3DPBB

Crystal structure of the complex of the caf1m chaperone with the mini-fiber of two caf1 subunits (caf1:caf1), carrying the ala9val, ala11val, and leu13val mutations in the gd donor strand
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
149
structure length
149
Chain Sequence
ADLTASTTVTVTVVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein caf1M
publication title Hydrophobicity and rigidity of binding segments enable CAF1M chaperone to act as assembly catalyst
rcsb
source organism Yersinia pestis
molecule tags Chaperone/structural protein
total genus 21
structure length 149
sequence length 149
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09255 Antig_Caf1 Caf1 Capsule antigen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1310 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3dpbB00
1Z9SB 3DSNB 4AYFB 1P5UC 4AZ8B 1P5VB 3DOSB 1P5UB 3DPBB 4B0MB
chains in the Genus database with same CATH superfamily
4Q0XH 2DQTL 4U1LB 4ODUA 4I1RA 5FECA 4XMKH 4ZOCA 4DESA 3BZEA 1JHKL 1OTTC 3MYJA 2VSDA 4FDWA 1A02N 2ZD0A 3R7QA 4QTHA 3NZHH 3MI6A 2ATKA 1UWGH 4NDMB 1TEYA 4FULA 3V8CA 2X1QA 4OH2A 1X5YA 3RGVC 1H3WM 1TOXA 5B3SB 1UB5A 4KVNL 4UIKH 1XD0A 1TQBC 3TS8A 3KPPA 2GSIA 3O4LE 5INCA 1ETA1 1NFDB 1ZT7A 3QCVH 3OGCA 4NJ9H 2XBTA 1FFOA 3BUIA 4ZW8A 5D2NA 3S5YA 4OF0A 4FTDA 2Q87A 1MWAL 4JFWA 1D5ZA 3MTXA 1SJMA 4L4TB 4WI0A 1E9QB 1RCYA 3DBSA 4J3SA 2G3ZA 4LMQI 4EZLA 5IW6B 2Y5TB 3BJLA 3TCLB 1WZ1L 3ZZQA 5T5NG 2GK0A 1VDGA 4PH8A 4Z77B 1UM6L 1YEFL 2JB6A 1MRFL 1ZSDA 3V0AC 3UAEA 2IV8A 4JAMA 3LEXB 4U7KA 3K8MA 2H6UA 5DMJB 5HHOD 3FBKA 1D7CA 3PDOA 3L45A 3PUUA 1OSZB 1RZQA 4LKCB 5AVUB 3MFFA 4EI0A 2NW3B 5EUOE 1KIPA 4G7VH 4UQ2B 2R2HB 4U6YB 1U8CB 1RI8A 3VD4A 3UGEA 1J48A 1J0JA 4CC1A 5JPMA 3FU6A 1B3IA 1NGPH 2CO7B 4OLUL 3K7UA 4PRIB 2DQJH 3QJQB 1VF5C 2XZCL 4S2SB 1BF8A 4BFEA 4ENEC 2KYIA 1VJSA 2IOIA 2B0SH 4RFEA 3KXFD 1CURA 1WGOA 3B3IB 2ZAGA 3P77B 5A3ID 2ED9A 5D1QC 3A3YB 3DARA 2GTWB 4PM1A 5IQOA 2E9WA 3NIDE 2Z7ZA 3VRIA 2FLRT 4XP6H 5IBLC 4U1KB 2R4RH 3LXCA 4E9XA 3ESNA 1FZKB 1OAKH 4ANWA 4J4PD 5IF0B 3SDYL 4W9GC 3EW3B 4QXWA 1C7TA 5HHPB 4WCYH 3FT2A 1DJGA 5HHOA 2F1BA 5SV4A 2R0ZL 3EGXA 5GRVL 3FONA 3ECQA 2EH7H 3F00A 2VERA 2C3VA 1ZAGA 5JR1L 2AV7A 1JERA 2ZOLA 1ZA3A 1A7RH 3D9AL 5DS8A 4XPAL 4LOEA 4KK9C 1JWMA 3L1EA 3QJFA 1RURH 4HLEA 4GI8A 1QTYT 3AY4A 1OCWH 4YXHH 4ELMA 2F54D 3KXFA 4XMUA 1CD1B 2WQUA 1JN6A 3ZDXF 3D69B 4X7TB 2WQRA 3O4LD 1KFAL 1OLLA 4HWNA 4YSSA 3QG7L 2N7AA 2FEDC 3AC0A 2FX7H 3DHJA 4LDLB 4YDVA 5D7IB 2OK0L 3F5WA 3QDGE 2NXYD 2NSQA 4WSJA 5DMKA 3KNBB 3CDYA 3FQNB 1U8MB 2WQAA 5EPMA 4J4PA 2AJSL 3FW6A 1IU1A 4J3UA 3MNWB 2X4RB 3D08A 3VM5A 1T80A 2RJMA 4JFYB 1LE9B 1WC7B 2WJ7A 5D96C 3CZFA 3L2LA 4PRBA 2ED7A 2QFRA 2RB8A 4ELKB 4XMTA 3WEXA 4QHNB 3VI4E 5I0DA 4P5KB 3POCA 3S9DB 4GW4B 4UV4H 4MCYA 2N1KA 4NKDB 1NOFA 1HKLH 3KVQA 4OCSH 4XBEH 4FHKA 5HJBA 5IVZA 3IS0X 3OZLA 1VFOA 4N0RA 2YIHA 4M62H 2PETA 1NEZA 1CCZA 2F54A 3FO0L 4ZFOL 1WYJA 4B5EA 3NN8A 1JGLH 1AHWC 1L7IL 3RX9A 2Y07L 3IJHB 3O4LA 3RX8A 1IAOB 1QVOB 3FCUB 1Y1UA 3IAPA 1XF5A 3QUMA 3SDAB 4QOKD 5GRUH 1ETJA 3ZRSA 2BSCA 3P3SA 4KJWD 1FYHB 2IDFA 2PCXA 4WW1B 2DLEA 1I1YA 1DQJA 3RAJH 4M3HA 3VSVA 2BX5A 4L8BA 4NQCE 2AXGB 5I8EB 1YNLL 4HUUB 4MHHI 4MASA 2CBQA 5TDPA 4F7TB 5AYUL 1J8HE 3ZOAA 3MLWL 5HHXL 1FVDB 3TT3L 1SJVA 2D2CC 4B9KC 2IH9A 2R23A 1FL3A 1DHKA 2CDFA 4IKIA 4R84A 2ZKWA 3ZTJH 3PGFH 4LLWB 3GRBA 5IW1B 4JKLA 3FOLA 1OCCB 3NSXA 3MBEB 3MLXH 3TV3L 4F24A 1IAIH 4LVNC 4YQXL 2XWJA 4X99B 4C4UA 1A6VH 5I6XB 4YXLL 1YMHB 2NLJB 3CZGA 3DK0A 3I6KA 1RU9L 1KDIA 1GOFA 1U3HC 3RB7A 1QAWA 5EUOA 4F15B 1DJHA 5IMLB 3S8FB 2WQ8A 1DVZA 4F57L 3FB6B 3AWFA 4QOKA 4TRPL 5BUPA 2ZYRA 2Q6WA 4XHQA 2AKRA 3MBWB 3QWOB 4E2OA 1BEXA 5CCKH 4UTBL 3FT4A 3NK3A 1LP9F 2GG1A 4IJ3B 3LXUX 3G5ZB 4L0ZA 3W3BA 4LLYB 5EZLB 5D93C 5K93A 4HLZH 1NBYB 1JK8B 2PWHA 2X9YA 3BE1H 2CM6A 1MIEL 2MPAL 2FGWH 1C5BH 4OFKA 4GUPA 3S34H 4G5ZH 4CU8A 1IC1A 4MXWH 2H3XC 4BZ2L 4TV3A 2L7UA 1QBLL 1SY6A 4MAZA 1HSAA 4PJEF 1JGUL 4PV1C 4JQIH 4DEPB 5I74B 1TNMA 2E0PA 2A9MH 5KVEH 1OAUH 5JQ6H 1G9NC 4JUSA 4Y5YB 3GSXA 1SLXA 5DMGC 4J6RL 4TLTA 4KKAC 3IAGC 5I75C 4RMQA 1A7OL 3DVGA 2YQBA 3NAAH 3KYOB 4HH9A 3P9LA 4ZUTB 3CZSA 1T1WB 3PV6A 4U33A 2W07B 5HGHB 4GMSL 3D30A 3OKKA 5BRZB 3RHWK 2X2JA 1JCVA 2P28B 5ILTL 1YEDA 5JHBA 5EO9A 3MRKB 2WXLA 3HI5H 1CG9A 4OM1H 4P23C 1I8IA 2GBUA 2L7QA 3BI9X 3FB8A 3APCA 2DM7A 3PWUB 4X7SL 5JPNA 2NY0B 2AW2A 1PZ5B 1S7RB 2Z4QA 3QDGA 3S97C 2E76C 4X4ZA 2BXYA 1USQA 2W60A 1AO7E 4Y4FB 3CUPA 1C9SA 3K2IA 5LAPA 4PTUB 1MWAA 3NJIA 1RUQH 4ZX5A 4EI6A 2ZPKL 2JB5H 2AZUA 3HMXL 1W91A 4K94H 5L9DL 1CK0L 2GAZB 3UTTE 5LG1A 3L3OA 1LK2B 5A2KH 4ZAKB 3VI4A 1IAKB 1K4CA 3PGCB 2IGFH 4FD0A 4Q6YA 4PB9H 2PTTB 1Y18B 2KMWA 4WW2F 4FQHA 2HB0A 3JV4B 4GW5B 4LBEA 5TE4H 1EO8L 1ADQH 2O5ZL 1JDAA 5CUSL 5HJGA 3VD5A 4YPGA 2X1OA 1OAXH 5IHUH 5DFVC 1M4KA 3A21A 3NEXA 3X1EA 1R3KB 1RZ7L 3CPLA 3UZVB 2QQNH 3POHA 2CK0L 4UM8B 3ARYA 4ETQB 4TQPA 1CXFA 3PQYE 4UNIA 2VRAA 4FABL 2ZAHA 2GJRA 2ZX6A 5E2TH 3DHUA 3LEYH 2CKNA 3QJVB 2VYRE 2G3NA 5F2FA 3ZDZB 4LEXH 3CNKA 4JFDD 1YMMD 2NYKA 1MELA 3QJZA 2Q3ZA 3NJHA 4FL4C 2H8PA 