4V11A

Structure of synaptotagmin-1 with sv2a peptide phosphorylated at thr84
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
150
structure length
150
Chain Sequence
KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SYNAPTOTAGMIN-1
publication title Phosphorylation of Synaptic Vesicle Protein 2A at Thr84 by Casein Kinase 1 Family Kinases Controls the Specific Retrieval of Synaptotagmin-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 42
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4v11A00
2LHAA 4NPJA 2A4ZA 4QJ5B 4WWNA 2Q0ZX 3APDA 1TJMA 4IQHA 4F92B 2Q3XA 4DNLA 3APCA 3KWUA 4ANWA 2YOAA 4NPKA 1UOWA 2K45A 3HHMA 3OAWA 2CJSA 4FA6A 3RDJA 2ENQA 3L9BA 3HIZA 4PS3A 4OVVA 4OVUA 3DBSA 1UOVA 4GNKB 2WXKA 3ML8A 2YRBA 4XX5A 1DQVA 2ISDA 5H4YA 4Y1TA 5EDSA 4A55A 2CHZA 3NZUA 4LDCA 3NZSA 2K3HA 3PREA 4HVBA 4KZCA 3S2AA 4BFRA 3F05A 2EP6A 3QR0A 4FJYA 2D8KA 2WXMA 3P2BA 4F1SA 4TV3A 5T8IA 2WXOA 2CM6A 4HLEA 1BYNA 4ANVA 1YRKA 3QAQA 3NSJA 3LJ3A 1DJHA 3QJZA 2KI6A 4WAFA 5CCHE 4F91B 3IM1A 1E90A 2CM5A 2CHDA 3L13A 4L1LA 3R7RA 2ZKMX 2CJTA 4WWPA 3HN8A 4FLHA 4XZ4A 3RPBA 3CSTA 4FULA 5H4ZA 1HE8A 1E8WA 2NSQA 3L16A 4ICXA 3ENEA 1DJXA 4LT7A 4L1BA 3F01A 2WXPA 4FHKA 4KZ0A 4WEEA 3W57A 3PYCA 1DJYA 2V4LA 3QK0A 4AOFA 2Y3AA 5CCGE 5JHBA 2NQ3A 5JHAA 1DJZA 1GMIA 1WFJA 2QZ5A 2QZQA 4ANUA 2JQZA 4QJ3B 1W15A 2WXNA 1RH8A 1V27A 2WXGA 3PRZA 4FHJA 4PS7A 3F00A 4FJZA 3SD5A 4DK5A 3B7YA 1DJWA 3TL5A 5KJ7E 1DSYA 3L4CA 3IBEA 4L2YA 4EZLA 4NP9A 3L54A 3ZIMA 1RSYA 2ENPA 4JPSA 2WXLA 4WWOA 2WXHA 5CCJA 3FBKA 2DMHA 2FK9A 4BGDA 1E8ZA 2B3RA 2WXFA 3QR1A 3W56A 4QJ4B 4EZJA 4FADA 3GPEA 1WFMA 4AJWA 1K5WA 4V11A 4NS0A 3PFQA 3QARA 4EZKA 1E8XA 5G55A 2X38A 3PS6A 3KWTA 1QASA 2UZPA 4TS6A 1TJXA 4TUUA 4ANXA 3F04A 2WXIA 4KITB 4LCVA 4QAMB 2WXRA 3CSFA 1QATA 4MJJA 3ZW3A 4J6IA 2WXJA 3R7QA 3OHMB 1W16A 1E8YA 2CHXA 2ENJA 4IHBA 3N5AA 3TWYA 1A25A 4PS8A 4GB9A 2Z0UA 2K8MA 2FJUB 1RLWA 3DPDA 3M7FB 3T8MA 2A5UA 3ZVVA 4ICWA 3TJPA 1E7UA 4XE0A 3APFA 4G11A 3JZYA 4Y1SA 2NCEA 1E7VA 3ML9A 4URKA 2K4AA 1DJIA 1BCIA 1UGKA 2CHWA 5G2NA 3MJWA 4F93B 4L23A 2R83A 3L17A 1CJYA 2DMGA 2N1TE 2RD0A 1DJGA 3FDWA 1BDYA 2WXQA 2BWQA 3L08A
chains in the Genus database with same CATH superfamily
3MFFA 4A7TA 3KPRD 1NL0H 1FFNB 4N5EC 4LHUG 5F6IB 3S36X 2NTSP 3AS1A 3OAWA 1NFDA 5E4AA 3HVDA 2ZUVA 5BS0E 3P69A 4P3CL 4U2YA 2MTAA 1CF8H 4OIIH 4FQXA 3C8DA 1DUZB 1E9OB 4YHPB 1RUKH 1PW3A 2APXA 2NR6C 1CWVA 1YEGL 4P4RB 5K39B 1J9QA 1NTDA 1PGRB 3KL5A 3AG3B 3NFNA 4DHLA 3PGDB 1OPGH 4DKTA 1HWWA 5D72H 1DQJA 2D8KA 4HHAB 4G8GE 4KKLC 4K55A 4XCCH 2OMZA 2OTUA 1UKQA 3ARGB 3MRGA 3TVMD 4Y16D 3H9HA 2ZUQB 4D0DB 1MW1A 4PG2C 4PRHD 4KQ3H 3US9A 4URTB 2GK0A 4OZIA 4FG4A 1XBRA 1V3MA 1NBCA 3P3YA 1XEUA 3H7BB 3UTZB 1EDHA 2Y7QB 3ISWA 3AW5A 3GLZA 5KSAD 5J3HC 5B1JC 3WTSA 2X4TA 4GW1B 2IMNA 1UCBL 2R59A 3HBZA 3PQYB 3PXLA 4JZJC 3MO1A 1MCCA 3IFNL 1DJZA 4EN3C 2PW2A 5AFAA 4KZDH 4WW2C 3VXMB 3WGUB 3RWDB 5LBSH 3UH8A 2CLVB 1WHOA 2DQFB 2CBOA 4RFNB 4XCYA 4YBHA 4EZLA 1CU4H 2OLDA 1NFKA 4G6JH 1UWYA 1JK9A 3AACA 2YLHA 1G87A 4PV1C 2J8HA 3VXUB 1QEWA 2G4EA 1E42A 4H1LH 2XV0A 1PSKH 1JV5A 3CFKA 5BRZA 1XR9B 3L3HB 3LRSA 4TULH 4NUGL 3GTVA 5DSCA 2MCG1 1S9YA 1WA0X 4N8PA 2WKOF 4JO2L 3W5NA 1ND0B 1OZUA 4AYID 2DWSA 5JYLA 1B9KA 2VXVH 2ROYA 3WCYA 3DVIA 2FJFA 1FSKC 1OSZA 1JPEA 4XO3A 1E8YA 3VFGH 4F2FA 3QQDB 2H1LM 1UTDA 3OXRB 4YSQA 4ZW6A 4R2GD 2QV2A 1P2CB 4PHZA 1OWRM 2NNFA 2COVD 1Q0XH 4HBQA 3ML9A 2OYKA 4JDZA 3I50H 3O3DB 2IANE 3KBFA 1OT2A 4IBSA 4P23C 4XXDB 4AVJA 4Y2DD 3MJ9L 4OF3A 1X5YA 1IAKA 1YEDB 4LPXA 3IKCB 4B9IA 2VDKL 4WEBH 3FULA 4KPHL 3FC8A 1DUYA 8PAZA 1H0DB 3QCUL 1M7UA 2LW3A 2YAQA 5CU9A 3SDCB 4YDJB 2WWKO 5DEFB 4P2AA 1OTSC 3QJFB 4YDVB 3N85L 3P30L 4E9RA 3HHMA 3QWRA 4F24A 5FHAL 1HI6B 1TT6A 4JS7A 4PJ8A 5HHVH 5LCVL 5C97A 1UFGA 2KPNA 3C6LA 3UIYA 4FABH 1BFOB 2DBLH 3UTQA 4FFYL 3C8KB 6FABH 2RR3A 3Q6FB 2PCXA 3ZGIA 1OY3B 3WSQH 4E9TA 5E94A 4RFEA 2Y1YA 1JMXA 1WSST 3S2AA 4QXVA 4MGXA 4EO5A 2EXSA 4YZFF 3KE0A 4NNYB 5GS0C 3ZR5A 4JFYB 1ZLWK 2G0LA 1KIUB 1ZT4B 1MI5D 2QADD 4MSWB 2YAMA 4N0FB 2A6IA 5ITBL 2IG2H 1P53A 4DEPC 2V2WA 3HZVA 4UILL 5F9JB 1BMGA 3IAPA 3MFFB 5JNYA 3QDJE 2X44D 1WWAX 4HKXA 4XWOD 4DP8X 2BIIA 1BD2E 4BK8A 3SKJL 4K9JA 1NFDB 1U3HA 2VR3A 5T1JA 3CNKA 4O58H 4PLJD 4DEWA 5CJOL 4YK4C 3F58H 3UPAA 3QK0A 5IFHH 4FQXB 1FIGL 4B6ZA 3T0WA 2AJYH 5IY5B 1BIHA 1HZHL 3CFEA 1NICA 2GQHA 4PJEE 5DVNA 3NFNB 3VI3E 1CFTA 1OSPH 2CA4A 5FKAA 4CAGA 3NH7L 1DQJB 3K91A 3A67H 4P59L 1A4AA 5AKVA 2OTUB 3MRGB 3KL3A 5F9WB 5C08E 3MV01 3H9HB 4GIOA 2BPBA 3PAUA 2GIMA 3SE8L 1AANA 2YLKA 5IHUH 4A38A 3CXHK 2EUWA 1TYEB 2GK0B 4OZIB 2ODHA 2CO4A 3RZCC 4BD4A 5JHLH 4JN1L 3OX8A 2LV4A 3AREC 1I7ZB 1B88A 1MFAH 2EADA 1YNLH 1DN2A 1ZLSH 3HW7A 3CN4A 1WTLA 5E2TH 4AT6A 1FG9C 1EEZA 3GINA 3NJMA 4HALA 1NCUA 2MNJB 2DQ6A 2DJUA 2OW6A 3MO1B 3N3EA 1PL3A 3WU1A 1I75A 2PW2B 3QXAA 4NSKA 4JHZA 3ZDZE 4UDUA 1GR7A 1NLDL 2DQUH 2NYKA 1QFUL 3BUTA 4C55A 2MRYA 4P5TD 2O5ZL 4XCYB 1NM9A 1N8OE 2F8IA 4NOBA 5IJCC 2H2SD 4MZ3A 1PU0A 3DX1A 1FDLL 1JV5B 3CFKB 5C3IA 2FQGA 3HG0A 3LRSB 2DEXX 3RQ3A 1YUKB 3MRNA 5DS2A 4BE5A 1S9YB 5F9DC 3U4AA 