4V11A

Structure of synaptotagmin-1 with sv2a peptide phosphorylated at thr84
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
150
structure length
150
Chain Sequence
KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Phosphorylation of Synaptic Vesicle Protein 2A at Thr84 by Casein Kinase 1 Family Kinases Controls the Specific Retrieval of Synaptotagmin-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords SYNAPTOTAGMIN-1
total genus 42
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4v11A00
4XZ4A 1DQVA 2CJTA 1W16A 1YRKA 2WXFA 1DJXA 2CHDA 3TJPA 1UOVA 2CJSA 3PRZA 1BYNA 2NCEA 4GNKB 4ANWA 2Q0ZX 5T8IA 4KZ0A 4PS8A 2FK9A 3NZUA 4EZLA 4L2YA 4F91B 1E8YA 3PFQA 4IQHA 4ICXA 4Y1TA 2CM5A 4XX5A 3FBKA 5JHBA 2WXJA 4WWNA 4FHKA 4FJZA 3SD5A 3L13A 3ZVVA 2EP6A 2K8MA 2WXQA 2WXGA 4KZCA 3S2AA 3PS6A 3TL5A 2WXMA 4KITB 2NSQA 2ENJA 3DBSA 4WAFA 3HIZA 2QZQA 4DK5A 4L1LA 4QJ3B 2K3HA 1RSYA 3F05A 3FDWA 5KJ7E 1DJGA 1E7UA 3HN8A 2WXKA 3APCA 3QARA 4WWOA 3R7RA 4FJYA 5H4ZA 5EDSA 3ML9A 4LDCA 1TJXA 3IBEA 4QAMB 4TS6A 2B3RA 3HHMA 3W56A 1V27A 2Q3XA 2CM6A 4FA6A 3GPEA 4IHBA 3MJWA 3QR0A 2V4LA 3DPDA 1WFMA 2QZ5A 4A55A 1W15A 2DMGA 3F00A 1UOWA 2Y3AA 2WXHA 4HVBA 2WXRA 3CSFA 2WXPA 4TUUA 1QATA 2CHXA 4ICWA 1E8WA 1HE8A 2FJUB 3PREA 3QK0A 4FADA 2CHZA 4WWPA 5G55A 2RD0A 3F01A 3JZYA 3KWUA 1DJHA 2D8KA 3RPBA 4PS7A 1E90A 1UGKA 4GB9A 5CCJA 3ZW3A 1DJZA 1BCIA 1WFJA 2WXNA 3NZSA 3T8MA 2YRBA 4JPSA 4Y1SA 1K5WA 1RLWA 3ML8A 2ZKMX 4EZJA 4AOFA 2CHWA 4F1SA 4F93B 4L23A 2X38A 3L54A 2WXOA 3KWTA 3APDA 4ANXA 2Z0UA 3OAWA 3ZIMA 1TJMA 2UZPA 4EZKA 1A25A 1E8ZA 4WEEA 5H4YA 1CJYA 2LHAA 4HLEA 2N1TE 1GMIA 3QJZA 2NQ3A 3N5AA 4J6IA 4XE0A 2YOAA 3NSJA 4FLHA 3L4CA 4NS0A 3IM1A 4NPJA 3L16A 4FHJA 4G11A 3R7QA 1QASA 1E7VA 3RDJA 4NPKA 3PYCA 3P2BA 4ANVA 2A4ZA 3W57A 1DJIA 3APFA 4QJ5B 4OVUA 4QJ4B 3TWYA 4MJJA 3B7YA 3OHMB 3QR1A 1DJWA 4OVVA 3M7FB 2WXLA 2JQZA 2BWQA 4ANUA 5G2NA 4BFRA 1DSYA 5CCGE 2K4AA 2WXIA 2DMHA 2ENPA 4L1BA 4URKA 2A5UA 4BGDA 4LCVA 3L9BA 4NP9A 4TV3A 5CCHE 2KI6A 3L17A 4PS3A 3ENEA 3L08A 1RH8A 3LJ3A 1E8XA 4LT7A 2ENQA 5JHAA 4V11A 2R83A 3QAQA 1DJYA 4AJWA 3F04A 2K45A 4DNLA 2ISDA 1BDYA 4F92B 4FULA 3CSTA
chains in the Genus database with same CATH superfamily
4HUCA 5DZ9A 2NT0A 2NNRA 2I25N 3P4MA 4KZEH 3NTCH 2QTEA 2YD1A 3V6ZA 3SKJL 1UOVA 3EJSA 3QGVA 4G7SB 4P5KB 4RSYA 3BO8A 2J21A 1DBKH 3MOBH 1RUQL 2W0FA 5TH2A 3TBYA 2I5YH 4DVBB 2DIAA 3F5WA 3SJVA 1IO4C 3HMXL 2WTRB 1U8NB 1MI5D 4G7YL 4XBGA 3OX8B 4M1CD 4ZQKB 2NQDA 2YEVB 2VN5A 3L1OL 1H15B 5A16A 2GSGB 3WKML 4FTVB 1T22B 3RJOA 1CLYH 2VITA 4OLVL 2E9WA 4GEIA 4ZPVB 3RKPA 3SE3C 4ODTH 4ORGA 2SEBA 1XB6A 4G6AC 4YHML 2H6OA 2AJ3B 2OXHB 2DOCA 5DSCB 2C3GA 2H0JA 2UYLB 3MV9A 1HCVA 1A6AA 1VADB 1OTTD 4XNUL 3CDZB 1CF1A 4HCIA 3NJNA 3IJEB 3IJ9A 4AITA 4H8WC 1U8QA 5B7MA 4ZUSB 2HFGL 3HN5A 1HNGA 2JSFA 3IJHA 4BH7A 3SQOH 4MQ7A 2VGLM 3BDYH 3P1VA 4TQIA 5MEQB 5F9JA 2ZF8A 2AERT 4G42A 1WBYB 3L9YA 3MXVH 4LBEA 4D0DA 3T04D 5IGXL 4LLYB 5D2LE 3IDJA 3RPBA 5MENB 4EZMA 2IAMC 2ZKHL 3CQPA 4N25A 2OMWB 4F15C 4K23H 3PL6B 1RLWA 4JY6B 1LE5A 3VCLB 4PTTB 4Q2ZB 3ZO0A 1T66D 1E9PB 1N4XH 2QL1A 4RWYH 5HHOA 3ZPDA 1XAUA 2QR0B 4YDKL 5I15H 1SQMA 4XMKL 4ZFFB 3QHZL 3Q2CA 1ASOA 4FJ6A 4RMBA 4IRSA 1SJVA 2W9EL 35C8H 5F88A 2C1PB 1OGSA 3US1A 2YMXL 2FATL 1QSVA 3FOLB 3IFNH 1USZA 5J5EA 5IFHL 3BQUA 1F58H 2BP0B 1XGQA 4AXWB 3IDIA 2WLJA 1O7SA 4HKZA 4KDVA 4P46D 2FX8L 4EXKA 1BGXH 4OZFB 2P8LB 1Q72H 3UMNA 3TH2T 1DSYA 2WB7A 3TIDB 1TQVA 2PPDA 3L1FA 5FHAL 2VQ4A 4TV3A 2N0KA 3V4VB 3FXIC 3FZUC 5C07D 1KIUB 3HZVB 3EFFB 1A0QH 2BIPA 2D7TL 2MFNA 3OPZL 1YYCA 2CO1A 2X1QA 4Z7UE 1ZHLB 1R5IB 2W8CA 3OKNB 4JRWA 3ZKND 1BV8A 4OKDA 4C59B 2FBJH 1TVBB 1W0VB 3CFBB 3MOAL 4JM4H 5SV3A 3P69A 3UJTL 3A21A 4NQEB 4TVSa 2G75B 5J11B 3NABH 3EIFA 2VM4A 5C07E 3UP6A 4PJCF 4ZMLA 1O5PA 4NZRL 1JHTA 4GLRI 3FQXB 5FR3A 4WCYL 2XWTA 3QNXB 4CNIB 4JRYD 4CW1A 1QO3B 3MFFA 3QDGE 3VGFA 4X42A 4YSDA 5IHZB 4NRYA 4OLWL 1NL0H 3B83A 5HHXH 3DO4A 3B56A 3VFTA 1WUNT 3L4WA 3ZTJG 1RSYA 3VH8G 3PL6C 3KPNA 1LWRA 3D25B 2CXKA 2J57A 2DDQH 4GRWH 3S36L 3S5YA 4FZ8H 2DLFL 3GSNL 3FO2A 2AK4D 4WI9A 3QR2A 1BX2A 2XWCA 4BZ2L 4DCQA 4Z77A 1D6EA 5JTWA 1BVZA 4OCSH 2ZKXA 3TNMA 5FW6A 3IGLA 3CZGA 2DKUA 4IMKA 5F3HA 3GMMA 4JO8A 2CSPA 4B5EA 2NT1A 4JPIB 4RAUA 4ZXBD 5I8OH 3FCTA 3QI9D 1T1YB 3O6LH 2OKMA 5D6DC 1R5IA 1DJHA 2R0ZH 4FXLA 4JVPA 1BQLH 2H2PC 3ARTA 1HZLA 4L4TE 5B3JE 4GMSH 2CLRB 1ORSA 2JE8A 1NBYA 4XMXA 2DJSA 2WGXA 2E27H 2IV9A 1E5BA 1PZ5B 1BF8A 5D1QD 3GMOB 3NRQA 5IY5B 2CO2A 1FNSL 1CJYA 1INDH 5EBLB 4U3HA 5PCYA 1RL1A 4AYDC 3F7RA 5DC0A 3AU1B 1MNUL 1L9SA 4YQXL 3PGCA 1NA8A 3UTQA 4L3CB 5C6TH 2P42B 2Z64C 4GI9A 3G04B 1WISA 1Q94B 1TQBC 2H3NA 1TO5A 3Q44A 3L7EB 5D1ZI 2R1XA 3LH2H 4DTGL 4NN7C 4LOUD 3SO5A 3ABKB 3OAZK 3CLWA 3HI6L 3BKJH 4ATWA 2ARJB 1A7PH 4ELKB 2XIBA 5FAAA 1HYSD 3GZKA 1X7QA 1WFNA 1U21A 5FO9B 3RZCB 1I7RB 1UM6L 4LCVA 3NGBB 4PB0L 3DDGA 4BFJA 3MV9D 5CZVL 3WTYA 2Y06L 2ED7A 1E8XA 2X4NB 4GIPD 3OHXB 3QIWA 4Z7WE 2Z31D 3GYRA 4EF3A 3OXSB 4GRLA 3SGJC 4ESKA 4X7SL 2PR9A 2WAHA 2A6KA 3HE7A 4AZ8A 1CDIA 3RWJA 1G9NL 1L9NA 4TSAL 3FQ1A 4WIQA 4NC0B 2PMZA 3BSZH 