1PZBA

The crystal structures of reduced pseudoazurin from alcaligenes faecalis s-6 at two ph values
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
120
structure length
120
Chain Sequence
ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSEUDOAZURIN
publication title The crystal structures of reduced pseudoazurin from Alcaligenes faecalis S-6 at two pH values.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Electron transfer(cuproprotein)
total genus 31
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 1994-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1pzbA00
3WI9A 3D12B 3WNIA 1KBVA 6PCYA 1N70A 1BYPA 4DP0X 2QPDB 5AFAA 3G5WA 4G7RB 4CSZA 2H3XC 2H5UA 3NSFA 2WO2B 1ET5A 3OD3A 1AR1B 4NERA 2XXGA 2CAKA 4A2DA 2VSMB 1KCWA 3KW8A 2J57A 1NIDA 4E9SA 4Q8BA 1WA1X 2VM4A 5E9NA 1ILUA 1ET8A 2JXMA 3HB3B 2UXGA 3PCYA 4HCIA 2GC4C 1IC0A 1W6WA 4E9WA 5B7FA 1TU2A 2XXFA 3ZX1A 4GP8B 3N2JA 4DP9X 1GS6X 3QQXA 5B7EA 1XB8A 5I5JA 2XV3A 3X1NA 2CCWA 5D4JA 2VMJA 1V10A 4YSOA 2XV0A 2FJSA 2YAFA 3CDZB 5D4IA 2BWDA 4FA7B 2UXFA 2X88A 3N55A 1JVOA 2GI0A 1ASQA 4MFHA 2AFNA 2FT7A 2VW7A 4UF7C 1XB6A 1GS7A 4JHVA 3ASNB 2PP9A 3IN0A 1PMYA 2QPEB 2J55A 3S3DB 1FWXA 1EHKB 2Q9OA 2ZXWB 1BXAA 2YXVA 3T6VA 3QJUB 1NIFA 4F2EA 1A4BA 3OMNB 2EILB 2GB2A 1I53A 1PZCA 3AG2B 1L9OA 3TASA 3FPYA 1M56B 1M57B 1OE3A 1AZRA 3FU9A 5PAZA 5TK4A 3ZIYA 1ZIBA 4TXVB 4AKOA 2BZCA 1AAJA 1BQRA 1ZDQA 3NSDA 2N0MA 3S3CB 3TBCA 1J5DA 3ZBMA 2HRGA 1MDAA 2BWIA 2IDUA 5TK2A 3WG7B 4BDVB 1GR7A 3EHBB 1AS7A 3CVDA 3JTBA 1ADWA 1PCSA 2BP0B 1XB3A 3DIVA 5B1JA 2HLEB 4A2FA 6PAZA 2DWSA 1ZDSA 1FA4A 4F7KA 5AKRA 1KCBA 2FQFA 3MX0B 4BWWA 3QJTB 3FS9A 3WKQA 2AANA 3DKHA 1URIA 2I7OA 5F7AA 3SBQA 1NZRA 1J9RA 3CZUB 4DPCX 3S8GB 5I6PA 1JERA 1L9RA 3NYKA 4A2EA 2OJ1A 1TKWA 3FT0A 3MBWB 2JFCA 1MG2C 1OF0A 4JHUA 1HAUA 2HZHA 1E67A 4CSPA 1SJMA 2MRYA 4JKNA 3NJIA 4A2HA 4DP6X 3ASOB 1L9SA 5ANHA 4GXFA 4DP8X 4KO6A 3T71A 1E5ZA 3H56A 1CYWA 1E65A 2ZONA 2OV0A 3OMAB 1X9RA 4ZK8A 3U25A 4AZUA 3NT0A 2J5WA 1BQ5A 1SDDB 2PP8A 2AVFA 4G71B 2HRHA 2E86A 1BXUA 1QLEB 4AI7A 2FT6A 3NJMA 3UAAA 1JZFA 2FT8A 2EIKB 4FAAB 1FFTB 1NPJA 3EH5B 3QJSB 2CALA 2YAQA 3AG1B 2J56A 2QT6A 3T6XA 4GYBA 3RYMA 4GP5B 4GY4A 2A3TA 1NWOA 2UXTA 1N68A 3AY2A 3X1BA 1AZCA 4KNTA 3NJHA 3WKPA 1GY1A 1AG0A 4WTQA 4YSRA 1XMEB 1AZNA 1AS6A 1CYXA 1PNDA 2HX7A 2NRDA 1J5CA 3QJVB 5I6LA 4QKTA 3S8FB 4G7SB 3CG8A 3PAZA 2JKWA 2ZOOA 1WS8A 3H4HA 4NAJA 4A66A 2XVBA 1SF3A 4YSUA 4BWUA 4YSCA 4PAZA 2W88A 1OCZB 2TSBA 4E9XA 4E9QA 2XUWA 4AKQA 1W6LA 2H47C 1JZJA 4YSDA 1RKRA 4YVNA 1JZIA 4W1TA 2TSAA 4YSSA 1KYAA 4HIPA 1AACA 4YVUA 1AG6A 3CDZA 2Q5BA 3GYRA 3EF4A 3FPXA 4A2GA 2CUAA 1TEGA 3AG3B 3UABA 1SHWA 3BVDB 1OOWA 4WKXA 2PPEA 3FQ1A 2YAHA 3FQ2A 4KNSA 3CVBA 2CBPA 3X1GA 1HAWA 2PPFA 5B1JC 1VLXA 4DP1X 2WO3B 1ZV2A 1B3IA 2AZAA 1JXGA 4HCGA 4F2FA 3QJQB 3PAVA 3AG4B 2RACA 3FYEB 4X4KA 3TBBA 1RZQA 2FNWA 9PCYA 5I28A 4P5SA 3NSYA 4UAHA 2QDVA 2BO0A 1ILSA 2FTAA 3OMIB 2WSDA 4M4RB 5I6KA 2P80A 1J9TA 4BDVA 3FSZA 2UXVA 4HCFA 1BYOA 2IWFA 2BP0A 1AIZA 2BW5A 1JXFA 2YAPA 3NSCA 2IH8A 3S3BB 3OM3B 3FU7A 2YXWA 7PAZA 2FWLB 5B7MA 8PAZA 1CC3A 2BP8B 1SF5A 3TU6A 2EIMB 3FU7B 4AX3A 1WA2X 4BXVA 5EHFA 1JVLA 1SHXA 3NP3A 1RZPA 1OV8A 1PAZA 3AW5A 4P5RA 1OCRB 1OCOB 1DZ0A 1PZBA 1KDJA 3SBRA 1X9UA 1JZGA 1MZZA 2CJ3A 1NDTA 1A3ZA 1NIAA 1KDIA 3OQRA 1PY0A 1BEXA 1NINA 5I26A 1SDDA 1PF3A 2XU9A 5IY5B 3NJKA 2YAOA 2XLLA 4DP5X 4KOBA 3T6WA 5I5IA 2HX9A 1DYZA 1E30A 2FQGA 2YARA 4Q89A 4EF3A 4KO5A 5I6NA 1BAWA 4BXSV 4DPAX 1WS7A 1ASOA 1L9PA 4YSPA 3ABKB 1WA0X 4HAKA 2YAEA 3KW7A 1PLBA 1CURA 2BW4A 3IBOA 4GP4B 1ID2A 4DP4X 2IDTA 4G7QB 5B1BB 4DPBX 3SBPA 4KO7A 2XWZA 3PAUA 4KNUA 1JZHA 3T9WA 1GY2A 3ERXA 1ZPUA 4G72B 3NJNA 1HFUA 5AZUA 4BWTA 3EH3B 5FC9A 3V9CA 2IWEA 2PP7A 3UADA 1IKOP 1OE2A 3L45A 2LLNA 1EZLA 1UATA 3NJFA 3FYIB 3X1FA 2YAMA 1J9QA 1IBZA 2I85A 3V9EA 2XX1A 4E9TA 1JXDA 1L9TA 3PXLA 1QHQA 3WIAA 1IUZA 1AQ8A 2OCCB 2VW4A 2HXAA 2IDSA 2IDQA 5B1AB 2GC7C 1PLCA 2UX7A 4HALA 1AZUA 1W8EA 2BHFA 1PLAA 4W9ZA 2PPDA 4PCYA 4E9YA 4E9VA 1MG3C 3UGEA 4HZ1A 3NJGA 2Y69B 2DWTA 4DP7X 1WAEA 1L9QA 1KV7A 3QPKA 3ZDWA 4NB7A 3SQRA 4YL4A 1PNCA 1V55B 3C75A 1YLBB 1GW0A 2PPAA 3H4FA 2FQDA 2R7EA 3QJRB 2VSKB 4K9JA 3NP4A 4HHWA 2R7EB 2QDWA 4E9RA 2XYBA 5B3SB 3IE9A 1QNIA 2W8CA 2DY2A 1JZEA 1AOZA 4N8UA 3BQVA 5D4HA 1NIEA 3JT2A 1BXVA 1T5KA 3AZUA 2VW6A 3NJLA 1M9WA 1ETJA 1ZIAA 1OCCB 2UX6A 1E5YA 1F56A 1SFHA 2BP8A 2I7SA 2PCFA 2GSMB 5LDUA 3FQYA 1A4AA 2PLTA 2GIMA 1JOIA 7PCYA 1PZAA 1KBWA 2VM3A 2P80D 3WNJA 4L0PB 2HX8A 3T6ZA 1R1CA 4AKPA 4YSEA 5I5MA 1KGYE 1V54B 1CUOA 3PPSA 1NICA 1RCYA 1ASPA 1SNRA 3NJJA 5B1KA 3IN2A 2PPCA 2EINB 2B3IA 2DYRB 4G70B 2X87A 3FSVA 1A4CA 4RH4A 1OE1A 1IBYA 2YQBA 2XX0A 2VN3A 3ABGA 1GSKA 4QLWA 3UAEA 3X1EA 5I6OA 3FSAA 1AZBA 3FSWA 1AANA 2BZ7A 1GYCA 4YSQA 1NIBA 3ABLB 2XV2A 3FU8A 3GDCA 2AZUA 1A8ZA 1ET7A 1NWPA 2FQEA 2GHZA 2IWKA 3UACA 4DP2X 1NTDA 4YSTA 4YSAA 1SFDA 1TEFA 2B08A 3X2QB 4ENZA 3EH4B 2IDFA 5F7BA 2ZWNA 3CVCA 3GXUB 1GS8A 1A65A 2PCYA 4A68A 3TA4D 4KOCA 2EIJB 4BK5C 3IEAA 3ABMB 1MZYA 4KO9A 4A67A 3DTUB 1J9SA 3PLYA 2IAAC 2DV6A 4UANA 1NPNA 4M3HA 1BQKA 2DYSB 2GBAA 5PCYA 4N4YB 5A7EA 2IH9A 5I6MA 3HEIB 2Y1AA 4HHGA 2MTAA 1AS8A
