3DPBB

Crystal structure of the complex of the caf1m chaperone with the mini-fiber of two caf1 subunits (caf1:caf1), carrying the ala9val, ala11val, and leu13val mutations in the gd donor strand
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
149
structure length
149
Chain Sequence
ADLTASTTVTVTVVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrophobicity and rigidity of binding segments enable CAF1M chaperone to act as assembly catalyst
rcsb
source organism Yersinia pestis
molecule tags Chaperone/structural protein
molecule keywords Chaperone protein caf1M
total genus 21
structure length 149
sequence length 149
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09255 Antig_Caf1 Caf1 Capsule antigen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1310 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3dpbB00
4AYFB 1P5VB 1P5UC 3DOSB 3DPBB 3DSNB 1P5UB 4AZ8B 1Z9SB 4B0MB
chains in the Genus database with same CATH superfamily
2YSTA 3MV7B 3ZE2F 4JPQA 3HC3L 3EO0A 1EHLH 2FHBA 1IGFH 3ULVE 3UBXI 2WYHA 3ATEA 1TXKA 3HG1A 3D3VA 3FYIB 3L3HB 3VWKA 1P7KB 3GKWH 2ICWI 1HXKA 4PJHF 3RZCB 3HI6L 5AYQA 3PWLB 3UROR 3C6LC 2OMYB 3BAIA 3LS5L 1U6AL 2VXSL 4JS7A 2C1OB 3RFZA 4PAZA 2JE8A 2DD8L 3P3UA 4MD4A 4UNUA 3BX7C 4B3VA 2RQEA 3NIGB 1TLKA 1KSRA 2A9CA 4XP5L 3IDYB 3DJTA 3DIVA 4FQCL 4XGZA 3QIUD 2XZQL 4JKWA 1CCZA 2HRHA 3KJ6H 5C0RH 1F4YH 1XGUA 5FV2A 5B3SB 5I5JA 4GG6B 1M3JA 5EUOA 1NJ9B 2JQAA 2VLME 2E7CA 4G2AA 5DK2A 3M45A 3O4LB 1H8NA 2FQEA 2E0PA 4MJ5A 3HLAA 2PW2B 4QPEA 8FABA 4MNGA 2GHZA 4P2RD 3HR5B 3IWUA 3IKCA 4NO2A 1BX2A 1JVOA 3CFJA 1JV2B 3U79A 3EJSA 1B2YA 1LMKA 3PL6B 3MRKA 1KTLB 5EA0H 2UVEA 1TQVA 5T5NF 2B8OT 4JRXB 3UDWC 1KFAH 1FL6B 1YYLH 4RRPM 4WWOA 1ZRUA 1TEYA 3D51A 3HZVB 5DS1A 3QDMA 3VD5A 1TNMA 3X11B 3KL5A 2XUWA 5ANMA 1XMEB 1T83C 2FX8L 3W0WD 4EEEA 2WMPB 4GBXC 1A22B 3MRCB 4NFDA 1P7HL 1UD6A 5BS0E 2X4NA 2FBOJ 4N2CA 2EEBA 1KGJA 1OQOA 4FXKA 1QW9A 3GSVB 3V0FA 2QPEB 3FT9A 5EOCJ 3SKNA 3L3DA 3OB0K 3V5HA 4PJ8A 3QUGA 4RDQF 1MQKH 1DVSA 1U3HA 5FK9A 3S2AA 1B90A 4RGMB 1KV3A 2UY7B 3GWJA 3RDTB 5BO1L 3FO1A 3WO3B 3KVQA 2IBGA 4TS6A 4KMQA 1J8HB 2CZNA 3N85H 4GEJA 4MX7B 5ESAA 5E1IA 2Y7QA 4J8RB 1FLRH 3OZKA 4WSGA 3PF2A 2ADJA 1AZRA 4BIKA 1WSST 3IDGA 1SJMA 3PQYD 4R7XA 3L7EB 4A2FA 3L3IB 5FA4B 3U4KA 2G3MA 4HJUA 3EF4A 3EYFB 4JM2B 2G5BA 1UQSA 4J3UA 4N0CD 3QPQD 2H1XA 4KXDA 3S3JA 5DUBA 3LQZA 3GSWA 1IGJB 1MVUB 2O5YH 4PW3A 4V1DE 1OAZH 1I3GL 3B3IA 4LLDB 4PJ5E 3CVHB 1NOFA 3BLKA 4U6TA 5KBKA 3KDPB 1FL3B 1ZANL 4HMEA 1CZ8L 4LGPB 3VFNA 1FFNB 4MWFB 5FYJL 5KYXB 1EMTL 1F6AA 1WITA 2HZHA 3ETSA 4PM1A 3TV8A 4KITB 2O1AA 1S78D 4Z7UE 2MNUA 4YEFA 4LSSL 3TIEB 3B2UC 5K39A 4YGAB 4XAKD 4YNYB 1AHKA 1YPZB 2DQFA 2ARJA 3JWDH 3NP4A 3S6CA 3FTUA 3UJIL 3HG5A 4Z95L 5JPMC 3HB3C 5BRPA 5L88L 3FFCE 5IB1B 4RFOL 2XWJA 1J5IA 4N0UE 4FEMA 3N1GC 4K2UL 3TZVB 2FJHB 4KO6A 1SXSA 1PD0A 3VE0B 1AE6H 1XXDC 2ZWNA 1FLRL 4F37K 3FRPB 4GSXA 4HOXA 2BINA 1ZV2A 2A0LD 4N87A 4HX1B 4MJID 1IBDA 1EDQA 3PXLA 2HRLA 5HI4D 2EICA 2QQNL 2OR9L 5J6HA 4MBOA 5FF6B 1TQWA 3BW9A 1M2VB 1R17A 2O5YL 3F7YB 2CO2A 4ZX4A 2ZOLA 1T7WA 2GSIA 1A6ZB 2CBMA 5I1GL 1OAZL 3OKKA 3HW7A 3MV8B 4XVUD 3BDYL 3QFJE 4LPYA 2O61B 3ZO9A 1F13A 5ID0A 3DX2A 1A66A 5JNYB 2ITDA 3PNWA 4DZ8B 5IM7B 4ONFL 3IS0X 3SB3A 2NW3A 4K8RL 3DX4A 3NOIA 4B27A 4XBGB 1EMTH 2CLRB 3G6DH 1UM6L 4G8EB 1MWOA 1A7QL 4G9DB 1FZJA 1OPOA 4OQTA 1CXHA 2QT6A 4ZD3L 3DIFB 5CINH 4BBWA 1KN2H 1BMZA 2D8KA 3HNSL 5BXFA 4M5YL 2E86A 2DQHL 4JFDB 3QC6X 4TRPH 5FFLA 2EIBA 1SDDA 1RUQL 5HGDB 4HA1A 3F8UB 4JPVL 1E28A 5I6PA 1T1XB 5K93A 3QS2A 1UWXK 1RZGA 4MQXC 5ILTH 3BCDA 2WZ6A 1VEOA 5EU3A 1C5CL 1U8CB 1JNLL 1X7QB 4WENB 4F58L 1FN4A 3CFEB 3NPSB 1MFNA 4PN6A 3HRZB 2QQNH 5I16B 2X53A 3RE0A 4A7GA 3G08B 3BVTA 3BZFA 4AYEC 3DX9A 2NY5H 4RBPH 4Y16C 2DQ6A 4L9LA 1HNYA 5J4MA 4JAMB 2Q6WB 3ZHKA 1KXQE 3BT0A 2P5WE 1ZMYA 3SOBH 3CXFA 1QLRB 5FM4A 5ITFA 5LAXB 5C0GB 4JN2B 3SBPA 3TFBA 4ZMVA 1UWEL 2IQ9L 5D4QA 4UYQA 2DM2A 4KZ0A 3V52H 3GXIA 1BQUA 3LEXA 1VCAA 1CK0H 3BUQA 2OJZL 5KN5B 4ZSOB 4UV7L 1ZTMA 2WLNA 1E6JH 3U7WH 3TPUA 4M5YH 1GRWA 2AJYH 4P9ML 1EFQA 4KPHL 1F4XL 4FA7B 4I0KA 2KERA 5FGBA 4H44C 5KW9L 4NPJA 2CDGB 4LDCA 1KZYA 5FB8A 3BAJA 3CQFA 4NSKB 3LXAA 4C54A 4L29A 3K3QA 4Q97A 2VLRE 5HGHB 1BZ8A 1JE6A 1F1DA 1NEUA 3HJ0A 4AQ1A 4GIAA 5TQ0H 2K7QA 1E4XI 2XU9A 3WKMH 1PDKB 1MIEL 1Q4NX 2HJKA 3CHSA 3W39A 1KPVB 1A9VA 3BPNC 2D4DA 4LPVA 4ANUA 1BOGB 3FTXA 1HESA 3FO1B 1W72H 3WEXB 1HCVA 3QEHA 4X4MA 5DVNA 1JRHL 4M6ML 1DVFA 3O6KL 1EFXB 4KO7A 4G6AD 4J8RA 1BFVH 2Y06L 6CGTA 3FT1A 4DW2L 4P5KB 1FVDA 1UZ6E 2B4CL 5DHVB 2J56A 4HCFA 2WNWA 2A74C 2OJZH 1UKQA 2D7NA 4S2SA 3NSXA 3BVNB 4XC3H 4LLDA 1A47A 5DEGB 4E41E 1YUHA 1XH2A 4I3SH 3HS0A 3VFVA 2F54B 1GW6A 3ZRSA 3HG4A 2O5NA 1DBMH 3NCYP 1REIA 5EU7C 5F0JB 1MW1A 3FAWA 3L3GB 4PJ5B 3KM2A 2VABB 1IFRA 2N0MA 3NJJA 3QCTL 3BAEL 3GMOB 3KWWB 3PPSA 2YD5A 4JHWL 3N42F 2DYPB 2JJTC 3F6LA 4JMXA 3SKMB 4HEPA 4N0FA 5DQDL 1QLEL 5JQIB 2OXGA 1UVQB 5AB2A 2ITFA 4G8GE 5JXAL 1TMQA 3SHSA 3TJHD 2DBLH 1XD0A 1JTOA 5D5ME 1JPSH 3FOMB 3CFNA 4WW2B 1H8OA 2VR8A 3AT9A 3TASA 1W72L 2YQGA 3TVMC 3UGUA 3GRGA 1P6FA 3IU4H 2VYRE 