3IDNB 1CTNA 4Y4KD 2XBTA 1L0PA 3M8OH 3WOVA 2AW2A 4F7TB 3A6BL 1VENA 1ZA3A 4AQ1B 2QELA 2VNCA 5FYKE 4PRHD 3BYYA 4N5EC 1SDDA 4DVBB 2Y2YA 5C08E 3SDCD 3GXDA 5DQJB 3CHOA 1MFEL 2LOEA 3LEYH 1OARH 4XZUB 1JNNH 5FCUH 2XZZA 1AAJA 3FQ1A 4G5AA 1ITBB 1HFUA 3BVUA 3OF6D 3FOLA 3P73B 5T1KB 4YHKL 5LJYH 4P59L 4HS3B 4O51A 3U30C 3QDGA 5C0AA 3P0YL 4GKZB 3V0DA 2WKOA 3VXSA 4U1GB 1S46A 4NXKA 1E4XH 4ZPVB 5A6LA 1R19A 3F5WB 4RGND 1TJXA 3KJ4B 1FV1B 2KMWA 1IIIA 3FN3A 4XCNA 1XF5A 4W9CC 2WXRA 2G9KA 2GC7C 4RRPG 4GQQA 1K4CA 1EO8H 2DQMA 1M7XA 4XXDA 4LK4A 5DVPA 3ULVD 2I7OA 2YGOA 2QQNL 4MQTB 3UIYA 3FQRB 2ENJA 4AZ8B 3HB3C 4MQXC 1BZ9A 5HYJB 1TZGL 4LPWA 3BEWB 2YK1L 4HPOH 3S36X 4A1RA 4DP7X 4WJ5A 5MEQB 1G1CA 2A73B 4ODSH 2EECA 2X4SA 2DDQL 3KNBB 1MQKH 5E5UB 2VERN 1MHCA 1MCKA 1AJ7H 2ZX8A 3VFRA 4HUVB 2DIAA 4DGVH 3KL5A 3I6SA 3IKCA 2NXYC 2YFNA 1MPAH 2IEPA 2PYEE 1AXTL 5I2IB 4KPHL 1T2XA 4JZJC 3QCTL 1HINL 2ZTBA 3DUSA 5EF2A 3NJGA 1HWWA 4LU5H 1UHVA 1OB1A 4S1SH 1GGCH 3VGDA 3SOTA 1FNGB 2VUOA 5ITFA 1OTTD 5DEGB 1NGYA 3EGXA 2R27A 4XNYH 1GZPB 1OAUH 1U93A 1QD0A 2EDYA 4EN3A 4NO2A 4LRNH 2HN7B 4D9LL 4GAYA 2HRPL 5C9KA 2ZXBA 4XHQA 3RDTC 1ZVSB 3B4NA 3GMPA 1FCCA 3HS8A 1P1VA 4HX1B 3VXNA 4Z7VA 3FFCA 4KH9A 4JM2D 2YARA 5IBLD 3QNYA 5CLZA 2ZYIA 3D69B 4Y8AA 2EEAA 4TVPH 3RILA 4Z23A 4R8WL 4UILH 4YNYB 1AGBA 3QJOA 4FQCH 5AW9B 1XGPB 3QI9A 2DQCH 2EO1A 5AZEH 5I0XA 5LBSA 4CU7A 4FQLL 2FHCA 3MRMA 4LEBA 5GS1B 2P8MA 1SFDA 3EYVB 1NCIA 3VGHA 1KTKE 1HEZA 3RVXD 3MRQB 3DXAE 2OCFD 5F71A 5CJOL 1JPSH 2AXJA 5D2LF 3VFPA 4PJXA 3CK0L 4D7PA 3Q6FA 3ZTNL 3V0FA 4DPAX 3BDYH 5FHAL 3MJ7A 4HH9A 2WVVA 4L4VD 3TBTB 4OD2B 5DRNB 4AGOA 4NJAL 4ZUVB 2X89A 4NO3A 2LLGA 1DDTA 4M03A 1ZGLP 3CFJB 2OTUA 3IPFA 1BYNA 1I1AC 3N44F 4WO4D 2W92A 5LG6A 4QRRD 1ZV2A 3QIWA 1CIUA 1D7CA 3MN8A 5C0EA 1AZRA 5IIEA 4L3CB 2BNUB 3FRPG 2X4TA 1QFOA 3VG9C 1NGZA 5SWSD 4CL7A 4HIJB 1F42A 4G71B 4FXLA 3RHWF 3KVPA 4AQ8A 4UI2A 5MP6H 5JMOC 4JGNA 1F86A 5DDHB 1E6JL 3TL5A 1CFNB 1D5IH 3NBNA 2X42A 4IRSB 5DJXB 4L3EB 5G4NA 3IMVA 3C5XA 4BJLA 1DQJA 1KBWA 5C0FA 4H26B 1UJ3A 3NDYE 1UUSA 3NEEA 4KKRA 1TVHA 1A5FH 1LEIB 4O2EA 4Q0XL 3H8NA 2K4WA 3N85H 2A6DB 4PIRF 4LF3A 1WZLA 5JA9A 4C4UA 1EEZA 2VM9A 1SJEB 2BZDA 3IETA 3MNMA 1X9QA 3QJFB 2OYPA 2H5UA 3DYPA 3PXLA 1DVFC 3MOBL 5JUEH 2D3JA 4YPGB 1EFXA 3P69A 3SD2A 3GD1C 3QUKB 1HKFA 4MYPA 3K0WA 4W9HC 5IMMB 2A9CA 1ETB1 5ICYB 1B90A 2Y9RT 1B2YA 4P2OB 3MRLB 4XVTL 3C09B 1M71B 4KXBA 4AXWA 4ZMYA 2Z8VC 4G6KL 3P4NB 3O2WH 4JPSA 1Q0XL 4K3EL 1DVTA 3SJVB 1KTJA 4JQIL 4LQFH 1XXFC 1NH6A 3RX7A 4Z9KB 2Z4QB 4E0RA 3B8YA 1A22B 1ZE3C 2Q3AA 4GO6B 1AH1A 4LDEB 1ZGLB 5LCVA 3MLVH 4S1QH 5F72S 4QRSA 1D5MA 4J6IA 3QAZC 2AXWA 1UM5L 5GRJH 4V1DB 3ISRA 4WW2F 4FQ1L 