2AJZA 3MRQA 1JNHB 3NSYA 3L2MA 3ULAB 3D3VA 1RXLA 1YEGL 4F27A 4A66A 3OB8A 4BFFA 3FT3B 1D5IL 4JHBA 5HTSA 5SWQA 1BIIA 3GO1H 4WO0A 3GIZH 2YLKA 3B9AA 1U8QB 3CE1A 3ROOA 1XCQA 3HW7A 2GFBB 2IVFC 2Z4QA 4HAGA 5I16B 4JFSA 3IDXL 4L9LA 5DJAA 3D50A 2XKUA 2OMVA 1OTUC 3VXMD 1P7KA 1T2QL 3KYOB 4ORGB 1KZQA 4BFKA 3WLBA 4LHUG 4LSPH 3UGEA 1S9YB 2M1KA 3ULUC 2X1XR 5A16B 2YGPA 4MYPA 1FC2D 1OO2A 4U1MA 3HG5A 5K69A 1DANU 3I74A 4JFPA 4X6BA 1A8ZA 3T0EA 3OL2A 3GHBL 5BVJB 1DLHA 3V7AG 4L4VE 1N6UA 5IROD 4FFZH 2CO7A 4HD9A 3FTVA 4J23A 1SFHA 1BEXA 4P23D 3VYNA 5KS9B 4WWKD 1OF2A 1A7BA 2M8XA 2OSLA 1EJ8A 2RR3A 1NTDA 3EJTA 4AG4H 4XVSL 4Y9GA 2NTFA 1G6RL 4ALAL 3VE0B 1T0MB 1IKNA 3DJSA 1HIML 4TLKA 5AW2B 1NGXB 2KZBA 3EGDA 4LFHD 4JPQA 3FFOA 3T6WA 5DTFB 1MJUH 5IVNA 5C08E 2XA8H 4A7GF 4EIBA 4YK4B 1CBVH 4Z3GA 3GS4A 1QSFE 3PQYD 3U82B 2X4OB 2E7BA 1D6VL 1AFVL 3LNHA 2MH4A 3PYCA 2BCMA 4FYTA 4OQTL 1R4XA 4J8RB 3BSGA 1DJIA 4PP2A 5DD5L 2O61B 4YGVB 3CH8A 2IDCA 4HU2A 5AOZA 1Q1PA 3EOTL 3MBEC 5GZOC 2I32A 5CGTA 2ADJA 3RDTC 1BQUA 2JKIS 1KBWA 3SGDI 3UZVA 2P3YA 9PCYA 3LN9A 3S34H 4XNXH 1OCRB 4F7MB 1NLBH 3MBWA 2ZZUT 3I02A 4XVUD 1JCKA 4FP8H 5DEFB 4LSUH 2FJHB 5F7UA 5JOPD 1CYXA 3L5IA 4U3XA 4OF5A 5T3ZH 1CD0A 3NG5A 4JCLA 3OMNB 1IT9H 2PNDA 3L3OC 2PPFA 4I77L 1CFVH 2NTFB 5KJRH 1QBBA 3K3QA 2BC4B 2GB2A 4XAWL 3SBPA 1IBFA 3HG4A 5GRWA 4YDJA 3HG1E 3EJCA 4N22A 2QHRH 1IV8A 4M8VA 2AV1B 1CLOL 1XFPA 2WXJA 3VMOA 2E3VA 3PGCB 2RTTA 4C56B 2X4QB 3PP4H 5CAYB 1A4JB 1KLGB 2BSTB 2W80C 3V0HA 1CGWA 1ND0A 5C8JA 5LBSH 3INUL 2VZ1A 1WT5C 2DQCL 2DQMA 1MRCL 3EDJA 3OSKA 1CIDA 3D39B 2AJSH 3EH4B 4G5AA 4HGKC 4QRQA 4Y5XB 1L0PA 2Z8VC 2F0CA 2HWZH 3AQZA 1ZGLA 4AIOA 4OM1H 3X12A 1ZT1B 3S36H 3FCTB 4DPAX 1ZKAA 2AK1H 2DLTA 4TF4A 1VJSA 5B39G 1KCVL 5I71B 3EFOB 3SPVA 1CDBA 3BIKB 3SKMA 3AS3A 2FEJA 2ZCLH 3CFQA 2R4SL 1DQMH 1TVHA 5DRWB 2YSSB 3ARGD 2GFBA 2Z4QB 3RB7A 2D2CC 3N42F 3TNMB 5I16A 3RWCA 3O4LA 4AEIH 4N3TA 3WMQA 1A7RL 1JZGA 5KEZA 2LABA 3TN0A 1XBRA 3UYRL 3FQWB 4JDZA 4U1GB 4L8SB 4S1DD 4Y2DD 4Y1SA 2HFEA 4RNRA 2GHWB 2IC2A 2P8MA 3F6LA 3P4LA 4JRXB 2XWZA 2H26B 1K8DB 3M88A 4NI6A 1HQRB 3QC6X 1I3GL 1V5JA 2B4CC 2WP3O 3QIWB 5TDOA 4OBSA 3OPZH 3SPIA 1P5UB 4TSCL 1NFDB 4TULH 4CW1B 2C1OB 1OQXA 2VABB 1CGVA 4IBLT 4DGWC 2HT3C 3KAAA 1GXEA 4L4JA 2OS7A 3L2NA 1QMUA 1FUNA 1R3JB 3MRJA 4R3SA 2N7BA 1B0RB 3HKFA 3STLA 3JWNH 4CJ0A 5FUOH 4H8PA 2XFGB 3P2BA 3DC0A 2EDHA 3APFA 1BGXL 3DETD 5E1QA 1CGYA 1I9IH 2WHVA 3VSQA 2OI9B 3KPLB 3NEOA 1GZPA 3BAIA 2NY1D 1JZDC 1T66C 3WKNA 3G5VA 4FABH 3QUYC 3AXLB 3MNDA 1KB5A 3T5WA 2EE2A 5IFHH 3ZMRA 4KI1A 1I9IL 3DPBA 1A5FL 4CKVX 1R1CA 1NC4A 5H94B 3KXFE 1RMFL 2W9EH 2GJ6A 1P7QD 4MBRA 4Z7UF 2BRRL 4PJFA 4Z7UB 1GGBL 1GKEA 2GAZA 4QO1B 5DR5L 2KZ1B 3SDYH 4FG2A 3BAYA 3CXDL 3FBQA 1IFGA 5EULV 5IFJB 1C5DA 2HRPH 5E1AA 4AM0B 3UCRA 3MODH 4J6RH 2NY7H 1BFVL 3NIGB 2I9LA 5GSRA 4M9OA 5HDLA 1OP3H 3QXTA 2XT1B 4QHLB 5FUZH 1VERA 1JFQH 1ONQB 2F6AA 4JFOB 1R75A 2D0GA 4KRPC 3VXRB 4ETQB 4AQZA 3DX6B 3PPSA 4N0RA 4AT6B 3G5XA 8FABA 1OAUL 1MFUA 1O0VA 2B1AH 2HFGH 5JUEL 3CFMA 2XV0A 2XYBA 4XXDB 3SPHA 4UCFA 3TLRA 4B9YA 4Y4HC 1DJGA 3HN8A 5CKAA 1RUPL 2K9FB 4UT6H 1QSEA 1DQML 4L05A 3ZDXE 2FHBA 1E4KC 4B6ZA 4E41D 5E6IC 4BH8B 3H9SA 1WFTA 2WTPA 4JRFA 1NLDH 4MCZB 1LK2B 4UTAH 4WV1B 4ODTL 5E2TL 4HOXA 1TCRA 1J1XL 4QHNB 4PRNB 3B6SA 1P7HL 3WS3A 3QB7C 2EUVA 4IEFA 3VFRB 2D9CA 4N5UA 4JKLA 4X80H 5CLXA 2C34A 2O1AA 4GXVH 3EJJX 3RTLA 3T2OA 3O2VL 2HVJA 4FQ1H 1J7VR 4FQXD 3RGVD 1TR7A 3OC5A 3CDZA 1T2JA 4HUXA 2FEEL 1MUJB 1A4BA 4GG6E 1VAHA 2HLFD 4AVJA 5E5RB 3FF7A 3BAEH 5JYLA 3O8XD 1G84A 2DBLL 1QYGH 3A4DA 4ADIA 4MNQD 4YDIL 1AZBA 2N59A 1BD2E 4JPKL 4XBPB 3INOA 2B14A 3VU1A 2VSMB 2QVFB 4KZEL 3HNSH 1TNMA 4LOFA 4UTBL 2G0LA 5DK0B 3TYGL 2DEWX 4BFOA 4PJEA 1COBA 5IVXE 3ZGHA 2IPKA 3ESUF 2ROXA 2ZNXA 1ESOA 1R5VA 4J6RL 2FQEA 5CFHA 1U8NA 5E6ID 3LKNB 2IPUG 3Q43A 3ZE2F 2AI0L 3ZYJA 4B97A 1HINL 1KEMH 4PVLA 1BBDL 4R3SB 1R3JA 3MRJB 1T6WA 4JHAH 4YSPA 4H88H 5A2FA 2BZ7A 2NYKA 3HG1A 2H32B 3E9TA 4KRMB 4O2EB 3L48A 1XGQB 2UZYB 3FQUB 1FRGH 3C12A 3MDJA 5K9JH 2HJKA 4TLTA 1PX4A 4AVIA 2C1PA 3QS2A 5F88B 4Y1AB 5FGRA 5DD5H 3FTYA 4XP6H 3ZMNA 2QSCH 3NACL 1RUMH 1OANA 1IX2A 2GYSA 4GJTB 4PJXF 2K6ZA 3TN0B 2QV2A 2ZXBA 3KWWA 4ZUUB 2JELH 5C0JA 5FO8A 3KBEA 3PL6A 5I1KL 3ZN6A 4TULL 2Y6SD 1K4CA 3FT9A 2CBMA 5AZ2H 1UADC 3SY0B 1OSPH 2A6IB 4G42B 3TOPA 3RZCD 3T3MF 3KXFA 5JDSB 3BUYB 4ADGA 3PWLB 4I5BB 2Z1KA 4MQ7B 3SGEH 2AMGA 4G9DA 3DBXB 3GZOA 1C5BL 2JCCE 4WUUA 5I19L 3JT0A 4H0IA 1KBGH 3EYVB 3POCA 2NY4D 5D6DA 4HAKA 1VHPA 3RL2A 3VVVA 1AQDA 3M8OL 5DSCA 1JWMA 2IANE 4XO9A 4HJIA 3RWIB 5GJSH 2LU5A 4GH7B 2HJLA 4KROD 2VDOL 2J12B 2X1OA 5FUCC 4KDTC 4EUPB 3DOSA 1ZY9A 3ZT6A 5I19H 1TTBA 2AITA 3WO4C 1C8QA 1DQKA 4N1CA 3VXMB 1FNHA 3F62A 4KJYB 3OAYK 4YR6A 4HEPA 4FNUA 3CPUA 3MRGA 2ZIDA 2HJLB 1H0DB 4R7DB 3RWIA 2BM3A 1IE4A 2HUEA 4HIXH 4X6DB 4OFIA 4L3EE 5EU7C 4JL1A 1EAPB 4JHUA 3T09A 5CN3A 1OGPA 1T89C 2OV0A 1MFAL 4F93B 3MLTA 3UZVB 4FLQA 2PCPB 2KKQA 3GO1L 1ZLWH 4WUUB 3IETB 5DYFA 5L4IA 1D5IH 3CN4A 3KHOA 2P7TB 4KQ4H 4MJHA 5E0FA 5T1DL 5I73C 3DXAE 4KPHL 3KXFB 5LWYH 3VFSB 1RU9L 1MVYA 4GRLC 4J28A 4Z7OB 3ZKNC 2D3NA 