3QWOA 1FA4A 4Y4HD 2C3HA 4WTQA 5I73C 5IHWA 2KZ1B 4U1LB 1SQMA 5GS0L 5TE7H 4AK1A 3H3KA 3TJEL 3ME0A 3POHA 3NA9H 4NDMA 4PJXE 3WL9A 1CDCA 1YAIA 2I25N 3R19A 2W9DH 3MOAL 3NFPB 5C07B 4JCWA 2WXIA 4XN4A 1K8IB 2R27A 2WTRB 3VXTB 1AC0A 4XAKE 3E8UH 2B20A 3B34A 1OCCB 4ZW5A 2PO6C 1QA9B 2X6AA 2ITDB 1TYEB 2QQLL 1SZNA 3PNWB 4AY0A 4F3FA 3BZDA 1PSKL 2WUCL 4XBGA 3TA3B 4LCCC 1FGVL 5CUSH 5DJAB 1CFTA 3DVNA 4N90E 1O9ZA 1GOFA 4LSRH 1PY0A 2PYEA 1WF5A 5HYSG 4S10A 5C0CB 4ORZC 2EADA 2GVYA 4QIRA 3BP5A 4NQSA 5SWZD 1NBVL 2WNKA 1MAMH 5DZJA 2W94A 4G9FB 2IPKB 4JFDA 1JUFB 5D1ZA 4ZOBA 2HFFB 1SDDB 3KLHC 2QZ5A 2VQ4A 3C6SB 3X1GA 4H5SA 3UOAB 4N9GA 4PLKC 5HHQB 5JTWA 2JKLA 4N2IA 1S46A 3RIAK 2H32A 5DJCA 3FB7A 3QCUL 4OCRH 3S3PA 2EDLA 5CD5C 2P24A 1MCOL 5E1HB 1OARH 3T0XA 2VLJB 4B41A 2ZXQA 3MTRA 4OSUL 3ZR5A 1O6SA 4YHYC 2ADFL 2R0LL 4HC1A 5A7BA 2YQ2A 4N6RB 4AV0A 5IFJA 5CP3H 3GFUA 4CJ0A 2V5SA 1OP5K 4OFIA 2ALAA 2VLKD 4ZI8A 3EUDA 2HRGA 2D2CC 5DUJA 4ELDA 2V9UA 3M46A 1CFVL 1Z2KA 1ODAA 3OHXB 4PJIF 4QRRD 2AK1L 1FGVH 1RI8A 4KXZH 4MNQB 1U93B 1DQQB 2GTQA 5DZNA 1AD9A 3T3PE 5HHOB 2EEAA 1NBVH 4CNIB 5LKNA 3ULUF 4FERA 3CDGA 2WLIB 1R19A 4A7VA 1L0XA 1M05A 2BVPA 2DLTA 4Y2DA 2OMVB 3BKMH 3LAFA 1D6EB 5L9DH 5AVQB 4LIQL 3STBA 4ABQA 3NSYA 3K8KA 1IILE 5JW4R 3UTSD 3QEUA 4BFIA 4XZUB 1IQDA 2CLZA 4UQDA 4DN4H 4LPTA 1EVTC 5EZJA 3V4VB 5DK0A 5GZOC 4YQXL 5LWYL 3E38A 1RH8A 3D85D 2VXQA 2K0RA 1KPUB 3LQAH 1EEZB 4QTHA 2H3KA 4LVHB 4TOYH 2YAHA 5DQ9A 5HHVH 5I28A 2F61A 4HIHA 2OI9C 2DQDH 3DKHA 4LLQB 2BHYA 3G6JE 2IADA 3ML9A 5F3HB 2OMYA 1P53A 2MOVA 5SWSB 2J21A 5CM1A 4D9LL 4S1RH 5JIIA 4NKMA 3LZLA 3N85L 4R6UA 3IB4A 5BMFL 2F53D 5C71A 3O3DB 4UOZA 3DWTA 4X4ME 1MJJB 3EOAB 2VLRD 5E08L 3MRQA 3SGDI 3T0VA 3O9WB 5A2IH 4BFEA 1AIZA 1N12A 3H9HA 3LXUX 5IV2A 3ARFB 5F7DB 1E7UA 4NBXB 4YMPA 3JVGC 3FFCB 4GKNB 2X4SB 3ARSA 5IW1A 2BK8A 1YUHB 1IM3A 4XXCC 5CN3A 3QWQB 4PJAB 5DVPA 4CN4A 2YD8A 4Y4KA 2XWBB 15C8H 3WNOA 2WN3A 1OPGH 5IIEA 1EBPA 4LIQH 3L3GA 4IHOB 2CDFA 3FQUB 2ZSVB 1BW8A 3KWWA 4MA3A 2GITA 2LU3A 3NPZB 2EYRA 4DN3H 2X1WL 4KDVA 5HI5C 4AQAB 3K7UA 4HHGA 3GBDA 3EJZD 4D94A 2DWTA 3IDXL 4R5VA 2FL5B 2ZUUA 3VU2A 3CN4A 3LQAL 5CEYA 4PJGA 1JV2A 3ASOB 5MENB 1J18A 1L9MA 1L7TH 1OIOA 4NUMA 1IFGA 3FPYA 3QG7L 3HRZC 4NPKA 3GHBL 3RX7A 4DP6X 1N5YH 3A21A 4H40A 4OFYA 2Z8VC 1T2JA 4E41D 2A2QT 2CHWA 4U1LA 3AMKA 1V7NH 4WFEE 2XBZA 3D39B 1Y0LB 3HE6D 5E9DD 5HI3D 5AAMA 1MOEA 3WHE0 3FSAA 2QZQA 1IZJA 5AVYB 3VJ6A 4DO6A 1KCUH 1DBAH 2OR9H 4PJXB 4D0BB 3MNWA 4I2XB 5BUGA 2DPKA 1T1ZA 4UDUA 3EGXB 3K6FA 4N2EA 5AEAA 3TCLB 4ZUSB 4LCWB 2PYEB 3CC5B 2C9AA 2ZKMX 4K15A 4UV4H 5CEZE 3RX8A 1ES0B 1ZLDA 3UTTD 2XRAL 3PHQB 2H41A 4PRNB 2K6YA 2CK0H 4AUYA 2APSA 3IDXH 4TNWF 3PHOB 4ZFZB 3S5LA 1YSOA 4NQEB 2IPKA 1OGAE 5TF0A 4Z7QB 5CINL 1G9EA 1H8SA 3HE7C 2G5BB 4P2QA 1EANA 3QG7H 3VXOA 4HGWB 5IVOA 4G43B 4HS8H 5E6IC 3VXRB 1GOGA 4OV6F 5DEJA 2N3JA 2Y2YA 3FB7B 1DVYA 5D5MF 3WE6A 1LEKA 4JE4B 2AJSL 1YMHA 3ZT6A 5G4MA 1QPPA 3CHPA 3L9EA 4GFXA 4NQED 1VESA 5CCHE 5EOTA 3LPFA 2MNWA 2V4LA 3LPOA 4KX7A 1MCPL 1U41A 1NDTA 1GZQB 4K23L 2WIIB 5GGSB 4KGLA 2DQCH 2HPOA 1BFOA 2VXTH 4O2CA 5JOFB 3GD1C 4NUJB 3FU7B 4F7CA 5DJ6A 3KGSA 4FMVA 2G0LA 3Q6GH 4C83A 1NGYB 4GI8A 4PJEF 1AQKH 1ICTA 4AI7A 5MI0B 1DQVA 1ZTXL 4YHZH 4DVRH 1G5AA 2AQPA 1WPCA 4U1MA 2O6PA 1PKQA 2GTZB 1U8QB 4BH7A 2MTPA 1T7YA 1EXGA 5E6UB 4YUEL 1XSIA 5HHOA 5LGYA 3QAZB 5HY9B 2Y72A 2CA3A 1KF9B 5DCCA 5BRZB 2PYFA 3S8FB 4A63A 4JFXA 4X4KA 1GJWA 1BVNP 1E6JL 4FQJL 3FL7A 3C60C 5IMMA 2XN2A 5FF6A 3EO9L 4P9MH 1X5YA 1E5AA 4LVHC 2NZ9D 4WUKL 1A6ZA 2DAVA 1V7MH 3T9WA 4U6VL 4DK3A 4KOCA 4L1TA 5I18H 2NW2B 4WHYH 5DO2D 3UMTA 4I4WB 2PKDA 4Z7NB 3LNFA 5ID0B 2EVHA 4HUNB 5DMGC 1IBBA 3SE9H 2PWDA 4P2OD 2Y5QA 4CKVX 4EZLA 4OGAD 4UIKH 4RX4D 1FFPB 3MRPA 1KIRA 4Z7UB 2IC2A 5FM8A 3WELA 3QUMH 1JZ3A 2VDML 4JDEA 4F7TA 4IBLT 1LO0L 2HRPL 2XWRA 4TNWK 1A8ZA 3TEUA 1E40A 4QXGL 3F7KA 4A66A 3HI5H 3MGOB 3AROA 5KBPA 1QFPA 3D4YA 4JO8A 1AS7A 2VZVA 2NXZC 3QJOA 4JZNB 1RL1A 5DUML 5CR8A 1YY8B 1CICB 2BXZA 2Y7OA 1MCIA 3FB6B 1RZGB 4DUVA 1D5IH 4ERSH 1SN5A 2A9NH 1WFMA 2LHAA 3H85A 4FNSA 5JPMB 1I8MA 3FQWB 3FT4B 3FH5A 3JWNC 4X7SH 3KEHA 2JJSA 4QHMB 4DPAX 4KTDL 4YHNB 4O02H 2J4WH 4HEPG 3NACH 4PIBA 1IAMA 3RWDA 1CDHA 2YAEA 4UCFA 1K3ZA 1PJ9A 3OPZH 1MG2C 3A47A 2OP4L 5SV4A 1KCWA 3DMMD 1AXSA 2CDFB 3FQUA 3N3EA 4L4VD 3TLRA 4AENA 4QHKJ 4L9LB 1DLHA 3GK8L 4U6VH 1K3IA 3UBXB 4HCRH 2ZKHL 4QRTA 3Q0HA 3T8VA 1S8DB 2NYZA 1KEMH 3MA9H 3KPQB 3ZL2A 4ZK8A 1GAFL 1UWXH 4GI6A 3CZJA 4KKNA 2CR0A 1NUFA 3BC9A 4ZOEA 5DJZB 3FU6A 4GG6E 4HFUH 5TD4A 4HZAA 4TYUA 3TEXA 5DSCB 1XL4A 2TRYA 4BH8A 1S7UA 3C2AH 3WMPA 1WIOA 1ETB1 1FAKT 2EH7L 2HKHH 2Q5BA 3C6LA 3F7VB 1QFUL 1U58A 5MENE 3K2UH 4QYAA 3WHXA 2HTLD 3KS0J 4OZGA 1DDHA 1F02I 5ICUA 3BCFA 3EAKA 2XPGB 1M53A 4P3CH 3WIIH 3LRSB 4K3EL 4LMQE 2GT9B 2F74A 5TGBB 5H4YA 2VW6A 1XO8A 1BDYA 2VH5L 3CFKA 4XH2A 2MRYA 2XFGB 5H94A 3QZWA 4F27A 3VSTA 3ZE0B 2CE6A 4LVNC 2GABA 4DQOL 1SN0A 3NRFA 5KSBA 1ZA3B 4KTDH 3IJ7A 5B22A 1KG0B 2HX7A 4JY5L 4JFDE 4XNBA 5L8KB 4OZIB 4AWJC 4BSVB 5DMKB 3N43F 1NUGA 2W60B 4DT2A 4LCWA 3GMPA 3J8F7 3PIQA 4TTGA 3ZU8A 1IGIL 2UXTA 1KTBA 3TT3L 4HALA 5KVGL 6FABL 1DVFB 1DJGA 4PWEA 