4W93A 4WFGD 3JWNC 5I6LA 3JZYA 4H20H 1V3KA 5DA4A 2PPDA 3V4PH 4YDJB 3Q6GL 2PTTB 4WDIB 3VI4E 5JOPE 1KCUL 2HG0A 4JFHD 1KENH 4OF5A 3FW6A 4JMXA 5DJZA 5SWQB 2VQTA 1GZHC 3DGCR 1V3JA 2ZXAA 5C09D 3BHBB 3IDXL 4YXLH 5AG8A 1CBVL 4CILA 5BOZG 1QR1B 3O11A 3JWNG 3CC5A 3WBDA 1S7RB 1YQVH 1YPZF 1T7VA 4ZMQA 5CN1A 4YHMH 1INDH 5DQ9B 1KB5L 1OLZA 4OM0H 1GIGH 2GSGA 2X4OA 1XH2A 5ID0A 4EBQH 2WCPA 1MCSA 2DEYX 4X8CA 5JMRA 2AV1A 4XTRC 3X3GL 1IJNA 3WXVH 3O8XA 1OGSA 3QQ3A 4JRYD 2WYHA 2WJ7A 3LB6C 1TU2A 4NRZA 3GKWH 3RAJL 1I4FA 3QEQB 3MA9H 4XNXL 4XNBA 5GS2H 1GGBL 4JE0A 4ZOBA 3NCFB 4NQVA 4MJ6B 3CX5K 3V9CA 2VE6A 3B5HA 2ODHA 2PXYD 3OAUH 5DYFA 1I7RB 3UPRB 1J0IA 2B4CH 4XPBH 4I85A 4EE2A 1B2WH 1KLUA 4GAGH 5DUBB 4YAQB 4EZJA 3C9NA 3GRWA 3UTQA 2UY6B 2Z31C 1OSZB 3MBXH 1J0ZA 1VCBC 2IH8A 3BPNC 1WBXA 4P57B 3ETSA 2NNXA 5EV7A 2OZ4H 1H3VA 1KXTA 3CBRA 4QXWA 1F8TH 1DJIA 2R7EB 5E8EA 5M95B 2DJSA 2NZ9D 3EFFB 3QUGA 1QOKA 3MX0B 4Q89A 2LU5A 4Z7UF 5DZPA 4CVWA 2BP0B 4XB3A 1BXVA 1WFUA 3S5LG 3NCCB 2FQDA 4JY4A 1JHTA 4K9EC 2UVFA 3BP4A 1BM7A 2O5XH 1U8HB 4RFEB 4N90E 4CN6A 1GZQB 1AGDA 1M05B 3QJXA 2YBRB 1N6QH 1A1NA 4ZZFA 2EYRA 4BDVA 5C7XH 2DRUA 1H8SA 2YAMA 2C1OB 3RB7A 2EH7H 5C6WH 2YWZA 3SGJC 1DUZA 2JLPA 2VQ1A 4BSJA 1JNLH 5EBLA 5FYJL 4UTAH 5EBWA 1QTPA 2XETA 3SQOL 1DFBH 1C12A 1PAZA 3FU6A 2WM0A 2HFTA 4HU2A 1RU9H 2RAMA 1RULH 4B9KC 3S2CA 3BGFB 4W6XB 3ROOB 1B0WA 3HNSH 4ZPTB 1WGVA 4E42A 4RISL 4P4KC 5DO2D 4M5ZL 1VCAA 4GW1B 3T4AA 5E9DA 1E4WH 2ZUQC 3KS0H 3MYJA 3Q44A 1BFOA 4NKOA 1FO0L 1HHGA 2C7FA 4ZYKA 5D7IF 1TENA 3HZYA 3IFPA 5ICZA 2CDGA 3UBXI 2YPLB 4JFVA 3BRGC 4KK5C 2BVYA 5D5MB 3ATFA 1UQSA 3VXRE 4P4KA 2GG1A 1RXLA 4JFEA 4JJ5A 5FO8A 3VXUA 4WI7A 4ZMNA 3L45A 2WLLA 2BC4A 1FL5A 2BVUA 3GQFA 1TQBB 4YFLI 1FAIL 2J1KA 1DVXA 5C9JB 1I8MB 1A4BA 4NJ9H 4JHZA 4Q58C 2YD2A 5K9KB 1GA2A 2YXVA 4YR6A 4A6YB 2VAAB 4KOBA 3LZPA 1HDMA 2MHAB 5I6MA 4F7EB 4L5FL 2VLKD 2NY5H 4MQ7B 2GJRA 2R2BA 3QXVA 4C54A 5E8PB 3RNKB 2YAOA 1PNCA 2ZP0T 1WUZA 3APNA 3QK0A 1UZ6E 5DGRA 4QTIH 4PRIA 1F45A 5KSBB 2W60A 4DP2X 5CUSL 2DYPB 4NLHA 3U4KA 4ETYA 4JFUA 4NP4H 4Y4HC 1W72H 4H0IA 2X10A 3SE9H 2W9EL 3LEVH 3VM7A 4QNPE 1JZ7A 3WEAA 4P3DA 1TJHH 5IB3A 3N1FC 4HUWB 1XF2A 2JKSA 1NMCB 2EYTA 1NBZA 2VDKH 2YLHA 4Z1PA 3T04D 1Y6KR 2DH2A 1YEKL 3BWSA 4GYBA 4LCCB 1SEQL 1XCQA 4UT9H 2OQJA 1PZSA 4XP1L 3DYOA 4QHMB 2WN3A 4Z0BH 4G1EB 5IROD 3A6CH 1LQSR 1BQHA 4Y4KC 4MZIA 2Q87A 3M1OA 4FFVC 4M7ZB 5D2NE 1WTLA 1BG9A 3M1CA 4L05A 3IVKB 1BZ8A 1FFRA 4EDWL 3MLUH 2CO1A 3CFKB 1TXKA 5I23A 2Q86A 2ITCA 5J89A 2YGQA 3AS2A 4L3FA 2DEXX 2Y5TA 1D9KA 3VA6A 2BFVL 3U0TA 5K9OA 5L2KB 1JPEA 3TP4A 4N0FA 1JDDA 4NQDA 2NMSA 4NHUB 3PABB 5DK0A 1S9KC 1S8DB 3RI5F 3JYCA 4O58L 3MFGB 5G5DA 2GABA 