4V11A

Structure of synaptotagmin-1 with sv2a peptide phosphorylated at thr84
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
150
structure length
150
Chain Sequence
KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Phosphorylation of Synaptic Vesicle Protein 2A at Thr84 by Casein Kinase 1 Family Kinases Controls the Specific Retrieval of Synaptotagmin-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords SYNAPTOTAGMIN-1
total genus 42
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4v11A00
3CSFA 4A55A 3W56A 2ZKMX 1DJWA 4L23A 3APDA 3L16A 4ICWA 2D8KA 1CJYA 1GMIA 2EP6A 2WXJA 3L08A 4IHBA 4LT7A 3KWUA 3RDJA 2WXMA 1DJGA 3OHMB 4PS7A 5H4YA 1QATA 4ICXA 5CCHE 4F93B 2Z0UA 4XE0A 2KI6A 4Y1TA 3NZUA 4F1SA 3QR0A 4LDCA 4Y1SA 2K3HA 4XX5A 3T8MA 1TJXA 1W15A 4TV3A 2YRBA 2UZPA 3PRZA 4GNKB 2QZ5A 2LHAA 2WXHA 2Y3AA 3TJPA 4QJ5B 3HIZA 3IM1A 4HVBA 3P2BA 1DQVA 1WFJA 3PS6A 1BDYA 2WXLA 3ZIMA 4FJZA 4TS6A 2CHZA 1E7VA 2K4AA 3QR1A 2FJUB 4L1BA 4FADA 4FULA 2K8MA 3QAQA 3F00A 5KJ7E 1E8YA 4OVVA 2YOAA 1DJIA 2WXKA 4EZJA 2ENQA 3L9BA 4FHKA 4NPJA 1UGKA 2WXPA 5H4ZA 1BCIA 2R83A 2V4LA 3R7RA 3CSTA 1UOWA 3NZSA 2WXOA 3F05A 3MJWA 4WWOA 4AOFA 3TL5A 4ANVA 2JQZA 2CJTA 1RH8A 3SD5A 3PFQA 1WFMA 1HE8A 4F91B 3R7QA 4NP9A 3NSJA 1K5WA 1DSYA 4QJ3B 3RPBA 3TWYA 2N1TE 4G11A 3M7FB 4MJJA 4NS0A 1E8XA 1E7UA 3PYCA 5T8IA 1QASA 4PS8A 4EZKA 3F04A 5CCJA 2QZQA 2WXIA 1V27A 2FK9A 3APFA 5G55A 3L54A 2NCEA 2CJSA 3B7YA 2NSQA 4GB9A 1UOVA 2WXRA 1TJMA 4FHJA 2ISDA 4DNLA 3APCA 3QJZA 1DJHA 2DMGA 2K45A 3FBKA 1E90A 2CM5A 3L4CA 4KZCA 3OAWA 2X38A 2CHDA 4LCVA 4F92B 4QAMB 2BWQA 4NPKA 4WWPA 4JPSA 1YRKA 4EZLA 3L17A 4J6IA 4L1LA 3PREA 1DJZA 3ZVVA 4PS3A 1DJYA 2WXGA 2WXFA 3L13A 3HN8A 4HLEA 3N5AA 5CCGE 4BGDA 4ANXA 3ZW3A 3LJ3A 4V11A 3KWTA 1E8ZA 4WWNA 4WAFA 3ML8A 3S2AA 5JHBA 3F01A 3W57A 1A25A 4OVUA 2NQ3A 1E8WA 2ENPA 4ANUA 3FDWA 2A5UA 2CHXA 4L2YA 4FA6A 4QJ4B 1W16A 4URKA 3DPDA 5JHAA 2Q3XA 3HHMA 1DJXA 4FLHA 2CHWA 4BFRA 4DK5A 3ENEA 2ENJA 2WXNA 4XZ4A 2B3RA 3ML9A 2RD0A 1RLWA 3QK0A 4WEEA 1BYNA 4KITB 2CM6A 4AJWA 4FJYA 3DBSA 3JZYA 3GPEA 4TUUA 4ANWA 1RSYA 3QARA 3IBEA 2WXQA 5EDSA 4KZ0A 4IQHA 5G2NA 2Q0ZX 2DMHA 2A4ZA
chains in the Genus database with same CATH superfamily
4OZHB 4DGVL 4QRPA 3CSFA 4Z3TA 2WWMD 3PNRB 3GO1H 2YFOA 1A3RH 5TGBA 4OUUB 32C2A 2Z9TA 1UOKA 3DTUB 4FHBD 3TS8A 2M1KA 4TTGA 4PB0L 1FFOA 4DESA 3BRFA 4JMNA 3CFKA 5IW1A 2F58H 2IBGA 4XC1L 2VMCA 3DX2A 1J10A 4MAYB 5F7YC 1KPVB 3TCTA 2F8IA 3SJVE 1ZVHA 2QGBA 1TVHA 3T0EC 2ZNXA 1Q9KA 3QUYA 4Y19B 3HRZA 5C09E 1OD9A 3JBG7 1MSPA 3BWUC 3X14A 4HFWA 3NK4A 2CJUH 1N6QL 3KPPB 4ELKA 4LE8A 3HE7A 1XCWA 3BH4A 1CICC 3FYEB 4NUJA 3CD4A 1B0IA 4CMMA 1TTAA 5DJ0A 3S3CB 4ETYA 5A2IH 2A9ML 3ABGA 1NCCH 1HIMH 3LKPA 2RB8A 4X99A 2OULB 2VSKB 5EZJA 4AQAB 3HMWL 1CD8A 3IFLL 2XQYG 1CWVA 4NP4H 3FU7B 4BDVB 3B2UD 3I3EA 3X11B 1D9KB 1WTGT 1VGEL 4BBWA 3U2SB 2ZG2A 2MTPA 1DFBH 4RIRB 5HDQH 1X3DA 1JK9A 3DSFH 5AVVB 4HC1H 4GAGL 3JWOL 4I48A 2FL5A 4FQJL 2Z31A 1LK3H 5CBAB 1BQHG 4MA8L 3BQUD 1T03L 1R3IH 4MMXA 4N2OA 1XZ0A 5AVZB 1IC4L 2Y06L 3SO3B 3H7LA 3TH4T 5HGHA 1BIHA 1QSFE 2WANA 4GW4A 4ZS6D 2H1XA 1C16A 3HAEG 3MBXH 1JDAA 4JKNA 2O30A 3SDDA 4C4UA 3FS9A 1MCIA 1PGRB 4LXFA 4PJ5A 4YDNA 3TZVD 2VDKB 2BNQD 3Q6GH 1L7TL 2M83A 4H1LH 4ZUUA 4Y5YA 5D1QE 4DQOH 2F9BT 4WO4A 5GRXG 3Q2CA 3FT2B 2B0SL 3O9WA 4I3RH 5F9WB 2QJDA 1Q72H 2ZXCA 4JRYA 4UYPA 1VZHA 2VGLM 5C07B 4PGJA 3BAEL 1WHPA 2GC7C 1BMZA 5IFJA 4PGCA 2JB5H 3G6JE 4JM4L 2WINA 3VXSA 4YHYC 4L8CB 2OSXA 4HIEA 2NNAB 4JRXD 2GT9B 4LESA 1X5XA 4PWGA 1CXIA 2O6CA 4B9YA 4EI5D 1OSZA 1JHKL 3MFGB 3QDJE 5AKTA 3SGJC 3P40A 1NGXA 4NQCD 2FATH 5A2LH 3VM7A 4PUBH 2GAZB 3R06A 3PP4L 3SCMC 4N20A 4Z7VB 2JKJA 4JY6B 3KXFB 3QW9A 4KVCH 4PGEB 2WUBH 2JCCF 2B7DT 5MHSD 4JFDE 4TS6A 3QA3B 5C0BE 1O6VA 4TRPH 1YY9D 3DX7A 5BXFB 2WN2A 4PJ8D 3UADA 3DX9A 2PF6A 4JFOA 1QD0A 2DQEL 1FRGH 1FWXA 1NCTA 1QVOB 3TCLA 2QHRH 1RZIB 4FFWD 4QRFA 4LOFA 3EUUA 4H0IA 3M07A 4OF0A 3TT3H 1YPZB 1AIFB 1QABA 2E7MA 3QG6B 1ZMYA 5GZND 5D93B 2FHCA 1H3VA 1FPTL 4JHUA 5TDNA 1CDIA 2HXAA 3KJ4B 5ERWA 5EH1A 