4QXTA 1E4WH 3M17A 2OCFD 5ANHA 3GSQA 4JCMA 4MXVE 4YBHA 5AZEL 1BG9A 3RX9A 1AYRA 4NRXB 3UTSA 1ET7A 3IT8D 4M6NH 2AVFA 1SY6A 2R0KL 3WFDL 3CV5A 2DQGL 1A4BA 3MV8E 2PR9A 4GSDL 5F9WC 1RZFH 1QBLL 3C2AL 4KFMA 3ZUNC 4Q9BA 5C09D 1J8HE 4RLDA 2DIAA 3BI9X 2G2RB 2ZXBA 3UTZA 1G9NL 2Y07H 1FC2D 2WM0A 1M3IA 3NCFB 2D3VA 3AITA 1F11B 1RZIA 3HZMB 4O2FA 2XJLA 4PJ5A 3O81A 5D1QB 3KLSA 4FTDA 1AD0A 3MRLB 3O2VH 4NCC2 4PJCE 2X9ZA 4DK6A 4B9GA 2Z64C 5GGSA 1SEBA 3MNVB 2JKWA 4QKXB 1YEWA 1BFOB 2W65A 4GLRH 3DUSA 3EJTA 4O2CB 3V0HA 3RWGA 4JDZB 2SODB 3FU7A 4F7CB 4UT9L 3SDCA 1EBAA 3TOPA 2BOBB 2G5UA 4XN9A 3GUTA 5HD8D 5EFIB 4J7RA 4NRYB 3GGWB 3M7FB 4ZS7L 3FN3A 1URIA 4GXUM 3PABA 5F1IB 1U8QA 1HZKA 3UTOA 4Y16D 3GSNB 3MR9A 1UA6L 3OL2A 2PPAA 4FQXD 3ETTA 4OCLC 3VVWA 2V2TB 1NC2D 1N18A 4YDIL 3CMOL 2QDWA 2GJ6A 2NYYC 3IFOB 4PLOB 1KGUA 1JSYA 3MKGA 3SE4C 4G42B 43CAB 5I1HH 1EUUA 5IQ9B 4I3GA 3HFML 5D71L 3T6ZA 4XX1G 2XWCA 3H2QA 3GI8L 5E70A 1AKPA 1KIPA 3IFLH 1Z9LA 1TQUA 8PAZA 4FFYH 2PYEE 4KQ0A 5BV7L 2OYMA 1G9NH 2AEPL 1LLAA 3T77B 1J48A 4Q9RL 2K3HA 2E9JA 5ISZD 2BNQE 1NGQH 1H15B 5CJXC 4Q6KA 5BZDA 2F53B 3B4NA 4E36A 1MVYA 2WQWA 3FOLB 3I9AA 4E42B 4FG0A 4PCKA 5CKAA 1RUPH 4YQXH 1E3ZA 4OLYL 3GTNA 2E9GA 3NJGA 1JF6A 4IS6B 5ALBH 4J3OD 4ZUWB 5FKAA 4X8CA 3HMXL 3RI5F 1BYNA 3BFOA 2NT0A 5ICZA 1T0OA 2PTTA 3TBTA 2H2PC 2LVEA 2BCKA 5G4OA 3PP4H 2BIQA 3MBXL 2I24N 5C0BE 4JQIH 3DVIA 3G7TA 4P9HL 4DCQB 5IMKB 4DAGH 2CCWA 2XZCL 3FSOA 3PP3H 4JANB 3VYOA 1UA6H 3GEWB 3GMQB 2BX5A 4RESB 5EOQL 1B2WL 2F19L 2WO2B 3I75A 3FT4A 2GFBA 5E1GA 4Z0BL 5T1LD 3TNNA 5I2IB 1KLGA 1Q1PA 2NY4C 3QXDB 2WB7A 2P24B 1OHQA 4GT7A 2UZIH 2MMXA 4QRUA 3RWDB 1WWAX 4QWWC 3B9KB 3D25A 1OSZB 4UI2A 3HCVB 3PDDA 2DM3A 4YHOL 1KCRH 2RQ8A 2EDBA 4L4VB 5A6LA 1ASPA 5FYLD 2D03H 4TSAL 4PR5B 3I74A 2BFGA 2IH3A 3D3VB 3VWKB 1JPGA 1EH9A 3ZL4L 5HHMB 3IDYC 4FABL 2BY2A 1A65A 1UD2A 4FLSA 4GRLA 4JREB 4NAMA 4CGUB 4ODUA 1VFMA 1HHKA 1WA2X 1Z9OA 1OP3K 1FL5A 3MRNA 1S9KC 4OLYH 3U0PB 1SM3L 2HMIC 1ZV9A 4HEME 1FAIL 4JB9H 1U58B 3DX7B 2IBZY 5GIRA 4HWZB 1HZLA 5IQOA 5F7BA 5AW3B 5HVFB 3B9VA 3FQ2A 5DYOA 6PCYA 2H3NA 3I6LE 4R3SB 4OT1H 1G7LA 2DWXA 3RB7A 2KDGA 5T5NG 1RUMH 2DI9A 2XA8L 4GUQA 4ZTOL 1JGUL 2FHCA 2F74B 5TGBA 3TWYA 4ODVH 4KXCA 4Y1AA 4XH2B 5H94B 3W5NA 1E2ZA 4TL4A 3MBEC 4AZUA 3TURA 1I1AB 1SBSH 3K6SA 2BY3A 2XPZA 4W68A 5DJDB 3J07A 4AEHL 4Q6IB 4X6CA 1D9KD 2FWOA 2XXFA 4MXQC 4P5SA 4N0CC 5DK0B 2DQIH 2IANE 3QPQC 5DD5L 5ABDE 3GBML 2WNXA 4TPRL 1A02N 3EYQC 1KGXA 4P4RB 4RWYL 2YKLH 1HDMB 5CCKL 4FQQA 4QNPE 3GLDA 4YHOH 5BZZA 4XVOA 3J27A 1RIHH 1WE5A 1JJUA 1DLFH 1JPEA 1GS7A 3K2KA 4MMXA 1PFOA 3TESA 4LSQH 1PCSA 1ZDQA 4U1GB 5JDJA 2LU5A 1FL6A 5L2KD 1G6VK 2DWYA 2E8YA 2DI8A 3B7SA 4PGDB 3KPRE 3QDMB 1N6QH 5BS0B 1MFEL 1XEUA 1H9VA 2P45B 4ODWB 3PGFL 5DI8A 5C07E 3OHMB 2J57A 3JSSA 5LGJB 3KWXA 3BZ4A 1MJJA 1UM4L 2R2CA 1ZLUH 3QIBB 4WU7A 2WMPA 5I1JL 1AZVA 2LABA 4FF9A 2OBGA 4JRXD 4UU9B 3V0WL 3HPLB 1FAIH 1WISA 2WVVA 5IBUB 3RIAF 5CEZL 2CHZA 2Q76A 3EFOA 3FCTA 4JJ5A 4FYSA 2W0PA 4U6XA 4GG6F 2RH0A 1R5IB 2KBGA 1GGCH 1F4HA 3HZMA 3IFPB 4MLSA 4P57B 1S5IL 5D7IB 1GYWA 1U3HC 4F2MB 5CZRA 3QDJE 3MROA 2UWEB 1EZSA 4XCNA 4M43H 3ZHFA 3X12A 1FZMB 3IRCA 4AQAA 4A6YL 1UTDA 3RWGB 4K23H 2Y7QB 1X5LA 4P06A 5CEYB 7PAZA 4OLXH 4PJGB 4DTGL 4GBXA 1S9XB 1KUMA 1KTDA 2H47C 2JKJA 4NKOA 3MV8D 4X98B 3ZT7A 3VXMA 5IR1B 3THML 1MCFA 2YBGA 1ZTXH 4DVRL 4WEBL 2DYRB 2JKTM 2YMTA 5F7YC 2B39A 2C9XA 3MV9D 3WNKA 2V9QA 4ZW8A 3ARGB 2F18A 3HG1E 4O58H 2IBBA 3DECA 1A6WL 4HOWA 2HA1A 3GTTA 2I60H 5HDBF 3EW3B 4YAQB 1W72B 3ZSTA 3P0VL 5KSAA 1U30A 2HVKA 3L5WA 5B21A 1FFOA 1BFTA 2JLLA 1KYDA 2J88L 4FQJH 1QVOB 4MXVF 2VSDA 3ECBB 2WWMC 5DU7A 1UZ8A 4HG4K 4YXKL 4AT6A 1EO8L 4FNRA 4X6DA 3OKNB 5I8KL 1CXFA 1GMIA 1ILUA 3QUKB 1F97A 3ZZSA 2P26A 4OU3A 3U1SH 5E2TL 5FOBB 5EH1A 2OCCB 3B1UA 1XDTT 2L7JA 3BT2L 2KZKA 3EGSB 4MDJA 1A14L 1CFBA 1T2QH 3KNBA 2EECA 3TYFA 3D30A 3E9TA 3QW9A 1KBBA 5I15L 3WFEL 2HB0A 2HN7B 3ARBC 4RCAA 5AW9B 1Q0YH 3UZEC 1TTFA 4NJAL 3HPJA 1CMOA 2VDMH 5DJ2B 2DDQH 1SMDA 4P5MA 1QFWH 2H9GB 4XWOC 1DJIA 2CLVA 2OL3B 3NQIA 3C2SA 1SF3A 2J1XA 2X4UB 3ZDYB 3L5JA 4MNGE 1HHJA 5HDBE 4AGPA 5DUMH 2IOIA 4XWGH 4JJOA 4E0RB 2K8MA 5CCJA 3MLZL 4OV5A 1R0AH 1B4JL 1TZIB 2EDXA 4HFWB 2VXVL 1E65A 1OCWL 3Q8AA 4WI5A 1CBJA 2PO6B 3SPCA 4G1EA 2DYSB 3LDBB 4AH2B 3T2PA 2WGNB 3GTVA 2A77H 4QRFA 1FO0A 4XVSL 3BAKA 4I0CC 1P7QD 3MFFB 3DIFA 3VD0A 1UCBH 1P0SE 1E50A 1II4E 5I17B 5D2NC 5BOPA 1YEDB 5GGQH 4LFHG 2GYSA 4XP9L 5F6IB 3JQOB 4XP4H 3UO1L 5JQ6L 1FL5B 1GGBH 1N5AB 1QUNB 1QABA 2BDNH 2PCFB 2ZOUA 3MRNB 4XE0A 4Y19E 2ZJSL 5CZVH 3MGAA 4X4YA 3ZYJA 2EIZA 1KJ3L 2X3BA 2OJ1A 3MC0A 5AVSB 4NIYE 3WFEH 4PYHA 1CD8A 1Q0EA 2ATKB 3G5YB 2ENSA 2Z7ZA 4JFTA 4M48H 3ETBF 2HKHL 2DYPD 1FP5A 3L17A 1OD9A 5IZ7A 3GSUB 1NWPA 3V0IA 5I16A 4R90H 3QDHA 2A1WL 2ZWKA 1XF3B 3N5AA 2YN3A 1AY1L 3CFDA 1N8OE 2OKMA 4I9WE 1JWUB 2FWOB 1PY9A 3MLZH 1HE7A 2P48B 3G5VB 2J55A 5LQBL 1AP2A 3I3BA 5FWRA 3FQ4A 4IW4C 4PLKD 3Q8FA 4Y5XA 1ZLWH 3UYOD 3BFWA 5FA3B 3MLRL 1KIRB 3ZMEA 4WJG3 3UPRA 2EDQA 5T3ZH 5I0DA 3LEXB 4RWHA 3RGVD 2OXHB 4HKXA 3UBHA 1UB6A 4KI5D 4BZ2A 3UTPD 3UAJA 1UB5A 2YAFA 1UD4A 3BFQG 2CWRA 4I1NB 3DO4A 3W1ZA 2BS71 