1SLWA 1LEKA 5AOKA 2PLTA 4JHWL 4PRHA 1PY9A 2ICWB 2LFGA 3KWTA 4XOCA 3SDCA 4GKLA 2DLFH 3NUKA 1I7ZB 4OCXH 3OF6A 4LNVA 5C2UB 3LN5A 4EDXA 2K45A 3DHMA 3NAAH 2WQ8A 3FXIC 5JORA 1PZBA 1P6FA 2VLMD 3GXNA 3PGDA 3VB8A 4KXAA 3ZZLA 2EXWC 3BAJA 1NBYB 1MUJA 3U79A 3TPUB 2XPGB 1LO0H 2FJHA 2QHRH 3DKHA 2P49B 3EJJX 4XMVA 3X1BA 4NC1E 4YZFF 5IFHL 1F4WL 4LKXA 3RPBA 1RMFH 2VLLA 2XWEA 2BSCA 4W4NA 2V2WA 3OXRB 3Q9PA 1OY3B 3MRHA 4FQ2H 1MG2C 1S3KH 1KJMA 4JS7A 4CNIA 5F1IB 3BD5A 1CF8H 1RUKH 3FU3A 4TSBL 3RVVD 2R1XA 3VSTA 5HYJD 4NI6A 5BQ7A 4NUGH 1DQKA 2F0CA 1RFDL 4FHBD 4NQCB 1KCWA 1PG7L 3CCHA 3MRPB 4FLQA 2AK4B 2Z35A 2FX8L 1Q9WB 1WISA 3MLXL 4OLWL 4UB0H 5LGYA 3KPOA 4BK4A 4HIPA 2MFNA 3HPLA 4TF4A 4Z8FL 4N25A 4CSTA 1S7QA 1C5BH 1IBDA 2H9GB 4W9LC 1RZKH 3PDOA 5GSRB 3B9DA 2UWEF 1DP0A 3V4VB 3MRBA 4PYGA 1PZDA 5CEZD 1A2YB 4W6WB 1AXSB 4KK6D 4CVZA 1AE6L 3CG8A 3OAZK 4LOVA 2L7JA 1C1EL 3QFGA 3W39A 1HQRB 1C8PA 1OLLA 5E6YA 6FABL 2NQCA 1CLZH 3LKNA 1M7UA 1QLEB 1N2RA 2OCCB 5AKTA 3KLLA 1AFVL 4XCEA 1PZ3A 5DVLA 1NBQA 3J2PA 3HE6C 4PHZA 1MFCL 3VNYA 4J7RA 3QXDB 1DQDL 4TVPD 2XYCA 5I1EL 1N0LB 2IWEA 5E1QA 4HV8B 1S7WB 3F6IA 4JM2A 1JGLL 1QLEH 3NESA 5I1AA 1U0QA 3OKDB 5LGHH 1UZ8A 5CZXD 3CZFB 4FXKC 3MLWH 3HHSB 2ZWLT 1MH5B 3UAEA 4UU9B 1WITA 2IOMA 5AVXB 4XPFH 2OR7A 2LVCA 3RWCA 4XO8A 5BVPH 2ATPB 1F56A 4XN4A 1NLDL 4S1DD 1AY1L 1QPXA 4UMGA 2WD0A 1L9SA 2ZXCA 4BFJA 3WKQA 3Q8BA 2Y24A 4L4VA 2NY2D 5E08L 5GXBB 3WDJA 5IOPB 2DL9A 3H3PH 3STZA 1LO2L 1OP5H 2AQ1A 4ONOA 3W9EB 3V79C 3SGEH 5DRZB 1IU1A 2HRHA 2JB5H 3QULB 4WO4A 3T6QC 4Q4IA 4HKJB 4DN3H 4QRRA 3RG1C 1HE7A 2AGJL 3U7YL 3FQ2A 5I1CH 3L3OB 1GJIA 2VGLM 5EUOF 1G1KA 5SWSA 1KDJA 3QPQD 1RUPH 4D0CB 4NZFA 5E2UH 5AENA 1OZTG 3H9HA 4WY7H 5IVZB 4LLQB 3GLZA 3DC0A 5TQ2H 4OLZL 2EDOA 3FO1B 1QW8A 4MX7B 2WQUA 2CLZB 2PP8A 3NCBB 5CINH 2WQAA 1G7LA 1P1ZB 1TPXC 3KJ6L 3Q1EA 4ACTA 4UMSA 3BUBA 3SKJH 5I76A 2ZOUA 2QSQA 5ECJE 4XMLH 4RRPM 5TE6L 3UIZA 5KN5A 4ETQA 3QNZB 1F5WA 4WTZA 4TSAH 4KRNA 1ZANL 3T3MB 1U95A 3NOIA 4RDBA 5EUKA 1KN2L 1U8JA 1ZT1A 3QB7C 4OF6A 2E4TA 4NKMB 1P7KA 1UH4A 1WC7A 4ORZC 1M9WA 5FA3B 5I71B 1I85A 1CDYA 3LNFA 4HBCL 1M7IA 2QADC 3GT6A 5B39A 5D4IA 5E2VH 1IEBB 2HJLB 5GGUB 1NUDA 5I1GL 2DLTA 2YMOA 2IFGA 3TBSB 1KZYA 4U1HB 3U9UB 1AQKL 4NZTL 5IMKA 4PJCA 1TITA 2UZIH 3BOVA 1LE5A 4WEMB 3N41F 4OZFB 3MV7E 3L95A 5ABDE 3WS3B 4X6BA 2NXZB 4AYBA 3CDFA 4EXPX 2X7LB 1O7VA 2B2XH 5HVFB 1TEGA 1IARB 1WCQA 4BA0A 2BS9A 4JY5H 4RMSA 3CC1A 2ZJSH 3VFUB 3G6JA 3KWUA 5HI5D 5ESQB 4CN1A 4QYAA 4AWJC 4DP9X 3GGWA 4JPWH 3FO2A 4ZFFB 1P7QB 1V05A 3L4YA 4L1TA 2FT6A 1ZCRA 4G9DB 3DHPA 5D2LB 1DL7L 1N0XH 1NOLA 1OCWH 3VGBA 4V1DD 4X6CE 3IBOA 3VJ6B 2EVFA 1W8EA 4E36A 5E70A 2WY3B 1KGUA 4JFXA 3M86A 