1F5WA 2JLPA 3VA6A 2B4CH 2QHRH 5I5JA 3X11A 4ES8A 3DUSA 1L0QA 2XG4A 3FH8A 3S34L 2VLKE 4X5XA 2FJFB 2A83A 2ZJSL 1OSZB 5F6HJ 5J1TC 3VSTA 1WF5A 2GHZA 2AABH 1A1OA 4PHXA 4LOFA 3VXSE 5KJRL 3CXDH 5J9PA 1H6EA 1RJLB 5L9DH 2IXQA 3W3BA 1JGIA 1OAQH 3SKNA 4YWGL 3U36A 4O02A 1CXEA 2NY4B 1JZGA 3D52A 4ZXBB 3P11H 5D1ZA 2YUVA 4WHDA 5IVZA 3GO1H 1Z7JA 4JDZB 3IDGB 3DV6A 4KKNA 2B0SH 3PXHA 4HJJH 3S88H 4WWKA 1IAKB 4GSDH 1BJ8A 2XU9A 3BLPX 4FE9A 4AIEA 1AC0A 1DUYB 5FEBA 4QY8A 3E9UA 1JYWA 1I9RH 3B3BA 1QA9B 2ZXCA 4HBCL 4HMEA 1AOHA 4M29A 4NIYE 1BAFL 4HG4J 2Q10A 3D09A 2VWEE 3O6ML 2ZCKL 2VRAA 1XHHA 5J4MA 4TUKH 5AZ2H 2PYEE 4N2LA 4HU8A 2XKUA 4PJ8B 1F2XK 4M5ZH 1AFVH 3C6LB 3MLTA 4YDLC 2XN9D 2CBPA 2Y3AA 4TL5A 1OOWA 1QFWI 3UTQB 2HVBA 5HYJA 4QYOA 3FCUB 4NFDA 5E94B 2EKSA 4RFEB 5CMAA 3ZX1A 5BQ7A 5L2KE 4FQPA 1AZNA 1XFPA 4XP6H 4MB3A 2R2CA 3F5WA 4JFXA 4H2AA 3RHWF 4UV4H 3DXAA 3RVVD 1R24B 1BZEA 1T7YA 4RVBA 2A6IB 2F58H 4PJDA 2XKSA 3MA7A 4OZGF 2V2WB 2DLGA 1ORQA 3D4YA 4KRPC 5JNYB 2H45A 2X0VA 5BCAA 3ZKNC 4HKXB 1I1FA 5IB3A 3V55A 4WFFD 3SZ6A 4K9EC 3HKZA 1D5ZA 2YGNA 3CSFA 3QUXC 1U3HB 3V4VL 5ELIA 3PJLA 3MGAA 1M7IA 3E9TA 4GT7A 4G9DA 1X5XA 2W8CA 3ARGC 4Q97A 4JPKL 4S1SL 1E9PA 3CFEB 2H2PD 1P4BL 3NCWA 4Q52A 4QT5A 5GRUH 1EAPA 1IE4A 1CICA 1R5VB 3ECBA 4F7TA 1CFTB 1BD2B 5EUKA 5FKAB 4L0ZA 2A9NH 4AEEA 1TVHA 2C7UA 1FJ1A 5C6TH 2WK2A 3NJIA 4PJIF 5CEZD 3KW8A 5D7KE 1AYRA 4ZPVB 1NUNB 1NC2D 4YE4L 5FGBA 2BSSA 4M02A 3MCLL 3BRGC 3E1ZA 1NGQL 1G94A 5DO8A 4Y4KA 3H6AA 3VI3B 2EC9U 1N8ZA 4KJPC 3SQOL 3TO4A 1F4XL 2C9AA 2CJSA 2O4EA 3LTVA 2JB6A 3CC1A 3DYOA 3OX8B 4MNHB 1HXMB 5FYJU 1OP3H 4DGYL 1JAEA 1CYWA 3DX3A 4MCZA 3BQUC 4HD5A 4PTUA 1MKFA 3DX6A 4RFNC 5EU3A 5T3XE 5C08B 1UUSA 5CCKH 4HCRH 4ZTOL 5KBPA 3T0DA 1T20B 5H4YA 3WNMA 1U8HA 4NSKB 2A0LC 4MS6A 4OI8A 1O7SA 4KKBC 4LMQE 7PCYA 3GIVA 1SJVA 3WFHA 5MHSD 2EDRA 2IDUA 2E27H 4KBPA 5AYQA 1IC4L 1HH9B 1OL0A 2P8LA 1RUPH 3GJFH 1N0LB 4HDIB 4OCWH 3O6FA 4XNBA 4FCHA 5DZPA 1DCLA 4OH2A 1BOGB 4LNVA 5DHXB 3MRNB 5A2BA 5DDHA 3JWOH 4XAWL 4X9GA 4CSSA 2XG4B 2BO0A 2QELA 4JG0L 4LL9A 1U2YA 4KXZI 2A83B 4L1BA 4X5XB 4XMVA 5AYUH 5ICXA 3CBKB 1A1OB 5DZLA 1C8QA 4ISVA 4ELMF 5J9PB 2GTZB 2QZQA 3BAYA 4JFHD 2Q6WB 4CU6A 3MRQA 5A2CA 3SKNB 3U36B 3E1F1 2FNWA 4O02B 3UX9B 1M7DA 5ACZA 4QHKI 4F9PA 1GC1L 3TL5A 5D1ZB 5IVZB 5D7IE 3CLWA 5FYLD 2JKIS 1IBFA 3DV6B 3AM8C 3RI5K 4WWKB 5IEKA 3D2UA 4MKTA 1ZXKA 3GSRA 1SXZA 2SODB 3UO8B 5E6SB 1MFDL 1PD6A 4QY8B 3ZTJG 3U7YH 1S78C 5IIEA 4RRPG 4NNPH 1AIZA 1WJ3A 2WZ6A 2PPAA 1HNYA 3GHEL 3L4WA 5ISZE 3H42L 3NIDF 1KF9B 2Z65C 2WC7A 1JG9A 2W92A 1J10A 1IFHL 1U3NA 1KY7A 3CVHA 5I9QB 2YPVL 2AQPA 1IGIH 5D8JL 4DZBA 5HYJB 4QYOB 1BVKA 3N1QC 3WHXA 3BKYH 3IEAA 2Y5TA 5CMAB 5BQ7B 3BQVA 5KYNA 2EILB 5CD3A 5SWSD 4J1UA 3D25A 3FQWA 3NZHL 3ESPA 3MUZ1 3F5WB 4ZAKA 3DXAB 5HBBA 3VSQA 1TNNA 3HG2A 1K4DA 4PREA 5DGRA 5CNHA 5AW6B 4M8UA 2R29H 4PJDB 3HKFA 2I5YH 2YRPA 4JHAH 3TT3H 1ORQB 1U3JA 3K8LA 3KYKL 2EJ1A 5KJ4A 3D4CA 4FQXC 4YXHH 3CLEH 3OKKA 3WJJC 3U9UA 2X6UA 5IB3B 4PR5A 4U1NA 1D5ZB 5K5YA 1NWOA 1I8KB 3IE4A 1BQ5A 1M7IB 3PAYA 4JRXD 2Q7YA 5DFAA 1F8TL 3FO2A 4CRPA 4G9DB 1N12A 4PW4A 5A2JH 2EDTA 4XMZA 2C9RA 4ZUVA 3WFZA 3IRZA 3MRPA 4QT5B 1EAPB 1T66D 1CICB 3ECBB 3PWPD 1KBVA 3U9WA 3O9WD 3WEAA 3GSXA 5EUKB 1ZTXE 4F7TB 1TVHB 3BZ5A 3P3UA 2C7UB 1FJ1B 4NHCH 3UJTH 3WFCL 4U1MA 4FP8H 1OGAE 1LO0L 2BNQE 1QSFD 1ZA3B 4QXGH 2BY3A 5JQ6L 3DDGA 2YZ1A 3L7EB 5DMIL 2BSSB 2AERT 2CGRL 4L5FE 4RZKA 1VLXA 4BQ9A 5GSRA 4XVSH 4FULA 4EXPX 4Y4KB 3TFBA 1N8ZB 2WYZA 2H7WA 3TO4B 4MCMA 2JB6B 4F7MA 1BPLB 2WOYA 3OC8A 4MCZB 3LAFA 4IKIA 4OW6A 4PTUB 3W57A 2DJSA 3DX6B 3OKEB 5E6RB 4MLSA 2LABA 4HKZA 2JH2A 5EU3B 3MLUL 4PJ7F 3WAJA 1KLGA 3VFVB 3NIFF 5LN4A 2Q8AH 2IFFH 5EUOA 1DBJH 2Y2YA 4HWEL 2BS9A 3I3EA 4KUCD 3GIVB 4NZJA 2W81C 2G2RA 1GW0A 4F8NA 4Z3IA 4JMNA 1N0XH 3JV4A 5CLYA 1TZIA 5BVPH 5HGDA 4ZMQA 5HHME 1SJXA 1MWOA 4DETA 3CE1A 4NBXB 2CLZA 3FXIC 1FNGA 1RURL 3G9AB 3F84A 4H8UA 4NFBA 2JKNA 3L3DA 5HSFA 1DSFL 2UVEA 5DDHB 3GUTA 2NY4C 3BUIA 5SX5K 3QIUC 3CK0L 1I1AD 4HH9A 4ZXBC 4CC4A 5L7XH 3G6DH 1DLHA 2YRLA 5ICXB 1AY1H 2DDQL 1CGTA 2WO3B 1J1OL 3IRPX 4H26A 4ISVB 4N28A 4BRVA 5CGBA 4NZTL 4Q4EA 2XXCB 2YD5A 3UJIL 4HJEA 2Q7AA 1M7DB 2C3HA 2G2NA 5HP5A 4UZGA 1TZOA 3IN2A 1VZHA 3EJCA 2DQHL 3W81A 2EDHA 5FV1L 2YD1A 3D18A 5IEKB 3D2UB 4K5LA 4PJ8C 3A6BL 3QXTA 4AGOA 4G3YL 1ZKAA 2XX1A 4NO3A 2J71A 1FO0B 3REVA 5IVXA 2WWMC 3P0YH 5EZPA 1JSYA 3K2IA 3FT9A 4KJQC 5AALA 5IIEB 1E2ZA 1CDJA 1M9WA 1T89A 3BYTA 2E7HA 3OPUA 3VYOA 3L9BA 3MNWA 4JO3H 3T8VA 3K4ZA 4LDOB 4JG1H 4OVUA 5I1JH 3MCKB 4B9KC 4Z7NE 5GJTL 2BXYA 2ORBH 3CQQA 3V5HA 5KW9L 4FCAA 4R8WL 3MLZH 3WO4B 4N2MA 2X0UA 4L8SB 1HKLL 3FK3A 4J23A 5IB5B 4JUTA 1UM6H 1BVKB 4DZBB 3WHXB 2CHNA 1ZVYA 4LSVH 3O6KH 3O0LA 4ZJ9A 4J1UB 4LPCA 3FQWB 4ZAKB 3U2IA 2X3BA 2Y9RT 4NRXA 2IGTA 3FSVA 1MCNA 4PREB 1A4CA 1DBAH 5HDQH 5C9JA 4IOIA 3I74A 1ZTXH 4Z78A 1YPZF 3EJSA 3EUUA 3EJUA 3S35X 3ETBF 2WB1A 3CGTA 3U9UB 1AHWA 1OM9A 4N0CC 5C0BA 4PR5B 4U1NB 3TN0A 1DJXA 2I07A 4L5FH 1YZZA 4IKLA 3BSZA 4XWGH 5T3ZH 1TZGL 2DM4A 4Y4FC 2OMXA 4C47A 2ZKHH 4HF5L 1QWUA 2Q7YB 2WIMA 3FO2B 2DQIH 3BH4A 2NYYD 3WIIL 2DMCA 3WXVL 3WNLA 