chains in the Genus database with same CATH superfamily
5I8KL 3UYPB 3D12B 2OMYB 2A9DA 2BNQB 3D07A 3NSXA 5SWSA 4DH2A 4QRTA 5HYJD 3BRFA 3QXDA 1TCRB 4CSZA 4E41E 1BMWA 4OUUA 4P2QD 4I1PA 5L4IA 3QI9C 2QGCA 2YD2A 2ENYA 5DDHB 4Z18A 2MEJB 1NMBL 5EU7E 2VSMB 2WP3O 2QLVB 1RZFL 3QAZC 4TSCH 3H9SD 2GTWB 1OAZH 1I1AD 1ET8A 4TUOA 3PCYA 2FUQA 3CN0A 5I1CL 3DARA 5L7XL 3HE7C 4ZW6A 3VD3A 1SJHA 2IC2A 4NN6B 3IRCA 5D1ZD 2XI9A 3WAKA 1NLBH 4CC0A 1VKXA 4I3RL 4NZTL 5F3HB 5IEKA 1ZLVH 1N64L 3STZA 2EABA 3G04B 4RQQB 2CJSA 2XV3A 1KFAL 2ZXGA 4YBQC 5I19H 1BM3H 4TOYH 3CK0L 1X5HA 1F6FB 2EDLA 3QIBA 1I1FB 3P2TA 4EN3D 4N8VB 3MLRL 5DZAA 3UROR 1JGVH 5IOKA 3RFZB 2HUEA 2AABH 2ZQKA 3N1MC 3CVHL 4KI5F 1MLBA 4UV7H 3FUMA 3TNMA 1A7QH 1M1XB 2JLPA 2V7NB 4K71C 4M61A 4AQEB 4K8RH 4JCLA 3OLIA 4UIKL 4B9KC 3S3DB 5DGRA 5HYIA 1RPUA 1FL6B 2BRRH 3O6FA 3T6VA 5L9DL 4UB0L 3F04A 2GB2A 1CDJA 2JJSA 2QSVA 4AUYA 2F7PA 1BQLL 2MCMA 3RVXD 2EH8H 4Z9KB 5IBUG 2BOBA 3ZKNC 2D7MA 4OJCA 3SKJL 4RMBA 5KW9H 2W0FB 3ULUF 4JFOB 4XB7A 2BWIA 1U95A 2L7UA 2AP2A 4JB9H 2OW7A 3MA7B 1NGPH 1EZUA 5GZND 1DLHA 4F8QA 2UY6A 2QELA 2ZYRA 5JLZA 1JFHA 4JVPA 1IV8A 1VFBB 2ICES 2J6EL 3T2NL 4I77H 1XIWA 1HKLH 2W95A 2DQCH 4NQQA 4KZDL 2ATKB 4JKPL 5DRWA 3BZ5A 2GQHA 1YQ2A 3L4TA 4Y89A 3RDTB 5A3IC 3QJTB 1URIA 3V0FA 4BQ6A 3S8GB 1UM4H 4G8FA 4GW5B 4ONHA 4AIOA 3IDUA 1MREH 4OCYH 1O9WA 1RIVL 1E7UA 2X3CA 3WU1A 1JDCA 3FT0A 5HVGB 1NEZB 2H32B 4K9EL 3C08H 1MG2C 1QI4A 3L95A 1PDKB 1F86A 1JNNH 1Q9OB 1FFQA 2IOOA 4L23A 4RFEB 4JREB 4Y1AE 5IF0B 5IG7A 4BRJA 4GO8A 2JKXA 3RVWC 3O8XA 5GGQH 3WJMB 1INQB 3FQWB 3GJEB 4Q9QH 1DTUA 3U25A 3NT0A 2ZYIA 2DQTL 1IEAA 4G59C 2X53A 1BXUA 1PX4A 5MI0C 5GGSA 4X9BA 3QEHA 3CDGA 2VKXA 2ZCKH 3AG1B 4PRBB 3F12B 1ZA6B 3FU3A 3GUTA 3O6KL 4PJHB 5C2UB 2VLLB 4FX5A 4QRRD 1GYAA 1P4LA 4ZNEA 4GKNA 1E6JL 3QG7L 4MX7B 1E4XH 4GAGL 3SKOB 3REVA 2PO6C 1EV2E 3B2XA 5CLWA 2H6PA 2X70B 1FJ1B 2YRLA 4KXDA 4J3VA 1CICD 3B7UX 3LKPB 4KH9A 3FTGA 1JN6B 3ARFB 4NCDA 1S4IA 2JKWA 3VUAA 3QQ4A 4GMSL 4POZD 3KLHC 4ODVH 4O5LL 3G5YA 3LN4A 3QUYC 2XUWA 3JWNG 5EPMB 4B5ZA 4ZFOB 2YJLA 2V6HA 1TJGH 4YSDA 3HN3A 1EXHA 3DWTA 1ZMYA 2X4OB 4ZMLA 1TQWA 3E7JA 2G30A 2LGNA 3AXLB 2TRHA 2YZ8A 2HWZL 3CDZA 4J5VA 2O5XH 2AITA 4QRUB 3SB3A 4FQ1L 5JW5A 3W38A 1Q9LA 1GZQB 1QD0A 3RGVA 5E6ID 4JPIA 4YBHA 5HHOA 4CVZB 5TDOB 3ZU8A 1H3TA 2YGPA 1M53A 2JNZA 3IGAB 4HVBA 2A6DA 4BQ8A 2CLVB 2UZPA 2ZUQB 4DP1X 2VZ3A 1ZV2A 5HGHB 2DQMA 4EBQH 5ITFB 3ZW3A 5IHZA 1E6OH 2Y22A 1TQBB 3SN6N 3PAVA 1RZQA 3WXWH 3FTYA 3S36H 1INEH 4NUJA 4P3CH 4X8CA 3VI3E 3UMNA 2R1WB 4LSQH 4HWBH 5ALBH 5ENWB 4HJEA 4YXHH 3TTYA 1QA9B 4NO2B 2Z91B 4FLHA 4AM0Q 2OCJA 3R18A 2CKNA 2X2IA 2NXZC 1HXYB 2W65B 4JO4H 4W9IC 5TQ2L 1XAKA 4JCMA 1P7QD 3Q8CA 1MIMH 5CBEA 1Z6JT 3S5LG 1PZ5A 1S9VA 3S3BB 3VTAA 4DTGH 3FU7A 3V6ZA 2X4TB 3CMGA 4DKFH 1E50A 2DQ6A 2FWLB 5JW4R 3WJLA 4AGPA 5E4EC 3MXWL 5JORA 4AX3A 5CJQH 1RJYB 2VZSA 1P53A 5CJOH 5B1CA 4BXVA 4M7LT 3TZVA 5ESQA 4Z7VF 1YEKL 2GK2A 5FYLD 4XP6L 2B16A 4X98A 4XN1A 3UH8A 2OMZB 5E4OA 1CF8H 2BX5A 4WY7H 3VFPB 3L4VA 1ZTXL 3GMOB 4JBSA 1VFAB 5D72H 4IKJA 5KVDH 4Z7NE 3N5AA 1OGAA 3G6JE 3LB6C 4DWHA 2EC8A 1UD5A 4Z77A 2YPVH 4PW9A 1Q1JH 3BP7B 5K9OB 1PY9A 1FZKA 1C08A 1FE8L 3I3BA 2MPVA 4ZS7H 2XU9A 4L8CB 5FK9B 3FO0H 2JE8A 2WNXA 3LZOA 5BS0D 3F58L 1LE9B 1YUHB 4KOBA 2KYIA 2VXTH 1I8MB 4JZOB 3U1PA 5E4IA 4P4RA 5I6NA 2FWSA 3CN4A 3N85H 1VCAA 1CGSH 5DRZB 1G0XA 1FNFA 1G7QB 3P0VL 4JY4A 4JFZH 1UT9A 5DMIL 1LWJA 4AQ1A 1XBRA 3LEXB 3S96B 5C2BL 4GRLD 4JFHD 4WFEE 4IGBC 1MWAH 3GB7B 3MR9A 4AQ8A 2Z4QB 4NPYB 4H88H 4QXTB 3SBPA 4TRPL 5HY9A 2E0PA 4HQQL 2VABA 3N1PC 1IIIA 3MNWA 5DJ8A 3UPRB 4Y5VC 5D7IB 1YC7A 3RURA 1U2CA 1U8HA 3RGBA 5CLZA 4B3VA 3Q0HA 4N0UA 2EAEA 2IWEA 4FNTA 5MEQA 4R2GC 5JW4N 3FYIB 3QRLA 4P57B 4JLRA 2L04A 2WJ5A 3LXBA 4ABQA 1LD9A 2LOEA 3N40F 3ZDZF 2DEXX 4X0KB 1T6WA 2NTSP 2BNRD 1GKOA 1FSKC 1NBCA 4ES8A 1ED3A 1S3KH 2C3VB 2AJZA 2V5YA 3QR2A 5FYKD 3KXFE 3GXIA 4U49A 5ICZB 2CIIB 1QSZA 4AK1A 1WZMA 2D8KA 3TBWB 3AACA 4ZI8A 1OAZL 2XDHA 1G0YR 3A6BH 4XB8A 2NNFA 1AHWA 4BFEA 1T1ZB 3CFIC 3FXIC 4GW1B 3UZEA 4DEPB 3CZNA 1NLBL 4DCQB 4KRPC 1PNCA 3C75A 5A2IH 5E9AA 5JHLA 3NRQA 4WWOA 4FQIH 5I19L 3RDTC 4FA6A 4C56A 3ZE2E 3F7YB 1BM3L 2AXJA 4TOYL 5DZOA 5D7JC 5TDPA 1TJIH 1YNLH 1AO7E 2GSGA 3PWVA 4PJ7E 1C1EH 3Q43A 1JGVL 3FC8A 5D55A 3ZZQA 2AABL 4XNAA 3IE9A 4ZPVA 2X44D 4CVUA 3QZWA 1G7JB 1S9YA 4UV7L 3PGDA 4UM9A 5HSFA 1UH2A 4K8RL 4JREC 3KPSB 4JUSA 4AE1A 4YZFF 3OC5A 3DX3A 5J8OA 2P5WE 2OXGB 2O5ZH 4RIRA 4XVTH 1P9MC 1JFQH 2MH4A 3VH8G 4G8GA 1XXDC 1KBBA 3SGDI 1KLFA 1ZPLA 2EH8L 5IW6B 1ZWIB 3JV4B 4ADJA 1M6OB 4Y5YA 5KW9L 3HZ3A 1FQ9C 4H0GA 3VFSA 2ZWZA 4JB9L 2EQDA 2XFXB 4APXB 2FJUB 4XVSL 4AKPA 2Y7QA 4C57C 3OX8A 1N5AB 3EJYD 1FCCA 3ARTA 3N6YA 3A67H 3ECBB 1FG9C 3QC5X 3TIEA 3RIKA 4X83A 3FT3A 1HKLL 2NZIA 1RCYA 2MIZA 4O2CA 4V1DE 4ZYKB 1IFGA 3ARBC 3ZIMA 1Q0XH 1M2VB 3DROA 3PDOB 5DFAA 3LH8A 3H54A 3HRZA 5DEFB 4PB0H 3TEZA 3ARFC 2CR0A 4N28A 2I07B 5IHWA 1IBYA 2HJFA 5KUKA 1ZLDA 4JG5A 5MEND 4OCYL 1AY1H 2ZOLA 1F5WA 3LQMA 3GRWH 1XZ0B 4PJCE 3COOA 3CDYA 4Y16B 5MHSE 2Z35B 