2ZX7A 4ZMTA 1SLVA 1GOFA 2JCCB 3MFFA 5C09A 1CFQA 3NP3A 1S6NA 2WOBA 2FWLB 1DJGA 2IXQB 5CBAA 2HP4A 4TOYH 4QHLA 2XTJE 1YY8A 5D1XE 4W4OC 4AV5A 4FZ8L 1JJUA 2AJYH 2OX5A 3EH2A 5DT1L 4ZZKA 3SZ6A 3IRPX 2CHNA 4OZHE 3WFZA 4ZFZA 5KS9B 1E9QA 1VF5C 2MKWA 4XNQB 3T0EB 2UXFA 2R29L 1NGQL 3UH8A 4HJUA 4JRYA 3DO7B 4I1PA 3VFSB 2EDXA 2ZX9A 4YHIB 2JKTM 3WY3A 3TH3T 2FL5A 3DOSB 3FFDB 2PXYA 3L5XL 3MLSL 3QEQD 3FSZA 1EK3A 4QRPE 3REWA 2NDFA 3VW3L 2YXMA 3N1QC 5L4JA 3CE1A 4A7SA 5HVGB 2NUPA 4G7VH 4DKEL 3NQKA 1YJDH 3MLZH 1NKGA 1PFOA 1NCTA 3AXIA 4FULA 2BVTA 4HWUA 4L4TE 4UINH 3FO9A 1KBBA 4L37B 3SOBH 1N59A 4I5BB 3NDZE 1U8QA 3CQQA 4CSSA 2QFPA 5HDBE 2R51A 4IRJB 2YGPA 2CBPA 5DK3A 4M1GL 5ENWB 1JSYA 3RNQA 3VDAA 3WFBH 1N4XL 5DZLA 4DEWA 2AZAA 2NY6C 9PCYA 1U3YA 5TE7H 3CFMA 3JWOC 32C2A 5ITBL 2Z1PA 2VDPH 1IC4L 2XQYK 4YHYB 1QSFE 5HVWA 3RX8A 4DZ8B 1H0DB 2QQKH 5DYOA 4I77L 5E2TH 3V52L 4AL8C 3BP5B 1OAZH 3MRGA 1MCPL 4KMLB 4YDKH 4F37K 3II3A 3GLDA 5FO2A 4P5SA 2D7TL 4GKNB 4YXHH 3GWJA 1PLGH 4D8OA 5DLLA 1T3FB 4N8VG 1QP1A 4PJIE 3DJ9A 3VX1A 3CAFA 4NLAA 2F6AA 3QJHB 3GM0A 1ZLSH 3UYOD 3L3JB 4UF7C 5EORH 5DHEA 4I3SL 4O2CB 4N8VA 4YE4H 5E51A 2BOBB 3V5DB 4LCYB 4ECNA 3D8MA 5F7DA 4DOHB 2ZKMX 4OIIL 1CVSC 4HJSA 2DH3A 2YKKA 1N68A 2XNAB 5KVFH 1E8ZA 4UWQB 2WQRA 1RP8A 3V5HA 4PJEB 4RAUA 2EILB 3MKGA 4CW1A 4X4XB 1H9DA 2J6WA 3WHXA 1DN0A 3EH3B 4JG0H 3PV7A 2AKRB 2DQIL 4LRIC 1CFMA 4G70B 1ZHKA 2YPLD 1AGCB 2XQ0A 3GYRA 1E65A 1FNSH 1MKFA 1UEYA 4TV3A 2WB7A 1MRDL 3WMQA 2P8LA 1W0VA 4JDEB 1BQ5A 3LMJH 1IFRA 4RESB 5AKRA 1IEHA 2D7MA 1HNFA 4RGOL 4BCYA 4LSRH 3NZ8B 2Y07L 3HG5A 3HZMB 3NZHL 1UURA 3UROR 5IGXH 2NW2A 1M1SA 4JY6A 3UTPE 3CFUA 1IAMA 1QO3B 2FB4L 1FFOA 4GEJA 4NDMA 4B9GA 4HHWA 3WE6A 3FT4B 3GMOB 4P46D 4X8GA 3RA7H 2VLKA 4PJDA 4WJKB 4YH6A 4X7CC 2IMNA 1DBJL 4NCC2 2EDMA 2NPLX 2MJWA 2X6BA 1NICA 2WVSA 2IPTH 3L81A 4OJFL 2C4FT 4BEIA 1P4BH 4O9HL 5E8OB 3H85A 3SKOA 2AABL 3Q1SL 4ZTPH 2GVYA 2VZ1A 1F00I 1GC1H 4HJ0C 3VM5A 2DYPD 3M88A 4HUNB 2N7AA 4LLYA 5IROC 2OTWA 4S2SA 5TH2B 3KR3L 3DPBA 1XF3A 3D4CA 3HNVH 4IU2B 5TDOB 1MDTA 2WPGA 5INCA 1R5VA 2IVFC 3JV6B 4JB9L 4NFCA 4Y5XA 5CEXA 1G0YR 1A14L 1U4EA 3ARDC 4M6NL 5HHMB 2Q3XA 2W59A 2BW4A 5AVZB 4S0HA 1XGRB 3EJSA 5CKGA 4YX2L 4Z7NF 3PP4L 4OLXL 3O0RL 4QY8B 3UJIL 5DJCB 3BWUC 4D9QE 1R24B 5IROA 3MRDA 4WWNA 3U7WH 2CUMA 4B96A 3QQ9C 4QF1B 1YYLH 4YFLF 2A4ZA 4ODBD 4M7JL 5DD6A 2FTAA 2V7HA 3BLPX 1DQMH 2NY7L 3GXTA 2FYVA 2IC2A 4AOFA 4CBPA 1JMXA 4AQ1C 4IOFD 1A6ZB 1OGTA 3B9AA 1OCCB 3U83A 2J1WA 1M2VB 5HHOE 5EB9A 4YXKL 2I9LB 2YD1A 3ZUCA 3MV9D 4IRZH 5GGSA 3ZSSA 3IGAB 1ZLEA 1BV8A 3ARBD 2GQHA 2YA0A 4RFNB 5L2KD 1P9MC 3PQYE 2PWGA 1CYXA 1RV6X 3MKKA 5I74C 1DR9A 1FORL 1MSPA 3IDNA 5DHYB 