2UUDK 4Y7MA 4GSRA 4XC3H 1NOLA 4OCYH 2UZIH 2DWEB 1A3LH 2XJKA 3P4MA 3GSXB 4H0IA 4ONGH 2DKMA 4TQPA 4DGWC 3BAKA 3LEVH 4U1MB 5DTFA 3EXLA 1EBPA 1JGEB 3UEZA 5DEJA 2F2HA 1NBQA 2R4SL 2V8MA 1LWRA 1GPOL 1QYGH 3WJLA 2DQDH 4M5SA 4YSUA 1SM3H 4LCWD 1KIQA 4M1DH 4GSQA 1KYDA 2UZXA 4U3XA 1S7SB 1AQDA 1XH3A 5DK2A 3JZ7A 3FUHA 3D05A 4Z7OF 1HCFX 3EFFA 4F7MB 1UXWA 3II1A 4N1EA 4GOSA 2ENJA 3FCSA 4HK3N 2A4CA 1A6AA 4JPIA 4NQDE 1HAWA 1KLGB 2QMJA 2D4FA 1Y7VA 1OV8A 4OF6A 5EUOB 5FF6A 1ZT1A 1CFVH 1IAIH 3DSFH 3MNZA 4NJ9H 4S1DD 3MRIA 4TPRH 3C09B 3VWKC 2EECA 1DQMH 1WISA 4EIBA 2G2RB 1FQ9C 4Z7VF 4R90H 4MAZA 3JV4B 3P2DA 4ZSOE 1TZIB 3CVBA 5HGDB 5GZOA 3PHAA 4FOMA 4X80H 4JVWA 3VD9A 2CLZB 3O2VH 4ELKA 1P7HL 5LAXA 4EZMA 1A7RH 4KY1L 1IGYB 2J6WA 1FNGB 3GIZH 1MFEH 3ARBD 4AI7A 1MCQA 1ZY9A 2WZAA 1ZDQA 3L3DB 1GGCH 1KC5L 3GUTB 1QZ1A 2BFVL 1KJVA 4GAJH 1I7UB 4P9ML 4MJ6A 2BRRL 3G5XA 3T6QC 4TUJA 1DLHB 1G84A 4PRAA 5DC4B 4ZX4A 2EXWD 3HG1D 15C8L 1BYOA 1C08A 1EHNA 1NOAA 1UOLA 4FFVD 4PSPA 1RPQA 4H26B 2HMIC 5E1AA 3V52H 1NIAA 1N7ML 5IROA 5AOIA 3SCMD 3FQ4A 4X7SL 1UKSA 1TZHB 3F05A 5EO9A 4NI3A 5DQJA 3FT4A 3QPXH 3UTSD 4F5CE 4YHNA 3VB8A 5T33H 5IESH 4UDTA 3W11C 2OULB 1A21A 3P77A 3ATFA 2GKIA 5K33A 3V7AG 3D18B 1F45A 4MNQA 1B3IA 4NO3B 2AKRA 3B9KA 4LCUA 2H1PH 3OAZK 4POUB 1MXGA 3REVB 5I9QC 5IVXB 2DQGL 2F7QA 1KTBA 1DQDH 4KHXL 2RCSH 2AC0A 2VWEC 3MNWB 2Z9TA 3BAEL 5DD1L 4DF9A 4XPFH 2X1PA 4WWID 2Q8BH 1F4WL 1IMHC 3V5HB 2NOYA 1DANU 2P1YA 2DICA 3NCJH 5DS8A 3TFKC 1NDGA 5F0JB 3VMPA 4N2NA 3WNJA 2ZOTA 5GGTH 1EUUA 3KYNA 3RE0A 2KT6A 3BMWA 1TQCB 4I8DA 2BWIA 1LE5A 4NRXB 2AVGA 2CO3A 4ZNCD 2A99A 1ACZA 4J3VA 1FFOA 5GS0L 4IOIB 1S3KL 2YGOA 4MCYA 5KBMA 4Z78B 4XZUA 1JPTL 2D9QB 3I9PA 3IE9A 4YEEA 4L8BA 3Q43A 4M7ZC 4NKMA 4BELD 2P26A 4P46C 2D7TH 2J1WA 3QNXA 2P52A 1HDMA 1UD8A 3TN0B 4EUPA 3EFDL 3UMNA 3GSQA 2ZPKH 1JPSL 4HK3J 4MB1A 5IHWA 2XG5B 3VI4E 5EWIH 3FU5A 2B2XL 4Y1SA 5DHMC 1T0NA 2DI8A 4MQSB 2K4AA 5FGBC 5TF1L 3NJVA 3P4MB 4LB8A 1I8UA 4LCIH 4Y4KC 2FX7H 3S36L 4PB0H 1WZ1H 2MJWA 4UINL 5DC0A 2W9DH 5EEZA 1PCXA 5DTFB 2X9YA 4U1LB 2HPTA 2BW5A 3MOQA 5D1QA 3WFEH 4APQA 1FE8L 5JW3H 4QDGA 1QBMH 4ZG1A 1OAZH 4N90E 3V6FB 4ZFOB 3RZWA 4AY0A 1BFVH 1KIQB 4JQIL 5EPMA 2UZXB 4ORZC 1AQDB 5I28A 1XH3B 2EZ0C 4XO5A 4GS7C 3V6ZB 2DM7A 3LYRA 4ODBD 1PJ9A 1UXWB 1A6AB 3PJNA 4Y1TA 4JPIB 5AVSB 4JM2D 1I8MA 3CWGA 5HVFB 5EBWA 5FOJA 4FNSA 4LSSH 3VRJA 4AM0Q 1IGJB 1ZT1B 3D48R 3TGXA 3ATBA 3TV3H 3MRIB 5I6OA 2LAAA 1L9RA 1OGPA 5CD5D 4HLEA 4ZFGL 4HLJA 2CKBH 4I2XE 3KWXA 2ICWI 3QAQA 4AIOA 4TSBH 4JM0A 4CN1A 5ANME 4TVSa 2XWTA 4ELKB 2ZCHH 3EO9H 5LAXB 2EACA 5CLTA 3VE0A 2LAGB 1ULVA 5T5NG 3EF7A 3NSDA 3SBRA 2IQAA 2VDRL 1V54B 3QFJD 3DJRA 3DARA 1QRND 1KJVB 3FRPB 5H37A 4ZMVA 4MJ6B 2B1AL 3G5XB 3GK8H 4TUJB 4PRAB 2E9IA 3I9GH 1X5IA 4FQ2L 4OLYH 3TPKA 2AQNA 4DGVH 5ALBL 3KPNB 5E1AB 3P4LA 5EN2A 3FH5A 3HI6L 3QHFH 4FYRA 5EEWA 5IF0B 5EO9B 5DQJB 3FT4B 2JJTC 1L6PA 2VN3A 2VC2H 2R56L 2EUXA 4GO9A 4ADIA 3KLHC 1TDQA 4MTMA 4NO0D 1KXVA 2NNXA 4Q6YA 1TJIH 1NCWH 3LS4L 4UDTB 4AYSA 3DUUA 2PO6D 3P77B 2B3RA 5TE6H 3K1KC 2GG1A 4MNQB 2AJXL 4V11A 2GEEA 4HP5A 5FCUL 3WNIA 2AKRB 1RSFA 4LCUB 5AVWB 3GGWA 1ZSHA 4ZZKA 4AQZA 2EIMB 2KC0A 3HC4H 3WO4C 4L8SC 5C92A 1KZQA 3FPXA 1RZJH 5C0AA 5HI4D 4XP5H 4CKQA 4MJJA 2DQCL 5E6IB 2JF1A 2J6EL 3C9NA 2HH0L 5CHNA 3ZTNH 1CXFA 3R8QA 2XWCA 1O75A 1SLXA 2FAUA 5BOZG 4ZYKA 4W81A 1IGMH 4YO0B 2P5ED 1Q0EA 3OKNA 3SYQA 2VDLL 3OG4B 3JTBA 5DS8B 5IFJA 4KZEL 3NCYS 1NDGB 4KTEL 1U58A 3BAWA 2E56A 5TF0A 3HN5A 5IW3A 5FDWA 4F93B 4B9ZA 2HT4C 3QDMA 4Y8AA 3AXLA 3BSGA 1LE5B 2WGXA 5M7QA 1BLIA 4G9FE 1FFOB 4D9LH 4MCYB 5D70H 2DI9A 2X87A 5E1QA 4AH2A 2R27A 5IZ7A 3APDA 1IO4C 4XZUB 5D93B 2EIKB 4BFEA 3KLKA 1FIEA 1ZOXA 4L8BB 2HFTA 4FA6A 4NKMB 2V0AA 1UYWH 3BUDA 4ZD3H 3QNXB 2B14A 1MREL 1VSCA 5KTEH 1HOEA 1HDMB 4K2UH 2J5WA 2XQYA 4ETYA 1JZEA 4K9EL 3BC9A 3INOA 2JTYA 3GSQB 4OGXL 3UTPE 4OJAA 3MXVH 3CCHA 4RDBA 2YK1L 5I76B 4HVBA 4LL4A 1OVZA 1SNRA 2I9LB 2FEDC 2YAEA 4NWTH 4ZNEA 3O3BB 3UZQB 1H5BA 2OJZH 5KYYA 2R15A 3WIHA 1EFXA 3GZKA 3B6SA 2NZ9C 1AI1L 3D9AH 3O2WH 1SN0A 4HX1A 4YBLC 1DVFB 4HOMA 1DFBL 4APQB 5D1QB 4Q89A 2ZKMX 2WQWA 4HMCA 4OZFA 3BEVA 3BP4A 1NL0L 5EPMB 1AZUA 4G83A 3OKOA 3HNSH 4JUSA 3UL4A 2H32H 1SHMA 2J8OA 2AK4D 2VR9A 3HAEG 3AU1A 4G7RB 4IRJD 4PLOB 2D7OA 2AXFA 3G9VA 5ILTL 3C09C 1VEOA 3QO1A 4J4PC 3DETC 4Y4HA 3BRDA 4XNQA 3FFCE 1CF8L 2QSTA 1JMZA 3US1A 2PCPA 4R7LA 1RUKL 2VLME 2XQ0A 3LKNA 3US0A 5C9KA 3VRJB 4FNQA 2N01B 4F8PA 1OPGL 4TQIA 4YH6A 2N0KA 4NQTA 5A16B 3MV7E 4PJ9A 4XCCL 1URLA 1P6WA 3GXTA 5L8JB 1IBGL 3H54A 2F1BA 4NKIH 4G7VH 5FO8A 2AHIA 4I1PA 4FQIH 4KQ3L 2J7LA 4JO8A 3VE0B 3ZGHA 2ZZUT 5F97E 2UZPA 3QORC 4KITB 2IQAB 5D1XA 2JXMA 2ICWA 3M1BA 4QRBA 2CA3A 3DVFA 2BX5A 5I6MA 1NPUA 4I18B 3TA3A 2OZ4A 4DAGL 3OZ9H 4AKOA 5HYFA 2FCBA 3APFA 3D08A 3FT3A 4KKPA 5IVOA 3U7WH 4KZDL 2KLSA 3VRLE 3T6VA 1ROCA 1S9XA 2J8UF 2IPKA 5LBSL 3T3PE 4GBXD 3IDXH 3QXDA 1CU4L 4ONOA 3X13A 3HA0A 4G6JL 5A6LA 3ZY7A 3DUUB 3OKDA 1YDPA 3PGFL 4NQED 4HQQH 2MPVA 3AY2A 4KWUA 3TWCL 2AXGA 3GGWB 1OZTG 5I1EL 2LQRA 3NCBB 1ZS8A 5AENA 1UJ3A 1FHNA 1J0IA 2AS5M 3C9NB 3O3AA 2IH3A 4QRRE 5CHNB 4FJ6A 