1RVFH 1T5WB 5DJ0B 4CVXA 5C0DA 2Y7NA 2IGTA 3MCLL 2X05A 3MN8A 2DLEA 5JOPE 4OCSH 1L0PA 4JM2D 4YSTA 2NLJB 2XTSA 3X2QB 5DK0A 2FHCA 4LOUC 4BZ2A 2L3BA 2ZWNA 5LCVH 2HT4C 3MRLA 1MFUA 3G9AB 1TPXC 1DP0A 2A4EA 1U93B 1LO0H 3ML9A 4JZNB 4OM1H 3DTUB 4B9GA 4IMKC 4B50A 2ZCKL 2ZUQC 1KNOB 4FN0A 3FKUS 4ZXBB 2ZCZA 1I8IB 1JG9A 3ZSSA 4B9JA 4IRSB 2VR8A 3F65A 3T77A 2EDOA 2I9LA 3MGAA 4U2YA 3MLUL 3HHRB 4FMFA 1JPSH 3SBWC 1ZVYA 1E4XL 2FUTA 1G1KA 3T0EC 2F7OA 3FOMA 1JK9A 3PABA 4ODSH 2XC8A 4PG2A 1KCKA 1J8HB 2R39A 3QFDA 1F1AA 1ET5A 4PU2A 2F2HA 2WUBH 2O26U 4LHUD 4ZOCA 3FCBA 4J3OC 1ZVSA 5I1LA 1IGJB 3WTWA 3GLAA 3PFUA 2FYYA 4GJTB 4PJAB 4QXWA 1NAMH 1TJGL 2JIXD 4ZDHB 3P4OA 5J9PA 2ZCLH 1KTDB 2RHEA 4XT1C 3RWHA 4ZW3A 2AS5M 4MJ5B 4XPAH 5T8IA 5BJTA 3TEYA 1TU2A 1ZLUK 2XKNB 2X1PA 5SWZE 4LSUL 3FN0H 1CG9A 1XB8A 3QRFM 3L1FA 3D8MA 3D39E 5F9AC 1MFMA 4JE4B 3HC0A 4R8WL 3A47A 4OZGE 3FRUA 3B1UA 5GXBB 4PGJA 5I1HH 1MCOL 4P9ML 2CA4A 3QDMA 4EBQL 2K6ZA 1E6OL 5B3JE 5BRZB 3NZUA 2NY2C 2X4RA 5TH2A 3T3PF 3V0HA 1RPKA 1I9EA 4OZIE 5D7LB 2J55A 3D4CA 3NDYE 5FO7A 3S36L 1INEL 1FWXA 2Q9OA 3BDXA 4X7CC 3IDIB 3A0OA 4P3CL 3TNNB 43CAA 1EFQA 4LSQL 4HWBL 4F2EA 3QUKB 3S48A 2PYFA 4YXHL 1YN6A 1PZCA 1Q8MA 2P28B 2ZUUA 5AB9A 2C3GA 3TASA 3U4EA 3UJIH 4X7TB 1CXIA 5TK4A 4JO4L 4JVUA 4U1IB 1MIML 1SYVA 2PWFA 2DBJA 3S3CB 4UT6L 4K7FB 1JWUA 2YXMA 4LVHC 5CZVL 2E9GA 2BS71 2G9HB 3GI8H 4Z7OE 3RWIA 1AGBA 4LDLB 5CJQL 1XB3A 4GRWE 2YD3A 5I24A 1ID5I 5JXAH 3FTVA 2OR8A 1C5BH 4PJ5D 5DD0L 3OJMB 5CD3A 3PQYD 3MX0B 3WTVA 3LZFH 1CF8L 4WY7L 3F7LA 1MCSA 2EYSB 5D72L 3F00A 3GK8H 3AFLA 1A7BA 3NYKA 2HN7B 5I1GH 1M7DA 1XD1A 2OJ1A 2ZXCA 4MNHB 4N2GA 3ZT7A 1VFMA 3HBPA 2YPVL 4ZG1A 2X7LB 1Q1JL 3HZYB 1HAUA 3HBZA 1TKWB 5AAPA 4TUJB 4E42B 1GKEA 4UQBA 2COVD 5ICYB 1OT1A 3NJIA 4ZS7L 1GXEA 3TFKC 3BGFC 3FO0L 4FNLH 3GMNB 4OIFA 1WAAE 5TE7H 5IJKC 4RZCA 3G3LA 2QZ5A 3DX7A 4KVPA 5I1KH 1T4KB 2VXTL 4NZUH 2YD7A 1EEQA 4FLRA 2RGSA 5FGRA 4BSVB 5IK3B 2AKRA 3E6FB 2AVFA 1P7KA 1FGNH 1CGSL 3A22A 4AI7A 1EFXA 1RURH 4I88A 4AJ0A 4JFZL 4BFKA 1FZOA 1UEMA 4FMKA 4LCCA 3SY0B 4KZ0A 2DS4A 3B2MA 5JIKA 1Z0MA 1MWAL 2WBJA 5AB1A 1NWOA 3VD7A 2QQLL 4H88L 1P7HL 5D2LE 4X5XB 3DA0A 4Y0GA 1QSFD 4IKIA 4AEHH 4BA8A 4NQDE 5ELIA 2YA2A 3VCLB 1XMEB 2WLZA 4PJ9B 2O5YL 4AL8C 3WFDL 1KIQB 4N9GA 3T2PA 3KBFA 3SGJA 3R8QA 2VDLB 5C0FB 4G7SB 1B2WH 3H9HB 2XVBA 3KM1A 1N2RB 2R23A 2XIDA 3ARDA 3HI1B 1S3KL 4Y8DC 1TQTA 3QORB 4XXWC 4MNQE 1LE5A 2P45B 4BZ1L 4HX1B 2HMID 2OX5A 2W59A 3CQQA 4JCWA 4P5MA 4C4KO 2W0PA 3OVUB 5IVZB 1TMQA 4PR5B 9CGTA 3GXNA 4HJ0D 1N12A 1Q38A 3WKYA 4NEHB 3DVGB 4K7PY 1AKJD 1O75A 1BQUA 4KJWC 4LMQI 4FQJH 5EB9A 2Y6SC 2R2EA 4TSAL 3U36B 3VRLF 3FQ2A 4L0YA 4FQIL 3S35X 3QO0A 4ETQA 3CFBA 5CM1A 1OEZW 1YMME 1TJIL 4H1LG 2ZOWA 2Q7YB 2Q7AA 2WO3B 1C1EL 2H0PA 3ILPB 2CQVA 1AQMA 2YA0A 5AOJA 4KKCD 3VXME 5LNDA 1CI5A 1ZCRA 3QUHA 3RL1A 2QPFA 1FLTX 4WWKA 1T66D 3I3DA 4Y16C 4QOKA 3OF6D 4UDUB 3NSYA 5DZLA 3APNA 3K6FA 2ZAGA 2H32H 4QHKI 3DRTA 5AVXB 3BLPX 2QVFB 5D5MF 5ADOH 2OSYA 5E8OA 4MS8C 4N2NA 5I6KA 4XN5A 2J44A 4DGVH 2XHNA 4GSDL 4DUXA 4HZLA 2F19H 4XVTL 3BGMA 2PMZA 2CHZA 4XZUA 1JFQL 5B39B 4FNPA 3SQBB 1L0QA 5LAXB 2F7RA 4JFUA 4WTXA 4L4VD 3QHTC 4X42A 3D05A 3MYJA 3PWPD 2B1OA 4ZXBC 2A4CA 2BP8B 3BPOB 3LNFA 4JM2F 3CHRA 3MBXL 5CEZD 3IGLA 3SZKC 3CE1A 5AOKA 4UV4H 1BF2A 5JYMA 4HT1H 2J20A 4XZ4A 3AW5A 1E4WL 5DF0A 1DVSA 3ILQC 5EZOH 3MODH 4FG0A 2XNAA 4WJG3 5JR1H 4S11A 2OR7A 3IJEB 3PHQA 3DURB 1KLGB 4Z3EA 4PTUA 4X6EB 1HC1A 3T08A 5HVHB 1AGCA 1CXEA 4OZHE 1AY1L 2EYRB 3OQRA 4NRYA 4KX9A 5FW7A 3SGEI 4U0QB 4QRAA 1W80A 2FWUA 5CIPA 1UB6B 1OQXA 1VEPA 1VACA 1RVFL 2CHNA 1ZVHA 5C09E 3VFMB 5DI8B 4DP5X 4D8PA 2HX9A 4WFFD 5CJXA 1W72A 3DYPA 4RCAA 3ML8A 3MGOA 3K2MC 4PJBB 3FB6B 3L9BA 3BP6A 3U7WL 5DMGD 1BAWA 2D4DA 4OCSL 4Q9BA 5CP3H 4OGZA 1TCMA 1E7VA 2X4UA 2AVGA 3AABA 1T20A 3HCVB 3JWDC 3HZKB 3L3IB 3OHXC 1YAZA 3U0PB 5FFLA 4W9EC 2CDGB 3VI4B 1LO0L 4RWHA 5F0PB 3QG6A 1TNMA 1WTLA 4OM1L 2BW4A 5DD6A 2FX7H 5IMMB 4XHJD 4JANA 1FO0B 2WB7A 4CW1B 5I6XB 3D9AH 1TJHL 3UZEC 3VAEA 3IGKA 3NJNA 3LKNA 4GAYA 5D1XE 1IAIH 5FKAB 1JPSL 1RJCA 2PP7A 3UADA 3CWGA 1EZLA 4HULB 2MPAH 3BP5B 1ODAA 5D1QA 4EJ1C 3FH7A 2EDFA 5J3HC 4ODSL 4NRZB 4QHUA 3GWJA 2CNZA 4PS3A 4TQ8A 1NANI 3ZTNH 3LEYH 3KPLA 2WUBL 4G6AC 1RK1B 2OTUA 1RSFA 1RUKH 4ZO7A 3K80A 3TJPA 4GQ9H 4LESA 2FECL 3SGDH 2AJYH 4RFOH 2FLBT 4J3OH 1NAML 4MA1C 2LAAA 2CLRA 5IB3A 3DNKA 2R29H 2V2WB 3L4XA 5AYUH 5G5DB 4PS4H 3ZDXE 1A0QH 3OR7B 4K5OA 2FIKB 3ZDWA 1KPRA 1H6UA 5E7FA 2VQ4A 3FN0L 3VXNB 3VD2A 1I85C 1GW0A 3GMPA 4ZQTA 2BHUA 3R4RA 3D08A 3UYRH 2R83A 3RTLA 1BPLB 1JGLH 3RJQB 3RVUD 4MJIA 1AJ7H 3VFVB 2DI9A 3ZJAA 3VFWA 1AHKA 4H2CA 2CLZB 3T09A 2N3JA 4LPYA 5DS1A 3P4LA 3MKGA 2PYED 3T4YA 2MQ0A 1I3VA 5IMKB 3K8KA 4ZMTA 4HH8A 4P46D 2BSDA 3LHAA 4F8OA 2R2HB 3OPUA 2HLFC 2VSCA 1M9WA 2ZZUT 1PG7X 3MLXL 1AC0A 4JRXE 4UQIM 1JGIA 2DTMH 2UX6A 3MRCA 3EO9H 1RK0A 1J5HA 1TXKA 4RMTA 5GRXG 1QRNE 1K5WA 1T7YA 1WZKA 3QJOA 4TQEH 1NGWB 3ZXAC 3EO0A 5ADPH 3SQOL 3IJSB 3H42H 4PJIF 1G87A 1KTLA 3U1SH 5EFIB 1XGRB 5T3XH 4ZNCD 5AWNH 4H8UA 5GRVK 3W0WA 3O11B 4IEFA 4XNQB 4TLKA 3GI8L 2ITDA 2IANA 3NIFF 4H26A 4IDJL 4S0SD 