4B50A 3S5YA 1HYSD 2WZ5A 2LLNA 1OAYL 4F7TA 2CCLA 3KJ4C 2J7LA 4AQ1A 2ZUYA 1N64L 3PV6A 4DGYH 5JHDB 5EOCH 4PRPD 4DVBA 5DQJA 3TEZA 4M5YL 3GMMB 4LGRB 4XZUA 4YLBA 4P2YA 1NIAA 1P9MA 4OCSH 1KTRL 3ECVA 3P73A 1M6OB 1OAXH 1ZLWK 3AVEA 4HS3A 5E7BA 2CBOA 1IC1A 4M56A 2O5ZL 3RVVC 2H7WA 2EC9T 4OFVA 5AKSA 5I75B 4K7PL 4ZPVA 1FBIH 1A25A 1UCBL 5C8JB 1FV1A 2IDQA 3GSVB 3BH9B 1ZV9A 3RDJA 3VXMD 1GYAA 4BZ2L 3FK3A 4APXB 1RHFA 3D25B 5IK3B 4PJ7F 2WSDA 4GMTL 4QOKB 4XVSH 2EIMB 5HYJA 2CIKB 3PPEA 3W57A 3FTUA 3RVUD 2C9PA 3BEWA 3HN8A 3RL2A 4MA8L 2J21A 1A0QH 5I8KH 4DPBX 1BIHA 4O2FA 2A73A 2PWFA 1U58B 2BVQA 3QG7L 3KNBA 4KQ4L 3N3EA 4NQCD 3H55A 3K81A 1UT2A 2KHAA 2YPVH 3WIAA 1PZAA 2AK4D 3U4AA 3DOHA 1NC2B 3E9UA 3Q13A 5AAMA 4TTDD 2J72A 4YBLC 3UDWC 4WI8A 3CTTA 3J27A 3FHEA 3LV3A 2IFFL 5EC1B 3ZYIA 1B4LA 5FW7A 4RFOL 5IJKA 3QBTB 3BT2L 1ML0A 3WFHB 3WFCL 1NAML 2H2SC 3BO8B 4DK3A 1FNGA 3FYEB 4LOFA 1NQBA 3QG6B 5DEGA 1YNLL 4M8UA 4Q4EA 1MFAL 1WT5C 2X70A 1A7RL 3QRBA 5AVVB 1COBA 4LEEA 3FS9A 5CWSB 1I8KA 2RR3A 4KUCD 5ESAA 4GI9A 3V0WH 2HN7A 2UX6A 4OUUB 1AR2A 5GS1C 4EEEA 4X9YA 3KLAA 2H2PD 1K3IA 3LNEA 3F01A 5EFIB 4HWZB 3W37A 3PL6A 2FGZA 3VA2C 3E8VA 4G11A 4HCRH 2BHFA 5C0RH 1CWVA 2ED6A 1WT5A 3D69A 4F7MA 2XBDA 1SN0A 4YNYA 5HYQB 4OGXL 1MF2H 1XGPA 5EIVA 1A6TB 5E6RB 2UZXB 3LDBB 4L29B 1SM3H 4E9YA 3DURB 3GM8A 4JDVB 5GS1A 2FO8A 4Q14A 4PV8A 4B9PA 4IMKC 3ETBJ 3MRQA 8CGTA 3PGFL 1OM9A 4HFWA 1KV7A 1EBPA 4QDGA 3SDDC 1G9ML 1OVZA 3PHQB 2E46A 4H4NA 4LLDB 5D7SL 4NQXB 1FNEA 2WWMC 1DDHB 4GRWF 4OD2A 5DRNA 1E5CA 3B2VL 1G7QA 4ZUVA 3F85A 3VD0A 2PYEB 2B77A 4B3VA 2NSQA 1J87A 4IOSD 4IRSC 4N9GB 4XI5D 4DK5A 1A02N 3QXAB 1MHPL 1JXFA 3W82A 2A6JB 4R7DB 1NOAA 1TTFA 2P3YA 3DX1A 1S9XA 4L3CA 5KVFE 3ZHLA 1TMCB 2ZXEB 3DWTA 3PP3K 1BQLL 4P5TB 3NMEA 4PJ9B 5IJCC 3GXIA 3F58L 3CFBB 4JUTA 3HR5B 4GIPD 5I66B 2CKBB 1IQWH 3UCQA 1CFNA 3APMA 5T8IA 3UCRA 5IUCA 2ZXGA 1FVCA 2BVEA 1CE6A 4H26A 4GSDL 2A9ML 4GG6F 4YVUA 3F7QA 3E1ZA 3ESMA 5BO1L 5T33H 2WYTA 2A6DA 4P2OC 8FABA 1LQBC 1INEH 1FG9C 2VR4A 3DV4B 5EZIL 2KQMA 3KH4A 4WK2B 3KD4A 1ZS2A 2F5AH 4KHXL 4HWEH 4WWKD 4OJDH 5FKAB 3CLWA 2GTZB 4FKEA 2BNRE 4KJPD 3IGUA 2HPOA 2ZWZA 1VFBB 3QUKA 5IMMA 2JTDA 3UADA 2HSIA 3WKPA 5ICYA 3BPCA 1JMZA 1UEMA 3MRLA 1O7DE 1SLXA 3EDFA 1UB5B 1Y18B 3DVFA 3EBGA 1M71A 5HGGS 3MDJA 3DX9B 1R9FA 2FDBP 3OC5A 7FABL 1OEZW 4KOCA 1DQLH 4K3JL 4RAHA 1KLFB 5AAPA 4PJFB 3AG2B 3AM8C 5F97E 5GGRB 4ZDHB 2JJSC 2AJVH 2Z4QA 2SEBB 4U1NB 3KWVA 4S1RH 3V4PA 4BK8A 2O6FA 2W81C 3X1GA 2FRGP 2IIJA 4PRBA 1NPJA 5DR5H 1YEHH 1ZGLA 1XH0A 2DM4A 4K9EL 1IQDB 5FYLD 1E30A 4L1DA 4HZLB 5DJ6A 1AYRA 1FUNA 2EE3A 4LL4A 4V1DA 3D5OF 3PGCB 5FO7B 3QO1B 3UC2A 4R2GB 5GS0C 3LNGA 1X5XA 4YDJA 4WDIA 1XFPA 