1KACB 5DJYA 3FQ2A 2W65A 3N04A 3C08L 2XQYA 4K5PA 2A9NH 4QRPE 4H88L 2H6UA 4X99B 1KY7A 1B0GA 3BKJL 4PW9A 4A67A 5KJ4A 4F7CA 5E99L 3WIIH 3U0WH 3EKCA 2DTSA 1ADQH 4ZO7A 3LH2L 1YNTB 1E43A 3N55A 4L1TA 1PZAA 4ZAKD 4Y1AA 3KPSB 3MOQA 4OJFH 4WHTB 2FX9L 1P1VA 5F6HJ 2VZ3A 4R90H 2HJKB 1JHLL 5EZIH 1U2YA 4MHHG 2R1YA 2VTFA 3CHXA 2WUCH 1EAPA 2F5AL 2GG1A 5KS9A 3BSHA 4CILA 2HT4C 1OAXL 4KXZI 3GI8L 4X6DA 4IU3B 5A3IC 3BYYA 2EABA 4JNXA 4UMSA 4XO5A 4WI4A 2FIKA 2R7EA 3DMMA 5DDHB 4DIXA 4GUCA 4IGBC 2Q6WB 3LOWA 3MJ7B 1DL7L 2RA1A 1HIMH 4ALAH 3DOHA 1R5VB 5IUCA 4H1LG 5KBPA 3C09B 4OU3A 4XHJC 3NIGE 4OD2B 1GZHC 4XPTL 3SE4A 2H6PB 2P8PA 3CN1A 4OB5H 3WFDL 2PPAA 1BQLL 4ZUVA 3ROLA 4AKOA 3D4ZA 4GQRA 2MSPA 4P59L 1BQ5A 1KEGH 1DZ0A 4HSCX 3EOYG 1I8UA 1PAZA 5CZXC 5MEOB 1AQDB 3MBXL 4H40A 4L9LB 1UWGH 2ZCKL 3EYVA 1HHHB 4ODUA 4UT6L 2NQCA 3K46A 4DP2X 3VM7A 1AJ7H 2VL4A 2N1KA 3KYAA 3ARYA 1EFXA 2DWEB 3GSNH 4X9IA 3VGDA 3I6KB 2IDQA 4N20A 4AUJA 4ANKA 3VFRA 3C2AH 4IEFB 1CFBA 4ZSOE 4ELDA 4HHGA 5D70L 4Z7QB 1IFHH 1FGNH 2WO3B 5ADPH 4FXKB 2QQLL 4MNHA 1Z9SA 5IJVA 4HSQA 2QQNH 5CBEB 2P80A 1XF5A 4JM0A 5KUMA 3ZW3A 2D7PA 3ZYIA 2J56A 3OXSA 1UZ8A 4GRLB 2LGNA 3DIFB 3VB9A 5CFAA 3ALXA 1KPUA 1X5JA 2EYSA 3GFUA 3LPFA 4XCFL 3WFEH 4AGNA 2M2DA 2A77L 5DJDB 3S2CA 2HUHA 2R15A 3BJ91 4QTIH 3KWWB 3DTDA 1BW8A 2BJMH 3APDA 1WHOA 3EYQC 3MSPA 4ELKA 2NY4B 3VH8B 2J3SA 3HC2A 4N2OA 3RDTA 3GINA 3R4DA 4JM4L 4GUOA 4NO0B 5FGBC 3GMNB 3CC1A 4JFOA 1TITA 3C8KB 3IM1A 4G8IA 2B15A 3PDOB 3T77B 3CMOH 3V4PB 3QI9A 5F96H 3R0MA 4KKQA 3W9EA 3BPLC 5CBAB 1IBYA 2D7TH 5J8OA 1RZIA 3GI9H 1ZLWK 3UABA 4JO4H 2NY3D 3WSQL 4LPCA 4Q4EA 3IU3A 3FTZA 5FB8A 3CFEA 3MX0B 3DDFA 1XB8A 1XH2A 3U4BH 2CO6A 2EZ0D 4L1BA 2IWEA 1NAML 4BKTC 4RBPH 4PJFB 4Z7UA 3QZNA 3Q13A 3UG5A 4DTGH 5E6YA 1HJCA 2R39A 1KT2B 2R83A 3ARRA 4G8FB 5DZJA 5ALBH 3GB7B 4IKIA 4PJDF 3JZ7A 4PRPD 1ED3A 2BOLA 3QEQE 1ETJA 1YC7A 2Y4SA 1FVCA 4B9GA 2DJUA 3KPLA 4N0UB 4YS4A 2FCBA 3C5SA 3BVNB 3N42B 5TE7L 5JPMB 1Q1JH 4HUXB 3DTUB 4DKEL 5HGAB 2WLYA 1J88A 1LNUA 3VFWA 1A7RH 4LLUA 1KYAA 5L2JB 2MNWA 4AMXA 5JHBA 4IJ3C 3EH5B 1X9UA 4XNYL 3RIAF 5BPPA 3QFJE 1ZPUA 5DK3A 4QRRB 4G43B 4NQXB 1LK2A 2ZICA 2Y22A 5D71L 2ZWLT 3HBPA 1OARL 5IHZA 1IGYA 3MRDA 2YZ1A 3VI4A 2FAUA 3QUZB 2AXFA 1DFBL 1N70A 3MNMA 2CM6A 3WN5C 4F7TB 2YQBA 3QJRB 4U1SB 4BK4A 1QFWL 2P5WD 5I30H 2ZCKH 3RVTC 4PRID 1WZKA 5IUSA 1MQ8A 2E5EA 3TTSA 3FU7A 4AK2A 3RNQA 4N6QA 4Y88A 3O3EB 4TUOB 2X0WA 3PP4L 4P59H 4YHMH 2XG5B 1KEGL 1V10A 5DWPA 1MG3C 3ZHNA 4WWPA 1U58B 1ZT1A 1FF5A 3LN5A 3OB0K 4OLWH 5HHXL 4XNZC 1UGKA 2AK4E 1S3KL 2OZNA 4H20H 5GSRB 1JMZA 3RPIA 1HHIA 2R2HA 4XX1G 1IEBA 2VDLH 3K6SA 4GG6F 3U6XA 3C60C 2VKXA 5DGQA 3VQMA 1SDYA 2BFVL 3FS9A 3WEBA 3MRNB 3TO4C 1TJMA 5DMGC 3TBVA 4Z7WF 5IMKB 3UTTA 4OZFA 3BT0A 2P5EE 5LQBH 1OAXH 5J1AA 3FC8A 2NY6D 4LLVB 3Q9QA 3ISWA 4DGVL 2J6WA 1FL3B 2YUVA 4JFXA 4R7NA 4BUHA 4C4UA 1FL5A 3L9EA 3FU9A 5FO7B 5LGYA 1JGUL 1G7MA 4O58H 3N91A 4W9KC 1RHHA 2P26A 1U8MB 1RZFH 4MKMA 3WO3B 5DQDH 2RALA 2YKLH 1VFAB 4NLHA 4OF0A 1D6VH 4P4RA 3HJEA 5FFOA 4AYGA 1VFMA 5MERB 3D52A 4ALAC 1N3NA 5EHFA 1LE5B 3I6LE 5AVRB 3WTUA 2VSDA 1BFTA 1O9ZA 2XA8L 2L7QA 4DNLA 5TPWL 1ZPLA 2L04A 1BDYA 4R83A 1FC1A 4DEPC 4YDVB 6CGTA 4YLBA 5TGBB 1IGTA 2AS5M 5PAZA 2YUXA 3UTOA 1CTNA 2EDYA 5BS0E 3FT2B 5INDB 1DVFD 1CDHA 4Y16D 1AQKH 3PFUA 4FD0A 4ODXB 3QXAB 1RZQA 1OTSC 2FWOB 2R9HC 1B3IA 3QZWG 2D0HA 3LPWA 2Q87A 4TSBL 3UTSE 4S0HA 1R33A 3DXAA 4EI5A 4JZJC 3PS6A 2P52A 4IRJD 4W4OA 5IREA 3UBXI 3CVIH 1Q9LA 2EAEA 2V2WA 4ZW7A 5BS0D 1JXJA 4PJIB 1JYVA 2GSIA 3VXRE 3EGDB 2IDTA 4X8JB 5IGXH 2EIJB 3RX8A 2CUHA 5BVPH 4JG1L 3BEWB 4HLZH 4HG4J 3BDYL 3WMPA 2OW7A 1H15A 2ATKB 3P4NA 4QAMB 1XD1A 2WQAA 5EIIG 1V27A 3KPRD 4NN6B 3SBWC 2B2XL 3U7WL 1OARH 2IGFH 1W8OA 1Z66A 4LSPL 4Z0XA 5HDBB 5CILL 1MKFA 4HJGA 1SF3A 1BJ8A 2NR6C 3C6LD 3Q1SH 1QSFB 3WHXB 1NJ9B 1IBGH 3D05A 3W5MA 3ATDA 3MCLH 2EUXA 1OK0A 1U92B 3TH4T 5E4IA 2YD3A 1XGUB 3F01A 2WYZA 3WNLA 4B60A 4WHDA 4KKLD 1UWXH 5JA9A 3ES6A 1DJZA 3MNZA 2WLIB 2ZJSH 4UYQA 2DM2A 1X5ZA 3NA9L 2IAMB 1WO2A 1MCPH 2RHEA 4G7YH 3QWOB 3BSZL 3GUFA 5EF1A 2Q86B 1DBKL 3MOBL 1GIGL 2CK0L 3GXPA 2XPYA 3QUMB 2ZXWB 5DEFA 2CJ3A 1AD9A 2YOAA 3BFQG 2E56A 4ZDHA 3B4NA 2QQKL 3ETBF 3FTGB 3BE1L 1FO0L 2PP7A 4UF7C 4DFIA 5KG9A 1DVFB 4D9LH 5CHNA 1QLRA 2YOCA 4PHXA 1UKTA 1GGUA 1PG7H 1BLNA 1U95A 4AC4A 1MRFH 2BW4A 3MMEB 3PUUA 4K3DL 3B2MA 1QRNE 2X42A 5GS0H 3ZZSA 1CF8H 3DX7A 3SE3A 4MAYA 3LIZH 2IEPA 4PRPE 3OLIA 4G82A 2UWEA 1WA0X 5CHNB 2DYSB 5FHBL 2XHNA 4AQEA 5KG9B 3QUHA 4F2FA 3T9WA 1NGXA 2ICCA 3DX9B 4TVPE 1ET8A 3F7YB 2TAAA 4M62H 1NGZA 3HUJE 2A77H 1FNAA 3IKCB 3RWGB 3ABLB 1OAQL 4LO9A 1AD9B 4N8CH 3MRFA 4WHCA 3LZFH 4L8CB 1UD2A 3RLSA 3HNVH 3JVGA 4YSCA 4WTWA 5DLML 25C8L 3VNYA 4YDIH 3X3FH 3PQYA 1P84K 3VI4E 2R29H 1MCRA 3K81A 4KMTH 5D7JC 3FT4A 1XMEB 5CSZA 1ZA3B 2H32H 3RVXC 3MNWB 3P3TA 4ODHL 3QFJB 4D9QE 1OPGH 5KS9E 3JV4B 2NMSA 3L3OB 4L4VB 3ARSA 5DHMC 5GS1A 2VH5L 1PX3A 5GHWH 4GG6A 1NBYB 1J5OH 1A1OB 1OTTC 3K0WA 3MLYH 1GGYA 1MCFA 3QVAA 3HRZC 4LLQB 4IOIB 1FH5H 1ZDQA 4NPYA 4HGWB 4NC2B 1GCFA 4S1SH 3FFCD 3FQYA 4LRIC 1K72A 2OMVB 4OSUH 1NL0L 1CVRA 2WLNA 3G6JF 1EGJL 