2HH0H 4Z7UE 2W8CA 4Z7VF 4KJYB 4BGDA 1EHLH 2KH2B 3NZ8B 5DJ2A 1WAPA 5C86A 2CR0A 2VLME 4YSOA 5HVFB 2EXWC 2OTWA 1BM3H 5D70H 2Z8SA 3CSPA 3CVHH 1TKWA 2EAEA 4Z7OB 1VEOA 3D34A 5LGHL 4LGRB 2A9BA 4BZYA 4GXUM 2R8SL 1OL0A 2R1WB 4P06A 4BSVB 4CNIB 3N43B 1U3JA 5MERB 1YEGH 3VNYA 1FA4A 3FHEA 1J1OH 3OAYK 5I5JA 2WBJC 3O45A 2E6JA 3NRFA 4QRTA 3MPCA 2OBGA 4G8EB 5K9QI 4XCYA 1YVLA 4C4KT 3BH4A 3WFZA 2VITB 3NTCH 3K5RA 4LLMB 4MA7H 3KPMA 1XT5A 3H9SB 2YGQA 1A6AA 4PJAE 1YMMA 1R3HA 1EEUA 5F1IA 3EYOB 3N40P 3ABMB 1CFTA 4BK5A 1DQML 5FW7A 1M1XB 2ADIB 1RUAL 4N2KA 2IGTA 1W8NA 4JFXA 5F3BA 2FIKA 3QXDB 1MDAA 4FG2A 1J12A 1Q9KB 4UT9A 3O6LH 4NXSA 3TYGL 3GZQA 3UTTD 3HNSH 2FAUA 4WI6A 1HILB 2CE6A 5IJDC 1A2YA 3Q2CA 4FEIA 4YBLB 1I8LC 3JTSA 3CLFL 5HYQA 1EHAA 3FMGH 2Z7YA 1UFGA 5TK4A 3L7EB 5BZWB 2XA8H 4N2LA 2FJHB 1ZEAH 2GTZB 1FNEA 1K9TA 1X5MA 4XI5C 1IGIL 3VG0L 3TZVD 1VKXA 5EN2B 1UWXK 3OHXC 3K1KC 3HAEG 2V8LA 2IBGA 2L7EA 1IBFA 3GMOB 3OPZL 5FYKH 2D9QB 4FFYH 2C7UA 5F1NA 1T7YA 4NFCA 5L2JA 2DLGA 2EE9A 2ZXDA 3ZE1F 1AD9A 1QO3A 3CZJA 3PQYD 4QHLB 2BIMA 4LCWB 1II4E 5BZDA 2K9UA 1IC7H 1UUNA 4NO2B 5EF2A 4LLDB 1V3LA 2NDFA 3BN3B 3GRWL 1QTSA 3U9PH 5FHBL 3I6LD 5K9JH 4E42A 4RISH 3OAWA 1KPUA 4YS4A 3O2VL 1FFPA 3W9EB 4FFVD 3KPLA 3UTTA 2RCSL 3B1TA 2CO6A 1A66A 4PGZA 4WRLA 3HC3H 4LAQL 5EZJB 1NGXB 1F4WH 5DJAB 4OV5A 4H5SA 2VLMD 5KS9B 1X9QA 5KYUA 1ECYA 2CDEB 3LQAH 2AEIT 3HPLB 4BH7A 3HHRB 4Z0BL 2QKSA 1QFWM 3TZVA 4IHOB 3AITA 4CADA 2C1PB 5DK3A 5DQ9A 3TEUA 2VDPL 1QWNA 3VSUA 4MAUL 5GGTL 3WUZA 3QO0A 5DHMC 5JW4Q 1ZHKB 1LE5B 4GAJH 1QWHA 3QWRD 3CFDA 3PQYA 5G5DA 1A65A 2BFVL 5BOJA 1CZ8L 4WDIB 1FYTE 2J56A 1PX4A 5E8NA 3ROLB 4HWEH 4UTBA 3ELAT 4FXKC 2Q8BH 4HIIB 1F00I 4DKEH 4OZIB 4CBPA 5A2AA 4QJ4B 4XVOA 3DMMB 4U0QB 3K2UL 2RA1A 3NCYS 5E1QA 4XNYL 4J6IA 2XV2A 3RL2B 1N3NA 3SQRA 1CLZL 1XBDA 1ZTMA 3K72A 3Q9PA 1A6UH 1C8PA 4H4NA 3MBXH 4Z7UA 1KMGA 2AAVA 1JPGB 3QZOA 1BXUA 5IQ7L 1K4DB 2Z91A 2F1AA 3W0WE 4BZ2A 1MFDL 3EJYC 5C0DB 2HVKB 5C0JA 4ONOA 3RWHA 3LPWA 1MCDA 1WISA 5EIQA 4HUXA 3VM7A 1MFEL 3RVXC 4XH2B 2FDBP 3V4VA 1I7TA 1XR9B 4IRJB 4ZDHA 1Y07A 1T1XA 4R8WH 1W0YT 2NY6D 3BZFA 3SKMA 3FUDA 4DFHA 1MEXH 2WLLB 5DVNA 2VMEA 5A16A 1AHKA 1CBVH 1NKOA 3VSTA 5B1JC 1UD2A 5MEOA 4K3JL 4PYHA 3QWRA 2HRPL 3RDTB 2TRHA 1KYDA 1BLIA 4K3EH 1F56A 2XQBH 4YSEA 3WMSA 3BCFA 5F7FA 5I71C 1MLCA 4JLRB 3MUGA 1RHFA 5HGDA 4XVTH 2B1HH 2JJSA 3EH4B 1SBBA 4MJ5A 2CJUH 1FNGB 4QYOA 4WWKB 3MRCA 1NMBL 2LLLA 4Y2LA 1IC4H 4NHCH 4PJAA 3FN3A 5C1MB 3WFEH 4U1SB 2MNUA 2XV0A 4V1DB 3AAZB 5C08E 1TUPA 4D7BA 4LPCA 2OJEA 3GIZH 4G9DA 1WICA 2OSYA 4WFGD 3WV0A 3IGAA 2Z9TA 4L3CB 3HMXA 1RPQA 1ECZA 3NEOA 5EN3A 1U3YA 1ZY9A 4JFPB 1RIHH 1HHJA 3KD4A 2MQCA 3ARGC 2H1XA 4QXGL 5AYQA 3V5KA 3ALWA 4DH2A 3CXHK 2X6BA 4LK4A 4TSAL 3BSZL 5FHAH 2I07A 1JWSA 3F65A 5DURD 1DFXA 3RU8H 1J1PL 3K91A 4JHWH 1AGEA 5KZCD 3LQMA 2N3JA 3LOWA 3KWWA 1G7MB 3DUSA 3TBTB 4HPYL 2XSKA 3TIEB 1GGBH 3SJVB 1HYSC 1L9OA 3GYRA 4E9RA 4EXPX 3FHAA 1U33A 3FQUA 1LO4H 3BP7B 1S8DA 3LN4B 3X1FA 1FFTB 1N2RA 4PJ5E 4WWID 5I17B 3FUFA 4FQ1L 3AACA 2OMYA 3JWNE 1Z0MA 2H3NB 4LDEB 1FYTD 1T1ZB 3IMVA 4ISVB 1A7PL 3LZFL 3EUDA 2FHBA 2VDML 3JZYA 1RUKH 4LCIL 1FLRH 2ZOWA 4G2AA 4I8DA 4R7NB 2RACA 1EVUA 4XOCA 1J0HA 5T1KD 5HTSA 3ZTNH 2ZG2A 3SD2A 3Q3GA 2XRAH 5EC1A 1JGVH 1EJFA 4S1DD 2MWCA 4I1PA 4X98B 1CLYH 1NFKA 5GGVH 1A3LL 2EUXA 4Q52A 2DMHA 2FB4H 4U6VL 4M8RA 4WKZB 3WS3A 2AVGA 4K71B 3ZKNC 4ATTA 3SGJC 1NLDH 1NKGA 3JXAA 3QXUA 5TDOA 3T1WA 1N6QH 1ND0A 1UT9A 1OAQL 3AXLA 3TYFA 1AHMA 1DQVA 4OLWH 4PGJA 1QBMH 3AG3B 2BS9A 4DZ8A 1GIGH 5C7XH 4G83A 3NCXA 1DL7H 1M2VA 2XT1B 1BHGA 4Y89A 3LPFA 5I1GH 3CIAA 3WJLA 4F2MB 4L29A 4LNVA 2A77L 4DOHE 2DKUA 2WLYA 1UJ3C 2ZXAA 4UOZA 5TF1H 2R29L 3MUZ1 1LWJA 4G7SB 1FYTA 4DGVL 4LP4A 5DYOA 4AQAA 5MHSE 3AXIA 1ZLWH 3BUQA 1M42A 3UOAB 4JFTA 2EADA 5T1KA 3A6BL 2E56A 4Z3EA 1FRGL 2WXHA 4KMQA 5AW9B 1TJHL 5CD3A 1VZGA 3BUYB 4PS8A 4AENA 1BAFL 1PG7L 2CRIA 2OYMA 1JZ6A 2AI0H 4LESA 3QO1B 4OLYL 4WUKL 2HTKD 3DI2B 2JJTC 1A1NA 2EDKA 3ULVL 3GLAA 4G71B 3JWOC 4XXCA 1OM3H 4I0PC 3BPOB 1XF3A 4Y2OA 5B4MC 3SHSA 1XH0A 4P9HH 3G5XB 4JPWH 3WD5L 3FQTB 2P24B 4K94C 1HCVA 2BVUA 4U1HA 2YC1A 1INEL 2DL2A 4KAQH 2FX8L 5TGBA 2E74C 2CMRH 2IDCA 3VU1A 2MHAA 2JKJA 2X4NA 3MRPB 2C9XA 3U4BL 3O2WL 3BKJH 3ILEA 4PRNB 4X7DC 3HE7B 4PRAB 3QDMB 3DBXB 4PRHE 5EFIB 6TAAA 3OQ3B 3GSNL 4PJFF 5LAXB 3HRZB 4KKLC 4RWHA 4NZRL 1QHPA 2VJ8A 5ETUA 1VHPA 4PP2A 4X6DB 5E4OA 2ZOOA 5J6GA 3KPQA 2J2ZB 2QQLL 2DI9A 2ICWJ 4K7FB 3U2IA 3MGTA 3UG5A 5EBGA 1AKJD 1QFUH 3OBAA 3TN0A 4NCC2 1IQWH 3WNJA 1CE6B 4L8SA 2E9JA 3L1FA 1F4XH 2WZ5A 2YXWA 4HQQH 5F6HJ 2CHWA 1URIA 3B2MA 2EYTA 4I2XE 3GDCA 4U1NA 1M7IB 2EE2A 1WWBX 1IEAA 2WOYA 2XG5A 3EYQD 3OAUL 4DGYL 2AANA 3FSAA 5A2IH 3L9RA 1WBYA 3Q7JA 4HSCX 4E41D 1U4FA 2CPUA 2DB8A 4G7YH 2A6JB 5CR1A 3VDBA 3B9DA 3KM2A 2EZ0D 1IGMH 3Q8BA 1GW0A 2EEBA 2CDGB 4PS4H 3E6HA 4XPBH 1OP3H 3U7WH 1QYGH 3TA4D 1Z5LB 3WG7B 3WXVL 2QBWA 3RUGB 4KK5D 4ABWA 5I1IL 1Q1JL 4BQ6A 2YOCA 4OB5L 1H5BA 2W65A 2PPFA 2MCG1 1XB3A 3BXNA 3BMWA 3UTSE 4PJ5A 2UY7B 3WNLA 3PYCA 2CUHA 5CILL 5GRWA 2ICEB 4JE0A 1F90L 1I9IL 2ADGA 3I9GL 1P6WA 3V0IA 1AKJA 2CGRL 5FDYA 3QNZB 4I4WA 2ZWLT 5EDXA 4MWFB 5GIRA 