3WD5H 1RJCA 1TQCC 3VFGL 1I7TA 2NY2B 4ZYKB 3Q9PA 4FG6C 1BVOA 4I3SH 2CGZA 3LH2L 5FM5O 2BOLA 4Q9QH 4GQQA 4OF5A 1YMMD 2FEEI 2FWLB 5IFJB 1FYTE 2WWNA 4GXFA 1TJHL 1Q0XL 3K1DA 5FDWB 4XHJC 3MN8A 4GKSA 1JUFB 3FU3A 3I50L 2VLJE 2ZUYA 3AXLB 4Y2NA 5BMFH 2LLLA 2VABA 2ZG2A 4WEBL 5CP3H 2IIJA 4AH2B 2JMRA 4HG4K 2KZKA 3VFWA 4L4TD 4ERSL 3K74B 1IGFH 4L37A 1LL1A 3ALPA 2QSCH 3MKKA 3IMSA 2ZWKA 1IARB 4AC4A 1HYRC 1XMEB 4P8QA 2AQ2A 4G9FB 1FRGH 3V8CA 4FABL 1D9KD 4Y89A 2DBLL 1M1SA 3FCGA 4MAYD 3T0EA 1NIFA 3CCHB 6FABL 3IJ8A 1PZDA 1H3XA 2ZX5A 1UUNA 1J1XH 3VM7A 4DZ8A 4G7QB 5H94A 1AKJA 1CQYA 4QF1A 3U25A 5T5NF 3WJLC 2HKAA 3OWRA 3UJJH 4CW1A 1X5KA 3C5XA 1H5BB 2TRHA 5KYYB 3DRTA 3ES6A 1EFXB 2IG2L 3B6SB 4Y19A 4HIPA 4HX1B 1HZLA 1PY0A 3EIFA 4QTIL 1XGUA 1XSJA 2QTVA 2XVGA 3DWTA 4MA8H 3BKJH 2EE9A 3BEVB 3BP4B 1RCYA 4DK6A 3C60A 3T2NL 3LIZA 3OKOB 4PAZA 5IQMA 5I66B 5E9DA 4K7PH 4X8JA 1MWAA 3AU1B 4YXKH 2AXFB 2VR5A 5FGCB 1X6NA 3N5AA 4O58L 3CD4A 3QO1B 1BPVA 4Y4HB 2YBGA 1R3HA 4XNQB 3F58L 2R0LH 4BDVA 1A3ZA 4OIBA 4WFHE 3TJPA 4LCCC 3BD3A 5IFHL 1ETA1 1IUZA 2AJYL 1YYMH 3TTYA 3LKNB 2VXSH 4IS6A 2C4FU 4L9LC 5HDLA 2R0ZH 3WKMH 3KDMA 2VW7A 2E5EA 1NOFA 4UT6H 3D6GA 4EBQH 3RVUD 3A67L 3WY3A 3EFOB 3FFCB 3E2HC 2ROXA 2OJ1A 1PG7W 3QXWA 3O8XD 4X5RA 4M3JA 2BHZA 3KCPA 3ZE0E 5FO8B 1PBYA 3ZMEA 2NY1B 5IHUL 5I75B 4LIQE 1J0JA 2C26A 1TXKA 2JXMB 3NACL 2B7DT 2ICWB 2WB7A 3M1BB 1CGXA 5FO2A 2JSFA 2BNRA 5C6WH 3KMDA 1MFAL 5EU7E 1YNLL 2QGDA 4K5OA 4X7TA 2VNCA 1VACA 4UB0H 1ZLSL 5JXAH 5E2TL 2W9LA 3TA3B 3W9EA 4FNTA 3S5YA 2OSYA 1ZT7A 4PRPE 1CDIA 3BZFB 3P2BA 4OLUH 1I7RA 4MB4A 3VDCA 1E4KC 2Y0SA 2DIAA 3QXDB 4PJFF 3X13B 5E6IC 1CE1H 3N6YA 3OKDB 3TPUA 3EJYD 3N9GH 4YFEA 1RPKA 3IDYC 1FG2B 1JF1A 5I30H 4BFNA 4QHNA 2AXGB 3PV7A 4U49A 4OZGA 4IIQC 2NSQA 4LQ1A 1VEPA 1ZS8B 5FM5M 1FZMB 2QHRL 3DGGA 1XCQA 1UJ3B 4PW3A 1DANT 4WZ9A 4TSCL 3TYFA 1HYSC 1KGXA 2WBJA 3O3AB 2KH2B 2IH3B 2YFOA 4Z95H 2AABL 4TSAL 3CFCH 4H88H 4OTXH 4RMWA 2G3XA 4J3OH 4P5SA 1NFIA 2KKQA 1QLEH 4M48H 3V0FA 4PWGA 4HULB 1OAQL 5D2LA 2P5WA 1CE6A 5JIHA 5AB2A 4WI9A 3RFRA 2Y72A 2G5BA 3P11L 4GKSB 1DVQA 4FQLH 4PLKC 4JPSA 4YDMA 3UZVA 5K59E 4FFZA 1CF1A 1OWWA 2XQBL 3LH8A 4PRNA 4HJJL 3KXFE 5ADOH 4PJCA 4RNRA 1R6VA 2VABB 1XL4A 3UCQA 2WZPD 4TOYH 2CPUA 4Y1AE 1XGRA 4WQOA 4U33A 4OSUH 1PG7X 1RZJC 1I9RL 2XV3A 1T21A 2WUBH 3VFWB 3QUZD 4PJGF 4L18A 2JI2A 3QWOB 4L37B 1T83C 5AZ2L 5DRXA 5A3IC 3IMWA 4M5ZL 1SOQA 1XF1A 3ARDD 1AFVL 1KYOJ 2NXYD 4QOKA 5CWSA 1T1YA 3SD2A 3FQRA 4JQVA 3T0EB 4K3JH 1T0OA 4NM4L 4GKNA 1DVFC 1RZ7H 4APQC 4DZ8B 3VFTA 5SWQA 5H94B 1AKJB 2OXGA 3V5KA 3CFBA 2M2DA 2CUMA 1YEFH 4XT1C 4CW1B 3F8UB 4UV4L 1BLNA 4FQCH 5I15H 3CH1A 4G6FD 4JJHA 25C8L 3DRTB 3AMLA 3ES6B 3LN4B 3ZZLA 2F58L 2Y07H 4Y19B 3H2PA 1XGUB 2FSDA 5C07A 1UM4H 2FQEA 1IC7L 3EO0A 3II3A 3QQXA 2Q2EB 3KPPA 3C60B 2N7SA 4JEGB 1YC7A 5LJYH 5E9DB 2QDVA 1MWAB 5JHDA 4NQUA 1NIEA 4NQCA 2NR6D 4LIQH 5CN3A 1R3HB 5D2NE 3HTLX 3FU7A 3L1EA 4BDVB 3J2PA 3ZYOA 2HWZL 3KYMA 2W59A 3PNWB 3QNZB 3FS9A 3A4EA 4P3WA 1A4BA 2XACC 1E9QA 4IS6B 3PNRB 3H7LA 2DD8H 1BGXL 3KDMB 3QYCA 4KKLD 4TL4A 5F88B 4K7PX 1S5HA 5GRUL 3TBWA 3ZHNA 2CM6A 3K2UH 1UG9A 3BPLB 1IQDA 3GS7A 4CDGC 1B0GA 4PLNC 3DMMB 4WF7A 2E47A 3ZDYE 4I18C 1YC8A 2YIHA 2L7QA 1MNUH 1P4UA 2PXYA 2W9EH 5IW1B 4WIQA 4M3KB 1G0XA 2CBTA 4XNUH 1AZVA 5J3HD 3DX9A 5B39A 1IEBB 1JZFA 4ZBJA 1J8HA 4X7TB 4R3SA 1VACB 4H8VA 3W9EB 2WXGA 4FHJA 1MPAH 3AT9A 5D5MA 5AW1B 1ZT7B 3HRZB 2XY1A 4Q9RH 2VUOA 4KO5A 1ZCRA 1F3JA 1I7RB 4I1RA 5FWRA 1RSYA 3AVEA 4LSTH 3NP4A 4FA7B 3AT8A 4M1CD 1NGWB 3VFOA 2G5UA 1A7PH 4CJ1A 4X4YA 3NJJA 4A39A 2UXTA 3ALXA 1JF1B 3N42B 4QHNB 2NY2C 4ILDA 4PRPB 4H8WH 2CR6A 1E5UI 3QIWB 5TJWK 2VERA 2EEBA 3DGGB 1WH0A 4K3EH 1XCQB 4R5XA 2GVYA 4X6DA 4XHQA 5DYOA 3TYFB 4KKCC 4WNJA 5FO9A 5FW8A 5AYUL 3KPRA 4G1MA 1KPUA 2ZG3A 3BPNC 3C8HA 4EEEA 1H19A 1NFIB 2IALB 1M53A 5D2LB 4FDWA 2P5WB 1CE6B 2HN7A 4P23D 1OP3K 1YYLH 3FN0H 3A24A 5AWNH 1A9EA 3VMNA 2G5BB 2BSED 3IDMA 4UT9A 5J7CC 4OFPA 1HHHA 2VM9A 3UZVB 1EDYA 3DSNA 4L0PB 4CU7A 5C0CE 4RNRB 4Y2LA 4K0OA 2APVA 2Q1EA 4Z5RA 5SX4H 1XGRB 1UWXH 1OTSD 2E6JA 3G04A 4NC1E 1K6QL 1C5BH 5AW2B 3U7YL 2CK0H 1MW3A 1T21B 1QLFA 2LE9A 1FL5A 4K8RH 4KY2A 4NNPL 1BYPA 1VFUA 3AAZA 3GJFK 2HFGH 4LGSB 3VFUA 3TVMA 5ABDE 2YS4A 4Y16A 4LOVA 4H25A 5B38G 5KSBE 3KXFB 4PRHA 4QOKB 4U4IA 2JCCE 2FSEA 4M43H 1W8EA 2BJMH 3Q2LA 4OT1H 3FQRB 5I0ZA 4RAHA 3RA7L 1IGIL 1WD8A 3Q9QA 1L0PA 4GKNB 4UYQA 5D6DA 2FVNA 3VFTB 3BKYL 4I9WE 4EZJA 5GS0D 3S35L 2OXGB 3V5KB 3IT8D 1CDUA 3CFBB 4Q2ZA 5K9JH 5KSAA 4N20A 1PX8A 5G4MA 3VQMA 1PPIA 2KI6A 2UY7A 1VPOH 2H26A 2XCMC 4Y8DC 4FRWA 5KBLA 5BV7H 2CHDA 2XZCH 2YD9A 2R29L 3DJSA 3ATAA 3CSYA 4LGRB 2HJKA 3TT3L 1X5LA 2FLBT 1QSEE 3FAWA 5C07B 2HB0A 2NY6D 3CLEL 1QKZL 5DD3H 3EO0B 2BZDA 3KPPB 4WI2A 5FUZH 2RTTA 3KBHE 2B15A 4KI5F 4U6VH 4YAQB 3VSUA 4J8RB 5M95B 3WL9A 1FGNH 1R3LA 2C34A 4LDLB 4NQCB 2FYVA 4I77L 2O1AA 1F4HA 2PCYA 1A5FH 4PJAA 3FU7B 2AJ3B 5CKAA 5BW7A 2UWEF 3KYMB 4M7LT 1MCOH 2EDFA 1M57B 3S3PA 1DSYA 1SJHA 1E9QB 4QNPF 4JANA 5T3XL 3IVKA 2XRAH 1D7DA 3J07A 3JVGA 1S5HB 4OJFH 3TBWB 2VUKA 3DX0A 3IS1X 1XCTA 4PYGA 4OY9A 3DVGB 2GI7A 3UJTL 4KKAC 1YQ2A 1VRSA 