3DPBB

Crystal structure of the complex of the caf1m chaperone with the mini-fiber of two caf1 subunits (caf1:caf1), carrying the ala9val, ala11val, and leu13val mutations in the gd donor strand
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
149
structure length
149
Chain Sequence
b'ADLTASTTVTVTVVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein caf1M
publication title Hydrophobicity and rigidity of binding segments enable CAF1M chaperone to act as assembly catalyst
rcsb
source organism Yersinia pestis
molecule tags Chaperone/structural protein
total genus 21
structure length 149
sequence length 149
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09255 Antig_Caf1 Caf1 Capsule antigen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1310 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3dpbB00
1P5UC 4B0MB 3DSNB 1Z9SB 3DPBB 4AYFB 1P5VB 4AZ8B 1P5UB 3DOSB
chains in the Genus database with same CATH superfamily
2LVCA 4JDZA 4AQZA 1X5LA 1YYLL 2ADYA 4QHLB 1OTTD 4L1LA 5I1LA 3QNFA 5IB3B 1Q94A 5JMOC 1QR1A 4H2AA 5F88A 3MRRB 3US0A 1MFVA 5T5FL 3IETA 2XJKA 4TNWF 5BVPH 2VAJA 5IJVA 3RKDD 2R2BB 3FSOA 5DVNA 1KCWA 2IOIA 3V5KA 1JGLL 5K59F 4X2UA 5C07A 5KVGH 3RUGB 2ADFL 1D5MA 3GYRA 1FIEA 4FHJA 2MHAA 4OGYL 3T0VA 4FQLH 3RZCC 1C1EL 5EUKB 3TP4A 2KZ1B 1KGCE 4AIXA 5T1KD 1Z9PA 4HKJB 4P5MB 4PRPD 4QTHA 2P8MA 1FVDA 4OGZA 1U8KB 3EGXA 2APTA 2HVJA 5JPMC 4WHDA 1MHCB 5FV1L 4KZEL 1J5IA 3V4PA 2NNXA 1PEZA 3HAEG 5FCUL 1RD6A 3NFSL 5E4EC 5IB2A 4HJ1A 1YEEH 3KPQA 4TUUA 5DJDA 2NUPA 2HG0A 5H2BA 3LKQB 5F9OL 3VXQB 3Q5TA 2BVEA 3CN0A 4KI1A 1I7RB 4L8BA 4FX5A 1BFVH 2K9UA 4PV9A 4EI5C 5AEAA 1OL0A 2LAGB 4TMPA 5C0NC 2L8AA 4UNTA 5EEXA 1U8IB 3BKML 4BSVA 2QHRH 1VPOH 3T6XA 2NY0D 1G7IB 1H6EA 4GP4B 3ZTEA 1AFVH 2NY2C 32C2A 3EFDL 4WCYH 1MRDL 2W07B 4LASL 1KNOA 1FIGH 2ZUVA 4UQDA 5CJQL 1JN6B 5A2IH 1B88A 2VN4A 3UL4A 1T83A 3VE0A 3NIDE 2KUTA 2Q86B 3AY4A 4M6NH 4M4PA 1OM3H 1L0PA 1QHQA 2ZSVB 3QS2A 4HUXB 5E9DB 3H85A 5CZKA 4LKXB 3VRLF 4ADGA 2YD7A 3OAWA 2IG2H 4G7VL 1J5OH 2OJ1A 3GSUB 3LKPA 4OCMC 5H35A 1ZGLM 1K3IA 4ZMPA 3PWJA 2JCCA 5C71A 3GSOB 5DJ8B 4J3VA 1VENA 3IDXL 3UTTE 3VB9A 3NGBC 5DHDA 4LMQE 2JLPA 5JW5A 4A6YH 4R7LA 3BEWA 2FWSA 1QSFA 4HS8L 1JZ7A 3QDGD 3QQ9D 1MCKA 5I6XC 3IDJA 1MG2C 2NR6A 1NAMH 3QEQA 4LVHC 5B1JA 3H53A 4XWOD 3V0JA 1EO7A 1KIRA 4DGVL 2H26B 2ZE0A 5D72L 1G9NC 1WFIA 5FW7A 1WBZA 3KGRA 3V7MA 2IMMA 5JXED 3I75B 3PQYB 2EIEA 5EOCL 1MCHA 1WAPA 4KKAC 1OGAD 4FQJL 5CSZB 5B4MD 3S97C 3IVKB 4WWNA 1EEYB 3GMQA 1W91A 5GS1B 2F19L 3RFRA 2H6PB 3CX5J 3G5YA 3FFCE 4H13C 2HWZL 2EDNA 1IRAY 4LF3A 4PU2A 1MHPH 1LM8V 1OZTG 1OF0A 2JXMA 4F7CA 4B9JA 4ZYKB 5KBKA 1FNSL 1PLGL 2VCOA 3EOBA 3DSFL 4MQXD 5F96L 2W9EH 5CGYD 2NTFB 4UBDD 3DYOA 4AGPA 4WFEE 1QEXA 2I9LA 4EIZC 1WFJA 4PN6A 2J6EL 5JOFA 5BUPA 3D85D 2BIMA 3O11B 3J8F7 2ZG1A 3P02A 3ZRFC 3CZFA 4HJSA 5FM4A 5EZIL 3RL1B 2OPCA 2NOYA 5CGBA 1W0VA 5B8CB 2C9SA 4EBQH 1CDIA 2R56H 1OPGH 4WO4B 1QAWA 1GA2A 3QIWB 4KPHL 5C0FB 3ZKMC 2YPLB 2XTLA 3HHSA 3IJSB 3L1FA 3QZLA 1KJ2H 4UT6L 4JZJC 5AKSA 2H2PD 2V7HB 3RVUC 5DRXA 4XO5A 4Y2DC 3M8OH 1BLNB 4LARH 1XH3B 4ZMZA 5BVJA 2YAMA 2AJVL 3TT1H 4RMUA 1SEBA 5JLZB 4Z7AA 1MJ7L 3MRLB 4UINH 2B77A 1A65A 3NSCA 2XZCH 1FDLL 3QR0A 4PG2C 5DDHA 3QA3B 4Z7UB 4FEIA 2H0JA 3IDIA 4RMTA 4AKOA 3HVDA 4P99A 3O3BA 4ADIA 3TN0A 4FRWA 3WUWG 2J21A 4YHZH 5J13C 3FMGL 1PLBA 1UH4A 4Y5VA 4W9GC 4PRBA 4OD2B 2Z31D 5DD6B 4B9YA 4Z23A 2XQYA 4KHXL 2X05A 5JQ6L 1LK3L 4LSUL 1PNDA 1E67A 3ZXAC 5KW9H 1INQB 4WWOA 4K7FA 1XIWA 4RISH 1X7SA 3E6HA 3GRWL 4NNPL 4NCC2 2AV1B 4MRBA 5EZJA 3U30B 5CP7B 4C4KO 4FQXA 2WW8A 3HLAA 3WG7B 1P1VA 4WNQB 2BFVL 5T33H 3RHWF 1NGWB 2J56A 4B9CA 4M7JL 2WSDA 3MROB 3S4SA 2JCCE 4HWZA 3RB7A 4G6KL 4KUCF 2ADJB 4PMFA 3T2NH 3CK0H 2F53A 2IBGA 3RWCB 4EE2A 2JVUA 1RLWA 3UC0H 4C56D 1G0XA 4ODXA 3VH8B 2YXFA 2P24A 1RK1A 1E6JH 3LPPA 2CGRL 4KGLA 3RILA 1NGQL 4F7PB 1DDHA 3WKYA 4TSCL 3EH1A 3DDGA 4EEEA 4LSSL 3CAFA 3GMNB 1EXUA 5EPMB 1BJMA 1J0IA 2ZXBA 4X5PA 3EJYD 1ORSA 3R0MA 1A4KB 1BIIB 1MHHA 1P7QA 1HINH 4JKPH 2YD5A 3CUPA 3LKNB 5AL8A 3V95A 2PWHA 4XNAA 1HI6B 2CLVA 5KJ4A 4YDVA 4BXVA 3SCMB 4B0MM 2BRRL 2X4UA 4PGEA 4K7PY 5FYLD 5E1IA 4P9HC 3BWZA 3QS3A 4I13B 3IE9A 5DHVB 1OXYA 2B14A 3PNWA 1A3QA 1XBRA 3G5ZB 1JHTA 4WW1A 1A1NB 1AD0A 3C5SA 1F00I 4JRWA 2NY5C 3PFUA 4NC2B 4HIHA 4PLOB 1Q1JH 3NPZB 4ALAC 2QKSA 2D3VA 3QZBA 3WIIL 4GW1A 4Z7VA 4HPYL 1QVOA 3B43A 4KRLB 2A9ML 2K6WA 3FSVA 4NZUH 3SDXE 2WIMA 2GJZA 3BAEL 2LAAA 3LD8C 3Q8CA 3LSOB 5F1NB 4JPVH 2OMVA 2P1YA 2APBA 2YD9A 2OZNA 3GDBA 1JNLL 5K1JA 4WKXA 2YD4A 1WQVT 1U36A 3FT3A 2R83A 4PJBA 3GRGA 5JOEA 1NPUA 2GC4C 4WFGE 1OW0C 4GAYB 5D7HA 5HY9B 3CDFA 1TQUA 2LGNA 1KBKA 4WTZG 5CWSB 4ZD3H 4ZQTA 3K5RA 4KDVA 5F7KC 3TXAA 2VDLH 3L3KA 4LPXA 1CL7I 4LBAA 3S35H 2VMJA 2YRBA 5F9JA 4LVEA 4RFNC 5KVMC 1HNYA 1E6OH 5E00B 4JKLA 3TIDB 4BH7A 3OMIB 2JTDA 2H6UA 4MCMA 2Y7OA 4F2EA 1DCEA 4LGRB 4FFYL 3MQIA 2FO4B 2IDFA 1M6UA 3WENA 4M1DL 3O4OC 4KVCH 1ET8A 4G3YH 2Y3AA 1E3XA 2DLEA 2JQMA 4JZOB 2E7BA 5IEKB 4JGUA 3RU8H 4HZLB 4IM8A 2WB1A 3MLZH 4WHYH 1DQMH 5E4OA 5TF1L 1D2PA 1KCLA 3WIHH 5ESVB 4JJOA 5DRZA 1GGYA 4Z18A 2WXLA 1F8TH 4OCWL 