3DPBB

Crystal structure of the complex of the caf1m chaperone with the mini-fiber of two caf1 subunits (caf1:caf1), carrying the ala9val, ala11val, and leu13val mutations in the gd donor strand
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
149
structure length
149
Chain Sequence
ADLTASTTVTVTVVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone/structural protein
molecule keywords Chaperone protein caf1M
publication title Hydrophobicity and rigidity of binding segments enable CAF1M chaperone to act as assembly catalyst
rcsb
source organism Yersinia pestis
total genus 21
structure length 149
sequence length 149
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09255 Antig_Caf1 Caf1 Capsule antigen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1310 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3dpbB00
3DPBB 3DSNB 1P5UB 3DOSB 4AYFB 4AZ8B 1P5VB 4B0MB 1P5UC 1Z9SB
chains in the Genus database with same CATH superfamily
1QFWM 5E1QA 3EYOA 1GCYA 3FH8A 4QHKI 1KBPA 4YC2C 1N4XL 3C6LB 3ULVL 3RI5F 2JLLA 3EYVB 3NSDA 3WLBB 1I9IL 3QARA 4HJIA 5AKSA 3TN0A 2X2HA 1A64A 4S11A 3VMNA 5K69A 2D9CA 2EH7H 1U8NB 4WDIB 3BWAA 4IMKC 3AS2A 1NFIA 2WTRA 5DC4B 1MFMA 1MLCA 5E23A 4BFNA 5B1CA 5HJBA 4PVNA 1F90H 1O7SA 3R0MA 1E8WA 5FW8A 2ALWA 4GLRI 3A6CH 2NR6C 4U3HA 4HSAC 3NIFB 4CN4A 2COQA 1ZT4B 2VZUA 4I89A 4L37B 5FOJA 1A14L 3FAWA 4N2HA 1FL5A 4NO3B 4UBDC 1BSIA 43CAA 5DUJA 4NIKB 4DAGH 3SPIA 1EDYA 5DRWB 4PJXA 3CZEA 3BPLB 4PY8J 3REWB 4TQHA 4PBWD 3L6FB 2JKSA 3IJSA 3TF7C 4ABQA 3GKZA 2XWZA 4DT2A 3GMOA 4H0IA 1ZLSH 1P7QB 3ENEA 2PTUA 1XV8A 1FGVH 2QGDA 3DUHA 3EHBC 2BW4A 4R3SA 5E2WH 3RUGE 1CGTA 3VU2A 5D2LF 1DUZB 4MXVF 2IWFA 3C60C 5F0JB 4LOEA 3HMXH 4QHUB 3S35L 3U0PA 3US0A 1GAFH 3QWRD 3VD4A 3U30C 3NACH 4JPQA 4XWGH 1CBVL 5PCYA 3II1A 5D7SL 1RZJH 5H37G 5F1SA 2WQUA 5HHNA 1XSOA 2R83A 4JVPA 5E5UB 3ZKQD 3QUHA 5FKAB 4ZOEA 2B4CH 3AXIA 1MFAH 1JXJA 3VCLB 5EZLA 2EUZA 4P46B 1I53A 1BX2A 2VM4A 1DVFA 1YYMH 2X6UA 3GSQA 1IBYA 1OD7A 4U1MB 5AB2A 1VZIA 2L7QA 1W8OA 4E68A 2AAAA 4PJ8D 4LB8A 3ZQXA 5E8PB 2BXZA 5KEZA 4FP8L 3A23A 2IOOA 1VESA 3TNNB 3DUSB 5D7LB 1XWVA 4AKQA 3QULA 3WFCL 1CURA 1XMWA 4D0BA 2IAMC 3E38A 3GMQA 4JFXB 4V11A 4A7QA 1QATA 1U93B 4R0LB 5GGSY 1ERNA 4LBAA 5HI4D 3SBQA 3OR7A 4KXDA 1HEZB 3ATBA 1I7TB 2B9BA 3WY4A 2BH0A 2NSMA 3KPRB 4KI5F 3IWUA 4YL4A 2DQDL 1KIPB 3GXFA 4HLZH 3RI5K 1V3LA 3O4LE 2P9RA 4NQDD 3OPZL 3CVDA 5H4YA 1NKRA 4NXKA 5CU9A 2PYEB 3WKNA 1AZUA 1A1NA 2R2EB 5J1AB 2X0VA 5KVEL 4QHLA 1HIMH 3WFBH 2D3LA 1UOLA 1NEZA 1MI5B 4QLRA 4C55A 4FD0A 3BVNA 4JQXA 3DO3A 2DQHH 1G0DA 4IIZA 1QNIA 3P9LA 4G1EA 1AY1H 5JQ6L 3A6BL 1N2RB 3PLYA 3CHPA 1C5BL 3G08B 1QZNA 5ISZA 3T4AB 1FI8C 2WXGA 4UANA 3UFIA 3W9EB 1N3NA 1T7YA 3BZDA 1H3WM 3C6SA 5FIEA 5CSGA 1WCBB 3QORC 2Y69B 4CC4C 4BRVA 2WPGA 3HRPA 4I13B 4KXBA 1OE3A 5FA4A 5SX4H 1JPFA 3HJEA 4EN3C 2A74B 1U2YA 4FAAB 3AXLA 5CJQH 1V3MA 2IDQA 4QKXB 4X0KA 1H3XA 1SBSL 3SDDD 5JYLA 2V2XB 2ROXA 3DI2B 1J9RA 4E41D 1TCMA 3D33A 1YNKL 3C08H 2ZOOA 2RTTA 4YSUA 1UD4A 1NANH 2COVD 3P9MB 3PDGA 1DSWA 1W0VA 2LU4A 4FMVA 3DX7A 1SEQH 3OGCB 4OKDA 3IU3B 1KXVC 2GJ6A 3QJVB 2DLFL 4WK0B 4Y4FB 3E9TA 3BFWA 5GGUA 1KJVA 1M7UA 3F6IA 4H0LC 2A9NL 1S7UA 2KZBA 5AUMB 3MO1B 3QUZD 5HBBA 3EXJA 4UQBA 2IPTL 1IC4L 4JPVH 3X12B 4AIEA 4YEFA 5I71C 3LN4B 4X5XA 5AG9A 2OFQA 1PLGH 5C3TA 2F19H 4JDVB 5HHVH 4HEPA 3V0WL 2P5WB 1U3NA 4CILA 5FA3A 2ENPA 4F92B 1MREL 2HT4C 5IF0A 3SB3A 4DGYL 3PDDA 4KOBA 1SVBA 2DJMA 3I75B 3PIQB 4MKTA 3TX4A 4MD5A 4N25A 4EQ3A 3B2UD 1MCCA 1BJ1H 2B9AA 3R06A 1PZDA 3QEHA 4X5WA 5FO2A 4L3EE 3OWRA 2F1BA 3GD1C 1T1WB 4GG8A 1ZCRA 3BCFA 3SCMD 1HESA 5AENA 5DQ9A 2SEBB 4ZFGH 1QOKA 1SGKA 1L4IA 4KNSA 2W60B 4LK4A 3ELQA 4PJAA 4XNXH 1MRFL 5DZAA 1P5UB 4ERSL 3L9YA 3S4SB 5HHPA 3PWJB 4AZ8A 1BIHA 3FUNA 1EHLH 3FRUB 1SFHA 5F3FA 4ODSH 4P3CL 2KQNA 4LVEA 1K4DA 4CMMB 3FU6A 5K9KB 3NCJH 4HUVA 3JT2A 4FXLA 2HTKC 2ZOLA 3VD5A 1OD9A 1V3KA 1MXDA 1T4KA 3NFPA 4KXZH 4XMWA 4M8RA 1O7DE 3D39D 2F8IA 2LVCA 3HZYA 4JL2A 4OGYL 1YEKL 1QG3A 5HHXL 2H6PB 3RJOA 2F18A 2NNCA 2JSFA 3BGFB 2ITEA 3C5ZC 3KYKL 4N8CH 1JNLL 1MH5A 2JCCE 3AMLA 4DKFH 5KS9A 1NANI 1AQKL 3MRHB 3CQQA 4NZRL 2GTQA 5DHXB 2WBJA 4R5VA 4DZ8B 1FG9C 5EBWA 1QUNA 2H47C 5DEZA 2VR6A 4MJIB 2ATPA 5GGVY 4BA8A 1GPOL 3CSYB 3EDEA 4NJ9H 4YHOH 1RIHH 2NYYD 3ARZA 4IBYA 4M93B 3CAFA 2DKMA 1GZHA 2WYHA 1B9ZA 2IXQB 3E6FB 4OZGA 2MFNA 5EWIH 3TJPA 4MNQD 3E80A 1UJ3C 3ES6A 3V5KB 4WWKC 3HS0B 4IRZL 2CR6A 4L1BA 2Z35B 3ZZLA 4OQTA 1BQRA 1WEJH 1JWMB 1YA5A 2JQMA 3CN4A 5I19L 1D5IL 3RAJH 1JZ4A 2BZDA 4L4JA 1HJCA 1OCCB 1PLCA 3ULSB 5T1LB 4JM2B 3LH2H 1KGUA 4NQCB 4FQHA 3BQUD 4MASA 1CF1A 3TU6A 4EJ1C 3MBEA 3G5YB 1NLDL 4ZFZA 4WW2B 1RIUH 3B7UX 3MJ7B 3QNZB 4J27A 1MFNA 2CLRB 3BJ91 4FTVB 4U1HB 4FMFA 4W9KC 1N6UA 4PJIB 3SODB 3U4AA 1T6VN 4LVHC 4LLUB 3NZSA 3EUDA 3CBJB 3KBHE 2YZ1A 4NN5C 3QJTB 2OL3A 2UVFA 4DVBB 1SXAA 1U33A 3R1GH 3IAPA 1F2QA 3QUXC 4LARL 4S1DD 4X9BA 3VWJD 2QEJA 4NWUL 1PSKH 3HC4H 3D48R 1HEJC 4KXZI 1J12A 3NABH 1BECA 2EINB 2XETA 2XQYA 1DVZA 4HGWB 4NBYB 4I0PB 3RBGA 5E6UB 5TH2A 4PV8B 2A3TA 4KKPA 1NCWL 2YXFA 4IKKA 1KLGB 2ZX7A 3OQRA 3MRNA 4XCYB 4TNFA 3O3AA 