4TNFA 1BEYH 1GHFL 1ZA6A 4YBQD 1RUPH 1TETL 4ICWA 2EDBA 1AH1A 2OL3B 2YK1L 3UYPB 4W6WB 5H37A 1U8IA 2JQAA 1L7IH 3FO2B 3BUDA 4TNEA 1ZLEA 3P40A 1O9WA 1M56B 4JPSA 3FSWA 4QWWD 2XXFA 3MRBB 4HDIA 4V2CB 5KVDH 3NJVA 1M1XA 4ZFOB 3SE9L 2OYKA 4L23A 1KTCA 3STZB 3ULUF 2LU7A 1PZ2A 3B9EA 4FFYA 3OV6A 1CXKA 4FNLL 3O2DL 1WA1X 2D4DA 2GUOA 3QHFL 4N90D 1D2OA 3NN8B 1IAKB 4HH9A 2Z7UA 1YEKL 4FQXA 3RGVA 3SO3C 3VXUE 3JQOB 1D9KD 3GEFA 4RAHA 5F6IC 1LP9F 1SFDA 3KZ8A 1ORQA 4F37K 5T33L 2XPZA 4X5XB 2ATAA 2KZWA 1S6NA 1M7IB 4QKXB 4XB7A 4JG0H 1TYEB 1YEJL 2JK5B 1ZHLA 3MLUH 5F0PB 2BZCA 2DS4A 2A9CA 1AANA 1K9TA 4GRWF 5MERA 2GC7C 4L3CA 3UTQB 4ERSL 3M17A 1NGPH 5C0BD 4XMLH 3TZVD 4FI7A 2G3XA 4W6YB 1U8MA 4EIGB 3UTPE 3X14A 4PMFA 5D7EA 1OGAA 2Y72A 3MUY1 5GS2H 1L0XA 2QADC 1ZVSA 4XMKH 2ISDA 5I15L 1TZOA 4FFVC 1U2HA 1MFEH 4LCYA 2CIKB 2BSBA 1PZ5A 1SEQH 2QSQA 1S8DA 4RVBA 2KBGA 2N3JA 4AGLA 4XMVA 4GQZA 2A3TA 3ZKMD 5AVSB 4ZX6A 2XBTA 3PAZA 4XWOD 5GS2D 3BQUB 1E8YA 3SKOB 3BRDA 4KV5F 1IAII 2YAFA 3MRNA 5LBSA 2VN6A 4FMFA 3GGWB 3TXAA 3II3A 1VB9A 3D69A 3MXWH 1TKWB 4AMKH 3K6SB 5T5NG 1KCSH 1IEBB 1SM3H 5BZWA 3RVUC 2Y36L 3PNRB 2F15A 4ODSL 3WDIA 5HD8C 1ETZB 4FQHB 4XMUA 5HDWA 4LDOB 3UAFA 3GXMA 5BXFA 5DFTA 5DQJB 2IFFH 3CLFH 5A7EA 2ZX5A 4WQOA 4X5QA 5BW7C 3OKMA 4F33A 4IBQA 4JO2L 3D25A 4PJEF 5EUOB 1KV3A 2X2JA 4RESB 1GJIA 4YHYB 2XX1A 4NAJA 2VLLA 3BEVB 4NNXA 4OM1L 4G8GB 5KVFE 5C0GA 4BD4A 4LEOA 2WM0A 5HGBB 4LPXA 3FQXA 1J5DA 12E8L 2EE6A 1HZKA 5B1CA 4LIQE 4KJQC 1QWUA 1CURA 4Q9QH 3DTXA 5CCJA 4PJDA 1J9QA 3Q8FA 4FQCH 4Q9BA 2JJSA 1GJWA 2PW1B 1W0VA 2XWJA 5SWZB 3U6RB 5FWRA 2OLDA 1CFQA 5C1MB 1GH7A 5KOMC 2GI7A 5EU3A 2XOTA 5K9QI 1LNUB 4CVZB 3NSXA 1DTUA 3SGJA 2G0KA 4ELMA 3KJ6H 3EOBB 4AL8H 2YAMA 3FSAA 5GXBB 2QT6A 4DFHA 1FFOB 1WPCA 4UB0H 2FYVA 2NYZA 1N64L 4HS6B 5KVGH 1HEJC 5FCSH 1AIZA 2PXYC 4OZIF 1IVTA 3GSQA 3GMPA 2F8XC 3KLLA 3ARBC 4XP9L 4YXHL 5E8OB 2JTYA 5GSVB 4HIQA 4K9EC 5IG7B 3P4MB 2YPLD 2EACA 1HXMB 1J1OL 2N01B 3ZTCC 4YHNA 5IB5A 1RLBA 2A99A 3FAXA 3UIZA 3I50H 1ZJBA 4Z78B 3L3HA 3RAJH 5IB2B 4JFHD 2DYRB 1QEWA 3ILDA 2QR0A 4N0CC 4PGZA 2XLLA 1RIVH 3BQVA 3BP6A 3NDZE 2F5BH 1CT8A 1EXHA 3HN3A 2C9XA 4QRAA 3LN4B 1MJUL 1JI1A 1K5NB 1SOQA 4QF1B 2Q8BL 3VI3A 1ZGLM 3QC5X 2BW5A 5I2IB 4Q9QL 5H2BB 3D9AH 4H25B 2O26U 4ZOEA 2HYMA 1OWRM 1SQ2N 2NR6D 4FHKA 5A2KH 3O2VH 3O3UN 4R97B 1IE5A 3UC2A 5EFIA 3CLEL 3HFFA 4UT6A 3EHBC 2QZQA 3RWDA 3RX9A 3KLHC 4JJOA 3RGHA 3IJEA 4LCCA 3D7PA 2QPUA 4MJIA 2YXFA 3J27A 4HHAA 5HVWA 1J1XH 4E9LA 2HMID 5A7BA 1N5YH 4FFZL 1QVOB 1AOZA 1KNOA 3KEDA 1PD0A 3L4UA 3MV9B 1D5BA 1G1CA 4F80A 3U1PA 1SXSA 1UACL 4XO4A 1HJBC 3UACA 3QXVA 2X9YA 1GYAA 1A6ZB 1AOHA 5ALCL 1JGIA 4FYQA 2IFFL 4Y5VA 5DMYA 3NJLA 4UU9B 5F1SA 2X70A 4JFEE 3C6SB 1J8HA 2BVYA 1XF2A 5MEOA 3V6FB 4WLCA 1MCLA 2WTRA 1DVFC 5DEZA 4JQIA 1JFQL 4L0ZA 4B50A 4EE2A 1IGJA 4U6VH 4DPBX 1AZVA 1INQA 1DQLH 3CPLB 2VZUA 4DEPB 4P5KA 2VDPH 2L3BA 3OXRA 1EZUA 3HI1A 3WOVA 4M7KL 2EXYD 3ML8A 4TQEL 4UV4H 1ZTXL 3VRIB 1AHMA 1X5AA 1G7QB 3O4OB 4XOCA 5JO5A 4PGBA 3ZIMA 1NC2B 3F12A 1E8ZA 3Q6GL 2GY5A 1YEGH 4R7XA 2CA3A 5A2AA 1ZVYA 5SX5K 1RAMA 5DR5H 2MJWA 2J4WL 4DP5X 4PREB 4ZUTB 1MAKA 3FFCB 4AIZB 1JMXA 1JGEB 3HBZA 5IVXB 1XD0A 3VFGH 3CGTA 3QA3B 5T3XE 2F58H 4CGTA 4UOJA 1PU0A 1KB5L 1Q38A 1HESA 4G1MB 5D7LD 1YEJH 1NFAA 2CLZA 5D4IA 1RVFL 2EDKA 4MNGA 2EIZA 4A04A 6FABL 1OAYL 1T2XA 3EJUA 3RP1A 1TZIA 3N85L 3OZLA 2WVSA 2NY5L 4OZGB 5EIQA 3PJNA 4P2RE 4URTB 4HOMA 2EVIA 5CGYC 5DMIH 3JV6B 3ZUCA 3AU0A 4CKQA 3WD5H 4HKBB 3EG9B 3FHEA 3QHFH 2DQUL 3ULVC 4ZBJA 3LEYH 5I76B 4LPWA 3LKPA 4GG8A 5I5IA 4C4BA 4YQXH 4ACTA 3FH7A 1PFOA 3BD4A 2V9UA 2HVBA 1OAKH 2WW8A 2H45A 1VFBB 3UYRH 2V7NA 2OR9H 3NIDE 3PFQA 4JZJB 3VXSA 3ARDC 2VM3A 1JD9A 2UY6B 2BXZA 5SWSB 1WWAX 3GSVA 2ALAA 4PRPA 3VWKC 1M3JA 3HCVB 5JR1L 1HOCB 4P2QB 3CVDA 1AYOA 4OCWL 2AGJL 4TPRL 4HUUA 1HYRC 1OKEA 3WY1A 1G0YR 1HL4A 1PG7W 4M29A 1VRSA 4F7PA 2PTTB 3QJTB 1UJTA 4GAAA 5I8KH 5ADOH 1JWSA 2EDOA 2EH7H 2WQVA 4AQAB 5AFAA 4DGIL 2VDRB 4QAWA 1BFOB 2VH5H 3M1BA 2W1NA 1A2YB 4N2CA 4OIIH 4L3EB 5FYLD 5LXGH 1H6FA 3S5LB 4N9GA 2ZF9A 1H3PH 3JTTA 5GRJH 2ZP9A 4OV6F 4JM2A 1A8JH 3H0TA 4KXBA 3ZSSA 5LBSL 2WPGA 3QIBB 2ZQKA 2ZUYA 4HBQA 1FIGL 2CIIB 4LASL 2IPTL 4XMZA 3H53A 5C09D 5AG8A 2FO1A 1OWWA 1ZLUK 4XI5D 3UC0L 2D8KA 4HJJL 4GI8A 1YJDL 3VG9C 2QHRL 4LCCB 3RIFK 4XN1A 1RZJH 1MHHB 3MNVB 1WD9A 4Z76A 1RI8A 3EYOA 2A74A 4K9EH 4Z95L 1JV5B 4ANXA 2MNJB 1UEYA 2XICA 2VOTA 3B2DC 1BZ9A 1YEDA 5DRNA 1MJJB 3FOMA 4FHBD 4NJ9H 3GF8A 1ML0A 3V52H 4QHUB 5CEZE 2YIHA 3ME0A 4RSVA 1NCBL 2ZXQA 4PG2A 1DSFH 3BZDA 5CEZH 5J1TC 3PAYA 1XAKA 5CSGA 1NLBL 4G11A 3AITA 1KJMA 4WW1A 5GS3A 1QR1B 4N85A 4CVXA 1DQTA 4H1LH 4NRZA 4I3RL 3U7AA 5A2JH 2VN7A 2XTJD 3QEUB 3EOTH 4GKLA 4G9FB 3S4SG 5F3BB 2F1AA 2UZXA 1RJZB 5I6XB 1N18A 4N6RA 5IMOB 5TQ0L 2DQEH 1FIEA 5I1GH 4KY1L 4JVUA 2FL5A 3BE1H 4LOEA 5HHMD 4CA4A 4X0KB 4LHUD 1I4FB 3HC0B 3QEQA 4M8RA 3O9WC 3R0NA 2UZYA 3O9WB 1CBVL 3TV3L 5IMMB 1S4IA 4XMWA 4UV7L 1NPNA 2BNQA 4M1GL 4LSTL 1TTCA 3OD3A 4MMYA 3S7GA 1PCXA 3LEXA 4G8AC 1J9RA 1W8EA 2VXVL 2CGRL 5AW7B 1EEYB 5E23A 3H6JA 4U6XB 1IC5H 4NJAL 2F08A 3II2A 1LO4H 1KELH 4HAFA 4JZNB 4R4NC 1VPOL 