3MI6A 3OR6A 4NAQA 1USZA 2OFQA 4Y9FA 2ZONA 2Y3NA 1AC6A 5JUEH 2BH0A 1OM9A 2IAND 2M83A 1LEGB 4KKRA 4NNPH 4GOSA 5DHVH 3GSNH 1T7VA 4A2HA 1BJ8A 4TUUA 1QFWI 3SE8L 1MSPA 4KRNA 5F7KC 3O8XB 5I71B 3LZRA 3P9WB 3ZYZA 3ESUF 5ECJE 3CHXA 3UACA 2BHFA 5JR1L 4NZFA 2WY3B 4AQEB 1ZT7B 3QFDB 4Y16B 3VXSE 3HUJE 3LZFL 3LZQA 4ZAKA 1MRCL 2WLZA 4H8WC 4IQHA 5SX4H 2CCVA 4W9ZA 1HK6A 1FNSH 4BHUA 3EYUL 2VAAB 3Q05A 2HXAA 2Z35A 2ZCLH 3EJPA 4GT0A 4P5KA 4YXHH 1TKWA 1FVDB 1EXHA 4EUPG 3TTSA 2CPCA 5DSCA 3VXMB 3S3CB 4CN1A 2CUMA 5GRJH 2WK2A 3ARDC 4EI5D 4X9YA 4ZXBB 1A6UL 3TBVA 1FSKC 1HI6A 3PWUA 2X6MA 1HHGB 4EVNB 1WT5C 4Q52A 3IETA 1IKFL 3HAEB 5I30L 1IBGL 2VR4A 5I1LA 2ZCZA 3VFVB 1NCHA 3B5GA 3O11B 1FYTA 3VI4A 1BIIB 2Y9RT 1A1NA 1E3FA 4JKNA 3NEOA 5E03A 3QQXA 3B9KD 1FFOB 1V3JA 2C1PA 2VDQB 3BKCH 5D71H 3ECBA 2ESVE 1S7TA 5J9PB 4J2XA 5KSBB 2X05A 1TF4A 2PCPB 1JWMB 3G5XA 3GSNL 1W0VA 3KGRA 4N0FB 3U25A 4OIFA 5E2VL 4L05A 3RWIB 5ITBH 1PLBA 3QDAA 2ENQA 5IVZB 2AEPH 2OSLA 3VD4A 2NY5C 2BP0B 3B8SA 4CU8A 2NY6C 2W60A 1KEGL 3BSZA 4WW2A 2EYSA 2MCAA 2J1ZA 1UEYA 4X7CC 4UTCA 4YHKH 3IYLW 1FH2A 4PSRA 4APQB 4YSSA 5DO2C 3DO3A 4PFEA 4CMMA 4Z7WF 1OF0A 4D8PA 2QDVA 4PS3A 1NEZG 1A4KB 2ZCLL 5DJ2A 1VADA 2H9GA 5ERWB 2PPEA 4KOBA 3IF1A 3I50H 3X13B 3RWJA 4HPYL 1JHLH 4H0HB 5D7IE 5GRJL 3WD5H 1QUPA 2LV4A 1L0PA 2K4AA 2W81C 4MD0B 3AXIA 2YPLB 1L0QA 3HBZA 4E2OA 2KPNA 5J5EA 4WUUD 3BQUB 2VB5A 2Y1VA 1B2WH 1YEEH 2F19H 3BKJH 4FYQA 3WFZA 5G5DB 2NRDA 4G83A 1MCWW 2FLBT 1FC1A 1F3JA 1BJMA 4F37F 4YFDB 4YOKA 1C5BL 4UTBL 4XPGL 5JHDB 4JFWA 5HGGS 4RDBA 3R18A 4BV1A 4KHXH 4XMWA 1EZUA 1WCBB 3EHBD 3V0EA 3HAEG 2VMEA 5AWNH 1FIGL 4I48B 1HOEA 3ZDXF 4AUJA 1NMBH 5HPOA 3QRFM 1YMME 5AUMB 4P59L 1AKJA 4P2QD 1QD0A 5ESVB 4NQVB 4HWEL 1T0MB 2C7FA 2CO6B 4AM0Q 2YMXL 1YNKH 4LBAA 5E23A 2XWXA 3TN0C 2OK0H 2EIZB 1FV1B 1VIWA 4UT9A 3D34A 3SJVD 3WEOA 1SM3H 4PCSA 3G5YA 4DEPB 1G4RA 3VXSA 2F68X 2OAAA 3KLKA 1U8HB 4HIJA 4GKSA 5MEOA 5DWUH 1PF3A 1WD8A 2DQUL 4JEGB 1N4XL 3DO7A 3I50L 2XG5B 5GS2H 3FU9A 1KYOJ 4KNUA 1XF3A 4LVOB 4N6RA 3QORC 4ODVL 1H3TA 2LGNA 3T77A 1M7DB 4A2LA 5I8OL 2YQ3A 1FZOB 2OX5A 2IAMB 5DS2A 3RG1C 2B0SL 4E42A 5T3ZE 2TSBA 3LZNA 4Y19D 5E9DA 1AI1L 1TSRA 4WLCA 2AK4D 3LKQB 3ASWA 3ALXA 1ZY9A 3VI4E 4G3YH 4UB0L 1NBQA 1RIHL 1FIGH 1G7PA 1I7ZB 1ZS2A 1X6LA 4XI5D 2MQCA 4EZJA 3MV7D 2DQEH 3FCSA 3QULA 3K0WA 3BPCB 4ACTA 4Y2DB 3H3PH 1SMAA 2OMVA 2YRPA 4JANA 3VFTA 2OK0L 1YEFL 3OR6B 5TDOB 1ZV5A 1TQSA 1CN4A 2VLKA 1P7QB 1JXJA 1NCAL 3BIAX 4BFIB 4ZFGH 1MJUH 2M2DA 5CR1A 1EJOL 3A6BL 5FUOL 4WFHD 5BZWA 3ZKXB 2AV7A 3BKYH 3KHQA 2IDTA 5HHMD 4M1DH 4AEEA 5BVJB 4PRHE 5JW4N 1BIHA 4QRUB 5DWUL 5B39G 4NUGL 5A2AA 3MRFB 1NBCA 5LGHH 2QMJA 3KYAA 4KGJA 3DROA 4W9JC 1QNZL 1L3WA 2HFTA 3BMVA 4Y9EA 4E9QA 1ZA6A 1EV2E 2JJSC 2WQXA 1S3KL 3CSTA 5I8CA 5KVDE 1JPGB 1JDCA 4FXGA 3O8XC 3QPKA 4IRJD 1KGIA 4MTMA 1BMWA 1H5BA 1QRND 2A0LC 1OGAD 3NTCH 4YPGA 2BNRE 1JBJA 1HHKB 2APWA 4A6YH 1OF2B 2VL5A 1CBVL 5DD3H 1MFBH 4GB9A 1BMGA 3NA4A 3ULUH 5D70H 3DBSA 1RZKC 5H2BB 4JRWA 2P5WA 3QNXB 1BD2A 4NKIH 2FUQA 5D7EA 5GGSY 3VRLE 3IGAA 4LCCA 2MCPL 4RGND 5T1KD 5CNHA 2E8ZA 3RVUD 2FO1A 4P99A 4EPSA 4UAOB 2DD8H 4DKDC 1BAGA 2D7MA 4Y4KB 5B1KA 1FYTB 1IM3D 4MQ7A 2I9LB 1W0YT 2D31A 5GGVH 3GJFB 3ZDXB 4F57L 4FQCH 3UZVB 1KYAA 3KLDA 4UQBA 5J9PA 1ETZA 4M1DL 5HGAB 1JYVA 3B1TA 3O6LL 3AWFA 1NCTA 1NKRA 2VWEE 5KJ4A 3TA4D 1MLCB 1HH9A 1QNZH 1QEXA 2EYSB 3ZPDA 3U1SL 4OIIH 4ZYKA 1T3FB 3LN9A 2L4OA 2AJUH 5CAYB 4JVWA 1C7SA 1E9QB 4MNHB 2WJ7A 1SY6L 4LESA 2IANA 4U7MA 2IGTA 2AXFB 2NY3D 3JTSB 2YA0A 4OGYH 4K9EC 2VIRA 1Y0LA 5E6YA 3AB0B 4ABUA 4K3GA 5JIHA 1Q0YL 3WIFA 1D2PA 4NJ9H 2BERA 1EJFA 4Y1SA 4JFZL 1I3VA 2IDFA 3GXNA 1QFWL 4WU5A 1XAKA 1AACA 1V3LA 3FRUA 4Z3IA 2HSIA 2YEZB 2BNQB 2RD0A 2WVVB 4FLOA 5D7LE 1PTZA 5DURD 5FCSH 3QR0A 2WQSA 2Q76B 3EFOB 3SKUD 3DNKA 2R15A 3G04B 3HE6B 5JHBA 4Q2ZA 2CGYA 3QRGL 2NZ1A 3ESVF 1XVSA 2D73A 2QQQA 1WD9A 3O2DH 2Z31A 3QORA 4URKA 3M8OL 4Y4FD 2EDMA 4NENA 2Y24A 4IIZA 1SEQL 4HIXH 5HDWA 3VB8A 4F57H 1DQLL 3WDHA 5AB1A 3DMMC 3QH3B 2E6QA 2DQJH 2X3CA 3QUZC 5DC9B 2HPTA 2XETA 1G7QB 5JOPE 4E9YA 1JL8A 3AG4B 4Q9QH 2W5PA 3MBEB 3LEVL 4XNDA 1LO4L 3P4OA 4IIQC 2YUVA 1KTDB 3DSNA 3OJDA 4P2QB 2XVKA 1IC5H 1LEIA 4G43A 2V0AA 2FJFB 2YIHA 4GY4A 1ADQL 4J3BA 4KXZI 1CQYA 1A7NL 4HSAC 4U1JA 3PL6C 1S7SA 3H4HA 4PQXA 4M00A 4R4FL 1E30A 4FQXA 4S0SD 4KQ4H 4YLQT 3HBQA 1WEJL 4I5BB 3EFFA 4U31A 4PJIE 1TZOA 3VXQB 4Z5RB 1H8LA 4MJIA 3QZNA 1FJ1A 3LRKA 5FKPB 1F2QA 2JQZA 1NCBH 2VITA 4PJ7A 4KRMB 3LXCA 3RY6A 4J3WA 4YHML 1H3XA 4G11A 3SDCD 3CVIH 4HT1L 5FUCE 5FOBA 3S88L 3CCHA 5DC2A 5EG6C 1MEXH 3DV6A 2JCCB 4N8UA 3PWVB 4GAFB 2J7LA 2GJZA 4LPUA 4MYPA 1IM9B 4RISL 3S97C 1PKQB 4PJDB 2C7UA 1EEYB 5BV7B 2OSWA 3F7RA 4AQOA 3U9UA 1TSHA 1NC2A 2VXQH 5EO1A 3IGKA 2A9ML 5J1AB 5IVNA 4JGMA 1MELA 3LEVH 5GRUL 1CQKA 1SLWA 3S3DB 3AQYA 5T5FA 1K2DB 2BW4A 4K2UH 4J5VA 1FDLL 3FFOA 3QJSB 3MRIA 3QJHA 1CGYA 5IB2A 4QO1B 4M6OH 4MZRA 2R56L 4H88L 4LP8A 1H3PL 4X6FA 3B2MA 5JIMA 2PTVA 5LXGL 1Q9KB 2ZNWA 5FO8A 1TQBB 2NW2A 4ZTPL 4MB1A 4OV5B 3OXSB 3LIZL 1KGYE 4M4RB 1G5GA 2FB4L 1J9SA 5AW5B 5EF1A 1NGWB 5MP6H 4NP4H 4NNPL 2AITA 3RDJA 4FQ2H 3MYJA 4GG8A 2QLYA 2VRAA 3GRWL 4GSUA 5F3BB 3V4PB 