4HIHB 3UBXA 1T66D 4KY1L 5MHSD 1M53A 1ZRUA 4FKKA 2V7HB 4HT1H 3WTSA 1DEEA 2SEBB 3CJJA 1CTNA 4I3SH 5AENA 3BFOA 2ODIA 3BP6A 4E41A 3WLWD 3I02A 1BZQK 1E4HA 3ML8A 3A24A 3QNXB 4DP6X 5DZLA 1KYOJ 2FECL 4A6YA 3KAAA 1U21A 3O3UN 4XZUA 5CSZA 4FLSA 2XCMC 4PJ7E 4MJ6B 1A5FH 3OMAB 4MA8L 2B4CL 3TWCL 1FJ1A 3BW9A 4DKFL 1NBQA 4LQ1A 3O0RL 1NZRA 3ULAB 3QPXH 3NJXA 1DE4A 4YHKL 1UEMA 4AH2B 4JDVA 3LXAA 3O6FB 1ACXA 5CD5D 2CKBH 5ERWA 5T1DL 3DPBB 4HUCA 3UG4A 3P54A 1W15A 3DURA 4TQ8A 4YBQC 1AE6L 1RZIA 1ZA6B 5E9DE 2OCJA 3FU7B 4PRHD 1CR9H 2VKXA 2L0DA 4WEBL 3NDZE 3CFCL 4NB7A 1GSKA 3VWJA 3A4AA 3APMA 5IHBA 1FDLL 4GUQA 4M4RB 5DFAA 4DFIA 4ZMYA 2EACA 1SUHA 2BOCB 3HAEB 3ZLQC 1S9YB 1HCZA 4FQLH 1O9VA 2VDRH 3Q2LA 4WU7B 1BF2A 1B0GB 3SDDD 1UA6H 3ABZA 5D4IA 4PEEA 3GTNA 4WI8A 4ONFH 2R56L 4X0KA 3GLEA 4OQTL 5F1SA 3N9GH 1MAMH 1MRDH 4ZTOH 1NFAA 3QT2A 3FXIC 4POUB 1MF2H 3B3BA 1ED3B 1ZSHA 4AQ8C 3K74B 2UX6A 2WXFA 5J6HA 3OKNA 5CEXA 2EYRB 1TEFA 1W6WA 1X7QB 4AGLA 4G8FB 5CJQH 1WF5A 1ID5I 1UH4A 3S3PA 3N6YA 3DOSA 4PRHA 1DUZB 3LQAC 4FJ6A 5HY9B 1RK0A 3LZNA 4ZXBD 3GMMA 1SHMA 3QEUA 4Q9RH 3TO4D 1J9QA 3UTSD 5AOMA 1BEYL 3LHPL 3GEFA 2V9TA 3ARVA 1MHPH 2MSPA 3KGTA 3LRLA 5J5EA 5EEYA 2J7LA 5C92A 4PG9B 2VUKA 1PZBA 2JF1A 3PS6A 3S37X 1GSMA 1M6UA 2YZ8A 5C3LD 5AAWC 4MX7A 2QADC 1DZ0A 3TBBA 3T0DA 4MNQE 2XX0A 1OW0C 3RGVB 3SDDA 3QQ3A 3MHZA 5C07B 4I9XA 1TQBB 5B22A 1KB3A 3L3KA 1BYOA 4I48B 5SX5H 3QRGL 4OD2A 3PP4H 1G7LA 3GGWA 1L4IA 3ZKXC 4NS0A 2V7NA 3T6WA 2XTJB 3TGXA 2R9HC 3ULVD 2BZCA 2X7LA 3HUJB 1FFNA 7CGTA 4RRPM 1S5HB 5F88A 5HSFA 3TO4A 3LKNA 1XSKA 3UTSA 4WY7H 1JZIA 4P2OD 3W39B 3MRIB 5FC9A 1E40A 2NUPB 2FWOB 2GJ6E 3EOBB 5KVGE 2CR6A 4P46D 2F53D 3CHQA 3SYPA 2G30A 4MSWB 4TN9A 3GC3A 4N8VB 5B3JF 3NJMA 1ZLEA 5KSBB 3IWUA 4GKNA 4QO1A 1TQUA 3IDMA 1U8KA 2OZ4L 5BJTA 4KXZH 2FJSA 3VFWB 5HHQA 5EEZA 4IIQA 2JTYA 1NBVL 3H55A 2NSXA 1OSPH 1ZVYA 5DEZA 1ONQB 1CXIA 5KYYA 5D4QA 1CT8A 3F8UB 1NIFA 4PW4A 5CJOH 3RBSA 4O2FB 2QPFA 4KXZI 4PJ7A 1KTRL 4WFFD 3WCYA 1NUGA 3QA3B 4HS3B 1TEGA 4PJDE 5D1QB 5L4IA 2ZF8A 4HXAL 1KB5H 4JGJA 2JIXD 2H26A 2FNWA 1KLFA 3EFDL 1KJ2H 2YEVB 3GI9H 3NCFB 1ZDQA 3II2A 3T0EC 5JHAA 4FYSA 4P2OA 5CN1A 5AVVB 4IBZA 1X5JA 4PTTB 3S2AA 3H4HA 4KO6A 2AERT 3C8HA 4AGPA 4EDWH 4XP5H 2XBDA 1WSST 4P46A 2F53A 3GSNA 4QCIA 3R1GL 3VMOA 4UOW1 1ZHBB 3TH4T 3EJJX 3CH8A 2GQHA 2G0LA 1E8XA 1QI3A 2WXGA 3DSFL 3QEHB 4EN3C 3CDGB 5CGBA 4PVBA 5FUCE 2D31A 3EBGA 2KKQA 4UQBA 5I8KL 4YAQA 1KCLA 1SDAB 1JFQL 5IVXE 4C4BA 3IFPB 1DJZA 3T2PA 4LSUH 4XN8A 3W5MA 3AZUA 1S7VA 5DS2A 2FR4B 4IYKA 5TDNA 2O5YL 3UJIL 1S6NA 2AK1H 1GGIL 1MFCH 4MNQD 1D5BB 2R2EB 1X5XA 1V7MH 3HS0A 2NNRA 4OCWH 4AV4A 3L9BA 2HKAA 2IQ9H 2JIXA 1ITBB 3MZGB 4PLOB 2OYKA 1HVXA 1S7SA 4JDZA 5I19H 1HEZB 4OD3H 3MOBH 1UQSA 1N4XH 4PG2C 5FYLH 1JZDC 4PLNC 2XNAA 5EO0A 2BY3A 2B08A 2EH8L 1T1YA 5EC2A 5IMMB 1CU4H 5C7ZA 1T21B 4XNXH 3ATBA 3HI6L 1J88A 4X8JA 1I3RB 1XZWA 2RIKA 2VR5A 4NQUA 2IDUA 1KYAA 1UKSA 1QG3A 2BK8A 4KZDH 2GC4C 1KC5L 2W88A 1W0WB 2ETWA 1KCUH 1CFNB 2PLTA 2VDOH 3UJTL 2BIPA 4Y9EA 3D51A 3PGDA 3S37H 1RZ8B 1X5AA 1PY9A 2AJUH 3BH9B 3LKQB 3DJTA 3MRDB 2IPTH 3UYPB 5E00A 2H0PA 2NT1A 5CEYA 4B50A 3MLYL 3TBSA 3KMDA 1QUNB 3FQWB 4JM0A 4M29A 1L7TL 1EEYA 1I4FB 2Y0SA 3DYOA 4MNQA 2EEXA 4JQXC 2JQMA 3NIFF 3PUCA 4MHHG 5IM7B 1F18A 2DLFH 3REVB 1AHWB 4HKZB 5D4JA 5GGUB 3FN9A 1JDCA 2YD0A 2ARJB 4MFHA 3BP4B 2OMZA 1W16A 1JP5A 1HEHC 4QRUA 3QFDA 4WGVB 5F89A 2YO3A 1E43A 1D6EB 1Q9WB 2VSKB 5LCVH 4NP4L 8FABA 2VH5H 4OZGE 4NO0D 1MRCH 3ZTJG 2HT2D 4JO8A 4D9QE 3MODH 4ZJ9A 1AQ8A 4M6OH 3JUYA 3RJQB 5FUOL 2F8OA 3MJ8B 4K9EH 32C2B 5FO8B 1ZS8A 5EU4A 1AMYA 4U6XB 4IEFA 5ADPL 1C5CL 1WIUA 3VAEA 1KTJA 2K6ZA 4XCNB 4LVNB 3KLSA 1MQ8A 1CI5A 2J6WA 2EDWA 2QSCH 4LLUB 4Q0XL 3UDWA 5JDSA 5E0FA 2KL6A 4HAGA 1U3HB 4XMKL 2F18A 2AXHA 3NZHL 4OZFB 3M1BA 2Z93A 2W9LA 2OAAA 2CRMA 2VM4A 1SXSA 1UWGL 3B5GA 1OD9A 2YBRB 3KCWA 4D0CA 4FFZA 1A3RH 4EIZC 1MHEB 1MJ7H 1QSFE 3OR7A 3FPXA 4HLZG 4UIKL 4G6KH 3MOQA 4XBGB 3MRGB 2EXTA 5AFAA 3N41B 4TQHA 4NO0A 3LKSA 4OQTA 1BW8A 4GIAA 4F3FA 4PJDA 3QCVL 4DW2H 5D93B 3BWAA 1I1AD 2XWBB 3FS9A 4NJ9L 2NNFA 5IT2H 1CDUA 3PABA 2ZOUA 3WXWH 3QIWC 4NUJB 1KPVA 4KV5F 3L3HB 2R4SH 4MMYB 5DDHA 1JXKA 2FQFA 1V5JA 1FVCA 4KUCF 3OQRA 5T3XH 3STZB 5SX4H 1AD0A 2VE6B 1A6TB 2ZXWB 2GT9A 5E8OA 1YY9C 1R6VA 2GHZA 2P47B 5CJ5A 1X3DA 4FTVB 3F6JA 5TK2A 2J8UE 2ZSWA 3MNVA 5I75B 1X5GA 4MB3A 4UZUA 3VJ6A 1KACB 4GXUN 1OSYA 1B88A 3LKRA 4DO6A 2CWRA 3D2UD 3FO1B 1AZVA 2BH0A 1T4WA 4GXVH 4FNQA 3EBIA 1KJVB 3B7YA 4GBXD 1BCIA 2MJWA 3IF1B 4YHZH 5IB4A 4Z3FA 1ZLVH 1CQKA 3GJEA 3D25A 3QJSB 1DN0B 4Z3TA 4NO5A 4AQEA 4G7VL 1YDPB 4W9HC 4MQXD 3G9VA 4PP1C 3BAXA 3CSBA 2Q7NA 1EDHA 1L5GA 5ACZB 1NGPL 3TVMB 3T6VA 1G0XA 2DQJL 3X12B 4HHAA 2I7OA 1NFDE 1MCQA 3VB9A 2B0SL 1GYUA 1J9CT 1I1FB 2CLZA 5IMOA 3T9WA 5FUZH 4FERA 4D9QD 2K1MA 2FUQA 4NRYB 4XP6L 1T3FA 1DJYA 2R4RL 4NQSA 5CMAB 1VFAB 3D2TA 4TVPH 1M7XA 1OAKL 2HJLA 3NYKA 1T0PB 2K4WA 3WDIA 2WIMA 3N3EA 1WFTA 3D2UA 3UO1H 4WCYL 2W80C 4FFWD 1LK3L 5J0BA 4N68A 3L3JA 4BUGA 3HZYA 3ET9F 4PPTA 4EO5A 4XWOC 4GBXA 5B8CC 2EVJA 2DI8A 2EH7L 4NXKA 1QLFB 3BSHA 1T5XA 3OXRB 3H53A 2J4WH 1IGJA 3IBEA 3V5DB 2Y7OA 4FNSA 2OZ4A 1A7RL 1Q4NX 