3C08H 4X9YA 4Z7WF 1G7HB 3H9SE 4QKTA 3TA3C 3RZCD 4ONHA 4IGBD 2PXYB 3ARED 4Y2DA 3QZWG 4XVSL 2ZXAA 3N43B 2ZQKA 1E28B 1IKFH 5IREA 3V4PA 3FKUS 3NCMA 4QRQA 1R4XA 3DX9B 5B39B 3HLAB 1J8HB 4U1JA 4R3SB 4PJ5E 3W1ZA 1OCZB 5DUBA 3SOTA 9CGTA 3MRRB 4N0YH 1MCPH 2Q8AL 3VCLA 3ZDWA 1DBJL 1BCIA 3L8QA 3MCYA 5D5MB 4HJIA 3DJ9A 2F74A 1KT2A 1NBZB 1I3RA 2DQEL 2P42B 3FDWA 1NAKH 1F3JB 3FPYA 4ZW5A 3L08A 4TVPD 2G3MA 1MIML 4F91B 5K1NA 1FO0L 1N0XL 4AV0A 3VFOB 4MZIA 2KYIA 5BVPL 2BP5M 4X4YB 3MDJA 4AQEA 2NMSA 3GBLA 5MENA 2DYPD 3BFQG 4HOWA 1GYCA 5KOMC 1GHFH 1GAFH 1S7RA 1MI5A 4JFDD 3ARWA 4R4BA 5A43C 2UYLB 1EFQA 5I6KA 4XB7A 3SGJC 1NANI 5L7XL 4X6DB 3ML8A 5DYOB 3P0GB 1AY1L 4JHWH 5FO9B 3KPRB 4G1MB 1KPUB 2YKLH 1HNFA 2RQEA 1UGNA 1AGFA 1JHTA 2VLLA 2FBOJ 1EMTH 2Z35A 2HN7B 3GMMB 2K9FB 1A9EB 2HFFA 2ZAIA 3TBCA 2VR7A 2ERJC 2GCYA 1PDKA 4YDNA 2YWYA 1HHHB 3DPBA 3EG9A 3DSNB 5AL0A 3QA3A 1CXLA 3R06A 1TQSA 3IJYB 2EVHA 2YMTA 3RPBA 2VN4A 4Z5RB 3QJHB 2UX7A 3G04B 4ZUTA 3P0YL 3T0EC 4A7UA 1CURA 2BIQA 1TF4A 2WN2A 1QLFB 3V95A 1FL5B 1JXFA 3I84A 4X6FA 3VFUB 3AAZB 3TBSA 1CXIA 1UFUA 4Y16B 2F5AH 1OTUC 4LLVA 5FM4A 3VXTA 4H25B 4J3OC 5I1JL 4YIQA 1GA2A 4PRHB 2XVBA 3PPSA 3ESNA 1Q1JL 5C0CB 2FSEB 2ORBL 1Q1PA 2NRDA 3BSHA 4PGZA 3PP4H 2E7CA 3MLZL 4JO1L 4X7FC 5C1MB 3KHOA 1UM6L 2ZCLL 3MLXH 2ZF9A 3OR7A 1KXHA 1ZDSA 4LSVL 2CXGA 4Q2ZB 5KSAB 3GHPA 1NM4A 2I7SA 3C60C 3NG5A 4JCWA 2UY7B 4RRPA 2H26B 1F90L 4KRPD 1DBAL 2AEOA 5GRJH 3CSYB 2WWKT 2HJKB 1ZTXL 3BD5A 4AVKA 1BXXA 4P5TA 1N64H 5EIVA 3QUXD 5KVFL 4TUOA 4AQAA 4CVZA 5FOBA 2HG0A 3WL9B 1R3LB 2C4FT 4XWGL 5I1CH 5JOEA 5A2IH 2CAKA 1WWBX 2DRUA 2VLRD 2ZKHL 3AZUA 4PJAB 5B3JF 2DQIL 2AZAA 3DMMC 5JW5A 1OB1A 4NO2A 1SJHB 3MODH 3QEQD 4JRWA 5K9KA 3TBVA 3IVKB 4OF8A 5K1VA 4OCYL 2BWDA 3A6OA 1A3LL 4YLCA 5BOJA 2VXQH 4JKKA 3D0AA 3HI1A 2A9CA 4L1TA 5KSVA 5F7EL 4R2GB 2LGNA 4YNYA 3IBOA 2XY2A 1O0VA 4NFCA 4KJPD 4RGMC 3K6OA 1R3IH 4XNXH 4Q6IB 4ZO9A 4M1DL 1Z0MA 4ONHB 2YPLD 4Y2DB 1XGYH 3WIFA 1VKXA 3CZSA 3BQUD 4HUNB 5E8EA 1MAMH 3GRGA 3HRZC 3V4PB 1GS8A 1ZLDA 2WXKA 2YRBA 2Z93A 1JBJA 1FGVL 5D96C 3E0GA 4KAQL 5IQLA 4U1JB 1R17A 5EU7C 1J9CT 2A0LD 4QXTA 1IKOP 5DUBB 3CVDA 4KC3B 3VCLB 3CFMA 1IAIL 1KT2B 2F74B 5IB4A 1I3RB 1DQML 2K8QA 5F9OH 2WSPA 1FORH 2APBA 2XN9A 3QIWC 4HIQA 1N5AA 4R90L 4HXAL 4OD3L 2QEJA 1U8IA 3ZQXA 1PX4A 4X80L 4FTVA 2VDNH 4AQEB 2WV3A 1HHJA 2PP8A 4S11A 1A7RL 2X3CA 3GIZL 4WTZA 5DXWA 5JR1H 1MI5B 3SDAC 2QADB 4R4BB 1AHMA 3ULVE 3K6NA 2KPWA 4GAJL 4MDRA 4PV8A 3ZHLA 2W38A 2R1XA 4J3WA 1AQHA 1NIDA 1PZUB 2ESVA 1FLTX 4DK5A 1JHTB 3V52L 1AH1A 2VLLB 1EXHA 2E9BA 3MV8D 4KNSA 3OJ2C 2GPZA 4FMFA 3QPXL 5TE4H 2HFFB 3P9LA 3Q5TA 5IBTL 2IH8A 5IK3A 2DWTA 2GCYB 1PDKB 1X7TA 4P57A 1DEDA 5IESL 3O11A 3DPBB 5SWZD 4KMTH 1LJMA 3QA3B 3R06B 5A6MA 4EZKA 1K4CA 4XXWC 5KYXA 4GSXA 1ERNA 2H1PL 1BQRA 1Z9NA 2IFGA 4BFBD 1ITBB 1NAMH 1PQZA 4ZUTB 4Z7QB 4JVPA 1W16A 4X6FB 3TBSB 3ZYJA 2VN6A 3J27A 1FNHA 4LLVB 4GB9A 4WUKH 1NC2A 3VXTB 1KENL 3QWQB 4YIQB 2Q8BL 2G4GA 1HZKA 4FERA 4Z7UE 5MEPA 5KSUA 3FZUD 5ITFB 3QVAA 4X6CF 3MPCA 3OR7B 1T5XA 5DWPA 2AW2A 5AZEL 5GGTL 3LS5L 5EC1B 3CDZA 3DTDA 5FR3A 2QSVA 1WTGT 1QBLL 1RZIB 5KUMA 3WEOA 4ZFOL 4CSZA 3RL1A 1GKOA 4QHMA 1BVNT 1C5DA 2Q0ZX 1OE2A 4J7RA 4HUXA 4OZHA 3NN8A 4K8RC 4L1DA 2HG5A 5F7DA 4P5TB 1FFQA 3MOBH 5C71A 4ZFFA 3ZHKA 4E36A 1G6RH 2NT0A 3SJVE 4TUOB 2AJSH 3F12A 1E4XH 2CBQA 4TNVK 4AQAB 5BS0D 4CVZB 4XP9H 4YE0A 3B9DA 3KLSA 1FF5A 4JPVH 1BQLL 1GKEA 2ZPKL 4MQXC 3GMPA 4NOFA 3VXRE 2JKJA 1OSYA 1UACL 3B5GA 3B1UA 4K7FA 5D2NC 3SQBA 1WWCA 4FFWC 1AIFA 1F1AA 1OB1B 2R2BA 3FOMA 4LAQL 5JW5B 4NO2B 3MUGA 3CVHH 1F3DH 3TBVB 5K9KB 3AT0A 4P2QA 4GFXA 2PXYC 3QW9A 4G8GD 3LJ3A 5BV7C 2BOCB 1E4WH 4K94H 4LCIL 4GRWF 2FX7L 3HI1B 5DJ8B 4PB0L 1WZ1L 3B2VH 5KSVB 1PZAA 2W9DL 2XA8L 3QEGH 3WFEL 4PCSA 5JW3L 2Z4QA 1E8WA 1OAZL 1CFMA 4KK8C 4NN7B 4V33A 4HUWB 4C56E 3WIFB 1BAGA 2C9SA 5E8EB 4ZW8A 2QHLA 5LQBH 1WCQA 3KBPA 4BKTC 2Z93B 3U2JA 4QHPA 1QI5A 2CALA 4PSRA 4V2CB 1U8CB 4QXTB 1NIBA 3ULVH 2BP8A 5EV7A 2V9UA 4FNPA 2P80D 4LSSL 3UYRH 4KUZH 1RFDH 2PABA 2Q3AA 4WW2F 2J20A 3TV3L 5IB4B 3OD3A 5IP4A 3ZO9A 4YDZA 1KN4H 4MRCA 2XN9B 2CKBL 3NK3A 4H4NA 1N5AB 3PXJA 5AVYB 3FTZA 1DQLH 2VH5L 4TSBL 1KBPA 1PJWA 5TQ0H 4HC1H 3OPZL 1OXYA 5SWSA 4QWWC 1X44A 3EO9L 1OCWH 1HHJB 2AMGA 1VJSA 3QIUD 1W9XA 3HC3H 4ZXBD 1HH6A 4NENB 3STBA 4PJBF 4I3GA 1Z5YD 2IPTH 4JFEE 4PV8B 1OKEA 4MLIA 4BH7A 4Z3FA 2R1XB 4MXWH 2XIBA 3B7TA 1EHLH 4OLYL 4IOFC 2WZ5A 3T3MF 3SOBH 4DGVL 4JZNA 1ADQA 1JZ5A 3OL2A 3QHFL 2PW1A 5J1AA 3S0PA 2IAND 4E5XG 2VC2L 3G6JF 5IK3B 5IMKA 4JRXA 3WO3B 4MKMA 4J2XA 1TJIL 1NCWL 4P57B 2GC7C 2Q9OA 3O11B 2WINB 4N4YB 4WUUE 5TE6L 2JKWA 4QRUA 4KJQD 3KPLA 1K4CB 3PWPA 4K7PY 4YFLF 3CH8A 3O9WA 4AYEC 1V3LA 4PIBA 4NC1C 4X6EB 5DHDA 3HC4L 3PWJA 2AQQA 1XSKA 2R2EA 2YGVA 1YMHA 1T1WA 3K46A 4PWEA 1RZJL 2RHEA 2PP9A 2XZQH 4PJHF 1SN2A 2CO6A 1QSFA 1NC2B 1AACA 3ZTNL 2HRPH 1J0YA 4N86A 3FQUA 4GIAA 3FQXB 4X7EC 2OSLB 1HEHC 3Q5YA 4QGTA 5MEPB 5KSUB 4OV5A 4JB9L 2Q5BA 3WY4A 1T5XB 1IE5A 3CDZB 3B34A 4XH2A 3ARYA 4RESB 2C3WA 3B2MA 2LT9A 1JRHI 1EQWA 3RL1B 4UIMB 4QHMB 4JRFA 5DQDL 1C5DB 4KXZH 3SDYL 4I3RH 5IQ9A 4D9LL 1J9RA 1ZHNA 4HUXB 