1EEZB 4R83A 5EU3B 4HD5A 1YJDH 1QBLL 3ESVF 2ZSVB 3NCYS 3MRKB 3BKML 4WGWB 2FBJH 1RPKA 2MPAL 1MFCL 5DF0A 2FZ3A 1IAMA 2NY1D 4PRIA 1T3FB 5KYYA 1UD3A 3FUJA 4L4VD 3L4WA 1I1AA 5IFAH 2UZXA 3FUEA 1AGFB 4PRBB 4P99A 3RE0A 3WUWA 4GXUN 4DCQB 3HNSH 3U36A 5HGAA 4JFDD 4WNSA 4MQSB 1RHHB 2WLIA 3UGXA 5JUEH 2IH3B 5TQ0H 1DR9A 1WRFA 3OJMB 4FXTA 4P9HC 3NP4A 5CFAA 5LXGL 2AXHA 2P5ED 4BQBA 1UB5A 3MLVH 2E6PA 2EE6A 3Q8CA 1JPST 4LHUD 3UBXI 4FQ1H 1R19A 3HMWL 4FI6A 4W9EC 4KKRA 2UZIH 3ELAT 4POYA 5DVPA 1Q9WA 5C0IA 2JB5H 1EX0A 3D8MA 2CIIA 1C12B 3V0FA 5GGTL 2O26U 5T5NF 2XKSA 2PWHA 1SHSA 1R3HB 1D6EB 3QG7L 4NP4H 2WSKA 1O6SB 1MF2H 3EJZD 2AQTA 1RUAL 3GIVB 2WCPA 4I2XB 1HHIA 1KCBA 3TV8A 3MRBB 2N4IA 1KT2B 2QVMA 4OI9A 3V4PA 4QRRE 1OAXH 4OGZA 5F7WC 3VFMB 5B3JF 4M48H 1LVEA 1UD5A 5GISL 3RU8L 3VXMB 3WNMA 1QRNE 3LKRA 3FT4B 2APTA 2BP8B 4JLRA 1WVZA 3WFDL 3VFTB 1ZHBB 3ARFB 3MRGA 1DUYB 3P4OA 2JKRM 4WI0A 3QUKA 4UM8B 5CP7A 3X11A 2VZOA 1XGUA 3PY9A 3LS4H 3QR0A 3UIYA 4B3EA 3T9WA 2P8PA 4PGBB 2UWEA 2XRAH 3NCYP 5LG6A 2AV7B 2Q1EA 4QXTA 4ZMQA 3IJHA 3O4OC 1H15A 1T21B 5GS2H 3T0EE 2NT1A 3BFQG 2GW5A 1JS4A 2HFGH 2Z8WC 5DD0L 3EDJA 3WNIA 5IBLD 5I23A 2JJWA 4Z7WE 5JNYB 4E5XG 1KXTA 3HUJE 3E2HB 1PX3A 4X98B 5CJOH 5JHLA 5DC2A 5C2BL 1R9FA 1T1YB 4F1ZA 2JQZA 3OAYH 4HULB 5C0CA 3OMIB 3F05A 4X9HA 3VTAA 4MS8C 3C5SA 2EO1A 1CTNA 1RUQH 3OKNA 4FQIH 4EUPA 3CVCA 4IBQA 1HYSC 4GUPB 1NBVH 4XXWC 1EO5A 3HNVH 1YEGH 3FTSA 1KEMH 2BY0A 3HR6A 3WFHB 5EO1B 3IFLL 2NTSP 2LU7A 5JW4N 4YLBA 1FNSH 4HIXH 1R3IH 3ZX1A 1NKOA 2JF1A 2VXUL 5D7IF 1KY7A 3L3GA 3CMGA 3W0WE 2FLMA 1BM3L 1CGUA 1IC7H 2PYFA 2ITDA 3QXVA 4CN1A 1D9KD 4OKVB 3PHOA 2Z6FA 5I1KL 3K6SA 5FAAA 1KJ2A 1Z5HA 2QHLA 4P2OA 4Z77A 2NY2C 2V5SA 2JJTA 3IM1A 4PJFA 2WYZA 3KH3A 5DUBB 3ZYIA 1Q9OB 4A7GA 2IG2H 1A6ZB 1FORH 1JZEA 5EC1A 3HB3B 1RZ7L 1A4JB 5FF6A 4M7KL 5I15H 4HX1B 4JFFD 4AJVA 4YHYB 3OKMA 3AG1B 5C0BB 4MMXB 4HLZG 2I9TB 2R0LH 5GJSH 5FO8A 2VKXA 1JDAA 3MCKB 4L0YA 5B1BB 4YHNB 2F54E 4JHAL 3B2XA 3KR3H 2ZUWA 4QF1A 5HD8C 2AMGA 5HDBB 3WTYA 5C2UB 1BVNT 5DVOA 3UTOA 3FPYA 1XF2B 4Y2NA 4RIRB 1RERA 5BRZE 2IH1A 4DTGL 1FO0H 4LASL 3WEOA 3BP7A 3CZFA 4WFHD 4X8JA 4X8GA 2W0PA 5HHMB 2DJSA 1KCUH 2OMVB 4N0UA 3H2WA 4K73A 3FT3B 5GZNC 2GABA 4GG6B 1U91A 5CMAB 3IBOA 5I17B 3RWFA 4PP2A 5TJWK 4KFMA 4OLVH 3IN2A 4DWHA 1ZSDA 1DN0B 2FT6A 4H2CA 3F62A 5GS1C 3WIAA 2KDYA 1JF1B 3SE4C 5E9DB 3U2SA 2NY3D 3OR6A 5AW3B 4GS7C 3O9WA 3VA6A 4BINA 1QSFE 1OTTC 1Z9LA 3DJSA 3PQYA 3JWNC 3GBNL 1NMBL 2R2HA 3AVEA 4JRYA 4ZPVB 3U1SL 4BEIA 2WTOA 5HP5A 1I7UA 3BQVA 3GRGA 4Z23A 3SYAA 2H8PA 1NDGB 4N4YB 1MCPL 4YHIA 2X4TA 5ECJE 4QLWA 2NYZA 3GXMA 3KWUA 4H20L 2P42B 3HLAA 2BIIA 3L1EA 4WUUE 3V0EA 3ZR6A 1AP2B 3W11C 7TAAA 2BWDA 1RZPA 3LY6A 2E7MA 2NMSA 2CJUH 5E99H 1AHKA 1Q0YH 1QLRB 1UWEH 1MFBL 1YY8B 4N2KA 1WAAE 2XJKA 1UZGA 5IKCA 3K72A 2OZNA 1Y1DA 4PHXA 1H0DB 2Q3ZA 1J86A 3V4VA 5DJXB 1BIIA 5GRYA 2YC1B 3TPKA 1U8KB 4K94H 5SWSD 5JOPD 3S5YA 1CFVH 4PS8A 3DTXA 4H2AA 3LEXA 4C4BA 2YPLA 4WHTB 4BUHA 2VR5A 1QSED 1A3RH 3D5OF 3NFSH 3WHXA 5I1HH 4K23L 1KBBA 1CDUA 3QIBD 1EZSA 1DL7L 4BDVB 1E5BA 2J8UF 4P5KA 1WD8A 5I0VA 2PCXA 2B59A 3OB0H 4FEIA 4N1HB 3TVMA 2LLNA 2EZ0D 3V55A 3F7YA 1Q1JH 4U1JA 4YL9A 3REVA 3HAEA 3DETD 4L4VA 2VGLM 2ICEB 2QQNH 4IHBA 3DJRA 2BIPA 3C6LD 3MBWA 5IFHH 4J3UA 1DQTA 1WIUA 1A9BB 1ID5I 3QXAB 4NX0A 1U8IB 1AHWB 1TJHH 2B0SL 3I6GB 3K2UL 5F9DC 2VNCA 1U8LA 1UA6L 4LEOB 1JJUA 1XSIA 1ZGLP 2E7LA 2XWCA 2FO4A 1HHJA 3GMPB 4PGDB 5ILTH 3SBWA 1FBIL 4H8WC 3FB8A 1OP9A 2BNUB 2DY2A 2HTLC 1FVEB 2PPCA 2G4GA 3FB6B 4P2QA 1ZHKB 4NAMA 4MJ6B 4UU9A 5HYSA 4X6CF 2E8YA 4F5CA 1OZTG 4NKMB 4S10A 2H0PA 4XXDB 5FKPB 1YQVL 4M62H 3U7AA 4BIKA 3QEGH 1MFEH 1TZHB 1W72A 2CRYA 3QXWA 1VKXA 3VI4B 5H94A 2P3YA 4MAYA 2VC2L 3FRPB 3WAKA 5D71H 1IAIH 5LCVL 1SXCA 3G3LA 1H19A 3HCVB 4M4RA 2CMRL 1CC3A 4O51A 2XZCH 4A39A 3CZKA 3OWEA 4PJXE 4CVZB 4ETQA 5EG6C 4YFLI 3GSNH 1KYFA 2J8OA 3VD3A 4OGXH 2OTPA 1ET5A 4L23A 4PQXA 3NJKA 5MEQB 1IGCH 2VQ1A 3VTMA 5JXAL 2HG5B 4OIIH 3MV9B 1B4LA 1HCZA 1BQHA 1KGXA 3MV7A 1WO2A 4JHWL 5E6RB 4GRWB 5ADPL 4O4YL 2YKKA 2CAKA 2ATAA 2B20A 4ZX5A 1TEYA 4X7FC 4L8CA 2HKFH 2PXYC 3GRWA 3Q6FB 4FNUA 3ZE1B 4XCCH 2XIIA 2IWGA 3WY1A 3ZHFA 5IMKA 3B9KC 3T0AA 3DX3A 1ZLVK 2DIAA 3PREA 5IB4B 4G6JL 1II4E 3NQIA 3U0WH 5IW3A 3P4NB 4P46D 4FN0A 5IVZB 5BMFL 1A7OL 3DVNB 3QO0B 1GVIA 4M7LL 5ITBH 1XTLA 3JWOH 3QB7C 5KVFL 35C8H 3MHZA 5AALA 5D7LD 1P9MC 3O0LA 5GRWA 1WFNA 2WYIA 4XNMA 5EIQA 2PTTA 4BA0A 5B39G 5FOBB 4RWHA 5CKAA 1S46A 5FYKL 4IJ3B 1M1XA 3IPEA 1CXLA 3AW5A 5CEZE 5EU4B 4ZPTA 1HH6B 3ZPDA 3ECVA 3KPRD 3BVTA 4GNKB 2J72A 3LRLA 1NIAA 2ZXEB 5C09A 3K8KA 4WEBH 4NO5A 1MHPL 4YDIH 1L9SA 1NQBA 1H9DA 4M6OH 4AM0B 5EU6A 5FYJL 5IHUL 5FGBA 2PYED 1ACCA 2XVKA 3E8UL 4WO4A 2EXTA 4NYLB 3EZJB 3DUUA 3KDPB 4LKCB 2ZXBA 4K4KA 1MI5D 4UIKL 1F2XK 3HI1B 5J3HD 1FF5A 1S7VA 4WI5A 1BJ1J 4NZTL 3B2VL 2XTJB 3K0YA 4PLKD 1UQSB 1S7RB 2DDQH 5CZXD 5EIIG 2Y72A 5AD0A 1AKPA 4JPWH 1U4EA 5DJDB 1JHKL 1XR8A 1G4RA 2XPGB 1KC5H 4XODA 4Z7OB 4Q4EA 2XWRA 1AANA 1CVSC 3MYZA 4MA1C 1KBWA 2NX5A 4PJ9A 5ISZE 3WIIL 3KPMA 3INUL 4XCNB 1J87A 1W8EA 4WWID 1GSKA 4EI5A 1T20B 1OCZB 2JTDA 4DP7X 2X3CA 1I3RA 4G71B 3L1OH 3PHQA 3B5TA 4KAQL 