1CS6A 4J4PD 1MJUH 1HXYA 3GKZA 3EDJA 3MJ9H 4P9HH 3W2DH 2Y7SA 5D1ZI 4JRXA 3NCBB 4LFHD 5AAPA 3QJTB 5F6HJ 5E2WH 3AG1B 3CFJA 4YIQA 3UG4A 1BOGA 4OIIH 3SGJA 2CR3A 3BDYH 4TV3A 5IZ7A 4ALAH 2ZX6A 2F53E 3S2AA 4AYFA 5C92A 5BZWA 3H3KA 1IUZA 3BESR 1SXAA 5JZ7C 1CLVA 3TBWB 4M3KB 3QPXL 4GKNB 4RQQA 1JHKH 4HBCL 4XO9A 2A9NL 1HEZB 4M62H 3ECUA 2NMSA 2ZOLB 5AALA 3CN3A 4N22A 5IFHH 4A7SA 1CYXA 3GS7A 5DMKB 2IADA 5FO8A 1D5IL 3CSYA 3MYJB 3OF6D 4PMEA 3TBSA 5KS9A 1YN6A 1IKFL 3T08A 3QDMB 4TTGA 1W72H 1LTXA 1O7DC 3HN8A 4HC1H 5BW7C 5C2BH 3NFPA 3L5IA 3QHFH 4GOSA 4XC1H 4ES8A 4Y2NA 4LU5L 1JV5A 3NACH 5DJCB 1MDTA 1TJXA 1RJYB 1JK9A 3V55A 4Z7OE 3ARGA 4PR5A 2OA9A 3MNZB 4GY4A 3PFQA 3U6XA 4Z78A 5C0IA 3S3BB 1U4EA 3KYNA 4ZFQA 4OM1L 3V79C 3QUYB 1VACA 3B7UX 4MJ5B 1RIUL 4PJCF 5AUMB 4H8UA 2GFBB 2C1OA 2W0LA 4PJGB 4FFVC 3SQRA 1N9PA 1OY3B 2QLYA 5F21B 3TONA 4H2CA 3FCTA 1YG9A 1EJOL 1MLBA 3EO0B 5DZNA 5LBSH 3C5ZA 3JWDH 3H9SA 5GGUB 2WTRA 3K72B 4R4ND 5G4NA 4PJBE 2BP0B 3TCTA 2WWMD 4GPVA 2J20A 5HDBE 1AY1H 3FCSA 4Z7WE 4OZIE 1T6BX 5FM5M 4R8WH 3NJHA 2WJ5A 3L9RB 4LHUD 4POYA 2C9RA 3WXWH 4O02A 2H9GB 1WWCA 3VU1A 4YXLL 3PGFH 2GT9B 4N5UA 5ISZB 2EKJA 1UFGA 4GH7B 1DJXA 3RDTD 1TZGL 2OL3B 1A4CA 4ZJ9A 3VTAA 1AO7B 4JREC 4M6MH 4D0CA 1UWGL 2VH5L 5A2KH 2C4FU 5MEOB 1FFTB 1TOXA 1LD9A 4H8WC 3BVNB 5L4MA 4JB9L 4BJLA 4L8SC 4QNPE 4AQAB 4Y8AA 4ACTA 2XN2A 4ELDA 1G1OA 3X1NA 1HILB 3NJGA 1H15A 2Z64C 2VRAA 5CJOL 2R29H 3N0PB 5FECA 3UTZB 3B9KB 4FMFA 1ZLVK 2DJUA 2H7WA 3SIKA 4WUUD 4KKRA 3PWVB 2PR9A 3O6FD 2BP8A 4DKEH 4OKVB 4WRLA 4G80B 3ZKXB 2B3RA 4K8RC 5DQ9A 5E8NB 1B0WA 2AMGA 3AADB 3MX0B 3VH8G 4HBQA 3FTYA 1PYWB 4Q4EA 2VXUH 3G6AA 4JRXE 2X4NA 1Y6NR 2MQ3A 4K7PX 2Y6SD 3MRKB 4A66A 2ESVE 2QZ5A 1NEZA 2CCLA 4BEIA 1P5UC 1SDAB 4UMSA 4X8JB 5E8DH 1MCLA 3UO1H 2ZNWA 1UZ6F 2Q20A 5DO2D 3NN8A 3VXOA 4X8CA 2DB8A 5F7HA 4R7VA 3ASWA 2NTSP 1QPXA 3UBXA 3Q2NA 2NY4C 3U25A 2X2HA 2YSSA 1XSKA 2X88A 5IK3A 3TPUB 2IWEA 4X6BA 3WEOA 2UZIH 5KS9E 1YEDB 3ARDD 4MA8H 2FECL 3OWRA 2ZUXA 4Z3GA 1UGKA 3KYMA 4GI6A 3NZ8B 3ABZA 3NIDB 4HYTB 4JFXA 3DX9B 5DQJA 1QLRB 2OMZA 5BZDA 4S1QH 2X70B 3DVGB 3G9AB 4P2OC 5L7XL 1U8JA 2X4SA 2EC9U 5KSAA 1NUGA 3SBRA 1FP5A 1LO5A 1MIEH 3T2LA 4DGIL 2Z3FA 4LFHG 2ZCLH 4P46C 4RWHA 5GRVL 3KPSE 4MMXA 4WI8A 3FFDB 4IIQB 1E40A 4IOFC 3V9FA 3OB8A 1MJJA 3V4VA 3WAJA 4CMHB 3UTTB 4IBWA 4FQIH 3FB7A 3CZUB 4KX7A 2LTQC 3W11D 4C83A 4HCRL 4MB3A 5HP5A 1CFNB 4HK3N 3CU1A 3VXMD 2FB4H 4D7BA 2AXJA 4K8RH 1BPLB 4EI6B 2EH8H 1PNCA 2EDFA 3TZVA 3WJJA 4YSUA 3PJLA 2OZ4H 3SODB 2C9VA 5IUCA 1ZDSA 3C6LC 1SY6H 3BZDA 5LQBH 3O4LA 3VD1A 2VR6A 3TO4B 2KZBA 4NUJA 4M93C 5B1KA 4DF9A 4AQ1C 1BQHB 2VLJE 4M6OH 3ILQD 4JFPB 2YJLA 3FTWA 2NY1D 4AIZB 5I0DA 5JW3H 3DV6B 2AHIA 3MJGX 4LL4A 5TK4A 3PWPE 3FFCB 1IGIH 4ELMF 4OSUL 2YARA 1AVAA 1MSPA 4D0BA 3JV5A 3HNSL 1YMMD 4HUUA 4YHLH 3C9NB 1DQQA 3N44F 4JDZB 3WTXA 1UEYA 3BE1L 1YEIH 2V37A 5FYKD 5I1LB 2EECA 3ULSB 5IB5B 1CFTB 1Q94B 5HDQL 2Q2LA 3DVFA 2JMRA 1NBYA 5GZND 4WIQA 2F9BT 1CQYA 2XFXA 3JV4A 1T5WA 4K55A 2C9XA 3V5KB 3W3BA 4HEPA 4CSZA 4WHCA 4LPUA 3VWKD 1G7MA 2BM3A 3P9WB 3WD5L 1M2OA 1V27A 4TNVF 2MHAB 2KMWA 1F2XK 4M3JA 3N85L 3H3PH 3RG1C 2YSTA 3F83A 2LU3A 2X7LA 1V7NH 2X1PA 4F7EA 1J12A 2IXQA 3O8XD 8PAZA 4TVPD 2ENQA 3SBWC 4FTVD 1FVDB 3CDGA 3ECBB 1LJMA 2VDOB 3UCQA 1L7TH 2PP7A 1EAPA 4RRPA 1GSMA 3KPOA 4CU8A 3V4PB 2IH3A 3DECA 4TSBL 3X13B 3MSPA 1J0ZA 5IB2B 3RTQD 3VRIB 4CSSA 2D03H 1OTTC 3D2UD 3KPQB 3M7FB 3QG6A 4CA4A 1XGZA 2NUPB 4X0NA 5DJDB 2GK2A 2FSEA 2NQDA 1L7IH 4PCSA 3ESOA 3AWEA 2ZUQB 4HCRA 4WJG3 4AC4A 4AVKA 2BOCA 3GDCA 3KS0H 3P0VH 5E2JA 2W0FA 3ZO9A 3RKDC 3S36L 2J5WA 3CU7A 1U2CA 3NIFF 2AP2A 3GHEH 4BSVB 1PMYA 2BSTA 5HD8D 1OCRB 5CMAA 3ZIYA 1DLFL 3QJRB 4MD0B 1MI5A 1INEL 3A6BL 3BUTA 3GO1L 5HTSA 5T3XL 3SE4C 1BMWA 5HHVH 1TEFA 1IBFA 4KRNA 2BSCA 2YXVA 4X4YA 4FI8A 3FPXA 5C07D 2DQGH 3RWEA 4P5SA 3GSNL 1ZLSH 2W60B 2QKIC 3EBAA 3TH2T 3DC0A 3S0PA 3LKPB 5H35B 4LVOC 4ZOAA 3PWJB 1FVCA 5AYUL 2JCCB 1NSNL 4FG6D 3HN3A 4J2QA 4UQ2A 1U0QA 5I1JL 1U8MA 1G7JA 5CJXA 1CGUA 2FQDA 5HJDA 1SHWA 4HH9A 3BEWB 5FUCC 2MJWA 3D33A 3RIFF 2EYTB 1OQXA 3HOGA 4X7TB 1E42A 1N18A 2NY0C 2AI0L 4U1SB 3F01A 3QUML 1ZIBA 2F8IA 4LLWB 5JORA 2EP6A 4S0HA 1OAQH 4K94H 1KIRB 4DNLA 1OAXL 2ED6A 1QTSA 4CVUA 4CVXB 1WBZB 3O4LE 2HH0L 2J2ZB 3MV9A 4JPKH 1I9RH 3EYOB 4PJ9A 2CK0L 3SDYL 3QPQD 1EHLH 1WZKA 1C7TA 4H1LG 3WKNA 1A47A 3APFA 2XN9E 3G5YB 2SEBB 1TTAA 4W70A 5F6HI 4S1SL 1ADQH 4KKNA 4LP4A 3I6GA 1Z32X 1I9EA 2YC1A 3BT2H 4N90D 5D6CA 4F7CB 1WS8A 1ETZA 2B5IB 2D8KA 3EOBB 1ZHNA 3FT1A 3EJQA 2Y5TA 3L08A 2NNFA 1OSZA 3TWYA 2HZHA 3QB7C 3VGHA 4XVTH 2J8HA 1AQ8A 1F1DA 3L4CA 2WXKA 3QQ9C 4XXWC 1BA9A 3BVDB 3LZOA 2I9LB 3SDXB 3UIYA 4XWOC 4YK4C 3S88H 2OKMA 4FAAB 1DO6A 3VFTA 4RGMC 2FJHA 1BFOA 3RJQB 3UYRH 3Q01A 2E27L 1N6UA 2HVBA 2N4IA 2XY1A 4XO3A 5HYSB 4I89A 3VFRA 5CD3B 5JXEC 1QSFD 2CE6A 2Z4QB 1W0VB 4ODUA 4YQXH 5B4MC 5IJCC 2NR6D 3QEQD 4CVZA 1T0MA 4LSVL 2EE0A 4XXCC 4EAEA 2WO3B 4TULL 3V6OC 4HAKA 3KLKA 4JG1H 5EBWA 3F04A 1N2RA 4G6FD 4Y9BA 4AE1A 2KBGA 5C3LD 5BVJB 1FZMA 3NCJH 1BZ8A 4BRJA 1SEBB 1U3YA 1P4IL 3WEXB 1ZLEA 2A4EA 2QVFB 2XWBA 4MQXC 5CGYC 4UBDC 1V54B 4PJ7A 4IRSA 2DW5A 1U21A 3CN1A 1MCRA 2H3XC 