1ZVNA 2GJZB 4RNRB 5E5UB 5LHDA 1RURL 1GC1C 4BFBD 4ZZKA 3FCSB 3LNFA 4YXHL 4X4ME 3U6RA 1ET8A 1JV2A 4HX1B 4OZGA 4WHCA 1SPDA 4N1CA 4PRIE 4R7LA 3MROA 1P7QD 2OSXA 4NZFA 2FX7L 2WINA 4K55A 5AEAA 4PVLA 1EO5A 3CZUB 3LZQA 4FL4B 5GGRB 4AEFA 1XWVA 4PLKC 3ZKMC 4HWUA 4TTDC 2V3DA 4N2MA 1G6RB 3HZKA 1YY8A 3GHPA 1UKQA 2KI6A 3QI9D 4PJHB 4PR5A 5K9QG 3FB7A 5IP4A 1CICD 4PJBB 5BOPA 2G2RA 2IG2H 3K4DA 5EF0A 4UV4L 2QV2A 3T1FB 1JZ4A 4YVNA 2AQSA 2VGLM 3H54A 3SDXF 1HKLL 3INUH 4RDQG 4OCSL 4JN1H 5GRJH 1W72B 2BCMA 4MS6A 3QC6X 2SODB 1S7QA 3EGSA 4AQ1C 4M62L 1GYWA 3IGUA 4WAFA 3WE6A 4J1UA 5IBUG 5I0WA 1JGLL 4JRXB 4JM2F 2ALAA 4UB0H 2VAAA 3U4EA 1B9KA 4K3GA 1XAUA 3WUWG 2ROYA 1Z9PA 2EIKB 1P7QA 2EC9T 4DQOH 1ZCRA 4QKXB 5GRUL 5ICYB 1TZHB 3QEQB 3HLKA 4AM0B 5C0RH 2ZNWA 1E7VA 3FKUS 5J6SA 5E5MB 1IGTA 2VB5A 3RAJL 3AY2A 3JSSA 2J6EH 4X9IA 1BX2A 5EBWA 5D7IE 3VFGH 4C47A 5BOZG 5E1AA 1KBBA 2OQJA 1PQZA 4BDVA 5E99H 3QI9A 4IGBD 4YDMA 3BIBX 3OKDA 1CICA 4ODVH 3PGFL 3VD2A 3NA9H 1LILA 2DQEH 3VRLF 4DTGH 5LLIC 2J8UA 2Y06L 3LD8C 1IRAY 4MA1C 1DQQB 1GPOH 3MLXL 1BXXA 5EG6C 5IOKA 1IAIL 1QSEB 5EEXA 1IKNA 1RZJH 2G5UA 3N1FC 1A6VL 4KO9A 4MLIA 1SMOA 1UACH 3BQUD 5TE7H 2DQCH 1O7SA 5EU3B 5EUKB 1I53A 4ENZA 1LYQA 1F3DJ 4K0OA 2VMJA 4K15A 4NOBA 4Z3GA 4Y0GA 4YIQB 5E9NA 3U2SB 3OHXB 2ZOKB 1MNNA 5DHEA 3OJ2C 4HKBB 1R0AH 2E59A 1P7KB 1HDMA 1VESA 4UTAH 4NCDA 2D3NA 2R2BB 3FRPB 1VRSA 5E4EC 1MREL 4KRPD 4FMVA 5CCKL 1XCXA 5ESAA 4K8RH 2J5LC 3VI3F 2VKWA 1FV1B 3D07A 1TSRA 2BIIA 5DMIH 4IGBA 3BEVB 2FGWL 1C5BL 3S34L 1DDTA 5T1LD 1W0VA 4MXWL 1FIGH 1IM3D 1JG9A 4QGYA 5SWQB 3DX6B 2Y3AA 4QRRB 4BFFA 3WAKA 1X5HA 1RUMH 4JQIL 4MZIA 4MGXA 3BQUA 3O11A 2A9ML 2UWEF 5KVEL 1OAUL 4IBSA 5JQ6L 4RBPH 4LHQB 1GMEA 1JGDB 1KIUB 1XIWC 4HS6A 4UDUA 2OMWA 3X3GH 1UB6A 4C8XA 3NAAL 2BW4A 4KNQA 4GP4B 3VWKD 2AQQA 4ZTEA 3HOGA 1YHPA 1T20A 2QKIC 3PWPD 3R19A 2FWUA 3CCHB 3C6LC 3B34A 4E5XG 2XN1A 1U95B 1SLUA 2P42B 3W38A 5KYNA 3C6SB 2IPUK 4X4MA 5MEPB 5D1ZC 3HI5L 4OM1L 4FE9A 4JKWA 3RGBA 2ZCLH 3JV6B 2Z65C 4BIKA 3ARPA 1AGDA 3JTTB 4UBDD 5T1LA 4DUVA 4XNDA 2ICWA 1IM3A 4I18C 2IPUG 4R7VA 1U92A 5FKPA 4GNKB 3C8KA 4N5EC 4Z7IA 1RUQL 5JOPE 1L3NA 1GW6A 2JB5L 3UTZB 3MGOB 4K94L 3NSYA 4XWGH 2WWKO 2RBLA 3CU1A 1QNZH 2IGFL 3MJ6A 3V0HA 4FI7A 4PB9L 1IFRA 3VWKA 4GT0A 1U36A 4JFQA 5FOJA 2A4CA 4G7QB 3PWPA 4XOEA 4KVCH 4R5TA 1RJLB 5HDBF 5TE4L 1ADQL 4D94A 1FH5H 4N20A 3BT0A 1OAXL 5IHUL 5I71B 4MVBD 2VLKB 3T6ZA 1VFBB 3L5WB 1BQHA 3VXRB 5LN4A 3RVTD 2QQNL 5E08H 4X4KA 5LGKA 1D9KB 5ELIA 5DC0A 4KJPD 5SWSB 3RVVD 2Y25A 2PCPA 3DRTA 4MAYD 3DHPA 3ZK0A 2B59B 5E2TL 1KTBA 3LEYL 3UYRH 1G84A 2OI9C 2Q76A 5L7XH 1B6UA 2ZJSH 5EF3A 4LEXL 3H2PA 3GMRB 5KSAD 3B2DC 2EIZB 4NN7C 4R4ND 4GI9A 4IK6A 1EAPA 2GB2A 2HH0L 3NQIA 4JFFE 4OKDA 3BAJA 3T0VA 2VISB 1NUDA 2LQRA 1HHIA 3FSWA 3ARGB 4N25A 3DX4A 2MKWA 5ESVA 1LE9A 1EHLL 4EKJA 2YA1A 1WZMA 3CFBB 1BM3L 1AGFA 2HX7A 3MCKA 4X50A 5D70L 5L2KB 2XYBA 3DGGB 3GKWH 4CW1A 3CVHL 5K9OB 3EYUH 4EIGB 5JW3H 4S0SD 5L0QC 3M6DA 1MCJA 1FC2D 2MQ3A 5CBEB 5AZEH 2OMVA 3K80A 4NKDA 5D2LB 1BQSA 3DI3B 1K5NB 1PZAA 4Y5XA 4JKKA 2HMIC 1E7UA 5BRPA 3NIGF 1YEGL 4X6CF 5D7KE 1MCWM 2IXQB 3TA3B 3WENA 1J1OL 1F0LA 1B6DA 4WFEE 1HQRA 2HWZH 4G8IB 4MAYA 3LTVA 5EZIH 4R0LB 5ABDE 3Q9QA 4NRXB 5AW3B 1CGYA 1XVSA 3W82A 3KYKH 1GKOA 3NTCL 2X40A 5KSAA 3S5ZA 3UAJC 5GS0C 3UX9B 2MOGA 3W11D 1AAJA 1C12A 2NXZC 1IFGA 2CRYA 2YXMA 4M6AA 3DV4B 3KS0H 2BNUB 1XTMA 4HUUA 2IWFA 3AS0A 5C0CB 4F7TA 1NPJA 3BT2H 3ARTA 3F58H 4AMWA 1L6PA 4QMEA 5I16A 1NKRA 1BQ5A 5IOPB 4AXWA 5JOPD 3LZOA 3MRNA 1QHQA 1BZ9A 5C0ND 3L5HA 3CFMA 3O6LL 5IW1A 1TVBB 2CHDA 2AMUA 1GJUA 3FYEB 5D7SH 2XPZA 3HNSL 3ZHKA 1Z9NA 4Z7VE 1ZLWK 3UJJH 3IGKA 2APFA 4F33A 5JOFA 1GZPB 4X99A 2NZ1A 3FMGL 4NC1C 4ZX4A 3PJSB 4Z7OE 2APVA 3ECUA 2XA8L 2OTUA 1ZEAL 4KY2A 1RD6A 2K6WA 5AB0A 2OW6A 1UJ3B 3QJUB 4F7MA 1H3PH 2WCSA 1BOGA 4HDIA 5FKAA 3ZIYA 4JZJC 1GS6X 2QHRH 3EJQA 3M88A 2Q7AA 3MV9B 4G6AD 5FO7A 4FFYL 1JUFB 1ZWIB 5FYKL 1O9ZA 3VCLA 4HPOL 4XOAA 4QRAA 2ZOTA 3HG2A 4M1DH 2I25N 1XF2B 3CN0A 1M7DB 3MLSH 1F11B 5DJ6B 3WNMA 1X5ZA 3WJJC 4PGCA 3HLAB 5ICZA 3JUZA 1FN4B 1IC7L 3MRMB 3T4YA 1LP9A 1JK8A 4NN5C 5AOZA 3TPUA 1HH6B 3U9PL 1VACA 3DX7B 5D9SB 5K9JL 2YPVA 4RISL 4XNAA 3L3GA 4KK6C 5G4OA 2P4AB 4I0PB 5J9PB 1YG9A 5DSCA 4JFFD 2H2PD 1E4KA 2HLFC 5DVOA 3HC3L 3EOAA 3RIAF 4AUJA 1F4WL 5IMKB 3LNIA 7TAAA 4P5MA 1KNOA 4S1SH 4WGWB 3CDZA 5IREA 4JBSA 2OM5A 4EI5C 4JKMA 2WWNA 3SE3A 4H0HB 4OGZA 3D1MC 3RIFF 5AB1A 2NZIA 3HJEA 5DFWH 4YOKA 3G6JB 4JY4B 3G5YA 1XBRA 3S48A 4GAJL 5D7KD 2I9TB 4AZ8B 1CQYA 2YD6A 4IBWA 4WFED 4QJ3B 1DQTA 1EO7A 2I85A 3O6MH 4DVBB 4NQVB 4WF7A 5I8OH 5HI4D 4HWEL 2Q8BL 2HCZX 3DROB 3QUXC 1CMOA 2K8MA 3C60B 3VVVA 1VSCA 2B14A 2APBA 3SGDH 4DKEL 1BYNA 1XGQB 3DTUB 4YDZA 2CLRA 5IBTH 4YXKH 2V0AA 1OP3K 4E9QA 1S7RA 4OM0H 1I7RB 4V2CB 1HZKA 1U8JA 4LCWE 4KI5E 3ZE1E 4TUUA 3SBWA 2ESVB 4OLEA 1L9RA 3V4LA 1A6UL 4JFFA 3MBXL 1P9MA 4NJAH 3SGDI 4TPRH 3TOPA 3MRHA 1KWKA 4IOIB 3ARXA 5DU7A 2PCFA 1OTUC 5FGBA 4BKLB 5F0MB 3BHBA 3RTQD 1O5DT 4PJCF 4GS7C 3CH1B 3MV7B 4UAOB 3IMTA 1AANA 1KT2A 1MH5B 3K1DA 4R8WL 4GG6B 1JHLH 1AYRA 3NPSC 1MEXL 1KOAA 3JV4A 4YK4B 4JKNA 1CBVL 4AYSA 2P8PA 1UYWH 4WW2A 1KUMA 1M05B 