4O02A 5HY9A 4DQOL 4KXDA 4QRUA 2VL5A 2ZJSL 3DVGA 4L2YA 4F91B 3VD2A 3HFMH 3N43F 2P24A 2ZUWA 3PWJB 3MRCA 1E4XL 3DECA 2ICWA 3U6RA 3QEQD 4G6KH 4ZMAT 3GNMH 2EKSA 1URZA 4OLUH 4APQD 3SQBA 2J25A 3FU8A 2H2SC 1YNLH 4ZUWB 3Q1SL 3LZOA 3D3VE 4JN2B 3GXUB 3W2DL 5KJ7E 4JRXD 2HVJB 5EZOH 3SQOL 1RUAL 4X7TB 3TWCH 4FKKA 2A83A 1KIPB 4EI5D 4IK6A 3P2DA 4PRDA 3V5KB 4Z7WA 1YPZF 1QFHA 4W9IC 4JG1H 2AJXL 2AV7B 4JFYA 1MCSA 5CLTA 1EAOA 3LV3B 3NH7L 4NZ8A 1WFMA 2HN7B 3QG6A 4IRSD 1A3LH 3WFCH 4BH8A 5JMRA 5J89A 4X6CA 3OR6A 2NW2A 4PJHE 1N67A 1PY0A 3DURA 4PRAB 2H1PH 1NUDA 3AWFA 4AK1A 4KVNH 3ECWA 4UOW1 2QLYA 3NPSB 1TU2A 3NSCA 1R47A 5B1BB 3DWTA 5J56B 4X6DF 2KHAA 3TCXA 3BSZA 3O6FD 1CICA 1XCWA 2P43B 4X4YA 4NQDE 3U46A 3ZQWA 5DZVA 4UILL 5IQNA 4PJ9D 4IBVA 4E9RA 5T3XH 2EE9A 3LEVL 1XL6A 2VR9A 3HR5A 4GKSB 2Q76A 4Z7VA 1YMHB 5TPWH 2XQBH 3RWHB 3NSDA 3WEAA 3ARDB 3N40F 1YDPA 4ZO6A 1IJ9A 3BKMH 1XX9C 5ICYB 2ICWI 4PI0A 1I7UA 1SDDB 4YBLB 1C5DB 3QDGD 5E1AB 1RK7A 1JZ4A 4JUSA 1YO4A 3A0OA 4GO8A 3W57A 4KX9A 1F0LA 3CZLA 4FXKC 4LF3A 3REVA 1XB3A 1AR1C 1VGKB 3DA0A 2EC9T 3ARPA 2W9DL 2OJZL 1S9WB 4I4WB 4PJ8C 4XRCB 1GSMA 4R2GD 2YAEA 3ZOAA 1PCSA 4XC1L 2YSTA 2JK5A 3FUMA 5HYJE 3D85B 1U6AL 1M7IA 5AALA 4DESA 1TTAA 2OPCA 4UQDA 1ORQB 4P2RA 2BP3A 3BLKA 3IFOB 1PZSA 3STLB 1MJ7H 1B0RA 2BRQA 2GCYA 1GS8A 1EHXA 2R8SH 4NHCH 3D18B 3CNKA 2VABA 1LEGB 4O4YL 4PJHA 1NOAA 2LR4A 3T0BA 5IF0A 5IJBC 2QPDB 4GMSL 4FQQA 4NXKA 4PJBB 4K3EH 5ABDE 1XSIA 4LLMA 4PUBL 5E2VL 3L45A 3FB5B 4ZTPH 4PPTA 1BREA 4U49A 2BSDA 5D1QA 1U93B 4XR8C 3DRQB 5IIEA 3L2LA 3AG2B 2CO3A 4OFKA 5DZOA 4UQEA 3O4OC 1YY8B 4YXLH 4AJYV 4ZK8A 5I24A 1U8IB 1P2CB 3CXFA 4G2AA 4OLZL 2XDHA 1G9ML 4LCUB 3O4LB 5ANHA 2OMZB 4JO5A 1RZJC 3FMGL 2QVIA 4N2AA 2FYYB 2YPKA 4J3XA 3BIKA 3SPVB 3UP1A 2V9RA 1ZSHA 4XPBL 1DHKA 4DWHA 2JKJA 4IOIA 4PJGA 1M7DB 3KVPA 4PBDA 5LCVA 3QJFB 3HUJF 2Q1EA 4BFIA 1N2RB 2ITDB 1J0IA 2E86A 3H7BA 3ISYA 2CGZA 2BNUA 3M6DA 2VDNB 5DC2A 4HQQH 3FQNA 3WEOA 5CJBA 1PZCA 1AI1L 2BVUA 2DIBA 4GAGL 1BXVA 3BVTA 1A9BB 4OI8A 4PAZA 2W0LA 2UVEA 3VGAC 4JEGB 3VXNB 2HAZA 3IN0A 2HB0A 2CHWA 4Q6IC 1IAIL 1LO5B 5HHQB 1DBJH 3EHBB 4PY8I 3NSFA 4XPHH 3ZDYB 2V17L 1BVKA 3CHOA 3APMA 3OB0H 4UIMB 1NDGB 4A2MA 1YEWA 3T4YA 3BKCH 1YYLL 4M7LL 4R4FL 1OCCB 3P11H 4KHXL 4JM2F 1SNRA 4QRTB 3F7YA 5L8LB 3DX9A 3B8SA 1Q72L 3UTSA 2ZOWA 2V9TA 1XBDA 3FCSB 2AFNA 1JAEA 3CMGA 4UOQA 7CGTA 2FJHA 3KCWA 1OTUD 2AQQA 2B4CL 2DWTA 3MBWB 1JNLL 2XXGA 4LGSB 3RL1B 1Q9KA 5BUAA 3PPEA 3ULUD 4PS3A 5KANG 1I9JL 2EDXA 2Q7YB 4WI7A 4YHIA 4PP2B 5AAPA 1P4BL 1R3IH 5B38G 4LKCA 2EDLA 5KVFH 1JS4A 1UATA 4LQFH 3E1F1 4N2DA 5E94B 2V5TA 1YRKA 1ZVHA 3VG9B 3BX7C 4B7LA 1MY5A 1UWFA 1Z2KA 3PGDB 3CHPA 4OIBA 4P57A 2V3EA 3NZ8B 4KK6D 4BK5C 5IB3A 4NFBA 1NIEA 4Q74A 2J88L 2PPEA 1J48A 4BCYA 1EA9C 2IG2H 5CF3A 1JBJA 4Z7NE 1ES0A 2A9DA 4HD5A 1AXSA 2D03H 3KYMB 3P02A 5DJXB 4Z7OE 2PO6B 1KXTA 4XP5L 3U79A 2IAMA 5D7IF 5DD6A 1ITBB 1XXFC 4QRPA 15C8H 4N4YB 1U8HA 1XF4B 5BNXD 1GZQA 3QP3A 1G9HA 2C4FU 2R2BB 4JDEA 4PJ8D 4MA7H 3VRLF 4E5XG 4HIJA 5HGGS 3WHXA 1C16A 5EEXA 1E50A 1T89A 1YG9A 2O5XL 4JFFB 3TP4A 4HALA 2VXUL 2WANA 3QYMA 1P9MC 3RWFB 2NDGA 1JN6B 3WFDH 2GVYA 4R0LA 4WHYH 4CUCA 1KBVA 1KENH 2QSTA 1UXSA 4MS6A 2G60H 3BDXA 5I6OA 3BEWA 5G55A 4S1RL 2D7MA 4WFHE 5IT2L 3GBNH 3VXTA 2DV6A 3BPCB 3KYOA 1AHWB 4KV5E 1P7KB 2IDSA 4IGBD 2V2WB 4NQUA 1L6XA 4P2QE 3WJLC 5DJAB 5IHUL 4I2XA 4MA3A 3EYFB 2JH2A 1TLKA 1IILE 32C2A 4JZOB 3GZQA 4A38A 1WICA 3KPPB 5DJ8A 4JHWH 4GQ9L 1E6JL 1BMZA 1IFRA 3U30C 3VX1A 3QUYB 4NZTL 4F7KA 3DO7A 4L2LA 1D5XA 2OSWA 1JNHA 4H0LC 3U0WL 3ABMB 3CVHB 2Y7SA 3TO2A 4I0PA 1NPJA 1F4YL 3FO1A 4LF3B 2CAKA 3UYOD 3CFJB 4U2ZA 5L9DH 3IMSA 1G7JB 3DIVA 5EOQH 2FLMA 3TFKD 2WBJD 3LIZA 3OC8A 3OJVC 1XF3A 3GHEL 5FO9A 1KLFB 2Y07H 4W68A 1KUMA 5EOQL 2ARJA 4HCGA 4TRPL 4ENED 1C8PA 4GRLD 4KKNA 2IXQA 1OZTG 3FUFA 2E7HA 4BQBA 5E6IB 1NCCL 4X83A 4U6TA 1X5LA 4N2KA 1BAGA 5T1DH 4ZOAA 4J39A 4IBSA 4KQ4L 4PHZA 4IRJC 3DROB 1P6AB 4JFQB 5HVGB 4W9DC 1PEWA 3CXHK 2ZT9C 3CZUB 2XKSA 3SCMB 1YECL 4P46B 3KDMA 1YEHH 4KTDL 4IBUA 5DA0B 3WUWG 5A2BA 4NZDA 4GSRA 4GQQA 1MQKL 4JFUA 4KXCA 5EU6A 2X0UA 3FN0L 2WSPA 3DURB 3VFNB 4U1LA 1MWAL 5DC9B 3QO0B 2JJUA 3FCGA 2ENJA 3ZTJH 4A1RA 4WAFA 1EEUA 1HHIB 4NNPH 3QORA 1CFTA 2C8NA 1HHKA 2L0DA 4M6MH 4YO0B 2X3AA 4XNMB 5AAMA 1U58A 4PRDB 3V5KA 1OAJA 5SWZD 3MV7D 2XG5A 2FHFA 1O75A 5JORA 5M95B 5F3HB 4WNSA 1NANH 3IMUA 3L3GA 2XWDA 4Y8DC 1LEKB 5IVXF 4IHBA 3K8MA 4R97C 4YHKL 1PYWB 2ZKWA 4PJHF 1P6WA 3MAWA 4OLEA 1AGBA 4P2OB 2H9GB 3KS0H 5INCB 3RQ3A 3HPLB 4QTHA 2V2XB 3MC0A 1AD0A 2G3NA 2WAQA 4KJWD 1IGYB 3MRDB 3HRZB 3VI4B 3LDBB 3QDME 3ZGIA 3A6CH 1PS3A 3STBA 3ZIYA 1OSPL 4WFFD 1XF1A 1ZIAA 4QXUH 3KPTA 5ABAA 2N7AA 4UM9B 5I6NA 3C60D 2IQ9H 2BSRA 1RCYA 4K7FA 3MRLB 1I75A 3LDBC 2WNGA 4TYUA 3KM1A 2VDQH 3AT0A 3O4LD 4XOEA 3UFIA 5D5ME 4HUMB 4U7SA 1ZSDB 3HNTH 2G75A 3LQZB 3MZTA 3CSPA 4KKBD 4M6OH 1T03L 1OEZW 3HE7C 3QDMD 1GTNA 1AO7D 1CE1L 4Y5YB 2QSCL 1SJMA 2PYEA 2D4FA 2A7BA 3C5SB 1YQ2A 3ZE2B 1GPOH 3NK4A 1HCFX 1R3KB 2NZ9C 1L9PA 3K2UL 2VLJA 4G72B 5C0AB 1FVCB 5F71A 4DZBB 5C0IA 3VNZA 3LH8A 1IGCL 2AEOA 4HX1A 5HHVL 3AABA 3G6DL 3B7YA 3FTUA 3QWRD 