4V11A

Structure of synaptotagmin-1 with sv2a peptide phosphorylated at thr84
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
150
structure length
150
Chain Sequence
KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SYNAPTOTAGMIN-1
publication title Phosphorylation of Synaptic Vesicle Protein 2A at Thr84 by Casein Kinase 1 Family Kinases Controls the Specific Retrieval of Synaptotagmin-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 42
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4v11A00
3PREA 2UZPA 4GB9A 3APCA 1A25A 3KWTA 5G55A 4LDCA 1CJYA 2R83A 4TUUA 4AJWA 1DJXA 3F01A 4FULA 4AOFA 2RD0A 2NQ3A 1DJYA 1DJGA 2Q0ZX 3TWYA 3QJZA 4JPSA 1DJIA 3QAQA 5CCJA 4BGDA 2Y3AA 3APFA 4IQHA 3ZW3A 4FADA 2ENJA 4QJ4B 4QAMB 2WXJA 3L08A 3F04A 4XZ4A 4PS8A 5G2NA 4F93B 1TJXA 2ENQA 4ICXA 5JHAA 2NSQA 4DNLA 4EZJA 2K8MA 4Y1SA 4F92B 1E7VA 4L1BA 1BYNA 1RH8A 2WXKA 4F91B 4QJ3B 3HIZA 1DJHA 2WXQA 2JQZA 2YRBA 3QK0A 4ANUA 3B7YA 3KWUA 2B3RA 4ANVA 1DJZA 4NP9A 3W57A 3L4CA 2CHZA 2CHXA 3QR1A 4KZCA 4PS3A 5T8IA 3ZIMA 2WXOA 3LJ3A 3M7FB 4DK5A 4KITB 4GNKB 3L13A 3FBKA 3L17A 1UOVA 4WEEA 4A55A 1E8ZA 3PS6A 4G11A 3RDJA 1BCIA 5KJ7E 1DQVA 3L54A 3PYCA 1WFJA 4V11A 3L16A 2K45A 3GPEA 4ANXA 2EP6A 4L23A 1QATA 2WXFA 1E7UA 2WXNA 2CM5A 3F05A 1DJWA 1E8XA 1BDYA 1QASA 2CM6A 1DSYA 4MJJA 3R7QA 5CCGE 5JHBA 4FHJA 4Y1TA 3F00A 4WWPA 2CJTA 1W15A 4TS6A 3CSFA 1GMIA 4ICWA 3T8MA 2WXHA 4BFRA 3NSJA 4ANWA 4TV3A 4J6IA 3ML9A 5H4YA 4XX5A 1TJMA 3S2AA 2CHWA 2BWQA 2K3HA 2V4LA 3N5AA 4XE0A 2A5UA 2WXPA 3PFQA 5H4ZA 4LT7A 1UGKA 3PRZA 4HVBA 3HN8A 4PS7A 1K5WA 3APDA 3DBSA 4WWNA 3FDWA 5EDSA 3ENEA 2YOAA 1RLWA 2X38A 2Z0UA 4OVVA 4QJ5B 4FLHA 3MJWA 5CCHE 3TJPA 3NZSA 4EZLA 2WXLA 4KZ0A 1HE8A 3OHMB 4NS0A 3W56A 3ZVVA 4EZKA 4L2YA 2WXMA 2WXIA 3NZUA 2NCEA 3DPDA 4NPKA 1V27A 2K4AA 2ZKMX 3QARA 4OVUA 1RSYA 2Q3XA 1E8YA 2LHAA 4FA6A 2KI6A 3OAWA 1E90A 4FHKA 4LCVA 2DMGA 3HHMA 3JZYA 2WXGA 3P2BA 4HLEA 2N1TE 3L9BA 4FJYA 4WAFA 2A4ZA 2QZ5A 2WXRA 2FK9A 4L1LA 4WWOA 2CJSA 2FJUB 1UOWA 2ENPA 2CHDA 4F1SA 4URKA 2QZQA 3CSTA 3ML8A 1YRKA 1WFMA 2D8KA 3IM1A 4NPJA 3QR0A 3SD5A 4FJZA 3TL5A 3RPBA 1E8WA 3IBEA 3R7RA 2ISDA 1W16A 4IHBA 2DMHA
chains in the Genus database with same CATH superfamily
2VDPL 5E4EB 5MHSE 4PB0H 1PZCA 3HPLB 4KHXH 3WKML 4HJJL 2BXZA 5I6LA 3GEWB 2PYEA 3GK8H 4GMSL 2VERA 3KBFA 3K6DA 4APQC 1NEUA 4H1LH 1UB6A 4PJ8A 4WKZB 2XQYK 3CVBA 3IS1X 4HUUA 4JFVA 1XEUA 1TUPA 5F7DA 3QDGA 1A02N 4PWIA 3KWWA 4PJAB 4G8IB 4QXGH 2DQHL 3F2LA 3FO1A 2R1XA 1LYQA 1YUKB 2EXYD 1UYWL 2YC1A 1O9ZA 1XO8A 3WDIA 4AQAB 3EXJA 5L2JB 2F53A 1Z9MA 1IVTA 4Z23A 1J1PL 3QUHA 1CQYA 3ALWA 1O0VA 4U1HA 1M7UA 5DFTA 4B50A 4XB7A 4PD4K 3GPEA 4BFIB 2IEPA 3QEHA 3AY2A 5GGUB 3ZDXB 3CN0A 3DGGA 2WBJD 1KJ2A 4OGQC 3D0LB 5LLIC 4Z95L 3RWIB 1WCBA 5CXPA 4G42B 5DVNA 1X5HA 1YJDL 3WUZA 1TTUA 1QEWA 3OC5A 3ZDWA 1F3JB 1QWUA 5C0IA 2HRHA 1UT9A 5I2IB 3FB5B 4KAQH 1CGSH 1QPXA 4GKZB 3S96B 4B5ZA 3WIAA 3J27A 2VLJE 4CW1B 5LDUA 4AW4A 1JGVH 2FSDA 4HKBB 3LDBB 1GGUA 3TEZA 3T0BA 3HG1B 3BUTA 1MH5A 4TF4A 5SX5K 4A6YA 3U4BL 4X7CC 2XWTB 2I7OA 3EH5B 5IF0A 3UZEA 2JJSC 3VFPA 4JDEB 1KYOK 3QIUB 4LHUB 2WIMA 4OCWH 4PW4A 2CHNA 4BEIA 1NUFA 5ID1B 4WF7A 4WI0B 2HH0H 5IB3A 2BRRH 3DVIA 3ZE0E 2OSXA 2OJEA 1EAPA 2NY1D 1QA9B 4LF3A 3FOLB 2O5NA 4LLWA 5IEHA 5PAZA 1SQ2N 2CJSA 1MFCL 1T03L 1BZQK 4QRRA 3SPVA 1WLHA 3AW5A 4E9QA 1EJFA 2C1OB 1IBZA 1X5GA 2IAMD 3D12B 3ECBA 3QS2A 4GIOA 1L0YA 1WBYB 2P5ED 5EOQL 1SJMA 2ESVE 1PG7H 1DDHA 1Q94B 3NQIA 4IDLA 3T4YA 1D5MA 1JHKL 4I18A 2PNDA 3GSXA 2BNRB 4FULA 2BSCA 4KXAA 3CDGB 2EXYC 1I7UB 1NMCB 4ZMNA 1SRDA 4KKCC 4LL9A 5KUKA 3QJZA 4XN1A 4L05A 1NEZB 2D0HA 1P1ZB 4MXVF 1HJCA 2AQRA 1MFNA 1AGFA 4LSUH 1MAML 1IVLA 3DXAD 3Q01A 1YEJL 3P77B 2P26A 5GGTH 3NJVA 3VXMD 1XGTB 4ICXA 1FSKC 4HOXA 4EZJA 4OM1L 3T2NH 2WBJC 3LN5B 4ALAH 1P69B 2Q2EB 1AR1C 2J20A 1GGCH 5C8JA 2ICEC 1Z5LB 4PRID 3W2DH 1YNKL 3O4OB 1BQLL 4EUPB 7FABH 2JKJA 5E2JA 4WJG3 1BZ7B 4P2QB 1CGWA 1TENA 3BPOB 3LKQB 1VPOL 3CQPA 4IOIB 2PW1B 1X3DA 3PAUA 3N43F 2Y06H 3X1NA 3H85A 3N6YA 5IVOA 3UG5A 4B9PA 5HGBA 3QUML 3FT1A 1CMOA 2VXQA 3OKEA 4O02H 2KZ1B 1EEUA 5IOKA 4W9GC 4B9IA 3R8QA 1IAKB 4GEJA 3TVMB 4DP8X 1AQKL 4NOBA 1SOKA 2ROYA 3SDYH 3L3HB 3BHBA 3EGDB 4BDVA 1IGYA 1VACA 3VGAC 3NCBB 3VXSD 4ODVL 3I02A 1DQIA 3PXLA 2B5IB 2E7DA 1IX2A 1JRHH 5IHWA 5LAXB 3RKPA 4JLRA 4P5TD 1A4JA 2H6UA 1AZNA 2EDDA 4DWHA 4QXUH 4RBPH 1PZ5A 2NY1C 5CN3A 2BP8A 4J8QA 3BQUA 4JFED 1W0WB 1I8UA 2P7TB 3BH8B 3CD4A 5E1GA 4BSVA 1X4YA 4EN3A 3B6SB 4LNRB 4F57L 5F3HB 4Z7UE 2IAMC 2FGWH 1RJYA 3ES6B 3W0WA 1S7UB 3S48A 5F6IB 1IBDA 1RZKH 2YEZB 3MV9D 1EZVY 1QYGH 1ZHLB 4UAOB 3SE3A 5CFAA 2F5BL 3S37X 3K4AA 2FNWA 4K5MA 3ETBF 2EIZB 5FECB 3ZQ9A 2WNKA 4QLWA 4AYGA 2A4ZA 2FK9A 3F8UB 4JFYA 2OV0A 4GG8B 2MSPA 5DC4B 5E2TL 4ZNCD 5IJVB 4ZOCA 2V2XB 2GK2A 1BMWA 4NRYB 2W81C 2ZX7A 4X8JB 2BIOA 4M43H 2ID5A 2YRLA 4LEXL 4JVUA 4X4ZA 5FB8A 2W9EL 5I8KH 3IU4L 3B7SA 5F9JA 2WSDA 3APCA 1P2CA 2EDRA 2AVFA 1LQBC 5GSVB 5B3JF 2C1PB 1XT5A 3AS3A 3LXCA 2XZCH 1LEKA 2DWDB 2Z31B 3ECVA 3FKUS 2WMPB 3TT1H 1OAQH 1YLBB 1MCDA 1W6LA 4TPRH 1I7RB 1XGPA 3U25A 2XYBA 2HVKA 3WEOA 4MAYB 5IGXL 