1BP3B 2PPCA 3QRGH 4P59L 5ILTL 2VZ1A 3O3BB 4Z77A 3TN0B 1CE1H 2XU9A 3QUMA 4NNXA 5L6YH 1JYXA 5BUAA 2QPDB 4Y5VB 3II1A 4PRBB 3QUKA 3OPZL 4Z7UF 3J2PA 4HJIA 3RBSA 2MOQA 5BO0D 3MLWH 3NZHH 4GRLA 1K4DB 1MI5E 3TM6A 4K7FB 1A2YA 4BIKA 1U95A 1XIWB 5TDPA 4E0RA 4HHAA 3E6HB 1NFDE 5FCSH 3WXVH 1T21A 1FPTH 4QJ4B 5EZJB 7PAZA 4D94A 3KR3H 4QHUA 2BZ7A 2H2PC 4KZDL 1WBXA 1LO0H 4OJDH 2K3TA 3U82B 4ZW7A 1ZAGA 2Q76A 4UV7H 3RB5A 4F91B 1D9KD 5IHHA 2NY7L 1KELH 3S4SB 1RJCA 4JAMA 4UT7H 1ZT1A 4HWZB 1IBZA 1PKQA 4X0KA 4N68A 2B1HH 2CUMA 2F53B 1T89A 3BCDA 2E6QA 5KVFH 3M1CA 1BQHG 3ZQ9A 1RZ7H 4ODXB 2B1AH 4AJWA 1RK1B 2Z31C 5CLWA 2DYSB 3P11L 2G60H 4HDIA 3WY2A 3K2MC 3SE9H 4S2SA 4DHLA 3LKOA 3BSZH 3I9GH 3U7YH 3PUUA 2FO8A 4LRIA 3AT0A 5D4QA 5F7FA 3O2WH 4NLHA 4OZFA 4PUBL 4X6EA 3PUCA 4ZOEA 5IMLA 1USZA 3HC3L 4B53A 1SDDA 3MV9E 3TBBA 3WAKA 4F8LA 5HPOA 5JW4M 3N1MC 1S5HA 3MCLL 5HGGS 3KJ4C 2X3AA 4RH4A 2WQUA 1AZUA 2OMWB 4V1DD 5HVWA 3QAQA 1F90H 1N0XH 2CLVB 2VLMD 4YDVB 4D3CL 1Q0YL 4APXA 5EOCJ 2E7MA 1KTLA 3FHQA 4I5BB 1HQ4A 4Z7OB 4CDGC 2EIBA 1QI3A 2OFQA 5MHSE 2F08A 3JTTB 5DHYB 4WW1B 4FQXD 3C5SB 1AD0B 3OQ3B 4HIHB 4LCIH 2D2CC 5DI8A 3DUUB 5G5DA 1BM7A 2DDQH 5JW4N 2F74A 6PAZA 1JPFB 3OB0K 2WQVA 1PBYA 1R3KA 2DJ4A 2UY6A 1J1OH 5T3XE 4NFDA 2OMVB 4KO7A 3TX4A 1EO8H 1X6NA 3MJ8B 1RK7A 3EJYC 3ULUD 1V3MA 3NVQA 1A3ZA 4QJ3B 3BDBA 3FT3B 1GS8A 4Y5XA 4PJBB 4AQEA 3SDDB 4HXAH 2WPGA 1UC6A 3V0WL 3WFEL 4AGMA 4N8VA 5HDBB 3CZLA 4PBVC 4Z7WB 3GEWB 2J8UA 1RU9H 4OZIB 1OT1A 3KDMB 4KDTA 3ZL2A 3H42H 3LZPA 1AR2A 1AZCA 4JEGB 3UIZA 5J7CC 4KUCD 3LQZB 2RALA 1P7QD 1OPOA 4RFOH 4EKXA 5L2JB 5F9JB 1FA4A 5FKAB 1YLBB 2VDRL 4ZQKA 3OTTA 3VQ1C 1YUHA 2NSMA 5D5MF 7FABL 1EO5A 1WO2A 4CGUB 1ZHBB 2YWZA 3UPRA 1B4TA 4AG4L 3MRJA 4YDKH 2VXTH 3UJTL 4U6XA 1SGKA 4A7GF 3W38A 2WWOA 3T0EE 4HLJA 5IV2A 2XPYA 5D7LE 3BP4B 2EDHA 1FHGA 1KXHA 4N2BA 2ADGA 1YNTB 4LLVA 2VKWA 2XXFA 3HFML 4OIFA 1IC4H 4HCGA 4JRYE 5I2IA 1VFBA 1NGPH 1L9MA 4EZKA 4TNEA 2OMUA 1S9VA 3T4AC 4JRXB 5F72S 1VSCA 5L9DH 4A7GA 3OMNB 1U8OA 2CO6B 3A4EA 3CFJB 4YIQB 2YJQA 3MFFA 3V7AE 2ESVB 4H0LC 4JCWA 3MGTA 3BGFB 4RSYA 1UKSA 4AYFB 4MJJA 5E99L 1WIPA 2CKBL 3FB8B 4P4RA 3BD3A 4JFFA 1QABA 2W65A 1OP5K 3EO1A 4EXKA 1JZ3A 4RQQB 5I1CH 2A1WL 4XPBL 2GJ6A 1W6LA 2Z35A 5T3ZH 4B97A 1ODAA 4R84A 1SJEA 3EJJX 4NJAH 3SE8H 2IADB 3LCYA 1ED3A 1YEFL 2G0LA 4GAJH 2QFPA 1IKNC 1E5ZA 1WHOA 2OXHA 4JDEB 4LMQI 2B7DT 2X6CA 5KS9B 3QWNA 1YN6B 4HQQH 3OKEB 4J4PC 4UZSA 1NMCC 5FYLH 4UOZA 4XX5A 1AGEA 3NFPB 3U79A 5IMMA 3HS0A 2WXQA 1U91A 1KOAA 2FAUA 4ONHA 3DTUB 4PP2A 4XRCB 3T04D 4YHML 1JK9B 5ANME 3C60A 5HYSG 4PR5B 4A2LA 3BH4A 3COOA 3SOBL 1PY4A 5C0IB 4Q56A 2VLKA 4Z78B 1KFAL 3KPSB 2HLAA 5I0YA 4Q89A 5HHMD 4B96A 4LSTH 5D9SB 1Z0NA 1U8HA 4OIAA 2C1OB 1I3GH 1Q8MA 5EU6D 2KZKA 3KVQA 4JHAH 5C09E 3TV3H 1TXKA 3EOTH 3QHTC 2OTUA 3WE1A 1IFHL 1TJHH 2XRAH 2FBOJ 2I5YH 5FYJH 3T0WA 3QNZA 5CR1A 2TSBA 4ELKB 5AZUA 2BVQA 2IDUA 3N91A 4U1JA 4ZFGL 1Y1DA 2AQPA 1HJCA 5C70A 3FCSB 4NQCD 2J8UE 4X42A 2WXRA 3MV11 1JVKA 5D70L 2VLJB 2EIDA 4L4VA 5D93C 4IKIA 4LCYB 1HWHB 4YSTA 5FOJA 4FABL 1T03H 3N55A 3IEAA 2A6JA 3L4XA 4JDVA 4JQXC 4H8VA 5FGBA 1URIA 3AJ7A 1ZT7B 3DJSA 2ZF8A 1BPVA 3NCWA 5KSUB 5JIDA 3PWPB 1QBLH 4XP1L 2EH7H 5D7SH 3E2HB 5I17A 4D0CB 1XZ0A 2IWFA 1AXTH 1CFVH 3ZE1E 4NCC1 5IIEB 1I8MA 3PG2A 3MAWA 1ITCA 5DJ0A 4KXZI 4RIRA 5ALCH 2HN7A 4FQCH 2X0VA 4ZUUA 3UP6A 3NEOA 1IEAB 3TEUA 3SY0A 1NWPA 1DQDH 1WAAE 1H15B 1JGVL 3ARGD 5GSRA 3D25A 3Q05A 2VZSA 3Q06A 5FECB 1M42A 3KYKL 4NQXA 1GTNA 2KHAA 4KMTH 5DVOA 3S4SG 1QBMH 3DXAD 3QH3B 2XXCB 3CX2A 4PJAF 4J27A 1XH0A 2BP8B 3R06A 4R4NC 1QRNE 1DVQA 2WWMC 3P1VA 5C6PB 4JY6A 5AW3B 3HLKA 2ZKHH 3FQWB 3SE3A 2G3ZA 1HH6B 3HBPA 1X5KA 3OXSA 2GIXA 3ZTJH 4ZAKA 3KPRA 1KYUA 4U3HA 1NL0L 5HDLA 5DS2A 5LAXB 1NCUA 1W0WA 3GQFA 4HD5A 3C5ZD 3MA7A 4HKXA 3H9SD 5E95B 2DIBA 3GSWA 1F86A 5JHLL 2X4NB 1WHPA 3FQTA 2EDJA 3RDTC 5EU4A 1FE8H 4IDJH 1H3PL 4XVJH 2ZXCA 5F0PB 1ZV2A 4D9RD 3OLIA 5CLYA 1FL5A 2W9LA 5GS0D 3JWNC 1F3DJ 4X7DC 2L04A 4RMSA 4HA1A 1NEZB 3V52H 4DVBA 1LWRA 1VZGA 4BZ2H 5I1HL 4Q7DA 2F54E 1WH0A 4Z0XA 4GIOA 3D52A 4ONFL 2EICA 1BAFH 1SJHA 3ESNA 2A9CA 1CGTA 2ITCA 3NN8B 3VXOB 4DTGL 2AJZA 4Y8DC 2PYED 2Y72A 2ENSA 2GAZA 4U6TA 4DZ8A 4HCFA 2KS0A 3SGDH 1QEWB 4I4WA 2VN7A 2D7QA 3EFOA 3O6FC 4NN6B 1QYGL 1OSEA 5E2VH 3ETTA 1Z7JA 3L1GA 2YSSB 4Q6IA 5SX4H 3FULA 2OBGA 1I7UA 1NMBH 5CLTA 2RQ8A 3EBIA 5IBLD 1AI1L 3KYMB 1T3FA 4ODBD 3UCRA 3U83A 5I8OL 4XP6L 5DQJB 4PTTB 2Y6SC 3AT9A 1KB3A 3ULVF 1FFPB 1CLYL 2HJFB 2OYMA 4S10A 1A6ZA 5JYMA 3FL7A 1TIUA 3U2IA 1OB1A 1GPOH 3DX0A 1NBQA 3WTWA 2OI9B 5T1DL 4YXHL 1FSKC 3FB7B 1IM9A 5DO2C 1XAUA 3ZTNH 1QLFA 3EOYG 1W16A 3VYNA 3KG5A 3F85A 4YLCA 3OD3A 3VXRE 3REVB 4QRPA 3EW3B 2E76C 2YHGA 3T1FA 1QPPA 4Z3HA 3BZ4B 2CDGA 4EVNA 1YYMH 3ARDC 1L5GA 1SXSA 3O4LB 4XPHH 5E8OA 2HFFB 3ZN6A 4EPSA 2AJSL 2JIXA 5JHLA 3ATFA 4L4VE 3E1ZA 5ERWA 4QPEA 1JZGA 5EO1A 2DQHH 1C16A 3J27A 4WW2C 1LMIA 1PY9A 1VKXA 4N5ED 1M05A 5AKRA 2ZXDA 2BNRE 2XN9B 3ZJAA 4HALA 4PTUA 1TLMA 3NH7L 5I8KH 4R7XA 3NCXA 4LGPB 3R8BB 3TEZA 2VITB 3HI1B 1FORL 1BAWA 4S0SD 4NFCA 1P1ZA 4G6JH 4TSAL 2MH4A 3TBVB 1FWXA 1QBBA 1XR9B 5JDJA 4XC3H 5KSAD 5I82A 3W11C 4F9PC 4WLCA 3W81A 