1ITCA 4TULL 5K9OB 1EUTA 4JKPH 3VQ2C 1WBYB 2A83B 3BO8A 4QXUL 1DL7L 3PWLA 1UASA 3KPSD 1XGRB 4K8RH 1LXMA 1OM3H 1HCZA 1A5FL 3OSKA 4KMTH 3MO1A 5AOJA 3P3SA 5E4AA 3OQ3B 2COVD 1WAEA 1A9EB 1G6RL 2EKSB 3K0YA 2MQ3A 2RCSH 3RZCC 4B95C 1CYXA 1LMIA 4PJHB 3A4AA 1Y6NR 5KTEL 4KROB 4OKDA 2DQHH 4P9HC 1FH5L 2Q8BH 3WFHA 5T1JA 2YUZA 2XVBA 4YSOA 3R7RA 3B2UD 3BAYA 2BZDA 4YHNA 4AIZA 2CJSA 3N6YA 5IKCB 1QWNA 5EEUA 4EBQL 1AQDB 1IBGH 3WXWL 3TGXA 3GJFA 1UGNA 1CS6A 1C5CH 3NIDE 3OAZK 3ARYA 2WW8A 4MJ6A 4X4XB 1LK3H 4LHQB 4MJ5B 3MVSA 5C3LD 1LWHA 2PW2A 3A22A 1AP2B 1FLTX 4LLYA 1CLYL 2R2EB 3DRQA 4NZ8A 5IGXH 3VWJB 2K45A 3HC4L 1NCUA 1SRDA 1AGBA 2PWHA 5A2CA 1Z32X 4X0KB 4X5WA 4UQ3B 3T0WA 3T65A 3EOTL 1ORQA 1RU9L 3CZSA 4S0HA 1JCKA 2Y25A 1WGOA 2BXYA 3DXAB 1K4DB 3D0AA 4QXUH 2R1WA 4DKFH 1S7UB 1L9QA 2HFGH 5TFSH 1HIMH 4MFHA 1ZVNA 2YHGA 1HYSC 2AXFA 4FYRA 3HNVH 3X11A 3GDCA 1M71B 1YUKB 4PB9H 1OP5H 3VGFA 1NGZA 4N2BA 5SWQB 3A5VA 3WJLA 3DMMA 2QVFB 5HPMA 2IGLA 2Z4QA 4IMLB 4YDKH 5J3HC 1LE9A 4N2MA 4PJXF 1OAXL 3WTUA 5D6DC 3ZHLA 5I0VA 2IAAC 4Y89A 1KC5L 2UYLB 4YDZA 3P30L 1DVFC 1BQ5A 3GHPA 5DLLA 4QHLA 4FQIL 5TDPB 4D7BA 5I1KL 5DWPA 3MACL 3K6OA 2EDTA 3V7AG 2NZ9C 4YE0A 4B9KC 3FN0L 1FG2A 2YUWA 4Y4HB 1LD9B 3BQUD 4A7GF 4FLHA 2CIIA 3QUYC 2JVUA 3QDJA 4XPGH 1ND0A 4HWBL 2Z3FA 3U4AA 4OQ1A 4HMCA 3RPBA 2E75C 2Z35B 4FQ1H 4WFGD 4K94H 4YHPA 5EUOF 4UNIA 3RHWF 1UOWA 2X40A 3DHJA 3QEQB 2JV6A 3U4BL 3GSWB 5A16B 3QNYA 5E8EA 1GGYA 3KD4A 4D9RE 1P4UA 3MJ8A 2ICWA 5F7FA 1LP9B 1H3VA 3RB5A 5LBVA 5CSGA 1Q8MA 2YPVL 5E99H 3TBWA 4PJAF 5FYLL 2X5PA 1SFDA 4L4TE 3VFNB 4PJEE 3VMPA 2B9AA 3EFFB 4QHNB 3HKFA 4O2FB 3VXQA 3ZDWA 2GW5A 5BUPA 5FYKH 2VDOL 1HQ4B 1RPKA 2NY3C 3IVKA 4BZ2H 2FD6H 3BSHA 2VITB 4PJ7B 1M1SA 5AW6B 3FQYA 4BQ8A 3ARZA 4FQPA 4IRSA 4BK4A 3ABLB 3SDCB 4LHUD 3GBLA 3ZKQD 1A9BB 2PW1A 5E8PA 4J3OH 3KPNB 3H0TB 3OJVC 4A7SA 3PJNA 1MI5E 2QTEA 2BSSA 2GJZB 1XF4A 4RMRA 1MUJB 4KTEL 1N8ZA 2VLLB 4Z3TA 1QLEH 4X7EC 2BVUA 1EHLL 3WY1A 4PGBB 1IEBA 2H2SD 2W9EH 1ZXKA 4J4PA 1W0WB 5C9KA 1QEWB 4HD9A 1I85C 5AAWA 2MPVA 4Y5YC 2J20A 4HLJA 1WJ3A 1D9KB 3WCYA 3JWOL 2EYTA 3GIVA 3E2HB 3X2QB 3N40P 4ZODA 2FQFA 4XHQA 1YQ2A 1XEDA 5LBSH 1SUHA 5C1MB 1K6QL 4P5TB 3WNMA 5KUKA 3P4NB 1XT5A 3NABH 4BFRA 4ZFGL 4PGCB 4QGYA 2HMID 1NGWA 1SMOA 4MB5A 4G6ML 4WW2F 3IN0A 4EN3B 3SYOA 1M57B 2F53A 3QNZB 4TLSA 3BKYL 3GSOB 4KK6C 3WS6A 2VDOH 5AOMA 4YSEA 2DLGA 2BSRA 1NGXB 5JIPA 1T89A 3SKOA 3KPRD 2Z93B 4M61A 2Q7YA 4L37A 3GJFH 4ZUWA 4CL7A 1FNLA 3DV4B 4GW4B 3F3HA 3FJTA 3AAZA 3F7PC 1ZS8A 3MO1B 3GC3A 3VFOB 1Z9PA 4M1CC 3FRPG 1A9EA 4N0RA 3IDMA 5CJBA 2OMWB 4C4KO 4GXVL 1HKLH 3SE3C 4KY1H 2OI9B 1J86A 1FV1A 1PZBA 4NOFA 4QD2E 1MCKA 1NGPH 2VL4A 3HBGA 1I9JH 4MD5B 2GFBB 3SDXB 2NCMA 4AIZB 4OTXH 1PZSA 5CHNA 4IKKA 5EU4B 3L1EA 3D25B 1P9MA 1KCSL 4UZSA 1QR1A 4UQ9A 4BQ6A 4DGIL 4DGVH 5D2LE 3T3MF 4L5FH 4D2NA 1UACL 2IH3B 5C0ND 2DQTL 1MCOH 2H6PA 4OFYD 4JLRA 2R2EA 5CCGE 2HJLB 3ULSA 3VI3A 2WKGA 2QSVA 4JN2A 3NRPA 5JYLA 1IBFA 2OULB 1NANI 4W6WB 2A6KB 3Q48A 3VD9A 3ECQA 3LKQA 4H1LH 3T5WA 4BGLA 1A3QA 5T3XL 3VSQA 1G6RB 5IHBA 2AJUL 2ZPKL 4K5OA 2BVOB 2ZUWA 2EVIA 3CLFH 1I9EA 3QULB 1UXMA 3F84A 2FECL 3ZDZE 4XPBL 5GRVL 3K6IA 3SDDB 4I1RA 1M6OA 5D1XB 3BWUF 1Q1JH 3IXTA 4IGBA 4QMEA 1G0XA 5HGHA 2NYYD 5I0WA 1Y6KR 2GG1A 1YN7A 1JZGA 5D6CB 2ADIB 3BIKB 4AEIH 1D5MB 4ODXA 4U1SA 1Q9LA 1XCQB 3T04D 2NSMA 3MRFA 4Z7IA 1DANU 3T3ME 5KWYC 4OVUA 1NUNB 3DDGA 4FHJA 2YD7A 3AQZA 3WJLC 3L95A 4YHIB 2FGWH 2JH2A 1WTLA 3TU6A 1RUKL 1F1GA 4S1DC 1MFCL 5D9SA 1BJ1J 2C3WA 4ZFOL 4AC2A 4HC1H 3MGTA 4NP9A 3SPIA 5IB3B 5DS8A 2ZUXA 2XZQH 3MNDA 5L8LB 2QHRH 2K3TA 3C08H 4ODWA 1QSED 1PCXA 2GTWA 3UJIH 1GYVA 1LO5B 3AS2A 2HWZH 5FYJE 2V5RA 3QEQA 5I74C 3C8DA 5H2BA 4FZEH 4WU7B 1QKZL 5FO7A 3S37H 2WBJD 3US0A 1IGMH 3FMGL 4XPTL 1ZLVH 4E5XG 5A6MA 1F5WA 2XICA 1SXCA 2H2PD 3FB8B 3G5ZB 3QEQE 2GKIA 3D3VD 4GO8A 3VWKD 2MPAH 4PS4H 3FCTB 1ADQH 1GW0A 3AS3A 1OE2A 1E6OL 1E8WA 5IQMA 4ANVA 4KZDH 4GI9A 1T4KA 1CC3A 1Q1JL 3M07A 3BPNB 1U8JB 2EE3A 3MLPA 5G4NA 4G8AC 3VCLA 4Q4IA 4ODSL 3X12B 1NFDB 4ENZA 5ADOL 4U2YA 1E9OA 1DYZA 2UUDH 2IDCA 4JPIB 3DYOA 1TETH 3M1OA 4QT5A 1E0OB 1OAQL 4Z7VE 3RUGF 1MG3C 1KCVH 2VDKL 1U91A 3ZE0E 3H0TA 4E5XA 2Y1AA 3CD4A 3E2HC 5BVPH 1OTTD 3ZX1A 3ZL1A 3MJGX 1OSPL 1A3ZA 4PH8A 3IE9A 4FMFA 4WSKA 5IMOB 2DJMA 4QR7A 1W80A 1KN2L 3FHQA 3M88A 3VNZA 4XMKL 1IM9D 1EZLA 3FB5B 2NMSA 3ME0B 1UEMA 3HEIB 1PD1A 3MMEA 4JO5A 3WIFB 4ZUVB 4DUWA 4OD2A 3ARBA 4BGDA 3FRUB 3TV3L 3QO0B 2PR4L 2HP4A 3CU1A 5I6XB 1FDLH 1QVOA 3KYNA 3VA6A 1BEYL 1KXVA 1S9YA 5HXMA 2QTVA 5KVFL 3MLWL 1U95A 3N1FC 4PGEA 5CIPB 3TO2A 3PWPA 4LAQH 1XH0A 3G04A 1SGKA 2JI1A 2MPAL 3L8QA 3NFSH 4H88H 4H2AA 4PS4L 4R9HA 3QUKA 5EPMA 5LXGH 4PBXA 1AQ8A 3UAFA 1OZTG 1U8KB 1AGDA 2VDKB 1NAMA 1MI5D 4YSDA 1F0LA 1AIFA 1CFTB 3DVNB 3UXFA 1X5HA 2ZXDA 2XWTB 1TTRA 2NYKA 3FULA 4JFEA 4EOWL 1AZNA 3QH3A 4FGMA 4JPWH 3RUGE 3AADB 4L3ED 5ADOH 2NY5L 2NY4B 3IJSA 5LDSA 4Z7WB 3MLXH 4L37B 2Q7YB 2DJ4A 3ZE0F 4WQOA 2YARA 4W4OA 3DJSA 5CJQH 2NDFA 3SDDD 2G3ZA 1ZHNB 1Q72L 4AGQA 5C7XH 1P5UA 1ZANH 1S78C 5J1TC 2HVJA 5IB5A 4WI4A 2CXGA 4WW1A 2QVTA 4KV5E 1OM3L 4AL8C 2OL3A 3NT0A 4MQSB 1OK8A 5JHDE 5EBMA 1WHOA 1D7BA 3UP1A 4XBPB 