1BBJA 2XHNA 1HL5A 1E5ZA 4QGTA 1N0LA 4MWFA 4XCCH 3S3PA 2WBWB 1OCWH 1YY8A 5LBVA 4WSJA 1CCZA 3RWCB 1P7KA 4O2CA 3TCLB 3VDBA 1B4TA 1OCRB 4NGHL 5F89B 3IFPB 4A6YL 1PJ9A 2CRZA 5EC1B 3EBAA 3F5WA 4M7JH 3W81A 4P5TC 5E5RB 5E8EA 3SDXF 4FZ8H 3WD5H 2FIRT 3KPRB 1YCSA 2J88L 1VKXB 1W91A 3D05A 1NDMB 1F4AA 2X3BA 3CU7A 3MLYH 1F6LL 1JV5B 4QRFA 2WYZA 1NL0L 3L3JA 3P2DA 4BFKA 1X7TA 4JW3A 3LVEA 3E3QC 2EIMB 4PGBB 2DQFB 2EKJA 4Q6IC 3BWSA 5GS0H 4JREB 4R0LC 4WWKA 3RDTB 3PDOB 2EJ1A 3NIGF 3K0YA 2ZKWA 3QIBD 3FT0A 4OZ4A 5GJTH 2VXVH 4HWEH 5B3SB 1JGEA 3GGWA 2GQHA 1HWWA 3IMVA 1AJ7L 2ZCHH 1QBMH 1JWSA 3NRFA 4JN1H 1IILE 4CVXA 3K81A 4L5FE 3UJTH 4ZYKA 4PGJA 2M1KA 3C9NB 4BBWA 3ABKB 4NOFA 4PV9A 2BS71 2HT2D 2J3SA 1AGCA 1YMME 3T4AA 3RQ3A 2CIIB 5L6YL 3QNFA 2B4CL 2XI9A 4EZKA 3FB8B 1FVCB 2ZG3A 4PJAF 4FLOA 2JCCE 1BREA 4FHBD 3MBEA 1U9KA 2IV8A 3NEXA 5A2KH 1DP0A 4JB9L 2FZ3A 4OTXL 4PJ7B 1NC2D 1RIVH 3GJEB 2Y6TE 5DHYA 4XN4A 1M2VB 1WC7B 3FQNB 5FDWB 2DBLL 1UOLA 3C5JB 5DK0A 5A2BA 1JYXA 4Y16C 4C4KO 3ESUF 4RGNE 1YDPB 4LVOB 1AQDB 1K8IA 1VCAA 1DTUA 4LIQE 5AVQB 1CWVA 4OZFH 4XN8A 1FZKB 2BNUB 1GPOH 2Z0BA 2XN9A 5C0AD 3BP6B 4QKXB 1V55B 3DJZA 2EKSB 4UQ9A 3S0PA 3ZJAA 1G0YR 1NGPL 3JV4A 2MCPH 2QELA 3N41F 4P2OD 4OLZL 1EDHA 4IU2A 5FKPA 1IAIH 2Z9TA 5FYKU 2HKHH 2Q7YA 3O3EB 4GMTL 2HFTA 5DJDA 5J11C 1BJ1H 4QNPE 3H6AA 4A7GA 4E5XA 1AGDB 3KLQA 4AMKH 3L3KB 2GUOA 3APFA 4FQPA 4AC4A 1R46A 4H1LG 3MREA 1GR7A 4LSVH 2I24N 4LQ1A 1QP1A 3Q2LA 3H9ZA 5D7LD 5HYSG 1T6VN 1K5NA 1BEYH 4G7SB 4DQAA 5JLZB 4E36A 3SPIA 32C2B 3WIHL 1MCOH 4M6NL 3WN5C 1BYNA 4ZOBA 1LD9B 5ISZB 3UAFA 5I66A 4JFOA 5DEGB 2WP3O 2ZUTA 4WU7B 5MI0B 1Y18B 2Y2TA 4ABVA 2YWZA 3RURA 2O6CA 1CZ8H 3QIBC 3UC0H 2Y1AA 3V4LA 2XKNB 4DO5A 5KYWB 1KXQE 4G8GE 4U1GB 4X6BA 3MRDA 2WXNA 3S5LA 1OARL 4OBSA 4LSSH 4ZX3A 4ONHA 4D7BA 4AYFA 2VR4A 3LQAC 1HJBC 1SNRA 5IR1B 4YXLL 5FPIA 3DK2A 1WVZA 1ORQA 3TTYA 3QJVB 2XYCA 1FJ1B 2OYMA 4XXDA 1XZ0B 2VE6A 4LPVA 3SEPA 2AHIA 4NN6B 5DYOB 1FAIL 3PP3K 4JG1L 1Q72L 1G7LB 4NUJB 3P54A 5EU5B 1SDYA 2ORBL 4IRJD 4MMYA 4S2SB 3APDA 4N8UA 5M7QA 1AXTH 4WSKA 2G0KA 2HT3D 3CFKA 1NCBL 1MFEL 4HYTB 3WEAA 1D5ZB 2GY7B 2XWBB 5AVSB 1CD8A 3I6GA 1Q9WB 3VWJD 5C0BE 3AROA 2OJZH 1QFUH 2BVTA 1BXAA 5DURB 3PFUA 4MFHA 1WUZA 1RZGB 1RL1A 2ESVA 5DJYA 4ZFQA 3OJDB 5LB1A 4GS7C 1NFDB 4FC3E 4P2OC 4QRQB 3WS6A 3HHMA 2XTJD 4N3UA 4P2YA 4PS4L 1IEAB 1AQ8A 4JRYD 2NW3B 4M7ZB 5ESQB 4Q4EA 4N2AA 1AY1L 3FRPB 4ZMLA 2LOEA 4OD1H 1WTLA 2BVPA 4MGXA 1CFVH 1FVEA 1V3KA 3ZTNH 3G5ZB 2MQ3A 2NY7L 5EBMB 3HFMH 4H8WC 1N5YH 4K7PY 1DVFA 2FWSA 3MLTA 2ZE0A 4D9RD 1K4CB 2XQYA 5D8JL 1Y07A 3IPFA 4RWHA 4ZSOB 3O81A 1PAMA 3WMSA 1XF4B 5C6TH 1L7TL 3SGEH 5CR8A 3P0VH 3CHRA 4EXPX 5EOCL 4KZEL 1OAZH 5EUOF 1IMHC 5DRWA 3TNNA 1MDAA 4GP4B 1WV7T 3CE1A 1HH9B 1MCEA 4EVNB 1RUQH 1MREL 4PJEB 3QISA 4QAMB 4FZEH 4JANB 2EO9A 4KX7A 5IMOA 3V55A 1T6WA 3BCDA 3SDAA 3THMH 4F93B 1I8IB 2GY5A 4PUBH 1BECA 1Q9KA 2H26B 1XL6A 3DV6B 1FI8C 1JD7A 1E7VA 1BVLA 3LS4H 4H0LC 2X4TA 1YNTA 4PJCB 4ANUA 3ZL4H 2M26A 3PV6B 4KDWA 5LNGA 2F8VA 3STLA 2E9IA 2F5AL 4WO4D 4JAMA 5HDQL 5E1AA 5E24E 2F7OA 5EA0H 5DHEA 3F12B 1L7IH 3GI8H 3SDDA 5J4MA 4A04A 3B2VL 1B0GA 4QY8A 2YEQA 1NLDL 4YFEA 2X2YA 2QVTA 5I17B 4O51B 5DI8B 1I3UA 4NC1E 3MV7D 1OD7A 2NXZB 4IRJC 1DJWA 1IFHL 4B60A 5I0DA 1R9FA 1PTZA 4HBQA 4MBOA 2F2HA 5GS2D 2HT3C 3FCSB 4JM2B 2O72A 4Z78A 4RGMC 1YYLH 1SJHA 4ZQKA 2ZONA 1RJLB 3GDCA 3SD2A 4N6RB 4NQUA 2GIYA 5F21B 2K7QA 3IJHB 3VWJC 4ZFZA 3AG2B 3NIDE 4TV3A 5JHDE 5D1XA 3ULSB 3BAEL 4AYSA 3U7AA 2NXYD 3VXPB 1KMGA 1CDCA 2KLRA 3JXAA 2J4WL 1A6ZB 1A2YA 4N28A 2XTJC 5F1IA 4TULH 1OAYH 1ZV2A 2F54E 4GQQA 4ZUVB 2X38A 5JDJA 4MMXB 1UQSA 3EYVB 4NN7B 4D8PA 4FN0A 4ZMTA 5C0GB 2WQRA 1ZGLP 1HE8A 1S5IH 4ZUWA 4X5PA 3ZKXB 4QHPA 1MI5B 1JTPA 1MIML 5ICYA 1IAOB 4HFWA 2BCKB 2CU9A 3H54A 4IBTA 4X9HA 4YFLF 2EIJB 2N7SA 1R3JA 3MROA 3T0ED 4JKPH 4E41B 1SYVA 4RX4D 1M56B 3OWEA 4O58L 1RZQA 2OK0L 1M7IA 2JF1A 2LR4A 3CVHA 1OB0A 1UJTA 3TPKA 5TE7H 3BVXA 1MAJA 2OA9A 3D2UB 5E7FA 2AQ2A 1UZ8A 1J7VR 2HFEB 2BY1A 3L2MA 4NKQB 4GQ9H 1F6FB 4OQTH 4FXLA 4DP9X 5J06A 2A9DA 4DTGH 3FTVA 4FQ1L 1HHHA 4Z3HA 2E6PA 4AOFA 3DGCR 4YXKL 1A9BB 3DX4A 2VLME 4G9FE 3ZE1B 4OF7A 4WO4C 1A3LL 3PL6B 3U83A 4TMPA 1ACCA 3OXRA 1L9TA 2ITCB 1F90H 1LMKA 1TTAA 1KTJA 2OQJA 1RZJC 4FLRA 3EBGA 3KPNA 2HVBA 2JXMB 3JWDC 1KN2L 3CSPA 1SYSB 5BMFH 3K4DA 3U4AA 5ADPL 3KXFB 4NC2B 4I77L 2VZ1A 1UWYA 4X6DE 4Y1SA 5AQ0A 3SKMB 1NAKH 3TIDB 4PGDB 3S34H 3E2HB 2Y24A 1JZDC 5FYKD 1OAXH 1HIML 4G43B 4WTWA 3CSGA 3U2SA 4LP8A 2PCXA 4BINA 4JKLA 3BKYH 4KXCA 4M48L 1K3IA 2R2HB 2WTRA 1KCUH 5HHOE 3NPSC 4HAKA 5FUOL 1DDTA 5AG8A 5KSAA 2NXYC 3ARGA 1JGLH 5A1AA 2TSAA 4YSOA 1JCKA 4XPFH 5E6ZA 1F1DA 5JOPD 1C5CL 4MVBD 4OGXH 5DJ6A 1QPKA 3UZQA 4ODUB 1QFWL 2V9UA 1SMDA 4WHCA 4HS8L 4W1TA 2FX8L 4Z76A 4IKKA 1OP5H 1TZOA 2H8PA 4V33A 4AEHL 4MCZA 1CFSA 1JYNA 4XMXA 1S9VB 4L3EE 5SWSB 3T0EC 1ERNA 3ZGHA 1A7RH 2AITA 3BUBA 3V0AC 4KNUA 2LVEA 4HIXL 3NCJH 3L3IB 2ZCLH 3K80A 3MBXH 4P5KA 4A68A 3H7BA 5IVXE 3T5WA 2X4PB 1TLMA 3QZMA 2BK8A 4K7PH 1G6RL 2PR4L 1ETZA 4XMPL 1P7QB 2V33A 4PRBB 3OWRA 3MRPA 4YC2C 3BDBA 4N9GB 3UZVA 1I85A 3PGDA 3QDAA 1R5IB 2V9TA 3DHJA 3ELAT 