3NN8B 4OZHB 1X7QA 4N9GA 3QDJD 3EJQA 4R7XA 5F7DB 2HG5B 4Q7DA 2VSCA 5BW7C 4HETA 1W0WB 2XZAH 4ZFFB 4LLUA 3NUKA 3B9EA 1UYWL 1DJYA 1EJ8A 1BIIA 5KTEL 2VDPH 1O5PA 4K2UL 4Y4FD 1J5OH 3JVGC 1WAAE 5ICZA 4MHHG 3GMPB 5KJ7E 4L2YA 5E2UL 5AAMC 1XAKA 3FOMB 5D7JD 2R2BB 2N3JA 3PDOA 4DSYA 1M2VA 3MUGB 1GOGA 4Q6IC 1U91A 4HKBB 4NWTL 1MCWW 3DV4A 2J8UA 4XC1H 4M6AA 2OJZL 2XPGA 1NCNA 5C08D 3BE1H 4NRYA 3O2DA 3D9AL 1ACCA 1UWEH 2HKFL 1U93A 3P2TA 2Y7SA 3SGKA 3A6CL 4QRFA 4NAMA 1YEIH 1ACYH 1X9UA 5GGRA 1UOKA 3T2OA 4GP5B 5DZNA 5JPMA 2DWXA 4MD4A 2AZUA 2X10A 3PUCA 4I89A 4G71B 3ETSA 4P07A 5GGUB 2QKIA 3FT2A 1BEYL 1BEXA 3WKNA 1C7TA 2XETA 1TEYA 1PEWA 5EA0H 2QVMA 2A6DA 5CZVH 3VWKD 5G2NA 3VAEA 1Y18A 5MP6L 2Z0BA 1J88A 1VENA 2MQCA 3KH4A 1UENA 2IQ9H 4DW2L 5IJKC 4K3DH 1XB6A 3C87A 3NBNA 1N6UA 4QHUB 4WKZB 2E8YA 4JO5A 2QADC 5DZOA 5ID1A 1HHKA 3T1FA 2GUYA 2ITFA 1OSEA 3U46A 2JI3A 1COBA 1VEMA 4FQIL 1F3DJ 2MTPA 2ZXQA 1GZQA 1OPOA 1G5AA 2EDLA 1S4IA 1C16A 2X40A 3O6LH 1KCSH 2VLKD 2V9TA 1DQVA 3FTGA 2HMID 1HEZA 5DJ2A 5KVMC 3VXSD 5FDYA 4BH7B 5DJYA 1SEQH 3OZ9L 1CK0L 4HJUA 3U7WL 3LHAA 5FGRA 2PW1B 5J1AB 3DVNA 3MRFA 4K5PA 3W11D 5IM7A 4PRBA 5GGSY 3T2QA 1W6LA 5IMKB 2PYFA 4JRXB 1S5IL 4QIRA 5HHQA 2ZD0A 3P4OB 1EZUA 2JKSA 1JGVH 4QRUB 4WDIA 3SKUD 1PTZA 3KPLB 3PWPB 1NH6A 5A6IA 3O9WB 1LO4H 3R18A 1MLCA 3TNMA 4DPRA 1A7OH 4W6XB 5C7XH 1BZOA 1GYVA 3PWJB 2OZNA 2PYED 3WTXA 1T1WB 1SXBA 4N68A 1UVQA 5AVVB 2CO6B 5EZOH 2J5LB 4RWYL 3TFKD 3FQUB 4LCWA 3DNKA 1MFUA 4A6YH 2V8LA 5C6PB 5IG7A 5L2KD 4GG6F 4M1GH 2XOTA 3BVVA 2DLEA 4HUUA 1PG7L 2ENPA 4TNWF 1CYGA 1IEHA 3QDGE 1LK3L 2WXFA 1NGXA 1CR9L 2VB5A 5JA8B 3KYAA 5KS9E 2FDBP 4EE2A 4PW9A 3QHTC 1B4LA 4UAOB 5IQ9B 3WNKA 4P46D 4KVPA 4X9BA 1X7QB 2VDOB 4N9GB 4I1NB 3P4NA 3U2SA 1XB3A 3EOAB 2VE6A 2R23B 3UAEA 5B7MA 4LLUB 4KKQA 2QSCL 1BIIB 3QUHA 3TA4D 2I24N 1KYOK 4PBDA 5ICZB 1XCWA 1YG9A 3WNPA 2X05A 4YDIH 3ARBA 4RSVA 1NJ9B 1EPFA 1W0YT 3GPSA 5TE7H 1J1XL 4YC2C 1GIGL 4FLRA 3PDOB 1I1AB 5GRYA 4BCXA 1M2VB 3MGTA 1UD6A 1U91B 3HG1A 3CVCA 2WYTA 2FIKA 2DM3A 5ETUB 2PR4H 4NNXB 2XPGB 5D7KD 2IAAC 3SCMA 1AGEA 4HPYH 4NRYB 5MERB 3BCDA 2Q76A 1U93B 5L0QC 3QIBD 3VX1A 2YGPA 1AGCA 3UTSA 2PTUA 1U95A 5GGRB 1SOSA 5JPMB 2WW8A 4MD4B 2OZ4L 4HJ0D 4K7PL 4YXKL 1CN4A 2QKIB 4W4NA 5KVEL 2OX5A 1H15A 4KNUA 5BPPA 3UADA 1X9LA 1SN5A 1J1PH 1CBJA 2VCOA 2CMRH 3CFNA 4HT1H 2HJFA 1JWMA 1Q94A 2A6DB 5BUPA 1ETJA 3L3KA 2EVGA 2VW6A 2VXSL 4NJAH 1Y18B 3DYMA 2R0ZL 5EU5A 3WKML 4K94C 4QHKJ 1UT2A 4DO4A 4UT6L 1YAIA 4I5BA 2XXMB 4U6YA 1P7QA 3CFJA 3MJ9A 4HLZH 1M9SA 1HHKB 3T1FB 4XZ4A 1UA3A 2APSA 4JKPH 4ODVL 4QGYA 2QGBA 3QJXA 1KCWA 1UT9A 1HHIA 1MEXH 4Y0GA 3I6GA 3T2PA 2W5PA 3H85A 1AR1C 3DOSA 1GZQB 2WLYA 4YN3A 4MASA 1VGKA 3KM2A 1ED3A 1F4YH 5LCVA 3FTGB 5JORA 1K8IA 5B8CC 3T65A 5DJ2B 3RVWC 5CLXA 1S7XA 4P2CG 1XTMA 5DJYB 5JXAL 3ZDXB 4FFYA 4JREC 2H2PC 4W9LC 2OJEA 4KXBA 3BAXA 3KLHD 4HWUA 5CIPB 4UNVA 1SXCA 3DVNB 3MRFB 5IM7B 4PRBB 4AM0A 1ILUA 2Z4TA 3UPRA 1WFMA 2PYFB 4UV7L 4MJ5A 1L5GA 5HHQB 1CE1L 3N9GL 3VGBA 3PABA 2W94A 1FAKT 1CB4A 3CN0A 3UG3A 4NC2B 5IOKA 2WKGA 3DO3A 1UXSA 4QRPD 3TNMB 3RRQA 2PNDA 5H35A 3M7FB 5ISZD 2OXHA 2ITEA 1UVQB 3FYEB 5LGKA 1OW0A 4M93B 4X4ZA 4BFFA 4XMTA 1HQ4A 3CFCL 4H88L 4XBGA 4LCWB 4OTXL 1L3NA 3CDFA 3LZPA 3TEXA 1CUOA 3LVTA 2HPOA 5BZXA 1MJ7H 2HT4D 2QKSA 3BVUA 4ODHH 5DURD 2KQNA 4LVHB 1MCFA 4B9GA 1JIBA 3OZLA 4NI6A 2ZTBA 4AUUA 1NGXB 4JM2A 2I60L 2Z3FA 4I87A 3JV6A 4OV6F 4YHOH 5ADOL 3LPFA 1LVEA 3A4FA 1NFDF 4JGNA 4UIKL 1CL7L 1U92A 4TOYL 1Y6NR 3NTCL 4POZD 5AL8A 3QFJE 1MWAL 3MLYH 4MNGE 4OSUL 4JAMB 5CJQH 3U2SB 2WUBL 4OUOA 3DBSA 1M2OA 2VE6B 4DP1X 3H3KA 2V9RA 3NSYA 3ASNB 4XP1H 4GY4A 3QDHA 4R0LA 1WC7A 3TS8A 2WCSA 4MX7A 5KS9B 4ZUWA 1T7XA 2H6PB 2NY3C 4UOW0 3X1FA 3GI9H 1P4IH 4K3JL 2FEDD 2OAAA 3CTTA 5B4MC 1QRNA 1RZ7L 1YA5A 2VJ0A 5I1IL 5I1HL 4BEIA 3BWAB 3MGTB 5HHNA 5BO1H 3EH3B 3HG1B 2NZ9D 4V1DE 3UDWC 4OZIF 5HYQA 1ZHLA 3B8YA 4FQCL 5I8KL 1OGAD 3DUHA 4YZFE 1VFAA 5A40E 3HCVA 2BNQD 3CFQA 1AGEB 2OS7A 2ZWNA 3KJ4B 1JERA 2Y07L 3LKRA 4WFGE 4CSTA 5KZCD 2Q76B 4LSDA 3SE3A 1UM4L 1AGCB 3UTSB 3GSUA 3T9WA 5T3ZD 3QULA 1AS6A 4NO0A 4X8XA 5HGGS 1XIWD 3DETD 2PO6A 3OLIA 3ZTCC 2BVYA 1BW8A 2O6PA 2R4RH 4Z3EA 5EIQA 5JYMA 2YJQA 4ATTA 2OX5B 5F8RC 1H15B 1I3VA 1RUML 2XZZA 4XBEL 4POYA 2GYSA 5F1IA 2HJFB 1CLOH 1JWMB 3QQ3A 1Q94B 4JFZH 1JNNH 3L3KB 3UBXI 3ZYZA 2PPCA 2VO8A 3TH4T 3LVEA 5EU5B 4MD5A 1SJMA 4I4WB 2VKXA 3BZDA 3QUGA 4I5BB 4W9HC 2P5EA 3OGCB 3CFJB 3NFPA 5HHMD 2YEVB 1DO5A 5DHYA 3QORD 1E4JA 1HHIB 2JKLA 2EO7A 1DEEA 3I6GB 3WIHH 1SDYA 1MNUL 2W9EL 2J1YA 3GEWB 4NM8H 4U1HA 4BIKA 4M4RA 3ZTEA 5B22A 1VGKB 3VSVA 3NRPA 4XNUL 1ED3B 2WTRA 4OZFH 4PIRF 2ATPA 4DGIH 1YNTB 5JORB 4F7PB 1K8IB 3PU7A 3T65B 1T5KA 4U6XB 4MD0A 1FVEA 5B3SB 1A3RH 1S7XB 1FCCA 5I0XA 3KNBA 1FCGA 1XBDA 1AG0A 1KN2H 1MPAL 2OJEB 4R4FH 4F37F 2WQUA 1T66C 4Q9RL 3O9WC 4DP9X 3HR5A 2NY7H 3UPRB 1K5NA 3OTTA 1RJZA 4MJ5B 1L5GB 3RBGA 1A7PL 5IHLB 2J5LC 4OKVA 2K0RA 3PABB 2X4NB 5F3FA 1AGDA 1H6TA 1INQB 3QH3A 2NY0B 2CCLA 1LP9A 3FOLA 4JY4A 1UZ6F 1EO8L 2OXHB 3VFMA 4FG6D 3LD8B 1JNLL 3V4VA 1HQ4B 3BUPA 4XBGB 2LTQB 1FH5H 5IT2L 4DCQA 1A1MA 1ZGLB 3BIKA 2Q87A 2AK4A 3OLEA 4IRJA 