2ZPKH 4O51B 1ZV5A 5F7FA 4OVVA 3ESPA 3BGFB 4CVXB 4UQ3A 4JHAL 5CMAB 2CPUA 4WW2A 4MTMA 3DSFL 3GC3A 3KNBA 4KY2A 2JKXA 2QVMA 1GL4B 2JI3A 2V0AA 4KQ3L 2Y69B 2EYRB 2KI6A 2CXGA 4L4TA 4LE8A 3VG0L 4ELMF 5ECGA 4Z5RB 3RNKA 2DMCA 4B9IA 1LXMA 4UTBH 2IF7A 3EOAB 1KJ2H 3IFPB 1M6UA 3UAJD 4JPKH 4ODBD 3VGHA 1KN2L 1LEIA 1MHHA 4G8IB 4Z76B 3K4ZA 3GD1C 4O9HH 4EOWL 5KSBB 3WU1A 4JK0D 4IBZA 5LGJA 2HT2D 3ZHFA 1A4CA 3AWGA 1IAIH 1QI3A 3EW3B 2GJ6E 2FSEA 1CI3M 1BD2D 4PTTA 4Q2ZA 4KZCA 4DO4A 1V7NL 1QRND 5LDUA 1KGCE 4JJ5B 5I75C 2HJFB 1X4XA 1YMMA 1UZ8B 2WBXA 2BSSA 1W6LA 1FCCA 3IXAB 4K71C 5TDNB 5E2JA 3BESR 4AYSA 2WXKA 4X9GA 3BT2L 4WWOA 4Z7NB 5KVGE 4JDTL 4L3AA 5E5MB 4HGMA 5ISZA 4C57C 5E4EB 3UZQA 3UBXB 2PTTA 1A7NL 4WU5A 4RETB 3GPEA 3LRSB 3P54A 3JYBA 2D7NA 3CD4A 4FQIL 1KCRL 3KS0J 2E74C 2HRHA 2X12A 3LSOA 2X41A 5K39B 1KJ3H 3GSVB 1HE8A 2H3XC 5GGRY 3AXIA 2JXMB 3IJSA 4CMHB 3ZQXA 1EIBA 1QZ1A 4MKTA 1H5BA 3B1TA 4OD3H 5KYYA 5FUZL 2A9BA 2L7JA 2XN9A 1AGCA 4L37A 4JFZH 4RCAA 4ADJA 3ZYOA 4UINH 4HWZA 4MD0A 5DT1L 4L8DA 1BPVA 2NY7L 3GJFH 3OX8A 1E4XI 3Q8EA 4HZ1A 3CBJB 5EN3A 3X3GL 3WI9A 4IRZA 1TJGL 5CD5C 2HRPL 4LK4A 5H8DA 1H3VA 5DDHA 5ID1A 1BVOA 1DUYB 5C3IA 1HYSC 1TEFA 1FN4A 3SDXF 3N5AA 2Y3NA 3RI5F 1HHJB 1IGFH 1CXEA 2AJVL 1LO0H 2EDDA 4FE9A 4NN7B 5F6IB 4MLIA 1WWBX 3MJ8A 5DWUH 3WAJA 3FF8A 1UWYA 4GP8B 3PG2A 2ZOLB 4AV5A 2CLZB 3CHQA 3NIDF 3KDPB 5CZKA 2Y5TB 5F9WB 2EIBA 3AACA 3SCMC 1WA2X 4BSWA 1AC0A 4ZX4A 3AQXA 3W0WB 2BLFA 3CWGA 1R3LA 2F74A 4GSUA 4QLRA 1NEPA 5E4AA 5HGHA 2DJ4A 3FULA 2OJZH 1FSKB 1AR1D 4CVUA 2ENYA 4Q9RH 2PYFB 2PWDA 3IDYC 1A3ZA 3BPNB 5T1KB 1WIPA 2GK0B 4AYFB 2OX5A 2E7MA 1Z5YD 4P8QA 1GYWA 5CKGA 1NC2A 4V1DE 4DGYH 1ZDSA 4K9JA 1Q9OB 4KZDH 4HV8A 4D7PA 5LHDA 1SYSA 1G7QA 5FYJH 4QCIB 4M61B 1F3JA 4FQJL 1WHPA 1ROWA 1QTYT 4MD0B 2DKSA 2ZWSA 3DUSA 1BM3H 4O00A 2FSDA 4HK3N 2ZG3A 4TLUA 3B7TA 4HS8H 3QRFM 1HEZA 4PY8J 4NOFA 2P7TA 1OHQA 3QYCA 2EXWC 3MREA 3SBWA 2AQNA 2PCPA 4JB9H 4XN8A 1T7ZA 3T3MB 2FNWA 3V6FA 5BOZG 3MLTB 3K74B 2W0KA 4BHUI 1UM4L 4POUB 4BUGA 4CRPA 3HIZA 4OCXH 2ZYSA 4HJEA 4KVNL 3NFNA 3LB6D 3ZE1F 2R2CA 1NDMB 1K2DB 1PJWA 3PJSA 5DRXB 1CR9H 1C12B 1X5GA 1HXYB 4RZKA 2NNFA 4GW5B 4YR6B 1HAWA 5HGDB 1E2WA 3ZR6A 5E5MA 1P1ZA 1XH0A 5JHMA 5E08L 4WNQB 1FFQA 3GTNA 3KLAB 5D2LF 2QGBA 3IXAA 2AJXH 2GBVA 3OPUA 4POYA 3OQ3B 3RWDB 4Y4FA 4DN3L 1A6TA 3ARZA 2DMGA 4GAYA 5EFIB 5DLLA 1CXFA 2Z93A 2WUBL 2AXWA 5TE4L 2XQ0A 3QK0A 1KTBA 4FQLH 4JO3H 3IJ8A 1UJ3A 3VFPB 1U8CA 2VZVA 3NJXA 2EO1A 4TTDC 4K94H 1I3RA 3QUZC 4WSGA 5MP6H 2W0PA 3TC9A 2OZ4H 5JW5A 3FO9A 4XAWH 1I8IA 1LDPL 4TQHA 2ATPA 4EJ1C 3PWLA 4I5BA 1E2VA 1EDQA 2H8PB 4OF3A 3RILA 2WWMD 5HJBA 5LUMA 1T4WA 4WI6A 5BOJA 2QLVB 4K8RD 4FI8A 1TTGA 3ABGA 3D2TA 5TE6L 4MQSB 3S37H 1ZHBA 5LCVL 4UIKL 4WKXA 5I1CH 4GINA 2X4SA 5E00B 5J6HB 4EN3A 2FH8A 4QI3A 4BHUA 3EDKA 1E42A 4X5RA 3MUHL 4HX1B 1CICD 4YAQB 1ZWIA 1XL4A 5DRZA 3VQLA 2MOGA 4QUOA 1QRNB 1NCNA 4MJ6B 5EZJB 3ULSB 1YC8A 1IUZA 3TIEA 2CH8A 2IDFA 3REWB 3L7FB 1M9WA 4HS6A 3NJHA 4B95C 2WMPA 4NO2B 4PBWD 5DCCA 3QH3B 4MZIA 1IQWL 2PTVA 5IMLB 1GC1L 1YQVH 3DJTA 5I0DA 1O7VA 1EZVY 1E4JA 2VDQB 5D7JA 2YLHA 4M00A 4F15B 2AJYH 1I8KB 4TVPH 2F53D 5JQHC 1YN6B 1FFTB 1KJVB 4N0FA 5DO8A 4U7MA 5BRZA 1LO2H 1MVFA 4YHOH 4UM9A 2PW1A 4XI5C 3T6QC 4XP1L 1V05A 5EOCL 3BPLB 3S97C 3W3BA 3S3SA 2ICWJ 1J0KA 4PM1A 3IWVA 2W5PA 2WZ5A 4U1KA 5GISH 2ZXEB 4X8CA 1EAQA 5KVEL 3D39D 2WXGA 4QTHB 3TU6A 5J11C 1ILSA 4IK7A 2E9GA 5IBUG 2CJUH 5I28A 3PWPE 4OZFH 4LEOB 4LHJB 3X11B 5C0GB 2PR4L 1PLBA 3UEQA 1ZIBA 5FDWA 3C6LA 5JIHA 5M94B 4PRIB 5E51A 4L29A 4ZMQA 1K6QL 1GS7A 4YEFA 2BSEA 4X50A 3T1FA 5DQJA 5EC2A 5C0AD 2HFFA 2XWXA 1OP5K 3QULB 5HDQH 4KO7A 3GJFB 1TCRB 4QHNA 3KYKL 3HBGA 5AZUA 3TYFB 1XEUA 5EC1A 4MJ2A 3O6FA 2PXYA 1KIQB 4RGOH 3RFZA 3EBIA 1S7UA 1W0WB 3D69B 5BV7L 2AKRB 3UTSD 3AUVA 4HUVB 5EUKB 2GTQA 3BH8A 3K80A 4CGUB 2ZXAA 5DD3H 2K1MA 4JQVA 1T7WA 4UDTA 1SOXA 1U0QA 4NXSA 3ULVE 3ATEA 1KPRA 2IWFA 3L4YA 4P46A 4HXBL 4I89A 1ONQA 1ADWA 4H8HA 3VD4A 1RSFA 1KWKA 5IQMA 1ZLUH 1E40A 4X7SH 4QHLA 3QCTL 1BF2A 2K0RA 3S96A 1IBBA 2UY7B 4H1LA 4JS7A 4X6CF 4MMXA 2H0FA 1T5WB 3EJPA 3MRIB 2GPZA 5IW1B 3ULVD 4DUVA 3OJ2C 1S7SB 3PAVA 2DQUH 1F8TL 3HHSA 3QQDB 4OH2A 3ECBA 5AW9B 3MGOB 1ET5A 3QNYB 3WD5L 1QTPA 2AQPA 2GJ6B 4BFBD 5JW3H 5FOBA 5FM8A 2X3CA 2RFXA 3CVHA 1KWGA 1YEIH 2VC2H 2I60H 4OJDH 3SD2A 1CLVA 1D5XB 2VW6A 4H2CA 1JCVA 2CNYA 4UAHA 2TRYA 1JPFA 4YHZH 4TVUA 4D3CH 2JKLA 1QPPA 4WTQA 3OJDB 4A2GA 3QAQA 5E2WH 2EXYC 3PUCA 1BVLB 2J8UE 4O02H 1PZUB 2AP2A 2YD9A 4LOUC 1QNZH 3STZA 5EEUA 2VW7A 3BWAA 3L3IA 3ZT7A 1WBXB 1QG3A 1TTRA 3IFLL 4PJ9A 4JL2A 1UUNA 4KMLB 4ZRGA 4NCC1 2ZUXA 3WFHB 2C1OA 4KDTA 2BS9A 4YBLC 5AD0B 4MJ5A 2MCPH 3NRFA 4N0UE 5DYOA 4A2FA 5TDOB 5C3LD 5D7KE 1T1WB 3B7UX 3X3GH 1HQRA 2RH0A 4O2CB 3MI6A 4Z23A 1XT5A 1K8DA 5G5DA 4YDZA 3V8OA 2B1OA 2E7CA 4YXKH 4JFZL 1U3ZA 2VRKA 4B9ZA 5GZOA 3A6OA 4UNVA 2WLHA 3B8YA 1EO7A 3CFCL 4LLQA 1FDLL 2AAVA 2A38A 4TN9A 1FZOA 1LMIA 1F6FB 3R7RA 1A1OA 3T4AC 1UCTA 2ZOKA 3HTLX 2WC7A 1WS8A 4PRBA 4TS6A 3PWPA 4FZ8L 1HSBB 3ZHKA 5LKNA 4XP4H 1OLZA 1HH9B 4YL4A 3GZPA 3QFJA 3U2SA 3SDDD 3C5JA 4WEUD 1HFUA 1VF5C 4PVBA 1R5WB 1ZLVH 5DD6B 