4R96A 3WAJA 4NPYB 3ZE2E 3V5HB 3D4GA 1MWAB 3KCWA 4RH4A 3OV6A 3ZOAA 3ULUE 4BCZA 3WMQA 3ARFA 3MNDA 3Q5TA 5J1SC 4OV5B 4IBVA 3RB7A 4M5ZL 1OIOA 3FHAA 1C12B 4WEUD 3AM8A 4MHHG 3POHA 4MZIA 2GEQA 3IAQA 1B9ZA 1XF5A 3GZKA 5CF3A 2BVQB 4IKLA 3AGVA 2J6EL 4PJBB 2L7JA 4AL8L 2QADD 1XF3A 3AADB 1GGBH 4KK6D 4YDJA 1EHNA 2E27H 2GAZB 2VDOL 2E9JA 3M17A 4G8FB 4HT1L 1XCWA 4M5SA 5EO0A 2OZ4A 4G80A 1CFQB 3GJFB 3L3OC 4U6TA 4ZFOL 4BK4A 1F1GA 1XH1A 4PRNB 3VRJB 3SKNA 3GSWB 1BM3L 1KTRL 1THCA 4R7DB 1E9OA 5T1LD 2YJLA 4M6ML 3RY6C 3UBGA 3UBFA 2A9BA 4IJTA 4PJ9D 5HDBB 2ADGA 2DQEH 2EXSA 4XBGA 4E9WA 2MTPA 2BVOB 1PAZA 2LFEA 1QBLL 2DQTH 4G6AD 1G9ML 4MDRA 2WGNB 4UIMB 1KXQA 3QEQA 1OPOA 3KHOA 4G8GA 2XXMB 5F72S 1DHKA 4R90H 2DYPA 2YK1L 3H9SD 5CGMA 4MQ7A 1UM5H 1GS8A 4POYA 2G30A 5DQ9B 4CKQA 4PIBA 1KBGL 3PDGA 5ICZB 3KYNB 4X0KB 1OPGH 2AQTA 4G6JH 3V5KA 5DQDL 1HCZA 4D8OA 5JUEH 3EIFA 1A1NA 4HAGA 4HJTA 5L7XH 4XO8A 3MOQA 1E4XL 1TQSA 2Q8AH 2D3VA 3VAEA 4WV1A 3FQ1A 1O5PA 3QORA 4HHAA 3MRNB 3ZKND 4APXA 5LJYH 4IIQB 2GHWB 4FMVA 5KSBE 3VVVA 4Y8AA 3U0WH 5I8CB 1CQKA 1GOGA 2PP9A 1ZHBB 1BGXL 5JXAL 1QNZL 2EICA 4MJIB 5C0BA 4OCXL 1CE6A 3TJEH 4GAGL 1S3KL 5DD3H 2X1OA 1RP8A 4QT5B 5E8OA 3JWNE 4UYQA 2LE9A 1ZHNB 3RWGB 4RFEB 4P2RE 4L9LB 4PJEF 2HTKD 4K3JH 4RAVA 1A6PA 4HEPG 1QRNE 3T2PA 1KJVA 3AUWB 1SJEB 3GMLA 4IRZL 2IALA 3SJVB 4NPKA 2QADC 3NZUA 4K71B 4ZTOH 4KK6C 4OVUA 2D7NA 1EO8L 1QLEB 4NQED 5E6IA 3IBOA 5B38G 5C0CD 2GUYA 3MRHB 2IADA 1AI1L 3SKOB 5I6XB 5HVGB 2FBRA 2MHAA 3V4PA 1D7FA 4LHUG 4C56B 3C6LA 5ICXA 2VLKD 4PTUB 1KEML 3ZT5A 5JHLH 5D7SL 1OWRM 3ESNA 4PJ9C 5DMIH 1KGXA 2JKLA 1TIUA 1CTNA 4QTHB 4G6AC 3B37A 5E9DE 5E0QA 2WINB 3CFDB 5JDSA 5FAAA 2DQCL 4JFXA 3MLSL 4JM2F 1LNUB 3CJJA 1SEBA 3KPLB 4E9SA 4HWBH 1ZLVK 3FL7A 5DRNB 3BJ91 3SYAA 1M7DA 1JK8A 4L5FL 5JW4M 1RULH 1NGZB 4I4WA 2E8YA 1CR9L 2CO4A 4IQHA 4YH6A 4OCLC 4KKBD 4TNVF 1ZGLA 2W94A 1JZGA 4X7FC 3TIEB 2NNXA 1TQCC 1WAAE 3HS0B 3LQAH 3R4DA 1YEWA 4HV8A 2V7NA 1URZA 4U1KB 1PDKB 1W6WA 4YBLC 5EO9B 3QULA 3MA9H 2I25N 4KJYB 4NHCH 4MXQD 4KGJA 1S5HB 4Y9BA 5KN5A 3O2WL 5FA3A 5E00A 3TYGL 3VI3A 4NT6A 5E94A 1WEJL 3LZNA 4QDGA 3V9EA 4NCDA 4EOWH 4G11A 4XCNA 1NGWA 1J86A 5DVPA 4EIZC 5HVHB 5JHDA 5EO1A 1ZGLM 4BCXA 4LIQL 1UWFA 3GHPA 2PYEB 5KW9H 2ZUWA 3ZHLA 4P9HH 2R69H 3FH8A 3I3DA 3N3EA 1YZZA 1HAWA 4JR9L 3JWOC 3AAZA 4U3SA 3RVUD 2F54A 4LVNC 1UB6B 4JG9A 2HTKC 4QOKA 2WZPA 4FEMA 4AG4H 4PJ8B 3BKML 4B9ZA 1SUHA 4EDXA 5AWNL 1F0LA 2F7RA 4CMHC 4AQOA 1F4WH 2CBQA 4HUUB 1NMBH 3QDGB 3KWWB 2Z1PA 1WFOA 2WLKA 3ARTA 4LLYA 4UBDC 3CLWA 5LDSA 3RWFA 3OKNA 3FO1B 2DWXA 1J9QA 2HG0A 1X5AA 5KS9E 1HWGB 3K6NA 5C3IA 4G82A 2AI0L 4BZ2H 1XGZA 1DBBL 1GOFA 2F53B 2IG2L 2WNWA 3P4NA 4LKCA 3RWEB 4FJ6A 4WHDA 3BH4A 2VLLA 1IJNA 2BH0A 3A5VA 3AITA 3GI9L 4FYSA 1R24A 1SM3H 5TQ0H 3FPXA 1DR9A 3QEHB 3DGGB 4U1MA 4YUEL 1KJ2B 2VXUL 5FWQA 3O2DH 2EEFA 5E8NA 3VO0A 3G04A 3WNIA 1WCBB 3ZT7A 2BNQD 1HZKA 1EIBA 1YNLH 3NVQA 3EFOA 1QEWB 3ESMA 5C1MB 3EBIA 3IFNH 1BZDA 2W60B 5AVVB 1LO5A 2VRAA 4MYWB 5C0IB 3VGFA 4YMPA 3BVDB 2QFRA 4B41A 2R0ZL 1W8EA 1AKPA 4G7YH 1S3RA 1MCCA 4GH7B 2LU3A 2ENPA 2XQ0A 4KKBC 2E75C 3BFWA 2LU4A 1RUKH 4KTEL 4I1RA 4WWID 4Z18A 3FQYA 4LHQB 3T6XA 1MH5B 2ERJC 4OJCA 4EI0A 4C47A 1IB5A 5AEAA 4F37F 2DBJA 2XZAH 4G71B 2X7LA 4X6DA 4XVSH 4A6YB 4IYKA 4ODSL 1A6WH 1G0XA 5EFIB 5L4IA 4MXQC 4GFTB 5IF0B 5B7EA 3VFPB 2XQBL 3VD9A 3O3DA 3BAWA 4I9WE 1JN6A 1R5WA 5DD0H 3WUWA 5IB3B 5FM5M 4P5SA 4RESB 2YS4A 4PLKC 3VWKA 4XPHL 4OF5A 5HHOA 1XH0A 1EAPB 2JH2A 2OJEB 1HU8A 3U30B 1I3RB 4RGOH 4JRWA 4LQFH 4LLWB 3TZVA 5IEHB 2ICWB 4F2FA 3LEYH 3IU3A 2IQAB 1HAUA 3H6JA 4QRRB 3SPVB 1TFHA 1RPQA 4I2XE 5JQIB 4R97B 1SY6H 4XP6L 1E27A 1HHIA 3OAZH 2JSFA 2DKUA 1T22A 2YQGA 4UM8A 1TTBA 1QSED 5F1OB 5ALBL 5I0YA 1DDHB 1H15A 3QDJA 3T4YB 5LBSL 1F8TL 5SWZE 3OX8A 4WFGD 3FTSA 1PJWA 4I18B 5ACZA 4I1PA 3GSXB 4F7CA 4M3HA 4Q2ZB 1B6UA 4FNSA 4Y9CA 4HWUA 3S6CA 1ITBB 4NLHA 1L9RA 2UY7A 3RL1A 5ESVA 1TJHH 3UYRH 1T6BX 4HU2A 4KVPA 4Y4FA 2RACA 5FFGA 1AGFB 1CYGA 1KYAA 4UTBA 4DP1X 4D0CA 4X8CA 5DD1L 2H0FA 2AJYL 1FZOA 3U36A 1II4E 4NN5B 1ZEAL 2CNYA 1FIGL 4ZTPH 4I8DA 1JAEA 1UD8A 4ENED 5CLWA 4X9IA 4Y1AD 3X3FH 2ZP8A 1WIUA 4PJ5D 5PCYA 1AP2A 4N3TA 3V9CA 5HDBF 3HJ0A 1MRFL 2X6UA 5FHBL 5FGCB 1IGMH 4N26A 3CVIL 5C08D 2F08A 4PWHA 1CICA 1NTDA 4IM8A 2WNXA 5HGBB 3SE8H 1MQKL 2PN5A 4UV4H 4YJZL 4LAQL 4YHYC 3OKEB 1KBKA 4L3CA 1H8SA 5D6CA 1UHVA 3VFUA 1AHWC 2AP2A 2Q5BA 3QPXL 4GKNA 5E2UL 1P4BH 1KBVA 3L5IA 4ZAKD 3BHBB 4BDVB 1RZJH 1X5IA 1IGYB 1VACB 3D4ZA 4EKJA 3DV4A 3I02B 3JWDH 4ORZC 4BK5C 1J8RA 5C97A 2GCYA 1Z7JA 2ZKHH 1ZIBA 1MWAH 3A6BL 4JLRB 1A4JB 2NY4B 1NFAA 2W07A 4WFHD 3SQBA 1QUPA 1PZ5B 3B5GA 3KWVA 2H6PA 2YUXA 2BP8B 2ZIDA 4W9EC 4WI2A 2FJSA 4X4ME 5IG7A 2F1EA 1U8QA 1A65A 3BKCH 5T1JA 3JVGC 1I8KA 2AKRA 2FAUA 2CDFA 1H9DA 3BQUB 1IC1A 2OYKA 4LO9A 3ZZLA 1V7NL 3NIFE 3OL2A 1QLRA 3RHWK 4MNQE 4BSVB 1IGCH 4EN3B 4V1DD 1QMUA 3D6GA 2OTWA 4BZYA 4UTAH 5I1AA 4R26H 1DLFL 1O75A 5EMYA 2AJVL 1RJYB 5KANI 1MJ8H 4GKLA 4MLSA 4OCSL 3W0WB 1MF2L 2VQTA 3B3IA 1IC5H 3EBHA 4U05A 5CILH 3T1WA 3ARBD 3DRQA 2B2XH 4G5AA 3PJSA 1MCIA 1BP3B 2ENQA 2X89D 3F7VA 2A4EA 4JFYB 1KCRL 1OW0A 2AK4A 