1NBYB 1PQZB 2F8OA 4A7QA 1CPUA 3JV4B 3KNBA 4O4YH 3FU9A 3WIAA 2P5EE 4KO9A 4UTBH 2V8LA 1G7MB 1SYVA 1KSRA 4FN0A 1DSFL 5D1ZD 5F70A 2GI7A 2YD2A 3MCKB 1HJBC 3ILQC 1EPFA 3KPRE 5TQ2H 4F1SA 2ATKB 2FQGA 4CBPA 4F7EB 2IXQB 2NY1C 1JS4A 1RZIA 1IQWL 1F4YH 3TZVD 3FU7A 3MBEA 1HOEA 2QQNL 3GBNH 1EAPB 1UYWH 3VRJA 4H88L 2IH3B 2MKWA 4JL2A 1SBSL 2DY2A 5SV3A 5DS8B 3OKKB 3IRPX 2ITDA 1ACZA 1EFXA 4EN3B 5F9WB 3V0IA 3KWUA 3FO0H 4LXFA 5I71B 1T20A 1IAIM 5GZNC 3FBQA 5JTWA 4PLJD 4K3HA 5LBVA 2OS7A 4I18C 2FJGB 3OAYH 1NKRA 5AOMA 3VWKC 4OY9A 3F7VA 5CMAB 4PPTA 5DMIH 3WFCH 1JFHA 1MI5B 3G5XB 4O2FA 1MVYA 2QR0A 2CDEB 2R0WL 4LPWA 4OJAA 4PWEA 5D4HA 3S3PA 1NFDB 2NQ3A 4NQVA 3DMMA 2DLGA 3QIUD 2G0KA 3O8XC 3ZY7A 3RWEB 4WSJA 2VLRD 1JVOA 2ZXEB 3NJMA 4J6IA 3ATDA 2H47C 3LQAC 4Z3EA 4HWBH 3P0YH 4TOYL 2V0AA 3TNNA 1U58B 1QFWI 4Y5YC 3RTQC 4YWGH 3QRFM 5F2FA 4CW1A 3ZOAA 2Q0ZX 4PW9A 2IQAA 1G7JB 2X6MA 4R96A 6FABL 1NFKA 1TFHA 2OXGB 5B39A 3EKCA 4QXGL 2F8XC 3EZJB 4HH9B 1MVUA 1RUMH 4BXSV 2Z93A 2JKRM 3F5WA 3S8FB 3L2LA 1A3LH 2F1EA 5HD8C 2MNUA 1RERA 4ERSH 1KB9K 2O5YL 2XVGA 4NZRH 2Y2TA 4DIXA 4IRZL 4J6RL 2FWOA 4GUCA 4IQHA 3FO9B 2EO9A 4M3HA 3BEVB 2IH1B 3MV9B 1MFNA 1PJ9A 3K8LA 4G42B 4K7PL 5FWRA 1EA9C 2XV6B 4OF3A 2VSDA 5L88H 4MD4B 2PXYA 4GKZB 5KYNA 3D69A 3RNQA 2DTML 3MRGA 3EDKA 1OVZA 3D4GA 4M7KH 5FYKH 4Z3IA 4YHYB 3ECQA 4FG6C 1P53A 3P4MB 4JPWH 3B5GA 5D1QD 3VFMA 2FX7H 1ZHNB 2UY7A 2Y5TB 4OGXH 4TPRL 1OSZB 1JV2A 3RLSA 3ILEA 3GSXA 4W9DC 3FQNA 4JPIA 4R7NA 1MCNA 1ONQA 3A4FA 4I9WE 2A6IA 3VFTB 1VB9A 1BFOB 1KCSH 4U0QB 2XPZA 1ITBB 4NB7A 1NEZG 3SDXF 1MQKL 1YEJH 3P3UA 4R26L 5HDWA 3VFRB 5I8EA 1KUMA 2BJML 3CFEB 4TVPH 5TE4H 5KJRH 2EYSA 2XZAL 2DBJA 3GSNB 3DRQB 4ODUB 5ICUA 4AM0Q 2W81C 4Z95L 1WSST 4CVZB 1T0MB 3LQAH 4P5TA 3QPQC 1UXSA 2N56A 3QWOA 4H26A 4BQCA 1DVXA 3UBXG 3FQRA 1A7QH 5EBWB 1N2RB 3GZPA 4TVUA 5A7BA 1B2WL 2OX5B 1TR7A 2PNDA 3SE6A 4JJ5A 1FZMB 5EORH 3T8VA 4F9LA 3EBHA 3AY4C 4YHKH 1WYJA 4PJ9D 3AMLA 4HLZG 1ET7A 3DYPA 2Y7QA 5LDUA 2XX0A 3C5XA 4PJ7B 4OLUH 4IRSB 4E9XA 4EOWL 1Q4NX 3MXVL 4AT6A 2DMGA 4XPTL 2Q8BL 4NNXB 3QUMB 4LNRB 2E7LA 1I75A 4N24A 2VDML 3FOLA 4NBXB 3LH9A 2M1KA 3QUKB 2GPZA 4IRZA 2WWKO 3ME0A 3NSDA 4HIXL 3T0EB 5D7LB 5I1KL 3QQNA 5LXVA 3LPOA 5CN3A 2V5RA 4OZGF 2DQCL 1U95B 4E0RB 3GI9H 4HHAB 4J8QA 4G9FA 1GMIA 3HG3A 4GS7C 5KYYA 2BDNL 2NR6C 1T21B 5B1JC 4JBSA 3L1OL 4JRYB 5HYJE 4IHBA 1YECL 3WS6C 3T1WA 3AB0B 1HCVA 4MRCA 2NSXA 2ICWI 1MCCA 5EWIH 4EZJA 1WIOA 1CYWA 5B1CA 2D7OA 1SLWA 1EGJL 3BPOB 3OSKA 2KI6A 4N2AA 2VOTA 1S2EA 3A6CL 4N0CD 4NRZA 2VDKB 4ZZFA 1E50A 4HOMA 4JAMB 4NWTL 4OJCA 1ZT1B 4X0KB 2YAQA 3V0GA 3ML8A 1UD2A 2XZQH 1UT2A 4FQ2L 3TA4D 4GG8A 3DUSA 3CMGA 3LKSA 3MRMB 2MPAL 2WZ5A 2EYRB 4ABVA 5DLMH 4ZT1A 4OLWL 3VX0A 1I9IH 4HDIB 1YA5A 4R90H 1HZKA 2VDNL 3U1PA 4S2SB 3UFIA 3LKOB 2YKKA 4WEMB 5DK2A 4CC0A 2VXQH 3FH8A 4PRIA 1HAWA 4L3EE 5DWUH 5IMLB 4Z7QF 2VR7A 3Q9QA 1A14H 4U3SA 3VI4A 2V8MA 3BPNC 4P07A 4UILH 2UVFA 2CRMA 2SODB 5JIQA 4MWFA 4G8FA 1VEOA 1KZQA 3DVNB 4AQOA 2N1KA 4GRLD 3OHMB 4ANUA 4UTAH 3VFNA 2XT1B 4OJFH 3PJNA 4HEPG 4APXB 4HG4J 4HOWA 1OE2A 3RY6A 1D9KC 1HQ4B 1WZ1L 5A2CA 2J5LC 2A6DB 1R3IH 1TENA 3GRBA 5EA0H 5ITBH 2R69H 5ANMB 2EEBA 5F7YC 1JZEA 2WXHA 3K6OA 3QO0B 3X1FA 2I85A 2ZP9A 4Z7OF 2VM9A 5T1LA 5KYUA 1R5VA 2VWEE 3I9PA 5I30L 4IBTA 5G5DB 2O6FA 3L7EA 2F5AL 4MYPA 2F6AA 4OF0A 5EOQH 2X4PA 1OAUL 4QR7A 2PTUA 2DRUA 1QA9A 5ABDE 4JFHE 5C09B 5K9QG 1CGWA 1MLCB 4RRPG 5IM7A 2EDTA 3TPKA 1URZA 2XIIA 4PB0L 5DFVD 4O2CB 3L4YA 3LXCA 1N7MH 1KEML 1QFUH 4AQEB 4CJ0A 4BCZA 3PWLA 1HQRA 3PP3K 1KN4H 2J8UB 2WTOA 4XMKL 3DBSA 4NJ9H 5TDOB 3INUL 2WOYA 5L0QB 2ED9A 2X9ZA 4U1IA 2X9YA 1WZMA 1KEGH 1W8NA 2D31A 3WEAA 1QZNA 1PAZA 3PP4L 5INDA 1RZPA 2QELA 4FQXC 4ZS7H 3N42F 3ZE1B 3HBGA 4MDJB 3MU3A 5J4MA 1AD9A 2R9HC 2C4FT 2C9PA 2AQ1A 5I73C 2YD3A 1J05B 1IGMH 3GKWH 2IQ9L 5IW3A 1OAKH 3UPRB 1EDHA 3IM1A 1PY0A 4MAUH 4QNPF 2VERA 1TEGA 2YRZA 4N86A 1FG2A 2QQLL 5AAMA 3ULUC 2ADGB 5JW4Q 1OO2A 4DETA 4KNQA 3UP1A 1BIHA 3U4BH 1VCBC 1MCJA 4LLVB 4NO0D 1QRNB 4WV1A 1IBYA 3WNJA 1G6VK 2GIMA 4A55A 3BYTA 4A1RA 1ZA3A 3MLUL 5DJ6A 3CH1B 1YNTF 5I2IB 2WINA 2BSSB 2Z9TA 2JJVA 5IEHB 3SSGA 2WVVA 2ZAIA 2GK0A 4HUMB 2H1XA 3U9PL 1FGNL 5DLLA 4MLSA 1S9VB 4MB5A 4WEBL 2XQBH 1HL4A 3QR2A 1NAKL 1XSJA 3DIFA 4PLKD 1ZCRA 3FH7A 3F00A 4WI6A 2EVFA 4HCIA 1EZLA 3MFFB 4QY8A 3APCA 1G7PA 1XGPA 3HMXL 3FQUA 3MGTB 5ACZA 3MLSL 1RZGA 2CGYA 2LFGA 1FH5L 4L29A 3QJFA 4MJHA 4P4RB 4X7SH 4IBVA 3CZNA 2F54B 1YY8A 3EO1B 3GFUA 1A1MA 3M7OA 4QHKJ 5I0XA 1A7PH 1SJEB 4IOIB 5DD0L 3U36A 4PJHA 3OKOA 4J3OG 1ED3B 2KPWA 5E8EA 2R2EB 2OXHB 3BWAA 3S37H 5GXBB 4B6ZA 1AQMA 3U4EB 4F27A 4PHZA 3SOTA 4DGWC 3LEXB 5E70A 1JZIA 2EDOA 4N6RA 5IMMB 3HS0B 5DUPL 1U91B 3MR9B 1L9PA 4PJ5D 1LO3H 3MODH 1ZKAA 2ZP0T 4HXBL 1ZS8A 4PP2B 4WK2B 2MQ0A 4OCSL 2J4WL 3MGOB 4L9LA 5J6HA 1NCNA 1BJ1J 1FFOA 1TF4A 4MAYA 3C60B 2EC9T 1C5CL 3D39E 3M1BA 4M7ZC 5L2KE 5SWZA 2NY6D 3LMJL 1CXKA 4KKBD 4B60A 3QCUL 1UA6H 2B8OT 3TOPA 1U8HB 4MB4A 3F6JA 1S7VA 1HH9A 4ODTH 4XPFH 4XCNB 2AK4E 3EJCA 3KJ6H 4LIQH 1RK0B 4MNQE 2AEQH 1LEIA 5AZ2L 1LEGA 3VXRB 2OTUB 4YMPA 5LWYH 4AYSA 2A5UA 4F58L 1KJ3L 2ZCHH 4JFFD 1IB5A 1UXWA 5FAAA 4WDIB 4D9QE 5DFAA 2OTWA 