4WEUD 4NBZB 2Q8BL 4M7JL 2CDGA 5DFAA 3K46A 2ZXWB 2Z93B 3QAQA 4HQQH 3GEFA 2ZUQB 4UAOB 1UXSB 2RACA 3MI6A 1I8IA 2EAEA 4LCWB 4RWYH 2DH2A 3IDGB 1EA9C 1GZPB 1TKWB 1U9KA 2IANA 3Q0HA 4Y4FD 1MW1A 2QQQA 4GQ9L 4XX5A 2VM3A 1DVTA 3Q8FA 1FLRL 4EIZC 3WAJA 2GJ6E 1XXDC 5D7JD 3JXAA 4WTXA 3P3RA 4KVNL 4FFWC 1QACA 5E8DH 1HOCB 4NRYA 4Y88A 5T33L 1YDPB 2R7EB 2RB8A 3ARBA 3CC5A 3LMJH 5D4QA 1A4KB 2KDGA 4PRHB 3GFUA 5I76B 4PJHF 2VDLH 5EEXA 2P5WD 5GSVA 3ULVD 1UM5L 4Z3HA 3RFZA 1WFIA 3CSBA 3MX0B 4YNYA 1PQZB 3F8UB 2MCPH 3QZLA 3HZKB 3QXUA 4AY0A 4RAHA 1TZIA 1MCEA 2X2JA 1S4IA 2K70A 2MTPA 4YX2L 4GMSL 1H3PH 3JUZA 3JSSA 4YO0A 1K2DA 2JJSA 2F53B 3U7WH 3VQMA 5AZEL 1D7BA 1U8CA 3EYQD 4AENA 4EDWL 5AVRB 1URLA 3TFKD 4N0FB 2WXLA 2CU9A 1JTPA 3U6XS 3Q5OA 4PWIA 5B21A 4PM1A 4DP4X 2ARJQ 4LSTL 3G7TA 5INDB 4NQVB 3MACH 5FUZL 4ECNA 2EECA 4GY4A 1G4MA 3WIHA 5B38G 4HKBB 1J1XL 2G2PA 4PJAE 2VB5A 3ZYZA 4YSCA 2OZ4L 4QDGA 1Y18B 2ZKWA 5J6HA 4I1PA 2WQXA 3BPNB 1RXLA 1GJIA 2WLKA 5DD1L 1X5ZA 1WIOA 2ZYSA 2LT9A 4UV7L 5ICYA 1U8QB 3QJFB 4Z8FL 1P4BL 5BS0A 2X1XR 4F33A 4M61B 5MP6L 3C2SA 4XP6L 2GTWB 3Q2WA 3V6ZA 1DQJA 3SSGA 4U1SA 1TZGH 5BQ7A 1A6UL 4XH2A 5CLXA 4H8UA 1FL3A 4GBXB 5LGKA 1ECZA 1F11B 3VXRB 4L4TB 2CXKA 5L4JA 4U1NB 2BSSA 3A67L 2RALA 3DIFB 3ZKNC 4PW4A 5KS9E 4MJID 4Y16A 2HG0A 4HHGA 4R2GB 1T1ZB 1TQCC 5EBMA 4EOWL 3NEEA 2MHAA 1Z5LA 1J8HD 4ONFH 3RJQB 5JMRA 4FL4B 3P73A 5E0QA 3TYFA 2I9LA 4P4KC 2YIHA 2A6KA 3HC0B 3O6LL 1IT9H 1CFTB 5IROA 3UAJD 1Q9KA 3VGFA 1TQSA 2PPAA 2YRPA 4WI4A 3T8XA 4BRJA 1GW0A 1NGZA 2OS7A 2Z7WA 5I1CL 5ADOH 5AVWB 1AQDA 2MQCA 4PYHA 4G11A 4FA8A 2P44B 3BZ4B 2Q6WA 2ZNWA 1KB5L 1E2ZA 1U21A 2OA9A 4JM2D 5T1LD 4YDLB 4NUQA 1XXFC 1X4XA 2ICWB 1BVLB 4NQCD 2CIKA 5DK0B 3MLWH 2NW3A 4D9RE 3SKMA 3RPKA 3OTTA 2IQAA 4QRBA 4UT9L 3L1FA 4DKDC 1QQDA 3CXHK 1HZHL 4XMKH 1IGYB 4FTVD 4KXCA 5L4FA 3L8QA 3T2LA 3QS2A 3OKEB 2VAAB 2ESVA 2RFXA 1UHVA 2VDQL 3CBRA 2KC0A 4L29A 4AW7A 3AG2B 3Q6GL 2VQTA 1QEWB 4P5TA 3BRGC 4MZ3A 4ALAH 4HW6A 2F7RA 4Z7UB 3UPRB 4TQ8A 3FU5A 4NC1E 4OLXL 4I0PD 2BSBA 4WUKL 4ZAKB 4XNYL 1QFWH 4U0RC 5LGJB 4XO9A 4OV5B 4G42B 3IYLW 1MAJA 4UWQB 4Y2DB 1RZ8B 1VADA 3QQ9C 4M1DL 3EG9A 1I8KA 4RETB 5DYOB 4LLQB 3BEWA 2LTQB 2H3KA 1KGIA 3RX8A 4GQZA 4EVNB 3RWGB 2X89A 2R0KL 3F12B 5CHNA 1X5HA 4GPVA 2BDNH 1CFNA 3CIQA 3IDJA 4F7PA 1DJYA 4N2IA 4PRIE 4WIQA 3IRPX 1DQLL 4ONHA 1AFVH 1XVSA 4LSSH 3UDWC 1HNGA 7PAZA 1H6FA 3O11B 5GS0D 1E4KA 4F2MB 2DQUH 5JLZB 2FQDA 4F15B 2QZQA 4HIIB 5IBUB 5J9PB 3QWOA 3IVKA 1SYVA 3KJ6H 3EBAA 2ZX8A 4MXQC 5CGYC 4HYTB 2Z3FA 2C3HA 1FN4B 1WS8A 4WWOA 4L1TA 2W9DH 3ZZSA 3SE8L 2YD7A 1JV2A 2YA2A 4I1NB 3M1BA 5T1MA 4E0RA 4M00A 4OUUA 1KCRL 4XNAA 3KEHA 3V0VB 1BFTA 1ZLWH 2Q7AA 5DVKA 3GZOA 3T4YA 3TWCH 2QHRH 1T66D 2WXPA 2F5BL 1J9SA 4RCAA 4ZW6A 2X4OA 1UACH 4AQEB 2V33A 3V9EA 4XBPB 1TDQA 5F9AC 2FWOA 3Q8BA 5LQBH 1ZVYA 5K9JL 3QJHB 3ECBB 2PCPB 3MNZA 2BIMA 1UM6H 2EDDA 2FB4L 3QUYC 1JRHI 4M5ZL 5ABAA 4HKJB 1HCYA 5JTWA 1I1FB 1MFUA 2CKBA 2AJVH 1N0XH 4X6EB 3ZZ1A 4FEMA 4H8PA 4JKLA 2XWDA 3QHZL 4PJEA 1ACYL 4H5SA 3V9CA 2X42A 3VXMD 2WBXA 3LD8C 1GGYA 1NC4B 4JPKL 2OMUA 2BM3A 3ARFD 4XN2A 2YFOA 4EEEA 1M7IB 2PP9A 4MFHA 5JR1L 1V55B 1LEKB 5AVTB 1UEYA 2WIIB 4FQCH 3A0OA 3GBML 5DFTA 3WSQH 3AY2A 4PGCA 1OWWA 3SKOA 1W80A 2CQVA 5D7JA 3X1GA 5BZWA 3ZDXE 4Z1PA 1USQA 4QTHB 4RQQB 2YD9A 2UWEE 1RZGA 3CFUA 4LOUC 1I82A 1NKGA 1WUZA 4E9YA 5T1DH 1KCSL 2VN4A 4PG9A 5CIPB 4AVIA 1RURL 1JGEB 2HFFA 1AGDA 4UTAH 1E6JH 4S1SL 4N2OA 3BIKA 2Y1VA 2XA8L 4I3SL 4FF9A 4UQ3A 1GYAA 4BGDA 5HGBB 5L8KB 4JG1L 3AU0A 4MNHA 4PV9B 3L3DB 4UTBA 4OLZL 4DUVA 4ZXBC 1XF3B 3P77A 3NN8B 1J9CT 5JIDA 4FXKC 4HPOL 1TQVA 2JMRA 2K0RA 1INQA 1OM9A 1TT6A 1WBXA 1JGDB 5JW4R 4NLAA 4U1IB 3V0AC 4F7TB 5EF1A 1QLFB 4HFUH 4JM4L 4DN4L 8PAZA 1SJHB 2XXGA 3JWDC 5DHVB 1LO3H 1N10A 3UYPA 1OM3H 1KB5B 4NM4H 3SY0B 3BAJA 3IFOA 3VI3B 3RGHA 1FZKA 2YD2A 3GB7A 3DKHA 3UYRH 4CJ0A 2UY6A 4TNWF 1AJ7L 5J56B 3CX5J 3BH8A 4K3DL 4PJFE 4TNEA 2HN7A 3HB3D 3WEMA 3O3BA 3BDYH 3Q8AA 5DMGD 4B9JA 2XC8A 3HR5A 1TITA 4RA3A 1ONQA 3V8OA 1RZFH 4OZHB 3UP1A 1EAPA 1HL8A 5C0BD 2ZONA 3RWDB 2J5WA 4TUUA 1H3TA 1IM9B 1TJGL 3LZFH 1A7QL 2VDQB 3FTUA 1SDAB 2WGXA 1MNUL 3QUGA 3QDAA 1OO2A 3OZLA 1OCWL 5ESQB 3SDXB 1CXIA 1CGSL 1TLKA 3FSWA 3R0NA 4PTTA 2J55A 1ET7A 4GT0A 3LEYH 1G7HA 3L4TA 4JZNB 5IK3A 5M94B 4X7TB 2Q76A 3RVUC 5HHMD 2BP5M 5D6CB 3FO2A 5CCJA 1WHPA 5DGRA 5AOZA 1BQSA 1AO7B 4KK9C 3GNML 4N0UE 3HRZA 3QDGA 1TYEB 1VCBC 4X9IA 5KJ7E 3KL0A 1UWGL 2GITB 5E9DD 4NM8L 4BQ8A 1HWWA 2ORBL 2AERT 2VLRA 2R27A 3MREA 3O2DH 1N12A 2F08A 3BAEH 4R7DB 4WU7A 1KY6A 3MA9L 3SQRA 1U8PB 3HNTL 5F89A 3FTXA 4CSTA 3UDWA 1RZIA 3R7QA 3GI9L 3MGOB 2W1NA 3UYOD 1LO5A 3PQYE 4K8RL 1KJ3H 2YGQA 2O72A 3M6DA 3NJLA 4JRYE 3T1FB 2J1WA 4XVTH 2AEPH 4K5MA 4DUWA 1I7ZB 2FD6L 3T0WA 3RYMA 4PW9A 5C97A 2PCFA 4TL5A 1MCKA 4AV0A 5TGBA 5H2BA 4PD4K 2OKMA 4G7SB 4M1GL 4V1DA 1CF8H 5JHDB 2X53A 2P43B 2I85A 4PVMA 4UQIM 3KPNA 3O2VL 3SKNB 1L7TL 4QHMA 1SY6L 3KWTA 2R51A 1KYUA 2BOCA 4N86A 1X3DA 4GRLA 1D6VH 5DMKA 3TV3H 3AGWA 4YFLF 1KN2L 1XHHA 3G9VA 4JM0A 1G6RL 4KTDH 3ZR5A 1FLTX 1XO8A 2W91A 4MJ2A 4PTUB 5FYJU 4KRPC 4Z76B 2W88A 4DERA 1AR2A 4Z3IA 4ZMZA 4TOYL 2EE3A 5E5LA 3CFNA 4GYBA 2WLMA 4K9EC 