3BAWA 5KVMC 4X4ZA 2XACC 3BEWA 4WO4D 5ALCL 4IS6B 3O6FD 1U8HB 3O4LB 1NCJA 5C0EB 3T8VA 4F57L 3IJHA 4EOWL 4W6WB 4L9LB 1PYWA 2MOGA 3MRLA 4EBQL 3WY2A 2DLGA 3ESNA 3D9AL 5JW3L 2NPLX 2WYIA 1NBVL 1H15B 4PRHA 5KYUA 1SLXA 1NL0L 2JJSA 2GJRA 4P46B 1CICA 2EO7A 1FH5H 3LDBC 1OTSC 3L6FA 4KJQD 2L4OA 4PFEA 4ZUVA 3MXWL 4Z18A 3GS7A 2EEXA 2I69A 4QR7A 4WSKA 4QRSB 4WAFA 4PRPE 5DWUL 4OUUA 3D5OF 1I1FB 4PY8J 1TZIA 2VDQL 4S0TD 4YR6B 4K7FB 5CP7A 1JZ2A 2NZ9D 4P5TD 4I9XA 4ZXBB 5CZRA 5HHOB 4JFEE 2BW5A 4XXDB 1UXWB 3MUY1 1WAAE 1ZLUH 2R2HB 1KYDA 5INDB 4GSUA 3VDCA 1OAQL 3PNWB 2R1YB 5FO8B 3HI5H 3UJTL 3OF6A 1Y7VA 1TDQA 2V8LA 5TTRA 4A2MA 2XPGB 3P77B 1KWGA 1OALA 4XNZC 2IH1B 2WTPA 3D08A 1U8MA 2R7EB 1A2YA 4XVJL 2DMBA 2CBMA 4OF3A 5AW4B 3KVQA 2XG4A 3V4PA 1J8HD 2D73A 4WKZB 4X4KA 1I3UA 1AI1L 4ESKA 1L9MA 1YZZA 4XPAH 2FJFB 3QO1B 1QBLL 5EZJB 4AIEA 1T2QL 1N0LB 1BQHA 2OFQA 3K46A 4BDVA 1C8QA 1R5IA 4PR5B 1R19A 2R15A 4X6CE 4TSCH 5KOVC 3P0YL 1W15A 3P3RA 4OLYH 1X9UA 4RETB 3RUGE 5CFAA 2YN5A 3VFNA 4TULH 4K55A 4WJKB 5E8DH 2BIPA 4NKIH 3OF6D 4R26H 2Q7YB 1CFVL 4HW6A 3UEQA 1OAUL 1MH5B 3ABLB 4JFDD 4HKBB 2IDFA 2QPDB 3RKDD 3REVA 4OGYH 5E5RB 4R7LA 4JN1H 4N22A 2X6AA 4XXCC 2VLJA 2MQ0A 3K8MA 2ZE0A 1JI2A 3BISA 2WNWA 1BF8A 2V4LA 1CTOA 3BC9A 3AQDA 1UOWA 2ICWJ 1UD4A 2NNRA 3S8FB 1RZJL 1FNFA 2J1XA 2XWDA 3N04A 2CJTA 3E3QE 5E9AA 3ZDWA 1KDJA 3FU9A 3RTQA 3COOA 3IB4A 2NR6A 3NCEB 3PWPB 1F3JB 4OIIH 5HYQA 3E38A 3ISYA 5EU4A 4JPVL 4PJEA 4YXKL 3GBML 3QJUB 3O9WB 1FC2D 1ORSB 4FLRA 4OZIE 2A73B 1AKJB 4KMLB 4XNMA 4Z7UF 5KVGL 5T3ZD 4LB8A 2ZYSA 3HMXA 4S1DD 1RUKH 5C07A 3VFMB 1E90A 3OAWA 5GZOC 1LILA 1MELA 5AW3B 2ZOOA 5KOMC 2E7BA 5AYUL 5KS9A 4UM9B 3AT0A 3FB7B 4FLOA 1XCXA 3FUMA 4LIQH 3GSXA 3TEUA 4HKJB 5AWNL 2GBTA 4XVSH 2XWXA 1SM3H 5GZNA 4IRJB 4JM2B 5F3HA 4ZG1A 1WK0A 1AZRA 3H1ZA 5D70L 3GEFA 3ZKMC 5KVEL 3BWAA 1F4WH 5E9DD 3MC0A 4GO8A 2J2ZA 2W65A 4D8PB 4OBRA 4GXUM 4LNRA 1MHCA 3ZYZA 3VFRA 4TLUA 2BDNH 4XWOC 1DBAH 1TJIL 3EG9B 3PLYA 3RJQB 1N2RB 1OO2A 4Q6KA 1EO5A 4LHQB 4LMQI 4OB5L 2WQXA 3QUZC 1JBJA 2O5XL 4IEFB 2WWMC 3AREA 1MZYA 1RZFH 4QRRA 4GOSA 2YJLA 2X4NA 3S34L 3F8UB 4APXA 3QO0A 5I0XA 3KEDA 3NFPB 3W81A 1WHOA 3SE4A 1KULA 1QPPA 3MRGA 2X3AA 1TPXB 2IH3B 3HE6B 2EH7L 32C2B 3SY0B 5I2IB 1NGYB 1ACYH 1NCHA 4PJCA 1JMZA 5B4MC 3HMXH 2C1PB 3TYGH 3AGVA 4P2OB 4NSKA 5CCHE 3CHSA 4ETQB 1WAAF 1U33A 5GS1A 3IETA 2AKRB 2BIIA 4FA8A 5FFLA 2WIMA 2CIKA 2CO4A 4KU1A 1WP6A 5EEWA 3PIQA 4WI4A 4Y19A 1FF5A 2C3GA 4XMXA 3B4NA 3VXTB 3C6LA 4BV1A 4YFDB 2YUWA 4EXKA 3SBRA 2GQHA 1U8KB 3BP4A 1SJEB 3FQYA 2X4UB 4JM0A 5TDOA 3GBNL 1N5AB 3T6ZA 4G1MA 1VESA 1HSBB 3SBWC 4JO4H 2UY7A 4TUJA 5FYLL 4G8IB 2YOAA 1E4WL 5IB3B 2D9QB 5EBWA 4BUQA 5FM8A 1UGKA 3WEXA 3VI4B 1E9OA 4OD3L 4NOBA 2UXTA 1AIZA 3SDCA 3H6AA 1I1FA 5LGJB 3S0PA 1FLRH 2P47B 1AZBA 4PRAA 3N1PC 5KBDA 4U1SB 5DCCA 1TYRA 5K39A 5DVLA 4LARH 1L0YA 4N8CH 3EYQC 4G82A 4A63A 4KO7A 5GGSY 5T5FA 4X6DE 5EIIB 3CH1B 2Z31B 1F13A 1FDLL 2IPKB 3MKKA 2ZG3A 3BAJA 3ZE0B 1MUJB 2JKXA 4XNXL 3RL2B 5DFTA 2E7LC 3JWDC 4AIXA 3QJOA 1PG7X 3P77A 1J0KA 4ECNA 1NIFA 4LL4A 1T2JA 1LO5B 1A3ZA 5C0JB 3LEYH 4S1RH 3PREA 2V5RA 4I8DA 3P3TA 1RHHB 4XXCA 3DJRA 5CZVL 4XPBL 3HG0A 2PP9A 3LIUA 1KTDB 3U82B 3O6ML 3N1GC 5AOIA 2NR6C 4NZJA 4N2KA 3IVKB 3VD4A 3P02A 1EBAA 4ZUTB 4JO5A 3UEZA 4G71B 3NIDF 4IRSC 2X4QB 2YMXH 3NZHH 2NY3C 4QY8B 1J5DA 4P46C 2NSMA 4B0MB 1ACZA 1SJMA 4UOW0 5IFJB 2VXUH 5ID0B 2MKWA 1USQA 3MRIB 3CVHB 4OZ4B 3RWGB 2A6IB 4NC2B 4EI5C 3BHBB 3DURA 3Q2VA 4YL9A 2Q7NA 4IBWA 2EE0A 5I6KA 4D9RD 2VLJB 4TNEA 5JXEC 1DQMH 4HISA 3HTLX 4NQXB 4HAKA 4RGMC 4NRYA 2DTML 1NOAA 3B6SB 1WWAX 1NC2D 3GLZA 5BV7B 3QRBA 2EIKB 1A7OH 1I7TA 3H3BC 1Z3GH 1P1VA 3KLAB 4I5BB 4MHHI 2KI6A 3MR9A 4BWWA 2WZ5A 5T1MB 1PZ3A 4KHXL 5EIVA 1BD2E 2OQJB 3FT3A 1I3GL 1IC0A 1IGIH 1WG3A 3HS9A 1P6AB 3PRZA 4HUKB 3QI9A 4ZAKD 4O2FA 5J0BA 4GAFB 3BIKA 1WFJA 4PJAB 4J2QA 4XNMB 3TN0B 2J43A 4FYRA 4Z3IA 5E2TH 2Y2WA 2F5AH 2F8VA 2E8YA 4YIQA 1HILB 4AENB 2CLZA 2R0ZL 4I3GA 2EICA 3I9GH 5E6YA 3MLXH 3KPSA 3MLRH 2Y72A 2NDFA 1RFDH 4HKJA 1X5JA 3NZSA 3ARBB 3DMMB 5ERWB 2APVA 3LRGA 1ZGLA 2D7NA 