3AG4B 3L48A 4MDJB 1M6OA 3AQZA 1ZVSB 1KTDB 5CGTA 4MD0A 5ENWB 4N0YH 3LRSB 1MCSA 4K3EL 3OL2A 1P5VB 2XQBL 3Q5YA 1R3LB 2JK5B 4MYWB 2YFNA 3RPIB 4XVTL 2B1HL 4M5ZH 3UO8B 2O6CA 2CJUL 1IC4L 2X4QA 3FZUD 2R7EB 4NHCL 5GS1C 1U2HA 2KLTA 4U3XA 1CFMA 2DWEA 4PRDB 1FG2B 3WFEL 4YDLC 3QP3A 1THAA 3SPVA 3GSWA 5HHNB 4AKPA 4PUBH 4TSBL 5CLYA 4OZIE 2LVEA 5T1JA 4BQ9A 3GIZL 5M94B 2M83A 2JKWA 2VQTA 2WKGA 3EDDA 3RTQA 1U91B 3WUWB 4HJEA 1U9KA 3OSKA 1YA5A 3QJOA 4PV8A 2C4XA 3KL5A 2BY0A 3SGKA 5I1AA 3KW8A 4Z7QF 4Z7VA 5KOMC 3VFNB 4Y2DC 4I87A 1HIML 5CGYD 5DQJB 4FRWA 5E6RB 2H32H 3SQOH 5F7AA 5FHAL 3RU8L 5E5LA 4BQCA 1ACYH 5GZND 1H0DA 4JHWL 2VXQH 3P2TA 4D9LL 2F7IA 1S5IH 4N4YB 4YFLI 5FXCH 4POZD 4HJGB 1GGBL 5DHVB 1L9NA 5A7BA 2ODHA 1LO4L 1XX9C 5HPMB 1MCIA 3KYMB 4RCAA 1F6LL 2YRLA 2GUOB 1OAZH 3KPSB 5FDWA 1NIEA 3QS3A 2MEJB 2DQIH 4KJQC 3RWGB 2GSMB 3K5SA 1RUKL 3S35X 2VWEE 4WV1C 1FLRL 5E94A 4HUVB 4H8QA 3K3QA 4O9HH 4F1ZA 1YLBB 1G1OA 4V1DE 1HNYA 1N0LA 2PYFB 4WI7A 1YO4A 4IBLT 3ZTNL 4A7GF 4X5QA 3RFZA 3GMQA 4GRWB 5GS2D 2XRAL 1WLHA 1JGVL 2FD6H 5AZUA 5I6PA 3GBMH 5JOEA 1Q0XH 2R1YA 4W9CC 3TJEH 4HBQA 1CLYL 2R69H 2IJ0C 4O58H 4YFLF 5GGVL 2FB4L 5GZNA 1NLDL 3CVHA 5DF0A 1N6QL 4AMKH 4KXDA 1MW3A 5DRZA 5BVJA 3WHXB 4OLWL 4DPAX 3LS4H 1NMAH 4AYFB 1A14H 1QBML 2JSFA 2NX5B 1GIGL 5C7XL 5FEBA 5AVQB 4Z7NB 5E6ID 1OGTA 1DL7L 5I1GL 5D6CB 1XGTB 3SPCA 4AKQA 5DK0B 4TULH 1U8LA 1SJHB 3OAZH 3L54A 3SYAA 3SJVE 2FYVA 5TF1L 3U1SL 1TJGH 4JFUA 5DJZB 1FH2A 3ZQXA 4UQ9A 2MOVA 3SDCD 1QX1A 4WNSA 4JANA 3GSQA 3AG1B 1WCBA 1BJ8A 2QADB 3BGMB 5FYKD 4YDKH 2Y9RT 3T8MA 3ULUE 3JV0A 3IXAB 3MJ7B 1F6AB 4CJ0A 3CSTA 1SVZA 4P2AA 3S3CB 2AI0L 4WO4D 4HUWA 5K59F 4LRNH 3W9EA 1ZGLB 2BWDA 3A67H 5CS7A 2BSSA 3ZKXB 2L8AA 1UXSA 3VFMB 4NZJA 1YN7A 5I6KA 1JD7A 1RIUH 3RIKA 3NBNA 4DO4A 1HJBC 3T77A 43CAB 2XXFA 2RTTA 3KW7A 1KGUA 1FZOA 2Q86A 2GSGB 3KR3H 4JPWL 4P9HL 5KUKA 3AADB 4TVUA 2MQ0A 2E3VA 5C0AB 3S96B 1BAGA 1RZKH 2W92A 5E6IA 4KAQL 3LQZA 4U6HA 3RZCB 2I27N 3GMPA 2CMRL 4ZMLA 5F3HA 4L8CA 4YR6A 1GZQA 1A1MA 2WZ6A 1UZ8A 4JO3H 4R7DA 1QACA 3BKJL 5EIIA 3WGVB 2WB7A 3SDCA 4KZCA 3HBQA 3LXBA 1R3IH 5FFOA 5ACLA 3N0PB 5HGBA 4YSAA 3WBDA 1WZLA 4FFYA 3DDGA 1CIUA 1Z5HA 4RMWA 5HYEA 5D1XC 3VGBA 2V4LA 4Y19E 2IFFH 1AIFA 2OSLB 1XMWA 4EF3A 2VNCA 1QFUL 4WO4A 1P2CA 1IQWL 3IKKA 1QR4A 1JPEA 2WLIB 2NTSP 4PJ9D 4Y9BA 1F4XL 2CD0A 3P30H 1WFUA 4KQ0A 3E6FA 3WNPA 4NZUH 4A1RA 1EXUB 4HQQL 1TZAA 1GOGA 4MD5B 4JRWA 4G59C 3H6JA 4KZ0A 3NCWA 2VL4A 2IOOA 2AJZB 3MYZA 2P80D 2NYYC 4G7YL 4L37B 4HU2A 4CMMB 1IGML 3T0EB 1CGXA 3O3EA 4IRJA 4BE5A 3DDFA 1DBJH 4Z0XB 4XPBL 3U7WL 2HVJB 2I5YH 4OAWB 5CHNA 4XC3H 4LFHG 3PL6D 1YEJH 1KULA 1RZFH 1PY0A 4ONGH 3AT8A 1BFSA 2EIEA 3KPNB 1PSKH 4F7EA 4D9RE 2UYLA 3H0TA 2N0MA 3RI5F 3M7FB 4HKXB 3VGAC 4EN3B 2WANA 4BD4A 4KO7A 5C0EB 2PUQT 5E8EB 3COOA 2YGNA 1N8ZA 2AABH 3S35H 2WGXA 4R4BB 2I9LA 4H25A 5D7JC 1JXGA 4KXCA 4DPCX 4LOUD 4PJ9A 4DGIH 4X6DE 2HFFA 2F7OA 3ASWA 1QABA 5FA4B 1PY4A 4HT1L 5KG9A 5HHME 5GZOD 5IEKA 4EKXA 1KGYE 3T3PF 1XGUA 4I3SL 3WIHA 3HC4H 3Q8CA 5IVNA 2XWDA 5IQ9A 4TNVF 4NQXB 2C1OB 3QUYD 4J8RA 3NCMA 2HJFA 4OFPA 3G5VB 4ANXA 5C8JA 1OF2A 3I75B 5JORA 1NMCC 1KTLB 4DPBX 2W9DH 3P3RA 1A5FL 3PL6A 4M03A 5FV2A 1X4YA 2B3RA 1UZ6E 3UH8A 2XVBA 5EOCH 2UZPA 3DRQB 3NSFA 1DUYA 2CKBL 4M61A 3J07A 3RY5A 3K46A 1HL8A 4N9GB 3P9WB 1Y0LA 3OB0H 3BVDB 4GO8A 5A1AA 2YAFA 5AAMC 1AG6A 4BM7A 1CR9L 3ZSTA 4GKZA 5G4MA 5T8IA 5GZOA 4PD4K 3MRLB 4XGZA 3BD3A 4GKSB 1WBZA 1I7ZA 1OE1A 3PFQA 4HV8A 3ZBMA 4Y19D 5H35A 2D4FA 5HDQH 4R7NA 2WNXA 2Y7SA 3HI1A 4X42A 3BVNA 4Y4HD 1U8PA 3CN2A 4FQLL 3QUYA 4PJ8C 3GMLB 1DCLA 2TSAA 2E7LC 2IALB 3LV3A 3STLA 2PF6A 4X83A 2Q7YA 1UA6L 4DO5A 1AIZA 3F7QA 1MAML 1F2XK 5BPPA 2FX9H 4FI8A 1DLHB 1MRDL 4L3AA 4ZTOL 4HMCA 2HRLA 1MF2L 1PTZA 3FCTB 2HVBA 3TBVA 1Z2KA 2H1LM 5ECJE 1QFWI 3WNOA 5I1LB 1EFXD 1ZHLA 5BV7C 2CK2A 1FL6B 5CJQL 3BJ91 4XOBA 3LB6C 4X6FA 5MENB 1LEGB 2UUDK 4I13B 4MNHA 1TQSA 1SY6H 5EOTB 1VGKB 2WYHA 4LCUB 2E9GA 4KU1A 4Z7AA 1J86A 1PGRB 1J05A 4TUKH 4Q9RL 2FYYB 4LSTH 4D9RD 4N8CH 5F9WC 4MKTA 2DQTH 4Y19A 5DJ0A 3DJRA 4PGDA 2XC8A 4ES8A 3CXFA 4Y4HA 1AR1C 4B7LA 2NY2D 3ASNB 4Z78B 4IRSD 2YWZA 1NBZA 4P57B 1D3CA 2X4SA 4DNLA 4L4VD 1P4IH 5I1DB 5HHMD 4JFZH 2JKRM 4N1HB 3VQLA 3DIFA 3D3VE 4MMXC 2ADJB 2G60H 4HIXH 3DC0A 3PP4L 1AGBA 1DQIA 2IANB 2WCGA 1EFXA 5DEGB 2WBXA 3AXHA 4NAMA 1U2CA 4ACPA 2D3LA 4OF3A 5DK2A 2Y24A 3X17A 2WYTA 2ZXBA 1AY1H 1HOEA 4M02A 1N6VA 3RVUD 4OGAD 2H0FA 3D18B 3L5XH 2E4FA 2CCLA 2G75A 1UWEH 1QEWA 3FRUB 5C0IB 1CVRA 4GMTH 4ZFFA 5IROD 1A9EA 1AJ7H 4WY7L 4NPYA 2JXMA 5EFIA 1T7WA 1FO0H 3VXUD 5FOBB 1MG3C 1YUKB 2HZHA 1BIIA 5HDOA 1BZOA 1E9OA 1NDMA 4M1CC 4PJFA 4A7VA 4EE2A 4BINA 4IRSA 4LHUB 2FJFA 3P9MA 2X3CA 4L4VA 4YH6A 1C8QA 1MFNA 5GSVA 4KNTA 3IGFA 1NWOA 1SDDA 3EDKA 4HXBH 2X4UB 3J27A 4NEHB 5HD8D 3TTSA 1IE5A 3RY6A 4ICXA 4BE6A 2Z1KA 1MHCB 2VQ4A 1OSPL 2MKLC 3S4SA 1TIUA 4PREA 1HN1A 1ETB1 3CLWA 1MLBB 2FHFA 3QXAB 4KKNA 5CJOL 4FLHA 4A2EA 3C09C 3G5WA 4HUKB 3BESR 1GYAA 2KZBA 5T1MA 1KB5L 3LZRA 2E46A 2H45A 3J8F7 5IROA 2BHFA 4O2EB 5DD1H 4AIXA 1OB1B 3OG4B 2J88H 3GI9L 2B5IC 4U0RB 4ZUUB 3HUJE 4G43B 4PHZA 3R06B 4U3CA 1U30A 3MA7A 5IW3A 3FB5B 3VXUA 1QZ1A 3S3SA 