4WK2B 3FU5A 3U4BH 3VWKC 1KMGA 5F1IA 4ONGH 1CD0A 4M1DH 3MREB 4AJVA 5EEWA 2JKLA 1ASPA 1QLEL 3T65A 3V5KB 1UXSA 3ARZA 2BS9A 2KQNA 5JXAL 2DMGA 1YY9D 3MRHB 4RSYA 4ZAKD 5CNHA 4HLJA 2VDRL 3HZMA 3LZFL 4EUPG 3LS5L 1F90H 1JWSB 4L1BA 3GK8L 1T0PB 4IMLB 1AGFB 5I1GL 4ZMAT 1P6AB 1PIFA 3AUVA 5GGRA 1XF3A 3FFCB 4E41A 3OLDA 2IFFL 2BZ7A 2Y2TA 3KPRB 4IRJD 5BUGA 3S35H 4B9PA 3BAWA 3L3OA 4RGMB 4BK8A 2X4QA 4L3CA 4U1HA 3UAJD 4XCYB 1JPTH 5HTSA 4MMXA 5I1KL 4NZUL 2HVKA 3GF8A 1VB9A 3WKNA 3ZE1F 4Q97A 1E2ZA 1LEIB 1JNHB 1FGNL 1K2DA 3VE0A 5HJBA 1UT1A 4FFZL 1SBSH 1NA8A 2LFEA 4OFKA 5C71A 2P5ED 3CX5J 1WFOA 3KAAA 4J8RA 4JDZB 1T89A 4KI1A 1EUTA 3H7LA 1BOGB 5PCYA 4OB5H 4AQZA 5I6MA 2FO4B 4H25B 3BJLA 4CMMB 2ESVA 3IVKB 5DFVD 4ES9A 3V8OA 3LN5A 4AEHL 2XCMC 4FG6C 1K8DA 3TBTB 5J12B 2BVQB 4ANXA 4JL1A 1MW3A 1P4BH 5IWLA 4JFEE 3G5WA 1A1OB 4MB4A 1N0LA 1DEDA 5D1ZA 3D33A 4AL8H 2XWJB 5E00A 1B2WL 4JDEA 3HAEA 5L2JA 2ZOUA 1QZ1A 1T1XA 5AEAA 4A2DA 1WFIA 5BO0D 4ODWB 1U0QA 1IC7H 2WP3T 1YN7A 1WA1X 4QTHB 4L3EE 5E9NA 2H26A 4EN3A 2J8UB 3WS6A 4FXGB 1UVQB 5HI4D 3BPOC 3WNLA 2C1OB 3BUTA 4MDJA 1ZGLM 3U2SA 4RGNB 2DPKA 3RPKA 4XMLH 4NQCD 4Z76B 1KENL 4X5WA 1GS6X 1O7DC 3QQXA 4OD2A 5DA0B 3WFCH 5EF0A 3CAFA 5BZWA 2BVTA 1FNGA 1PKQB 4GS7B 4ELKA 1KLUB 3TLRA 2WMPA 1D9KA 5HVHC 2CUMA 1LXMA 2KDYA 3UEQA 4HJGB 4IOFD 4V2BA 1J0YA 4WLCA 3AQYA 3VRJA 2QPEB 2C9XA 2NMSA 2WLNA 4K7PX 3EOBB 4G43A 4WI8A 3NIDB 3EZ8A 2HFEB 2UZXB 5ADOL 5FGBC 4KKBD 5D2NB 5C0ND 5IKCA 2F7QA 1HZKA 3CH1B 1MCWW 2EICA 4DGVL 3BMVA 1XBDA 4HPHA 1MY5A 1NGQH 4B95C 2F19L 2EXYC 3U9UA 1U8QB 4MJ4A 3ARGA 3HS9A 2RQEA 2N7AA 3QEQE 4RRPA 3U83A 5FKPB 4ORGA 3IU3B 1O9ZA 3Q3GB 4OY9A 1VA9A 2X6UA 4U7KA 3FT4A 1AZVA 4NO3B 1UZ6F 3RNQB 5I6XC 3DVNB 3ECQA 4U1LA 2EE3A 4A6YH 1PLGH 2QR0B 5DSCA 3VXRD 3QNXA 3R4DA 3RX9A 4FHBD 2NQDA 4UV4L 4E2OA 5HDWA 1OF2B 2C9RA 3CJJA 4BWWA 3BKJH 3MZGB 3WN6A 3UTSB 3FS9A 3KGSA 5E8NB 3CZUB 5EZOL 3QDGD 4HG4J 5DJCA 5EWIH 4W70A 3CPUA 3DXAD 4FKEA 4XPGH 4HK3J 1NDMA 1HQ4B 3EJSA 2WXHA 1SJMA 1IM3D 5KYXB 4QRPB 4HGWB 5A7BA 4GIPD 3U4AA 1M9SA 2ADGB 1LEGB 2GFBB 1YNTB 3HHSB 4QRRA 1XF4B 4PJ6A 1ZT4B 2NYZA 5K9JH 2OV0A 4M7LH 1MFEH 4N2IA 3SPVA 3B2PA 2W60A 1I8UA 3HLAB 4MD0B 4IOIB 4AYID 4D9QD 4ZZKA 5F7UA 1XGZA 4UOQA 1J7VR 2E6JA 1IRAY 1DQTA 1SQ2N 1U8PB 3MJWA 5GGRY 4D9LH 4RWYL 4M43H 1P0SE 3QEUA 3TBVA 2YAQA 4JHAH 3EYUH 4ZOAA 2J56A 2X1QA 4JMXA 5CBAA 1PG7H 2GG1A 3JWDH 3VFRA 3OPZH 2XTJB 4OIBA 2QSTA 4L37B 5B8CB 3OLGA 2QGBA 2XN1A 3D2UB 3LH2L 3D9AL 2WCGA 4QIRA 3WKPA 1T2JA 3D48R 1IAIL 2HX7A 3LPPA 1VF5C 4KJPD 1UJ3A 2EZ0C 5JPMA 1FYHB 4UUJB 5KSVB 4QYOB 3JQOB 3C6SB 2ZOOA 1WFUA 2GY5A 4BGLA 2HJKB 2K0RA 1HNGA 2VXVH 3BW9A 3ISYA 3VI3A 3ZTNL 4YSUA 4ZX6A 3LEYL 2WN3A 3RWDB 2JELH 2VL5B 5E6IA 4PRIE 4WWKC 3IKKA 1RUKL 1U91B 3BX7C 1T0NB 2QQKH 4PW3A 1MRFL 3KLSA 3PWLA 4PJEB 2BIMA 1I1AB 4RFOL 1MJJA 2IO5A 4DEUA 4ALAL 4JJOA 1CFVH 1AACA 4ZW7A 2Q5BA 5LNEA 3EF4A 1A0QL 3FPXA 3O41A 1TEGA 4KI5C 1BBJB 3UABA 2IVFC 3EYQC 2VE6A 2E76C 4ELME 3CZGA 2VCOA 1A6VH 3GSXA 4M1GH 2X2UA 4Q2ZB 4Y2DB 4B9ZA 4ZZFA 3GJFB 4NZ8A 2AZAA 1AJ7L 3TA3A 3FQRB 3V4PH 2NY0D 5IW1B 2VLKB 1WIPA 1QTYT 4HUVB 5JXED 3FONA 1OK0A 1WZ1L 1C16A 2Z0UA 3SE8L 3N9GL 3ULUC 2AF2A 3KS0H 2ED9A 3CZLA 3I75A 3JUZA 4K07A 2DTML 1QTSA 2DQDL 5EO1B 3KYNB 3P40A 1AIZA 1XH2A 4U1SB 3AGWA 2YAPA 3VNYA 3NSCA 3RZCA 1G84A 1JXFA 5I1JL 4I3GA 4TQEL 1GC1C 2XXCB 4AM0A 1IEBA 5ADPL 5DMKA 6TAAA 3H42L 4U1JA 2JLLA 5CFHA 5AOMA 8PAZA 2XJLA 5FW6A 2A1WL 5AWNL 5ACMA 1SLXA 4GNKB 3C6LD 1L6XA 4Y2NA 2JJVA 4ZS6D 4IHOA 4F3FA 1W91A 4MGXA 3E38A 5DQJA 2I24N 3FO2B 3DTXA 2VDQH 3L16A 2XN9D 3NP3A 4KXCA 4PRPD 3U4BL 5J12C 1FV1B 1ORQA 2DZEA 4YMPA 2J1WA 2QEJA 2OKMA 1DZ0A 1HEHC 1S7TA 4J4PA 1X9UA 5I71C 5CUSH 1D7CA 3D85D 1MZZA 4N3TA 1S78C 2KZ1B 3RNKB 4Y9BA 2BVUA 1S7UA 2VDLH 3EDEA 1NANH 5I26A 1MH5B 5GRZA 4WFGE 2E7LC 5B22A 4JK0D 2P9RA 4GRLA 4ISVA 3MJ6A 4FXGC 1BD2E 5EUKB 1D6EA 1WBYA 4DSYA 5EC2B 4PGCB 1BVKA 3L3HA 1HSBA 4RGNC 1X5ZA 3KPMA 2FJGA 3FN3A 1G7HB 1JPTL 3VW3L 2EIZB 3SJVD 2EYTB 4EIGB 3Q6FB 4MB3A 3DETC 1X5IA 5FECB 1OARL 4BSWA 1R3LB 1S7WA 4GS7C 1JHKH 4OTXH 3RWCB 4K7PH 3V52L 2W9LA 3KPNA 3BSZH 1A7NL 1JI1A 4XP4L 1UOVA 3HS0B 1CT8B 1ZV9A 2DEWX 2ZX6A 4KO7A 5F89A 3UTZB 1YG9A 4KNUA 3F85A 3NG5A 4OB5L 4KV5E 4PJ7A 5AZUA 1I1RA 4PCTA 3V9CA 5K1NA 2QQQA 2C9VA 3O2DA 5FUZH 4HUXA 5D7KE 4APQA 3QUXA 1P4BL 2PKDA 4NJAH 2O4EA 1YC8A 2YAMA 4XMTA 1XR9B 5LGJA 3IDXL 1Z5HA 4WW1B 5D2NC 4PLKD 3CFJA 3DO7A 4AL8L 1MLCA 1IBHA 4JFFB 1AC6A 3APDA 1HSAA 5C0BA 3ARPA 5E9DB 2J88H 4P5TC 1EQWA 3BPNB 1XF5A 1IC7L 1LWRA 3HUJF 4WEMB 1UACH 3AITA 3EDDA 3ZE0E 2YWYA 4LCWD 5HJGA 5CWSA 1MHPL 4JRYE 3RWFB 4F93B 4BH7B 3VJ6A 5IHHA 3MLWH 3IKCB 1R33A 4MLIA 4RX4A 4XMLL 4YL4A 4XO9A 3GRBA 4ANKA 3WFCL 3HMXA 1R6VA 5KS9E 3FNKA 3LZLA 1JRHH 2YLHA 1S9XA 2WANA 3VXSE 2B2XH 7FABH 3BE1L 3BQUB 3WEXB 4ACTA 1W0WA 4JPWL 1QO3A 3VRLE 1JZEA 2OYLA 3QR1A 4B27A 3BQVA 4FNUA 1TZHB 2VR3A 2D9QB 5E23A 1G6RB 4PJFA 1R3HA 1ANUA 1RUPL 1VGEL 2DLIA 3E6HB 5F7NC 1LDSA 1S5HA 1JWMA 1XSKA 4PJCA 5EOQL 2BPBA 1ZIAA 4HHAA 1M2OA 1OM3H 1EDQA 4OFQA 1MDTA 2OTWA 3TM6A 1FAIH 1IE4A 1ZS8A 4ZPTB 1T22A 2B15A 3C5ZA 4UINH 3KPPB 3VFNB 