4XXWA 2FUQA 4FTVA 4NP9A 4QRUA 5K9QI 2CLRA 1FLTX 3DBXB 4HEPA 3TCXA 3TP4A 3CFEA 4FQ2H 1DUZB 4M00A 4OGAD 3CVIL 4CC4A 3FSVA 4GLRI 1ZT4B 3FCUB 3HI6H 3LKNB 5B38B 1EJFA 4PJ5D 4YHNA 1KB5L 5TF1L 1FHGA 4WHYG 4AX3A 1QLEL 1A4AA 1OF0A 5DVNA 1K9TA 5T1KD 5BVPL 2BY2A 4HU8A 2P5WD 4P9HL 3AU1B 4A66A 4LCVA 2XTLA 3MRPB 1P5UA 1E5BA 1A7QL 3GK8L 2BCKA 3HC4H 3ZKXC 4CADB 1EMTH 4B9JA 5IESL 3T2NH 5K9KA 1RSFA 1M6OB 2DH3A 2WQRA 3GTVA 3CN0A 2C1PA 1CVRA 3HG1B 4L1SA 4K7PY 4HIJB 4QT5A 4D7BA 1HAUA 4P8QA 3F6LA 3S35L 3EW3B 3ROOA 4OCXL 2C1OB 5F1NB 4MASA 2A5UA 3UZQB 4ANUA 3BUDA 1C9SA 2BWIA 3AXIA 5KUMA 4WW2B 4FMKA 3PUUA 2BINA 4XN1A 2YBRA 1KTBA 2H1LM 1CZ8L 1FIGH 1Q0YL 1VACB 4JO2H 3NG5A 4ODHL 1U8KA 2CA3A 3BP4B 3HI1A 2WQAA 1U8MB 3RLSA 1JZ5A 2GTWA 3CHOA 5B39G 1TNMA 4J8QA 4R5XA 3QFDA 5I82A 4JDTH 4RZCB 1SOSA 2KZ1B 3UAJA 4Z7WB 1T89A 4Y19E 4OLZL 2G9HA 3MOAH 3G5ZB 1FA4A 1NAMA 1D5IL 2OTWA 4KK8D 4FTDA 4NBYB 2JNZA 3U9UB 3VI4A 2DQHH 2VXSH 2D7PA 3V6BR 1MPAH 4N2CA 1VFOA 1VKXA 3FO1B 3QXDB 1Y6KR 4WWID 5L8JB 2YN3A 3REWA 5EOTA 1AGDA 1HEZB 4M29A 4KKBD 4XE0A 1TQBC 2DQFB 4O02H 4OCWH 5KVFH 3VW3H 1S2EA 1S4IA 2LLNA 3GSVA 1T7YA 3JV5A 3IU4H 4I0PA 1H6TA 1NH6A 1J1PH 4LVHC 4N0FA 3SE9L 1HQ4B 5J11B 3BI9X 2YSSA 2EYRA 4XGZA 1K5NB 3RX7A 3RL2A 4ELMB 1CPUA 4WTQA 4AIOA 4QRQA 4E5XG 1I8MB 4JR9L 5LKNA 4CMHB 4NIKB 3KPNA 4RFNC 3MV7A 5CMAB 4KXCA 4NOFA 1QI3A 1KJ2H 1JF1B 1X44A 4LRNH 1OE1A 3O2DA 3FQUA 2NY5H 4JG0H 5SX5K 3TJHC 5HYQB 3QQDA 4GAYA 2EVHA 4L5FE 1CT8B 2Y7QB 2ZSVB 3JV0A 3WNNA 3S36X 2B77A 1KLUA 2CDEA 2ZKHH 3LPOA 3QT2A 1EDQA 1YUKB 3NCFB 3ECBA 2H26B 3ARGD 3GFUA 4ISVB 1F3DJ 1EH9A 4XCNB 3D39E 3OKYA 4J6RL 4IW4C 1QP1A 1L7IL 2XX1A 2P5EE 4G42B 4JO3L 5KJ4A 1RJCA 2ICCA 4LDLB 5GRJH 3NACH 2E47A 1IGYA 1FQ9C 3KYNB 5K1VA 3MUZ1 4MJ5A 1TMQA 1IL1A 3LV3B 4JFTA 3QXWA 2A4EA 2XC8A 4WUUD 1KXTB 4X0KA 4I13B 5E4EC 3CZLA 5HYSB 4NQCB 5CGMA 4ENEC 2HJKA 3DA0A 4GXVH 2A6IA 1V3MA 4YZWA 3TBVA 5KSVA 2QQNL 1BQUA 4L1LA 1G7PA 1AHWC 3MQIA 1IZJA 1IBFA 2ZWZA 4E42B 1WUZA 3F58L 3EH3B 2FJHA 4PWKA 3C8KA 3LPWA 4IU3B 2AJUH 4RMUA 2J2ZB 5DRWB 5D7JD 1WIUA 3ZE2E 2JK5A 4W9GC 4WI7A 5F6HJ 4H8WH 2IBBA 1ZS8B 3MR9B 3DK0A 2C5DC 4Y9EA 4DKEL 4DOHE 1VAHA 2GABA 1DBML 3IKKA 2DQTH 4KJYB 4G8GA 4P57A 4PB9L 3S3PA 3ULSB 3WEMA 3BAYA 1IO4C 4TLTA 4OJCA 2R51A 3RWFA 3AREB 3CDCA 3ZTEA 1T20A 4DVRL 4JFWA 1VFBB 4APXB 4PJXA 3MCKA 1OP3H 1A0QH 1HNGA 3OKDB 3BO8A 5HYJE 1FCCA 3H55A 5K93A 2OV0A 3BFOA 4R3SB 3LTVA 2GFBA 2WLJA 4NCC1 5D1ZI 4QXGL 3TT1H 1IGJA 5C7ZA 3QQ3B 1CL7L 3KPSB 2CBQA 3OR6B 5IY5B 4NSKB 5KYYB 3WG7B 3OHXA 4ETQA 4MA7H 4ICWA 4KDTA 3T4YB 2DTSA 3A6BH 2O61A 2ZUXA 2P8PA 1FBIL 3PGFH 3GSNL 4PWFA 4X7SH 4EUPH 3ZT5A 1JV2A 4FZ8H 4L5FH 4J4PC 5BS0D 1XH2A 2EKSB 1C5BH 3VXTA 2AF2A 2ZZUT 4XBGB 1AP2B 3ATDA 2GUYA 4PV9A 1EV2E 2X4UA 1WT5A 3LH8A 3S4SG 2YEZA 3QIUB 1PIGA 2W9DL 1GOHA 4WSGA 3WDIA 3DNKA 4Y2LA 3QWRA 1FNSL 3BIAX 1RIHH 3U2JA 2WLIB 3WS6A 3O9WC 3BUYB 4IIZA 1WWCA 3GMRA 3RNQA 4Y8AA 4U33A 1HEJC 3H42H 1CR9L 5LGJA 3OXSB 3ABKB 4U0QB 5D7JA 3LD8C 1NKGA 4PRAB 2XJLA 1Z9MA 3GSQA 4FXKC 1I82A 3HG1A 5DS8A 4YXHL 3PGCB 3UPAA 1OAKL 5DMJB 5MERB 3HG1E 3VFUA 4A04A 4NS0A 3CFIC 4XNBA 1RZKH 1N68A 1D2PA 2D3VA 4WW2A 2HVJA 3MJ6A 4F15B 1NAMH 3HS8A 4QTIH 3RVTD 4K15A 1KCKA 2NCEA 1JZIA 3FB8A 1WRFA 1PLGL 4A2HA 2AXFB 2ADGB 4KTEL 5H94B 5DFVD 4UT9L 5EMYA 1JGLH 5DO8A 4ZMVA 4Z7WA 1D6EA 4Q56A 3RG1C 4H25B 2NXZB 1WBZB 2ZOUA 1WEJL 2YPLB 3GSWB 5KSBF 1MAML 3WS3A 1M42A 2DI9A 1GW0A 3GI8H 1ZAGA 5I19L 3OL2A 2ITDA 2VZSA 4HV8A 1MRFL 1WT5C 1GIGL 5I1JL 3LEVL 2VLMD 2X4QA 1KELL 1A6TA 3GIZH 2P42B 2ZX6A 4LLUB 4I0PB 2EDEA 4JG1L 3ZL4H 5DJ2B 1BZEA 3QNYB 3QK0A 3JVFC 4OLWL 5I17B 4NZUL 2Z4QA 3LZPA 4IGBD 1H8NA 3BH8B 3FFOA 4HDIB 1NA8A 2B16A 5E5LA 4WQOA 3K2UH 3D3VE 3TIDB 1AHWA 5D72L 1UCTA 1J0YA 3AY4C 2DS4A 2VN6A 3B6SA 3GIVB 4OLXH 4G70B 3ZN6A 5A6IA 3APDA 4WW2C 3FTXA 3FU6A 4W9CC 3RDJA 4NBZB 1V54B 5TD4A 2EDMA 4WUUB 1TCRB 1TVBA 5B8CB 4OZIA 3H3PL 5DHDA 3MTRA 2NYKA 5FS5A 3DX3A 4RSVA 1RMFH 1BVLB 3PHOA 2VL5B 2WJ5A 5DJCB 4MNGA 1ZY9A 1ZVSB 2V0AA 3L2NA 3QG7L 1ZHNA 3IDIB 2OSYA 4YIQB 4AENA 1GOFA 5HYSA 2P5ED 4JPWH 