1OQXA 3BN9C 2IPUK 4TNWK 1NJ9B 1RJLA 2YPLE 3HHSB 1H6EA 2X2YA 3M8OL 2DYRB 1KYDA 2DMBA 2OI9C 2YAPA 3U4BL 3ISYA 2Y5TB 3C2AL 2HWZL 4QT5A 2ZCKL 1D5ZA 5C7XL 4QYOA 2PW1B 1QFPA 4ODXA 3L95A 5JW3H 3HZMA 1MY5A 4KKNA 3PAYA 4PRPB 1F3JB 1LJMA 4L4VE 1FNEB 3EBGA 1AXSB 1DLFH 3QQ3A 3VFRA 2D03H 4Y2OA 4XPGH 4TVPD 1WAEA 4ORZC 1RJZA 3VWKC 1E3FA 4NAQA 2DBLL 3SKJH 2DWSA 2ISDA 1PLBA 1SMOA 5HY9A 4E9QA 1NOLA 2P5EE 1XGQA 4RGNC 3CFMA 2C9QA 2EIJB 5MI0B 5IWLA 1FJ1A 5JOFB 5F93C 3T77A 2OP4L 4ZTOH 3I50H 4HU8A 3TA3A 4Y5VC 5FGCB 2OMYA 1W91A 3CFQA 4UUJB 3QG6A 5KVDE 3CDYA 5JZ7C 2CO6A 3LNGA 2AEWA 4F5CE 1F56A 3P0VL 2UUDH 3VD0A 2F0CA 3LDBC 4HWNA 4H1LG 4XB8A 4HXAH 2QVFB 3RL2B 5DGQA 3H9YA 3D0AA 2E5EA 3CFKB 1ZPUA 3CHXA 1ACZA 4S2SA 3JTSB 3EJYD 3O41A 3VUAA 2OQJB 4FXGB 4DOHE 4TPRL 4QRFA 5D8JL 4JDZB 2B14A 4K5PA 2X6VA 3W9DB 2VDKB 4HWBH 1YEDB 3DSNA 3NCFB 1EHAA 3EDKA 3MV9D 1L3NA 1MFVA 3WJMA 3N6YA 3VFOA 4N3UA 2YGNA 2NSXA 3QDMB 1CI5A 3MV7E 5E2VL 4RMUA 3TH3T 1X5JA 1NFDB 1JFQL 1B88A 1VEPA 3KM2A 4I0CC 1QP1A 2HJFB 4UQEA 2N1TE 1LO2H 4FQXB 1AXTH 1S2EA 4GW5A 4KFZC 4RFEA 2Z0UA 3VG0H 3FN0H 2ZCHL 1WUNT 5DFVD 2A99A 4HJGB 3HG0A 2R4SL 4FERA 5E2TH 4BWTA 3RVXD 1JPEA 1NMAH 1W2KT 4KKCD 5F1NB 2VITA 3AAZB 4MXWH 4UT7L 5FDWB 3O45A 3BT2L 5F72S 5TFSH 2CHWA 4M5YH 4IMLB 4A2EA 5I8OL 3GIZL 3GS4A 2OJZH 4FG6C 1J1OH 3O8XA 3LVTA 3N1MC 3EH2A 5FLUA 1YMHB 4X5PA 3X17A 2BINA 3OHXB 1N4XH 2H2PC 3QCVL 1NGQL 2DIEA 2HLEB 3WOVA 2C4FT 3RTQA 3EO9L 4AIZB 1I9IH 2FIKA 2LQRA 5C09E 3T2PA 3WENA 4MJ5B 4EI6A 5E6IC 2VN7A 3V0JA 3ML9A 4ZMAT 5EU6E 1NCJA 4NJAL 3AS3A 4AGPA 2XTJD 5LNEA 3WS6C 1MIML 1EUTA 1NCCL 3LVEA 4WRLA 5D9SA 1C16B 3FQ1A 2AVFA 5EUOE 3PGCA 4QRQB 2PO6B 1A14H 1Z9NA 3STLA 3EJTA 3U25A 4YHML 3IGAA 2C9PA 4XPHL 4YPGB 3T0EC 4PRDB 3OLIA 4U1GC 3AITA 3F5WB 1YEHL 1DQVA 2C7UB 2NX5E 1LQBC 3PP4L 2IADA 2XQBL 2ENYA 3N1GC 4MA7L 5F9WB 2W95A 3CXDL 3DIVA 4JDEB 2OYLA 1BQLL 3WEXB 1AXIB 1R3JB 2IV8A 2Z91B 1PX4A 1XIWA 2EICA 1WE5A 3FTZA 2VABB 2ZE0A 1G6RB 4LCWD 4DP5X 5D1ZA 4WFHE 2HVJA 4YBQD 5AW1B 2HLAB 4X80L 2PWFA 3D50A 4NHUA 5C0GA 3F6JA 3K4AA 3S35H 3TF4A 2IANE 2X4PB 1NWPA 5DHEA 1OLZA 4U7KA 1CBVH 4MKMA 1EZUA 1NWOA 5D7SH 4F9PC 3U46B 2WXMA 1VGKA 3L2NA 3MUGA 3X13A 3NZUA 4PRHD 3DX9A 7FABL 2ADJB 2P8LA 4ZS6C 4PWGA 3SYPA 2CPUA 1XZWA 3ZL4L 4KJPD 3V7AE 3LN5B 4FP8H 3AREA 3BO8A 4Y4KC 1ZHNB 1OK8A 2G75B 2EABA 4PI2A 5E7FA 3WFCH 1S9VA 2F53D 1OWRM 3D4ZA 2AQ3A 2NNFA 4GAYB 2WWKO 4PCSA 4N24A 1ZTXL 2YN3A 1BLIA 2FWUA 5MENB 2ZICA 3GJEA 3B1UA 2QLYA 4QO1B 2R1XB 2DQDH 3D4CA 4HG4J 5AVXB 1E5YA 3OPZH 3HHRB 5IVXB 4HS3B 1SMAA 3KCPA 3Q01A 1GS7A 2ADFL 1KB9J 2JJVA 2XWTB 5JPMA 3BESR 4NZJA 3RWCB 5KVEH 3A4FA 3S7GA 4G9DA 2GI7A 4XZUB 4ABUA 1ZS8B 5I8EA 5HVHC 1RZKL 1U3HC 5EC2A 3P02A 1QSEE 2CBPA 5AAWA 2WXQA 2GCYA 2TSAA 4P5MA 5JQ6H 1TEFA 3A6BH 4JRXB 4HIJB 5BS0E 1IEAB 1ZD6A 2VSMB 1C5BH 3HBGA 4S1RL 1KLFB 2XV0A 4G8GB 4GBXD 3RG1C 3HJ0A 1CQKA 4LLYB 3STZB 3VXRD 2PWDA 4L4TD 1R5IB 1W0WB 1UA3A 3S35X 3L4XA 5DC9B 3DXAA 3LV3B 4H88L 4GAJL 3VGEA 5IB2B 3OV6A 4ADIA 2F74B 1NCAL 4TXVB 3HN8A 4GXFA 5DEGB 1HHGA 3PWPB 4R2GD 3SQBA 2ILLA 4FLSA 4WKZB 1OGTA 1SBSH 3V52L 4I87A 5K59E 3FQTB 1UTDA 4W4NA 2Q20A 3HLKA 4UQAA 5DHDA 1HS6A 3QRFM 5TDPA 3HN3A 3SYOA 1YNKH 5KVGL 1D5RA 1JN6A 1L9TA 2R59A 4URTB 5HYJB 4LPTA 4I3GA 3BSHA 1P2CA 4N28A 1KBGL 4L8SC 4YXHL 3ABLB 4X4ME 2DLFH 3WN5B 4YAQA 4J8RB 2APVA 3LHPL 5EPMB 4ZX4A 2A9NH 2NY5L 1WICA 5F6IC 5AW6B 3BOVA 3ME0A 2IPTH 1IC4H 1X5LA 5LB1A 5HJ3A 2WKLA 3WV0A 3FQUA 3JV5A 5L2KA 1AQ8A 1MCQA 5F7YC 2VW7A 3LNEA 2R69A 1TTGA 5JPNB 3ZMRA 4HF5L 3SEPA 1SEBB 4NQED 3V0WH 1Z66A 2PF6A 4N8VG 2FE0A 3EADA 1MREH 3FAXA 4DGYH 1IB5A 1PZUB 1WPCA 2J57A 5FYJD 5C0ND 2O6CA 2WLLB 1AC6A 2R9HD 2GFBB 4R26H 2AEOA 3EJRA 5C0DB 4CN6A 2D8KA 1H8NA 3OM3B 5DS2A 2I26N 1UZ6E 5IHZB 1M6OA 3HG1B 2E9BA 3NSCA 1VENA 4YOKA 1WFUA 4L1SA 1KYOK 1T7WA 1G1YA 1EEYA 4X4XB 1V3JA 2ESVE 2EXYD 2WNKA 4KJQD 5D96B 3VRIA 1OV8A 3PAVA 1MRFH 2E0PA 1VPOL 3L9RB 4ERSH 1Z9PA 4J28A 4ZAKD 2QQLL 4FMKA 1T7XA 2NCMA 4JFTA 1N9PA 1JXDA 2Y07L 3EKCA 4MMZB 5CUSL 3NTCL 4Y2DD 4P3CH 3GXIA 3QWNA 4YIQA 3EZ8A 3KJ4C 5I16A 6CGTA 1EGJL 5T5FL 4N2FA 5A2AA 5TE7L 3EGDB 5CCKH 2EDKA 1G7PA 4FQ2L 3VSVA 3S5LG 1OGPA 1ZA6A 3ZIMA 2KBGA 4JANA 4QTIL 1BZOA 2E4FA 4N6RB 2DIJA 4OGYH 1YEKH 2VJXA 3D3VB 4FG4A 4JKWA 5SWZA 3RWHB 4DEPB 4J4PD 3KYKH 4TNGA 1IGIH 1JNLH 1UB6B 4JPIA 4QRPA 5D4JA 4B95C 3ULUL 1J88A 1AQKH 4LDCA 4LIQE 2QTEA 2VXQA 2VUOA 4NZRH 1EHXA 2OMZB 3WDIA 1FFOB 2HKHL 3OKKA 1CCZA 1EXUA 4WI3A 4XTRD 1BVOA 1GPOH 5I75C 1CYWA 1ZPLA 5FECB 4MB1A 4Z3EA 1CICA 1AI1L 4KJWC 1DQQB 4GIOA 3TNMB 4C56B 4QIRA 2DOCA 2YSTA 2J25A 3EJJX 3GXPA 4KKBD 5KTEL 1MWOA 1TVBB 3VFWA 4Q9BA 1ZIBA 2GB2A 5KJ4A 1SDYA 3JTTA 2JQAA 4MX7A 5DJ8A 1CT8B 4TULL 3ZDWA 4QWWD 1NFAA 5FLVA 3T6XA 2Z31B 4IRZH 2W0FB 3QAZC 2NY4B 2KPWA 5EZJB 3ZHDA 5L88H 3N44B 1OF2A 4GKNB 5I19H 1D5IH 3ZKSD 4XX1E 2WANA 3E0GA 4ZUWB 4APQD 4W6XB 2EDNA 2EDRA 3DPBB 5MHSE 2K6ZA 4PREB 3DGCR 1HYRC 1N18A 5CBEA 3SO3C 3FU3A 3RNKA 3TBSA 2AC0A 1FSKB 5JOFA 1U36A 2GSGB 5KSVB 2G5BA 3L3OC 1NLDH 1DVFC 1MG3C 4NO2B 3FOLB 4PJEE 1KPRA 1P5VB 1HI6B 5ETUA 2KZWA 2HPOA 5FGSA 1DVUA 5LWYL 5HDRA 4MQ7A 1OGAA 4JCLA 4Z0XB 1YRKA 1ZVSB 