4A7TA 3FBQA 4M1CC 4Y1AD 1NGQL 5DFWH 2PW2B 3S3SA 3K71A 1KXQE 2KDGA 1KY7A 3IDNA 4L0PB 3L3OC 3U7YH 3HE6D 4YH6A 2DLGA 2CKBH 4FQHB 1XH1A 1Q9KA 1MCJA 3MRFB 4N8CH 5MENA 3U6RB 2ZUSA 2GABA 35C8L 3ELAT 4PY7B 4KRLB 3H6JA 2VDNH 3HKZA 1QOKA 4A6YL 5GISL 5L0QB 1PLGL 5IFHH 4KDTC 3OKDB 1FO0H 3IN2A 4HP5A 5INDA 1CL7I 2ITEA 4ODXB 1P2CA 2ERJC 2D7PA 6FABH 3AWGA 1OE1A 5D9SA 4YXKL 1D5XB 4N2MA 4WU7A 2A6KA 4QTFA 5CMAB 5HDBE 2Q8BH 5I1DA 2ORBH 2JQZA 2WN2A 1KIRB 1X5XA 3DPDA 3C60B 4H0HB 3X1EA 1AXSB 2MTPA 5L2KB 5BV7B 2EH7L 5KSBF 3QE5A 3WFHB 1U3HD 2BSEA 4FI7A 1I1AC 3K5RA 4HUUA 1U8JB 5DJAB 4TVSa 2R56H 3QA3A 3CSYB 4MNGE 4R83A 4KFZC 1BYNA 1UC6A 1Y6KR 1TEFA 3QIWD 1MFEL 4M7LL 4R3SA 3LRHA 3RWJB 4KK9D 1HE7A 1S46A 1UM5L 2EJ1A 4XXCC 3GMQB 3B9EA 1FYTE 4GAAA 4IU3B 3Q2VA 3ABMB 3DYOA 5E2VH 5SWZA 4EN3C 5EF3A 4JHAL 3EYUL 2VL4A 5A2LH 4BUQA 2AXFA 2Y6TE 5HYSA 5BCAA 4I2XB 2HG5B 2I27N 2OYPA 3UIYA 5EDSA 2CO3A 3OPZL 4F8TA 3WLWD 5I73C 4NC1E 2WLKA 2Y1AA 4OZGA 4CU8A 5EIIG 3ZL4H 3ATFA 3HG5A 1FHNA 2DMBA 2HTLD 1A1MA 4YQXL 4OFIA 5KSAA 4Y5XA 5IB4A 3VRIA 4PJDF 2ETWA 5TQ0H 4Z7UE 4X50A 1JTOA 4JY6B 3X13B 2H5UA 3APFA 4HIXH 1EGJH 2MOVA 4QRTB 4OZIA 3UZQB 3P3TA 4EIZC 4NERA 5D6CA 1RPQA 4PLOB 4OUUB 3KLDA 4X80H 3SY6A 2LU7A 1P1VA 3RVXC 2JELL 1NBQA 4JPVH 3QCTH 1ETZA 3KCPA 3KYMA 4Y9CA 4BQ9A 1F4WL 1UWEH 2JCCE 3BVTA 2P47B 4G82A 5GZNC 2HFFA 1ZTXE 2E6PA 3BAXA 3V7AG 5CD5D 5GZOA 2OMTA 1V3LA 4R5VA 3QUMH 2YHGA 3ATDA 5K93A 15C8H 4IBVA 3K46A 5IEHA 1PKOA 2OFQA 1UGNA 3BPCA 3PG2A 4M7JH 4PSRA 4LIQH 1JZ8A 1BVNP 1DBAL 4W4OA 5CXPA 1VKXB 2J25A 3DX8A 2WQRA 5HVFB 1ZK9A 1CVRA 3LY6A 1MFVA 4GIOA 4M1GL 5AOZA 4A37A 2P52A 2VWEE 4YAQA 2J1ZA 5BO1H 5DZ9A 4FFYH 4N1HB 1XF2A 3SDXF 2FT7A 3V4PL 3C5XA 2ZUTA 2IOMA 1V05A 1MW0A 3NJVA 3UAFA 1A7PH 1YEEH 2YFNA 5E2TH 5FA4A 3U48A 3R06A 4KGLA 1S8DB 2VJXA 4UT9A 5CU9A 4ECNA 4KGJA 1NIFA 2EDEA 3C5SA 3FMGH 1U92B 5J11C 3VSTA 3O6FB 3ULUH 2YKKA 5C97A 1EHAA 4N0FA 1HZHH 5F6HJ 2WTRA 4PJ5A 4LEOA 4F15C 1BQRA 2N0MA 3EJJX 2HRGA 3E3QC 3X3FL 3HS0C 1ORSA 1FNHA 2G9KA 1GR7A 5LG6A 4JDTH 1ADWA 1UCBH 3EDKA 1PCSA 1GC1H 3KVQA 3WS3B 1HOCA 3WEMA 5JLZB 3SE4A 1ZDSA 2Z6FA 2FJHA 2ZKHL 4P2RA 1XIWB 2VDQL 5EUOF 2YD6A 1E8WA 4F9LA 1BJ1H 3C09B 4DPCX 1CICC 5F1SA 1J9RA 3GSWB 5CUSL 5DRWB 2IH1A 1J8SA 5H94A 1EMTH 4NQDA 4QUOA 4ZD3H 3IFPA 5D5MB 5IFAL 4XWOD 1OVZA 4POZC 3MBWB 3NACH 4UMGA 2XG4B 1UHVA 1W8OA 1E3XA 3FU6A 4IIQA 2HZHA 1B6DA 4P23D 2OXHB 3WFZA 1QABA 3L95B 3LKQA 1JF1A 1AQKL 4Y4KA 1WHPA 3ZYIA 5FF6A 4XE0A 3WEBA 2ZONA 5IG7B 4LLAA 1UWXK 4LEXH 2X40A 3DMMD 1MFDH 3KXFD 5LGKA 2IAMD 1BIIA 1ZT1A 2KLRA 1HIMH 3MSPA 2WQXA 2H1XA 1FL3A 3ETTA 5E6IC 1DVFA 3H2WA 3OGCB 5BVJA 5CAYB 2DJ4A 4Y19E 1A9VA 2KZBA 2BIOA 2NZ9D 5C0CE 3TURA 1JHKL 4OTXL 3QZOA 4K7PL 4JKLA 3BSZL 3S2CA 2ZOKA 5GGSB 3P11H 2BC4A 3QEHB 2E9WA 3CDGB 5FM4A 3W9EB 5HHMD 3GUTB 5JMOC 1I9JH 4J3SA 1NBYA 4HJ1A 4HUWB 3QNYA 5IQ9A 5ISZA 4Q9CA 3I6GB 1QBAA 4W9KC 3IAQA 2AXWA 1S7RA 4FTVA 1BZ7A 1KB5A 2IBBA 3L5XH 4Z3FA 1KEMH 3OJDA 4NP9A 4HS6A 2H6PB 1QG3A 1WS8A 4NBZB 4PWFA 4OLVH 2OMVA 4BWUA 1J12A 4LHUB 2I5YH 2YBRB 2TSBA 2V9UA 3ECWA 1BV8A 4WI7A 4TLSA 3QQ4B 1KCRH 3NFSH 2Y3AA 3ARED 5H37G 1CQKA 1JZIA 2CR3A 3G5YB 3LN4B 4UBDD 4W1TA 1JHLL 2P5WD 3IAGC 1DJZA 4NO0A 3HB3D 1EO5A 1I7TA 4C4KT 5HGBA 3CUPA 1R3IH 4WGKA 3WN5C 4NDMA 4M9PA 3MLWL 2VOTA 4N8VG 4ZUSA 2YGVA 3FK3A 3GINA 4XVUD 3OF6A 4F58H 5I30H 1M71B 3KL3A 3EFDL 3ROLA 4HLEA 5TDNA 1FH5H 1Q9LB 4Y2OA 3TBYB 3RGVB 1PX8A 1JRHL 4GQZA 2WZ5A 1IGMH 4JPIB 3CVIL 5HHOB 3T6QC 1XD0A 3SD2A 5FYJH 2B2XL 3ZY7A 4ZFZA 2OS7A 2ZCHL 3WIHA 2F5AL 2A6DB 1U6AH 3NGBB 2CO6A 1GGIH 3E9UA 3VYPA 2RACA 4RLDA 4HLZH 5BV7C 3W5NA 1O6SA 2GTZB 4WCYL 4PVNA 4L4VA 4HJSA 4OZHA 1JS4A 2YRZA 3LTVA 3WO4B 3ZKSD 5GS0D 1XZWA 5ERWA 1LP9F 1QEWA 3RTQD 4YNYA 2XWBA 1AD0A 4KK6D 1OM3L 4CDHA 5MHSD 4HD9A 3S5LA 2UXVA 2TAAA 4HJTA 5C09A 1FAIL 5FWQA 2VDKH 4UINL 2IH8A 5GS1A 3A4EA 4X9YA 5C3TA 1PZ5B 1S9VB 1F4YH 4AV4A 4F2ME 3ATBA 3DI2B 5EZPA 2CKBL 3FU7B 3VX1A 1SUHA 5TD4A 4N8CL 1Q72H 4QI3A 1IFHH 3AQZA 5JORB 3CZSA 2VDNL 2AJ3A 3MACL 3IMTA 2AI0H 5C3IA 1JGDB 5DVPA 3TZVB 1OCOB 3G5XB 5ESQB 4HZAA 1NEZG 4P07A 1Q0EA 4IU2A 4CN4A 1LO5A 5D1XA 1A3ZA 4PRNA 1Z9LA 3T0VA 2VIRB 5KYNA 3CU7A 1PY0A 1QSEE 4OZFB 5I0YA 3OGOE 1CE1H 4BKLA 4Z77B 1EVTC 3VXUE 5DC0A 3LD8C 1NFDE 3FSOA 3UP6A 1FZKB 2V8LA 1C08B 4HOXA 5DZVA 4YDVA 4WF7A 3QFJA 1CFMA 4U0RB 2R56L 3NCYP 5FCSH 1YNKH 5KYUB 4QT5B 1UKTA 1OZTG 7TAAA 3SDYL 2J12B 4P4RB 5G55A 3BN3B 1NPUA 1JGEA 3VFOA 3HFFA 5IGXL 1K4DB 3NPSB 2IDTA 1Q0YH 2Y1YA 1H15B 3EBAA 4URKA 3CPLA 1F4XL 4PV8A 3QC6X 3MR9B 3LDBB 1GY2A 5L4JA 4G72B 2VUOA 2VABB 5JDSA 3ZL4L 4QCIA 5BOZG 5DJ8B 2LLNA 1K9TA 4PWKA 1UATA 1KT2A 1U8HB 2FYVA 5D7EA 4U6YB 1UOLA 2EIDA 5IVXF 2P8LA 5TQ0L 4F33A 3TN0A 1DQLH 1EXUA 3CZFA 4X4YA 4HIXL 2VLJE 4XTRD 2IWGA 1N10A 4F7EA 1CLCA 1NMAH 4JLRB 3OZ9L 1ZAGA 3PXLA 2O61A 3ZQXA 2VW4A 1LD9B 1U42A 4LKXA 4X80L 3PE9A 4JRXA 3K2IA 3NVQA 2W1NA 2F5BH 4UNIA 2XYCA 1AZUA 3CFKA 4JPVL 1QRNA 2AJZB 3QCTL 1NGYA 3RDJA 3G6JF 2HLAA 4P3DA 1UWEL 5H2BA 3WHE1 3RP1A 3EJYC 3U30C 2PXYA 5F3BB 5AENA 1AHWB 3QUML 1OB0A 5J7CC 15C8L 1ZHNA 1YLBB 2PYEA 5CZXD 4M7JL 1UFUA 2ZG1A 2L4OA 1U8CA 