4LLDA 3VGAB 5DZLA 4R4FH 3OX8A 1G1OA 4P5KA 1BFVL 1FO0L 1UD8A 4QOKA 2VRKA 5EWIH 5F3FA 5K33A 4UTBH 1X9RA 2J73A 5E8NB 4BHUA 4GQ9L 4ONFH 3OHXC 2YXWA 4DPAX 1OM3L 3P9LA 1M57B 3CFEB 5A40E 6CGTA 3DETD 1INQB 4XHJC 3ZXAC 4OCRL 3IBOA 3FB6B 3DUUB 3RIAF 1BWMA 2ZAIA 4HKXA 1KFAH 3C08L 4ODSL 5LCVH 2FLRT 2Z64C 3UERA 4KJYA 3ULSA 4P57B 4TOYH 4ZFGL 2FK9A 1BZDA 4TVPE 1MNNA 1FFTB 4WO0A 1MAJA 3INUH 1CLCA 2K0RA 1QUPA 5EC1A 1C08B 3QEQE 4QO1A 5D7IA 5HJGA 3U7YL 5ESQA 4IBLT 1E4KC 2Y36L 1GGBH 2JB6A 4PVLA 4FI8A 2GFBB 3MA9L 4HS3A 4KH2A 4MQXC 43C9B 4ELME 4G8GE 2CJ3A 1E4XI 3IN0A 1G0DA 2VSMB 1IAIM 4OF5A 3A24A 3AMKA 4U0RB 1FAKT 3ILPA 4GPVA 3UBXI 5ICUA 5DUPH 3L7EB 4TSAL 4JDZB 3GXPA 4LLQB 1AQMA 5T1DH 4WHDA 4PJFF 3GZPA 5BRQA 4AEEA 1JP5A 3HCVA 4XZUB 3RIFF 1JZ8A 5JHAA 3VI4E 3NDZE 1A7PL 3QGVA 4QHKI 2GTWB 1G9ML 2FH8A 1M4KA 3UYOD 1HI6B 2EDHA 2YEZB 1IILE 2P8MB 3QNZB 3ZTCC 3FQRA 5JR1H 2DLFH 2FLBT 2P7TB 3CSYA 1CXKA 4LMQE 1U3HD 4UUJB 2J8OA 1QW8A 2GY5A 1G7JB 3IJSA 5ENWB 5G4MA 2EUXA 4XP5L 2VR8A 5E4EB 2UZIL 1ADQA 4QHNB 1AZVA 5G2NA 4YSUA 1AY1H 3GMRB 1HXYA 2QQLH 4R7XA 5HVGB 2VMFA 4GMSL 2VMJA 5ADPL 4L4VD 1OK0A 4PRHE 1FNEB 1NKRA 4GKNB 3REWB 3OR7A 3L3JB 2VWEC 1QA9A 3F12B 3HS0C 3L5JA 1HYSC 4X6CB 3TYFB 5CXPA 5GIRA 3MSPA 4UQEA 5HDOA 2HVJB 3HR5B 3L3KA 5D2NA 4W93A 3CWGA 5I8KH 4MJIA 3SO5A 1W72A 1NICA 2E27H 2XY2A 3A23A 3K0YA 3OBAA 2WLLA 5D96C 5TE6H 3RIKA 2F53B 4KK9C 3BP5A 3VD1A 4I2XA 4HCFA 2SODB 2VZVA 3MV7B 5CMAA 1TJGL 1B4TA 3VD0A 4S2SA 4E0RB 3HG4A 3H9SD 4HXAL 5AYTA 5AL8A 3U6RA 4L05A 2AHIA 1CG9A 1J05B 3BGAA 3GNMH 4FNSA 4NRXB 2MFNA 3SDYL 3V5DB 4Q58C 3WS3B 2Y7QA 5EF1A 1SUHA 1H5BA 4NO0A 2XV6B 1VDGA 3D4CA 4G6JL 2AJSL 1JD9A 4TVUA 4C56A 4HFUL 1KJ3L 2F0CA 5GGVY 3VI3B 1UJTA 2K7QA 2EEDA 3I3BA 3DJTA 2QT6A 3ES6A 4PJFA 1J1XH 3DV6B 4PCTA 2C7UA 1B3IA 5FYLE 3RVVC 4X0KB 3ARUA 3TA3D 2AQ1A 4WFHD 4P2QE 2ZNWA 1XGPA 2Z91A 5KSVB 3VCLB 3BZFB 4GB9A 1UOVA 5I28A 1EANA 3QZPA 1WFUA 4GRMA 4N2DA 4L0ZA 3PHQB 3LD8B 5TPWL 1G7QB 4OFPA 1O5DT 3QEQB 1G9MC 1DJYA 1XEUA 1NJ9A 1OGSA 4N2AA 2BW4A 3ZW3A 3AVEA 4F58L 5C6WH 5F0JB 4S0HA 1REIA 3MV8A 3O4LE 4NC1E 4WUUA 3DDGA 4N85A 1E8WA 4Z0BL 4J28A 2PCPA 2KS0A 4LLAA 1RD6A 4P2QD 4U6HA 2YQ3A 1AS6A 4J3OC 3VSTA 4MDJA 1EDHA 2VL5A 4X5RA 4EDWL 2FBJL 4K23L 1OXYA 1PS3A 5DJCA 5IB2A 4P2AA 1C5CH 3SYPA 5EC2B 4RMSA 4X7CC 1A9BB 3Q43A 5HD8C 1WITA 3BGFB 2XQBL 2IAAC 5AOKA 2JJSC 4I3SH 5J11C 5CINH 1BLIA 1V7MH 3U4BH 2CCWA 1K72A 2P8PB 3PE9A 2BX5A 5JOPE 1RV6X 1WBXB 1TZHB 4NB7A 5IR1A 1F11B 4EDXA 1ASPA 5ESAA 3VI4F 5I1KL 3QUYD 5K9OA 5L6YL 5KVDE 1KTCA 4DGYL 3UPRB 1BM7A 2VN5A 2VXTH 4B9PA 4MXVF 2C9XA 1E43A 1MCFA 1CIDA 3ZO9A 1U95B 3WHE0 5CJOL 4UT7H 4L8SC 3QDJB 1AKPA 2VQTA 5F6HI 4O4YL 4AQEA 2RAMA 3GHPA 2EDBA 4BFKA 1F97A 1F90H 2XZAL 1B2YA 2OTPA 1E7VA 2CG9X 4F80A 2GSGB 4XN8A 5I23A 1TZAA 2VXQH 2PTTA 5FFOA 4WHYH 3GHEH 4X6BA 4AH2B 8CGTA 1KIRA 2VMEA 1U8OB 1P1ZA 5FDWB 2P80A 1JPTL 2VDPL 5GGVH 4GKSB 5ABZA 4NPYB 1ET7A 1HZHH 1ZTXH 5CLTA 1DVFB 1I3VA 5DZNA 1UKTA 4B7LA 1G7MB 2HWZH 3VFUB 4M93C 5IBUG 1XGYH 5C09A 4XVUD 3V0IA 1YNKH 2EYTB 1LE5B 3GGWA 1ZGLP 5CEZH 5BQDA 4N0UE 3CX2A 3D50A 5D55A 2N1TE 4Z95L 2PCYA 1CTNA 4M1GH 3EXLA 4HPOH 1PD6A 1MDTA 2OMXA 4BZ1A 3EO0B 1TYJA 4BKSC 4WO4C 5DHVB 3VGAC 3HZYA 4AGLA 4HT1H 3L54A 1E28A 1WFIA 4HJSA 4PJBF 5J13B 2XSKA 4EZMA 5IQMA 3QFJE 5I76A 1JVKA 1JF6A 1WBYA 2PXYA 3NIGB 4ODXB 2YPLA 3GSWA 4F92B 4QHNA 2DKMA 1I1AA 4JCMA 3AG3B 1IRAY 1HXYB 2Y6SD 4AJVA 4BQBA 3MA7A 3P4OA 1FAIL 1N4XH 1WD8A 4NRZA 4LBEA 2CUAA 3WY4A 2RR3A 4HJEA 4L3CA 3RA7H 1S7UA 2EDRA 1QTSA 3GSRA 2WLHA 4YBLC 3BLKA 5D7LB 4XOEA 2F54B 3V4VH 1G6VK 2DI7A 3E9UA 4AKPA 4WZ9A 4CSSA 1FL3A 3HHSA 4LCUA 4LLUA 4OV5A 1E4JA 2YAOA 1DEDA 2BXYA 2Z1PA 4HJIA 3ULUH 1QUNA 2GTZB 4JG5A 4M1CC 3BDYL 4E41D 3N0PB 4NZRH 1A3QA 2GKIA 4JW3A 1HWWA 5CSZB 1XF3A 4CVUA 4KHTL 3KM1A 1MCLA 4B9GA 1MREH 4GSDH 1VADB 1JFHA 5KTEH 2F53A 2GJ6E 3BP5B 4FTVD 2X6CA 3B34A 4CKVX 4HC1A 1E40A 4DHLA 3DDFA 4JL1A 5F7FA 4JY4A 2V3EA 5C2BL 1BBJB 1R0AL 1YYLH 3OLIA 2NSXA 4PJXF 4WF7A 5GHWH 1KBKA 2KYIA 4NRXA 5JIKA 1URLA 3TFKD 5LDSA 3DPBB 5JNYB 1NMAH 3CHXA 