4JO4L 4N0CD 3WLWD 1ZT1B 3HS9A 4CL7A 3OAUL 1AGEB 15C8L 3VO0A 1U95A 2Z8RA 4NWUH 4PAZA 5B1JA 1ITBB 1FFNA 3MGTB 5ESAB 1NAML 2NR6A 1XBDA 3FMGL 4C58B 1V5JA 2EE9A 2WZ6A 2Q5BA 2XN2A 3CJJA 4RRPA 1FWXA 1NCWH 3IMRA 5FFGA 5KW9L 2OXGA 3GSXB 5DT1L 5BVPL 3BX7C 1W6WA 2PKDA 2W38A 3RVTD 2WP3O 1MELA 1QBLH 1QEXA 2IAAC 3BKMH 3RTLA 2NXZC 2MPAH 4I4WA 4JQXC 3S3BB 2GQHA 1DBKL 1MFCH 2DWEB 2E7DA 3QJXA 1I75A 3CVIL 1CXFA 4RAVA 2XN0A 1E27B 4EIUA 1SVCP 2LU3A 9PCYA 5INCB 4KBPA 4GXUM 4XBGA 4W9ZA 3ZTJH 1R17A 3DX8B 2VR3A 2Y7QB 1TVDA 5DHYA 3U0TA 3L4YA 1AKJB 1AS8A 5T3XL 5AYTA 4M3KB 3QK0A 2BC4A 5FM5M 4HH8A 4KV5F 1RLWA 3ESNA 4AZUA 5JORB 3H3PL 5F7HA 2NY6B 3TLRA 5LXGH 2BCKA 2HUHA 4MWFA 1MLBB 5HHQB 2IPKB 1XH3A 3ERXA 3ZRSA 3HMWH 3JV6A 5L2JB 1TCRA 2ERJB 4G8EA 2XG4B 4EZKA 4P3DA 4WHDA 4YLCA 2KHAA 1HKLL 4JFEB 1U8JB 4QMEA 1A7NL 5GGTH 5D1QA 3QG7H 4J1UA 2WB7A 4MD4B 1GW6A 4GOSA 2JE8A 1RUAH 3SY6A 4LLWA 4AL8L 5D1XB 2NOYA 2YAFA 4BFIA 5CD3B 3K5RA 5HI5C 4CGTA 2UY7B 2YSSB 4OSUL 3OKLB 1IQWL 4QCIA 3EW3B 3P0GB 4HWZB 3VJ6A 5JIHA 5KAQG 3VFVB 4MJ4A 3WMPA 4HKZA 3FN3A 5HHOA 4TUJB 5DFWH 3RU8H 1BG1A 1J8HE 3IAQA 1K5NA 3WFDH 1K4CB 4ZOCA 2EKSB 5EOTB 5B7MA 3S96A 1AO7D 2Z8VC 4QXUL 2X6AA 4XHQA 4FHKA 3VRJB 4X7CC 5ESVB 2IH9A 4FJ6A 3ZGHA 1ZA3A 4JFYB 5CEXB 3MUY1 4UOW0 3GS0A 4Y7MA 5D72L 2QQKL 1DQKA 2ZUXA 3QDGE 4IU2B 2DAVA 3BSZL 1MUJB 5ELIA 4CDHA 4OGQC 5DEJA 2GIMA 3EGXB 4IHOA 4Y5XA 4GKZA 5C08A 3UAEA 2VLRE 1BHGA 5DD0H 5F1IB 1B0RB 2FR4A 1IGJA 1W8NA 2OR9L 2W0KA 3BLBA 1PEZA 3NZ8A 2DIBA 5C2BH 4LGPB 4BV1A 4ZQKA 5C0FB 1HHHA 3BI9X 3NBNA 1A6PA 5CZRA 2EUVA 1ZIAA 5EOCL 3TJHD 2ZP8A 2DQJL 2J88L 2AXGB 2AXWA 4K9JA 3K1DA 4A55A 1DJXA 4NC2B 5JQIB 4A6YL 1DVQA 5J0BA 1Z0NA 4Y1AA 5JHDD 1X6NA 3L3HB 1YY9D 4KKAD 1G7IA 5EUKB 3UMNA 5JW4M 1RK0A 5IFJA 1ADWA 2OTUA 1S9XB 3IFLH 3MNVB 4L8BA 4EQ2A 4V1DE 3GUTB 1F18A 1KXVA 2Q2LA 3FB5B 3L4CA 1IAKA 2AK1L 1XCQA 2VXUH 4GI9A 1JK9B 2WV3A 2BHUA 4LDOB 4GSUA 5K39A 1TZ8A 1BM3H 2Y6SD 4I18A 1KWGA 4QRUA 3F7PC 2QKIB 3WTUA 1B3IA 4GRWH 3H4FA 4FYRA 4RESB 2CRZA 3ARDB 5A2BA 3QQXA 4YZFF 1GA2A 5DS8A 3EFFB 4M56A 1RZ7H 1SXSA 1C1EL 4M7KH 3HOGA 2JK5A 1IV8A 4R7XA 1UZ8A 1L0PA 4I88A 3TJEL 1I7RB 4CADA 1UUNA 2BMKA 4PRPD 3AABA 4PJCA 2A4EA 4Q0XL 2EE2A 1EZLA 3MZGB 3PAUA 2DLEA 2LFGA 4N90E 2Q8AL 1JZ2A 2IGFL 5AYUL 3LQAL 3I85A 5F7MC 3WKYA 1NAMB 2X5PA 3VXSB 2CLVB 4DTGH 3D0VB 4LASH 5F9JB 4K94C 1R6VA 1Q9LA 3AMKA 4TSAL 4J2QA 1JF6A 1UFUA 3SJVB 5FWRA 2J1YA 1LNUA 4O00A 3QXDB 2JWYA 3BZEB 3K3QA 2EH7L 2AV1A 5EBGA 1B0GA 3NP3A 1AD0B 3K2KA 4ELMB 3B7TA 1AOZA 2J4WL 3ZU8A 1EO8L 4MSWB 4APQA 4CRPA 4NC1C 1PY0A 3UTTB 4FHJA 1A1OA 2DQ6A 4MDJA 3GBNH 1YQ2A 1NMBH 4JREC 3U1SH 4WW1B 2EDQA 5I1LB 4D8OA 4JZJC 5DJAB 3EBIA 5CN2A 4XBMA 4RAUB 4PGEB 3L2LA 4WENB 1C08B 3GGWB 3BD5A 2KMWA 4H20H 4HUXB 3ATAA 4GKSA 3QDMD 3PABB 2HT3D 4ZMOA 3F64A 3C9NB 5HI4C 3IETB 4MLIA 4KXAA 1MFBH 3QQDB 4W4OA 1T89C 4PJ7A 4PLJD 4FQXD 4LQ1A 2K8QA 4MHHI 1I1AC 1O9VA 2GUYA 1UJ3A 1VA9A 3FU9A 4I5BA 4KJYB 4PN6A 1PZCA 1SDDA 3RKPA 4XCEA 4K2UL 3VXOA 1U58A 1KTLB 3ZRFC 1YMMB 1CZ8L 3AB0C 4ZMLA 4FKHA 5DO2C 4DP9X 1A5FL 3WTSA 2YUZA 4Y19B 4P8QA 4OB5L 4K23H 3ZQ9A 5DYFA 4NQXB 1ZAGA 3RGVA 1DL7H 5IG7B 4BYHA 3A47A 1A2YB 2B4CL 2RJMA 1TMQA 2P7TB 3RY5A 1S7SB 1XAUA 4FCHA 5L8LB 3CFEA 3QH3B 1E5ZA 3V4PH 4Q6IC 1CFQB 3TESA 2H26B 2LLLA 1FZOA 1NDMA 4L9LB 1GY2A 1HEHC 3H56A 1CN4A 3NRQA 1KCVL 1OAUL 3GHBL 3K2UH 4IIQB 3TO2A 2A5UA 1XR9A 4QRTB 3ULVF 4ONOA 1FBIH 4NRZB 3MPCA 5FX3A 3RA7L 2AS5M 1JF5A 4HCFA 4LZKA 4NHCL 4B5EA 1VEOA 3ABGA 1P1ZA 5BVJA 5KAQF 6PCYA 1CDBA 4G6FB 4IRJA 3DO4A 2PO6D 1YQVH 3NGBC 3KLLA 4LVNC 5BXFA 3Q7JA 2J21A 3BUBA 4AIXA 3FU8A 4WI6A 2H1PL 2DL2A 2VC2H 5C0BE 4AV5A 1I8MA 4A6YB 3AADB 3ARGB 5LCVH 4AQAB 4Z7WF 1KFAL 4KZCA 3HUJF 2CMRH 4ZG1A 2W07A 5HDBE 3D05A 3THML 5FHBL 4MJJA 1E9QA 4O02A 4TNVK 3ECUA 5T1JA 2XFXB 3B2UC 3I9GL 3ZE0E 2E74C 2XTLA 2DQEL 5JXAH 2X10A 2BHZA 5MEOA 5HHME 4WU5A 1K3IA 4JHWH 1H8SA 2B15A 3GF8A 4O4YH 4ACPA 5ADPH 2DV6A 2X1OA 4G7VL 3SCMC 5EA0L 4U1KA 2BP0A 5F3BA 1XAKA 3AC0A 4RBPH 5TDNA 3IGKA 5I6XC 4XE0A 2XVGA 2C3VA 2F58L 1SXNA 3QUML 4MQXD 3CH8A 4J5VA 1IGTA 3FO9B 1GY1A 5IV2A 2R15A 4YC2B 4ABVA 5BMFH 5D2NB 5AL8A 4Z7VA 5KVFH 4M7LH 4KKLD 1BPLB 5F1KC 5K9QI 2JJTC 4XRCB 4YDVB 3WG7B 5F6HI 2NQCA 4XI5D 4ODUB 2XG5A 4GAGL 4HT1L 5FYKH 3MNWA 3PUCA 4YSQA 2PR4L 2Z4QA 5AB1A 3AUWB 2VR4A 3Q13A 4HDIA 2BY1A 2X7LA 3APNA 5MEND 3CH1B 3AJ7A 3LKPA 2DMKA 3GM0A 4H25B 1M4KA 4X83A 1MHPH 3J2PA 3X3GL 1NEZG 3K1KC 2BCMA 5LHDA 4X6CB 1JNJA 5FYJH 3WMSA 5IHUH 1SNRA 3A3YB 4CW1B 2CDFA 1A22B 2YOCA 4HCRA 3E8UH 4HU2A 1RMFL 4JM2F 5ITFA 2WXRA 3WE6B 5BV7C 1S7XB 2HH0H 2XN9D 4AEEA 2NYYC 3MRLA 4UIKH 1V7ML 3G5VB 1TU2B 4F7KA 3RX7A 4WFFE 3W3BA 4AT6B 2WM0A 4WW2F 4UMSA 5I73C 1FHNA 3B2VH 3V0GA 5I30L 4JRXD 2IGTA 4HIHB 4PJIF 3GSWB 1JHKH 3C8KA 1EHLL 2GEQA 4KWUA 3KPOB 4G8GD 2PMZA 1N59B 1SUHA 4NRXA 3ZE2B 1G9NC 3WIIH 1NL0L 3KBEA 2CE6A 5K93A 1EFXB 1AZZC 4J12A 3C60B 4YSTA 2VE6B 4IU3A 4LEBA 3PWPD 2ENQA 2XLLA 3UJIL 4E5XB 3O9WC 1DEEA 3DXAE 4AQZA 4KAQH 2PPEA 3E7JA 4R4BB 4OCRL 4X6DB 5F97E 2PETA 4EDXB 1QVOA 3BQUC 2CO2A 4M7JH 2Q8BH 2WAHA 1BOGB 1M42A 2B3RA 32C2A 2ZXQA 4TVPE 4AV4A 5I2IB 2EYRA 2D7OA 4LLDA 1IBZA 4L48A 