4LSTL 4CN6A 5LNEA 1YYML 4H2CA 3JV5A 3WSQL 2XRAH 5KSBA 1N4XL 3ZDYB 2HJFA 2CHXA 2DYSB 1UWEH 2BDNL 1F86A 3CCHA 1HHKA 3AGWA 5FB8B 4YAQA 1Z2KA 3RFZC 1RQ5A 2FUTA 1OD9A 3DSFL 4AENA 1P2CB 5GGVH 2E9GA 2GEEA 3WNOA 4WEBL 4A39A 3SKJH 4OIBA 4ENEC 4P23B 2Z92A 1FFNB 1BXXA 4NQXA 4XCFL 5ID0A 1LEKB 1HESA 3MYZA 3J7HA 2XA8L 2X9YA 5CKGA 4YN3A 4P2RA 1QAWA 1AZCA 1XGPB 1QRNA 5F7YC 2HVKB 1EAQA 1BBJB 3GLAA 1TETH 1J8HE 4OIIH 5HHME 1ONQA 3UCQA 4ZW8A 2CMRL 1N0LB 4MWFB 1YY8B 4F27A 1P7KB 4O2CB 4ZAKC 3O2VL 4KXDA 5B39B 2B1HL 3QHZH 9CGTA 1YEKH 5EZOH 2F58H 3RJDA 3RZCA 1T4KB 5E8EB 3OD3A 2IDFA 4PBXA 5FF6B 3MLZL 3NP3A 4JO2L 4YHZH 4B9CA 2FX7L 2DWSA 1WA2X 2WOBA 4F8QA 4L8SA 3L3JB 3O0LA 4HPYL 5DZAA 5E9DA 4N25A 3CFBA 1H6UA 3HUJF 5DJZA 3LNEA 4OT1L 4PRPD 1A7PL 5JPNA 4WWKB 4UMGA 1YEGH 4JFFA 1NCAL 4K73A 1NCGA 1D3CA 3QIUD 5D70L 4AM0Q 4OZ4B 3BZDA 1F97A 1P5VA 1JGEB 3GGWB 2VLRA 3PNRB 5C2BL 5L0QC 2XN2A 1JWSB 1HN1A 1AFVL 2DTSA 4OD2A 3ARBC 4W6XB 4XO9A 3EO0A 2B20A 4XODA 1WAAA 2FDBP 3KS0J 4BFNA 2N1KA 4HKXA 1DBAH 2B77A 3IAGC 3FRPG 2J1KA 4PV9B 5FYJH 1EEYB 4MKMA 3T4AB 1LM8V 2HLFD 2AJ3A 5FHAL 5CZXC 1TZAA 2YD9A 3BX7C 3IGLA 3BAYA 1CXKA 3MRIA 3EYUL 2QQQA 2ROXA 4GT0A 2BSRA 1CIUA 3MBEB 2E4FA 4GG6E 1J1OL 4L4VE 1AACA 3UEZA 3W5MA 2HFFA 4MS6A 5D2NA 2H5UA 3F7KA 5F71A 1FYTE 5HDOA 4YXHH 5DHYB 2PTUA 2PWGA 1BXVA 1I7ZA 2HA1A 1A4CA 2NLJA 4KO6A 4NSKA 4OB5H 5DK0B 5DD5L 1GJIA 4Z8FH 1KDIA 4J3BA 4NO2A 3II2A 5C86A 1I1CA 2AEQH 4X4KA 3VXOA 4P2CG 2YGOA 4ILDA 4DQOH 2ZXBA 4Z0BH 4NX0A 1HC1A 2GJRA 3RI5F 3LH2H 4U6VH 1DL7L 4LKXA 1BCIA 3TT3L 1J5HA 1EJOL 2CBPA 2H1XA 1TVHA 3CFEA 4NZRL 4IU2B 4LVHC 5FKPB 1FO0A 2Q7YB 1CF8H 1D5IH 3IJEA 5DJDB 4H8UA 3BZ4A 2FWLB 3BW9A 2PO6C 3T2LA 1HK6A 1E7UA 4E5XB 4IGBA 2GUOB 2G2NA 1BDYA 5FFOA 3MREB 2IVFC 4P2QD 3R7QA 4RFNB 3C60A 2I85A 2R29H 1KPVA 2EAEA 3A4DA 1CFMA 1RURH 2YQ3A 2X4NA 3RY4A 1T0PB 2Y1ZA 3MUHL 1DYZA 3WKNA 1WE5A 5CN1A 4MA1B 3ILDA 2D3LA 3WS6C 2K3HA 3MACL 4JFOB 3VI4F 3F6LA 4ODTH 3TVMD 1JZIA 2EACA 3GUTA 1IGIL 2P80A 5EU6E 2ZKYA 3CMOL 3N40F 1LP9E 3ZTEA 1FFRA 2YWYA 3CN4A 4YDVA 5EDSA 1ZCRA 3NA9H 1YECL 4AE0A 5KJ4A 5JA8B 3VH8A 4EZLA 4GAAA 5CJOH 1W72H 4X6BB 1UM4L 5E2VH 3MRDB 3S5LB 4GQPH 4EI6A 2D9CA 2FO4B 4IKJA 2YFNA 1KBWA 3MRMA 4ONHB 4AYFB 4Z3IA 1EGJH 2N0KA 1HKLL 4FHKA 4Z7NE 5CIPA 2R4RL 4NNPH 2HLFC 5L2KD 5FLVA 1ORQB 1J05A 4XXDB 1YPZE 2TSBA 2VE6B 5FC9A 3MJ8A 1DVSA 2MPAH 2WQWA 4HF5H 4AI7A 4JBSA 3UCRA 1NCCH 3GS7A 1J88A 2VT0A 3M8OL 3N42B 2XV2A 3GUFA 2DKMA 1MJ7L 4U2YA 4IBYA 2YAHA 3CFKB 1J87A 5E5LA 1UZ6E 2LTQC 1KENH 2D0GA 2VN7A 1DFBH 2R59A 2EH7L 4UF7C 5I1CH 1DBKL 4TLUA 1WCQA 1BYOA 2ESVB 5DJYB 3U6XS 1AQHA 4PRHD 4XWGL 1RZFL 3JWOH 5SWZA 1IBGL 2YAEA 4W9FC 1SXCA 5IM7B 5AB0A 1OTTD 2YGPA 3J07A 3ILEA 4DN3H 5D1ZA 2BVPB 3K6IA 3QJQB 1FVEB 1KIPA 1QUNA 1WIPA 2FD6L 3O45B 3QR1A 3WFDH 4Q0XL 2MCAA 4G1MA 1I8MA 1DVFB 2JK5A 4G6ML 2JKWA 2VQ1A 1YN7A 4MB3A 1OCZB 4FG2A 1XGQA 2YD4A 4HS3A 2MRYA 5DVOA 1GYWA 4MQXD 1X4XA 3ZRFC 4MA3A 2D0FA 2WUBL 3TGXA 4NQDE 1PKQE 5DWUH 5DRWB 1U4EA 3TNNB 4CDGC 1S7XA 3WLWD 2ZNWA 3N0PB 4BFJA 2JJWA 5FWRA 5IMOB 4FQJH 4FYQA 2BIHA 1JZ8A 3SDAB 5I1HL 3AS2A 3CAFA 1OL0A 1ZSDA 5AW7B 1Q9KB 3IDYC 5L4JA 2EDKA 1BVLB 4FTDA 2X4TB 1YNTB 3EDDA 2HT4C 1M9WA 3BPCA 1LE5A 3QJTB 3W9DA 4ZXBA 3STLB 1JJUA 1MNUH 1RFDL 4JAMB 5E1AB 3T0DA 5D7EA 4J12A 3CN2A 5DZNA 3S4SA 2QDVA 3HG4A 4JHZA 5DO2C 4B27A 4EF3A 5JORA 3A21A 5IUCA 3SDDB 5AB9A 2YXFA 1B0GB 4QY8B 2W9DH 5D6DC 3CPUA 4X4MA 3B7TA 2FRGP 1MCQA 4N0CD 1D5BA 3RA7H 3KYMA 3O3BA 4F15C 1Q9LB 4Z78B 3ZDYF 5FCSH 3NGBC 5D4JA 1SJHB 4ZQKB 3ERXA 4HXBL 4XCYA 1JTOA 4RZKA 3T3PB 4CC0A 4LP4A 2AEPH 4Z7UB 1QO3B 2VXQH 3L5HA 3DHMA 3WTUA 1AH1A 4ZFZB 8FABB 5D1XB 5IUSA 4YL4A 2RCSH 2IANE 2EEBA 3WFBL 2CO1A 1DFXA 3FU7A 5AD0A 5F7NC 5AYUL 3GSNA 2Y25A 5F1IB 2APXA 4BWUA 4PGCB 5DZ9A 3P3RA 5FYLH 5C0DA 1RPUA 4O4YL 3ZQWA 1ET8A 1UQSB 3L4TA 4D8PB 5MEOA 1DVUA 3PWPE 1GYAA 3FU5A 1PG7W 1LGVA 2CJUL 2Q3AA 5ICYB 2ADFL 4HFWB 5DQJA 1NOAA 5F8RC 5GRUL 1UCBH 1R3JB 3MROB 1SXSA 4UT6A 4M6OH 4ZRGA 1SYVB 2K70A 3UDWA 4ZPVB 4EQ3A 2D03H 1SDDA 3TN0D 3QJXA 4JHWL 2Q3ZA 3MNVA 4LSRH 3UBXB 1M7IB 4N2GA 5BRPA 3GS4A 1BVKA 5HJDA 4MMZA 3CVHB 3Q44A 2UZXA 3WLWC 3ATBA 3ESOA 3FB6A 3R1GL 2YBRB 1UZ8B 2CHZA 3T65A 3V79C 2YO3A 2NZ1A 4FG4A 5TK4A 3UTTA 1CI3M 1J8HA 5KEZA 3FW6A 2NUPA 4Y7OC 5IMMB 2Y22A 3P3SA 4AV4A 2OTUA 1HHHB 3DARA 3QO1A 1UA6H 3MLRH 4Q89A 3GRBA 4G2AA 2H41A 4ODHH 3IDIA 1HEZA 3L7FB 3OXRB 2OQJB 2O5YH 1QASA 2Y1VA 4QHUA 3V4UL 3TJHD 5JHBA 5IB5A 3KPNB 2H1PL 1MW1A 4F9PA 2N3JA 2YD8A 5EZIL 1GHFH 4G7VL 3FOMA 1E5CA 2N56A 3BGFB 2APWA 2OYPA 1W9XA 4N0CC 2PWHA 5D7JD 4N8VA 1SN2A 3AC0A 4LRIC 4Y5YA 3U2SB 3IMBA 3MRRA 2WJ7A 1R3LA 5MEND 2C4FU 5KVEE 3V4VA 4BH7A 4D9LH 4BZ1A 2WTRB 5FOBA 5JZ7D 3OQRA 4OZIE 4EDWL 5KSAB 3ARGB 4FS0A 4X6EA 3NSCA 4P4KD 4LFHG 2P1YA 1AZBA 2OL3A 2GABA 5JIMA 5IQ9A 2DWEA 2GIXA 3SBWC 5CZVL 3UZQB 5HYJE 3BGMA 5JQ6L 2IGLA 3F6IA 1D9KA 4YSSA 4M8UA 1YMMB 2IGFL 4FQIH 2H8PB 4RMSA 1AZRA 2CIKA 2NYZA 3VG0L 5IQOA 4MCZB 5DLML 1CFSB 4LLMB 5CINL 2IH8A 5CWSA 2QMJA 5EG6C 5BRZE 2ICWI 4LP5A 3VTTA 4URKA 4J3UA 2NY2B 5T3ZE 2EVHA 3TN0C 3N44F 1FYTA 2X4RA 1ETJA 4P5KB 3H7BB 2JJUA 3FQWA 