2EDLA 2A1WL 3UGUA 2M2DA 4L48A 2PN5A 4LPVA 1KGIA 3OKLA 4EDWL 4XP5L 2CKBB 3SO3C 3SY6A 4ZD3H 3H9YA 3ARDD 1Z7JA 2ENYA 1V27A 1UH2A 2HXAA 4HD9A 3B37A 4U1IA 1KEGH 1L3WA 1TYJA 2E9BA 3IJEB 1QLEH 4R2GD 3VFPB 2Y6SD 3AREB 3LN5A 3QJHB 3FQXA 5BS0B 2BXZA 2HJKB 5CCJA 1OY3B 3QC5X 3L4VA 4JRYB 2DICA 2E7CA 5KSBE 2HG0A 2WXPA 4F8NA 3C2SA 2AK1L 2MRYA 1MFCL 4ZQKB 5B3JE 5JNYA 2Y1VA 5MI0B 3T4AA 4LHJB 4PLJD 3UPCA 1D5IH 1V7ML 4OCWL 2VDRB 4Q56A 1IMHC 3D3VD 4F9LA 2VJXA 3HEIB 2IQ9L 1WPCA 4DZBB 1EXGA 2DYPB 4GAFB 2FCBA 5FS5A 5I19L 4OD3L 4CC4A 3MOBL 2XPGA 4EZJA 1N4XL 5D1QE 4H26A 4X9HA 4YSTA 2MIZA 1CU4L 5DUBA 1P5UB 4XNXL 4KQ4H 3HCVB 2ENPA 1LWRA 2R1XA 2ZUYA 2CXKA 4HISA 5DMYA 3ARDA 5B39B 1MCCA 3AGWA 4UT9H 2EICA 1RK1B 1QKZH 4KZDL 5EOQH 4MA3A 4WFHE 1KCUL 2VDOL 2C5DC 3UBFA 3S37L 2Z31D 2AJUL 2O1AA 1URLA 3B2VH 3APNA 2IPTL 3CX5K 4JFEB 3QZBA 5LNGA 4KMTH 4UU9A 2IPKB 4OCMC 5HI3D 5ALCH 1HWWA 5ABAA 4EZMA 3LMJH 2IAMC 4FC3E 4AQ1B 1ZS2A 4W4OA 1HZLA 1OTTD 2VL5A 2W0FA 3RNKA 2DLFL 2AP2A 2NY5C 1S9YA 4N6RA 5D6DA 1NCAH 1I3GH 3D3VA 3UBHA 4MD4A 2W59A 4H2AA 3AROA 3KJ4C 3RURA 2O6FA 4D8PB 5FX3A 1J0YA 1VPOH 3VDAA 5JXED 1CD9B 1YPZB 5BXFA 5LCVL 1XCQA 2VH5L 1GY1A 1RVFH 2NTFA 5AQ0A 1KXVA 4OZ4A 3EO1A 5C09D 1MRCL 5JPMC 1SVCP 1ODUA 3MODL 3DXAD 4M6OL 4YHIA 5SV3A 5FF6A 4JHVA 2HSIA 4K9EL 2EDBA 4LLVB 1FQ9C 2A74A 2JMRA 2COQA 5IK3A 3VD3A 1YRKA 2Z31A 2H6PA 1DUZA 3LD8B 3L4YA 2A73B 4NERA 5IB3A 3FAXA 5FM4A 4L3EE 1OKEA 1JWUB 2WWMD 2XVKA 4G70B 4UQ3A 4XXDB 5F9DC 3TV3H 4HULB 3WMQA 2QSCL 3ECWA 4GAYB 2CU9A 4WI9A 3CFQA 5DTFA 4NQDD 2ITDA 3EYSH 1KCBA 2WWOA 3LKPB 5HBBA 3TURA 1H6TA 2YS4A 4XNQA 4CRPA 5IB5A 4TS6A 5HGAB 1PPIA 3ISWA 3NJNA 3R8BB 1BG1A 1A3RL 5H2BA 5JXEA 1XGRA 4HGWB 1MJ7L 2OXHA 4Y1AE 3U9UB 4QXUL 3U36B 4G6KL 4WU5A 3EO9L 3MO1A 5C09A 2WXMA 4L0YA 4NUGH 2J5LB 3PHAA 4DW2L 3F64A 3DXAA 3MU3A 1QOKA 1HL5A 4RBPK 3TCTA 3TNMA 4KK8C 3PDDA 1J7VR 4X5XA 2ZXCA 1QUPA 2VLJE 4H0GA 5I82A 3AY4C 3X14B 4AVIA 5IT2L 3LH2H 4OIFA 3BAYA 3BIKB 4MCMA 2CQVA 1FF5A 3WXWL 5A3IC 2RQ8A 1R3JB 1BZ8A 3BPCB 3IVKA 2ED8A 2NW2B 3IDIB 1KJ2B 4NM8H 4XC1L 5T3XL 4A2FA 1KV3A 4XBPB 3RNQA 1I9RH 4ZPVA 1WQVT 5IQNA 2AC0A 4RESB 1MJJA 4N0UE 4Y16D 4NQDA 4BGLA 3V4VH 1UFUA 1XIWB 2YD5A 4WFHD 5C9KA 4FG6D 3NPZB 4ZRGA 4OJAA 3CDFA 4B9GA 3WTTA 4GXVL 2QKIB 1V05A 2AV1A 1AQHA 2PW2B 4X5WB 4Y4KB 4BWUA 5EA0H 1JZHA 1OO2A 3FTVA 4YHZL 5KVDE 2JLPA 2BNRB 5F7DB 4MQ7B 3QJRB 3BLBA 5D1ZB 5AVTB 2P8LA 3CPUA 5DD6B 1NIBA 3LN9A 3NGBC 4C83A 4Z7WB 3PHQA 3SZ6A 1S7UA 5B1KA 4X7SH 4OD1H 2D7QA 1YC7A 2EVHA 4UDTB 4AMXA 4I18B 4IK7A 3WL9B 1TF4A 5I0ZA 1FNLA 2YD1A 4HOWA 2YPLD 5FUZL 2NXYC 5TH2A 5F9AC 3V6FB 2AEQH 2CNYA 2RD0A 4PTTA 4H8WH 1HOCB 5HYSB 3MV8E 5KYXB 4KV5E 4M8QB 4TVPL 2O61B 4IKNA 3F12B 3DYMA 4APXB 3CHSA 1WD8A 3C5SA 3UO1L 4L3ED 3PLYA 4CUCA 3CC1A 3ABKB 4EUPB 4IOFD 5E51A 2VDOB 1T6WA 2VM3A 3HB3D 4XPGH 1T4KB 5GHWH 1NCTA 1P1ZA 5IIEA 1R5IA 1Z5YD 3GUTB 2J4WL 3UAAA 1Q72L 1TR7A 1NWPA 4B6ZA 3CC5B 2AMGA 3QNYA 1E4JA 1KIQB 2HRHA 3K6OA 1TTCA 1WA1X 1BVKB 4Y9GA 1KENH 3E1F1 1G7JB 4G42B 4ZS6C 4G8GD 4IS6A 2WXNA 3IEAA 4FABH 5IHZB 3WDHA 3V6ZB 4Y1AD 1MCHA 1T7XA 2YPLA 2OI9B 4GIPD 2ERJC 1EERB 1IKFH 2X70A 1KB5A 4EVNA 3AUWB 2AQPA 4PV9B 3EYFA 2YA0A 1GA2A 4WJ5B 4EZKA 2VLJD 5IJKA 3OJVC 2RH0A 4MNGE 3M86A 1YN6A 1AGCA 2EO9A 4L3EA 1S7WB 4YHYC 2J20A 4QXTA 5E2WH 2A4EA 5L0QB 3C9NB 5F1KC 3ZKSD 1YYCA 3UPAA 2HG5A 2V2WB 2IG2L 3UYPA 3CFEB 2FBJH 1TLMA 2BVPB 4YNYB 5C9JB 3BKYH 5DEFB 1G7PA 1N59A 3INUL 3NFSH 1BD2B 2IVFC 4JN1L 5GRJL 3DO7B 4G8GA 4O5LH 1E90A 3QJXA 4FQCH 4L23A 4WEEA 4Y1AA 3MRFA 4HKZA 4XX5A 1F1GA 1BFTA 3H7BB 1T89C 3F7YB 3C5JB 3OSVA 2X3AA 3F83A 3OJMB 4I5BA 1S7XB 4I0KA 3UAFA 3WN5A 4DQOL 2VLJA 4JN2B 5E8PB 5C0RL 3ZL1A 1J0KA 4LCCA 2J6EL 3PXJA 1RFDL 5DJDA 5DCCA 5IEHA 4TLSA 1WH0A 5HGGS 5JPNC 1FC1A 2CHXA 4PJGB 1M57B 2BZ7A 5JZ7D 1IQDA 4DP7X 5E99L 1DANU 3K6FA 2Y7LA 4PJXB 4N0UA 4MB1A 4MZ2A 4ODVL 4DTGL 2DQEL 4DP1X 4ZUSB 1AR2A 5AG8A 3MV8D 3IB4A 4RMVA 4JY6B 2EO1A 3SGEH 1GPOL 3LJ3A 3THMH 1N9PA 4I7ZC 1N67A 4NWUH 1F4YH 3MUHL 3MBEC 1XR8A 2QGCA 4KUCD 4PJHE 4PRPD 2WLZA 1RZJL 4ZT1A 4F91B 1QRNB 3L3OC 3VXTA 2P5EB 1UACL 4RGOH 2DQCL 1CXHA 2DWSA 4OZHF 3FQYA 1O7DC 2FH8A 5CR8A 1KJMB 4NUPA 5CZXD 4FEMA 1R0AL 3Q6FB 5JMRA 2MCPH 3VXPA 4UTAL 3IDGA 3GS7A 2Q5BA 2NY3D 3B2PA 4WK0B 5C6TH 2RFXA 3GSOB 2A9CA 3X13A 5GISH 1C16A 1JNLH 1R5VB 3GTTA 2XV3A 4K8RL 2IMNA 3DECA 3I2CH 5KANI 4P23D 5LCVA 4GB9A 2BOBA 2C3XA 3QEQE 3G6AA 4UINH 5DMIL 2V2TA 4U4BA 3G04A 4W9DC 3U9WA 1YAZA 1EHKB 3BZ4A 4KRMB 1GXEA 3O2VH 1JNHB 2VDQH 3MV8A 4NUMA 1FIGL 2WN3A 3FTGB 1WFIA 2VQUA 1DJXA 1R5WB 2DWXA 1IBGH 4LEOB 4PRPA 3QB7C 4UQCA 5MEQA 1RUML 4WKXA 4FN0A 1Q94A 1XZ0B 1G6VK 4DEPC 1A6ZA 4EI5B 5J13B 3FCBA 3VRLE 1QSEE 4HFWA 4PJIB 4EDXB 3ZPDA 2N0KA 3X3GL 1OP4A 3CZKA 3HKZA 1Z66A 2QMJA 3E8UH 4WWPA 3P3UA 2DS4A 1JHTA 2J72A 5FM5O 4XNMA 5EHFA 3ETTA 3TJPA 4GSUA 3L6FA 1E27A 1IL1A 1QQDA 2YSSA 5DFVD 4FKEA 3JWNH 1ZK5A 4GEJA 4P23A 2W0KA 3QUXB 3T8XB 3VD9A 2AFNA 4DUXA 3IBOA 4JHUA 3FH5A 3VFRA 4APQD 2HKFH 2ZCLL 3MRBA 1QR1B 3X12A 3LKOB 1A4KA 1EWHA 2WZAA 5AKVA 3PNWA 2NY0C 1N19A 4RQQB 5LXGL 1F86A 1EQWA 1E67A 3BO8B 4MNGA 4B9PA 3BEWA 4Y4FC 2PPCA 1L0YA 3VI3E 2YOAA 1QLRA 4H20H 