4QRAA 2OV0A 4NZUL 3TEYA 4NIYE 2YD3A 3BHBA 1USZA 5EULV 4Y1AB 1QR1A 1E40A 4QLWA 2XWCA 5EWIL 3REVB 4HHGA 1I8AA 1KYUA 3ML9A 2CRZA 2ITEA 2AJZA 3UXFA 1TJMA 3WKYA 1HI6A 1JNHB 1U30A 3PHAA 1DQQA 4XN7A 3DSFH 5C0CB 2OJ1A 3EZJB 4OR1A 5FPIA 1MAJA 3CQPA 3TT1L 2VT0A 3PYCA 2ZWNA 1S5IL 3QEQA 1PZ5A 4LAQH 4PGJA 5DMKB 1E90A 3QZWB 1BW8A 1MWAB 2C1PA 4BKTC 2WKLA 2D3LA 4NZRH 1R0AL 3F2LA 3C8DA 1LDPH 1JXJA 5JZ7D 3STBA 5DUBA 4YAQA 2BJML 2UY6A 5FF6B 5GQBA 1OSZA 2BWDA 2ADIA 3FQ4A 3GPEA 5FGRA 2APVA 1MWAH 2H6OA 4I48B 4P57A 1T03H 1QWNA 2FIKA 2R7EA 3D0VB 4NUMA 4AX3A 4P3CH 3EFFA 4ZAKB 3MX0A 4B9FA 4HSQA 1XBDA 1EXUB 2YS4A 2CH8A 2BP0A 4IRJD 2XIIA 1UWXK 1BMGA 2BVPB 1UGKA 2DQHL 3N41B 1GGTA 3LS4L 3SYCA 3KPQB 4R7LA 3UO1H 4HOXA 4IOIB 2EDFA 3L1FA 1O0VA 4JFYB 1LHZA 1U8HA 3O4LE 4RFEA 1GZQA 4FQIH 4XODA 1MJJA 2MWCA 1M05A 4UTAA 2YBRA 3PPSA 1ZLVK 5IHWA 1MY5A 1R33A 3EO9H 2C1OA 2B8OT 3IRZA 4ZMAT 2DI8A 1UWGH 4A39A 2AMGA 1WBZB 3AREB 5KBLA 1UD6A 2QHLA 3NACH 1DBKL 1NCCH 1MCQA 4LLWB 2D31B 3DIDA 3GLAA 1YYCA 3KWWB 1QFWM 3JTTB 4ZPTA 2B7DT 1J88A 3G9VA 2P28B 1J10A 1H15B 2GT9B 4L0PB 4N20A 3FU7A 5D7JA 5KBDA 4OZ4A 1O9ZA 5DHVH 1GSKA 3VYNA 1A64A 5I1KH 1K5WA 3X12B 1CDBA 3WENA 4YHLL 2BP5M 1I9IH 2DYSB 3BAWA 3LCYA 1CICB 4LL1A 1ZA6B 2YPLA 4X9BA 5J6HA 2EVIA 3L3HB 1J5DA 5FM4A 4GEIA 1HHIA 4LHJB 5ANMB 4F3FA 2G0LA 2V5YA 1F1GA 4LSVL 3VACA 3DNKA 3ARGD 4MJ5B 5EF1A 1YEFL 1QEXA 4HGWB 4JR9L 5K5YA 4X7TB 3U2SA 4C56B 3W2DL 4XMUA 2R0LL 2VSMB 1JGVH 1NFDF 2CHXA 4AQEB 1I8MA 2CBQA 2PW1B 1JV2B 2P8PA 3I50H 4HBQA 4CC4A 3H6AA 5K9KA 1K3ZA 4TUKL 4P46A 4A6YA 4E68A 3S8WA 3GI8H 4HGKC 4WHTB 5F21B 4F7EA 2XZQH 1SYSB 1NMCC 3FUFA 5E8PA 3RNKA 2DF3A 1ZDQA 3R4RA 3ILPB 4GH7B 2NW3B 2IDUA 5KSBA 4KXDA 1ZS8B 3PNRB 1N5YL 2DYPA 2VDRL 5KWYC 5KVEH 2VC2L 3GBLA 4OZIB 3OKNB 2VN6A 1P84K 3OPUA 3HMXA 3OZ9H 1FZMB 4UT9A 1UFGA 3I6KA 5DUML 1LK3H 4HUWA 2XPZA 4TQ8A 2I25N 4TULH 4WTWA 1CFVH 3ESNA 4ICXA 3L16A 3UC0H 5F3BB 3AU1B 3HMWL 5K9JL 2H8PB 4ZXBC 4M7ZC 4Z18A 3TT3H 1FYHB 1P7BA 3QC5X 1A3QA 1FN4B 5HHMD 5DF0A 1NM4A 1V7NH 4HWBH 5E1HB 4LCCA 4OB5H 1RHHA 4OVUA 1DJXA 4GT7A 5D4JA 4ACPA 3IBEA 1QRNE 3MJ9H 4QHMA 4G8FB 4KKCD 4G1EA 3VXRB 5HHXH 2CGRH 5FECA 4U33A 3KPMB 2GIYA 1Z32X 1YC7A 4LOUD 4MXWL 3Q3GA 1HXYB 4WNJA 3BUPA 4GJTB 3MRNB 4PWEA 1J1PH 2F58L 3GUFA 5FUOH 1HNGA 1IFGA 3CFKA 4OW6A 2Y69B 4WWOA 3ZY7A 3VD4A 4QJ4B 4I18A 1X5AA 3MV9A 3ARBA 3WUZA 1ACYL 3GLEA 5L2KA 5E2WH 1R6VA 4CGTA 5HYFA 4F20A 3W81A 1BECA 1XD0A 1CIDA 1K5NB 4NHUA 2NQDA 3PABA 4ODVL 4OLEA 1SHSA 5PAZA 5LNGA 1BX2B 3T0WA 3QYNA 1S8DA 5KYYB 1LVEA 2P5ED 4MKMA 3CQFA 1EEQA 1AIFB 1E5BA 4U49A 3TM6A 5DC9B 1KYOK 1N12A 4OD1L 4AEEA 4LEOB 2P43B 3ASOB 4PRPA 4JFDE 4NNXB 4PR5B 3ZDXF 2UVEA 5JHDD 