2XPGB 4TQPA 3VMNA 4K15A 1QFWI 3WGUB 1E5CA 3NP4A 3F7RA 4GI9A 4GQQA 5TDPB 4E9RA 1A6WL 3K0WA 5GGTA 2VQ1A 5BO1L 3PWVB 3OB8A 1ZEAH 2NOYA 2QJDA 4FFYL 4PS7A 1AOZA 3BJ91 4P2OA 4M03A 2VUYA 4ZPVB 1YEEL 4A55A 3QZWB 4MRBA 4UOJA 3HG4A 5E2TL 3PGDB 4UM9B 4J3OG 4NRXA 3IDYB 3WIIL 4R7LA 2EDDA 4P3WA 1E5YA 3FMGL 4JM2C 3VH8A 2PCFA 2A38A 4D7PA 2PNDA 3KBPA 4M56A 3ULUL 4V33A 4ABWA 4POYA 2ENPA 4UM8A 1PZAA 5DWUH 5C9JB 1DSWA 3JZYA 4G8GB 3G5VB 1KLFB 2NW3A 4BGDA 1THCA 3N41F 3PWPB 4KQ0A 1I1YA 1H5BA 1RMFL 1MCCA 3HNVL 4JDTL 2XWEA 1GPOL 4UTBA 5KG9A 5FXCH 4AEEA 4BE6A 5AVWB 2ZWLT 4FXTA 4FG2A 4NNPH 3VM5A 3BPLB 3PGFL 4N87A 4F8LA 1TF4A 5E1IA 1N6QH 1SEBA 4IRJA 3EYOA 4LPWA 1ONQA 1DQVA 1W72L 1EJOL 1PYWA 2N7BA 2DYPD 2YSTA 4O2CB 3VSVA 3SCMA 2EINB 2YEQA 4WTWA 2YMTA 1NC4D 4Z0XA 1V8HA 5DJ2B 1QUPA 1ND0A 3HRZB 1EMTL 1TYJA 4ZD3L 1EHLH 2WWNA 3QWRA 1MFNA 4WI0B 4YE0A 3MNVB 3ZE2F 3PF2A 2HJFB 3TO2B 2ZOLB 4CKVX 1BX2A 1MCRA 2R4RL 2MOGA 3R0NA 1NWPA 2YN3A 1DQDH 3LRLA 4I18C 2VLRD 3F6IA 1HWWA 4CVXB 1ZXQA 4JPQA 1BFTA 2B08A 4L3EA 5E5UB 3ESOA 4LEXL 1JMZA 2APWA 1L6ZA 4MNQD 1HIML 5DK0B 2APXA 2AAAA 1MZYA 2A83A 3MRLB 5E2WH 2H0JA 1YAIA 1UT2A 2RFXA 5CN3A 4AH2A 1IO4C 1NCAH 2AQSA 2BP3A 3GXFA 3LKSA 3DOSB 3NGBC 2IADA 4N4YB 3RB7A 3FQXB 2KQMA 3OWEA 1I9JL 4L3FA 1CS6A 4DFHA 2I9LB 4NZRH 1SQMA 1YMMD 3CSBA 1R17A 1RHHB 5I8OH 3TIDB 1P4IL 2O93L 1YEWA 3IJYA 4ZMZA 3VXMD 2BIPA 3L5XL 4Y4FD 5HP5A 3FOMB 4XOAA 1WWAX 2F53E 1Z9SA 2WO2B 3PABB 5A3ID 1IGTA 1TQVA 3OB0K 4NQCA 1XR8B 4OLVL 4UILH 4Y4HB 5TF1H 1NEPA 1MUJA 2F58L 2I5YL 2NX5A 3ROOA 1KCRL 1S2EA 4XR8C 1CN4A 5FFGA 4RFNB 5K33A 3NOIA 1F02I 3IETA 3P4OB 2O6EA 2Z8SA 5J9PB 3IWUA 5CR8A 3BAYA 2P7TA 3ZKXB 3STBA 4DF9A 1R3IL 1TU2B 4PD4J 1KBPA 2NY6B 4J1UA 5I30L 5KYWA 3IPFA 3QR0A 2E47A 2WZPA 3VG9C 4WU5B 1FH5L 4IJ3B 4I0PA 4OQ1A 4WGVB 2OMWA 1IGML 5FYLH 3UTTD 1QRKA 2O6FA 1XCQA 3FRUB 2XY1A 3ZQWA 4G42A 2HPTA 4HDIA 1BSIA 2JKJA 1U6AL 4UF7C 4C58B 1GGIL 1GS7A 3EGXA 3ASNB 3SDCA 4NUQA 3HFMH 3QDMB 4IRZH 3GSNH 4FEIA 2MKWA 1BMGA 3WEAA 4NQEE 1EHKB 5HGDA 1DN0A 2X4RB 5TH2B 1IQDA 1PY4A 4P46B 5BV7H 4RAVA 2X6CA 5FO7B 1A4BA 5F1KC 3MRNA 3JTTA 5GHWL 4Q7DA 4YDLB 3V7AE 4OCXH 43CAB 1ZV5A 3LNGA 1EBPA 4B97A 4WEEA 2PYFB 1RI8A 4YBLC 1DQQA 1Q1PA 1ADQA 2VDKL 4X6CA 3U4EB 2F8IA 4TNEA 2R27A 3NSDA 4UQ3B 4CADA 3ZLQC 3TS8A 1J5DA 2HH0H 4N85A 3WIFA 5TE6L 4YHPA 1SYVB 3IE4A 1F1GA 1ZTMA 3OXRA 1N3NA 1F4YL 4JN1L 4QJ3B 1JWUB 1AMXA 3TPUA 4EVNB 3LDBC 2K7QA 4A2FA 3B5GA 1Q72L 1V7MH 1LO2H 5T33H 3K81A 3GD1C 1IFHL 4MD4B 3KLQA 3R8BB 1TO4A 4HF5H 4FLQA 4GKOA 2AI0L 2GBVA 2XZCH 2NY3B 5I8CB 1I4FA 3K1DA 1UXLA 5C08E 4L4TD 3RX5A 2WXFA 1U2HA 1M6UA 2F18A 4B0MB 1TETH 1XL6A 4LSSH 2G60H 3MRBB 4B6ZA 2V37A 4K3EL 1QLRB 4L1SA 1OF0A 3H2QA 3WY4A 3BUBA 4FZ8H 2G3MA 3NZSA 4WEUD 1L9SA 1XGTB 1FIGH 1EO8L 2HMIC 1AKPA 2WLMA 1SM3H 4PRIA 2Q8AH 5FYKH 5BQ7A 3CXHJ 4KZEH 1HK6A 1KCVH 3P30H 4HJ0C 3SO5A 2AK4D 4R7NA 4RZCB 3W11D 3HI6H 1UKSA 2XBDA 2E27H 4D9RE 4L9LC 4CDGC 4AVHA 5FOJA 4B53A 4W9GC 1Z3GL 3TJEH 5D8JH 1NC2D 2AKRB 1WH0A 1P7KB 3BIAX 4P59H 4JFXA 4M5YH 4EI5D 1SN0A 1EFXB 4GYBA 1FZOB 4X8XA 1I82A 1PU0A 2P5EB 4LCCB 1Q0YL 2G75B 5E8EA 3S7GA 1WE5A 4KKCC 4UNTA 4G8AC 1T83C 4KBPA 1ML0A 4XNUL 2WBJB 3RHWF 3UTPD 3M7FB 1T66C 1RFDH 3NESA 4YSRA 4P04A 3SE9H 1PNDA 4FABL 2NRDA 2VZUA 3VGFA 5I1IL 3T3ME 4YGAB 2E7MA 4A66A 4B7LA 4JO2L 3MLPA 2OMBA 4QHNA 2A73A 3Q5TA 3W82A 1FAKT 2K8QA 3DGGB 4ZTPH 1MCFA 1NMAL 3WY1A 3GPEA 3NZHH 5A6LA 2W88A 4KPHH 3LVTA 1W6LA 3LB6D 2H47C 4G8EA 4DOHB 2LVCA 4M7KH 4G6JH 2R23B 1KIUB 5JW3H 4RNRB 3ARDB 3PYCA 4YSSA 2WOYA 2VDPB 1X7TA 3OKMB 4Z7WA 3T4AC 1MKFA 4XMPH 1LE5B 5LGHH 2WW8A 1WEJH 4MMZC 1U8OA 4WO4A 3LKRA 4P5MB 1YY8A 2E56A 3KEHA 4TV3A 4OQTH 5IJCC 2EDHA 1OOWA 1WAAF 4O2EB 4U3CA 3O4LE 2WWOA 4KNSA 5EU3A 3MFGB 3Q01A 3FT9A 2F1BA 2R2EB 2WNKA 1S7QA 1QBLH 1VLXA 3IJ7A 3BWAA 1ZLWK 1QR1A 4KK5D 4ZMPA 3CFBB 2X4SA 4XP9H 1GZPA 2P24A 4H2AA 1ZEAL 3FYEB 5EBLA 3VYNA 4BK4A 2UWEE 2F1EA 1EWHA 3E2HC 4QRSB 1J5OH 4QOKB 1ILSA 5D2LF 3HUJB 3ZZ1A 3P4NB 3WEOA 5DMGC 3EXJA 4PRPA 5MP6H 1BYOA 3JYCA 3QJFB 4XOEA 1WT5C 4ZW8A 4HZLB 3OM3B 5D93C 5JA8B 5DWUL 4MS6A 2VITA 3D85A 3FB8B 5LVEA 5AVQB 4BA0A 1FFPA 4OBRA 2EIMB 4QKXB 1YHPA 3QBTB 4XHJC 3MYJB 2A5UA 2A6IA 4ETYA 5GGUA 5EHFA 4KJYA 1HHGA 4HIQA 1G0DA 2K6WA 2QKIC 4NNPL 2NY1B 4OU3A 2PN5A 3VXRB 1N6QL 4JE0A 4G1MA 3ASWA 3ECUA 2WWKO 1G9ML 1IL1B 3BKMH 5DJ6A 3RDTD 1YJDC 2CCLA 4AVIA 3ZR6A 1DBKH 5T3ZD 1U3YA 1NIAA 1YPZF 5JDJA 3KNBA 5K39A 4N68A 4U1GB 2ZXBA 3DXAB 1D7FA 1E40A 4M8UA 4PTUB 1UH3A 3DGCR 4GEIA 4JFED 4MYWB 1QWNA 2W92A 4NRYB 1C5DA 3BT0A 2ZXAA 1QFHA 3QHZH 4TQIA 5IY5B 2IPKB 2XLLA 2B1AH 4FQLH 5CIPB 3HI5H 1DQDL 5B38G 1VACB 2YARA 5G4NA 4OD1H 3ZKXC 4D8PB 4BHUA 4OH2A 4Y2LA 3MBED 3RY4A 3WUZA 4AJYV 1T4WA 4MD5A 2BDNH 4JRYA 1D5MA 4HKZA 3TYGH 2X4UB 4RDQG 1CURA 3GS0A 2VC2B 4GP4B 4JQIH 5E2WL 3RVUC 1JTPA 2FSEA 4W93A 1NCAL 4TUKH 1IKNC 3KYOB 3CTTA 5KS9A 1JZHA 3JVGA 5IROD 1OT4A 4CC4C 3CLEH 4PI2A 4BKSC 3VXSA 3MLTA 1HHJB 3O9WD 4OJDH 5KSBB 4NZRL 2VR7A 1H9VA 3LKNB 4GAYB 4P46C 3W57A 2VLMD 3WGVB 5I8OL 2YSSA 4CNIA 1P6WA 1IJ9A 2G2NA 3UG5A 3ZDYF 5JO5A 1JYNA 5D1QB 4YDLC 4LEEA 1YQVH 2FWOA 5ETUA 