5HYJD 2TRYA 1R5WA 4FNTA 5IOKA 4Z7QE 3LYRA 3BW9A 1MVYA 5DZNA 5BW7C 1CYXA 4JFPA 5AW9B 4GQ9H 5IW1B 5F7UA 4G7RB 1KWKA 1G0XA 3FQNB 1UT1A 1DVXA 1FLRH 4HEPG 4X2UA 1KNOB 2ENJA 3IS0X 1NCBL 1A1MB 2YUVA 1AOHA 3QIUD 1EJOL 2K8MA 4S1DC 2IAMB 2Y36H 4KVNH 2P4AB 4FFYL 1WZ1L 5B8CC 1BBJB 5JW5A 2IEPA 4Q2ZA 2XWJA 5DJ2A 5T33H 1KGYE 2FRGP 2VDML 4PR5A 1YEFL 2X4RB 4XAKD 2HRPL 1UM5H 5L2KE 3EOBA 2C1OA 2CH8A 3T2NL 1NUGA 1BLNB 4KI5D 5IEKB 2ICWI 4Q97A 4GXVL 2PN5A 4X99B 4YX2H 2OMNA 4GMSH 2WNWA 1V7NL 1HSBA 3E6HA 1A6TB 3D18A 2H45A 3MJ8A 5AZEH 3HG1D 5L4MA 3ETSA 4PJ5B 4EDWH 1AS6A 1G7QA 1TO4A 4YFEA 4B5ZA 1YUHA 4N5ED 1E4WL 2BFVL 3DV4B 4TN9A 4LSTH 4FYQA 5FUZH 4XGZA 3ZHKA 5EF0A 5I66B 3KYMA 4M7ZC 3O0RH 1N5AA 1GS6X 4XP4L 1J1XH 4P2RB 1F4YL 1VFBA 2CO7A 3X14B 5C0AB 3UH8A 4F7CB 3MV11 1R3LB 3LIZA 3QEUB 3QORB 5DD1H 3QYNA 2E7LC 3T3ME 2WQ8A 4EN3B 1P4BH 1T7ZA 4PJDA 4BSWB 4PCTA 4Z8FH 4PIRF 5MP6H 5E8NB 1G0YR 4XP6H 3FT2A 5I5IA 2NNAA 3HEIB 3R18A 4TKWA 2J1ZA 3D3VD 1A6UH 4XN9A 1SZNA 1WITA 1HCVA 3BXNA 4IOIB 1LE9B 1DSYA 3DROA 1D5XA 4F2FA 5KSUA 1M1SA 1COBA 2NZ9D 4HZLA 5SWZE 1XQ4A 1YJDL 4GAFB 3RURA 3N04A 1CFBA 2XBTA 4D8PA 3QA3A 4QRPE 3A67H 3NJXA 3SZKC 2OM5A 1GIGL 4JFQA 4X6BA 4S1QL 1G9MC 4EOWH 2HVBA 4WV1A 4MGXA 1DHKA 3QUMB 5C3IA 3AQZA 2JKNA 4WLCA 2UZPA 2WZ5A 4P9HL 1FL6B 4UT6A 4C56D 2QPUA 3DWTA 1SUJA 3O3DA 3MRRA 4M9PA 3GRWH 3LJ3A 1VF5C 4B9IA 2Z31D 2YQBA 4Y1TA 1E2WA 5I1CH 2NY4D 1SJEB 1J8KA 2Z1KA 2O61A 4WEEA 1B2WL 3OX8B 1NGYB 2Y22A 3MRPA 1URZA 4KUCD 2Y23A 3EDFA 1KB5H 2H0JA 2JI2A 5DD3L 2GJZB 4GW4A 4JPSA 3ROOA 3WJJC 3SKUD 5IB3B 5ES4B 1JXFA 4E2OA 1XH0A 4U6VL 4UT9H 3UZVB 5HPMB 1P4LA 2LHAA 2XACC 1KTBA 1HZHH 2JELL 4LEEA 5BZDB 5DUML 2P48B 2HCZX 2OW7A 4RRPM 4TUOA 5IUSA 1IKNC 1JUFB 1KTKE 3S36L 2XQYG 5JA9A 1OAXL 5F88B 2EUWA 1OGAE 3F84A 4FYTA 3TIEA 3T71A 2V5YA 3Q6GH 4FHBD 3NCXA 1BZEA 3OXSB 3ZDZE 1I3VA 1FZJB 3ALPA 1QBML 3FCTB 2XOTA 5F7FA 3IXTB 3IMTA 4OLXH 2EDTA 2YHGA 4WUKH 1WWBX 2TSBA 4XNYH 5K9OB 2VMFA 5A6IA 2R23B 1TVHB 3C5ZB 5GGRA 2Q9OA 1Y6KR 3LS4L 5FGBC 3UERA 4NENA 3ZJAA 5J57B 4PMFA 1D9KC 2N7BA 4WO4C 5T1KD 2VN5A 3T65A 4M6NL 3IRCA 4M1DH 1X5YA 2BVPA 4OZFA 1IM3B 2YUWA 1A6WL 3WUWG 2NCEA 1KG0B 4GG6F 2R0KH 5AG8A 4M4PA 2OJEB 4JO5A 3TBWA 3KYOB 5EU5A 3PF2A 4XNBA 1JMZA 4N2MA 4LFHG 3MOAL 5E95B 1DQLH 1Z1WA 3PYCA 4PJ9C 4QAWA 1LO0L 3NCBB 4U6XA 1TENA 1AKJD 2UXVA 4WWKB 1CE6A 1ZGLA 4FQIL 2VXSL 1S8DA 3SGEH 4FFZL 2WWOA 5I1AA 4KNQA 5IQ7L 2CKNA 1CD1A 1N0LB 2NY6D 1E4XI 2V3FA 2XN9A 3A4EA 4HUWB 1TUPA 5IW6B 3KM1A 2MOQA 4A2MA 4WTZA 5L9DL 3ALXA 1KCRH 2FJGA 4MLSA 3TBYA 3H42L 5ERWB 4LO9A 3K71A 4JFED 4YDJA 2F5BH 2H6OA 1PTZA 3ZMNA 4DEWA 5IBTL 1XF5A 1BPVA 2DWTA 1P9MA 5K9JH 1WG3A 2HFEA 5D1XD 3DMMA 4LVHB 2FB4H 4G8FA 4M5ZH 5D1QE 5D2LA 3FQRB 3IF1A 3LPOA 1BD2B 4JFZL 2AJZB 4NN5B 5KYXA 4QRSB 3GSOA 2Y1ZA 3TIDB 1WA0X 4ZUSB 3QUXB 1S7WB 1IQDA 3QHZH 5B7FA 2IMMA 3LSOB 1ACYH 1CLOH 1RPUA 5B39B 3DPDA 4JPKH 3SDCD 1ES0B 1ZS2A 3PV7A 2A77L 4KROB 2XKUA 4TYUA 5HHOE 4XO4A 2WVVB 3P4MB 4H4NA 2DQTL 1QR1B 1BFVL 5JR1H 3LKQB 3GBMH 3FHQA 3MJ9A 1OE1A 2WBWB 3QIUA 2WINA 3BGAA 4M8VA 1E5UI 3TPUB 4AUJA 5H35B 5DCCA 3T3PB 4Y9BA 2ZKYA 1H3VA 4AXWA 3QEQA 4RZCA 3BAYA 43C9B 2G3ZA 1KCSH 3ULUD 4UILL 1RURH 4GI6A 1ZWIA 4EUPG 2FX7L 4Z18A 4S1SH 5C08E 4RISL 4OD3L 4NQEE 4A7SA 2VDNL 2XA8H 3NJNA 1F58L 4I3SH 3K8MA 4HH9A 4JG1H 5EIIB 1FYTA 3UTPE 4GUCA 4LCIL 4OLZH 4M8QA 3WE1A 4ES8A 2E86A 3QIBC 4DGWC 2FNWA 5DZLA 4HPOH 1AIFB 2P24B 4O2EA 1UUSA 3DETC 1TTFA 4OZ4B 3KCWA 5J11B 4P23B 1NOFA 2JIXA 4P2AA 3I6KA 3L13A 4Y1AE 2AKRB 3B9EA 3VI4F 4JM4H 3T6QC 4DN4H 4GAAA 1GS8A 1G7JA 1I31A 4GI8A 3CDZB 5FO9A 2C3XA 3MRFA 4YVNA 3FQXA 4ATWA 3NVQA 1YNTB 1IC5L 1ZDQA 2Z7YA 3IFNL 1PDKA 1BFOB 1KIRA 3ARDD 4BWUA 1AJ7H 3DVGA 1MHEA 4K3DH 2I7SA 1UD2A 4OZGF 5KN5A 2OYPA 4KH9A 1BVNP 2M8XA 1DBJL 3FXIC 4GRWF 1KTJA 3UG3A 5FXCH 2V8LA 1OSZB 5IROC 1SLVA 2PWEA 2MSPA 3VDBA 4Q52A 2FL5B 3ESUF 1GOGA 3GS7A 3ZE1F 2EVHA 3MA7B 1PPIA 1TJGH 3VYNA 1A7QH 1UVQB 1D7CA 4PJCE 1LP9B 5FM4A 3AT9A 1MNUH 4KO6A 1OCWH 1KSRA 2R1WB 1CGSH 2CM5A 4OCXL 1Y0LB 1J05B 3NMEA 4OCYL 4YFDB 2B39A 3VXSD 5JO5A 4J3VA 3S2AA 4H8QA 3FF7A 1F3DH 3JV0A 3PJNA 1LHZA 3SJVD 1SOKA 2C1PB 4H8WL 2F8OA 3BN3B 3KGSA 2JXMA 4LCVA 4M3HA 4LL1A 5HYEA 2MH4A 4X8XA 5BJTB 4BHUI 3GNMH 3UTZA 3HZ3A 1V27A 5IMLA 4P57B 4BH8A 1UWGH 1P84J 4NM8H 5B38B 1XTMA 2C4XA 1QASA 4U6HB 2ORBH 4B60A 2OMTB 2BNRA 2O30A 3FFCD 3UTTD 1XSKA 5CD5C 5F7BA 1L0YA 3HFML 3HNTH 3LKOA 2AVGA 1FH2A 1C5CL 3GI9H 5DI8A 5DD6A 3CK0L 3Q05A 4K8RH 2E6JA 2Z8SA 5IJBC 4OJAA 4ZW8A 2CRIA 2VO5A 2Y25A 4NUJB 2A2QT 3ARXA 3IMWA 2FD6H 4LIQH 4ODTL 5KYUA 5F3HA 2AJ3B 3UTSB 4LSVL 3BWUF 5BUGA 1WZKA 1VACA 4NQSB 5MERB 4R0LC 3RIAF 4X4YB 4BELD 4C8XA 1KCKA 4M1GH 2BS9A 2BW5A 4Z7OF 3KPSA 3I02B 2KI6A 3MU3A 1L7TH 2WIMA 3G6JB 3GLZA 2YZ8A 3O2VH 1SY6H 2B1AL 4F8LA 4FKEA 1ADQL 2NLJA 4PWEA 5HDQL 4HCIA 4JE0A 1RK1A 4PJ7E 2CLZB 2FJUB 4ZMTA 4HK3J 1UENA 2J7LA 3QC6X 4OZIB 1KN2H 3D25B 1G6RH 2YKLL 5T1KA 4DPAX 3OB8A 3FONA 5GGSA 2C9VA 4U3SA 1YN7B 4F7EB 4TOYH 2GKIA 3HAEG 3KGUA 4XCCL 2QVKA 3RB7A 4PY7B 3ZVVA 4Y19D 4C57C 2R1YB 1G94A 3KXFB 4Y4HA 3M8OH 3T6ZA 2V7NA 1MHHB 1KPVB 4IRSB 4HS6A 3U4BH 3H9SA 3QDJA 4PLKC 4XPFL 3C2AH 