2P46B 4JPVH 1DANT 2BXZA 3S34L 1I7ZA 5CF3A 5AW6B 4F37F 2Y36L 2WBXA 1V5JA 5HVHB 3TWCL 2O93L 4JQVA 1BOYA 3FQUB 4JFFB 2A6KB 3NA9L 2PABA 4G8IB 1QW9A 4HDIB 1UD4A 1CFTA 3VXMA 4QRQA 1J8KA 2CJTA 3TPUA 2XPGA 4GMSL 3KBPA 4AGLA 4G6ML 1KJ3H 5A2KH 1R3IH 1X5JA 4H0HB 4ISVB 2WZPD 2WUBH 4TTDC 4J3OD 4S10A 2EDRA 3P11L 2EDNA 5ABZA 1HE8A 3EJQA 3MUGB 3S35H 4AIEA 3KYMA 4XH2B 3D12B 3BVNA 3SO3B 4QOKD 4OCYL 2RBLA 5F1IA 1FZJB 5FUCC 1JCVA 3QO0A 3WYRA 4F57H 5GZOC 1G6RL 4MA3B 4NQCA 5D2NB 1Z5LB 3MRPA 3MRCB 1MXGA 5AOMA 2APWA 3VSVA 2AK4A 2JV6A 4NKIH 3RY6A 1Q9WA 5ISZB 1SNRA 3T9WA 1M6UA 3UBXB 5IHZB 1IKNA 2M83A 2O5NA 2XWRA 5LB1A 3V7AG 2LFEA 4OZGB 2H9GA 3O2VH 3KLSA 1RZ7L 3K4DA 3UG4A 15C8L 3TOPA 3K46A 1GCFA 3LZLA 3WIFB 3Q0HA 2WTOA 1FG2B 2CO3A 2YRBA 1AXSA 4GUPB 2E3VA 4QXGH 3BPOC 1RD6A 4PSPA 3E2HB 1HQRA 2DWTA 3CN3A 4IBLT 2H3KA 4OI7A 4JFZH 3FSOA 2PP9A 2ITFA 4P8QA 1BF5A 4JHBA 4ZNCD 4YK4C 2OXHB 5JIQA 5HI4C 3QXDA 5D1QC 1N0LA 5E0QA 2QJDA 3FUDA 2HCZX 5F7HA 3B2MA 1DQIA 2R4SL 4HV8A 3WDIA 5IHUL 4G8EB 3DETD 4IDLA 2AERT 3O41A 3MV8E 5HD8D 3OKDA 2R4RL 2CBMA 3V0AC 2IH3A 2L7UA 3EYUH 3HHSA 2BSSB 2QPUA 5DTFB 4YWGH 1MH5A 2R9HC 4UU9A 4LVNC 1QFWL 4AEIH 2Q9OA 5GJSL 1P6WA 5I8EB 4PJBF 5MERB 2X4UB 5EC2B 4F8TA 2ATPA 3CHPA 3MUJA 2CR0A 5IQ9B 3F12B 4PBVC 3H6JA 1MRFH 5KVGH 5I1DB 1MNNA 2I9TB 4WI5A 4CKQA 2BY3A 1NBVL 2C4FU 3TIEB 3QORC 2XTLA 3HN5A 3H4FA 4Y7MA 3A6BH 2QGEA 4LDCA 1PDKA 5HPOA 3EGDB 3O6LH 4DPRA 3ME0B 3W9EA 5HGBB 4JN2B 3MNZB 1DJZA 2EINB 4R96B 5CEYB 4AQAB 5AL8A 4IOSA 4KWUA 1H8NA 3QULA 4OFPA 5LQBL 1JZ2A 1MFEH 1ADWA 4J27A 4JO4L 1YN6A 2A9DA 3L3OA 4DP4X 2N1TE 2HPTA 4P59H 3KLHD 1TFHA 3BAKA 4PJ7B 4AJVA 5AYTA 1KXVC 1DJWA 4D0CA 3B1TA 2QVKA 3KZ8A 2O26U 4PJ9D 4P5TD 4LPXA 3NABH 2CALA 3NCMA 4X9FA 2FJSA 2CLZA 5I71C 2B0SL 4DETA 3BJLA 3BDBA 1YQ2A 2GJJA 4KJPC 2QQNH 1NDMB 1UOLA 4LQ1A 3E6HB 4H44C 2I32A 2CCVA 2CO4A 4ELKB 1ZTXL 2FH8A 3A23A 2B3IA 4MXQD 1KXVA 1WBYA 3QNZA 5J4MA 3IXAA 1TZGH 4HIXL 2C9AA 4R83A 1HT6A 1ND0B 3MRRB 3CXFA 3R1GL 1H6FA 4NKMA 2NXZC 3AMLA 2WLZA 4X6DF 4WWKA 5FA3A 5EOTA 4ZT1A 2WBJC 4DTGH 1KACB 3WN5C 4R6UA 4LDLB 1NUNB 2ZX6A 1U8CA 4P4RB 1IEBA 2OSWA 2HJLA 5GGUA 4OZFG 3RWJB 3K3QA 3TBSA 4BD4A 3QCTH 4U1HA 3U9UA 4KI5F 2P5WE 1HZKA 5CBEA 4EI0A 2PCYA 3G5VA 3V6ZA 1XH3A 4DCQA 2VL5B 3WS3A 4R4FH 2Y23A 4KTDH 2X7LA 2YD9A 1J1OL 1BYPA 2QQLL 3KHOA 3KG5A 4X99B 1X44A 4ODUB 5T3XH 2XVGA 4Y4FD 5CJBA 1OD9A 1T2QL 2EE6A 1FLRL 2EC9U 3PFQA 2HXAA 3ARYA 1L6ZA 1FLTX 3GUTA 5IW3A 3VD2A 2A3TA 3LKSB 1FJ1B 4R26H 1WTGT 1LE9B 3SEPA 4N9OB 3D3VB 3HG1E 3Q43A 4G9DA 2BOCB 5A16B 3JWOL 3OMNB 4YL4A 1TQTA 5D2LA 3AAZB 1G4RA 3N2JA 1GGIH 2F61A 4R8WH 1DUYB 4XP4H 1KJVB 3GMNB 4R2GD 4FQLH 2MTPA 3VJ6A 3VXTB 3WO4B 4AL8L 