4M5SA 2BW4A 5GZOA 2BVQB 2GJ6D 4U1JB 1K9TA 3BOVA 4BFIB 5K9OA 1GIGL 4UAOB 1THAA 2WXIA 2BC4A 3VGGA 3S3CB 3QYNA 2PWEA 4XAKD 4JRFA 4L4VB 3OKNB 3G5VA 4X5WA 3UJJL 4OLVL 2FECI 2A6JB 4JDVB 2OMBA 2GHZA 3HUJF 3V4UH 4UYQA 3OHXC 3B9DA 2BNRB 1DLHA 1ADWA 5I17B 3O81A 2A74A 3VD5A 1XZ0B 2CKBB 3K71A 3L7FA 4AKQA 4RZCB 2Y25A 1I8MB 4KK5D 5HPMB 4U1HA 2C3HA 3MRPA 1N10A 1NDGA 2HN7B 2K4AA 1F97A 1FFQA 3R4RA 2XKNA 4OB5H 4L37A 5K9QI 1DTUA 5BVPL 5IESH 4ODSH 4P49A 1TVBA 4FXKC 4N2KA 4JGJA 1T1ZA 2VJ8A 2H8PB 2VLKD 4G8IA 5KVGL 2G5BB 5IBTL 1TQCB 3H2QA 4XB3A 1DVTA 1I82A 4TL5A 3TJEH 5E08L 1R0AH 2CD0A 2P5EB 4R7DA 3V7AG 2VMEA 5D7IA 3M6DA 1A4JA 4NHCL 4BZ1H 4FQLL 2JB6A 3BQVA 3FK3A 1BZQK 2EDYA 2Z0BA 2Z8WC 1X7QA 1VZHA 1BM3H 1LO2H 1UATA 3KPRB 1U8QA 2WXOA 4ABQA 2EABA 1DSWA 3WL9A 3K7UA 2LLNA 3A67H 1FH2A 3UTSA 5EU4B 1NMAL 1R75A 4OZFG 1Y0LA 5CBEA 4A67A 1MEXH 1TPXB 3LH2L 4J7RA 1YEEL 1REIA 4MCNA 1H8LA 4OFPA 2ERJC 5LO7A 3PLYA 3MRHA 3D50A 3QRLA 3VWJD 1FBIH 4HS3B 3GJFK 4Z0XB 5LXGL 1BFVL 4IKKA 3ARGC 3BUIA 2X4QB 1SJHB 3UEQA 4ORZC 5BQ7A 2FZ3A 3QUXA 1HXKA 4JFOA 4P3CH 4DZ8B 2VZTA 2QHRL 1VPOL 4LCCA 4JGNA 5H94A 1C5DB 1MCOH 5I1AA 1T5XA 3IB4A 4XNXH 4PJHE 1AFVL 2V2WA 3FB6B 4FNTA 3VDBA 5J5EA 1FIGL 3MN8A 4L8DA 4ZRGA 5LLIC 3MREA 4M8RA 4MTMA 2JB5H 2BCMA 1T3FB 1RSYA 2IF7A 3APMA 4M6NL 2AK1H 3FW6A 4U3CA 1XD1A 3C5ZC 3ORJA 3P9LA 5E6UB 2BRQA 4FA8A 4EUPH 4URKA 5GS0C 1PG7X 2IG2L 3D9AL 1J5OL 4YXKL 4E9QA 3DDFA 2AEPH 4HOZA 3CNKA 5LN8A 4FLSA 1A6ZB 4Y0GA 5SWZE 5C7XH 4ZAKD 2KPNA 2Y07L 1GW0A 2OMTA 3BVTA 1JUFA 4J3BA 3LRSA 4FS0A 4XPAH 2EIZA 3B7SA 4CC4A 3WFDH 5LGKA 1Z2KA 1IM9B 6TAAA 5B7FA 2AVGA 2DYPB 2PPAA 2EEAA 3N5AA 4KQ3H 1PD1A 4QXVA 1NAML 3AC0A 2XWTA 1D6EA 3MRNA 2COQA 4Q6YA 4HJTA 3UDWC 3PU7A 3WEMA 1QFOA 5AW7B 3B5HA 4XZUA 4X6CF 1GZPA 5E9AA 5HHPA 1FLRL 3T1FB 3HZMB 4DP2X 2ZUWA 1DE4A 5IBLC 2NXYD 1L5GB 1QFWM 3D8MA 3QEUB 4IGBB 5E8OB 3L95A 2JIXB 3GM0A 2EC8A 1RPQA 4HFWA 4QTIL 2XTJE 4DP9X 2DQMA 5E94A 1C16B 1S7SA 4Y7MA 3FF7A 4H44C 3PGCB 5LUMA 4PJEF 1JRHH 1M05B 4WI3A 1K8IB 1NCIA 5DO8A 1MHPL 4PTUB 4OV5A 4IBZA 3I3DA 3C09B 1U41A 4ANVA 3K5SA 3ES6B 4OAWA 4K23H 1INDH 1VDGA 3AQYA 2LVEA 2ZUUA 1T66D 4U1GC 3UPCA 4P3DA 4AIEA 2X41A 4F24A 1N70A 1S8DA 3BUQA 4PRHA 3SO5A 1ANUA 3IXAB 4XBEH 3VACA 2F8VA 3IJYB 5D7IE 1CR9H 4BQ9A 3CXHJ 1MFCL 1SYVB 4LBEA 2Y2WA 2XKUA 3VFOA 3KPLB 4EBQL 2GUOA 2B39A 4OJEH 4DP6X 2GYSA 4HK0B 4QRPD 4KFMA 4XNDA 1KJ2L 5GS0H 3ULVD 4CN6A 1RZIB 2P5WA 4N5EC 1CLOH 3M8OL 3VXTA 2YGOA 3MBEB 4LARL 3PL6B 4M7LL 3B1UA 5GJTH 1I4FB 3TT1L 4BCXA 3EH2A 1F45A 4UINL 3SKOB 5ACLA 4A6YA 2QGDA 1QLEH 3C12A 1H9DA 1DVYA 4ZFZA 1ECYA 1A3RL 4BQ8A 3TFKD 1YRKA 2ITDB 1EFXB 4X6DA 5KSAC 4NQDA 2ATPB 4YHZL 3D18B 5CZRA 3OJ2C 4IKLA 4J3SA 4MMXC 5BJTA 2VN3A 1E27A 5C0BE 2UZXA 4N25A 1G9NL 3DOSA 3TS8A 1ACYH 4X5LA 1EAOA 4AK1A 1TQBB 3VFVA 1MPAH 4RISL 5I9QB 2V17L 3SKUD 1U8CA 1JXGA 5D1ZC 4XVUD 4O2FB 2OM5A 2QR0B 5CIPH 4AENB 1IC1A 5FA3B 1ICTA 2CNZA 3AW5A 3DMMB 5HYJB 5JPNA 3TZVC 3GTTA 3WJJC 1JZFA 1NFDF 3RI5K 3VFGH 5E6RB 2JF1A 4WNJA 5DEZA 4Z1PA 1EFQA 2BVPA 2XV3A 2ZKMX 3T2NL 4CKQA 3CK0L 4A04A 1G7LB 2DQFA 2IQAB 1QSEA 3UC0L 3DNKA 4R96B 4AK2A 3QCVH 2CIKA 5B39B 5KVGE 3SO3B 1E6JL 1MVUB 1WV7T 3G6JF 4PLJC 3V2AR 3OLEA 4GSDH 1HFUA 1AIFA 3F5WB 1R3HA 3FF8A 2WJ7A 4JFDE 5AOLA 4Y9GA 1ND0A 5IW1B 3ZR5A 2N1TE 4L3EB 3SGEH 3WFBH 2E9JA 3HC2A 1CL7H 3FT2A 4R5XA 5E51A 1HINL 1KJ2A 1QNZL 4B95C 4JKPL 2F7PA 2JKLA 3QJXA 1U92B 3B9EA 1CK0H 1YPZF 3AWGA 1T1YA 1BZDA 5IMOA 2PXYB 3G6JA 4GRWE 3SHSA 3D69B 1Y6KR 1FNGA 3MRGB 2NLJA 4U7KA 3AXHA 1KPUA 3T5WA 4NPYA 5EEYA 2LU5A 4X99A 1P7KA 2D4DA 4YH6A 3WNKA 3FYIB 1MWAH 1DBMH 2G3MA 5DZ9A 3VFMB 2UY7B 5AQ0A 1FYTA 1JV2B 4BH8B 4HS6B 3OC8A 2WLJA 3CG8A 3V4VH 3DOHA 3GSXB 4NZUL 3WHE0 4JPIB 1RXLA 1NTDA 4R7NB 1ONQB 4TQEH 4DN3H 2A6IB 2DWDA 3AREA 3IAQA 4JPVL 5EIIA 1B4RA 2Z91A 4GKSA 5JPNC 3LY6A 4QRTB 3P77B 2EACA 1MFAL 3MRBB 3HKFA 4NQTA 3VJ6A 1CXIA 1DJZA 4PSRA 1T7WA 3SZ6A 2VKXA 4P5TB 4A7TA 3L3OB 3LN5A 4NN5C 3BO8B 3HBZA 3QWOB 2QVMA 4Z3TA 5JDSB 4ZD3L 3FQRB 2NW2A 1ZWIA 2EDWA 1XMWA 2CUHA 3MV7D 4WU7A 1KCUH 5D1QC 4KV5E 1AE6H 5BRQA 4F7TA 1E6OL 5IQLA 3TBYA 1XR8B 2OULB 2Y7QB 4LAQH 3KLSA 3VGEA 4KXDA 3BKYH 2K9FB 1HL9A 3S5YA 3BP5A 1QOKA 4NBZB 5IB4B 1WITA 3BUYA 1KIQA 1RUAH 4AT6B 3E0GA 4KVCL 4MFHA 4N8UA 2XG5A 4G8GA 3N9GL 3S34H 1E30A 4XB8A 1LMKA 3RU8L 4YFLI 3NK4A 2GY5A 3MLZL 3ZYIA 4JZJA 3PXLA 3WIHL 1WFOA 1JE6A 5KYYB 5I75C 3ATBA 1PZDA 1CDUA 5FK9B 3RPIB 1UH2A 3GBLA 3WNIA 4Y2LA 1MJUL 1TZIB 1TZ8A 1I1CA 1VCAA 2K8MA 4HF5L 2DM3A 4IMLA 4P9HL 2IALA 3ZKSD 7CGTA 3MA9H 4GEIA 1CXEA 4ENED 5E6YA 2EEFA 5E2WL 2ZTBA 3MUY1 1S9WA 2NY5L 4FOMA 4KQ0A 4IRJD 4OIIL 4WK4B 1TTCA 2CALA 3GZOA 3FHAA 4PJ9C 4ALAL 3DHJA 1GTFA 5L8JB 3TF7C 2ADIA 2FUQA 4HWUA 1UD4A 1GY2A 2Q7NA 3DUSB 2AJUH 4OF6A 5CZVH 3BIKA 5E23A 5AOKA 1WUNT 3JTBA 2FX8L 2P43B 3FUJA 1FJ1B 1WGVA 4M62L 2VQTA 1H3UA 35C8H 4ATWA 3GXIA 1PIFA 3E9UA 4LCWA 5IFHL 1N6VA 3V6FA 2YZ1A 5ICXB 5DC4B 1DQTA 4TQ8A 3GMMA 2HKHL 4HKZA 1CI5A 4FG2A 4RNRA 4TQHA 2MWCA 2YMOA 1HHJB 4F8OA 1DQJA 4U3SB 4S1RH 3WHXA 4HWEH 3LYRA 3O9WA 5JR1H 3KLHC 1W72L 4HC1L 4MWFB 5C2BL 2NX5D 4XCYB 2J71A 4G8FB 3E38A 3B6SA 3O45B 1TSHA 3NACL 3RNKA 5D4IA 