2ZAIA 2HWZH 1JNHA 3S6CA 3HE7B 1ZHLB 2ZCKH 5L7XL 1HXMB 3T4AC 4KZDL 5C7XH 1PAZA 4MCYA 1RV6X 4B9CA 5DZOA 5KSBB 1IL1A 3VXUA 4EIBA 1HNFA 2XFGB 4X9FA 1QZ1A 3GSVB 3MLZH 1D5MA 2YGOA 1RUML 1VIWA 2O5YL 2A74C 1FO0B 5GS1B 5HYSG 3MV8B 1HSAB 2K4AA 1U0QA 4GS7B 4WSJA 4GO9A 1M3IA 4WTQA 2DBLH 2YPKB 1EVUA 1NCHA 2YD1A 4LNRA 2CG9X 3MLXL 5CSZB 2J56A 3NSJA 3OZ9H 3L5JA 3DRTA 3FTGA 4BSVB 1YAIA 2VDNB 2FVNA 4JFOA 2CR3A 5IQ9B 2OP4H 4EPSA 2BVUA 3L4UA 4G6FD 4A63A 1AH1A 3CPLB 4LPUA 4MDRA 4MNGB 3RBSA 5DJCA 4CU6A 4HBCL 4JB9L 4A1RA 4GRMB 3SGKA 3PWUA 3BRDA 3M45A 2VLLB 3P0VH 4ZTPL 4JVUA 5D7JC 2V2WB 1UXWB 3U6XA 4BBWA 4BM7A 4LL4A 3ARGD 2IV9A 4N1CA 3APDA 3PUUA 2A83A 2DDQL 1BQHG 2KLRA 1G7MB 2I07A 3S98A 4XN4A 4QOKB 5EFIA 2EDWA 1MPAL 1HILA 3GMLB 4TPRH 5D8JH 3ULVC 4WFGE 3PWLA 3T2QA 5E8EA 3SDCA 3QQ4B 1KIUA 4A04A 1ID2A 1WIPA 3D2UB 3KBPA 4J8QA 2IBZX 3IGFA 3SE9L 1KENL 3G04A 3CLEL 1EH9A 5LAXA 2FJHA 4L3CA 1ZDSA 3RIAK 5HVWA 4JZOA 1AO7E 5CR1A 1G7LB 3EYQC 4UDTA 5IMMA 5D5MB 2IBGA 1NUDA 1S7QA 1JFQH 5C9JB 3RILA 3Q48A 3EOAA 3NIDE 2MQ0A 2V9QA 3BZFB 1KXHA 3PHAA 2ZCHH 3VFPA 1PKOA 2EIKB 1F97A 4WNQA 3APMA 3OD3A 2R4SH 1YN6B 4R97C 3R8BB 2J6EL 1EWHA 3EO0B 2UV3A 1HQRB 1F6LL 4OCSL 4ZX6A 3PWVA 4MAUL 1F4XL 1N26A 1OP4A 4U7SA 1C8PA 4PS4L 4UT7H 4Z7VE 4AEHL 2EDMA 1FVCA 1ZOXA 3BT2H 4AQ1B 5I8OH 1I9EA 1IE4A 3GIZH 1MCDA 4F8NA 1BF8A 3D08A 4JMNA 2EEXA 2V7HA 1LEGA 1FVDB 3BGFC 5ACMA 3QCVH 3DX6B 2ZOKB 3RDJA 2DD8L 1NGQH 4Q56A 1CXHA 1ZLUK 3GO1L 3EO9H 3NJVA 4AMWA 3B6SB 4RSYA 1PKQB 4X9GA 1MVUA 3QZMA 3GPEA 3QFJB 4RNRA 5A3ID 1CD0A 3T65B 2CDEB 2CGYA 4NJAH 4OFPA 2H32A 3HKFA 4WI9A 2BVQB 3MBXL 3LPPA 4JMXA 5C07B 1MIMH 2I7OA 5IJVA 1NCCH 3NJJA 2LU5A 2WZPA 3WCYA 4HIEA 2ARJB 1TZAA 1HOEA 5DZJA 5HYQB 2H3NB 1FH5L 2AJYL 4D0CA 2LAAA 4XNQA 2MEJB 5F21B 4YHMH 3VGAB 1OE2A 3IJEB 3MCLL 5SX5H 2NUTA 3D6GA 1MHCB 1EFXD 5I9QC 3NIGB 1INEL 1BAFL 3C60D 1S9YB 1ORSB 4OU3A 4Z7UF 1YEHH 1MOEA 1JHLL 4FXKA 3PP4H 2XQBH 4MA7H 2PXYB 3CXDH 1FFQA 1I9JL 3QXTA 2DQGL 1BQLH 4O2CB 3B9KB 3ZDYB 2CJTA 2R0ZL 4WW2C 3ZTEA 1JSYA 1D5BA 1NUFA 3L9EA 3MTXA 1L9QA 4M6AA 2J3SA 2VMEA 4RFNB 4NDMA 1AGBB 1ZV2A 3I6LE 3KDMA 1EANA 4X80H 4AE1A 2CBTA 4R4ND 5I5RA 4UYQA 2XV6B 3V7AG 1J5IA 4G1MB 4HWUA 5DJZB 2IAMD 4AI7A 1PFOA 3FFCA 3ARYA 4AVJA 2A4ZA 4NKDA 3UEQA 2FGZA 1R3KA 5CKGA 4G9FA 4JQIA 3CLFL 2DMHA 4YLQT 5F9OL 7FABH 3BCDA 3VFNB 1OSEA 2BNQA 2GAZB 1TQUA 4RBPK 4JN2A 2EDJA 3ZL4H 3VXQB 2W80C 2R4RL 5D7IA 1KF9B 3ML8A 1O5DT 3UABA 4MCZB 3UBHA 2K6WA 5DQJB 3PNWB 4JN1L 4PJ5D 5FS5A 1UOVA 5D7EA 3P30L 4KMLB 3AQYA 1K8IA 1ZTXH 2O5ZL 4MA8L 2AW2A 3ABZA 1M2VB 1PNCA 5FK9B 2YPVL 1CGYA 2GVYA 1CIUA 3E1F1 5DRNA 1HFUA 1QSZA 1MCWM 1Z9SA 1GYWA 1UASA 2Z1PA 3KYNA 4PY8I 3VGGA 4P2RD 4QNPE 2YEVB 3IFPB 5ID1A 5GS0C 4AOFA 2ADFH 4GFTB 5C0AD 4HFWB 2VO8A 5KANG 1SJVA 2G30A 4LAQL 3QORD 2P80D 2QT6A 4NS0A 4R96B 1NFKA 4RDBA 1KGWA 2FSEB 3OF6D 2J44A 4EN3D 4E9VA 1K72A 1N64L 1RZKH 3K74B 5IIEB 5EN2B 3V5HA 2E9IA 2VL5A 4Y5YB 3WN6A 2A1WL 1WAPA 4PJDE 1C5DB 1QFWL 1YO4A 5IWLC 5B3NA 5MEPA 3IDIB 3JWNE 1T66C 1SF3A 3IXAB 3GI8L 4S1RH 4YSSA 4PHZA 4BZYA 1GJUA 3FTVA 1U92A 3BH4A 3TA3C 4W9IC 1XGRB 1WBYA 3OQ3B 4R90L 4N2LA 1WS7A 1UXLA 2GUOB 4H88H 4GAJH 1SM3L 4ZZKA 4JE4B 3KNBB 4PH8A 4U31A 1NCAH 4JKPL 4UQCA 3CHSA 4WGVB 2Q7YB 3C6EA 3AT8A 2CHNA 4QUOA 5IT2L 3EFOA 1QI3A 3V52H 4HHWA 1IGML 1FIEA 3NEXA 3BH9A 4URKA 3H9ZA 3W5MA 5LLIC 3IRZA 4OLYL 1DDTA 5JDSA 1UKSA 4TV3A 5C6TL 5C9KA 5KVGH 4JY6A 1A7RL 1UWXK 3L48A 1N7ML 4FQQA 5FCUL 3T2OA 1KBGH 2QGEA 4CNIB 4YXHH 3VXNA 3N41B 1ETZB 3KJ6L 3F7QA 5CZVL 4D2NA 1MWAL 3LHPH 3OAZH 2NY5H 1F6AA 2CALA 1HINL 5EEZA 1NBZA 5EO0B 3QJQB 2IH8A 4B50A 2AXFA 2IWKA 1NGXB 1QWNA 4IOSA 5CBAB 2GC4C 3MTRA 4DK6A 1NGWB 3MLTA 2EKJA 1FHGA 4P59L 2CUAA 3KAAA 3MV01 2XU9A 2VR8A 5DA0B 5I5JA 1R24B 4J3TA 5DDHB 3NPZB 5ACZA 3S2CA 1TLMA 2AEQL 5H37H 2VLJB 1N0XL 4H44C 4PJGB 1H5BA 2C8NA 5CEYB 3RJDA 2ITFA 3CN1A 3LKNA 4JAMA 1HHKB 1UYWL 2VXTL 3O3EA 4NAJA 4OLWL 4WJ5B 4LSQL 4J3OG 4NNYA 3QZPA 1GOFA 2ADIB 4OZHF 4ORGA 3QI9A 4OFYA 3U1QA 2UXFA 3L3IB 1U8OA 5CU5A 2KH2B 2J8UA 3FULA 1VPOH 1LD9B 4AK2A 3QDHA 2DM7A 2QQLH 1KULA 4X5QA 2NZIA 3RTQC 3C5ZD 3SGDH 2Y07H 5CUSH 1NM9A 2FEEL 3KPPA 1XCWA 4KRNA 3SDXF 3NTCH 4ELDA 1B0IA 2WOBA 1EGJH 3DGGA 1CD9B 5BO0D 5T5FH 2BVYA 5TE7H 1ZGLM 4D0DB 4FQ2H 3ARTA 1PX8A 4NT6A 3JV4B 1IM3D 3TH2T 5JYMA 3DO7A 1TQCB 4RMBA 4G8IA 2IALB 1F13A 4QTIH 2JVUA 1VSCA 3IBEA 4U2YA 1TTUA 3BGMA 4ZUTB 1GRWA 2ATKB 5DMGC 1PZ5B 3CFCH 5E0FA 1IBDA 2X1WL 4HS8L 3FYEB 5I8CB 1LEIB 4H1LB 2OV0A 4P4KB 3D87B 1LK2B 3ULUH 4B27A 4MMXC 1X7QA 4WWKD 2HKHH 3RNQA 2YMXH 4O2FB 3EIFA 5JW4Q 4RGOL 2K45A 3TO4B 2WXJA 2DEWX 1IAOB 4NOFA 1N5YL 3JWDL 1EAOA 2VW6A 3CU7A 5CAYB 2FECL 1AI1H 2F1EA 5FUCE 4M9OA 1CFSA 3WKQA 1QW8A 4MCMA 4ZSOA 3RY6C 1JDDA 3MLYL 5FGRA 5KTEH 3GZQA 2XN9E 4PJBB 1CDCA 2VUYA 3MRIB 4MA3A 2NW2B 2WMPA 2DICA 2XKNB 4TULH 4YHPA 1LO3L 2BSTA 4XT1C 3SPVA 3LEVL 3IU4H 3BMVA 1K9TA 3D9AL 2PPDA 4AIOA 4YJZL 3TP4A 3S48A 1S78D 3F85A 3DVIA 3VSUA 1XZ0A 2VDOL 3VRLF 4AG4L 2MRYA 4LBEA 4JJOA 2QR0A 1BD2D 4MDIA 1RSYA 3UC2A 4XXCC 4FOMA 5D2LE 3COOA 3QUXD 1X44A 3PWPE 4MXVE 1GZQA 3Q8EA 4DESA 4YUEL 1XH2A 1UKQA 4OD1L 3G6AA 2FCBA 3TBTA 3CU1A 1HC1A 