1J9QA 2V3DA 5I6PA 2VH5L 3IFNL 4Y2NA 2YD6A 2EP6A 3CTTA 1LJMA 4YXLL 2CBOA 4J3TA 3IS0X 4ZX6A 4R2GB 5DQJA 5FKPB 3GUTA 1OM9A 3DTXA 3V5KA 4AEHL 2OR8A 4RVBA 4RNRA 2NY6B 5B38G 4ZBJA 1J8KA 3BWZA 1CCZA 1FYTE 4KKQA 1BOGA 4ALAH 4G5ZH 2I25N 3SPHA 3DXAD 3VCLA 1KB9J 3N1MC 1A6AB 3HPJB 3GJEB 2R4SH 3SD2A 3CFBA 4F15C 3A6CH 2H47C 4G8GD 5CKAA 2D31A 3PAZA 2NY7L 3ZIYA 4NX0A 3BH9B 1DJIA 4Y2DD 2AXHA 2IPTL 3JV4B 4RAVB 4FHKA 3ESPA 2WBJD 1INQA 1ITBB 2YXVA 4BRJA 1BQRA 2BSRA 4MRBA 5C0CA 3FQTA 2KQMA 4YDZA 3DUUA 2X4PA 5BZXA 3UC0L 5C6PB 1A1MB 3APMA 3KPLB 5KYXB 4Y2OB 1UFGA 3T8XB 3WMSA 2ARJB 3GEWB 3GXDA 2COQA 5B22A 3ZE2B 1N6VA 4Z1PA 2RCSH 4R84A 2Z7WA 4UIMA 1C08A 3GKWL 5FFGA 1CL7I 2XN9D 4N87A 1CURA 1QPKA 1YEWA 1MQ8A 2XDHA 3WSQH 1U8LB 1UACL 1CD9B 3GSNB 3NTCL 2AVGA 3EJUA 3PABB 5D71L 4ZDHB 1A6UL 2AQPA 4FQQA 5HHVH 3VXRB 5AB9A 5L4MA 4KZDH 2E8ZA 1X6LA 1QSZA 4L29B 2X4SB 3SDXE 2BRRH 5BUGA 1KIPB 1TTRA 3QRGL 1PG7W 3JWDH 1CB4A 4U6XB 5F9JA 4FQXD 4KK5D 5B4MD 3WTWA 2PPAA 5AW5B 4AQ8A 3FN0L 5CEZE 3UTTD 2BIMA 1UCBL 4NN7C 1DVYA 4I7ZC 2K9FB 3NA4A 4WNQA 3VNZA 1FE8H 5K9OB 3UPRA 2XV3A 4I0KA 2Q86B 5LXGH 1F3RB 4GRWE 1CO1A 2RHEA 1IGML 4J27A 3QPQD 2W0FB 3C6SA 3QIWC 4I87A 3FCGA 3BWSA 2AJZB 3NAAH 4NZTL 1W16A 3V5HB 4TM9A 1T1YA 4QMEA 2PUQT 1PG7L 2FD6H 3H6JA 4WEBH 3BCDA 3R1GH 1CXFA 1DVXA 1PFCA 4KQ3H 4XPTL 1QLRA 4G8FB 4MA1C 1T0MA 1T1WA 1MHPL 1KYOK 2X0WA 3ARFA 4OKVA 3ZHNA 4N1CA 1CI5A 3OR7B 5IBLD 4AV4A 1A7BA 2BIQA 2JV6A 1WAAA 4KRPC 3ESVF 3TYFA 4F2EA 4KRMB 2ESVA 3ATAA 3K6OA 4FFZA 4HF5H 2NY2D 3GGWB 5JO5A 1BYPA 1MEXL 3T3ME 2A4CA 1I8UA 2ED6A 4U1IA 12E8H 4A6YH 2XTJE 2XN9E 3NESA 4U3SB 2F1AA 4K73A 4TV3A 1CDJA 1FL6B 1PJ9A 1WA1X 2F74A 4A6YA 2O6DA 2NW2A 1E67A 2V5SA 1UUSA 5IWLA 4MMZA 1QRNB 1MCOL 3FFCA 5J6SA 3SZ6A 3I02A 3UMNA 3I6LD 5HJBA 3I6LE 1ZSHA 1WPCA 3QUZB 1WA0X 5EN2B 3Q5YA 5BO0D 1HDMB 3H8NA 2ADJA 3IGAA 1KIUA 1RULL 3GMLA 4LCWA 2W60A 1NOLA 3DO4A 4G7VH 3C12A 2VC2L 3K5RA 2XT1B 2VR4A 3O3BB 4H2CA 4K5NA 1T1ZA 2FYYB 1CGSH 4L8DB 3JSSA 5CJQL 2P48B 1Y1DA 4YPGB 4GRWH 2UUDK 5L2KB 4ODTH 4LLWB 3S5ZA 3QI9C 1H6UA 2JQAA 3GO1L 4RA0C 2LU4A 3G04A 4G59C 5F89A 1OT1A 2ZKWA 1DDTA 4L8SB 4D0BA 4PVMA 3N06B 4IBYA 1BBJA 2HVBA 2RGSA 1F00I 3SIKA 1NMCB 5GGRB 1CFSB 2XTJC 4NGHL 4HOWA 4AYID 2EXWC 3U0TB 4ONOA 4JFQA 2Q8BH 4HBCH 4HOZA 5JOFB 4M48L 3ZKQD 3FUDA 1OZUA 4AL8L 1RURH 3F01A 5TH2B 2WB7A 2CJUL 3WFHB 4L1HA 4E9SA 4GG6F 3B2PA 3D34A 3MBEC 4JRXB 3BZ4B 3EH5B 2AQQA 2H2PC 1TU2B 2YRZA 1HHJA 1M7IB 3HS0B 4Y2DB 2SEBB 1OCZB 2F7RA 1S7RA 5GGUB 4PJDA 4DAGH 3AS0A 2WQ8A 3QDGE 1A9BA 2P9RA 2AXGA 3V9EA 3FCTA 2JJTC 3FH5A 3Q8BA 2DIJA 3TV3H 4FEIA 4TTDC 3KPRD 2F1EA 3HMWH 4NNYB 4NP4L 4UTCA 3WAKA 1LMIA 3W0WE 2CGRH 2KHAA 3G08A 1FC1A 4MCYA 4M02A 1EAJA 5FWRA 4QIRA 1RZGB 4K2UL 2FECI 1MFAL 3RY4A 4DPBX 5B3JF 3VQ1C 3BPOC 1G9EA 4M1CD 1G7HA 4HC1L 3JWOH 3OHMB 1MCWW 4ODUA 4U1KA 4M7JL 5LXVA 1GRWA 4Z0XB 3AG4B 3V6OC 1L6XA 1JK8B 4KKCC 2WY3B 5JYMA 4OQ1A 2Y06H 2WXHA 4U1MA 3SGEI 5FO7B 3I6GB 1JWSA 1AGBA 4A7QA 4AQOA 2VLKA 4MQTB 2N59A 3DX4A 3FQNB 4S10A 5EUOA 4ZDHA 4QLRA 3VXRA 4GIAA 1JZHA 1L7TH 5FO9B 4NJ9L 5I66A 3DI2B 1BVNP 4DQOL 3X1NA 5JW4Q 1RZQA 4Q74A 2WVUA 1AO7A 2TRHA 3D06A 4LBAA 1OAYH 1D5XB 1BZ7A 2OLDA 4ZSOB 4LDEB 3VO0A 3IMSA 5AAPA 3GJFK 1UD2A 3AY4A 4G11A 1CLOH 5FYKH 3EDDA 2X4TB 3U2IA 3DVNA 2AJZA 1AGEB 1FYTB 2CHNA 3WJJA 5C97A 1RCYA 4JKPL 4XE5B 2LFGA 3CMGA 3QPXL 4L8BB 3M6DA 3IMVA 2P44B 4CN6A 4IKLA 2HT4C 3FO2B 3H9HA 3WD5L 1QFOA 1KJMB 3MRRB 1AVAA 5C0AB 3ZVVA 1Z5LB 3T6WA 1HXMB 5JHLA 5ALBL 1FJ1B 3U30B 2NLJB 1JWUA 4ELDA 4IK6A 3MKGA 4D9LH 4NT6A 5SWZB 4XPGH 4KKBC 2GTZA 2EILB 4YBQD 5B3JE 3S88H 1HXKA 4MD4A 1BLNA 5D2LE 3VDAA 1JDDA 2WZ6A 3NPSC 4NHUA 1T22B 3GMNB 4OZGB 4QHUA 1CK0L 1MW1A 4BFEA 1F4AA 5IHLB 3AXHA 3GZKA 2D4FA 1H3UA 4N2GA 3O2VH 4Y4HC 4MMZB 3LB6C 5IJKC 4RCAA 1FSKC 2Y5TB 5DHYA 3RU8H 5F97E 5KYWB 3CBKB 3LNEA 2BY1A 1HCYA 1MWAL 3EJSA 1A14L 3F62A 5ALCH 4DO5A 5K9JH 5D1XB 5LAPA 3S3BB 3HNVH 2PWHA 1J9RA 4HGKC 2FRGP 4PTUA 1LEIA 1TFHA 1YN7B 4HZAA 1OE2A 1UUNA 1W0VB 2EDFA 5JZ7D 1QLFB 4FQHB 1H6EA 3D9AH 4KKLD 3Q8FA 1HU8A 2WCGA 5DFVC 4WK2B 