3LKRA 2H32B 1E5UI 4PJ7E 4TUKL 4WFFD 2C8NA 4Q7DA 5FECB 4YL9A 4PUBL 1CD0A 2FT8A 4HPHA 4AYBA 3LH9A 3QUYB 5J06A 2FLRT 4HFWA 1JPFB 4K7PH 4WWID 4QXVA 3ULVL 3VXSD 5LAPA 1WIPA 5HVGB 5IWLC 5JPNA 3RJDA 1JS4A 4MAZA 1IC7H 3HG1B 1AE6L 4BJLA 2XTJC 3E9UA 4XMUA 2AXGA 5LXVA 1WAAE 1Z1WA 2A38A 4IGBC 2CAKA 3N04A 1NCWL 3ABKB 4HBCH 1C8PA 1OCOB 2OMXA 3V7AE 1MHPH 2PCFA 2WOBA 4QOKA 2N4IA 3KWUA 5J1AA 3EOTH 2WXJA 5AVTB 4AXWB 1NIAA 4F93B 2I07B 2WKOF 4XZ4A 4DIXA 5EZLA 2GI7A 1T22B 2BWDA 2NY2B 5KEZA 1BFVL 2Y06H 4IJTA 2HFGL 2JKXA 2QKIA 2EUWA 3MRIB 2XQ0A 3QJHB 4FTVA 5IB2B 2Z31C 1XGUB 3KZ8A 5CBAA 2HKAA 3IXTB 2KYIA 1A7QH 5KUMA 1KNOB 3CDZA 4MMXC 3EXLA 4D3CH 1AHWA 1WHPA 1DJZA 1UH4A 2EDFA 1IQDB 3GIZH 5FPIA 5D6CA 1NMAL 2EEFA 1KIUA 4HU2A 5FR3A 1KT2B 4XC3L 2KHAA 35C8L 2J8OA 4XPAL 3W9DA 4YIQB 4B9PA 7FABH 1HWHB 3GPEA 3HR5A 1X5FA 3L95B 1G7JB 4FHBD 4FNQA 4GLRI 1PD6A 4MA7H 3EJZC 4YHIA 2YAOA 4BWWA 2BNUB 2A83A 2N01B 3FN0H 1KTLA 2F5AL 3UPRB 4KAQH 1GMEA 3FO9B 2YAPA 1DVXA 4RFNC 3W56A 4Q58C 3C5ZB 2ZTBA 3ZGHA 1RVFL 4IKNA 4E68A 4I7ZC 4X7FC 4POYA 2CBOA 2X2JA 2FX9H 3RY4A 1BVOA 5D2LF 2FZ3B 4LEXH 3SE6A 3W2DL 3D8MA 3N44F 4HOZA 4PJHA 3MRQB 2H45A 1A4AA 3CH1B 5FW8A 2XNAB 3HG0A 3B3BA 3CBRA 3JBG7 3PGCB 1HYRC 3U4BH 1R5WA 3TF7C 1F6LL 2AABL 2EIDA 1A6TB 3FHEA 4Z0XA 5J1SC 4X5RA 1WZLA 2WZ5A 2XIIA 1LWRA 4NRZA 3TJEH 4IHOA 1HILA 1ZVSA 4JG1H 3B8YA 4D3CL 2C3VA 1ZT7A 5C97A 4WO4A 2HG0A 4H8WH 5I19H 4JO2L 2BO0A 1NMAH 2VN3A 4ZAKB 4LHJB 2WLJA 1FZKB 4J8QA 4ENED 1TCMA 4MX7A 5ESAB 3WS3A 1PZ5B 4BZ2L 4N2KA 4JPIA 3OPZL 3VWJA 4CVZB 1CFSB 4HCIA 1V10A 4I88A 2VOTA 4OBSA 1L7IH 4H8PA 4PWKA 4UQ3A 5F0PB 3VXUB 3CZFA 3L3IA 1TKWB 4DNLA 4Y5YA 2X0VA 1JNNL 3UL4A 3FFDA 4APQC 1K4DA 3RVXC 4R2GC 4IOSA 4Q14A 3KH3A 3C60D 2R1WB 3V79C 4D9QE 2BHUA 3QO1B 3QEQD 3OLIA 2Y7LA 2HTLC 3D39A 4OFPA 5EHFA 1RLWA 2V3EA 3KPOA 1JAEA 4P49A 4X8XA 4AGOA 3CZUB 5HPMB 1LHZA 1OD7A 4LNRB 3ARBB 5GGRY 4JDVB 1J1OH 1G7MB 4NO3B 2XI9A 4OF7A 4X6DF 2AKRA 2IAMD 3CFQA 4BXVA 1F6AB 2VSKB 2UYLA 2N7SA 3TYGH 4UTAA 1IMHC 2UZYB 4PGEB 2BIOA 1W15A 2PCPA 1BEXA 2WXNA 4DW2H 2AERT 1L6PA 2VH5H 1HSAA 3I6GB 5IVZA 1MCLA 4H7VA 5GS1C 4ATTA 4U6YB 1JF1A 1MPAH 4DQOH 2XWTA 4FTVE 3SGDH 1UOVA 4DGYL 4P46A 2JB5H 2VC2L 3NZUA 5E4OA 4QHUA 3O3UN 3ZQXA 1MY7A 4RAVB 2J73A 3GZKA 3S5LB 1VCBC 4TUJA 1C1EL 2OTWA 4HX1A 3A23A 5EORL 1HINL 2NY0C 4WNSA 4YK4B 1CICC 4EQ3A 1IGIH 6FABH 2Z9TA 3OF6A 1BAFH 4M62H 2PP7A 5EBMB 4Z1PA 2HYMA 2EXWC 4GXVH 1ERNA 4HHAA 1TG8A 5DD0L 4OM1L 4MA8L 3BYTA 3NIGF 4W4OC 3N1MC 3S36H 2Q86A 2WP3T 2R0KH 4M56A 3SCMD 3CHOA 4RRPA 2LE9A 2WSDA 5DJYA 1J8HD 1XCWA 1ZVHA 3GLEA 1LM8V 4QTFA 4DZBA 4F8PA 3ELQA 3NPSC 4BZ1A 5JHLL 3V0JA 4EI0A 3BKML 3H1ZA 1A64A 5SWSE 2TRHA 4I18C 2BNRD 2NXYD 4P2OC 1J5CA 1UKTA 4IRSB 3FCUB 1AG6A 5HSFA 1KCSH 2ZCKH 5GS0H 1WUZA 4JZOB 1NGYA 1A9BA 2PW1B 3O2VL 4XVJH 5T1KA 3CLEL 4G80A 1S7WA 1TJIH 4FL4C 4N2LA 1TFHA 3PV7A 4JN1L 2OMXB 4U1MB 4U49A 4NQVA 3K71B 4BH7B 2KZBA 3HHRB 4Y8DC 2Y7NA 4OJDH 1F4YL 1WAAA 5KYUB 2Z4TA 2IPUK 5L8JB 4OQTL 1IBYA 1FVEA 2EDEA 3ILDA 4KUZL 3QYCA 4NNXA 3ZE2B 1W8NA 4AM0B 1GGTA 4D9LH 2BWQA 4HIJB 4PSPA 2QKIB 1FO0H 3OX8A 3WLBB 3BVXA 2JLPA 3CLFL 4WKZA 4XPBH 5JO5B 4M7LL 4NQDE 2UVFA 1IARB 1R6VA 2XJKA 4WV1A 4EIGB 3QT2A 3APFA 3PV6B 1PS3A 2Y23A 4F7PB 4PWIA 2FBRA 2B7DT 1WH0A 4AVIA 4AV4A 4NQCD 3ZDYE 5E7FA 5HYQB 2GSGA 1OT4A 5AAWC 5B38G 1PZCA 1OPGL 4K94C 3MOBL 3VB9A 3EH5B 5E9DB 2ZX8A 4EDXA 1INDH 4P05A 2CJ3A 3QFJA 3MRDA 3GXTA 4ZSOA 1JG9A 2FGWL 3DJZA 2COQA 4XMVA 5C0CE 1OT1A 4XVJL 4FCAA 1JK9B 1U8NB 4M93B 3ASNB 4Z9KB 1RMFH 5DC0A 3WIAA 2VUYA 3N41F 4JZNA 5IMLB 4BFFA 1F56A 3FH8A 3U2SA 5H35A 3PFUA 3OV6A 2O6FA 4WWKD 4CSPA 4KRPC 2W0FA 2Z92B 1I8MB 1SHWA 1Z0NA 2FWUA 2G60L 3TBSB 5TE6L 1IGML 3FMGH 4XPTH 2W0LA 1JERA 3FU8A 3HN5A 2QADC 5D7KE 4AW4A 3P9LA 3MZGB 2CRIA 1IEAA 4JKMA 1SHSA 1ID5I 5KSUB 2FATL 5C0EB 2VGLM 4L0PB 2B1HL 5EUKB 3L13A 3P54A 4WO4B 3MA7B 1ZLSL 2P49B 1H5BB 1QBML 2C9UA 4YPGB 3QJFB 5G2NA 4FP8L 1BVZA 5A2KH 3IMRA 3IJEB 4N8VB 1CFMA 3O9WD 3CZKA 5E94B 4Z7OE 3ARRA 5CIPH 4X9BA 5C0JA 2DICA 4ELMF 2WZPD 3PAVA 4JUSA 1DQKA 4ZOAA 3S36X 1X5GA 4FI6A 5INDB 4GQQA 4UM9D 4YDMA 2AVGA 3QO1A 1WWCA 3VQ1C 3WO4C 4L8SA 1TZHA 4WTZG 3PWPE 2CK0L 1S7RA 4FXLA 1AXTL 5IT2L 3SDDA 4KTGA 2Q87A 4DPBX 4LNRA 1JTPA 4RGOL 4IGBB 4M8UA 4W9IC 5HHVL 4PY7A 2HFEA 2YJLA 4DEWA 2DQDL 2RALA 2GHWB 4H1LG 5AW7B 4Z76A 3SQRA 3GMOA 2ADIA 2UZYA 3BDBA 1VF5C 1TYJA 3RVUC 1KXVC 1ZA3A 3JYCA 4KJYB 5EIIA 2VQUA 2EEDA 3IMTA 3UO8B 2Z1KA 1OSEA 3ECUA 1Z5HA 4CU7A 3ILQD 1OLZA 2QGBA 1MLCA 1U33A 3UG4A 1PQZA 4AIOA 3R4DA 5J11B 5AW1B 4PMFA 5FYJU 2W0KA 3KW7A 1QBMH 1E9QA 4MNHA 4X7TA 3O3EA 3LQMA 1MVFA 3DOSA 4JY6B 5ISZA 1BAWA 4IBZA 3JTSA 3QIBC 4OD3H 3M1BB 4N0UA 4ZUTB 5C0FA 1KLFA 4M5SA 3CXHK 5HYJB 2NY4D 1KV7A 4MMZA 1VDGA 4JREC 3CG8A 4KTYA 4D0CA 4PV8B 4NWTL 3JXAA 4R7NA 4FNPA 4UQIM 4ZX5A 1ZLEA 2BNQA 2YEZA 3H9SA 4DN3L 5F8RC 1G1KA 1R5VA 1DQTA 4WWPA 4R7DB 1JN6B 1GC1L 4XOBA 2Q86B 5FCUL 2V8MA 5DD6A 1S9VB 1MNUL 2UZXB 3ARTA 4M5ZL 3HNSH 2WIMA 4U3SB 1G0DA 5DRXA 4U1HB 5BQ7B 2CUAA 3FUDA 4FTVD 5DJAA 1SEBB 4JQXA 1XBRA 1H3UA 4YLBA 2IFFH 3N42B 3FC8A 2IMMA 4JDZA 5I18L 5E8OB 3SPVB 4J6RH 1G7QA 1T1YA 1V7NL 1UM5L 4CSTA 4QT5B 