1I4FB 2AHIA 4KROD 1ND0A 5CP3H 2VZ1A 2IIJA 3DHPA 4ZOAA 2KKQA 4XE5B 1U2CA 5DRZA 4GSXA 5E6IA 3S37H 4JO4H 1WC7B 3SGDI 3T0VA 1DP0A 1FFPB 3H2PA 2XWBB 1EV2E 1AVAA 1MJUL 2HX7A 3OAUH 3D34A 3GMNB 15C8H 4PPTA 4XVSL 1PU0A 3GBDA 4AYFA 4YHKL 3WS6A 4BKTC 1DZBA 1EHKB 1NAMH 2PLTA 3MLRL 4LSPL 1J5OL 2XXFA 3MRMA 1WISA 4PS3A 3QEQE 3HPJA 4D7PA 5JPMC 3D85B 5KW9H 5DT1H 5I24A 1GGTA 2IBZY 5BVPH 1PYWB 5DD5L 1XH1A 1YSOA 5G5DB 3HE6A 1HH9B 1K8DA 2E27L 2EIDA 3FT0A 2D31B 4KI5E 4NERA 2E75C 1E0OB 3PNRB 3ASOB 2MKWA 3CZUB 3EBHA 2ALAA 4P4RA 4X4ZA 2X38A 4W81A 3B2MA 1DBKH 1FYTE 5AAWC 1SHMA 1E3ZA 4DPRA 3CVIH 3NJGA 3G6DL 3CFDA 3LQMA 5LBGA 2HZHA 4UQ2A 2OTWA 4GT7A 2ICEC 4P23D 2B1HL 1HXYA 3RUGB 2NRDA 2A73B 2LGNA 1MWAB 2ZKHL 1MJJB 4R7NB 1BVKA 3FTYA 1RULL 4YSOA 3PGDA 5DK2B 5T3XH 2BVTA 3J07A 2ZG1A 3N40F 3KLAB 1U3JA 5J5EA 3H3PH 2V3DA 2AK4A 3QUYB 3K4ZA 1T22B 4Z6AT 1M9SA 2CPCA 9CGTA 1JL8A 1U2HA 4JUSA 5E94B 4K9EL 3RPIB 3BKJH 3FQWB 4LKXA 3FB7B 1F4WL 4D9QD 1HKLH 1VZGA 1A7NH 3LD8B 2BVOA 3H0TA 1XCTB 4JY4B 2M1KA 3S37X 4OD2B 1NFDF 3U9UB 4AL8H 1S5HA 3MRQB 1YNLL 4LCUA 5EOQL 4OSUH 4PLOB 1IQWH 3V6OA 3GRBA 3EYFA 2IFFL 4FQJL 3O4LB 3OG6B 3CDGB 1B4JL 2EIBA 1QA9A 3UPCA 2CM6A 4RH4A 3KPLB 4PJHA 2ITCB 1BXVA 3JT0A 4KOCA 3CFJB 4KITB 2DEYX 4MS6A 1DFBL 1B90A 3ZKXC 5HXMA 4QXUH 2NNRA 5T3ZE 3UZEA 2DTML 2V2TA 3EXLA 1U8MB 3MSPA 5KSUB 2FEJA 3FHAA 4C4KO 1U3HA 4ZXBB 2EE0A 5D72H 4HUNB 2QQKH 2A6IB 2ZG3A 3BSZH 4IBWA 4F3FA 3CDFA 2MNWA 1HYSD 1OEZW 2JI1A 5IR1B 4JNXA 2BNRE 5DFVC 4JKNA 2W81C 4K15A 4O5LL 4U6YA 4KRLB 3V5DA 2OR9H 2X4UB 4N8UA 5C6PB 5LNGA 1ILUA 4OTXL 4KKCC 5DC0A 4ONGL 3GM8A 3RGBA 3VNYA 1VAHA 4HXAL 1UA7A 3NZHL 5EOCH 1HVXA 3CFBB 2DQJH 2J88H 5E56A 3IDXL 3VXTB 2I60L 4YH6A 4EBQL 1R33A 1VFAB 4A6YH 4UM9B 1QLEL 1KDJA 4ISVB 4NEHB 5GRZA 3RDTB 5GSRB 5GIRB 4HWBL 3R7RA 3BT0A 1QD0A 4XN5A 4L8SA 3FO0L 3KPSE 5A16A 2AK1H 3O6ML 3Q3GB 4FFVD 3L7FA 5JDJA 2VDOB 5DJ0B 5E8OA 5FUOL 2CA4A 1I1YB 4YDKL 3BRFA 2D3JA 4FZEL 2AZAA 3T09A 4FZ8L 1CICC 3KXFD 3VGDA 2X0WA 3ULAB 1HT6A 1F4HA 4IRSD 2XTJC 3BWUC 1U8HA 3L7EA 2H41A 4DP1X 1DZ0A 4RMVA 3HE7D 4ZUVA 1C1EH 3PWNA 3ZZQA 3K4DA 2FK9A 4E42B 3EGSA 4L3EB 2AP2A 3H9SE 3QDJE 3TJEH 5GZND 2WY3B 5IGXL 2B5IC 4Q0XH 2NTFB 4Z95L 3I3DA 4JQVC 3P9WB 4N8VB 2X4QA 4JFWA 2YD5A 2Q8AH 3VXUE 4L5FE 2IGFH 4IK7A 5DU7A 1SHXA 1A9EB 5AYUH 1ITCA 3LQAH 5E6ZA 5F7DA 5CWSB 2F7IA 4QY8B 5LKNA 3P40A 1A6AA 3RVWC 1OTTD 3P3YA 1MCHA 4NPYA 5E9AA 4TSAH 4C54A 2ZUQC 3JYCA 4N9GA 2WQRA 2YWYA 4WJG3 3DECA 2ZWZA 1G1KA 2OSLB 1QO3A 4YBQC 4H40A 3UBXA 1DDHB 3M86A 3NFNA 4ZFOL 3QHTC 1NMCB 3OJDB 3WO4B 1MCOL 2YBGA 5FHAL 1FYHB 5ID0B 3FO1B 3W11D 2J4WH 1FNGA 1EO8H 4BZ1L 4JKMA 1H6UA 1KTDA 2BOLA 5B1JC 3CSFA 2HKAA 3VX0A 3IDNA 4S0TD 3DOSA 3QPXL 5IVXF 2HAZA 2JCCB 4LLMB 4QOKD 1ML0A 4K7FA 4NO0A 1NC2A 3GT6A 3S5LB 1T1XA 5C8JA 3CN3A 3N0AA 4KJPC 1BZ9A 3WNJA 1IGFL 2EDOA 1KCLA 2Z92B 3VFSB 2GT9B 4CU8A 5BO1L 1OPOA 3FCSA 4DN3L 3V6FB 1KLUB 2KPNA 3HPLB 1FG2B 1OW0A 1A6VL 3V0IA 3DHJA 4P48A 1PZBA 2GK0A 4UIMB 3EJUA 1M56B 1WHOA 3LIUA 3M17A 3UXFA 4K2UH 2H9GB 1UADC 1JZDC 1WP6A 1CZ8H 3QP3A 5DMIH 1A5FH 3DOIA 3B3IA 3TBBA 2DEXX 1JWUA 2DQFB 4OB5H 5FYLE 3P2DA 2BPBA 1M7DB 4MD0A 4RX4A 2GBTA 2N7AA 4GW1A 3PJSB 3VWKB 1CJYA 4N2GA 3L3OA 2VLKA 2ZJSL 2OYKA 1XSJA 4PRNB 5IOPB 3C8HA 3RVVC 3PDOB 1RAMA 3I3BA 4HV8A 5D1QC 3H9HA 2EVFA 4BK5C 2WHVA 2LVEA 5CJBA 1KCVH 4Y5VB 3LXUX 1OF0A 1OAUH 2F15A 4PU2A 5AWNH 3X1EA 5I74B 3GHBH 3DBXA 3W82A 1HL5A 4L8DB 3CHOA 3QFJD 1ZANL 3K6DA 3RWEA 2A6DB 4F8TA 4PB0L 1WBZB 3LZNA 1GC1C 3RA7H 2OMWB 4DIXA 5EEVA 3BUDA 4F2EA 4NHCH 5C07D 1P6WA 5DTFA 5I1DA 1SOQA 4BWWA 5E5MB 3P4LA 1ORQA 3ZUNC 3BD3A 2EEFA 1JK8A 2NUPA 1EDHA 2IJ0C 4Y8DC 1AIZA 5B3JE 3CVHL 5DWUL 2AQ2A 3MCYA 3DV6B 3RP1A 2H1PH 3KWWB 5IQMA 4IGBB 3ZY7A 2F6AA 1T0MB 1QNZH 1KFAH 3KS0H 3GSUB 4YDLC 4LF3A 3VFUB 4Y5XC 5LVEA 3TZVB 1E8YA 3MRDA 4FNLL 1R5VB 3THMH 5FHBH 3B5GA 3TCXA 5IB5A 3B9KD 2QVIA 1KBVA 2R9HC 1MRDL 2QFPA 3UGUA 3PV6B 1SQMA 1BAGA 3I9GH 2MKLC 2DQEH 3DNKA 5H8DA 1S9WB 1TNNA 5I5MA 2A4CA 5ICZA 2WYTA 1AD9B 1KJMB 4FJYA 1X6LA 3OPUA 4G7VH 1FDLL 5EA0H 3QO1B 4ODWB 3ILPA 3H7BB 3NA4A 1DLHB 4OV6F 3MROA 3CZSA 2ZSWA 3L3JA 4KJQC 3GMRA 2SODB 2GSMB 3MFFB 2QADB 3U2JA 3VGBA 3FU0A 2F58H 3QUMH 1TSRA 3EAKA 2ADGB 3FFCE 3EJCA 4ZAKC 5DRXA 3OKOA 1JBJA 5FB8B 2GSIB 2IMNA 2Y4SA 4G9FE 2DYPB 4OBRA 3WMQA 3F7VB 3O6KL 4Y2DC 4I18C 5E6YA 2J2ZB 2BNQE 4NNXB 3QIWA 1BMGA 4QRRB 4IW4C 2LTQC 5FC9A 3DIDA 3W57A 4QHNB 1F42A 4GAGH 4HT1H 5IESL 1S3KL 5D7IE 3BPCA 2PR4H 1QRNB 4RDQF 1CG9B 5I0XA 4HKXA 1B4RA 4I48B 1L9OA 2BSEA 2X70B 4J4PC 1KEGL 1E9PA 2XI9A 4R26L 3N44F 4ZFOB 2IOIA 3X3GH 3BUYA 4KUCF 4HHAA 2G4EA 4DZBB 5A43C 4FG2A 1Q94A 2EIZA 4NKIL 2FSDA 4W9LC 2CGRL 2QELA 1CFMA 1RMFH 5KYWA 4LCCA 1E28B 4U33A 3T0EB 2D7QA 3APCA 1FAIL 2IF7A 1J9QA 3MYJA 1J0YA 2ZUVA 4APXB 1V7MH 2GK2A 1MCJA 5DVMA 3DBSA 3LH9A 3MLUL 4I9WE 2X05A 4Z7WB 3CPUA 5GZOD 4KKBC 1SYSA 2AJSL 3HUJB 3PL6B 5I30H 4G82A 2G2RB 4IKJA 3ZIYA 4L0ZA 4NPJA 3SDAA 4DEUA 2YXVA 3JVGC 4AEFA 2XNAA 5ICXB 3VE0B 1TTBA 1YEEL 1FZMA 1BP3B 2NDFA 5F96L 1NL0H 4G43A 3O81A 2W5PA 4U2ZA 5ENWA 3OXRB 5CCKL 3CCHB 5SX4I 1QWUA 4APQC 2FHCA 4BFBD 3UJIH 3SQOL 1I8LA 1KIQB 3FSOA 1V54B 3GSRB 4OCRH