1F97A 1CXIA 1UM5H 1AQMA 3EF4A 3X12B 2ZUUA 4QY8A 1OP3K 1Z5LB 1ZGLB 4JDTH 3BAWA 2E6PA 4BE5A 1ES0B 2BOCB 3LH9A 2KLRA 2WBJC 4G70B 4YFLI 1S78C 3N43B 5CP7A 2GTWA 2BNQE 4JFWA 4OCYL 3IAQA 3ZE0E 2ZWNA 4HEPG 5F7DB 1C1EL 1ZHKB 4IHOB 1AP2B 1WT5A 2FT7A 4QR7A 4WI0A 1XGZA 1A4JA 3UJTH 1NGZB 4W6XB 1UURA 1RZ8A 1JWUA 4QHMB 4EEEA 4LVOC 1RZGB 3IN2A 3DX4A 1FFPA 3PAUA 4G7RB 5IOPB 1GYCA 4NBZB 5FYKL 2XZZA 1FYTB 4OKVB 3SHSA 4JO1L 4KKLC 3DX7B 3FFCE 3NSJA 2ED6A 3M45A 5KAQF 3DHMA 4JREB 1EHLH 1MW3A 2J1WA 2F7OA 4MX7A 2PWGA 3Q6FB 4NQSB 4IGBA 1QUNA 1FFRA 1W72H 4P4KC 2YS4A 1UD3A 2JQZA 1EFXD 4WUUD 1F58L 1OSZA 3VFMA 1IQDB 3QZWA 5C7XL 1VLXA 4JFDA 4I18C 2EVHA 2F7RA 5HHVH 3IDNA 3FRPA 4CVWA 3ARBD 1T6VN 1DQDH 1MW1A 4A7QA 2QPFA 4AYMC 4YVUA 1BVKB 5I0VA 4QXTA 2BXYA 3Q6FA 5CD3B 4PCTA 4QT5B 5D6CB 5EF2A 1DQVA 3QWNA 2YD5A 3CZFB 2D31A 1OM3H 3VRLE 3SOBL 1YN7A 3PABB 4TUJA 5KZCD 4F2MA 2P46B 2PN5A 4G3YH 1A9BA 4MXQD 1NKRA 5K9OA 3MNZB 1MIEL 1TQCB 1FYTA 4RDQF 4MLSA 5IOPA 1UZ6F 3D08A 1JZJA 1A47A 5HI3D 2XZAH 4FQLL 4JO3L 1U30A 4XE5B 3WE1A 1MHEB 1NJ9A 3HS9A 3FUKA 3FCUB 5AEAA 3FTWA 1H6UA 3MR9A 3KL0A 4I48B 2EEAA 2XC8A 2R2EA 3C2SA 3I6GB 1G7IA 4YHPA 5ESVB 1F3DJ 3LRHA 4I13B 1F3RB 1MCOL 3OG6B 3S3JA 5EZLB 1FAKT 3FW6A 2X6VA 3E3QE 3JXAA 4J3VA 5LG1A 1K8IB 1DQQB 2DZEA 1J05B 3LQAL 1OZUA 2J71A 5DHXB 3WJJA 1JHKH 4L1HA 2VIRA 3PWVB 4NLAA 3U2SB 3EXLA 1HH9A 4OLVH 3M07A 1YVLA 3DRQA 1JPGB 4MBOA 5D1QB 5HDOA 4B5ZA 4P9HL 1OALA 2H0EA 3DXAB 4I1RA 4TUUA 4WV1C 4ZNEE 2DBJA 4GOSA 1J1PH 4TUJB 2GEEA 2Y36H 3QXAA 3S3BB 2X0VA 5D6CA 3UO1H 3BZFB 2WWOA 4JCWA 1B6DA 4PJ7B 4BRJA 3LD8C 3MA9L 5K9QG 4LNRA 2YR3A 3H2WA 4DK6A 1BM3L 2C3VA 4NQTA 1H19A 2QMJA 1XCQB 2FHCA 3SYCA 1NCWH 5FYJL 4YPGA 4AGMA 5D96C 2K70A 2EIKB 2HTKD 1MIEH 4D2NA 3MACL 3D4GA 3QQ9D 2SODB 4W70A 5EZPA 1BIIB 1CDJA 1A1MA 5L2KD 4J6IA 1YECH 5IROC 3UXFA 5IHHA 4M5TA 4I4WA 3NCEB 4YWGH 5KTEH 2NX5A 2XACC 5B3SB 3SKNA 2GBAA 3CH1A 3VAEA 4MCNA 5T1KD 1NCTA 4K73A 1LD9B 3CZNA 3NIDB 4XMLL 3TWYA 3MRHB 1GTFA 3LNDA 4YZFF 3B2UC 2AW2A 4BDVB 2HA1A 2WXLA 3O41A 4Z8FL 1NUFA 3QHTC 5JIIA 1L9TA 3KW8A 5CGMA 1IM9B 3ARDA 2DJMA 2CG9X 2IIJA 4MB4A 5FOBB 3ZDXB 4YIQA 1YMMD 5EEWA 1FGVL 4GP5B 4FG6C 5D1XE 4TKWA 2QMKA 4OGXL 4D7BA 2J55A 4NZUH 4DP6X 4XZ4A 1GW0A 2FDBP 3RHWK 3HR6A 1SVCP 3U46B 1RK0A 2WNWA 2VXQL 4X5WA 3MRIA 4PW3A 4NQVA 4NZTH 3V4PL 3QEHA 4OGAD 2CUIA 3BJLA 4XXCA 3NZUA 4GUPA 1QBLH 3FQ4A 2EE3A 2FX7L 1R5WA 3LVTA 1TSRA 5IHUH 4TNVK 1P5UC 2R0WL 4Y4FC 2JKRM 4POZC 4WFGD 1KPRB 2ZOKB 5E5UB 1SRDA 4LSSL 3AB0C 1Q0EA 5GGRA 3V7MA 3VXPA 1FZOB 3S5ZA 2YK1H 2Y5QA 3Q1EA 1CI5A 1T1YA 4R2GC 2XVLA 4OFVA 1BEYL 1GHFH 1NBCA 4K5MA 3BZEB 3QUZA 2IWGA 1URIA 1XH3B 2OMUB 3GMMB 5E5LA 4PWFA 5KYXB 3OAUL 1LILA 1NEUA 4CU6A 5I8CB 4YGAB 2FO4A 4XP4L 4YSSA 2XY2A 1OP4A 2EIDA 1BVNP 4PR5A 5TK4A 1WRFA 4YFDB 4DCQB 4MJ5B 3T3PB 1L9MA 1G5AA 1PZ3A 3V6BR 3GRWH 1BJ1H 5FYKU 1DLFL 2V5YA 4E42B 3WHE0 1BMWA 6PCYA 1KLUA 3CFCH 4FNSA 4RGNE 4U1HA 4WJKB 5E8PA 4EN3C 5JPMA 3EGXB 4JZNA 4N2MA 3OJDA 4M93C 1JPFB 4EZJA 2PW2B 2NNAB 4KXAA 1ED3B 3MV9E 5CP3A 3RFRA 2I07A 1DVUA 4PG9A 1A7OL 3VD0A 1XCTB 2BNQB 4MMYB 5D96B 2VC2B 3ZE0B 2YRLA 5AG9A 1T4KA 1E28A 1R0AH 1A6WL 4OF6A 4D9QD 1JF5A 3O9WA 5GGVL 4GKOA 4Q52A 3CFBA 1TVBA 5C0NC 4GW1A 5KW9H 1NQBA 3OKNA 1R3IL 1JF1B 2JCWA 2WOYA 4HKJA 5IW6A 3BW9B 5C6PB 3IU3B 2XRAH 5GJTL 2VQUA 3PIQB 2C9SA 3ZHDA 4BXVA 2IH1A 5GS0L 3D87B 3EDEA 3FT1A 2R56H 3PE9A 4FMKA 4ZPTA 3S6CA 1EV2E 4JGUA 3PDOA 4QHKJ 3T77A 4DEUA 1XZ0A 3V9CA 4NCC2 3O3BA 3RI5K 2P8LA 5DRZB 1P4LA 1E65A 1CO1A 3FU0A 2X9ZA 4N2FA 4QHUA 4YIQB 1ZWIB 1A9VA 4YAQA 3KPOA 5EO9A 1YEDB 4PRIE 1BZ9B 2PETA 5DRNB 3CSBA 1PMYA 1WAAE 4AX3A 5HYIA 4GSQA 2J44A 1AMXA 4UDTB 3G5ZB 4E36A 4JQIH 3FOLA 2ESVD 1FHGA 1WCBB 5BV7C 4P3WA 4IRSB 3F8UB 1GIGH 2CK0H 5DFVD 5T3ZD 4H13C 1WVZA 2XTJB 3UO1L 4N3UA 4NFCA 5AW4B 4Y1TA 4YK4C 3Q2LA 1ZT4A 5E9DD 5HHOB 5E6SB 2ODHA 3TNNB 2YAOA 3VXOB 4LSDA 2MPVA 4L1DA 2B20A 5DJ2A 1H9VA 1SHWA 3FSZA 1UASA 2JB6B 1OP9A 3VWJD 2R0KL 1TZGL 3U1SL 2VSKB 5AW3B 3KPMB 4HQQL 1RFDH 5MENA 1BZDA 1FG2A 4DO6A 4CU8A 1A2YA 3M1BB 2GQHA 3CUPA 4W9ZA 2BINA 1DBMH 3N41B 4HJSA 4KXZH 5DFAA 4BKLB 4GYBA 4EDWL 3O0RL 4P06A 5BZXA 3KVQA 2J5LC 4BZ1H 1S9VA 3POHA 1TQUA 3ARUA 3BC9A 5SWZE 5T1JA 43CAA 2B2XH 3QR0A 3S98A 3U7WH 2F19L 3K5SA 4GKNA 1PSKH 3RY6A 2YD8A 1K6QH 1EVTC 3AGWA 1A6AB 2VDNH 3T0EE 1NGYA 3UG4A 1MWAH 2UY6A 1MREH 4OAWA 4QMEA 3LY6A 1OGAE 1U91B 1TG8A 1VFBA 4LXFA 3CVIL 5HPMA 1U4EA 2VITB 3TEWA 3NFNB 3ZQ9A 1F5WA 3LPPA 1T22A 5DUBA 2MKLC 4H44C 2KT6A 5E2VH 5EO1A 5BMFH 1HWGB 1T0NA 4N2EA 4TSBH 3RVUD 3DX1A 1EDHA 3ZE1E 3MV8A 5GPRA 5JHDA 3ULSA 3QIBD 4PJ8A 3BP7B 1SUJA 3LXBA 1DEEA 1JTOA 1S9XB 4QRSB 5EU4A 1HEZB 1NCCH 3IDGA 2KERA 3DUSB 4TNVF 4P5MA 2Y2YA 1CFSB 1YQVL 4R8WL 2X4SB 5E00A 4MNGB 2DQTH 4Z8FH 2Y7NA 4KGLA 4FNTA 1D7CA 4OZIE 1NC2D 3MTRA 1D5ZA 4WFHD 4FFVD 1UA7A 5FYKD 4PJIF 4QT5A 5EBWA 4Y4KD 3MGTA 4OUOA 2H1XA 2XKNB 4RAVB 4AMWA 1BFSA 3LZLA 1F11A 3FRPB 1KJ2A 2VLRE 4ONOA 1QR4A 1T1XB 3D30A 3IETA 5DQ9A 2FQFA 1PPIA 3QO1A 4L8SC 4LVHB 2ZAGA 3MJ6A 2E6JA 4W81A 1BOGA 3D4CA 5I1CL 3X1NA 1WFOA 1DBAL 4MVBC 1HHJA 5TFSL 5T8IA 3N0AA 5LNDA 1INQB 1EO5A 3CPLA 