3V7AE 1BVZA 3VXUA 3W38A 5HI3D 4AV0A 3KYAA 3TBSB 1YHPA 1DVQA 4NXSA 3WFEL 3QUMB 5DEGA 3US1A 1FH5L 1SF3A 1OAXL 4R0LC 4RGOL 1C1EH 2ZWYA 1CGUA 1KB5A 3EJJX 4M1DL 4XP9L 5E1QA 1FNHA 4X7FC 1LO3L 2P8LB 2YWYA 5C3LD 3Q5TA 3U79A 5TF0A 2B9BA 1UURA 5I0ZA 1GZQB 3O3EA 2D31B 3RWDB 3BKJL 4F8PA 2X53A 3EYOB 1MAKA 3JV4A 4Y8DC 3NFNA 2LR4A 4HOXA 1AYOA 3UO1L 1HESA 3SOBL 1BW8A 1G1KA 3OKNA 4EZJA 4LF3B 2WLNA 4PJXE 3IDGA 3S97C 3NP4A 4FYTA 2NUTB 3U0PB 1G7LA 1OGAB 3B1UA 2PO6B 1OAQH 3JWNC 4IHOA 1AZZC 4LCCA 4XNQA 4CW1A 1VEMA 4G1EA 4UQCA 1C7SA 2HX9A 4P59H 1QMUA 4M8QB 5LUMA 4MNQA 4N8PA 1PSKL 1DP0A 1KPUA 2C9UA 4BZ1L 2D03L 4OCSH 3UP1A 3HS0A 4EZKA 4RDQG 3HFML 3EIFA 3MLUH 1AI1H 3IDMB 3RFRA 3DJSA 2H2SD 5D5MB 4X6EB 2WB1A 1N0XL 4U6YA 4AJYV 2ZSWA 5EU7E 1Z9OA 4PVNA 3F7KA 5DEZA 4F7PB 3UGUA 1T2QH 2UVEA 1UJ3B 2WP3O 4X9YA 3WTYA 4NLAA 1J0IA 4JQXA 1U8QA 4KY2A 5JUEL 2BFVH 1T6VN 5BNXD 1T5XA 4V1DE 4GG6E 3KE0A 5AW8B 2CCVA 4CMHC 1BHGA 5FIEA 1THCA 3BPLB 1NFIA 3RTQD 3BQUA 4F9PA 3KPMA 2X2YA 3Q05A 3H2PA 1CFVH 5F6IB 1YC7A 5CP3A 2YR3A 4H8WC 1I1YA 1H0DA 2NQ3A 2QVKA 3BKYL 5ACMA 3KBPA 1QFWL 4AIZB 1DJSA 3DRQA 4H13C 4WGWB 2CKNA 4OZGF 1TVDA 1KN4H 3VI3F 3VXOB 4D3CL 4X5LA 1FN4B 3OKMA 3ZE0F 3AADB 1OB1B 4HSCX 1LO4L 1AACA 3H7BB 3D05A 3G9AB 5FO7A 5IHZA 1EBPA 2OL3H 4UCFA 3MNVA 2XRAL 2IAMC 1M53A 3TNNB 2B5IC 2QDWA 3O8XB 4XWOD 4XRCA 1JYNA 2EIEA 5CN2A 1I75A 3UJJH 5FK9B 4CVZB 1J5OL 4JPVH 4MAUH 4YXKH 2ATPA 2BC4B 3KHOA 4M61A 1CGWA 1NMCC 1SYSA 2ZKMX 2DQDL 3E80A 5KVGH 4XWGH 2YZ1A 4N24A 1NLDH 2QKIC 1RUKL 3RBGA 3OZLA 4U3SA 4MQXD 2A77H 3VGGA 3NGBC 5AYUH 2X12A 5G5DB 2PYFB 3U46A 4LIQL 4KROC 2KLSA 4AMWA 4XVSL 5DC2A 1N10A 3IM1A 1SM3L 3L5IA 3QEGL 1S7WB 1T66C 4G6AD 2YPKB 4X2UA 2XQ0A 3FO2A 3BZ5A 3UBFA 5KVEH 4DT2A 2GSMB 1F4WL 4AZUA 1Z0MA 4DKFH 3T0VA 1KIQB 1JGVH 3ECVA 1NGWB 1OOWA 2BDNL 3MAWA 2NLJA 4QRPB 1L6PA 5I8EB 2QLVB 3QDGD 3L3OC 2ARJQ 4TVPD 3KJ4C 4XCCH 5KVFE 3RVUD 4ZMXA 4ZTPL 3WKQA 1JXFA 3GS0A 2ZUYA 1HOEA 2FX7L 4MD4B 4MCMA 3NEXA 1T22A 3GMNA 4OZGA 1F4XH 3EJYC 2F54D 2VISA 5JMOC 2H4EA 1ACYL 3CX5J 3HMXL 1NM4A 5BMFL 2BVOB 4HFWB 1D5BB 2XKSA 4XP6L 2NY1D 1NEZB 3KXFE 3QIUC 1I8LA 3WEAA 3HE7B 1F56A 3U0TA 2NY6D 4G72B 5T1JA 2HT3C 2EO1A 5D1XA 4I2XE 3T6VA 3BEVA 2PW1B 3DXAB 1XGQA 1NCUA 3UBXB 1ADWA 2FWOA 2XBDA 3O45A 2GHWB 2FX9L 2YQ2A 4PW3A 1EZVX 3J2PA 5FOBA 3VXMB 1IFRA 1XR9A 2Y5EA 3KD4A 3DGDA 1CVSC 2Y69B 4NYLA 3SPIA 2A9CA 3VGEA 1JFQH 5EU5A 4TTDD 4YHML 2MTAA 2WZAA 1P9MA 2G0LA 2PPFA 2HKAA 2ZP0T 4MBOA 3QI9D 1ECZA 4LCWD 1BGXL 5SX4H 5IB4B 3ZRFC 5EDSA 1EXGA 1LTXA 2FQGA 4N8CL 1S5HB 3QPKA 5C08A 4V1DB 4GG6B 1O9VA 1FDLH 1T6WA 5C0CE 3G7TA 2VDOL 3K81A 3BCFA 2EE9A 4XNXH 5I0YA 3SDDB 4XBMA 4GBXB 1XAUA 2ZUWA 4GEJA 3M1BA 4GRLD 2Y7OA 3W1ZA 4NUGL 2QGCA 1TQTA 1T21A 3TIEB 4S1RL 5DD0H 2XVGA 2BVEA 5CZVH 4PI0A 1PFOA 1IFHH 2HN7B 3DLQR 3O3DA 4BZ2H 5FWQA 3VTMA 2E7HA 4DFIA 1F18A 5KN5B 3X13B 3VGDA 2DQUH 3SYOA 2W81C 3QWNA 1A1NB 1BG9A 5D7SH 5I66B 3GINA 3ARWA 2XNAA 5ADOH 2MHAA 1UJ3A 3D12B 4Y4HB 5KJRL 1E8YA 1JPSL 1SJHB 2WINB 1J8HA 4HIEB 4BCYA 4S1QH 4PRIE 3IJEA 5F7UA 1SY6A 1BCIA 3ZT6A 1XEDA 3NZHL 3EADA 1K6QH 1PTZA 3KPMB 2PETA 4P2YA 3ZQWA 4OQTH 3SD5A 4JKMA 3KWWA 2OTUB 1UVQA 1RK0B 1SNRA 3DVNB 1HE7A 4RBPH 5CN1A 4B0MM 2EDXA 2E9BA 1GHFL 3NK3A 1RQ5A 3QXAA 4DN4L 4ZZFA 4QNPE 4FQXB 1UT2A 2OJ1A 3EYQD 5IJBC 1DQLH 4X4XB 3PYCA 4YGVA 5E6RB 1U92B 3GMOB 4U4BA 4DCQB 3DVGB 3DHUA 1MVYA 2E6PA 2QELA 3D0VB 4OTXH 1L9OA 2XZQL 3QUHA 5LBVA 1A7OL 4OZFH 4XRCB 2VJ8A 3EO1A 1K4CB 5FK9A 4JGUA 4MXWL 4WY7L 2DEWX 3P11H 4AC2A 2WWOA 4JGNA 3MRBA 1FVEB 1I3GH 4QRAA 4YHKH 5FF6B 1SVCP 3UTSB 3IU3B 4OZFB 1TO5A 1UB5B 1OP9A 1QKZH 1QBMH 3FCSA 5I8OL 1NANH 1BLNB 1H9VA 2ATKA 1TQCC 4V2CB 3T9WA 4NHUB 3L3GA 2XN9A 1U2CA 3RVXD 2R0ZH 2Q5BA 1IC7L 3HVDA 3IDYB 5K69A 4XT1C 3MRKB 5B39B 3OB0K 3MLXL 2O6EA 4PJAE 4ATTA 4M6NH 2AEQH 1LD9A 3QUXC 3D0LB 2NXYB 1J11A 1BMWA 4HJJL 5AKVA 2P3YA 2NTSP 5CILH 3F7PC 5EEXA 4JJ5B 1W6LA 1D5MA 1PZBA 5DGQA 4OD1L 2PLTA 3GPEA 5TE7H 3CZNA 1CIUA 5DD1H 4HIHA 2OMNA 3SKOB 5SWSB 5J7CC 3VVWA 2XXCB 3Q44A 1HX0A 1IE4A 2KPWA 4IJ3B 1JXGA 4NBXB 3QUZD 3O81A 4N9OB 