2B20A 2QBWA 3DVIA 3VFNB 1T0NB 5SX5H 4N0CC 3FO1A 3O41B 4G9FD 5DGRA 4MNHA 1ASQA 5D1XA 5D7JD 3GUTB 2Y7LA 1UB6A 5F93C 3D39B 5JHDE 5GRJH 2PMZA 1F13A 4P05A 3CX5K 5KYUB 2BNQA 3VNZA 1SF5A 2VDMB 4H8QA 1E9OA 2QSCL 3ELQA 4XBGA 2DAVA 4QHNB 4ZZKA 2AK4B 1QA9B 4PREA 4Q97A 4MNQB 2ISDA 4FL4B 3WIHA 5LBSL 4AEIH 1NCWL 1JHLH 2FNWA 2X1WL 1PSKH 3JV6A 2R39A 4O00A 1USQA 2I07B 2EINB 5F0LB 3MJ9A 4TUJB 3PWLB 5I5JA 5L4FA 4GRLC 4ZX4A 5IFAH 4H8PA 3I6KA 5DEFB 5FUOH 3WXWL 3GGWB 1RFDH 1XD0A 2DQJL 4PRID 5I6KA 4U1IB 4YDNA 4Y88A 2BCKB 3FUIA 1YEWA 1RP9A 3QK0A 3C8KA 4FQ1H 5BPPA 4M6ML 2WKOF 1IEBB 4WJ5B 3VXSE 3V9CA 5INDB 1FLTX 2AQNA 2V5SA 5BS0A 3AGVA 1AHWA 4OD1H 1HS6A 1EQWA 2VDNB 4OLEA 1PTZA 2CJTA 3CDCA 4X5QA 5C9JB 1HXMA 4ETQA 4N2DA 3TH3T 1VJSA 1FG2B 1T89C 4I0CC 4MVBD 3QO1B 3P4NA 5DFVC 5IT2H 5T1LD 4L1DA 1WAAF 4DKEL 1W72A 1RZ8A 4HC1A 4H0HB 4RMVA 1H6UA 2WM0A 5K1VA 5B39G 1L0YA 2OSLB 1E7VA 3DI3B 1M7IA 3P2BA 3QI9B 4POUB 4NT6B 5DJ6B 3RWFA 3OLGA 2WINB 1NBCA 1XGRB 4GAGH 4ZMOA 2VXUL 4LRIC 5DMGD 2HP4A 1DBBH 3V0VA 2QT6A 2ROYA 2BOBB 3KXFA 3POHA 4BGDA 1OANA 2P46B 1EX0A 3FN0H 3VQLA 3OMZA 4JCMA 4X4XB 2COVD 2ZOKB 4TS6A 5HJ3A 1R5WA 2DF3A 4QY8B 1G7PB 5B38A 3FQUB 5EOTA 3G08A 3LRMA 3QJFB 5I74C 3UO1L 2OYPA 4LDCA 3WNPA 4ZMWA 3SKJH 1YY8B 3C5JB 1A7RH 3FCBA 2ZZUT 3B2DC 2CBMA 3KH3A 4LCWE 3ARBD 3SPGA 1CFQA 4UI2A 4AJVA 3U36B 3GIZH 1MCIA 4PJHB 3WNNA 1JTPA 2UZIL 5E8EB 4L23A 3UAEA 3CJJA 3BWAB 1Z5HA 4HSQA 1I1AB 1JZ8A 4MA8L 4XNUH 3H55A 1PX4A 4DAGL 2VW4A 2XZZA 5E8PB 3WNMA 3QAZB 5PAZA 4GT0A 4LRNH 3KGTA 4ZX6A 1F18A 1CBVH 2IV8A 4Y16D 4N6RB 4HZAA 4S1QL 1WISA 2WXGA 2P8PB 4Y5XC 2PP8A 2O6EA 2ZKWA 2YAEA 1QQDA 1MIEL 3LZRA 4NM8H 4PLKC 1FFOB 1OP9A 2ZCLL 3V5DA 3M1BB 2V5MA 5SWZB 3SPCA 2FJFA 4YPJA 1EEQA 2GITA 4FQIL 1V3LA 2R29A 3ZE0E 2BNQE 5J1AA 1KC5L 3GMPA 5KG9A 4OCRH 1AYOA 2FEEL 4YS4A 1ZIAA 4M43H 1XFPA 1NFIA 4JO8A 1LEIB 4E68A 1LEGB 2FB4L 1KWKA 4K8RL 5H37H 1AYRA 1KXVA 2CK2A 2EH8L 2HFEA 2IBBA 4P2AA 5FHAH 4DZBB 1AXIB 2OZ4L 3LS5L 1YDPA 1UXWB 2NT0A 3ASOB 4K5OA 4WWKD 3DJTA 4XWGH 2OTWB 5LQBL 5FUZH 1UM6H 4JN1H 5A2BA 3LS4H 1NC2A 5K9OB 4APQD 5ENWA 4M6OL 3WYRA 2X42A 5DFTA 1J1PL 3SZKC 1WJ3A 4M02A 1QI5A 4YNYA 3NOIA 3GLAA 2XTJB 3AGWA 3G5VB 1S7WA 4FFZH 3AAZA 4G7YH 4X5WB 2IAMB 4WUKH 4NOFA 5FLUA 1IAOA 4YAQA 1IGIL 5ECJE 1D5BA 1CGVA 1SMAA 2NY6C 4YBQD 2C3GA 4YHLL 3G6DL 1MCDA 3K4ZA 3K71B 1MZYA 1S7UB 3FQXA 1YEIL 3WO4B 1NCCH 2A0LD 4KKBC 5BS0E 1JNHA 5KZCD 1N5YH 1S46A 2CLRA 1Z9LA 2J55A 3QJHB 4JM2F 4QRBA 3SDCA 4UOJA 1AIZA 2XKNB 3FS9A 1N64H 2RACA 4L37B 3L3JA 4I85A 4MAYD 3OKYA 1XF5A 1MNNA 1T1ZB 4G8IB 1FCGA 4NZ8A 1Z9OA 1ZHKA 4R7DB 3MLRL 2OW7A 2VYRE 1S9XB 2CBTA 5D7IB 5DU7A 1Q1PA 5FFLA 2WKLA 4UDUA 3H3PL 2JB6B 4ZUVB 4ZDHB 3CPLB 1CICA 3MZGB 4KY2A 1X7QB 1L9OA 4GBXB 3QG7L 1V7NL 1UT9A 2A6KA 5LHDA 1P5VA 2GTWA 3RDJA 1ZTXH 1DFBH 4JG9A 4L8SA 3WL9B 5GISL 6PCYA 1L7TL 3KXFE 5EN3A 3H4FA 3QXVA 5GRWA 3HZKB 3HEIB 3FT4B 3IU3A 4G7RB 2HVKA 4X9IA 2K6ZA 5GZOD 3THMH 4U0RB 3IMVA 4KK5C 1B6UA 1LP9E 4TTDD 1L7IL 5KANG 3KPMB 2O5ZH 4XT1C 3P0VL 4IMKA 1U30A 1Y6MR 3I50H 4Y1TA 3MXWH 4F7MB 1RLBA 1UM4H 2KLTA 3JUZA 3VG9B 1JOIA 5C0RH 4JFOB 5LDSA 3GHEL 4HPHA 2YD6A 4LCCB 4OFQA 4PS7A 2OZ4A 1GGCH 4PAZA 5H94B 5C0BB 3U7AA 5I1AB 1SY6A 2HKFL 3BD4A 5KOMC 2XNAA 4AH2B 4JE0A 5C0JA 3K91A 5HVFB 1ERNA 4KRPD 4O58L 3Q7JA 5HHVL 4MA3A 5HGDA 3UO8B 1FUNA 1T5KA 2QGEA 2WYTA 4TLUA 2ZAHA 3L3GB 2NCEA 4MQ7A 5AWNH 2VRQA 2DQGL 3WJLC 1ZLSL 4K71B 3P9LB 3CFIC 3ZGHA 1GW6A 2QHLA 3QFJE 5HGBA 1P5UA 3EHBB 2Y1VA 5FIEA 1KYDA 2WLIA 2QMJA 5MP6H 2E47A 3FXIC 2X2YA 1OGTB 2MCMA 2OMTB 2JKJA 3QDHA 1MW1A 2BIPA 1JUFB 3VWJC 4W81A 4E9RA 3LRSB 3U0WH 2EIZB 1IAIH 3CQQA 5DT1L 3UTSD 2MOGA 4FZEH 4PGCA 5I1EH 1AGFB 1R24A 2R7EA 2XWTB 1D6EB 4NYLA 1O7DE 3AG4B 4E41A 1LWHA 2YBRA 4JFDB 1LDPL 1OAQL 1GZPB 4HOXA 1QHOA 5HHPB 1ILSA 1XX9C 4BFOA 4F2MA 1T4WA 5C9KA 1UA3A 3F7KA 4NXKA 3TCLA 4MX7B 1ETA1 4PGDA 1Z9SA 1AR1B 3OKMB 3QIBA 4ECNA 3QUXD 5J11B 3CD4A 2A2QT 2YK1L 3IF1A 1I9RL 1N8OE 1NFAA 4WGVB 5F7NC 1GZQA 1JMZA 3L95B 4U4BA 3T77A 1I85C 3QZOA 4V11A 2ZPKH 3KBFA 3MKKA 5IWLA 3MBWA 1H3XA 4GRWB 3BH8A 4XMLH 3V8OA 4PV8B 1ADQL 3VQ2C 3ILPA 2HRHA 3Q48A 4HX1A 4ZAKC 2JLLA 4GQ9L 2APVA 1Q9OA 2JNZA 1PPIA 3TF4A 5C1MB 1I1YA 2X2UA 4LLAA 1AZVA 2WKGA 4I2XE 3FRPB 2D9QB 4P3DB 3GIVB 5B7EA 3O0LA 3C6LA 3S88L 5MEQA 1S8DB 4FQQB 1FAIH 4JFEE 3RRQA 5F1KC 3UYRL 1K4CB 1EEZA 4HUKB 1J9RA 1O6SA 4F3FB 1YSOA 4XNBA 1JI1A 4KKQA 2H0FA 5TGBA 1JWSA 1WT5A 3QULB 4K3GA 4PWJA 5C0CE 4G43B 2NXYC 5KVDH 4LBEB 2YPVH 1CTOA 4H4NA 2GUOB 3TYGL 3KCPA 4CVWA 3OG4B 2WLYA 2XIBA 1KJMB 4GAAA 2CMRH 3S37X 2Y24A 3PS6A 4UV4L 1NOAA 4Q6IC 3SYPA 3VXTB 3R8QA 1KGJA 4FTDA 5F3HA 3NCJL 3QR1A 2E46A 4CMMB 1LVEA 5IVOA 4NC1C 1OF2B 2PWGA 4GT7A 1G1KA 1N3NB 3QCTH 3TA3A 1JYNA 2AITA 1SHMA 3QRGL 4A7VA 1LDSA 1T66C 1TKWB 4MMZC 1NAMB 2ZG3A 1J86A 1XB3A 2XUWA 1CE1L 3ARFA 1EVTC 2J73A 4IHOB 5L6YL 3RP1A 3W56A 3RZCB 1A0QH 5T5NG 5BJTB 2WLKA 3ESUF 4MA1C 3MLWL 3NFNA 3DOSB 2BFGA 3A22A 4GXVH 5ICZA 2GSMB 1T1WA 3VFVB 4K0OA 1U8CB 3CV5A 3IJEA 8FABA 1XCQB 1R3LA 2GSGB 5JPMB 1FPTL 4PJDE 2WSPA 5IFJB 2O5XH 1MUJA 1YNKH 2FL5A 4PRHD 5ALBH 1G6RB 1N5AA 4NKOA 5EZOH 5E4EB 3KWXA 3U2SB 3ULVC 4AMKH 3OQRA 