2WTOA 4ALAH 4YLCA 1PG7X 3CFKA 4P2RB 5L8KB 4XWGL 4R7XA 4A6YH 1PCXA 1VFAA 4GS7B 4JVWA 3TONA 1MCOL 1QNZL 1S9XA 1QW9A 3FT0A 5KYWB 3NPSB 1N10A 4NNPH 2EXWD 3RE0A 4UUJB 3PY9A 4HP5A 2VZUA 1QFOA 5FM5M 5J1AA 4KVCL 2DAVA 4K3JH 4E36A 4J3OF 1QLFA 2AJ3B 4JDTH 3RG1C 1FH5L 3FU3A 1EEZB 3NJVA 1HHHB 2X10A 4R96A 2YLKA 1T0MA 1DTUA 3AABA 3NABH 5DVKA 4APQA 1PLGH 5IY5B 2GJZA 5E08L 2DTMH 2WBJD 5GS1B 1DANT 4AJWA 2FO4A 4RA3A 5JLZB 1P7BA 4JR9H 4YDLB 5D55A 4Z3HA 4MJHA 1WZKA 4LSPH 4RA0C 2G9HA 1JS4A 3Q2NA 4TYUA 4XRCB 3O2DH 3S3DB 2XG4B 3TTYA 2VQ1A 4JM2D 3WLBB 4HWBL 1B2WH 3KGUA 4H1LB 5L7XL 1DDHA 2ZJSL 4F7CB 4ZUWB 5DZAA 3SBQA 5LBVA 1E5BA 4M7JH 3T04D 3ROOA 1HTYA 1WCQA 5HJ3B 4GW1A 3UIYA 1A64A 4A39A 1WAAF 4HALA 4FA8A 4Y2DB 1G6RA 1YEKH 3IU3B 3T3MF 2D03H 4I0CC 4IU3B 2CLVB 3GKWL 3V0VB 3EYUL 2X0WA 4IQHA 5JW3L 1K8IA 1DQDL 1UM4H 1KLUB 2FEEI 3NCCB 5AZEL 3T1FA 3RRQA 3E2HC 2DWDB 1Z9MA 1P4BH 3CD4A 3VE0A 2WBJA 3SDXA 4B60A 3TZVC 5DD0H 1Q9OB 5HDBE 4LBAA 2HWZL 2B16A 3ZSSA 5EZIL 5J1SC 2LHAA 2FEJA 4OV6F 3BWUC 3LVTA 3M17B 4M43H 4JVUA 1IARB 4W93A 3PAVA 4JM2A 3KYKL 1OE2A 2XTSA 4WV1B 2WVVB 5EULV 4CKVX 3HNTH 4WSKA 1VADB 3QQDA 4GRMB 4IOSD 1J8RA 2VMFA 3WKPA 3D85D 5GRYA 1KG0A 1WBXA 3BT2L 2H7WA 1BECA 2X4PB 3F58L 4FFVC 3ESUF 4AV0A 1EHXA 3OAZK 4ZYKA 2DDQH 2X88A 4JFOB 4N5UA 4NKMA 2EEDA 2RMNA 1H15B 4GMSH 4U6VH 3GS4A 5D7SL 2MMXA 4UIMB 1ASOA 3UJJL 3F7RA 2RQEA 1QSEA 2P52A 2KLRA 1PAMA 5L2KE 4NSKA 3ESOA 4P8QA 3OJDB 2VDLL 3QH3B 4Z1PA 1GS7A 1J18A 3FFDA 3GBEA 5D2LE 4JJ5B 4M7ZC 1CF8H 2I24N 2WUCH 4LOVA 1NC2B 5EEWA 3V4PA 1QSZA 4P4RB 2QHRL 4EEEA 4EQ3A 4P5TB 3EG9A 1JE6A 4D0BA 1UATA 3I85A 3NIGE 4X6CE 1IZJA 4M1DL 1FZJB 1I8KA 3NZSA 4IOSA 5E2JA 3MLSL 5KSUA 3TBYA 3D85A 4D0DA 1MCWW 1WO2A 4AEHH 1FV1A 3LSOB 3VFVB 4FXGA 4K8RD 3BVVA 1A9BB 2J6EA 4A2MA 1UC6A 3VI3A 2EEAA 1MHHA 2BP8A 2X6AA 3SE9H 3BOVA 1JXDA 3ZDYB 3CLEH 3VG9C 2A3TA 4Q4EA 3HVNA 5I26A 3EJYD 3N42B 4I88A 2BSDA 4NKOB 5IFAH 4PBVC 4S1SL 1VEMA 3QZLA 2FX8H 2NY6C 1S7TB 4I89A 2UWEA 4XX1E 1TTGA 2R59A 2XQYK 5C0GB 4KH2A 4OUOA 5B1CA 1ORQB 2QGBA 2VXVH 1FI8C 1LNUB 5KJRH 4XMPH 1MWOA 3VYNA 1HH9A 1EJ8A 1YUHB 3H2QA 4ZTPH 3AU1B 4NZRH 2XQYG 5D1XB 2NY4D 3RA7H 4BWWA 4FXKA 1CLOH 3O6ML 1XO8A 4WHDA 5MEPA 1TFPA 2RAMA 5I8OL 3G08A 4TNVK 3KE0A 2OMTB 2OKMA 1MNUH 3QDJE 2G2PA 5EU6E 4JHZA 5AD0A 5MEQB 1UXLA 5IBTL 4YXKL 4OM0L 1DFBH 5DRNA 3KLHD 1DJIA 2HFGH 1HESA 5I18H 2QL1A 5JUEH 5HYJE 1CWVA 1UOVA 5CN3A 1IBBA 2FSEB 4NJAL 3S5LG 4TPRL 1PBYA 3OXSA 4PJ7F 3BH8B 1UGKA 4NIYE 2N4IA 1FLTX 1QSVA 5E4IA 2X2UA 4OFYD 3KEHA 4YHLH 1LD9A 4C56E 1ACZA 2VZ3A 4S0HA 2F2HA 5ECGA 4LKXA 2H41A 3I6GB 2OJ1A 4IMLA 3CBJB 1R75A 2BCKB 1ETZB 4K2UH 1CLCA 4FJYA 1JHLL 2R0KH 3F84A 2E8ZA 1S3KH 3BFQG 4WUUB 3TO2B 2VLRB 1KYFA 3RVWC 3P4MB 1B3JA 1UYWL 1OD7A 4G6FD 4NKIH 2X9WA 1HI6A 4HCIA 4H8VA 4Y7OC 3AUVA 3VGAB 4YHMH 4N0YL 1V10A 4BRVA 1JV5B 3L5WA 3A4FA 3TCXA 5I0XA 1UOKA 5GRZA 1BFVH 3MR9B 4W1TA 5D7LB 3WDJA 3WJLC 1NEZG 2YD4A 5DI8B 1N5AB 2B59A 5A40E 1R9FA 4JFHE 2BHUA 3F6LA 1WFOA 4PUBL 3MMEB 3F62A 4UQIM 3SQBB 5IJVB 3WN6A 3FN0H 2ESVE 4OFYA 4I1NB 4H8HA 1DBKH 1L9SA 4Z5RB 1JPFA 3OB0K 4S1DC 3ARGA 1AKPA 3WKMH 1NMCB 4CN4A 2AJXL 1AFVH 1R24B 2DQUH 3ZR6A 1V7NH 2JJVA 4LZKA 2O5XL 4MA8H 4ZOAA 3APDA 3MTRA 3MV7E 4XXCC 3SQOL 2X2IA 1URZA 3X1NA 5G4NA 4PJCE 1JZ7A 5EH1A 1ACYL 2V17H 4AG4H 4TNWF 3WEMA 2VXQL 4PY7A 1LWHA 1S5IL 5D5MF 5HVWA 4LRIA 4WNQA 1BJ1J 4NM4H 1OCRB 2IXQA 5F7EH 5KVGH 4X6CA 4L2YA 3HG3A 3QCTH 1ICTA 5J56B 1M1SA 1U8OB 1E8WA 3GO1H 5D8JH 1OAZL 4J2XA 1BBJB 2DQIL 3B6SB 3QEGH 3X3FH 1Q9LA 2LVCA 3X11B 2GPZA 5AKSA 2ZUSA 3QDJD 4O9HL 5EU6D 4HWBA 5KAQF 5F7MC 1LMKA 2FSDA 4FFZH 2QHLA 3P11H 2FD6L 5HYJD 3W37A 1J5HA 3B9VA 3GBML 1O75A 2HTKC 1Q0XL 2R51A 3TJEL 5F0PB 2R69L 4JL2A 4O58L 3U46B 1OAJA 4GQ9H 3HPJB 2QVIA 3EFFB 2IH1A 5AUMB 3ZIMA 1PZCA 4YL4A 4C56D 2WIIA 4EN2A 4AT6B 1N6UA 3RWCB 4AMKL 4I3RH 1WA2X 4Z7QE 1BPLB 4AIZA 2H6OA 2CIIB 1NMAL 1NEPA 1X44A 3I3BA 3B2UD 4DGUA 2Z64C 3ZE2B 3D0VA 2IDQA 3KDMB 3K2MC 5DJXB 2YKLH 5I8CA 3FTSA 2A6IA 2H5UA 3QQ9D 4WQOA 2NNXA 3TWYA 1AOHA 4H40A 3MNDA 5F9WB 1MVUB 1TJGL 2X4TA 4XNUH 4H0LC 1H5BC 3L81A 2NY1D 4KKLD 4QRQA 2F08A 3QDJA 2PW1A 5EU6A 1AP2B 2QPDB 1AR1B 2Z6FA 2KBGA 4YGVB 3VFOB 1EXHA 4YDKL 2A0LD 3MREA 2WWKT 3WTWA 1M3JA 4U4IA 1KPRA 3Q48A 1ZTXE 4OJFH 5HYJA 4MMXB 4QRBA 3MVSA 4NQEB 5DJYA 2JJTA 2GIMA 2I32A 4N3UA 4NYLA 4LRNL 4PJDF 3A67L 3HG1B 3QRGH 3EDFA 3GJFH 4GRWE 1NJ9B 3ATFA 1RK7A 4C56A 1CC3A 1RIUL 3FUHA 2OTPA 3WIAA 1JAEA 2A83A 5FO9A 4HAKA 4L8DA 2BVEA 4J2QA 4ALAC 2EZ0C 2XIIA 2WLMA 2IV9A 3KBFA 1RZKL 2PXYB 1S9VA 3KLAA 1MSPA 4F5CE 1WITA 4KK5C 4JEGB 2AQRA 1VZHA 4JO3L 1SYSB 4RAHA 2Y7QA 2NX5E 2C4FT 1AVAA 5E6SB 2C3GA 4P2QD 4Z7NE 5DXWA 1R3IL 4OCXH 4RZKA 1IVTA 4HIJA 3SCMB 2XACC 3KHQA 5IVXF 2QR0B 3EO0B 4G72B 4HJ0C 5DHYA 5TTRA 5F7HA 1SXAA 2IFFL 4OUUA 4GY4A 2BP0A 1CPUA 1T66C 1PLBA 2E75C 1LEKA 3RX5A 1I8MB 2OZ4H 3P30L 4ONHB 1T0NA 4NZUL 1PLCA 3A6CH 1GZHC 4L1BA 3CFNA 3WLWC 1NANH 1UVQB 4NO3A 1VZIA 2BIOA 5EEUA 3C09B 4O51B 3ARFD 2JTDA 4OW6A 1N8OE 4KMLB 1PKQB 3QZPA 1FSKC 2H9GB 3QFGA 3E1ZA 3I3DA 4ZFGH 3UP6A 2B5IB 5FGSA 1DBJL 2MCAA 4PJCA 2I5YL 4LCYA 5CN2A 5ICUA 4P2QA 3HZVB 3OWRA 2BIHA 2H32B 1YEJL 