3DX6A 3DXAE 1R46A 4LT7A 4JREC 3NJKA 1EFXD 1JGDB 4YDVA 4YDJA 4P9HH 3KPOA 2W9EH 4ZXBA 2Y7SA 1MIEH 4DVBA 1WF5A 3GK8H 3HC4L 4Q9BA 4GNKB 4P3DA 1RIVL 4YHPA 1QQDA 2X41A 1AQ8A 4Z7VF 4AITA 1E9PB 4RQQA 2AJXH 4FFTA 2PR4H 1E4KA 2CUMA 4MKTA 3LPFA 1ZHKA 1E6JL 2XA8H 3MRDA 4OCXH 4DTGH 2BSTA 1TSHA 3VI3E 3LKRA 5F3BB 2VERA 1KN2L 3GRWL 1YQVL 5IQNA 2AGJL 2X42A 5DJAB 5IJCC 4GW1B 1Q1JH 2OX5A 2ZJSL 4PGZA 1Q0YH 4LSPL 4JO2L 5ESVB 2WLYA 3UBXA 4NWTH 2UX6A 3BUIA 5JQ6L 5FOBB 3CVCA 5CFHA 1OLLA 5D4QA 3UH8A 4WWKD 4JDTL 3GZOA 1NQBA 4ZAKC 3NOIA 4M5ZH 2QKSA 1U8IB 4KKLC 1P7BA 3DECA 3HUJA 1D5IH 3ARZA 2CE6A 3DX8B 2PW2B 2F8XC 2L7EA 3TJEH 3MX0B 4WW2F 2VZ1A 4AVJA 2NY0C 3AFLA 1QFHA 3FO9B 1OTTD 1TFPA 4LRIA 4NKMA 4OUOA 5TQ0L 1JIBA 1MH5A 5H35A 3NPSB 3NIGF 5HDWA 1JG9A 1KTRL 3L4CA 3CC5B 5CP3H 5F71A 4O02L 4TMPA 1IAIL 3BQUB 3BPCA 1ZTXE 1TIUA 4MMZC 4U7SA 4N0UB 1NUNB 3MJ9L 3WN5B 5IROD 4KAQH 3WY1A 5IUSA 2VLRA 2R1XA 5DZPA 5FHAL 2N7AA 4OU3A 1FHNA 1MW2A 4JR9H 1DO5A 2XICA 2XWTB 4TL4A 5EUKA 1VB9A 4H5SA 4QJ4B 1MCPL 4WTWA 1G0YR 1KJ2L 4LRNL 1A4KA 1DE4A 4MBRA 5ANME 1S7TA 5C0DA 4MNHA 5KN5A 1A6VH 3BE1L 3X13A 4JG0L 3EJCA 4HWZA 4JFXB 5ANMA 5T1LD 5HVHB 2W59A 2ZKHL 1B0WA 5DVKA 3W9EA 3FSAA 4OR1A 4PMFA 4CL7A 1E2WA 5DZJA 3SKNA 1FYTD 3NN8B 2XCMC 1L7IH 3TTSA 4YZFF 4ZFFA 3QHTC 4S11A 3BMVA 4ZPTA 3PPEA 4O02B 3WHXA 1ASQA 4PRNA 3RVVD 1T7VA 4KMTH 4OBSA 4ES8A 3F7YA 1UEMA 4NZDA 4U3HA 1B2WL 3B3IA 2DIEA 3RTQC 1B9KA 2X4RA 4X9IA 2PYFA 4E9VA 5BQ7A 5JDSA 4MJ6B 1G43A 1FO0A 2KQNA 5AYQA 3V6ZB 3C5XA 5HHPA 4FZEL 2YKLH 3GM0A 5DMYA 1YNTA 1S7WA 3INOA 1MFCL 1TEFA 4NKOB 1K3ZA 1INEL 3EH4B 5AAMA 4BXVA 2AJUL 1Q9WB 4X7EC 3MV9E 4FI6A 1CE6B 3WCYA 4MD5B 3K72A 1M56B 1QSFA 1XR8A 1G7IB 1NCGA 1K8DB 1JF5A 2BNRA 4LCIH 5BUAA 3CK0L 1ONQB 5I1IH 2Y6SC 4W4OC 3NFPA 1OHQA 3LN5B 4PBDA 3GLEA 4JDVB 5SV3A 4LHJB 5E8EA 2GK0A 2AK4B 2WWKO 3SY0A 5I2IA 4HUWA 4HIIA 4OZHF 3RFZB 4R97B 5DJ8A 4BH8A 1DN0B 1T83A 4DEPC 1YAZA 4PJ5E 3WMPA 3EYSH 2G5BB 3UMTA 2Y25A 3TT1L 2CIKB 3ECWA 2A83B 3UGEA 1RZPA 5F6IC 2R2EA 4L3EB 1XQ4A 3JYBA 5ACZB 2OMZB 4KGJA 3ULVL 3TGXA 3A6BL 4HGMA 2WXRA 3ZSTA 4G9FE 4AYEC 3DO7A 4ODWA 3D07A 3GSNH 2YHGA 3QQXA 2FLMA 2IF7A 4FZ8L 5FGCB 5LCVA 1O5PA 1QAWA 4QAWA 1TQSA 1NFDF 1C5BL 3GUFA 1I8IA 3SGJA 4HX1A 2XWJB 3MLYH 4DZ8A 3B8SA 1C8PA 3UYPB 1G87A 3VYNA 4PLNC 4KKNA 4NQQA 4AT6A 3CZGA 1X5KA 3FTGB 3ML8A 5HP5A 5HGBB 4DN3H 1QZNA 4ES9A 1JGDA 2NX5D 3Q7JA 1W0WA 4ZUWA 3DK2A 5IB5A 4L3AA 3A0OA 4QD2E 1BV8A 2ZXWB 3K71B 1GR7A 1VPOL 4BQ9A 3WUWA 2OMYB 3HC0B 3KS0H 4OFIA 3MN8A 3H42L 4P0DA 4DK5A 7CGTA 2CMRL 5EIIA 3QZLA 3IMTA 1NCCL 1TENA 1HIML 5EU6D 5E03A 4YXHH 2WO3B 4FFYA 5AW2B 2I60L 1ZD6A 1OAKH 2OZ4L 1UA3A 4LVNC 4Q4EA 4R4ND 3NA9L 5I5JA 2A6DA 3QBTB 2LVEA 5C0JA 4UT9A 2UVFA 4FEMA 4QTIL 1VGEH 2P5EB 2GG1A 4M4RA 3S98A 2OX5B 1NDGB 3S35X 4NQDD 4PJBE 1P84J 5HDQL 4U1NA 4AQ8C 3DSFL 1PLGH 4GAGH 5KAQF 3ZZSA 1OCWL 2VDRB 2IDCA 2XPYA 4UNIA 2ITFA 1R3IL 1YECH 5T3ZL 3Q9PA 4N6RA 1IC4H 1T5WB 1DQQB 1WEJH 2L8AA 1OGTB 4E9RA 4KDVA 1IEBB 1EO8H 4HLZH 1MAMH 2OS7A 2QZ5A 5DTFB 4QY8A 5F93C 1AGFA 3OJ2C 3DWTA 4FJZA 3MBXL 1VZGA 4CVXB 1EHLH 3MV9D 1GIGH 1SXNA 3EJQA 3FMGH 1IV8A 3DGGB 1KELH 1AE6L 2HKFH 1HWHB 1N19A 4JAMB 1NFDA 3DRTB 5E00B 5AVTB 2ZXBA 3VAEA 2B0SH 4I3RL 5FYJH 5HHQB 2IFGA 4JG1H 3NVQA 4JY5H 5EG6C 4OLWH 2V9RA 4NZUH 2VDLL 4OT1H 4PJ7F 2ZTBA 3PQYA 3NJGA 5J9PB 4N2MA 3K6NA 4J1UB 5T1MA 2FO4A 2JB5L 5CBEB 3MLVL 4JUSA 5D72H 2OCCB 1GY1A 4OLXL 2VLRE 2FYVA 1SHMA 1BD2B 2XYBA 5FM4A 1UH3A 4K71B 4POZC 4EI6A 2H3KA 4NCC2 4PJIA 3SCMB 1UZ6E 4PRDA 1XF4A 2VJ0A 4E2OA 5C9JB 1BAFL 3B56A 3BDBA 2DEXX 3K1KC 1UB5A 4P4KA 4PUBL 4DP1X 2MJWA 1RMFL 1D3CA 3PP4H 1ZA3A 3VXPA 3D69A 3QEQD 4LVOB 4KVCL 3B37A 2YMTA 3F7YB 4DERA 5IGXL 4ZFOB 3DGCR 3UX9B 5FA4A 1FVDA 4E9YA 1BM3L 1A22B 2W92A 4TRPL 4QI3A 4W9IC 4ZUUB 4R4FL 1QSEA 4LPVA 1L9TA 1V10A 3LQAC 3S2CA 3U1SH 1JYXA 1G1YA 3IDNA 1V55B 2BNRD 2IMNA 1EPFA 4P2QB 3VD7A 4GQ9H 3QDGB 4L1DA 2VQ1A 5CD3A 5DD6A 1WC7B 3EYVA 1OM3H 4PN6A 3GMMB 1A47A 2K6ZA 4P07A 5IF0B 3Q48A 3QZWB 4C8XA 1KZQA 4XN9A 4AI7A 3C75A 1IC5H 2FUTA 3KM2A 3MRPA 1EEQA 2VSDA 3P4MB 