1KIUB 4UTCA 2FWLB 1ADQA 5CCKL 4C55A 1LO0L 5GIRA 4PFEA 4GG6A 4XVSH 4UV7L 1B4JH 3OG6B 1ZSDA 3EFFA 2GTZA 2BK8A 3SPVA 1KENH 1KELL 1I3UA 5DA0B 2RH0A 4EI5B 2ATAA 4Z0BH 4UT7L 5KANI 2JV6A 3B8SA 5I15H 1I8LA 2H1PH 3BWUF 1HE8A 3QNXB 2L7UA 3WY3A 3TFKC 1AMXA 3OL2A 3TESA 2HT3D 2P5WD 4Y19D 1KB9J 2MFNA 3TC9A 2NY2B 3FOMA 4QT5A 3ARQA 3A5VA 4KROD 1HE7A 4QKTA 3RWHA 3SD5A 1SPDA 3SE9L 1AIFB 4K3JH 1R3HB 1NUFA 3P3TA 3BSZL 5C7ZA 3I9GL 5T1KA 3U7YL 1OK8A 3IFNH 2XQ0A 4PRPA 3VI3A 1GHFH 4XP5L 2EDXA 2CO7A 3U6XS 3ZU8A 4XVUC 4F2ME 1OTSD 4NQDD 1FGVH 3MGAA 1JFQH 1LEKB 5CEZD 2IIJA 1KJ2B 2X40A 3IDNA 4N1CA 2CHZA 2XWXA 1F90L 1ID5I 1N0XL 2OTPA 5GRUH 5IMOB 2FO1A 3WN6A 5EV7A 4HIPA 1XL6A 2A3TA 3NGBB 4PYGA 3FQ2A 1FNGB 1UH3A 2NLJB 3BQUD 2YQ2A 1KPUB 2ZOUA 1XBDA 1GGBL 3OKDA 4RBPH 5FF6B 4B7IA 4NPYB 3OJDA 1M53A 2WBJA 4I88A 3Q2LA 3VB8A 5I6XB 2XBTA 1LO4H 2E8ZA 1X5IA 4LVHB 3X3FH 2DMKA 4QXTA 5JHDB 4BFGA 2GY7B 2VZVA 4WENB 2DDQL 1HHHA 3PAYA 5BOJA 1UM5H 4I1PA 3GS0A 4IS6A 5I0VA 3QWQB 1H9VA 1ZT4A 3VMPA 4JX0A 5TH2A 1TETH 1JGDA 4GUOA 3L54A 1BXXA 1M9SA 1JTTA 1EO8L 3WKML 4JFZH 3QBTB 1QSED 5MENA 1QUNB 1RZFH 5I19H 1YEHH 3ULVH 1GGIH 4HXAL 4ZTEA 1A6UH 4JL1A 1PG7L 1HX0A 4FQHA 4JHWL 1F4HA 3DX6A 5CN1A 1JZ6A 3NA9H 2V2XA 3CFKA 4I87A 4DCQA 4MZRA 4NRYA 4XXWA 3CIAA 5IW6B 4RFOL 3TT3L 3WELA 1GCFA 4R4BA 3VXSB 1DBAH 5KTEH 3UMNA 3X3GH 5I76B 1MFEH 5I1GH 4FLRA 1F6FB 2QGCA 5BRZE 1HL8A 3BP5B 4NUGH 1YAZA 1KYAA 3BSZA 2EXWD 4KDWA 3BUYB 2VXTL 4YDKL 1KIQB 1UD6A 3AFLA 3AU1A 5KBLA 4RMQA 2XG5B 5KAQF 1OGAA 5MI0C 1PKOA 3NSYA 3STLA 4FYTA 4N0FB 1X9QA 2EIJB 3CLWA 4JFUA 1W8OA 1FYTD 4JZJB 2APXA 4ODHH 1IC4L 4K3DH 2C8NA 4Y2DB 3PE9A 4UUJB 1DN2A 4MXVE 2OMYB 3VNYA 2P45B 1NGPL 1S5IL 1ZVYA 5SWSD 3ARED 1U6AL 3H8NA 2IALB 1WBYA 4BDVB 3IWUA 3RFZA 1YEGH 5L9DL 4GG6E 3L5WA 3NQKA 2CKNA 4YL9A 3LTVA 4PRNA 1S9WB 5J13B 2AV7B 2YD8A 4UOW0 5F3BA 5C86A 3D3VA 1MIMH 1YY9D 1PFCA 4GUPA 4JKWA 1ACCA 2V5YA 3BIKB 4XPGH 3E6FB 3EZ8A 5I1CL 3VM5A 5GSVA 3AROA 3QQ4A 5T3ZL 2AF2A 4JO1H 1FFNA 4NJAL 4LCWB 3SE8L 1UD3A 3BZFB 4PRPE 3LZLA 3B2PA 2Z0UA 2VUOA 3V6FB 1SRDA 5F8QC 4E9VA 3HR6A 4FDWA 4F80A 4PD4K 2DD8H 1EJFA 2GTQA 3O3AA 4RNRB 2AXGB 4KXBA 4HQQL 4U1KA 4ZG1A 3WHXB 3QZWB 4G8GD 2QADD 2EDEA 1FZOB 2QSVA 3FRPG 1VEPA 5FYLL 4KXZH 3P9MB 4L9DA 4HU2A 4KTDH 4ENEC 4EDXA 3L9BA 2PCPA 2VDOH 2X3CA 4W9KC 2Z7WA 2GUYA 4BE5A 1KPVB 5E1GA 1IU1A 4IRJC 4Z6AT 5FUCE 3ZT6A 1COBA 2I7OA 4N0UE 1BVOA 1UT1A 2CO2A 4PJFA 4GO9A 2EDBA 4G8EA 1TO4A 3ESPA 4KRMB 4UANA 4OUUA 3ZE0B 5B1BB 2BNQB 3MLVH 3RAJL 1S4IA 1I3GL 4F9LC 1E9OB 3W1ZA 2A4ZA 2LE9A 1Q72L 4JHAL 3OZLA 4QHMB 4ZO8A 4LSRH 3TV3L 1QATA 2WLLA 2WGNB 3EOTL 43CAA 1UKQA 4PREB 1TJHL 2XRAL 4JG0H 3ZTDC 1UB5A 2AEWA 2DQEH 4ZMTA 1D5XA 3WSQH 1ZANH 1WWAX 1D6VL 4XNYH 1ZLUH 1OP4A 2KH2B 1OALA 2PW1B 3U46A 4QRSA 3SGKA 1BZ9B 1H19A 2A9DA 4K9EH 1SHXA 3D5OF 2CPCA 3PWNB 4KQ4H 2VQ4A 1D2OA 3FTVA 1LQBC 2UWEE 4WK0B 2R4SH 1DJHA 4C56A 1B0IA 1YHPA 4YHOL 5HI3D 1GOGA 5D7JC 1QBLL 3QDGE 5E6IA 1K5NA 4GNKB 5D7SL 3WY1A 3O9WD 1CTMA 4HIJA 1AXTL 4HAFA 1CT8A 4HZ1A 4QIRA 5DJYB 5I8CB 5T5FH 3H9HB 5ALCL 3LD8B 4FQCL 5BS0B 3H6JA 4M8QA 2J1XA 4TXVB 4NLAA 4CSTA 3OR6A 1DQDL 3GMLB 1UWEL 4FNRA 3ZSSA 1AACA 1PS3A 3LXBA 5D1XD 3LXAA 1I8AA 5LJYH 1OGAE 4KMTL 1EMTL 2E6PA 4FYQA 1QBML 3P4NB 3Q13A 3NIGF 3PV6A 3DX7A 3V6OE 2DWEA 1B0GA 2AJ3A 2G4EA 2ID5A 1A9VA 5EZLA 5J12C 4K15A 1W72B 1XF2B 1G1YA 3L4VA 4FCHA 1VERA 5D2LE 2WQ8A 5LGJA 1RJZA 3L4WA 5C08A 2WXNA 4LQ1A 3RWFB 1DQVA 4W9JC 4X5RA 1EV2E 4JGMA 4RFNB 1JF6A 3MLTA 3KXFB 5C8JA 1G9MC 4IDJL 3MRIA 4XVJL 3LZFH 1KLUA 2YIHA 3V0HA 3O4OB 1R5WB 1SYSA 3LZNA 3V52L 5HGAB 2XDHA 5BOZG 1LP9B 4WSKA 3TNMA 4U6YB 3PIQB 4P5RA 4OCYL 2HRLA 2YGNA 3EFDH 1KN2H 1MRDH 3A24A 3BCFA 5GS3A 4MVBC 1XGQA 5SWQA 2R23A 1CFQB 5E2VL 5EB9A 2Z92A 3FTZA 4HMDA 2JCWA 3T4AA 2QGBA 2BVOB 1NMBL 1E2ZA 1BOYA 5F7LB 1P9MA 3FUMA 4G6ML 1IE4A 4R2GD 5AVWB 5DMGC 1N8ZA 1XCTB 1HHIB 3HVNA 1MCWW 3QFJB 5EC1A 4FHBD 3ZE2E 1TTUA 2AS5M 1IBGH 3M17A 2VL5A 1I53A 1WFMA 4AJ0A 1ECZA 3NK3A 3V5DB 2X4OA 2FJFB 2GITB 1QUPA 4LHQB 5T5NF 2V33A 5C2UB 1RIVL 3PGDA 3RL2A 1AOHA 3ZTNL 3K6NA 1QTPA 1IT9L 4F8TA 3GNMH 3KL5A 2OR9L 4LSPH 3T0AA 2PYFA 4JJHA 3AVEA 3ARBC 4PJ6A 4J4PA 2Y3NA 4IBQA 4JM0A 2PCFA 1IILE 4FQJH 1YDPB 2JE8A 4FFTA 1YYML 5LNDA 1KLFA 2V5TA 2FDBP 2HPTA 3IJHA 4AV4A 4XPHL 5LN4A 3WO3B 1BXVA 3QORA 2ZX9A 3GLEA 4GJTB 5ENWB 4Y16C 3EYSH 1ZY9A 4YE4H 4KI5F 2DQHL 2XVKA 2P44B 4YNYB 4C56E 3TJHD 2AJXH 2F5BH 1S7WB 4RAUA 3AAZB 4WV1C 4C4KT 4I3GA 1IAOB 4YAQB 5F96H 4QUOA 4XI5D 4BZ2A 5I8KL 3UC2A 1GVIA 2L4OA 4ACPA 1ETJA 2NY3D 3IKKA 3CHXA 5J56B 4G6JL 4GO6B 2XI9A 2CLRB 2K7QA 3MLYH 4RAVA 4QO1A 3HC0A 3KBPA 3BH9A 3I2CL 3ZKND 1EJ8A 4I2XB 1IM3B 4FERA 2QEJA 4P4KA 4OCXL 3B3IA 5D71H 1XF5B 1A7BA 4O4YL 5EDXA 5J6GB 2YMXL 4JFEB 4L1HA 2C26A 2HRGA 3BPCA 4UTBL 5DTFA 3VSQA 3K1DA 1ETB1 2J1YA 3RWJA 4WWKC 3S9DB 1UHVA 25C8H 1ZHKB 5C0CB 5FYLE 5GHWH 2DBLL 2IMNA 1QFWH 4XN1A 4UT6H 1SQ2N 4APQC 2RB8A 1XF3B 4PCYA 5CN2A 2A38A 3IU4H 4N4YB 1AS7A 5D7EA 4JREB 4LDEB 2ZP8A 2A6KB 2BSDA 3WDIA 3HPJA 2JQAA 1RKRA 1P0SE 3QISA 1IGYA 1F4XH 2VN6A 4IEFB 4L8SB 3TH4T 5J89A 3GBNL 1UYWL 1P4LB 1IGFH 1QBAA 2XVBA 4HD9A 4JFQB 4YBQC 2NRDA 3IU3B 1NC2D 4LPTA 