1RZFL 1M05A 1CB4A 1HNGA 3RWEA 4ONGL 3UEZA 4DAGH 1ZVSA 5CD5C 2DWTA 3SO3B 1PSKL 2O4EA 4H88H 3GHEH 4UMGA 3EXJA 3IKCA 3RWDB 1NBCA 2P8MB 4YDJB 3T2LA 5INDB 2DYRB 2AABL 3FTUA 5AW1B 4DGIL 2VDNB 1HE7A 1OOWA 5AVWB 1LEIA 2BNQE 5J3HD 4PD4J 4ODUB 2KZ1B 3D6GA 5HHNA 3KPRE 3F7PC 5FECB 3BZEB 3MYJB 3GT6A 4QHKJ 2D7OA 3UJIH 5CZVH 4QTHB 1HHKA 2O30A 3HC4L 1I1RA 2XWRA 2ATKB 4UM9D 3SYCA 1IM9B 5JQIB 3JVGC 3EFOA 4QWWD 3QQNA 3SDDC 3QCUH 4R83A 1UB5B 1D2OA 5CIPA 1OT1A 4UYQA 4F2EA 2K7QA 5DUJA 1G7IA 3KPPB 2GSIB 2W9DL 5INCB 4F8OA 1ZT7B 3R8QA 3OGCB 4ES9A 5I2IA 1B4RA 1FFOB 3GLDA 1TVDA 3OD3A 1NCNA 5DC4B 5EOCL 3FOMA 5D2NB 1XGYH 3MRQA 3TX4A 4MJIE 2EYSA 4U1JA 1D5ZB 2ZXEB 1OLZA 3FTYA 4HH8A 4ZXBC 3TO4C 1K3ZA 2GK0B 2Z3FA 1FIEA 3QGVA 4Z95H 4HVBA 2D9CA 2JB6B 4HWZA 4BELD 5ADOH 2EILB 1ZSDB 4JAMB 4KNUA 2MNJB 5HDQL 2UZYA 4UM9A 4ZFQA 1AQDA 3PDOB 1C7SA 5JHLH 2QZ5A 4B3VA 3CFJA 4LF3A 4NPJA 3KJ4B 5B38A 1TQCC 1FVEA 1BGXL 1BMZA 3MFFB 1M3IA 1WWCA 1IAIM 3AVEA 1DVYA 1KIPB 1QFWL 4YO0A 3T3PE 4A7GA 3QHZH 3P73A 1ODAA 1UWFA 2LAAA 4IIQC 3FULA 4AQ8A 5ICXB 2C9PA 5JPMB 3F05A 1KB9J 5BO1H 1D5XA 3NA4A 4YHPA 3ULVC 1RAMA 5IUSA 4F5CA 4OY9A 4RFEB 2I26N 3AS1A 3MCG1 4NZDA 4A04A 2MFNA 3CZLA 2IOMA 2CHZA 1CDCA 2ZUVA 4YLQT 1SY6L 4DERA 4FG4A 3VRIB 4P2OC 2ADFH 2BVQA 4BQBA 3W56A 3ZHNA 4TUKL 4WEUD 3Q05A 4LSTL 4N8CL 4RGNB 1RY7B 2F5AH 5H37A 5I1JH 3HZMB 3ARBD 4P59H 4KPHH 4P46C 4W9JC 3FT2B 3GSVA 4OLVH 5FYJE 5HHOB 4YPJA 5LB1A 3EGXB 3FONB 2Y5QA 2BNQD 2C3VB 4XB3A 4OBSA 5FK9A 1P4IL 1OWWA 2VR9A 3KPRD 4JFZL 5IKCA 2OJZH 4Q9BA 3PIQA 2AV7B 1K3IA 1A4JA 1SHSA 1NFDF 4GG8A 4AC2A 2ZOLB 5FA3A 1ZA3B 3M07A 5DS8B 5TFSH 4FF9A 2G60L 4JE4B 4HIXL 2YZ1A 3B56A 1JWMB 1HU8A 3QJFB 2R69A 4HCRA 4JVPA 4XO9A 3FT3A 2EXYC 5GJTH 4ELMB 3KXFB 1JN6B 1WTLA 2PTUA 1L9MA 2XTJC 3HS0C 4P5RA 4M00A 4TSCH 2YEZA 3O8XD 5DEJA 1AY1L 2VZ1A 5FW8A 4M4PA 5C0BE 3L5XL 4ZFZA 4YDVB 1UWEL 1ZKAA 3F5WB 5D72H 4GMTL 3LY6A 4QHMA 5DMKB 3QRLA 1AJ7L 1A6PA 4F58H 5EPMB 2UV3A 2ICWI 4AWJC 2XKNA 4MJID 3QISA 4MMZA 3ARBA 2DTSA 1FO0L 2OZNA 1YECL 4ODSH 4CVXA 1MCNA 3CZFB 4UOW0 2Y72A 3D8MA 1ZLUH 4RGND 4PRBB 5F6HI 5CXPA 1B0RA 3FO9A 1O5PA 2XQ0A 2BNQA 2VZOA 3WEXB 2X6UA 4DIXA 5CBAA 2HYMA 2OR7A 2WXQA 3KPRA 4MCYB 4HXBL 1BSIA 5IVZB 4DF9A 1UT1A 3NGBB 1JZ2A 1A3ZA 1NEZB 2F54B 4YSQA 1G9MH 1MW2A 3NN8B 2HFEA 3KYNA 5TJWK 3O4LB 3O8XA 3VACA 1IEBA 3I50H 4ODXA 4QHUA 2IANE 3U6XS 1XF5B 3QUMB 3OKMA 2NXYB 1TQVA 2NRDA 5DD1L 3MLTB 2J88L 2AJYH 3P4OA 1DQJB 1I1YB 1FAIH 1ASQA 1IC5H 5ANMA 4MJIA 4L8BB 3ATAA 2B4CC 1MCKA 2QSQA 4KBPA 5TDPB 3D06A 1SHXA 3UC0H 3KPNA 2VUYA 2CCVA 3Q1SH 1D6VH 2DJSA 2R23B 1FL3B 2CDFB 1MQKH 1OZUA 3ALXA 4IJTA 4ZD3L 5JHDE 2CM5A 1LK3H 5IV2A 2PYED 1T5KA 5EEVA 5BO0D 3FOLB 1JXJA 2EIMB 5IUCA 2Z4TA 1KEGL 1UXWA 2G5RA 3IFOA 1QLEL 1B4JH 3CX5J 3V6OC 2XWJB 3CN4A 1AACA 1KXTA 1TO5A 2EDNA 2XQYA 3HN8A 1AXSA 2EUZA 1NGZA 1U3ZA 3UDWC 3I6KB 2LV4A 3ETSA 2FK9A 3SIKA 3EJUA 4GSXA 4M7KH 5EUOB 4OJCA 5CWSA 1D5IL 2V37A 5JW5A 4QOKB 2CO2A 2ERJB 2Q6WB 5D7IF 3PAUA 2AKRB 1FNSH 2ZKYA 2JELH 1OEZW 3FT4B 3S5LA 2PO6D 3FFCE 3UPRA 1TZGL 1EPFA 2HT2C 5ISZE 5I76A 5I9QC 3ZYJA 5JMOC 3EH3B 1E2VA 5DYFA 3Q8EA 4KQ4L 3BVXA 3NIDB 4YHYB 1PX3A 5C0BD 2FJGA 5A2FA 4C4KO 2PYEA 4DEWA 4UT9L 3OR6A 4CSSA 4NHUB 1QKZL 3VU2A 5EOQL 1ORSA 3O41A 1G94A 1HSAB 3NJGA 4W9EC 1SXNA 3B9KD 3B2VL 3K0WA 4KMTL 4KQ3H 4HSQA 1JTOA 3MQIA 2VXTH 1BQLH 3GSXB 5ALCL 3CN1A 1T83A 4RFNC 5I0VA 4MS8D 3LMJL 3TH2T 5FUCC 5KEZA 3DVGB 4ZMOA 3BLPX 4RRPG 2C26A 1DBAH 4ZMVA 1MN4A 1KF9B 3F6IA 2YJQA 1DQKA 1CL7I 5BS0E 4IBTA 2YAMA 1NCAL 1I3GL 4HH9B 4I9WE 4N2AA 3FUMA 3VYOA 3BUPA 3SY0A 3PV6B 4AX3A 3OKKB 2YXFA 1X5KA 1P4LA 1LQSR 2VCOA 2PO6A 2UZXB 4U6TA 1VPOL 4L4JA 1J9SA 1YEDB 2EE3A 2N7BA 1CG9B 1I1AC 3E0GA 3GXTA 1I8IB 3FB8B 1RVFL 1E5YA 3EDEA 5JPNB 5C0BA 4FNRA 1DVQA 2Z4QB 2YPVH 2AVFA 4K7PY 2IC2A 3QIWD 3PXHA 2W60B 3FTXA 4P99A 5G55A 3CUPB 4B9YA 1ZE3C 5F44A 5EU7C 1L9QA 1MWAB 1KCVH 3V9FA 3B9KA 4EI6B 3L7FA 1U6AH 5JO5A 5AOLA 1RL1A 2GITA 1FFRA 2Y06H 3ISRA 3HKFA 3MLPA 2V8MA 4NX0A 1FL5A 1RZGA 3L3OB 1Z1WA 1UHVA 4ZPTA 3TU6A 5JHDD 2A6DA 2BY1A 5KBPA 3VI4B 1K4CB 1HZHH 2X09A 4XN9A 4WZ9A 5KANG 3RP1A 1V3KA 3T0BA 1ZHNA 3EYSL 1WDAA 3MSPA 3QORD 5DJ8A 2OMXA 4FQHB 4OGXH 3MV11 2ZYSA 1CVSC 1KY7A 2OX5A 4LBEB 4FXTA 4N9OB 1GCYA 4OCLC 2NZ9C 1SLVA 3ZTDC 4AC4A 4XCEA 3GM8A 1UENA 5B3NA 1BXVA 3P4LA 4G7RB 1VCAA 4QRPE 5MP6H 4YPGB 4CDHA 3EUUA 4B3EA 1MREH 3W1ZA 1JK9A 3WNNA 3ZHDA 1T2JA 3ARRA 4OSUH 3CPLB 4JPKH 4NUGL 4Q58C 3N44B 5DEGA 1AS6A 2P43B 3MUUA 1XCTA 2GCYA 2GFBB 3QIWA 4C55A 3LH2L 2P46B 2X87A 1T6VN 1BZEA 5C71A 4BH8A 3QDGD 3ETBJ 1SYVB 2AEOA 1E6JH 5C97A 5ISZD 4NM8L 2QMKA 4AV5A 3TBWA 4PY8J 5ACMA 2AK4E 1I9RL 4V11A 4Y1TA 2H8PB 5JHDA 4LGSB 1JGIA 2DQDH 1RUPL 3V4VL 3QORA 3UZQA 5DJ2B 4YDIH 4FFWC 2VR3A 2OTWB 3RWIA 2BMKA 3OKYA 3TP4A 1ZGLM 2HN7A 25C8H 1TKWB 4LPYA 3EYVA 3N85H 3JWNG 4J5VA 1CFSB 5I15H 5EA0L 3UBXG 1ZV9A 3GB7A 1DCEA 3TIDA 2FWSA 1FAKT 1WT5C 5FLUA 2KZKA 1XF4A 3C87A 4I9WD 1H3XA 5KBNC 3RKDD 1F45A 1PVHA 2EKSA 3O45B 4F37F 5ITFA 5T3ZE 1O0VA 4QRTB 4X4YA 3FT1A 4OD1L 4XCYB 4M1GH 2R2CA 2B9BA 3FFCA 3TVMC 3B7SA 1K6QL 5SWZE 3KPMB 5ISZA 1A6AB 4JFDB 4NGHH 1YMMB 3LPGA 1R3HB 4O2EA 5F1IB 4M5TA