3CN1A 4KK9D 5ILTL 2M8XA 2GY5A 1M7XA 2X41A 1I8AA 2E9IA 2WBKA 3GGWA 1JNLH 2NZIA 2BRRL 4KX8A 4KK8C 1EQWA 3IFNL 2XN9A 4UIKL 5PAZA 1OW0A 3EDFA 1A7PH 5KYUA 2AANA 2FO4A 4MRCA 1DSFL 4YFEA 1BBDH 4DTGH 1LO0H 2HRPH 4ZX6A 1U3YA 2BS9A 3WOVA 4E9RA 4LCUB 2DH3A 4G42A 43CAA 3VO0A 1YY9D 3HMWH 4WDIB 4X8JB 5CD3A 4ZMYA 1SHMA 1ZSDA 4AJVA 4EO5A 3T6WA 3KCWA 2GK2A 4UV4L 1CDUA 1UHVA 5B1BB 1Z5LA 3O0LA 1D5IL 4ERSL 5DVMA 3FONA 1CGSH 1AJ7H 5I9QB 3V7MA 4HUMB 2Y2WA 1OHZA 1XFPA 4OY9A 4FG6D 2PXYC 4L5FE 5LO7A 4H20L 2J12B 4JVPA 3X3GH 2WLLA 3CSYA 4HEMA 5KOMC 1EO8H 1QOKA 1K5WA 2EZ0C 4HS8L 3WUWG 3R0NA 2VXUL 5DO8A 5GRVK 2PETA 4MGXA 4Z7WA 1OW0C 2XLLA 3SD5A 3FHAA 5EO1B 3WNLA 1UM5H 1ORSA 43C9A 4B9IA 4DGWC 5IESL 2ZWLT 5ICZB 4ZMLA 4BFBD 2CBPA 1N0XH 2YZ8A 3W81A 1RSYA 2XX0A 4YFLF 3U6RA 4M7ZB 2HG5B 3MX0A 1GAFH 3VFMA 3WUWA 1SVCP 1OB1B 5EZPA 4EN3D 1QBBA 1BZ7A 1H5BC 4JKKA 4XPFH 5B3JF 2EH7H 3ML8A 2YRLA 3DX6A 3U2JA 4ABWA 4KROD 4U3HA 2AGJL 3N9GH 3MODL 1G0YR 4P07A 2XQYA 5CGBA 1P4LA 4QTHB 5JPNB 2J44A 1N2RB 4QRSB 3V4PA 3FTYA 4KROC 2CNYA 2ZSWA 5I19L 4GRLB 1Z3GL 1YEKH 1TTGA 4N8VA 4IKJA 5ACMA 2VLJE 4H20H 3T2QA 3K72A 4GP4B 2YOCA 4XNMB 2H3XC 1CDIA 2BM3A 2EKSA 4JY5H 4M8QB 2X4OB 3U0PA 1XB3A 1QX1A 4QRPB 1V7ML 3UCRA 1MWAH 2D7TL 4XVUC 5DVLA 4YSTA 4XOAA 2QV2A 4OIAA 1M6UA 5IESH 4HJ1A 4XN2A 2W07A 4JY4A 2ZUVA 3BAEH 4L4TD 5DYOB 3DHMA 4GKNA 2IEPA 4JFQA 4FTVB 5DRZB 5CZVL 2NY1C 3V2AR 3EGDB 3LRGA 3Q8CA 3UADA 1RIUH 1S2EA 2F1AA 3P2BA 2ITCB 1MW2A 2HFEB 3B9KC 1FCCA 1AQDA 1DVUA 2V2WB 2Y69B 4TM9A 3EO1B 4QRRB 5PCYA 4NZRL 2D7PA 3F7LA 4W1TA 1AGEB 2V2XA 4NZTH 3UEQA 2EDWA 4H25B 2OMTA 1IGYB 3RNKB 3TFKC 5HJ3B 1CPUA 5F71A 2VZOA 1AZUA 4LLYB 4KJPC 2X4RA 2GJ6E 2Y07L 3I84A 3N9GL 4LO9A 5FM5O 1SJEB 4OB5L 3VXNB 3SDDC 4A7UA 3T2OA 3NFNA 4GW1B 4YSQA 3OR7A 1I7TB 1Y1UA 2BSED 1ORQB 3ULVD 4MJHA 1U9KA 3BUIA 2L7EA 5BPPA 2HTKD 4RNRB 5CEZD 2P47B 2IH1A 5ISZB 4YVUA 4EI5A 1JZEA 3WEBA 4BHUI 3VFUB 1KPRA 1NGZB 3LRLA 1GPOH 2B9BA 4KKPA 5HYJA 3SIKA 4J23A 4KKBD 2QQLH 3T08A 1HINH 4RMVA 3T8MA 1G87A 4PJ9A 3VJ6B 2QR0A 4C8XA 4PJXA 3KS0H 4LL9A 4I18B 1JN6A 3CMOH 4I2XA 1NCIA 3S48A 2DZEA 4ONOA 5DGRA 3X3FH 5I1HL 5EMYA 1GHFL 1KBKA 4ECNA 4F2MA 1MAML 2ZX5A 4L8BB 4NXSA 4F5CA 1RURH 5KVEE 4QLWA 5DZLA 1CYWA 1KWKA 3TBYA 5FDWA 3WKQA 1J05A 1DEEB 2DW5A 1CDGA 5IK3B 4DFIA 1XD1A 1QFUH 5F7NC 4N2FA 5EZIH 4RH4A 3DA0A 3PHQA 1IFHH 2X4QB 1U8OB 3QQDA 2LR4A 3RVTD 4ODTL 3ZDXE 3DBXA 4JM4H 4NKOB 4WI0B 5EDXA 1LP9E 4X98A 5CLTA 2H8PB 5J8OA 2DBJA 4HGWA 2F8IA 2A4CA 4U2ZA 3KMDA 5CSZA 3EBHA 3N40F 1P1ZB 2EACA 2K6WA 2X1PA 2X10A 5E95B 3QFJD 3MCKA 1JOIA 2ADGB 4YXHL 2MOQA 4LCUA 4YHLL 4GAYA 4BQ9A 1KCKA 1WS7A 4GRWH 3OSVA 4JDVA 4NO3A 5D7JB 2HVKB 3L5WB 3PP4L 1ZLWK 3F6JA 1QATA 1CL7H 5GSRA 3BN9D 3ABZA 4WDIA 2VRQA 4F9LC 1FO0L 1ZIBA 4F9PA 4J3XA 4URTB 1ED3B 1DQJA 2WIIA 1QBAA 1JXKA 4MMYB 3FONB 2FNBA 2EC9T 3VRJA 4JFFE 4K9EL 2BVEA 4D0DB 1JPTH 1WDAA 3LIUA 1JD7A 1GHFH 5DJ0A 3JYBA 4MDJB 2C9QA 2AI0H 4QLRA 2OW7A 2ERJC 2XZAH 3AJ7A 4MJ2A 4PBDA 1WFJA 4JFPB 1QBLH 2IPUG 1CXEA 1KCRL 2VM9A 5L9DL 2F8VA 5I75B 1T20A 4EI6A 1W6WA 1XIWC 4NT6B 4HZLB 1AOHA 4NN7B 3VI4F 3ZL4H 4ONGH 4HJTA 1L5GA 5DFVC 3PQYE 1P84J 3NZHH 3ZW3A 2AEWA 1X3DA 5EOCH 5C0DB 2CLVB 3LRHA 2QSCH 4WY7H 2DN7A 4YHKL 4EDWH 3VACA 1H0DB 1MH5B 1U4EA 2VDLH 2FDBP 3RGVB 4OI7A 2FX7H 1V3MA 4OCMC 3IJ8A 3Q3GA 5C86A 3NCXA 3ATDA 3EKCA 3FU3A 4TVUA 3EF7A 1TT6A 4NGHH 1TZIA 2NX5B 4JFSA 3GF8A 1L6XA 1IV8A 5TQ2H 4Y1AE 3BP6B 2Z34A 1RUML 2XA8H 3D87B 3KGTA 4LL4A 3RNQA 3WJJA 4UDTB 5BMFH 1DJYA 1T66D 1N2RA 4MYWB 1FWXA 3RVWD 1N59A 1ZGLB 1YECH 3SO3B 5TK2A 1PZAA 4TLKA 1MWAA 3VGHA 1WICA 5C09B 1HXYB 1J88A 2AQQA 4F7TB 5IB4A 1QSEE 4O51B 1VAHA 2ZYIA 4OF5A 3VFSA 4H8QA 4AKQA 1AKJD 4MCZA 1NIEA 4OGAC 2ZWSA 4MSWB 2W8CA 3IDMB 2FVNA 1BG1A 4UZUA 1KWGA 3LIZA 2J25A 4DEPC 3IFLL 3QUZB 1E5BA 1DLFL 2EABA 5C0AB 4RMSA 1CR9L 5H4ZA 1NSNL 1U0QA 3CH8A 2JI3A 4EZMA 5AG9A 3U48A 3VGGA 4XGZB 3HS9A 2O5XH 3QQ9D 4GW5B 4YC2B 5T33H 2DEYX 4QHMA 2DQMA 4IOIB 3OX8B 2GBTA 4L9LC 5FO9B 3IAGC 5CHNB 3PXHA 2BP5M 3LH2H 1A0QH 2IFGA 1AXTH 2V2WA 5EUOB 4AG4L 2VDNL 2L8AA 2E7LA 2MOGA 4LAJH 3Q1SL 5FUZL 1HL5A 4U4IA 4F7PA 3HMXH 3GHBH 1N5YL 5CEZH 3K2MC 5HYQA 3IXAB 5TQ2L 1RZJH 2GSGB 1D5RA 4OLZL 1BX2B 3IAQA 3FT3A 2KT6A 4TTDC 3KJ4B 2J8UB 1XCTB 2P28B 3QI9A 1U2YA 3MRKB 4HKZA 1G84A 3CE1A 3A6CH 1WFOA 1UT9A 1TCRB 4YGVB 4Z0BH 4Y7MA 3VGEA 4L1BA 1BVLB 4Y8AA 4AVKA 3KW8A 5JLZA 3HHMA 4JL1A 3S96B 3H7BA 3S4SB 2XFXB 2GT9A 3QQ9C 3DPBB 1EPFA 4LKXB 4TSAH 2W0FB 1MXGA 3THMH 2YFNA 1FNEA 2ARJQ 4WEBH 3TBSA 1HT6A 4ZPTB 1KB5A 1XTMA 4K5PA 1LILA 5E00A 1NEPA 2F2HA 1ZIAA 3APNA 3L3DB 3KYKL 3V5HB 1GZHA 4B50A 5EU6B 3NJLA 3Q2NA 2I60L 1OE3A 3LVTA 4DPRA 2IALA 5KSUA 5EDSA 4TQEL 4HJEA 2ZUQC 5C0EA 4PWJA 2C34A 3JV6A 4DKEH 1LO2L 2WKLA 5FDWB 4J1UB 4Y16A 3DUUB 5FGSA 3QWRA 3TBYB 1E43A 5D9SB 1IC4H 1QWHA 2EILB 3GMNA 3DGGB 3KBPA 5LGHL 1HHHA 2C9SA 1S7QB 3D1MC 3TO4B 4Y4FA 4WVRA 1AZZC 3BP4B 4XMTA 1EAOA 5E2TH 1ZPUA 4DP2X 5JHDD 4MAYD 3UTSB 2AJSH 3DIDA 1RHFA 4QAWA 2UWEE 1SOKA 2YRZA 2WCGA 3KLLA 5EF2A 4DK5A 4OKVA 5IHLB 1T6VN 1QO3A 2JIXA 3EYQD 1RP9A 1KJ2H 2XIDA 4FYTA 3MCKB 1CBVH 1A7PL 4RGNC 2DQCL 5D70L 1NPJA 3VI4B 4Z8FL 1T4KB 1VFBB 