3C8KA 4QHUB 1XDTT 2C9PA 1I9RH 2IDSA 4B41A 4NKMA 4PSPA 3RUGF 2NCEA 1J0ZA 1UZ8B 3KJ4B 2UX7A 3E0GA 4OCNC 5T1LA 1A14H 2QADB 4KVCH 4O02A 2OTUB 4MVBD 2NSQA 4FP8H 3SPHA 2L7EA 4LP4A 5EN3A 1EAQA 1PAMA 2UY7A 3D4GA 1KXQA 1IGCH 2XQ0A 4GBXA 4JGJA 2F74A 1AFVL 3UYOD 1MVUA 1FVEA 1I7UA 3D1MC 3VDCA 3QEQD 3V6OA 2ZP8A 1L5GA 1K72A 4AMKH 3E8VA 5INCA 1KPRB 2R7EA 4KHTH 4MCYA 1YY9C 2PR4H 4ZAKC 2DWXA 3GMPB 1K6QH 3HG1E 5IFJA 1F11A 1AIFA 2YC1A 4WJ5B 4XHQA 1C5CH 1M7IA 2J8OA 5EOCL 1MJUL 3QYCA 5C07E 1MCPH 3NUKA 1MNUH 1WBZA 1TTRA 3AS0A 3LQZB 5BOJA 2HRLA 5GJTH 1I8LC 3BKYH 5SWSE 1U4FA 2X89D 3VXOA 4PUBH 3VFWB 3GSNL 1WCQA 4OZFH 3T4YB 1TZ8A 5AYQA 5CSZA 1TZIA 4R6UA 4M6MH 4RSVA 3A24A 1I3GL 2E75C 2YOCA 3UAJC 1OAJA 1B6UA 3P4MA 3MGTA 3J2PA 1NGZB 1T0MA 3O3DA 3PJSA 1FNSH 3EJUA 25C8H 4BUHA 5C0IB 4MNGA 4JFQA 4QHKJ 3SZ6A 2VM3A 1HCFX 5LQBL 1XGQA 1YECL 1KG0A 2XWRA 3EO0B 4FCAA 1SDYA 4HK0B 1KTLB 1FYTA 1BLNA 4WW2A 3GKZA 2IOIA 3LZNA 3W0WB 2CIKA 3WUWB 4R4BA 3T0EE 1CU4H 5DFVC 3DBSA 3SDXB 1V7ML 3P54A 2ITDB 5T33L 2IANB 5JQHC 2I9TB 1OCWH 1U3JA 2XN9B 4H26B 4YDKH 1GGTA 3KPQA 4HF5L 2R8SH 4LSTH 3AY4A 4EUPA 4EZKA 2ENJA 1QKZH 3ZDXF 2XZCL 4PJ8A 3T65B 4KVNH 1UXSB 3EH2A 5C0GA 3SDAA 4KDWA 1TFHA 4JG1H 4HXAH 2B0SH 4QLWA 4FI8A 1TETL 3TO4A 3CXDH 1TENA 1X3DA 3BVXA 1AANA 3NN8B 2D7QA 5FHBH 4XI5C 2XV2A 2ICEC 4IK7A 1FPTL 1XF3B 3SD5A 3VDAA 4E41B 1USZA 3CN3A 3CHOA 5HI4C 3RIFF 3V5DA 5I17A 4R84A 1FIGL 2RR3A 2Y1VA 1SM3L 3QVAA 5FYKL 4KZEL 5AL8A 3EH4B 1KCVL 5F7BA 2OZ4A 2JCCA 1KJ2H 3HI6L 3D18B 4O2FB 4GFXA 2HVKB 2X9YA 2GK0A 2JJWA 4KUZH 1J1XL 4KO9A 3WD5H 5D8JL 4S1SL 1FZMA 5DLMH 4U7MA 2D31B 1K2DB 1SXCA 2OYKA 3LCYA 3L3KA 4P59L 4KHXH 4N9OB 5ICXA 4LP5A 4XPHL 1Z1WA 1RULH 3PL6D 4IOFC 4J8RB 3KWWA 1G7LA 1RFDL 2R0KH 1H0DA 2JCWA 2HFGH 4TTGA 3SE9L 2Y9RT 2WYIA 4YEEA 5AFAA 3FT2A 1RH8A 2EUWA 2J2ZA 4CMHB 1X44A 4KKBC 4AQAB 3OD3A 2O6DA 4NHUB 4M5TA 5C0NC 4N2AA 1N0LB 5E00B 3J8F7 2JTYA 3BD5A 3D51A 4JDEB 1HL4A 4MSWA 4GT0A 3HAEB 4KPHL 4BIKA 1T1XB 4HFWB 3VGEA 4M7KL 4W68A 4XNZC 5JW3L 5DYOB 2YPKA 1UD6A 4PGEA 4OLZH 5LXVA 2H26B 4FC3E 4KKRA 3TFKD 3KL0A 2X4PA 5LGHL 3VG0H 4MDJB 1LK3H 3U2SB 3X1NA 2M8XA 4OQTL 3QIUD 5FYJU 5CEZH 1Z9OA 4YSOA 4OD2B 2WVVB 4ABUA 1OO2A 1YVLA 1SVCP 4ZNEE 1FNGB 3AT0A 3WKML 1MOEA 4ELKB 1QBLL 5KVMC 5EF2A 1ASQA 4JZJB 2YMXH 3JBG7 4NNYA 3S37X 1XB6A 4XP9L 4A7GA 3QAQA 2ZX8A 1EANA 3VQ1C 5BVPL 2ZNWA 4WUUA 5T1JA 1J5OL 3VRJB 2YK1H 3KPSD 2EDRA 2F8OA 4QGTA 3WMQA 3WCYA 4CGUB 1I53A 3VGAB 2J8HA 2ZSVA 2YQGA 2VDMH 1WHOA 3TCLA 5LUMA 1M57B 5JOEA 5F9OL 2NY7H 5MP6L 5DT1H 3UCQA 3QXVA 3B7TA 5AD0A 4AKOA 4XPTH 1UXMA 5EBWB 2E4TA 5DHDA 5IHUH 3MV9E 1RAMA 4ANWA 1G9EA 1KV3A 3U9UB 4D8OA 3Q06A 4YC2C 2OYMA 1TDQA 3MLYH 1MI5E 2BP0B 1UA6L 2MNWA 3GRGA 3O0LA 4WRLA 3QUZA 3V0GA 1IM9A 1RL1A 5I0VA 3ZSTA 3S8WA 4FXKB 3PUCA 3QJHA 4KC3B 1TQUA 5DS8A 2W9EH 2KH2B 4P23A 4PG9A 1NUGA 4PGBA 4U1LB 4X6BA 5C9KA 1MJ7H 4ATTA 1SXAA 3TYFB 4KJWD 4KJPC 2M26A 4PYGA 1ZD6A 3NTCH 1CI3M 2CO4A 5LXGL 2EDJA 1YMHA 3BKML 3LYRA 4N86A 4PJHF 2OL3H 2Q0ZX 3T8VA 5F8QC 1G7PA 5DJCB 2AHIA 1UCTA 4TNGA 1CXHA 3U6XS 2Q6WB 1YJDH 3B2VH 5D7KD 1RZJC 4NXKA 5C86A 3MAWA 3GFUA 1NDMB 5E56A 5A6IA 2Y5TB 3QHZL 3U0WL 2B1AL 4AVKA 3HI5L 3LZPA 3DJTA 1MHHB 3DBXA 1AH1A 1F6AA 4UZUA 5FO8A 3QIWB 1FBIH 2BVPA 3I6LD 2HRHA 3PS6A 5ACLA 2Y7OA 4JRLA 2W60B 2C1PA 1ETA1 2A9NH 4OUOA 4WEBL 3B1TA 5CLYA 3QJSB 2KT6A 4Y9EA 3B9KA 4BFGA 3TYGL 3G6DL 3DGDA 3F7QA 2WXNA 3QEUB 2A3TA 3TBVB 4ANUA 5F9JB 8FABA 2B1HH 3X1BA 5SX4I 5CBAB 4JPSA 1R3JA 4F7MA 1N59A 4IRSD 4PJGA 4O9HL 2VXQH 2YQ3A 2MQ3A 1A25A 5TTRA 5CP7A 5JXEC 1LO3H 5DXWA 1RUAL 1OP5K 4QKTA 3MTRA 1QFOA 1OGAE 3GSRA 2LAGB 4P99A 1F3RB 4IBUA 1JV2A 4AW7A 5JPMB 1TZGH 3BO8A 2FX9H 3S9DB 2X9WA 5F2FA 1YQVL 1A3RH 4PAZA 5FGCE 2WBKA 1T21B 4DJMA 4JN2B 2NT0A 3VI3B 3BW9B 4BV1A 5BZDA 5KN5B 4UQ9A 1RKRA 2FL5A 5FM5M 5IREA 1A14L 4FP8L 4HKBA 2VZ1A 3Q44A 4DQOH 2DWEA 2HJLA 4N90D 4X6DE 4POUB 2X3AA 5AB0A 3C6LC 4ZS6C 1MJJB 1IGCL 3AG3B 4YHZL 1SHWA 4BKTC 1HCVA 3VXPA 4F2MA 4PJXA 4AMKL 1E4KC 2C9QA 2WZ6A 4PVLA 5DQDH 2M83A 4KHTL 5C8JA 2EADA 2PR4L 5EIVA 1UM6L 1KJ3H 1ACZA 2D7NA 4F2FA 3HPLA 5JQ6H 3WE6A 1G7MA 4F37K 1MCPL 2FNWA 4N0UE 1LMKA 5G4MA 3HRPA 3TA3B 3WL9A 4F5CE 2D4FA 5GJTL 3BKYL 1AXTH 4H8QA 4PRHE 5AAMA 3RBSA 4AY0A 3M88A 2DQFA 5D7LD 4Z7NB 2EUXA 1MSPA 3VD4A 2HVJB 5EOTA 3G6JB 4RA0C 5EU7C 2P80A 3VGBA 3VXUA 4BDVA 2DQHH 1TTAA 2FEEL 1NFDA 2F8VA 3GKWL 4UZSA 2IWFA 4WDIB 4NKDA 2X0WA 2B5IC 1FNSL 1QEXA 1B9KA 3BN9D 1OWWA 1R5IA 5F1NA 4RISH 5T1KA 3NIGB 2XZAH 3AM8A 4FQXA 5EMYA 4PHZA 2O1AA 2QL1A 3R0MA 3RAJH 2V8MA 3D69A 1W0VB 2BZDA 1X4YA 1A7RL 3CFCH 3TEXA 1I3UA 1IEBB 3MV8A 1FHGA 3TL5A 4U1JB 4IBSA 5FOBA 1E2WA 4N0YH 1FN4B 1SHXA 1YEIH 4LVNB 4D0CA 4XN4A 4LASH 1QPPA 2WLJA 4HLZG 4C56E 4F3FB 4IHOB 2P8MA 5DQJB 1OCWL 3IJHA 4YDKL 1PZBA 3DTXB 4HWBA 3N43B 4LSTL 4PWHA 3GZPA 1ORQB 1QKZL 2CUHA 4XGZA 4Z3GA 4KVNL 2QV2A 3K6NA 2FX8L 2YEVB 4PLKC 5E08H 4ODHL 4PRDB 1VZHA 1PZUB 4ELMF 3DECA 4ICXA 4LBEA 1BEXA 4XNMA 1TQCB 5JPNB 1S7UB 3CXDL 1SDDA 4U2ZA 5JHDA 5D7IF 2YKLH 3ORJA 5FHBL 2XFGB 3GBLA 1A1NA 5KJRH 3ZYZA 1V5JA 4HH9A 2YAOA 5JW4M 1FF5A 1TZOA 2H2SD 4R0LC 4HOMA 3RIAK 1WBYB 