2X9XA 1A6TB 4EKXA 4UQCA 1I1FB 4ZMVA 3GBNL 4HWEL 3SDAD 4PI2A 3H3BC 2K8MA 1OM9A 1I8LA 2G60L 4QD2E 4RMUA 4WWKB 4OKVA 2J2ZA 4NENB 5MP6L 3FK3A 3C9NB 3I2CL 2JVUA 4EIUA 1VCAA 3DLQR 1J5CA 1JNNH 5IR1A 5KYYB 1ICTA 1A22B 3E7JA 1S7TB 3GSOB 3CFKB 1UVQB 4HP5A 5I1LA 1JWMB 4M03A 3TBBA 1C5CL 3TZVA 3FCBA 3LZPA 3AC0A 4NNYA 3WFCL 3RE0A 1QBML 3KH4A 2Z8WC 1YEEL 1FNLA 4UMGA 4ZS6C 4AEFA 4XH2A 2NW3A 1E30A 4CSTA 4POZD 3MLWL 3MREB 1QBMH 3EO0A 3W0WE 2NSXA 5GS0D 1BAWA 1C5CH 2FGWL 2ITCA 3CZJA 3HUJA 3TT1L 1HAUA 3UZQB 3WJMA 1MXDA 4BWUA 2DQDH 5JDSA 2XIIA 1HCYA 5C0CE 1CMOA 1LO3L 4AKPA 5I2IA 2ZONA 1YLBB 1F3JB 3EXJA 1AYRA 1I9RL 1J5HA 4K5OA 2V5RA 3PWPB 4OLUL 3KPMA 3BRFA 5DD1H 1YMMB 5JOEA 3TBWB 4L5FH 3FTXA 4C56E 2GK0A 4AYFA 2BERA 4X8GA 4BQCA 1E4XH 3P9LB 2W60A 4H26B 4RDBA 2FSEB 4YC2C 2OMNA 3MO1A 4HU8A 5TE7H 5H4YA 1VZIA 4JLRB 3U7YL 4KNQA 1DQDL 4PIRF 4QXGL 3DJ9A 1DBAH 2FBOJ 2JKTM 3APNA 5IOKA 4B3VA 4HULB 2ZNWA 1GGCH 4UT9A 3WIHA 1FVDA 1NGWA 5DYOB 4DGYL 4I3SH 1HKLL 4M1GH 3SGKA 5IG7A 2FJSA 4KHTL 3VUAA 4LZKA 5BQDA 4N0YH 4JFED 3G6JE 1JP5A 1VSCA 4EUPH 4QRSA 5EU4B 2CR6A 1F8TH 3GSQB 2CZNA 3QQ4A 4JRYE 1Y7VA 2NLJB 3GLEA 4PP1C 4ELMB 2IH1B 4G6MH 3UBFA 5H35A 2DLIA 1FI8C 3QQ3A 2BY0A 3QCTH 5EU3B 5C0IB 5ECJE 2X2IA 3RUGA 3WTWA 2CR3A 4HCRA 2CHDA 2CKBL 3NFPB 4DPRA 1I1YB 2Q7AA 3E2HC 1XGTA 1NEZG 1S7SA 1DDHA 3IRCA 4FLSA 4ONHA 5D9SB 5EUOE 2HX9A 4Z95H 1ILUA 1YUKB 1Q0XH 3LRSA 4BBWA 5BMFL 3L13A 5I6MA 4WU5B 1P9MA 1X3DA 3OAZH 3QDAA 3ZMEA 2F53E 3RJQB 4M43L 1NINA 4DK5A 2QELA 4LPYA 1A3RH 2VLLB 2JTDA 4U7KA 5E8PB 1GOFA 8PAZA 4L8BB 5J6SA 4F33B 5EO0A 5LDSA 4GUQA 3QUXD 3U2IA 2ICEA 3GMQB 4MS8C 2JKSA 4ACPA 2A6DB 5AYTA 1H3PL 2NY2D 4PV8B 3WJLA 5TTRA 4HK0B 4TMPA 1SN0A 1FDLH 3DPDA 3LKSA 2OMTB 4UBDD 4B0MM 3W11D 3O0RH 4R9HA 3CDYA 2O5YH 5GGQH 2ZXGA 5EC1B 5JNYB 4FADA 1LEIB 1JGDB 4KJWC 5TF1L 2HT3D 4QIRA 4PV8A 3EOAA 1E90A 1JVLA 3BAXA 4KO9A 4PJCB 5CUSH 2NY0D 1SGKA 4PGCA 5F1IA 5HDBE 3UROR 2YEZA 5ICUA 4HJ0C 5EO9B 3KPOB 4PU2A 2C7FA 2FEEI 4OW6A 3H2QA 1JZEA 5IFJA 1CFNB 1XZ0B 4E2OA 3N1GC 5I9QC 3ERXA 4WW2B 1K3ZA 4O02L 4QO1A 2I26N 3RVWD 1URLA 1OB1B 4GBXC 2B7DT 3L4CA 2WBKA 4RQQA 2VZOA 5T5NF 3MJ9H 5I17A 4R6UA 5D2LB 4U1KB 1JHLH 4AYID 1VIWA 1W80A 3CU1A 1HXKA 4J3UA 5IW6B 3HZKA 5AVTB 1BWWA 3DRTA 3TBSB 1VGEL 4P2OD 4XTRC 1KGYE 3VFUA 1VFUA 2G2RA 2DYPA 2IBZX 2QSVA 2HKFL 5DMIL 5C70A 2CBQA 1T4KB 3IWUA 2P80D 3CX2A 5I1HL 2NY5H 1N0LA 4I3SL 4LMQE 2WXIA 2HKAA 2WWNA 5I9QB 4WGKA 3C08H 2VR7A 4FXGB 4RGNB 3MRLA 5F8RC 3ULVL 5I1DB 2BSRB 1RH8A 1WTLA 4CC4C 1P5UA 2XRAL 3CU7A 5LCVH 4C55A 5D1ZA 4CSSA 5I5RA 1HU8A 1LD9A 4CSZA 3S37L 3I3DA 3B34A 3CH1B 3IMVA 3QQ4B 1RU9H 2H26A 2FEDD 1CBJA 1NIDA 1GPOL 3SDCC 1M1XB 1X5KA 1QW9A 4DEWA 2WWKT 3MRBA 4HDIB 1X9QA 2J4WH 4NM8H 1I1CA 4DP8X 2B3IA 3HNTL 4LAJH 5FDYA 5E7FA 1QTSA 3PGFH 1MFAH 2APTA 1GAFL 2A73B 1DN0A 2EP6A 4IMLA 2YSSA 4U4BA 3U36B 1ZHBB 1LGVA 1G7HB 4HIXL 1NSNH 5BV7H 2ARWA 2AXGB 1UT9A 4X7FC 3SDDC 4PSPA 2Y7MA 3BQUD 3A6CL 4IS6B 2VISA 1JE6A 4XPAL 3NH7H 4IW4C 4XNMA 2F53B 1S5IL 4G8GD 3V6OE 1DLFH 1YEEH 2WYHA 3PHOB 5GGRB 3UDWC 3VXPB 1ZV9A 4AEEA 1RV6X 4U0RB 2Z1PA 3K72B 2CUAA 3L3OA 3QDGA 1I3RB 4HMDA 3UX9B 2AVFA 2QADD 3RWFA 4KK5D 3US0A 1H8LA 4ZFGL 3CC5B 5C0AE 1E5ZA 1UOWA 3GDCA 3QEGL 3HUJB 3ZE2E 3WJMB 2ITCB 2X4QA 2NY4C 5HJ3B 2VLKD 1I85C 3PREA 1UQSB 1RK0B 2B39A 4ZTOL 1XF4A 4FTVD 1MFDH 3BVVA 4HWEH 3NCYS 4M6ML 4GXFA 5A2IH 4NNPL 4GKZB 2BC4A 1KTLB 1SMAA 1D9KC 2VAAA 4NYLB 3LTVA 4TL5A 4DQOH 1HWHB 1PDKB 5IFAH 1U3HC 5TFSH 3D9AL 2OTWA 3IU4H 1SVBA 3JWDC 2X87A 3QPXH 3HLAA 4FQJH 2VXVH 4TVPL 3VD5A 2X7LA 3L9RB 4WW2C 4YSTA 3S0PA 5FYLE 4OFDA 5JXED 2HLEB 3O41B 4W4NA 1QQDB 3BP4B 1BXAA 3D12B 4UV7H 3MRHA 2BZDA 1M05B 1PY9A 4F2MB 2EDMA 1I1FA 3F84A 4Y4FD 2D31B 2OL3H 1MCCA 3TVMA 4YGVA 4KY1H 2C5DC 3CVHH 2XJLA 4AJVA 3DKHA 5TQ0H 2Q7YA 3MLRL 1QKZH 3QXDB 1S7XA 4K4KA 1YY9C 2IAND 4K7PL 2A9AA 5DMKA 3HI5L 4U05A 1B90A 3PDGA 3LJ3A 2IH3A 2VNCA 1JD7A 3HHRB 3MRMA 3ZZQA 4NQQA 5B8CA 4KU1A 3VTMA 5I23A 3BMVA 4LL1A 3TESA 1SN2A 2DY2A 5AVYB 3CN0A 5L88H 4KI5E 1KYOK 1AR2A 4U3SA 7FABL 4K71B 3OKOA 2VB5A 4FQXC 3RGVC 1EMTH 2FK9A 2YPVL 1JPGA 4LU5H 3ZO9A 4JHWL 2OZ4L 2X2UA 4UIMA 1CPUA 4HJJH 3T0DA 1IKFH 2NXZD 1QYGL 5E1IA 1C16B 2HLFC 2AQTA 1S9XA 1KJ3L 1OAZL 4ZT1A 2X53A 4PJ8B 1AP2A 2HX8A 4WI0B 5JHDB 2H7WA 1ZHKA 5SV4A 1GZQB 3HVDA 4S1RH 4CADA 4OCLC 2RCSH 3I6GA 4NOBA 4M8QA 5FF6B 1AE6H 4FJYA 2ZOTA 5MI0C 3HS0B 4OIIL 3WUWA 4Q89A 2XN9B 5AZEL 2PWFA 2EDNA 3OAYH 2B3RA 1FORH 3HHMA 3L5WA 3FUNA 4NX0A 3DYMA 5JPNC 3E6FA 1I53A 5E03A 4PH8A 4ZNEA 1WJ3A 4CC1A 4PJIA 2EJ1A 4N8VB 3CSGA 4YE4H 4NDMA 2H5UA 1MDAA 3FSOA 4BJLA 2Z34A 3LSOB 4PRBB 3OVUB 3BGFC 1MCOH 4ZFZB 1BAFL 3ROOB 4ZSOB 1KYDA 4X4ME 43CAB 2GUYA 5JUEH 2H4EA 3RY4A 4PJAB 1S9VB 3FAWA 3US9A 1NMCB 5MHSD 3SYOA 4NKIH 4BCZA 5INDA 4AMKL 1W8NA 3VYPA 2PABA 2KL6A 5DU7A 1KB9K 4PVNA 1IGTB 2XI9A 1HTYA 4LSVL 3S8WA 4YDVA 1NBVH 1WG3A 2A6KB 3DX8B 3HE7B 2BSSB 3QUXB 5JMOC 2NY5C 4PJBA 4OFYA 3VU2A 2AABL 3RIKA 2G2NA 5D8JH 5C09B 2H2PD 3QNZB 4HT1H 3BFWA 5I1EH 3SOBH 4NS0A 2E4TA 4J1UA 1W72A 1FE8L 1FYTE 2HVKB 3W39B 4BM7A 4D9RE 2BDNL 5HI3C 1VA9A 4FLRA 5FA3A 1BVLA 3RBSA 1I9JH 2R1XB 3T4YB