1F4AA 4AEFA 4Z76B 1A8JH 4JGUA 1ED3A 5BCAA 4G8IA 3IDIA 5K9JL 4UBDC 4LEEA 4G9FD 2UX6A 1CF8L 4FJZA 4NO5B 3BZEB 3L4CA 1KYOK 1OTSC 3KYKH 3P73A 4YZWA 3WLWC 2ARJB 4BKLA 4Y5VC 2WXGA 1AJ7L 3CZGA 3W82A 4NKQB 1PQZB 1GS6X 5IB1A 4A2GA 1I8IB 2AZAA 4XRCB 1KZQA 2JQMA 3AACA 3ZE2E 1OK0A 2FJHA 1LTXA 1RPQA 3O3EB 3C5ZD 1YEJL 3HC0A 5F6HI 1T20B 4EI6B 4WUKH 5AENA 5C0FB 1UCBL 2Z91A 2DL9A 3IFOA 4JZJA 3RWFA 1YNTB 2B2XL 2Q2LA 4WK2B 3REVB 1XF2B 1GJIA 3MUHL 3ZTNH 1BREA 4HWBA 4PV8A 4FQHA 3SE9L 3PQYB 1RK0A 2ZJSH 4OJFL 1GC1C 1QPKA 2MKLC 4IU3B 4MD0A 2ZP0T 3CQQA 1ZK5A 1TMCB 5LCVA 4C57C 5JIQA 4XNYL 2XYCA 4JFZH 2NW3B 1EA9C 4OUUB 3BP6A 1MCBA 1AGDB 1TQCC 4UDTA 4ZO6A 2AQ1A 4OI8A 4P2CG 1VACA 3L2NA 4NFCA 4FRWA 1EGJH 2BY0A 3GBNH 3IJSB 2GAZA 4O58L 5C0AD 3SZKC 1NC4D 4G7VH 4PRBB 2IF7A 4WNQB 3FUFA 1SEQH 4E41A 1UH2A 5CLXA 4MSWA 3HNTL 4PRAA 3RAJL 3KPPA 1D5ZB 4MAUH 1U2CA 1FNGA 1R3IL 3II3A 4ZZFA 3ZKMC 3NACL 5IMKA 4C4BA 5F88A 1XSOA 2X44D 3NCYS 2G9KA 2GBUA 1O6TA 5DFWH 3BD5A 4PRDA 1YNLH 5F0LB 2Y5TA 3GK8H 1FUNA 3WNJA 2B16A 1MHCA 3UTQA 1LE5A 2GJPA 2YS4A 1JTTA 4BA0A 4V1DA 4NYLB 3QC5X 5ITFB 4CADA 3I9GL 4CMHC 3C5JA 3Q9QA 3V6OE 1AH1A 2N56A 2XQBL 5DFVD 3UYRL 2BNRA 4MAYA 3O3AA 5J6GB 5ECGA 5HI4C 1BLNB 1N64H 3L3KB 5SX5K 2NPLX 4PD4J 5FS5A 2WLYA 4YSUA 3AUVA 1QNIA 5E6IA 4JFUA 3JWOC 4G1MB 4HD5A 3D4ZA 3EBGA 1SYSB 2YSSA 5SWZA 1GTNA 5GGRB 3QHFL 4EIUA 2ID5A 2FGZA 1ORSB 5ALCH 3KLAB 5IHUH 5MHSD 1WLHA 2CGZA 4G7VL 5F97E 1WYJA 5ETUB 1TZGL 4TMPA 5IW6B 3VA2C 1DO6A 3OAWA 3CU7A 2BMKA 3D6GA 4PB0H 3H7BB 1G7LB 5AKVA 5L0QC 3TWCH 4P23A 1IJNA 2HG5A 3MX0B 1R3IH 2F7OA 2QPDB 1UT1A 5JDSA 3CDZB 5EC1A 1PEZA 1E4KA 5CU9A 3B6SB 3EG9B 3V4VL 4FULA 2EDKA 1WFIA 4Q6IA 3WNIA 1AR2A 1TJGH 2XQYG 1DUZA 5HYEA 2NDGA 2Y22A 1EFXD 1R9FA 4NC2B 1OSYA 3OB8A 3I9GH 3EJRA 5TTRA 4RZCA 2OYPA 1ZA6B 3K91A 4KK9C 1HDMA 2X2UA 3NIFB 2H0EA 4PG2C 4L48A 4XHJC 2ESVA 4R96B 4ADIA 2OMUA 4MDIB 4OD1H 3DGGA 3J7HA 3CLWA 4GAJH 2ZSWB 1HKFA 3JV4B 3FO9A 1BF5A 4M48L 1Q9OA 3U0WL 4RA0C 5DVKA 4X5XA 5HDOA 3MLVL 2CG9X 2VL5B 2ZOKA 1I53A 5ELIA 4CDGC 4M8QA 5LGJA 2L7QA 2F5BH 4PJGF 3RJOA 3F6IA 2P52A 1OKEA 4PJFB 3OAUH 2JIXB 4UQ2B 2JKRM 3V5KB 4D7PA 2RFXA 3SBRA 3QPXH 4YLCA 3MQIA 4JHAH 4QY8A 3EYSH 5DMYA 1L3NA 3TCTA 4LHUA 1F4WL 1GSKA 4UOJA 4PJDE 4PJBE 2YWYA 3RJQB 4LZKA 3GMLB 4Z7VF 1QSFD 4FFVD 1YMMA 5D7IA 1UXWA 2FWLB 1ZVSB 3U36B 2HKFL 3UZVA 3MROB 4PVBA 4Y7OC 4ES9A 5E2WH 2YFOA 2NLJA 2AXHA 2R69L 1UXLA 1FZMA 3ZKND 3BZEA 3AXLA 1V05A 3NESA 4KXAA 2VTFA 4X5QA 2NUTA 3QJVB 4OZFA 3NFNB 4PVMA 4TNEA 1S9XA 3SE4A 1M4KA 3FQTA 1FHNA 4HUXB 4E9VA 4P3DB 4UT6A 4NI6A 3VW3H 4C58B 3U0WH 1M1XB 1BVKB 2Y3AA 1JYXA 2F1EA 3DX0A 2AFNA 4NDMB 1CURA 3KYMA 1W72A 4F8NA 1TDQA 5JR1H 3NZHL 3QJUB 4LLUB 1TQTA 5DR5H 5HYSB 1URZA 1MI5B 1P5VB 1YNKL 3HNVL 2OYLA 1X5AA 1RUPL 4BKTC 1UZ8B 3G6AA 1AR1B 4IBWA 2HH0L 5FFOA 1HJBC 5GS1A 5FYKD 3WDIA 1QQDA 2R2HB 4F8QA 4JG0L 4NGHL 2DQUH 1ZJAA 3DI3B 3P30H 4OZHE 1E7VA 1MJ8H 4JX0A 3VXRD 4XMXA 4KI5F 3T4AA 1RK1A 2AQSA 3WMQA 3ARQA 3VFPB 3CGTA 5KBLA 4JO1L 1XIWA 4ZMOA 3SE3A 3QA3A 2PNDA 5KYWB 1H6UA 2HN7A 5C0NC 3VD7A 4YO0B 5JHAA 2OSYA 3DBXB 3D0LB 2IV9A 2ZUYA 3WG7B 3HE7B 3RTQD 1WP6A 2J6WA 1MCSA 3C6SA 3FAXA 4I0PC 4MVBD 1LEIB 4L4TB 3KCPB 1KB9J 4ONHA 1ML0A 4H5SB 1HHJB 2WCPA 4WRLA 1P1ZA 2Q8AH 2J6EH 4UIMA 4HLZG 5E2VH 5ITBL 2D03L 1O6VA 4FQXB 4IKIA 1WAAF 4F9PC 5HHPB 3ZIYA 5FFGA 2MFNA 1E2VA 2YD3A 4S1DD 1O6SB 3QIBD 3ISYA 3UC0H 5DR5L 3U7YH 2DLIA 4P46D 4AH2A 4JRLA 5F3FA 1DSYA 3WJMB 2VDNH 3OKLA 3GPSA 4NXKA 2YPLD 3GZQA 5E6IB 1SOSA 3OHXA 3J2PA 3DV6B 5C0IA 1LL1A 4G80B 3TN0D 1PLGH 2WINA 4MNQA 5DRWA 4ZX3A 4M4PA 2X4TA 2R23B 3UAJC 2WWKT 4M7JH 2GK0B 4MXWL 5E8DH 5FUCC 4CVXA 2ZX6A 2AJXL 4CNIA 3O3BA 4MS8D 4XP1H 2ATKA 3MLTB 3UTPE 5D72H 2JNZA 4IDJH 2HLFD 4G71B 1QW8A 2OMZA 4OFQA 5FGCE 2YBRB 3RGVA 1Y18A 4I3RH 5DD3L 3X1FA 3ZDZF 2NQ3A 4NM8L 5ESQB 1OWRM 3E6HB 4RQQA 1TJHL 2L7UA 4ESKA 2NCEA 3EG9A 3CFTA 2I5YL 5DC4B 4NKIL 2CLZB 2OYKA 4M4RA 5ES4B 5IP4A 1DUZB 4X9FA 4PJFF 3HLAB 1QFOA 3BJ91 5E1QA 3KXFB 2OZ4A 1KJ2B 5K9QG 4FFZA 3QFGA 4MDRA 4JUTA 1JK8B 3S0PA 4E9WA 1AFVL 1BPVA 3KDMA 2DTMH 4A1RA 1WAPA 4TQEH 4LLQA 5JIDA 2F1BA 5F3HA 1XGRA 3CVHH 3U1PA 2X42A 1OXYA 1U4FA 4NQQA 5D96B 5GS3A 3GB7B 3VFSB 2F15A 2IWGA 4MCZB 5T5FL 2HCZX 1ECZA 2BP8B 3CMGA 3VG0H 3VXPA 4TV3A 1E9PB 4XNZC 1NPNA 3VG9B 2NTFB 3O4OB 1D5BA 4EI5B 3TBCA 2GCYB 2N1KA 1YRKA 4JFOB 3DOIA 4D8OA 5DK3A 1QSFB 3LD8C 3QQ4B 4M7JL 5H35B 5KYYB 4MJ4A 2X4NB 3BLBA 4H0IA 3CSFA 4UYPA 4R4NC 5F7DA 4LVEA 4JO4L 4HDIB 2JSFA 5IW1B 4MA1B 1JXFA 5DMJB 4TNFA 3IDUA 2BP3A 4C56B 1WBXB 4WO0A 1E2WA 2R2BA 3GKWL 4QRPE 3KL3A 2F7RA 5JYMA 4OF3A 3DOHA 3GMRA 2XKNA 2AF2A 3D05A 3LEYL 2EYRB 4XB8A 5JPNC 4TNVK 5FLUA 4WGWB 3DI2B 3VFRA 4R4BB 1XXFC 3Q01A 4Z23A 3QYNA 3MN8A 4HULB 1SBBA 1F8TH 2DKSA 4ZXBC 2QEJA 1I4FB 4HKZB 5D93C 2R4RH 2YK1L 3US9A 2FIKB 2VWEC 5GS0C 2FR4A 1DQLH 4UBDD 1I1FB 3OJ2C 1EJOH 3NSCA 4BDVB 4CRPA 2ZIDA 1ANUA 4QCIA 3TC9A 1HNGA 1QTPA 1ZWIB 1HHGA 1NCGA 1S7RB 3PAUA 4OR1A 3MZTA 4XNUL 2VE6B 4FKHA 4B9JA 1HH6A 3A4FA 4LKXA 2NNFA 5T3XH 5DLMH 1QSEA 4BINA 2C9VA 2Y7MA 3V0GA 2X0WA 3ZYOA 2Q20A 3QJZA 4FS0A 1F45A 1T2QL 2Z7YA 5EBWB 4GP5B 2Y36L 3MUZ1 3F85A 4JBSA 3ELAT 4P2YA<