3T0EC 2JCCA 2ZXQA 4WHYG 4NFDA 2IXQA 4HJ1A 5DJ8A 5CLXA 1MFBL 4J6RL 4Y1AD 4Y19A 3CK0H 5C0IB 4J3SA 3ZTNH 3BIKB 4ORGA 4GRWH 5FHAH 1H3PH 4WTXA 4RNRB 5JZ7C 1N67A 1MEXL 1TLKA 2X4NA 2RFXB 2QPEB 4FFYH 2E27L 4WFFD 3PDGA 5KS9A 1OF0A 3TFKD 1MY7A 4HEMA 5MEPB 5C0CD 3DO7A 3VFSA 4YHIA 3MV7B 5GGQL 1FSKB 4M6MH 2Y3NA 3FFDA 3PWJB 3OLGA 3NEXA 2XG5A 2CA4A 5CXPA 2WSKA 2BRRL 3FH5A 5ESVB 2HVBA 3ASWA 3BP6B 5KAQF 5LNDA 4R90H 2V9QA 2BX5A 1FFQA 1JFQH 3VMOA 2EIZB 1I8IB 3ELAT 1G9HA 3SGKC 2CXGA 4EIBA 1YEJL 2HJKB 4IRJA 4C83B 1XTMA 4ZAKD 4JN1L 3CSYB 2OI9B 3RRQA 3AQZA 4JFWA 4Q6KA 1IGJB 2ZZUT 4G8GB 1XD1A 4X6CB 2J20A 3P9WB 2DWDB 2H1LM 4DKTA 3APDA 3FH8A 3MOBH 2HT4C 5SV3A 4DZ8A 1H0DA 3GBML 2DW5A 3KYNB 3ZKND 2G4EA 3HE7B 2YC1A 3BP5A 3OJDB 4HS8L 4UQ9A 1ID5I 3ESUF 2ZCHL 1E4HA 4H25B 2XTJB 5IY5B 1JPFA 4GKNA 1YEWA 4AMWA 1MFVA 1RPUA 2WXFA 4XVTH 3VO0A 2M26A 3ARED 4G6KH 1M7DB 3BVXA 1JWMB 5AFAA 1Q0XH 3FHAA 1T3FA 3CXHJ 4K3EH 1JZ5A 1A6UL 4X83A 4JQIH 1RZGB 1L7IH 3BVTA 4K3DH 2BOBA 3V5DA 4LCYA 1OCZB 4N2CA 4OIFA 4KZDL 1BFVL 4LSPL 3SE3C 3U1SL 4ODTH 1ADQA 5EBMB 4QRPB 5AG9A 2XNAA 4P9HH 4XE0A 4YC2B 4LZKA 2YD8A 3VFVB 4A2LA 4Z7NE 3APFA 1UM5H 2G3NA 4IKJA 5FWQA 1D5BA 4XBGB 1EMTH 4BELD 3P4LA 4XBEL 2AKRA 3HTLX 4LPYA 1IT9L 1AG6A 1HIMH 3OAZH 1CICD 5F6IB 1AGCA 1KCUH 4XO5A 1OGPA 4IEFA 4L4TB 3RX5A 2K1MA 2GI7A 3EXLA 3ARGA 3O45B 1ZK5A 1TQVA 3BZFB 4JDEA 1CBVH 5L7XL 3FC8A 3B2XA 3L1OL 4HKZB 4BKLB 1XO8A 2OP4L 3BLKA 1IAOB 3ULAB 4E9XA 3NZ8A 5EIQA 4JGMA 4C56D 2MQ0A 2WO4A 1KB5H 4RMVA 5IQMA 2IH9A 3HZMA 3VVVA 4NOFA 4OD3H 4HAKA 4MA1B 4JO8A 1S7TA 1FQ9C 3O2DL 1QO3A 4XNMA 4ZMOA 2X12A 4KAQH 3Q5YA 1JZFA 1XMEB 4PJHF 1AS7A 5FS5A 2WKOF 2UYLB 1GTNA 3BUIA 2BW5A 2PTVA 1BFSA 1GGBH 4XT1C 1F58H 1KXQE 5FGCB 3TIDB 5D1ZB 4WENB 2XV0A 3T3PF 2DLHA 5FGBC 3LXCA 2WVTA 3QJUB 5GGVY 4PGBB 4Z7AA 5T3ZD 2C3WA 2FX7L 2KC0A 3DTXB 1SHXA 3CU1A 2V3FA 1JXDA 1JF5A 4OGAD 1PD6A 1MW1A 1O6TA 5DJ2A 4IU2A 1A7OH 1L9NA 2XBZA 2QGCA 4N87A 5JIIA 4KX8A 2I7SA 4AY0A 2APXA 3S97C 3JV6A 2LGNA 3BIBX 5BJTB 1NDGB 3DMMB 3BUQA 3L4UA 5FGBA 3EYSL 5KSVA 2YAHA 1XGRA 2EZ0C 4WUKH 1J5CA 4QY8A 1AP2B 3E7JA 5DJCA 4XMKL 4OM1H 1KFGA 3PWPE 4M43H 3LX9A 4RFNC 5H2BB 2YO3A 1MVYA 1CFSA 3VXRD 1FYTB 2D8KA 4IRZA 1J1XH 2D73A 5IG7B 3TJPA 4JQXC 4BH8B 2J8OA 5FV2A 3VRIA 5TDPB 1KYOJ 3U6XS 1E28B 2I27N 1A6ZA 2VZSA 3FZUC 5FYJH 3IDMB 4PJGE 1TVDA 2ICES 3BPLC 3QRLA 1SXBA 2I9LA 3FB8B 1QQDB 2Y6TE 3IGAA 4M6AA 1PAMA 5C0NC 4FXTA 1TNMA 1OM3L 2P5EA 4OJCA 5E23A 5DHYA 3SCMD 4G2AA 1JTPA 1OPGH 4X7SH 3JV4A 3VFWB 3ZT7A 4EF3A 1HYRC 4N2OA 4OTXL 2V3DA 4KKAC 5JHDA 4FCHA 4L1BA 4LVOC 1FO0H 4E41B 5H94B 4X5RA 2OJZL 4DKDC 4J3OC 4XP5L 5L6YH 1BVZA 3SDYL 1EXGA 1F4AA 3GMMA 4FG6D 4I9WD 4GKSB 3A21A