4UAOC 1NBVH 1YYLL 3FN0L 3VYNA 3QJZA 1RIHL 1N6QH 4L3CA 1NCBH 1OTTC 4GO6B 4S0SD 3DO7A 2KMWA 4MA7L 1IL1A 3L2NA 3BIBX 4JM2B 2GJ6E 4JVUA 3T4YA 3JV6B 3IGAA 4FN0A 1CCZA 3RNQA 6PCYA 1C5BL 3PG2A 4XOCA 3CFIC 2CK0L 1U3ZA 1A4KA 4K8RL 4WEEA 1LNUA 4ABVA 2H9GA 3OAUL 4OZ4A 3FUMA 2HFGL 2Y5EA 4JFOA 4HIJA 1I1AC 4JJOA 2AJVH 4DKFH 4R0LB 1WC7B 4EJ1C 4MX7B 2A9ML 3UPCA 2HKHL 2J4WH 4M43L 5HYSB 2H3KA 2BJML 3KM1A 3ARXA 2GSMB 4R7NA 5HHPB 3QFJB 3ZL4L 1JCVA 1GOHA 4X4KA 3V6OA 4MJHA 1QRNB 1SVBA 2OL3H 3B1TA 3NCYP 3I85A 5K9JL 1I1YA 5HHNB 1BP3B 3OF6D 1IB5A 3RAJH 1V7MH 1VFBA 5JPMC 3CZNA 5HYQB 1ZHLB 3IMVA 1VPOL 2YAPA 2IOMA 5AVRB 3P73A 5BV7L 1VFAB 2ZSWA 3HCVB 4ZDHA 1BAWA 3LKRB 4PV9A 2YPKA 3BPOC 4NUMA 2NDGA 3A0OA 3L3IB 3GSUB 3DX4A 4GBXA 4JG9A 3T4AA 1NCAL 3QULB 4NO0B 3U6XS 3DK2A 5D7HA 2K8MA 2PO6B 5FUZL 4Q0XH 4R83A 4NQEA 2ED9A 4P2OD 4U6VL 5DD0H 3UGXA 3FO0H 3JZYA 1UWXK 4F1ZA 4YL4A 4NQDD 3IPEA 2FUQA 2OCJA 1A5FL 2B8OT 2OTPA 4HISA 5F1IB 4XMPH 1O9WA 3LNHA 4W6WB 1MCOL 3QQ3B 4UYPA 2CDFA 2EEDA 4AV4A 4OCLC 3GB7A 4P3DA 4WNSA 2XRAL 3AQDA 4GXUN 4MD5B 3VTTA 4OJFL 5EF3A 3HOGA 2P5EB 1S7TA 4PVLA 1Q38A 3NFPB 4W9DC 1YMMA 2CJUH 4XI5C 3UBXA 4PJIE 5CZRA 2ZUWA 2E0PA 3L9YA 3VD0A 3K0YA 5E08L 1DEEB 5HHXH 1BSIA 3ZR6A 1KTRL 4U1HB 5J0BA 4M4RB 1IKFL 3RBSA 3VFNA 1TCRA 1I85C 3NYKA 3S97C 3T09A 2ATPB 5I1DB 2R51A 4GP4B 1FVEB 4L4TA 4FD0A 1Z6JT 5HI3C 4N0YL 2YPVA 1MCPL 2P8PA 3F7YA 3KNBB 3GXPA 3IJ7A 5IMOA 2ZIDA 3HC0A 3L7FA 2ZNXA 2QL1A 3LQZB 2CLRB 4A66A 4B9JA 2ZF8A 1OE3A 4J3BA 1S7WB 5E6ID 1D9KA 2W1NA 1MFNA 2O72A 4K73A 4LEXH 4MAYA 5IB2A 3F64A 1WZLA 3SE4A 2NTFA 1K5NB 4N2BA 3IGLA 1RJZB 2Q20A 3ZL2A 4F2MA 3EUDA 1I9JH 4M93C 4OKVB 3BAIA 1YHPA 2E4TA 4LT7A 4ZUUA 1CZ8H 3QH3B 3BKCL 3EZ8A 1P0SE 2EVJA 1LP9B 3ARUA 3FOLB 1XSIA 2FR4A 3PGCB 2VIRA 4JY4B 3TZVC 3VFMB 1YEJH 4ZX5A 3AABA 3LXUX 4JHWL 3V4VB 3N44F 4D9QE 5DU7A 3VD3A 1RK7A 2P46B 2R0WH 4NYLA 1CGWA 4DCQB 1A1MB 3BIKB 5E2JA 4ELME 1EMTL 4PJDF 4QRSA 1KEMH 3QG7H 4IRJB 4PLKD 3S5LG 3QS3A 3AQZA 2O5XH 3FHQA 5DI8B 4L3CB 4TLKA 3DO7B 2UVFA 3IB4A 1G7LA 4TNEA 1IL1B 4IK7A 3FF7A 3T4YB 2ZOKA 2YD3A 3HRPA 3IGAB 5D7EA 4MJ2A 3EZJB 1WT5C 3RNQB 4XX1E 1BZDA 5HDBB 2ADIB 4JQXA 4QKXB 1ZV9A 4J5VA 2P45B 1G9NH 5A3ID 1A4KB 1LNUB 3MJ6A 2H9GB 1GH7A 1S6NA 4OZ4B 4JFOB 4HIJB 4ZMPA 2F5AL 3CX5J 3O8XA 5T5FH 1BV8A 4OKDA 2EXWC 2RMNA 3GNMH 4KFZC 2D7QA 3A5VA 2EDYA 3LZRA 3NIDE 4JRYE 2W0LA 4R7NB 3BO8A 1B0WA 3KJ4C 3N06B 4ZQTA 5FYJE 3O45A 3MLXL 3VG0H 4LLAA 2XNAA 1W80A 1UZ8A 1SYVA 2J25A 3DROA 1I1YB 1URIA 2YAFA 4Q74A 1VFBB 1KNOA 3F6IA 2X2HA 3L1FA 3P73B 2ZSWB 4ZDHB 1KCKA 3BUYA 4MDJA 5GRJL 4PV9B 3RUGA 1MRDL 4N90D 2YPKB 4NQXA 3LPGA 3IGFA 1N64L 3T4AB 3HPJA 3AGWA 3E8UL 4H20H 2C8NA 3QO0A 3LEYH 1NMCC 3HE7C 4L3EE 2EO9A 3MRHA 2DV6A 4NQEB 2Y7MA 1L9OA 3ZZ1A 4HZAA 4WLCA 5I1CL 2WGNB 1XGQA 2YA1A 1J8SA 3IKKA 3MOAH 3B5TA 5IQ7H 3ARFB 3EYUH 4KXDA 2CDFB 3MODL 2DH2A 2MNUA 1HXKA 3KPQB 5C0EA 3GB7B 1KTLA 4P3DB 4ZO7A 1EXGA 1IAOA 4DGUA 3IM1A 3T5WA 3VD7A 1YEKH 5LG1A 3CLFH 2VXQL 4CADB 4Q58C 1S7TB 4L8DA 4TYUA 1OAKH 4AGNA 1JZ2A 2XN1A 1G4MA 3UBXB 4AGLA 5TQ2L 1KV7A 4U2ZA 4FF9A 4XNXL 1R3IL 3CAFA 3M45A 4GYBA 1TO5A 5DJCB 1BVNP 4E41E 3E6HA 1XGYL 3QPKA 5FO7A 2N7AA 4WENB 2A77L 4LL1A 1KIRA 1W0VB 1MAML 4LESA 1TCRB 3H8NA 3QJQB 4Z7AA 5A2FA 2WZPA 1UD2A 4EQ3A 3LMJH 2CZNA 3ARQA 2EH7H 2TSBA 1Z3GH 4Z0BH 4J8QA 5J11C 4OLWH 1R5IA 4L4TB 3QUZA 2X70A 4OQTH 3RVXC 3T2LA 3F7YB 2P8PB 4PJ7E 2N0MA 4XXCC 3EF4A 4G2AA 2YD0A 3HC0B 3L7FB 2LU4A 3NIFE 2H0PA 5JPNA 3ARDA 2QFRA 3IGKA 2NY0C 5D71H 1D9KB 1NGZB 4WCYH 4MAYB 4KRMB 4GLRI 1EAJA 1UZGA 2NTFB 3W2DH 3MRJA 2HUEA 5CXPA 2HX7A 4F2MB 5G5DB 1UC6A 3LD8C 1EXUB 2DWYA 4ZUUB 2UXFA 4O00A 4B97A 4LP8A 4ALAH 3U82B 3L5WA 5JR1L 1U8PA 4KKCD 4WHTA 2FR4B 4JCLA 1CLYL 3PUUA 1NUDA 2VIRB 3W82A 5JOFA 3IJEA 3PDDA 4UTBL 1E7VA 1I9IL 5C0GA 2Z91A 1MHPL 3FRPG 4Y5XB 3PWNA 4JM2C 2EUVA 4XCNA 4NYLB 4P2RE 1M6OA 3QQNA 2P24A 2J73A 3SYCA 3DJTA 3V4LA 3FYIB 4PJXA 5I1KH 2O6FA 5TE4L 1ECZA 5CD5C 2NR6A 4PGCB 5C09E 4DKEL 2FZ3A 2VITA 4LKCA 1N3NA 1FNFA 5FYJH 5EFIA 1OQOA 1O6TA 5FECA 1AJ7H 4G9FD 1ADWA 2YA0A 3ABMB 2ZOKB 4R0LC 2FHBA 1NGYA 1TOXA 2KS0A 2WUCL 3L3JA 3BGAA 3PIQA 2C9PA 2FT7A 4HIIA 3AC0A 4PG2A 2XI9A 1J5IA 2DAVA 3OB8A 3VXOA 1UJTA 4DVRH 4WUKL 3O8XB 4LE8A 4N0UE 3QRBA 4BFRA 5DWUL 3MLWH 3EW3B 3UTPD 2D7MA 5I73B 3CZUB 3RGVD 3SY6A 3DRQB 3UC0H 1TVDA 5FYKE 3BO8B 3HZYA 5B1JA 1HL5A 3NSJA 3O45B 4JZJA 2XNAB 1UZ8B 1SYVB 4YSOA 3WNNA 3DROB 3LRHA 4EN3A 5EN3A 2DLFH 1JP5A 2YOCA 1QBAA 4Y5VA 1KNOB 4JE0A 1ZJAA 4JY5H 4OGAC 5L4MA 2OR8A 1KDJA 4IRZH 4ORGA 1XH1A 3BUYB 3SYPA 4GKOA 4NQXB 4JGUA 4MMZC 1WBYA 2H0EA 1J0KA 2WXPA 5BUAA 5F1NA 4GINA 1YPZE 3ECVA 3HPJB 4KU1A 1PD1A 1WZMA 3QO0B 1WFIA 1G6RL 5EUOF 35C8H 3D3VE 1RVFL 2AJSL 1E4XL 3MRHB 3FFCD 5JMOC 3GLAA 1JZ6A 4P5KA 1L7IH 1GJWA 2BIOA 1XGQB 4MA3A 4IHOA 5CZKA 5IWLC 4KK5C 3QCVL 2VLMD 2Y5QA 5CUSL 2C1PB 2DYSB 3FSAA 4BGLA 3CIAA 1C5CL 5C0EB 3ZRSA 1KTLB 2DLIA 1R75A 4L3EB 3H0TA 3MV7D 1JXJA 4MJIE 1E4WL 1ET5A 3CMGA 1K2DB 4GUPB 4K94L 3B2VL 5EIIA 4L8DB 1NA8A 2X4UB 4P23A 2WNKA 1KFGA 1QTYT 2BSEA 4PWFA 1QX1A 2E8ZA 2AITA 3E6HB 3BI9X 5FCSH 1W6WA 1T2XA 2FJUB 5FO7B 4HOXA 3NJXA 