4ZDHA 3NZ8A 3RVWD 1NDGA 2WWMD 1ETZB 5DJ2A 3EXLA 5TK2A 3MRPB 3UZVB 3K0WA 1G7IA 4RGNB 3PGDB 1OVZA 2XWCA 4R96B 5E56A 3N50A 4HUMB 4PB9L 2BVYA 1BD2E 1FNLA 4WV1C 2W59A 3IN2A 4HFUL 2V2TA 1Q38A 2AJXL 5EC2A 3ARFB 3HTLX 3IMSA 1JNLH 4NZ8A 3SPHA 3QFJE 2DLGA 4KUCD 3MRLA 3HR5A 3B43A 2W8CA 5D93B 4ZNEE 2IBGA 3CBRA 3HE7D 3LMJL 5DK3A 6PCYA 1AYOA 1V05A 1XF5B 1GY1A 3RAJL 4JGMA 4DEWA 1XF3B 4J3TA 2LU5A 4YDJB 1VZIA 1JNHA 3M17B 5EO0B 3L17A 1YVLA 4KHTL 3MLUL 4G80B 4RA0C 3O4LE 5D7JC 1JXGA 3SKNB 1OWWA 1CGXA 43C9A 4QGYA 1E9OB 1T20A 2D7TL 4XNZB 3T04D 5E6UB 4FI7A 3U1QA 3WHE0 2FEEL 1G4RA 2BZCA 2YPLE 2ADGB 4XBGB 4FFWD 2G2PA 3IDXH 4P4KC 1YQVH 2YD1A 4IKNA 4ELDA 2JLPA 1E2VA 3N42F 2JI1A 4G6FB 5E6IC 5JNYA 4G8GB 5SX4I 3AQXA 5I1GL 5D5MA 1G5AA 5E7BA 2DYPB 2NXZD 4MQ7B 2OSLA 3ARDC 5J13B 3S8WA 2AQNA 2XZQH 1Q4NX 4QRPA 4PJDE 1UGKA 3D1MC 3BISA 5EBWA 4PS7A 4RETB 3V5KB 4NBXB 1QOKA 4R8WL 1A1NB 3MUUA 1T7WA 4B9YA 5BW7C 1XSKA 3PGCA 4UZSA 2X6VA 4JPVL 4UZUA 3C5ZA 3QORB 3KG5A 1M3IA 1DSFH 4HHAB 4NS0A 12E8L 5TE4H 5I18L 4APXB 4OFVA 4ODXA 4NUGL 3ABZA 1WWBX 1URLA 3RVWC 2WWMC 1R17A 4ABWA 3VXRD 3NN8A 3QWQB 1F56A 2BJML 5DDHA 2VDNL 4HBCH 1QKZL 3LV3A 3LH8A 2L7QA 5FEBA 3VB8A 5C0BB 2ZWYA 2X6CA 4NM8H 5D1QE 2JIXD 4L1TA 3QP3A 5E8OB 4E41D 5I5IA 4WW2C 2PW2A 4LCCA 2R56L 3GMMA 6CGTA 4XWOC 1UXWA 3RTQA 2WPGA 1KLUB 3HE7C 3EADA 4IJ3B 4RAVB 1KJVB 4WHTA 4O5LH 3GMLB 4FQXA 2IALB 2IMMA 4DGVH 2LAAA 5DT1L 4G6KL 5DJAA 3IN0A 1KB9J 1A1MA 3OC8A 3CFQA 1E6JH 3ULVC 3P4MB 3TOPA 4FADA 3B9KA 2IADB 2N59A 3GBLA 3WKPA 2MHAB 3V4PB 3V95A 2C3WA 3WY2A 4JO1L 3C6LB 4FQHA 5ICXB 2A6IA 5B1JC 3TU6A 2OI9C 3DVFA 3M45A 4OQ1A 1PKQA 5C0JA 3PL6D 4YS4A 3TBSA 5I73C 4FFWC 3NCEB 2VSCA 4IMKC 3EDKA 2DI8A 3QQ3A 2H47C 2FSEA 4M00A 1IGTA 1WFNA 3RU8L 3CXDL 1RERA 1U42A 1SEBB 3UTSD 2CO2A 2WYTA 2YPVL 4B96A 2C26A 3T3PF 5C09D 4J28A 1M7DB 1JK8B 2D7QA 3B7UX 4L23A 4TLTA 4RQQA 5GRVK 1CDBA 2XJLA 2R7EA 4FFVD 4I4WB 3VRIA 4AYDC 5F7LB 4JUSA 4Z7WA 5KSUA 3B1UA 1F6AA 2J6WA 1B9KA 4FNLL 4DP5X 1ZGLB 4P04A 4ES8A 3HB3B 4JPKH 3T09A 2FECL 4HV8B 1GMIA 2EDLA 2X4SA 2V7NB 4LCIL 1TZGH 4Y4HD 4M8QA 2ZAIA 3NP4A 2VH5L 4NBZB 3QULB 1QFWM 1GZPA 4UIKH 3GB7A 3QCUH 3ARXA 3K2UH 2VNCA 2DZEA 3PNWA 4HP5A 5KN5B 3X2QB 4RNRA 5FA3B 5E00B 2QPDB 3VI3B 5E94B 1T89C 3CXHJ 1NGQL 2EH8H 1NGWB 3NIDB 5JHDB 4XNXL 2IANA 4OJFL 5EO1B 1ZTXH 5SWSD 5LQBL 3B2DC 3S88L 4X8GA 3BQVA 4TKWA 1RIUH 1Z3RA 1MIEH 5KTEH 1YSOA 2SEBA 4A2DA 1FG2A 4U3SB 3AAZB 1ASPA 4R3SA 2F54B 5I1EH 3IXTA 4QOKB 2VDMB 4RIRA 1WA1X 4EDXB 4NKIH 3FFCE 4QO1A 1TZIA 1ZT1A 4QRUA 1KGCE 5I1JH 2MKWA 3KLKA 1I7TA 3U4KA 3QUYA 1PX3A 4LLYB 4ZFGH 2Q8BL 1E40A 3HW7A 4N5ED 3RWFB 3OKNB 4W68A 3GXIA 4Y9FA 1CDGA 1EMTH 2GC4C 3P4NB 4LKCB 5C3LD 3Q9PA 3PY9A 2VLLB 4O9HL 3P3TA 4YHKH 5HY9A 1R24B 4R4BA 2RD0A 4YE4L 3CLFL 5E8NB 1J9SA 3G04B 4M1GL 4TM9A 3I9IA 3CLEH 3EFOB 2R2EA 2A9ML 3O0RL 5BV7L 2VWEC 1LO5B 3F04A 4TUOA 3EOAA 5K93A 2YRPA 3FU9A 4MXVE 5CLYA 5IJKC 4UDUA 4FFVC 3TBWA 1B3JA 1T5KA 3BIAX 2YUZA 3NJIA 1CK0H 4KO7A 3F7PC 2P8LA 1TITA 1JP5A 4KTDH 2AEIT 1T7VA 3OKKA 3D9AL 1MRDH 5CSBA 4Y4HC 3VD4A 3KLLA 1NBYA 2DLFL 1KFAL 1CF1A 3CN3A 4NQCE 4K23H 4KK5D 2X7LB 4X6DB 3V0EA 4Q56A 4LGRB 4C54A 2WUCH 4JRLA 2CD0A 3O3DB 3VW3L 2NZ9D 2WIIA 1B0WA 4DAGH 1R5WB 4KQ3H 1YEIH 3WUWB 4YSEA 5AW0B 3VWKB 4MJJA 5HHOB 2XPYA 4RISH 4WDIA 1UWXH 4N0YH 1J18A 2GC7C 1OAKH 3UTPE 5JW5A 1ZWIA 3TZVB 3FAXA 4ZODA 2Z8WC 1KCVH 1XGUA 2DIEA 3VYNA 5F9OH 2VM4A 3IU3B 5HDLA 3S3JA 3WO3B 4RFOH 5CUSL 4LPYA 3IKKA 3U9PH 5HYJA 1XGYH 4F7TA 3DOIA 1M57B 5CD3A 3C5SA 1E27B 1HHIB 1H5BA 2DI7A 4JG0L 1T22B 4DH2A 4UM8B 1J5OH 1G9NH 3MODH 3FO0H 4HU8A 4L4TD 3W37A 1H15B 1N70A 3QDJB 4L3EB 1VSCA 3F7YA 3OX8B 4N5EC 4MJID 5ACZB 4Q7DA 4UNTA 4F7CB 2VMJA 1CGTA 2EEDA 2HRPH 5BRZA 3STBA 1HNYA 4UQCA 2ENSA 3W56A 4BFFA 2ATAA 3DUUA 2UY7B 1UD5A 4E42A 5ESVB 3CFIC 4OLXH 3LX9A 1R33A 2EDBA 5IVXB 4OLWH 4Y4FB 4CC4C 1MY7A 1R0AL 1PFOA 1KN4L 3E6HA 2HYMA 2VIRA 4WW1A 4NWUH 4D0CB 1QFWI 1BVOA 2UX6A 1K72A 1FZOB 1A22B 3U36B 2JELH 4BV1A 3TWCH 3NAAH 3Q6GL 1TXKA 2NYYD 3TX4A 2XXGA 3ZE2B 4UQBA 3DX0A 3WEXA 3HMXA 1HKFA 2PXYA 1AP2B 2C3VA 5ADOH 1EXUA 4XVUD 2DQDL 4IOSD 4QIRA 3QDME 1NEPA 1C5BH 5CGTA 2OAAA 2R83A 1QFPA 3NPZB 3K5RA 4F58L 1NUNB 2WV3A 1CICB 4IBQA 3V0HA 43CAA 1AE6L 1Z6JT 2FQGA 2OPCA 3DX8A 4L3CB 2QKIC 2UZIH 5D6CB 5LCVL 3VFUB 5B3JE 4S0SD 4GKNB 2ATPB 4KK5C 3VU1A 1AKJD 1FG9C 2D73A 4Z3TA 2EUVA 1JFHA 4ZMZA 2IPKA 1RK0A 3DV4B 4XPTL 4WUKL 5IWLC 5A6MA 3MV8E 2NZ9C 4ZX4A 4KZDL 2GCYB 2AAAA 1OSEA 5B1AB 5I16A 2YPLA 4U1LA 2W07B 4YGAB 3SQBB 3KLDA 4TTGA 3IRZA 1NJ9A 4B9FA 1U8QB 3M7FB 4XXCA 5C07E 1I8KB 2GTWA 4DEUA 2CDFB 1ETB1 2IC2A 2NY3C 5MP6H 3TH2T 1NQBA 3H42L 2Y7QA 2Z8VC 2NDFA 4HCIA 4Q9BA 1QLRB 3UPCA 3OG6B 2EADA 3KLAA 2OTWB 1V5JA 3DC0A 5DC2A 4CMMA 2X6BA 2X0WA 2XWZA 2G2RA 4PJDA 3SDXE 4EPSA 4H1LA 5IESH 3V0IA 1NCWL 3MLVH 3B3IB 2GJ6D 2E47A 4RWYL 1I9RH 4NQVA 3SCMA 4L8SC 3BUDA 5E0FA 4XP4L 1FHNA 3PJSB 4ZO7A 4WKXA 3F7VB 4JZJB 5L88L 5D7IF 4J6IA 2PYED 3WJMB 4JQXC 3MNZA 2AK4B 4XX5A 4B3VA 3RWJA 4M5YH 1MCKA 5TF1L 3FCGA 4JFDE 1OGTA 3NIGE 4LSDA 3IVKA 5KSBB 2HJFB 3CCHB 4L48A 1HHKB 1ACYH 3AB0B 1K5WA 4XO5A 4L29A 3WDHA 3FDWA 