5GGVY 3I3EA 2NNAA 3S37H 3DV6A 4B7IA 4R7VA 1SEQH 1BVKB 3V7MA 3DMMB 3KXFB 3KPMB 4HAFA 4AEIH 1CDBA 1KJ2L 2FJGB 2J5LB 4K5MA 3V5HB 3RBGA 1A4JA 2GJJA 1F3JA 4I3SH 4TNWF 3DRQA 2A74B 4XO3A 1AQDB 3FH8A 4BSWB 3HS8A 5DLML 4DP4X 4OGAD 4HYTB 2CO1A 4W9CC 4JZJC 1HOEA 2K45A 4KHXL 2YPVA 1DBMH 3WY2A 1D2OA 2V4LA 1RULL 1VESA 1JK8A 2UVEA 4NPKA 3PWNB 1WQVT 5DTFA 5F89B 1HFUA 2Z8VC 3ZE2B 3W39A 1FL5B 5C0EB 3MV7E 4I9WE 3P1VA 4MA8L 5EORH 1AO7B 4PJ7B 3AWEA 2HFGL 4PJ9D 3U4KA 2E59A 4P49A 1J1PH 3BVNB 3IS1X 2O72A 4APQB 5GJSL 3VGAC 2K9UA 2PWHA 5LGJB 3AAZB 3DK0A 2GJ6E 1FVDA 2F08A 1CO1A 4PWJA 3DO7B 1BJ1J 4UT7H 5KBDA 3SSGA 1MLCB 4GG6E 3OKOA 2BM3A 4ZSOA 1MWAA 3DX6A 2WKOF 1CFQB 1HSAB 3HE6C 4ADIA 5I2IA 3QORD 1SXSA 3QQ3A 2P5WB 4OLZL 1CIDA 1IC4H 3BDYH 4FXKC 2Y69B 1E42A 4G3YH 5CWSB 1KV7A 1CIUA 3QS3A 4KQ4L 1Z2KA 1XWVA 1LK3L 2WIIA 3I9IA 3GLDA 5C1MB 2VSKB 4GQPH 4IKKA 1ZRUA 1NLDL 2DRUA 3ALWA 1L7IL 1TYRA 2D2CC 2ALWA 5IJBC 5KAQG 4ZO9A 1S9XB 2DLFL 1J0IA 2W8CA 2YMXL 4V1DB 3P0GB 3QK0A 1LMIA 3QI9A 5D4HA 1ZHLA 1P5UB 1W0WB 1JF5A 4WHTA 1A5FL 1HEZB 1QO3B 1NIEA 2ZYSA 1VHPA 3AZUA 4WAFA 4XC1H 1U3HC 3AY4C 1JXKA 3WJJA 5IQMA 2YPLE 5EZJB 1OGTA 1R3HB 2YK1L 4KV5F 4P05A 4Q74A 5EU6E 1T6BX 4DGIH 1BGXH 1DJXA 3LS4L 1F56A 4RAHA 1JWMB 4N1EA 1I7RA 3HE7A 1KB9J 4PJCB 4ZW5A 3QIWC 3KDMA 3MLSH 5DUJA 3WTTA 2JK5A 2VDML 3D3VE 4KK9C 2NY7L 4GUPA 2OTWB 5DT1L 1ZS8B 1Z7JA 3K0YA 3C5ZB 4F27A 4XPTL 5IHUL 1GH7A 1F18A 3K71B 5L4FA 1R1CA 2BIHA 3EBIA 2B39A 2FRGP 3MLYL 3WLWC 5M94B 1Q9KB 4Y19D 1SNRA 3ZE0F 1WVZA 2HTLC 1KPUA 3M45A 2W9EL 1H8OA 1MJ7L 2B3IA 2FB4L 3VD5A 1QAWA 3NTCL 2D2OA 5INDB 1R24B 5AUMA 1XSOA 5EDXA 2VN3A 1G6VK 2OL3L 3G08A 4YHLL 1MEXH 3L2LA 3VFTA 5D9SB 5AW1B 1GTFA 1AZBA 1HH6A 4WU7B 1E4JA 2A6KB 1B90A 5I1DB 1FP5A 3B2VL 2RIKA 2SODB 3WO3B 4XAKD 1HCZA 3OMZA 1A8ZA 2EE2A 4E9LA 4KNQA 3VU1A 2WXQA 2ZF9A 3EJQA 4DP2X 1RZJH 4NQTA 3D06A 5CD5C 4HUUB 1UEYA 4A7VA 5BMFH 1ZSDA 1JZ4A 4LRIC 4BEIA 1LILA 4D2NA 3VWJD 4ZUVA 1XXFC 1DCEA 4U1KA 2A9NL 3HG2A 1OAXL 1A6AA 4Y4FA 2E5EA 2EXYD 4YE4H 3RPBA 2XBZA 4FFTA 3QZNA 4YS4A 2DV6A 5SWZB 4LAQH 5EIIA 2BVOA 2GBAA 3GRWA 1UA7A 3V79C 2AXFB 2B1HL 4LSVL 5HYSB 2RCSL 3D39B 3IYLW 3HOGA 2AJVH 2VXQL 4OZGB 4WI3A 1UD4A 4YIQA 1ZLVK 1LO3L 1X7SA 5EBMA 1WFMA 3SGKC 2AQTA 1A1MB 4JM0A 5KSAB 5IB4B 2DIJA 3MO1A 3VRIB 2UYLA 1AR1B 1MHCA 5LCVA 4H1LH 4NQEA 1TZGL 4Z78B 2FX9L 3ULSA 3QXAB 1A3RL 4LLYB 1B0RA 4OZIB 1HT6A 1KYDA 3P0YH 4P8QA 5I75B 4NO5A 2YIHA 5D6CB 4E9SA 3GIZH 2JXMA 5HDBF 2XG5A 2ZT9C 1IC0A 1Y0LA 5E0FA 3DLQR 4YLQT 5F7DB 3IDMB 5CCJA 1ETZB 2A9AA 3KBHE 3CIQA 3KYMB 4ZO6A 5IJVA 3QH3A 2CGRH 4AENA 3VVWA 2VDOH 4QD2E 4DKEH 2HFFB 3PV6A 3MJ9H 2IH3A 4ZMWA 3AMLA 1E5BA 2CUIA 2BRQA 3CLFH 3DIFA 4OFYD 1PX3A 5C0AA 2C9SA 2PO6A 3BPCB 3N06B 3UBXG 1X5KA 4Z7OB 4MQXD 4OLWH 4FA7B 4L48A 2QHLA 3D0AA 3K72A 3N55A 3RPIA 2EC9U 1QLFB 4GRWB 2OMXA 2BIIA 2VH5H 4XWOC 3OXSA 1KJ3L 2VW7A 2VSDA 2DWDA 5JQ6L 5JPNC 3D7PA 4Y7OC 1R47A 1NAMA 1OP4A 1CD9B 1NOLA 1SJEA 3EOAA 2H6UA 2Z7WA 1AXTL 3QUYA 4K3HA 1CDGA 2YXVA 3QSKB 2YUVA 4GSQA 4UTBL 3NRFA 1DLFH 5FA4B 4P9HC 5CILH 4MDRA 1R3KA 3WXVL 4FD0A 1NCBH 1QSED 1T04A 3B8SA 1QUNB 1USQA 3A21A 4G8IA 3WHXA 2DQHL 3DMMC 3BESR 2C3WA 2IAMC 1U36A 2W07B 3C5SB 1KTJA 3AT9A 3H0TB 3MRKA 4HJJL 4BSJA 4Z7UF 2OJEB 1PQZA 3GZKA 2BHYA 4HS3A 4DETA 3TBCA 2A74C 3BRGC 2NZ9C 4RISL 3HTLX 4N0FB 3VXTA 2XZAL 3PNWA 3Q8BA 4L4TA 3BHBA 1CYGA 2YXFA 4LEOB 4N6RA 5C3LD 4J3TA 3F83A 3LMJL 1CFTB 2NUPB 1NFKA 2AC0A 1ORSB 4JO1L 2IQ9H 4N0YL 5SX4H 3QWOA 4NUMA 3TONA 1G7IA 4BFIA 4LASL 1MJ8L 1TVBB 1UH4A 1P69B 1W15A 2W80C 1EEYA 4JFDE 3CN2A 2CO7B 5F7LB 4XRCA 1NC4B 5D2LB 3RI5F 3OKKA 2V2XA 3FUIA 2IH1B 4MHHI 5H94B 1N5YH 3ZRFC 4NQDB 5L8LB 1KCLA 3TBSA 1QNZH 3CFTA 1N8ZA 1NC2A 2X10A 3HPJB 4QF1A 2YKLL 3AREC 3FFCD 4A2HA 3ASOB 1I9IL 5DJDA 5KJRL 3N0AA 3C2AH 3KPRD 4IIQB 2VLJD 3T71A 3D0VB 4M02A 4A04A 5AW3B 2DW5A 3HB3C 1KJMA 1DO5A 1F2QA 1INDL 1QI3A 2R69H 3KPOA 5E5LA 3S37L 2IALA 1SEQL 4XVUC 5I5RA 4AEIL 3NJMA 5J1AB 1JZFA 4MNQB 5EIQA 1BIIB 1FFTB 2OMYA 2BNQA 2V5RA 3ZUCA 4I3SL 1FL3B 1YO4A 3EDJA 3O4OB 5BVJB 2XRAL 5KVEH 1IGIH 5ESAA 3ULVL 5IP4A 3O4LA 4LCIH 5FHAH 5KBPA 1DBML 1AZCA 3H85A 2F54E 3HC4L 5DDHA 1P5UC 1DQKA 4KMTL 1YEFH 2DICA 3ULUE 4AIZA 1NBYB 2WLLB 3QNYB 5DRNA 5IQ9B 1K4CB 1X5AA 1YMMB 4MA7H 4MJHA 4YLBA 5GS0C 3VXMB 4NAQA 4G9DA 2UWEA 1J1PL 3RTQC 1S7RB 3EXLA 1BZ7B 1KB5B 1I75A 4KK6C 2DM4A 3OJDB 4PM1A 4HS6B 2MOQA 1GGCH 3CZJA 4GFTB 1S78D 5K9KA 1DFXA 1R34A 5F6IB 4LP8A 3BWUF 3H53A 2R4SH 1ACXA 2XQBL 4WI9A 5HYEA 3CHPA 2HT2D 4QDGA 1PGRB 1I1FA 5IOPA 4HIPA 2MNUA 2ZKWA 4HPOH 1XCXA 3ZMNA 1AG6A 3FBKA 1EHNA 3GYRA 2O5NA 3RFZA 3BDYL 3MU3A 4D0BA 2F15A 3BVDB 5HGBB 1IAKA 2PPEA 1H3VA 3CUPB 5J5EA 2DQUL 1M1XA 1QBML 2V7NA 3CVBA 3P73A 4NDMB 4Y5VA 4ZUSB 3X1GA 5ECGA 5MERB 5BRPA 2CG9X 3AC0A 2PPFA 2FD6H 3ROLB 5TDNB 1RZ8B 3LPOA 4TMPA 3HC2A 4Y2OB 4UIMA 4WV1C 1FL6A 2X9XA 5F9WB 2GEQA 2PTUA 4OCWH 4HPYH 4ZFZB 2YS4A 2CO6B 4IW4C 2XT1B 5I74B 5EEVA 1IKFH 1S3RA 1O6SB 4OGXL 2HVBA 3FOLB 4XC1L 1MFCH 2AQPA 4JFOA 1JNJA 4U6HB 4BM7A 3GIVA 2XPZA 4OZHB 4DGIL 3OTTA 5ERWB 3R19A 1VFBA 1QEWB 2Z4TA 2XWBB 3L5WA 3MLSL 3MZTA 1QPKA 4HEME 2BLFA 3L8QA 4FZEH