1KIRB 3QQ4A 2Q2LA 5LQBL 4AVIA 1Q0YL 4UM9A 5E03A 4LBAA 1A9BB 4BZ2A 4Z7OE 1PKQE 1TQVA 1D5IL 3MSPA 2EXYC 3RKDC 5AVTB 1R5IB 3QUZB 4GSUA 3WS6A 3II2A 3L17A 3MBXL 4GJTB 3GTTA 3S6CA 5F7MC 1KXTA 4KUZL 4XRCA 4AQOA 4YJZL 1DLFL 4U31A 3ARDB 2NXYB 5IVXF 4KO6A 1U4FA 3WYRA 1KN4L 4PS4H 2F54E 5HHOE 3MRJB 4OLXH 5AOZA 4Z7VE 3RDJA 3O4LE 5CEZL 5TQ0L 5CBAB 2UV3A 4HC1L 5CN1A 3SPHA 1OCWL 1SFHA 1B4TA 1H8SA 3G5VA 2ZXBA 4G6MH 1O5DT 2NUPA 3L5WB 4G6FB 1U8PB 1I3GH 5E95B 4IRJC 4FZEH 2L8AA 2HTLC 1UH4A 3AXHA 3GRWH 4DUVA 3QEUA 3TLRA 2IPTL 4QRRD 5JOFB 3IJEB 1RHHB 4WFEE 5SV3A 4DP2X 2RBLA 4UOW1 1HK6A 2BLFA 5C0GB 4MXWL 1EHLL 5H37G 3RX8A 3PWNB 3CFDA 3PAVA 3SOBL 1PF3A 4JPWH 1CFNB 1FYTD 4GEIA 2FH8A 1JPFA 2P24B 1BBDL 4NWUH 1W8NA 3N41B 2HZHA 4G59C 1TQUA 4DN3H 4PJXB 2VLJD 1JCKA 2E46A 2X09A 3FCTB 3ULUF 4XCEA 3SGEI 3HUJA 2FZ3B 2VITB 5FYKH 3HNTH 1N3NB 3IDUA 4BINA 5EFIB 1U8JB 2BSTB 1AZBA 2WLIA 3CSTA 5DK0B 5FECB 4WV1C 1EA9C 1KXQA 5IW6A 3LNEA 3R1GH 4N8CH 4LSPH 4ICXA 1NGYB 2IMMA 4P2RB 3OGOE 3UAJC 4IYKA 3P9MA 4CN4A 3GBNL 4LSUH 3L3GA 1CMOA 5LWYH 3L3JB 3MHZA 3PIQB 4TKWA 1OTUD 3I6KA 5JLZA 3OHXB 4JQIA 4HIIB 4J3OD 1RULL 4HMDA 4N6QA 4PI0A 5A7EA 1FNEA 2XZQL 5ESAA 3VXOB 1PIGA 3LRLA 3RZCA 4NUQA 1DBKH 4ZO6A 3CZGA 4IGBA 3AREA 1PS3A 4ZT1A 5F6HI 1G0YR 1RZKH 3B3IA 3HZYB 3IYLW 4JZJB 3D39E 2OMTA 1NCCL 3FUDA 5ALCH 4AYDC 2AV1A 1TIUA 2BVOA 5DUMH 4Y5VB 2ADFH 3AJ7A 4KVCH 1SHSA 1NCHA 4XO8A 1IEAA 4FHBD 5F7KC 4ORGB 4I3RL 2JQAA 1OE1A 1DBMH 2D03L 2YRZA 1P69B 1YECH 4GO8A 4JFDE 1WBYB 4GRLC 4ODXA 5F1NB 4AYGA 3ARFC 1A25A 4J12A 2Z0UA 2A5UA 1D2OA 2CG9X 4HFUH 2F8XC 2X6VA 2ZXEB 3PP3K 2VDPL 3RTQC 2H0JA 5CAYB 3H3PH 4MB5A 1J5OL 5INDA 3MLRH 2DYPA 4P5KB 3DMMD 4WFHD 3VD1A 5DVOA 4MA3B 4IHOB 4UOJA 3IXAB 1IQWH 3NZ8A 1FSKB 3VFPA 4A2LA 1LDPH 1OAJA 1WQVT 4G5AA 5B1CA 1E50A 2FWUA 3D3VB 3H0TB 4MHHI 4FQQA 3FTSA 4KTGA 4N0RA 4BV1A 2Q3XA 4XC1L 1RMFL 3ZKXB 5DZ9A 2WO2B 5EIIB 3BE1L 1X6LA 1PZ3A 1FNSH 3PAZA 4P23B 5GISH 5AW4B 2AAAA 5F8QC 3MBEB 1QOKA 1RIVH 2HX8A 3KGUA 3KPOA 3QXVA 3SPVA 4J27A 5E6UB 4ZX3A 5F7HA 4U7MA 5E8DH 3GMRB 2IF7A 3QQ4B 1JS4A 3KPTA 2J6EA 5LBVA 3FB8A 4X0KA 2ZONA 4AMKH 4DN4H 2A74C 1VZGA 3ABLB 3BP7A 3SE4C 3WY2A 1OLLA 4PRPD 1IV8A 4XNYH 1DJHA 1KXTB 4XRCB 5DJXA 3QIWD 5ABZA 3AUVA 4IU2A 3VX0A 1QW9A 2IQ9L 3S8WA 4K3DL 1RK1A 1WEJH 4YGVA 1MQKL 2DZEA 3CVIH 1CT8B 1LEIA 4ZMLA 1KJ2H 4TLTA 4Y5XC 3SDAD 3IWUA 3BOVA 1ZMYA 3WY1A 5DVPA 3G5VB 3WLBA 3S8FB 2NUPB 3O6LL 2E75C 1GY2A 1KCSL 4IBZA 2FB4L 3VGGA 3HG5A 3QEUB 4YHPA 3ZZSA 2RIKA 3JTSA 3NAAL 1UASA 4A2HA 2X53A 5EDXA 1IBBA 3NABH 4W9CC 4AZ8A 4KHTH 1SEQL 2NY6B 3QUXA 2Y36H 2K1MA 3CFDB 5IJBC 1H8OA 1ETZA 1JPFB 4YK4B 2V2XA 3O4OC 3JWNE 1N9PA 3NEXA 5CGYC 3RVUC 3SGDI 1KGYE 4XCEB 2VLRA 1T4WA 3QARA 1JVLA 1DBBH 2EDOA 2WLIB 1OD7A 2WTPA 4V2BA 1NEUA 3QEQA 4X4MA 4Y1AD 2WXRA 3ARTA 5IW6B 1B4JH 3N55A 1JGVL 2AF2A 3LRMA 1PX3A 1WO2A 2YFNA 3UTZA 3P9MB 3RU8H 2W65A 3L3GB 1LO4L 1GCFA 1U42A 3I6KB 1AXSA 1A7OL 2OR9H 3ZVVA 4QRAA 1Q9WA 5C7XL 3V2AR 1U6AH 4J6RH 1FNEB 4XN7A 5CEYB 5ESAB 1ASPA 3H6JA 3ZE1B 1CXKA 2JB5H 1SBSH 4G6KH 3RZCB 4E5XA 5FS5A 4IGBB 2YPLA 4A6YL 1EH9A 1Q72H 2DQFA 3BQUA 4HD9A 2F08A 2X9XA 4M1GL 3B3IB 2EIZB 2ZX9A 5TK4A 4XGZB 2OMTB 3KG5A 2KZWA 5TPWH 1T4KB 1ZS2A 5B21A 2AV1B 3L3HA 2BVOB 8FABA 1L9PA 3NFSL 4K8RD 5D55A 3EJYC 5HGAA 1NANH 4M8VA 1IEAB 4XMLL 2W88A 1X5FA 5E99H 2ZWSA 2XKNA 4AXWA 1O6VA 4Z6AT 2CBMA 4ODXB 4E9VA 2Z8SA 3DDFA 2ZG1A 2K3HA 3QQDA 1NPJA 5EO1B 3OXRA 4MQXD 5CN2A 1V5JA 1WITA 5INDB 1P2CA 2DYPB 3BAJA 3ERXA 4FFWD 4YDIL 2VGLM 1DVUA 5TDPA 3NEEA 3NZ8B 1JNHA 4JFDB 3BWUF 1TJGL 3O3DA 5TE7L 2VRKA 3K6DA 4AUYA 1OK0A 4OFDA 5LBSA 3REWA 1MJ8H 4HWBH 3PV6A 4FQQB 4J3OG 1KB5H 2PR4L 1FFRA 1NWPA 1I8LC 2WZ0A 2R0KL 3ETBJ 3MV8A 4WW1A 2I27N 5AG9A 4KK8D 4H1LA 2A4EA 2YWZA 5AD0B 2FH6A 3KPOB 1EEQA 5HVWA 2F1EA 3QUZC 3SPVB 3TBYA 2GIXA 1W72H 2YUXA 1KFAH 4QJ3B 5SWZA 3HEIB 1F11A 3LHPH 3ARDC 1XGZA 4DKAA 3FB8B 4N6RA 4X0KB 3WV0A 1J1PL 1CTOA 2CMRL 3BP7B 2EEFA 2IBZX 3V10A 5IBLD 3V7AE 2VDLB 2A2QT 3GKWH 4NJAL 4O51A 3LZFH 1HSBB 4F8QA 1XX9C 2WPGA 1MVYA 1ZEAH 2BRQA 5DJXB 2QVTA 1Z32X 4IU2B 5FFLA 1RK1B 3SDXA 1H3TA 3UTTE 2FATL 4YGVB 4BE6A 4QWWD 1U33A 1LEIB 2JV6A 2KHAA 3JWNH 3OHMB 3D87B 1MEXL 4CA4A 4PWHA 5GRVK 1ZANH 2VDQB 4I0PB 2ZKXA 4ZOEA 5C3TA 3WLBB 4JKMA 1E7UA 4ZOBA 4KRPB 1F4YL 2AJUL 4IOFD 3WJJA 4XMXA 3FAXA 3JTSB 2QLYA 5C0ND 1F6LL 2ZYIA 4AZ8B 2Y1AA 5JTWA 1BG9A 2R83A 4OJDH 5IKCB 2XXFA 2BY2A 3QUXB 4E9XA 1FC1A 2L3BA 3Q06A 3VW3L 5FXCH 1ETZB 5BS0A 2C3XA 2V2XB 3QXUA 2FX9H 1LLAA 4GQ9H 3OHXC 4W93A 2EIDA 4XMKH 2VLRB 5TH2A 4YSRA 3U4BL 4CJ0A 4K5NA 1ECYA 5C0CD 2EDMA 3TT1L 3QEQB 5DR5L 3I75A 4G8GA 4AEHH 2W65B 1I7ZA 4ZOCA 2CPCA 2FYYB 4AMXA 2BIMA 1M6UA 1AXSB 4H8QA 3VFRB 1Q9WB 2XFXA 3FRUA 1P1ZB 2ATKA 3PREA 4XNZC 1KYAA 1WVZA 2EE3A 2Z1PA 3X17A 2D2CC 2AQRA 2V3DA 1A6WH 1TEGA 3D85D 4Y5VC 5CILH 4E5XB 3PDGA 2YPLB 1TYJA 3BQUB 1YCSA 1VADA 1Z2KA 1QVOA 1MJ7L 4I9WD 2D7NA 4JR9L 4H2CA 4TTDC 2YC1A 1MW2A 2JKRM 5A1AA 1KB3A 5HYEA 4I13B 4M1CC 3K80A 8FABB 2G30A 4N2FA 3LKQA 3RX9A 4YHOL 2P80A 3L16A 4PRIE 5HGAB 3HZ3A 3B37A 1QSED 3V6BR 4R26L 1OOAA 1EVUA 2XKNB 1EHXA 4AXWB 3MLYL 5I5MA 5D1ZI 2YUZA 2APFA