1Z32X 1T5WA 4AENB 5IJDC 2V7HA 3QDGD 2VDQH 4QTIL 4AIEA 2NYYC 3QQNA 3TV3L 3LCYA 4RVBA 4J3OC 1FBIH 2IQ9L 5D1QA 2Z92B 5MEPA 3P1VA 1JZ3A 3LZOA 5GRXG 3VGDA 2NCEA 4GBXA 5LAPA 4YHML 4BWTA 1E4XI 3ET9F 1RSYA 1RHHA 4XVUC 1AGEA 2F53D 4FA6A 2Z4QB 3BDYL 4CU7A 1J1XH 3BH9A 3GLEA 1E90A 1HHJA 1U6AH 4P2RB 3D2TA 4PJAE 5DUPH 4XMLH 1QRNB 4ACPA 1FZMA 2A3TA 4CN4A 2QPFA 3S5LG 1ONQB 1E6OH 5C6WH 5I15L 2VR3A 3UBXI 3UO1L 1A9EA 4NKOA 3OJVC 3D85D 3OAYH 3E9TA 3GXTA 3F62A 3L1FA 1GJWA 3PHSA 4K5OA 5FA4A 5BZZA 4BKTC 4L8CA 3MYJA 4UT9A 4X7SH 1T2QL 3SO3C 3RZCB 3QYCA 35C8L 4XI5D 4JQIL 1H8OA 4FFYL 3T77B 3VXNA 4X50A 5DMKB 1QNIA 4CJ0A 5E9DB 5KVEL 1N59A 3S36H 5EU3B 1QHOA 2AXGA 1KPRA 3CFBB 2CRMA 4AGMA 1U3HB 2I5YH 4XVTL 4AEEA 4OCYL 4FTVE 4J39A 2HN7A 5DJZB 3GWJA 5JPNB 3HNSH 4M8VA 3VI3F 1F3DH 1Q0XH 4WK0B 5DZOA 3UACA 3ZYOA 4KFZC 2K8MA 4QF1A 1OGAE 1BLNA 5E99L 1WFTA 5BS0D 2AQPA 1P5VB 3ULVF 5EEVA 3HI1A 2VLRB 3RX9A 5LG6A 4W9DC 2B3RA 1KZYA 3FUFA 3QH3B 4XTRD 3EO0B 3K2KA 4KK9D 4N68A 1ICTA 3U9WA 3RG1C 3ZO9A 1BQHA 5KSVA 2K0RA 4UOW0 1DQLL 1TT6A 5T3ZL 2AJ3B 4AW7A 2ZOWA 3NTCL 3QZNA 4FKHA 2ZTBA 3BWUC 4FQ2H 4WK4B 5TE6L 3WCYA 3B9EA 3MRIB 3MZGB 4PYHA 4N20A 3NFSL 2BSRB 4M9PA 3NRQA 2XQYG 4JFZL 1RXLA 2O6EA 4MXWL 3BUPA 3UTQA 5GGTA 3CFJA 2HFFB 2PPEA 5D2NB 5EIVA 1TQVA 1JPTL 3OZ9H 3ZN6A 4WLCA 3T2OA 4D7PA 4ZS7L 1I7ZB 3OMIB 4NSKB 5K69A 2MQGA 4NO2B 5DZJA 3LHPL 2FQEA 5T5FH 5EF0A 5AOKA 1NPJA 1SF5A 4F8LA 4GAJH 4HUXB 3FFCA 4HVBA 3HBQA 4FOMA 3TBBA 1CD0A 5DO8A 1ZVHA 4LKXB 5CEZE 4J6RH 1T2XA 4JFQA 5IB2A 3CFEB 3QQ9D 1TVHB 1WISA 1ZA3A 4KFMA 1ZLUH 1GTNA 1FO0B 4O02A 3IJEB 4X4YA 2C7FA 3NFNA 4AH2A 1K2DB 5IW6A 3BW9B 5HJBA 5KS9B 1GCYA 4IGBB 3H3KA 3BAXA 1VGEL 4PCSA 4XH2A 4XVOA 3C60B 3ULVH 4XI5C 5DHVA 4IK6A 2A77L 2IPTH 1KPVB 2GSGA 4JDTH 3PP3H 5F3BA 2X4NB 5H2BA 2BXYA 1CLOH 3CFMA 2GTZA 2ED9A 4GAYB 4YPJA 2YMOA 3IT8D 1JK9A 3GUTB 1OP5K 4PB0L 4ADGA 3O8XA 2QEJA 5D1ZC 3DETD 1F4XH 1VFMA 4IHBA 5TPWH 3S3BB 1JI1A 3IE9A 4YDVB 2MJWA 4YR6A 4GQRA 3RGVA 3GK8L 5ILTH 1FL6A 2NY4D 3VH8B 3DMMD 4OLUH 3U0TA 5CD5D 1XTMA 4X9YA 4Y4KC 3GT6A 2GBVA 4XTRC 5LKNA 4QTFA 1TG8A 4KK9C 2ADIA 3N1GC 4EI6B 2QLVB 2CG9X 2EUWA 3MRMB 5DHDA 1ET7A 5TF0A 1I1AA 5EUOE 3B5TA 2JLLA 5CIPB 4ETQA 4Z77A 1SLUA 1J05B 5L8JB 3L1OL 1S9XB 1VFBA 3MX0A 4LPCA 3MJ8B 5AUMA 1J9TA 5FIEA 3O9WD 4I13B 3GO1L 4CSZA 4ZFFA 2RA1A 2CKBL 5HHXL 4UM9A 1UWGH 4BFGA 1IBFA 3EHBB 3EF7A 2Z35A 5E9AA 4UNVA 3D3VD 5JOFA 4C59B 3AREB 3BVUA 2B4CC 2JV6A 1DANT 1MFDL 2NNRA 3OKDA 2YR3A 3RLSA 3S37L 2KL6A 1OE1A 2FIKA 4KAQL 3T71A 4YFDB 1CGSL 1U3JA 2EXWC 3MUZ1 1ZLWK 1CYXA 3QQ9C 3GBDA 4UU9A 4W81A 4OM0H 3GBNL 1ZVSA 4XRCA 5SWZB 5C0RL 1LE9A 5I1LA 4TSCL 2CJ3A 1JGVL 4RZCA 4U6HA 4P23D 1V54B 2DQIH 3BT2H 2CO6A 1FRGH 3CIAA 1SLVA 5H4YA 5AVZB 2XOTA 5F88A 4F5CA 3EZJB 1ZXQA 3OLEA 4XB3A 4MA8H 4X9FA 1TYJA 5IJBC 1KIPB 1QUNB 3EOTL 2Y69B 1V3JA 2AVGA 1IKFH 2NR6D 3DYMA 1I8MB 1YO4A 1CURA 2JK5B 5HTSA 1C8PA 1O9WA 2OBGA 2PTTA 1MNNA 4I85A 1A9VA 4HS3B 3MOBL 3MFGB 2H2PD 1VESA 3ARRA 2WWKO 1VIWA 4KZ0A 1ULVA 4MA3B 3Q13A 1C16A 1XD0A 1P0SE 1CLVA 1ZV5A 2JNZA 4X5QA 1S7XB 1EA9C 1INEH 4K8RL 4RDQF 4QRTA 5F0LB 1S9YA 4KDTC 1OZUA 3QDMA 3Q06A 3VVWA 2CAKA 3DMMC 3K6OA 5CD5C 4Z3FA 5IMKA 1BIIA 3PWLA 1KXTA 3B3BA 5IBUB 1UOWA 2XWJA 3ECQA 3ZHNA 2VC2L 1PG7L 1BBDH 1U8KA 1T0NB 1WFMA 3BPCB 3DI3B 4TRPL 4ZXBB 1LE5B 3Q8FA 4XBPA 4K2UL 3KPRE 1EO5A 2G60H 3WY1A 2AGJH 3S4SB 3IAPA 3GKWH 3MV8A 1KLGA 5GXBB 1XV8A 1QTSA 1USQA 5JORB 4RCAA 3O9WC 4LXFA 1Z9SA 2D7MA 3OBAA 4LSUL 1A5FH 1R3IH 5DFAA 5I71C 2X4OB 2ZCKL 5GGTL 3E8UH 1A7QH 1DVTA 1D5BB 4DPCX 3T2NL 3KYMB 1Z66A 3O3BB 4ALAL 1VB9A 1NCTA 1NKOA 3NIFB 4I7ZC 4XCYB 1IC0A 2B1OA 3BD5A 4MJ5A 4MYPA 5HYQB 1FLRH 3CWGA 4BCYA 2WHVA 3ZUNC 1HDMA 4AITA 3FBQA 2HSIA 4L1BA 3SDXA 2CUAA 4OZFA 4KV5F 3FU7B 5AD0B 3P4OA 3AY4C 3GSNB 4O2EA 3QUXB 3V7AG 2X2HA 4AQ1C 5MHSD 2WAQA 2Y06L 5C0DB 3UC2A 1AGBA 2VDPH 4DEPC 4O02L 5MEOB 4EE2A 5HPMA 4NI3A 3GBMH 3ZQXA 5FM5O 4JFDA 4HJJH 3SGJA 4BHUA 2D2CC 5DQJB 3SDYL 4GMSH 4JCMA 4CVUA 2AQSA 3GMRA 2JKTM 2H2PC 4YHLL 1SDDB 1FDLH 1FORL 2FJGA 4JCLA 3MNVB 3PHAA 2CO7A 3RNQA 1P84J 2GJPA 4C4KT 1BVKB 2VDNB 3BEWA 4MMZB 2UZXB 4GFXA 4FRWA 3T8XA 2DQHH 4XP5L 3FB6B 5GRYA 2NTSP 3K6SA 4XX1G 1KZQA 3PUUA 4HUCA 3E3QE 5K9QI 2PP8A 3UTTB 4EI5A 5HHMB 1J8HB 2R0LL 3GQFA 1J1PH 1N19A 1OLLA 2XBDA 5D4QA 2NUPB 1RV6X 2OTUB 3MJWA 2VXSH 1RZKL 3MMEA 5TJWK 3ZVVA 1AO7A 1TKWA 1A7BA 5I6MA 3L9RA 3Q2CA 5GZNA 3IDIB 1HEZB 4QHUB 4R5XA 3HZKA 5HVWA 2P5WA 1XQ4A 4JVWA 5IB5B 4LDEB 3TH4T 1MHHA 4PP1C 1X6LA 2VZOA 4J3OF 1N8OE 3GKZA 3GRWH 5BZWA 5I8OL 5ISZE 2DQ6A 2VLJD 3QNYA 4OZGF 1F11A 3AMLA 4GRMA 5KJRL 4M43L 3OM3B 5IB1A 1XBRA 2DJUA 1OCOB 1YRKA 1T04A 4FTVA 1CGVA 4Y5YB 4YPGA 2WLJA 3MRRB 3QZWA 4NRZA 3MNWA 3N5AA 4BH7B 1JNNH 3BZ5A 3X1FA 4I1NB 4J1UA 4ZMXA 2EVIA 1OGAA 3U4BH 3HC4L 4X6EB 2WBKA 3TT1L 1OAQL 2DWEB 3S3CB 4QHMA 5B38A 1R47A 2W0LA 5LGYA 1NINA 5I6OA 4S11A 3MCYA 5F7HA 1X7SA 3BGMB 3FSAA 4APQA 1M4KA 1XH3A 1D9KB 4WU5A 3MRKA 4TNVK 4XCCL 2CIKB 1OCWL 4FGMA 2IDCA 3H3PH 2BERA 3X12A 3L95A 5CWSB 5IBTL 2J7LA 5DK2A 2YZ1A 3BPLB 4U1IA 1MFCH 4MX7B 4R4FH 5E4IA 1FV1A 2VR9A 3STZA 4GG6B 5ABZA 4X4XA 2WSKA 3PWVA 2NNCA 