4ODWA 2A0LC 1XCXA 5C0AD 3QZWG 1I8KA 1ORQB 3FO0L 3PDOA 4KHXH 4L9LC 2WN2A 4LSUH 1WA0X 3NCEB 4MAYC 4EZLA 2G2NA 2FYYA 3ZDXF 1NIBA 1FI8C 1YN7B 3GRWH 4HFUH 3QEGH 4NNPH 4JNXA 3HNTH 3QZNA 4L2YA 1E8YA 1O6TA 4LHUA 2XNAB 5DMIL 3WFCL 3SDCD 2X4TA 4JY5H 4WTXA 4BRVA 2CUIA 4TUKH 2WO4A 4NO3B 4XNQA 5GGRY 3RDTA 4PJDB 1TZHA 1E5BA 2O61A 1F6AA 3LV3B 3P0GB 4HUWB 4OM0L 3DO7A 1ZGLA 5GJSH 1AG0A 4WHYG 1Q0EA 4PJIA 4HWBL 4G6KH 3FZUD 3J07A 5HGBB 4Q9QL 3L2MA 1DUZA 1P5UB 5E5UB 5GZOC 2Q10A 4U6HB 3UZVB 2HG5B 1CICD 2WLIB 3UTPD 1MREL 3NSXA 4YWGL 3ARSA 3WBDA 2VN5A 4GLRI 4JM2D 4TTDC 1T2QH 2NY4B 3RGVA 3FPYA 3FN9A 3O6FA 1CURA 2ORBH 1OQOA 1RUML 1W6WA 4PGCB 1HTYA 5FOBA 2A74C 1R24B 3HIZA 1A3LL 4PG9A 3FRUA 4NYLB 4PS3A 2OW6A 4ERSL 4TM9A 4NZRL 2HRPL 2W59A 2YBRB 1DQIA 5J1SC 4KRPC 1NCAL 3MV8D 4HEME 1NCDH 1M1XA 4F2MB 1I8IA 4P2OB 3TCLB 4HUVA 1Z9SB 2O4EA 2J6WA 1I1FA 4GQQA 1GZQB 2B9BA 4P46B 4A2FA 5L88L 3T77B 3EYFA 3S3JA 3P4OB 3DO3A 3MBWB 1I3RB 4JMNA 5HHOA 3BH8B 2QQQA 3SY6A 1TJMA 4M29A 5FYKL 4JFWA 3SJVA 1QSVA 1OD9A 2LTQB 5B1AB 4JPWL 4NM4L 2YN5A 2Z4TA 1L6PA 4GRWF 2FX7L 1UWXH 1BD2D 4GP5B 4OGXL 3BAEH 2IWKA 4IOSA 3SB3A 1QNIA 3VSVA 4KKZA 1T80A 3B5TA 4IJ3C 3ARDA 1XGTA 3C6LB 1NCGA 4AJYV 4G5ZL 4PBWD 4FNPA 4M93B 4AQ1B 1PJWA 5F7UA 2BMKA 2XSKA 3IXTB 1NGZB 1QI4A 1JWSB 5TGBB 3BAJA 1B0RA 1N68A 1OTUD 1YEJL 3GXUB 4WW2A 5KJRL 4TVPL 5TE4L 3TVMD 3GEFA 3QUXC 1AKJB 4HV8B 4F57H 5JNYB 3LQAL 4HWBA 3CC5A 4E41D 1MCFA 4Q58C 5KBMA 1WP6A 3MRDB 1S7TA 2JI2A 1A7QL 4IBYA 1B90A 2VISA 4LCUA 2Q2EB 4YHNA 1P2CB 1C5BH 5EORL 4UQBA 3L16A 3QIBD 4F9PA 2ICEC 4FFYH 4YHKL 3D4CA 3UAAA 2DKSA 3C6EA 2W91A 2H41A 3FAXA 3M1OA 4WFHD 5D4JA 3CFNA 3BAWA 5BRZB 1S7RB 4KV5F 5KYWB 4LT7A 1KG0A 3KAAA 3KS0J 4H5SA 3T4YB 1DEEA 3T8MA 1T1WB 3ATEA 4OTXH 2JKXA 3GI9L 3WI9A 3NZUA 8FABB 5IQ7L 3HRZA 3EF4A 3NJIA 4LNVA 1Y1UA 3W9DA 1F3DH 3HZYA 2YKLH 4UM8B 1JPGB 1TQVA 1MUJB 3OAUH 3JWNE 1N5AB 4A38A 1EXHA 5EWIL 4RGOH 3LPGA 3ZDZE 1NICA 2EADA 4IK7A 1SBBA 3IDGB 4Y4HD 5GIRB 5HI4D 4DK5A 4GG6B 2BINA 3K6SB 1U8PA 3GXDA 5CCHE 1ZSDB 3VMOA 2GTZB 3SPVB 2I27N 4EXPX 5HGHA 5KSBF 3RYMA 4TQIA 2VJ0A 5F7MC 3X1BA 1CQKA 2UZPA 4HBCH 4N28A 3VGBA 2XZQL 1T7YA 1QW8A 4I18A 4WUUE 1G7QA 1CDBA 3VWKA 3AS3A 1VFUA 1R33A 2G2RA 2VTFA 3ETBJ 2YS4A 3BRDA 1DL7H 4PJGE 5DLML 1JPEA 5HVHC 2R0LH 2D7TH 2XA8H 4L2LA 1D5IH 1I9IL 3RWHB 4R90L 5DUML 1M6OA 2UVEA 4PI2A 2EUZA 5T1KB 3ET9F 4PS8A 3SDAA 5FO9A 3O8XA 1IKFH 3TA3D 4PRPB 3HS9A 1BFTA 3LNGA 4NKMA 3HNVL 4LLQB 1E8WA 4U49A 3VD4A 3ARFD 5I1DA 4UILL 2QKIB 4U1NB 3Q1SL 2R59A 4OF7A 3IDNB 5CHNA 2PR4H 4MA7L 3RTQA 3DHMA 2AAAA 4LVOB 3KPTA 3ZHDA 3VFWB 3QARA 1J0HA 5BMFH 5I6MA 4UTAL 1J11A 1T1XA 3HFFA 5DF0A 1GJUA 3H7LA 2YD1A 5EA0L 4HETA 2R69L 4UQEA 5ID0A 3HE6D 3OJDB 4N0UB 4ABUA 5D55A 4AQ8C 4JM4H 2NY0B 3PJSA 2HT3C 1Q9WA 1OV8A 4QXTB 5FGCE 5C0DB 4GSQA 5HHXH 4IKNA 3X1GA 3E80A 4ISVA 4KROC 5JUEL 5EOQL 1J7VR 4D8PA 2EEDA 4UIMA 1ZT4B 2HX7A 5TH2B 1BVKA 3WU1A 1T4KA 4CADA 1JPST 2DQDH 1WFTA 1OTSC 4I3SH 1SLXA 5CP3H 4OT1L 1DZ0A 1SQMA 5CFAA 2CH8A 1N7ML 4PVBA 5A2JH 1ZVHA 4YXLH 3CLFH 3VD9A 3GK8L 4FYRA 1T04A 3CFBB 3NZSA 4NJ9L 3DX6B 3WKQA 4EDWH 4OQTA 2UWEB 3OZ9L 2VW7A 3CFKB 3BQUC 1S6NA 3U9UA 4B3EA 2R1YB 4JB9H 4DCQB 2X6BA 2FHBA 1A9BA 4G70B 4NRYB 5EHFA 3QDGB 1BYOA 1M71A 1SJMA 3UBFA 4R4BB 4XN7A 1C8QA 4N87A 1V3KA 3MACH 4YK4B 3VXME 3KLAA 4DKTA 5LNGA 4LKCA 1UOLA 4N0RA 4RGMB 3BI9X 2FK9A 2NDFA 3GKWL 1PZUB 5TDNB 1Z3GL 2DIJA 3WNLA 1JPTH 4AZ8B 1T7XA 1I31A 1RURH 2V3DA 4DUVA 1F2QA 5EO9A 4M9OA 2WBJD 4LEBA 2VXQA 3WLBB 1OGAB 3QQ3B 2FD6H 2HCZX 3U4BL 4IDLA 1VESA 2PABA 5EUOF 4GEJA 3AMKA 5T1MA 2DQ6A 3T3PE 5D2LB 1KCVH 1Z5LA 3QXAB 3BUPA 3DURA 4KY1H 1YMME 4UTAA 4L05A 3C87A 5FYKE 1ZLDA 4HMEA 1XHHA 4Y4FD 2R69A 5MEND 1S3RA 3DROB 1S7QA 2XQBL 2I25N 4E5XA 1CN4A 1G1CA 1U8LB 4MNGA 3LOWA 1RSFA 4E42B 3KM2A 4ZFOA 4XO4A 5EFIB 5KOVC 1TMCB 5EUOA 3WJMB 4PJ8A 3D85B 1KYOJ 4X7SL 4GUPB 5FR3A 2EXWC 2EKSB 1VGKA 1KBBA 2XWJB 1KZYA 5GSVB 4TF4A 2DMHA 3QQ4B 1A7PL 5GGSY 1FFNB 5DZAA 2GBAA 3NABH 3NEEA 3ZDWA 2OMXB 4F7KA 3WS6A 3KYOB 5CEZH 3DBXA 4FTVE 5GRVK 1WCBA 3CVIH 3JVGA 1V55B 3S37L 4N3TA 4OZ4B 3DOIA 3O3AB 2FH6A 4JFYA 3TEXA 1CGYA 1XB8A 3S48A 2Z34A 3AREC 5DRNB 1KT2A 1L9TA 2Q5BA 4N2HA 1LHZA 3HW7A 4DGIH 3DX3A 1LO3L 3DGGA 3QGVA 1A7NH 2PCPB 3P73A 2YOCA 2C5DC 3MOBL 5K9JH 3ZE2B 1GS7A 3DK0A 2CIIA 2Z31B 4TUOB 2R1XB 3QVAA 1JWMB 4CN4A 1YY9C 5ES4B 1NPNA 4B9KC 2NUTA 4RFEA 1VRSA 4G8EB 4ANXA 2YUZA 4ODTL 3SBQA 3Q3GA 1JDDA 3C6SB 4XPFL 5BZZA 3KJ6L 4LIQL 3ULUL 2AEQL 2WLLB 5LWYL 4N8CL 2P80A 3KJ4B 1CD9B 3D3VD 5C07E 4EMZA 3GINA 4YDMA 5CAYB 1AP2B 2ZCHL 1IQDA 1A64A 3U46B 1GJWA 3BKCH 1EAJA 5DJAA 5ANHA 2QADC 1NLDL 1PVHA 1IMHC 1D9KA 2LW3A 3FT9A 4Q2ZA 2KDYA 3FSZA 2VSCA 2EEXA 3DX4A 4CSPA 2ZUYA 4C56B 3V4UL 2BHYA 1DVFA 1GXEA 1K5NB 3GTVA 1WS7A 3L81A 4OZHF 2YN3A 4OJYA 5HDQH 4HIJB 2VXSH 1CT8B 3AG2B 1KBGH 3Q44A 4XOCA 4OB5L 5HDRA 4M8QB 1SOXA 3Q0HA 5HBBA 4RMWA 2CNYA 1MH5A 4ODSL 1RHHA 2ARJQ 3MUUA 2DWTA 3BPLC 2VQ1B 3WHE1 1BDYA 1HWGB 4YGAB 1ZA6A 2ZOOA 4J39A 3N85H 3N1PC 4V1DA 3TJEL 1R0AL 1RUKH 4FNUA 3ETSA 3PV6B 2OCFD 1CF1A 3Q9PA 1RZJC 1B0GB 2AJ3B 1NJ9A 2DWEB 2FEEI 2W9DH 1AQKH 3CFTA 5EZLB 2DLHA 2YD0A 3IGFA 3TYFA 3VQMA