1FYTB 2X4RB 3SY0B 2DYRB 5IHUH 4YDLB 1B2WL 3FQWB 4CAGA 1XBDA 4ZDHB 3NZ8B 3MLYL 1M6UA 1NDGB 1VENA 5DJ2B 3ZIYA 5I82A 5K59F 2VDRB 4RA3A 3BMVA 3VXQA 1G7IB 1JD9A 3QWOA 4J3OH 3I9GL 1CXFA 1LMIA 2VERN 1PIGA 1E2WA 3ZX1A 3G7TA 1BJMA 1EERB 3Q1SH 2V2TB 5EC2B 1YEJH 2VXVL 3FQRA 1KGUA 5SWQA 2QGDA 4NFBA 2BHFA 4ABQA 3MRLB 1QBML 3HR5B 5K1NA 4JN1L 5FUZL 2V3FA 4WI8A 3VFOB 2K3TA 4LPWA 3GSVA 2WCGA 2ZSWA 3F65A 4LT7A 5JO5A 1JNHB 3EYSL 3QRGH 2ZKXA 3CFNA 3HNTL 3OMAB 3V6BR 3O6LH 1NCDH 2LABA 1KIRA 2B8OT 2Y7LA 2Z0UA 4FERA 3O3AA 4FLHA 4H0HB 1XSJA 3IYLW 2JJSA 4PJEE 5T1MA 3QUMH 5E51A 3OAZK 3HA0A 2K4AA 2AMGA 5LWYH 4NQTA 3WO4B 1ADQL 3PGFH 1AQKH 1TQBC 2X6AA 2MOVA 4AVIA 2YLKA 5BV7B 5IK3B 3VYPA 5JNYB 2HWZL 3KR3L 4ODVH 4Z6AT 5D5MB 2WLNA 3UGXA 3P9LA 4P07A 1Z9OA 4QRPB 2BP5M 5CGBA 4Z7NB 5C0AE 1TCMA 2N01B 4MCMA 5EBWB 1KB5H 3ZPDA 1IAIL 2HKHL 4MA7L 4AM0A 4F7EA 1MCLA 2A99A 2EE0A 1JGDA 3H9HA 3PGCB 1U8LA 4UYPA 1Y6NR 3C5ZB 3SN6N 4F57H 1DJYA 3C2SA 5IQLA 3KPMB 3LOWA 4AGOA 4FG6D 3BT0A 1X5XA 2WQAA 2NY5L 4ODXB 3S5ZA 1UC6A 5TQ2L 2F5BH 3PAYA 1MCOL 2FL5A 3QZBA 3NN8B 4UNIA 3WFHA 2YPKA 5I1KL 1XCTB 3LV3B 2A74C 4I5BA 2WBJA 3OXSB 2VJXA 1AIZA 4OH2A 2YD0A 5I19L 2YRBA 1BAGA 2ICEA 5AKSA 2X05A 4LSQL 2C9PA 2EIDA 1CZ8L 1W80A 4BUGA 1CB4A 5CIPH 2OMTA 3K2IA 4LEXH 2PW2B 3KE0A 3GIVA 2ZPKH 4LCCB 3GMMB 1BG9A 4H13C 3IU4H 4TQEL 3RTQB 4ONFL 5CHNA 4WHTB 1DO5A 4FQXB 4LU5H 2J44A 4M61A 1D5RA 5DJAB 3F05A 2JFCA 1A1MB 2L8AA 4Y7MA 4H8PA 3CQQA 1FGVL 3TF7C 2BX5A 3B9KB 4H7VA 4PWFA 2CJTA 1EFQA 2CPUA 3G6AB 2A6IB 1U95A 4LCWE 4ZS6D 2PF6A 4NQDB 1ZAGA 4OW6A 3WUWG 4GRWF 1PKQB 4WY7H 4AL8C 5C0JB 3TBSB 5BUAA 1F3DJ 1F1AA 1AXTL 2B0SH 3AXHA 3BVWA 4HSCX 1XMWA 1S7RA 2HAZA 4PLJD 4Y2NA 5E8PA 3QQ3B 4KROB 1TQUA 2FSEB 1IGTB 1JWMA 4NGHH 1PZ2A 4XNDA 1OT4A 3NJMA 4X6CA 1LK3L 5TH2A 1FN4A 2OULB 3VQLA 4FF9A 4XNYH 1SXNA 3TJPA 4KI5F 1LQSR 3ALXA 2IAMA 1DVZA 2R23A 4RQQB 1FFQA 4JFHE 2P5EA 1QPPA 4PM1A 2L3BA 2R7EB 3VRIB 2EDEA 1QR4A 1FNEA 1G9MC 4Z7WB 5KSUB 1F6AB 3KXFE 4BRJA 5B8CB 4PY8J 4KVCL 2XTJE 3FMGH 3I50L 4TN9A 3ARGD 1FFOA 3RY5A 4OD1L 2X4SB 1CFVL 1A3QA 2EE3A 3ZTNL 1WUNT 4FG6C 4M8QB 3QXTA 1HH6A 3D69A 3UJJH 4FLQA 2OMNA 1P5UC 1GZPB 3UG3A 4DT2A 3GB7B 1PYWA 1GL4B 4F20A 1AJ7H 3PNWB 2VL5A 1E4KC 1PNDA 1YHPA 3DXAA 4Q74A 4XOCA 5GSRA 3TL5A 1T21A 4YBHA 1YMMD 1L9OA 2C9VA 5D7KD 3JV0A 2IANB 1EFXB 4YDIH 4HJEA 1NBQA 1T4WA 4PRIA 5L6YH 2XLLA 1J0KA 1RUQL 2B4CH 3HE6C 4FZEL 5F7EL 4P3DA 2SEBB 1FG2B 5CEZL 1ZANH 4R3SB 4PUBL 3IXTB 4GRWH 2O30A 4RIRB 1NM9A 4QO1B 3LS4L 1KB9K 1TZIB 4OTXH 1ZT1B 4XZ4A 4FXGC 4RAHA 1FE8H 4QRUB 5AOZA 4YLBA 3BOVA 4WSGA 2RGSA 2DBLH 1I7TB 3VM7A 3QUYB 3C2AH 5KVDL 1BV8A 1BG1A 2VDKB 3N0AA 3REWA 4NUQA 1L7IL 3GI8L 5D96C 1BIHA 3IFOA 5KYXB 3ARFD 2PETA 2BOLA 4UANA 3O6MH 2LLLA 4YWGL 4ZS6C 2QSQA 5HY9B 3DRTA 4P5TA 4YIQA 1IRAY 3O6KL 4OLZH 4WZ9A 4N1HB 2ZYIA 2PLTA 2WLIA 4PLJC 1WBXA 1WZMA 3OKOA 5I75B 1L3WA 4DVRH 4BFBD 2X53A 1A4AA 1U92A 2AZUA 3HZ3A 1QZNA 1ECZA 5A43C 3U2IA 4JFEA 5LGKA 3ISWA 3C8KB 4GIPD 4Q6IA 5SX4H 4FABL 2ED7A 4YHIA 4R0LA 4TUOB 3EOAB 1ED3B 3ZKQD 5JW4Q 1NBVH 2DWYA 4HK0A 2IO5A 4UDUB 4M6NH 3TBWB 4TULL 1BF5A 3O6FD 3SGKC 4R7XA 2ZWNA 1V10A 2P8LB 1TMCB 2L7EA 2Y3NA 1M71A 3PRZA 4TQHA 1INDH 3OKKB 3HHSA 1DSWA 1E3ZA 4R84A 4G6FD 3IDNA 3FQUA 4KKQA 3T2QA 5AVUB 4HUVA 5HDBE 2ZWLT 2UYLB 4F2EA 3GIZH 2OR9L 4DK3A 1WFIA 2WIIB 5F96H 3CC5B 3AACA 4OJYA 3T0EE 4YK4C 3CFCH 3ISYA 4MNGA 1ZT4A 3CPLA 2ZX5A 4WDIB 3BKJL 4OZIB 1GW6A 2ZYSA 3HS9A 1L0PA 5TE7L 1ZWIB 4N5UA 4YXLH 1OEZW 3N9GH 4K4KA 1MFMA 1XGUB 2FX9L 2QV4A 3AWFA 4OD3L 3L4XA 2VKXA 1FAIH 4G9DA 1G1CA 5HYJB 5IW1A 1Q72H 1K9TA 4OQTL 1SXBA 1N8ZA 1QW9A 4F7TB 4WI3A 4QRSA 2I60H 3A4EA 1H5BB 3C5SB 4QRBA 3RKDC 3DIFA 3SD5A 4FMKA 2ORBH 4CADA 4UI2A 1KCWA 1JWUA 2QL1A 3LSOA 3N06B 4JHVA 2HFGH 5D55A 3OLGA 1NCBH 1MFEH 5C0BD 3TASA 1WGOA 1WZAA 5BRZB 5BUGA 1KIUA 3DUUB 3P0YL 4E42B 1MCPL 4N0UE 5BMFL 3V4VH 1F5WA 4P59L 2HUHA 5F3FA 4YNYA 1IM3D 4UV7H 3E6HB 2OL3H 5JHLA 2VIRB 4WW1B 1UXMA 5J9PA 1OAXL 4FXKA 3ZYIA 1TO4A 2FLBT 1LL1A 3FFDA 2XVGA 3WN5A 1JXFA 1KPUA 2DV6A 4NENB 3X3GL 1MCHA 1KULA 2EC8A 3ZBMA 3WEXB 5LXVA 4DVBA 5IFHH 3V0FA 2DW5A 2DAVA 2Z7WA 2PXYB 2C3VB 1EXUB 2C9QA 3L13A 4XPFL 4ZW5A 4N0FA 1ANUA 3QIBA 3SJVE 5D8JH 3RI5K 4HWBA 3L54A 1VHPA 2UX7A 3O6FC 1BZ8A 1R5VA 1L7TH 3NJKA 3VGHA 1KXVC 43CAB 1KGJA 4J3OG 5D5MF 4KZEH 3FH5A 2B1AL 1CT8A 2UUDH 1J0JA 4JY6A 3FTYA 4C56E 4HZAA 1MREH 4JCWA 4CGTA 3FSOA 3HVNA 4FNPA 1MPAL 4HZLA 3ZZSA 1ZJAA 5FYJE 1RK0B 5L9DH 1ZHKA 1A7RL 4BFRA 1OB1A 4HH9A 2YXVA 3L3DA 3NCJL 3KGRA 2ZCLL 3FPYA 3BZFA 4OJDH 1TEFA 2DM2A 2YPLB 4U1LB 4MS8D 4AJ0A 2BSTA 3MRGA 5H4ZA 3RX7A 2F5AH 1NJ9B 1NC2A 5HDQH 1O5DT 3FTZA 2MWCA 3HAEA 2Y7QB 1LEGA 2EDTA 4EZMA 2YD6A 2R69A 3KLAB 1NLDH 3DJ9A 4U3CA 3KLHD 4CMMB 1FAKT 3QCTL 4LZKA 1DQMH 2G2RB 4PJDB 5C0AA 4H1LB 1LJMA 2OR8A 1XWVA 4XMVA 1OOAA 2V5MA 4NQVB 3SCMB 4S1DD 4P2OA 2FEEI 5JHDD 3UMTA 2FH8A 2WXGA 3QEGH 1LDSA 3HUJE 2WAHA 4HIHA 4E2OA 3QAZB 3WIFA 3MNZB 3BAEH 2E27L 1AZUA 3IVKB 1OGTB 4X99A 5F9WC 5J6GA 4ENZA 5DGQA 2J4WH 5FLUA 2WZPD 3TLRA 4OCMC 2V5SA 4P3CL 4DGYH 4L29B 1MRCH 3KJ4C 5GHWL 5I74C 2XJKA 4KI1A 4S1SL 1T5WB 1WFUA 2V7HB 3RVXD 1NIBA 1O6SA 2ZWSA 3LS5H 5DF0A 5D1QB 5MEPB 2P24A 4OIAA 4GBXB 1VAHA 3IXAB 3MCKA 4PH8A 1RHHB 1KBPA 1WGVA 1AGEB 2DQUH 3WIIH 4J2QA 3BH9B 5JR1L 1HHJB 1L4IA 3VH8G 4PVMA 3VD0A 1FZMB 4GXVL 1UM5L 4O58H 1COBA 2OK0H 1ML0A 3H9SE 5K9JL 3GD1C 1X9LA 1A9EB 3OTTA 4NKOB 2XVBA 1GGYA 1I9JL 1Q0YL 3FULA 1JYWA 3Q05A 1O6TA 1DVQA 2ZXWB 2F61A 4I3SL 5A16A 5FA4B 5HJGA 4Z7WF 3MYJB 4L8CB 1S7QA 4N8CH 2VLMD 1PY4A 4G9FD 5GS1C 4GW1A 4MS8C 4YXKH 3U0WL 2P45B 3HMWL 1TTCA 2KT6A 4FAAB 1Y1DA 2AF2A 4IRJA 3WFCH 1N59B 2VMEA 3QSKB 2AXGB 2VMFA 1KPRB 1MXGA 3MCG1 3TFKD 5KOVC 5AYTA 4DETA 3ZYJA 2HN7B 1K6QH 2MTAA 3OHXC 2IWKA 1DBJL 2UWEF 4K9JA 3TJEL 5ADPH 3WU1A 3VWJA 4QF1B 1M6OA 1BLNB 2NY6D 1SY6A 3HI1B 3CSYA 3QUGA 1SBSL 1AZVA 4S1DC 1HIMH 4JY4A 4K3JL 2XBTA 3QBTB 4HIIA 5DS1A 2FBOJ 4JRYA 1HZHH 1ZD6A 2FO1A 1N9PA 1BQHB 4RSYA 3VI4E 5KSVB 3ROOA 4J5VA 3P30L 1BYPA 4NNXA 4GO9A 1G9EA 3ME0A 3ZZQA 1OV8A 2VN6A 3L4WA 4AGPA 3OHMB 3WAKA 2Y5EA 1OHQA 1IT9L 3LKPA 1NFIA 3UTQB 3GFUA 2B15A 1QFWH 2A9AA 3CFJB 3ZTJH 3BD4A 2V5RA 4HS8H 3GNML 2FX8H 2RFXA 4L3ED 5DMIL 2C3XA 3UGEA 1DLHA 1N12A 3OR6A 5IHZA 4B7IA 3IJYA 1NSNH 4YO0A 1NLBL 3QUZB 2PCFA 1MCWM 2GHZA 3Q2NA 4Y4FD 3FFCB 3FT9A 3R18A 5LVEA 1EUTA 2BP0A 2GI7A 3MRFA 5IBUG 3EJYD 3PQYD 1OM3L 5A3ID 2LFGA 4K15A 1G6RH 4JFQB 2PR4H 3FAWA 5IB2B 2NTFA 1H3PH 4XMPH 1XB6A 1AS6A 1ZA3B 4O02B 3V6OC 3KEDA 4X4YB 4AH2B 3NFNB 4P46D 1K85A 3IF1A 1TZHA 4WO4A 3C09B 3DNKA 4ACTA 4R2GD 5AW5B 4NKMA 3S4SG 3ZW3A 1UA3A 3RX8A 4XH2B 4JN2A 2OS7A 5DHVB 1L9QA 4JRXD 2ZOOA 3I6KA 4DP2X 2KZBA 2QFPA 3FTGB 3P3UA 1PCXA 1NGYA 1BFOA 1N7MH 1C7TA 2DEWX 4NHCL 4KX8A 5T1KD 5F3BB 3MV7A 5H2BB 1WD9A 3R8BB 5I9QB 2GTQA 4XBEL 3TFKC 1MFAL 3D06A 2GTZB 5DRXA 4GXUN 4DO6A 4E9YA 4X98A 4EOWL 2J6EH 4ZUUA 1DJZA 9PCYA 1FNSH 1JK9B 1TZ8A 5FGCE 1UH3A 1Z0NA 3C6EA 2VDOH 3O8XB 5F7AA 4CU6A 2BZ7A 4FFTA 5C6PB 3GSRA 3X11A 2NY6C 4YR6B 4P9HL 3RGVB 2G5BB 1FL6B 1XIWC 4HS6A 3DBXA 1BM3H 3U0TB 5J3HD 3E7JA 4M62H 2AAVA 2APSA 4N4YB 2HTLD 4M6MH 3WEMA 2ADIB 4KXZI 2K6ZA 3B1TA 4YHPA 3CXFA 1F4WL 1NMBL 1U58A 5CN2A 2OMXA 3CNKA 1I1AB 3MHZA 1QBLH 1KT2A 3HNVL 5FYLE 1G9MH 2WKLA 4ETQB 2EIBA 1HI6A 4Z77B 3LEVH 4JQVC 2NZIA 3JUYA 4TVPH 3T3MF 4F24A 1G7MA 1HX0A 2AEOA 3DURA 3MV01 4BZ2L 3N43B 3S2AA 4EBQL 5AUMB 1BVZA 3T0EA 2B59B 3HS8A 2CRIA 4ZFFB 3LZLA 4RX4A 3BN3B 1DQTA 5TQ0L 1KBGH 1Y6KR 3LNIA 1OP4A 3BIBX 4OLVL 5LGJA 5JOFB 2Z35B 5DQDH 2NCMA 3VXTA 2W5PA 1DVXA 4JJ5A 3AZUA 1OGPA 5JPMC 1OM9A 2D2OA 1E4XH 3O2DL 5GZOD 4BFEA 3OKDB 3QXUA 1YNLL 2XY2A 3HZVA 4J3SA 4AVHA 2HKAA 4Z1PA 4Q9RL 3U9UA 1HSAA 1KC5L 2FIKB 5A3IC 4C58B 4OFYD 5K5YA 3PCYA 4UU9B 4XRCB 1P6FA 1LE9B 3M88A 4LVEA 3RILA 3G6JF 4U6HB 1JBJA 1BGXH 4P46C 5JXAH 3ZDYE 2W92A 3IS0X 4BSJA 4JG5A 2FYYA 3MAWA 4N0UA 4R2GC 1HQRA 2YFOA 5F88B 5DUML 5DCCA 4G8EA 4YDNA 4GAGH 1S3KH 4PRAA 4DUXA 3H4FA 4J4PD 4XVSL 1PMYA 5I24A 7PCYA 4LLUA 1QRND 1BOYA 2V17H 2PTTB 1S46A 3L3OA 5ELIA 3KWTA 3VUAA 3LZRA 4N8VG 5DD0L 2F7QA 1GC1C 4IRZH 2Q0ZX 1C16B 1FIEA 1VFAA 2XFGB 3RY6A 1RZ7H 2MCG1 4ZMQA 1SEQL 3FQTB 4RGOL 3EYOA 2EQDA 3KPPB 1U8IA 3MRQA 3QO0A 3IDJA 1KELH 1AI1H 4P3WA 1S9YB 4QRTB 3QDMB 4KJPD 3RZCD 4F8TA 4LGSB 5J3HC 1QBAA 5IMKB 1BIIB 6FABL 3PWLB 3KMDA 3JZ7A 1KXTB 2HTLC 1KEMH 3APNA 3JTBA 5B1CA 1RMFH 2J1WA 1BZEA 5E9DD 2XWJB 4OFPA 4FG0A 2ICWJ 3VD2A 1TVBA 2D3NA 1U3HD 1HQ4A 4OJAA 3KEHA 3SDCC 3I75A 3HG0A 4XBPB 2OTPA 4UCFA 1NC4A 5AG9A 3AT9A 3KNBA 3ZO0A 1NCIA 3MV8B 1KLGB 1JCVA 5GGSB 1GZHC 1WYJA 1TJHL 5HVFB 4PJHF 5IVZA 2VRKA 3HMXH 2LW3A 1Z9SB 3BJLA 2JKIS 3CVCA 2P8PA 3EH3B 3QI9D 4FNUA 4OI7A 1R34A 2CPCA 2KLTA 1QQDA 2K9FB 3I3EA 5GZOC 3GF8A 1OY3B 1WT5C 4L37A 4DGIL 1RZ8A 1W15A 2C4FT 2ZF8A 2HKFL 4LBEB 5H8DA 4MJ5B 5LG1A 4B7LA 4U0RB 3X3FL 4G70B 1BWWA 4MNHA 1CXLA 3R0NA 3SDXB 3TNMA 3FTWA 4OZFB 2WXPA 3O2WH 4O2EB 1AHMA 5C0FA 5KYUB 1WEJH 1KCBA 1ZDSA 3OPZL 1K4DB 3SE8L 1AGBB 3HUJA 4UV4L 5JHMA 5C08E 3FK3A 5HPMB 3AXLA 2G3NA 4R7LA 3M1BA 4JFDB 3WEBA 3NIGB 4NNYA 4M1CD 4HPHA 4J4PC 3PXJA 2MEJB 4P5MA 4LLQA 5GRZA 1U33A 4YX2H 2R29A 2OJ1A 2EDYA 2WB1A 4TNWK 3GMRB 2ZKHL 1MWAL 3ALPA 3SE4C 1GOHA 4BRVA 2FJGB 4HC1L 3AT0A 4TL4A 3RNQB 5T1LA 4WI7A 2CK0H 2O1AA 1A6AA 2X2JA 3BEWB 4L1LA 2CUMA 4PJ9A 4H88H 2XN9E 3T8XB 3O11A 2C5DC 4WFHE 3QIWD 3EDFA 3FF8A 3K6SB 4KRNA 4KJPC 1SHSA 4FNTA 3C60D 4Z7VF 3K1DA 1DBBH 2IG2H 3L1EA 4EI5B 4IRSD 4UTAL 3GI9H 3H9SA 2IGTA 1W72A 4Q4IA 1OXYA 2IH3A 3MMEB 1I82A 1TKWB 2I9LA 3G5XA 1IC5L 2L7UA 4HK3J 4YUEH 3ECWA 2VXUH 3L9RB 1NIDA 1EGJA 1R3KA 1IC7H 2B2XL 3L8QA 3QAQA 1EZSA 4IHOB 5K39A 3HZKB 5C71A 3KPOA 2P5WB 1MEXL 1JVOA 2WZ0A 1NKGA 3U48A 1MHHB 5DVKA 4ZG1A 2FYVA 4UUJA 2WN3A 1RCYA 5BZWB 4CBPA 3QNYB 4NDMA 1F11B 4GRMB 1Q1JH 1UWEL 4S10A 4P4RA 3N41B 5IB1B 3QI9C 5GRJH 1W0VA 1E9PA 4MCYB 4KTEH 1T04B 2P49B 4FTVB 4KZCA 5GGVL 2Q2LA 4YPGB 4YZFF 3QZWB 3CZFA 4NRZB 3MNWB 2X09A 2ZNXA 1OGAB 4DW2H 4PG9A 1WRFA 4I9WD 3L16A 1TSHA 5B38B 1TDQA 4NO5A 2IOMA 4UT9H 1L6ZA 2X70A 1OTSD 1TETL 3WFEL 1UD6A 4APQB 3VI4A 1XH3B 3ARED 2O61A 4WU5B 4NRXA 3MRKB 1I1RA 2CLZA 3DVGA 4WNQA 4ZT1A 1CE1L 3BIKA 3X12B 4N1EA 4OCRH 4TTDD 5DK2B 1UA7A 3L5JA 2DQGL 3QHZL 4U1IB 1ZIAA 4NQEA 4HKJA 1FV1B 4ZTEA 5JYMA 4Z7QF 2F58L 3STZB 2HMID 3VMPA 3FHQA