1XSIA 4FP8L 4BFJA 1XGZA 3VWJD 3VFGL 4BD4A 5E8EB 1H3TA 3DETC 5IQOA 1DJWA 4YDJB 1KFGA 2FEJA 4R6UA 3DX0A 3BN3B 4ZT1A 4P2OD 1NBVH 3RDTD 1LWHA 5F1NA 2WK2A 3MA9H 4URTB 1TVHB 1ZLSL 2ICWA 1RUQH 4QRTA 4K8RC 4G6ML 4RQQB 1CC3A 5CGYC 1JZ6A 3HRPA 3KWXA 3MJ8B 4QHLA 2ZF9A 1IEAB 3MTXA 3EZJB 5DWUH 5T1LA 1HHGA 1I1RA 1NUGA 3KBHE 1MCQA 4HCRH 4MXQD 1GYVA 1R47A 4GT0A 4N5ED 1FCGA 2VW7A 2OMWA 1UZ8A 2MCG1 3SBQA 1ESOA 1M7DB 3IJ9A 3N0AA 2QTEA 1UFUA 2OTWB 2R23A 1PAZA 2CQVA 2ZOKB 3CSTA 4MJHA 3ULVC 2VUKA 3F05A 3ZYIA 3OD3A 1RH8A 5HGBA 5IROA 1IM3D 3G5VB 3CLWA 2JELH 3FU7A 4JKKA 1GTFA 1L9RA 4TNWK 3BEWB 3ARGB 4PG9A 1EJOL 4QPEA 2WMPA 1QI4A 1AY1L 4KKPA 4YNYA 4D8OA 4L9LA 1XH3B 1JK9B 4KFZC 4N28A 2ILLA 2K70A 4Y9GA 5ADPH 3IYLW 4UV4L 2EAEA 3C5ZB 4N6QA 2R2BB 4JHAL 1LO2H 4JO1H 2KLRA 4X80H 4QRQB 1I8MA 2RMNA 4P4RB 3BVWA 3ARFC 5KVDH 2PP8A 2VM3A 1PBYA 3L1FA 1WAPA 4TSCL 1E4XH 3FF7A 2R1XB 3LN9A 4QRSA 3T0DA 2CDFA 1U4FA 3ARDC 5DZAA 4NKIL 4IGBC 4YO0A 5DJDA 5JPNA 1S7XB 2WSDA 2BZCA 2H0EA 1CT8A 1UATA 1S9YA 2H6UA 1ZKAA 1UXWA 4WLCA 4X5QA 4X6DF 2W8CA 2GBAA 1LEKA 3MUUA 3CZUB 5D96B 5F7LB 9CGTA 1R34A 3GNML 1KY6A 1M71B 5B1JA 2R4RH 4XCYA 1RZJH 5CZXC 1MLBA 4LCYA 2AJSH 4PRIA 2R56H 2R7EA 2AEOA 4L8CA 1COBA 1FL5B 1FV1B 1AAJA 2V5TA 3I85A 3NUKA 4JLRB 4N2BA 5ILTH 1KNOA 2WLMA 4JVPA 1PZUB 2XIDA 2I07B 3V9CA 1J1XL 4K7PL 3DRTA 5E00A 2N3JA 5A2JH 4JFFE 3ASNB 3MRCA 3EBHA 2C4FU 2BP0B 1Z2KA 3VRIA 1IBZA 1NSNH 2XKUA 4CC1A 5CKGA 4YQXH 4AQ1A 2GJJA 3TA3C 3QISA 5F8RC 2FJGB 5BZWB 2AK1H 2VN4A 4N1HB 1P6WA 3QDMA 4MJ2A 5AWNH 5HYJB 3ILQC 2EXWD 3FN3A 4Z78B 1DQVA 4OJDH 1RU9H 1NCWL 4F7CB 1K8DA 1JDCA 1O0VA 2TRYA 5D70H 5LQBH 3LN5A 3GHBL 5C9JA 3BESR 3TBYA 3UTZB 3U6XS 1E27B 3MFFA 4U1GC 3BFWA 5DJXB 3R8BB 5DJYA 5DJ6B 1QSED 4JM2C 2V9QA 2WAHA 3SQBB 3LPPA 5KYYA 4CGUB 4K23H 5DUBB 5F9DC 1C5CL 2XX0A 1A3LL 2K9UA 2FCBA 3PJSB 4GKZB 5DK3A 2A83A 1J12A 1P4UA 4IS6A 3OXRA 1G6RH 1JV2B 1RZFL 2YQBA 2XQBH 4MJJA 3TF4A 2VB5A 3L3HB 1ID5I 3TWCH 1E7UA 4OGXH 3TBTB 3I6KB 2B1OA 1ORSA 4YC2B 3V6OE 1PYWB 1PZ2A 4P2QA 5E2JA 2EH7H 3DO7B 3RL1A 1MCWM 1M2OA 2E76C 1QFPA 1EFXB 3TYGL 3VFMA 4Y9BA 2H0FA 2IH8A 3BGFC 3WNJA 1DUYB 1FZKB 4X9GA 4TLSA 3ZKND 4ABWA 4P48A 5L6YH 2VKWA 1SMDA 1G4RA 1TZ8A 3CFUA 4UANA 2A38A 3UYPA 4A68A 5H2BB 2APWA 3CDGA 3BAKA 1UH2A 5HPMA 5CJOH 5JORB 3E6FB 1JAEA 4HAGA 2VL4A 1I3RA 1IZKA 3KG5A 3VG0H 5CUSL 3PWNA 1UZ6F 2OR7A 3GSQB 1O9WA 3KNBA 2XZAH 2VLJE 5AG8A 2V2TA 4D8PA 3OVUB 4X6FA 4FS0A 4XXDA 2VXQL 5JLZA 3VFRB 3GHEL 1KBVA 5INDA 5IOKA 1QHPA 4FA6A 4HJGB 4PJFE 4X98A 5E23A 4Y4FB 3HLAB 4R4NC 25C8L 4BFRA 1BZ9B 5F1IB 1JNNH 1HZHL 1IEAA 4A38A 4PWEA 1EAPB 5CR1A 1ZT7A 4M8VA 1AG6A 3D4YA 1BYNA 4RGNB 2N56A 4N8VG 5A2BA 4HUMB 4NO0D 2CO6A 3QO0B 5I1EL 1R17A 1IM3B 1D7CA 4Z95H 4QTFA 5IOPB 3V2AR 4ELMF 4MB3A 2H8PB 2PYED 1M7DA 3RY6C 4P49A 1P2CB 4HEPG 4CSTA 3L48A 4FTVE 2R23B 2FJFA 2ZOKA 1KEML 5GS1B 1YEIL 5DURD 1EJ6A 3KYOB 3IJYB 1KCBA 2DLTA 4HV8B 4ZK8A 3PIQB 4ZO8A 2EVJA 1XH0A 1XVSA 4MJID 1M9SA 3NGBB 1CQYA 2FQDA 3LEYL 3QS2A 5DTFA 3C6LB 2CD0A 3DV4B 3P1VA 4MX7A 2OPCA 1Q9LB 3VTTA 4MZIA 4LKXA 4ZPVB 3QNYA 3AMLA 3LS4H 4UINL 1UQSB 4HWUA 3V4VL 2HFEB 5ICYB 4BFFA 4DKAA 1X5MA 4UMGA 1UADC 3KPSE 3FRUB 4P2CG 3ULUL 1KTLA 3NQIA 1U91B 4EI5B 3BDYH 1IJ9A 1U36A 4LSUL 5I0VA 3GIVA 3CCHB 4KHTH 5JIQA 4GP8B 1D2OA 2YMXL 2I9LB 3BGMA 4P04A 1TETH 4PJIE 3FULA 4YO0B 5DJDB 3A67L 4PLJD 4J1UA 2VXUL 4U1SA 4FX5A 3M88A 3R7QA 4RGMB 4UQAA 1AXTH 3EOYG 4K5OA 5K39B 5ID1A 1YYLL 4Y5VA 3HG2A 4W68A 4ADIA 4JS7A 4QGYA 4M03A 2IWEA 4WV1A 5GISH 5C3TA 3KXFD 1Q9OB 5GHWL 3T77B 2A73A 4W9FC 1VZIA 2F7QA 1U3ZA 3K6DA 4H0LC 4RX4D 2BIHA 3SCMA 1W6WA 1M71A 2H32A 4JRXE 2H6PA 5G55A 1INDH 5LNGA 2UYLA 1AQDA 1XF4B 5I1AA 3FT4A 5MENB 1OANA 1PMYA 4BIKA 2G75B 4HJTA 4APQD 3ULVD 2A6KB 1Z3GL 2WD0A 1R5VA 1RUAH 3QXUA 3GSXB 3PWJB 3FUNA 2DV6A 2YSTA 5IW6B 2HSIA 4JM2A 2ZXAA 4PBVC 1QNIA 2D0GA 1ND0A 5CGBA 3WIFB 3POCA 4O9HL 2WO2B 4J3OH 4GP5B 2FWLB 3AZUA 4F33B 1RZ7L 3K2KA 4BSWA 2EXSA 3EZ8A 4OFVA 3R18A 1GAFH 2GPZA 3IDNB 2KL6A 2YK1H 4AQ1B 1ZHLA 3MODH 1LO0L 3DSNA 3OV6A 1NCIA 4M6OH 4UIKH 4JRWA 2IPTH 2XPZA 2QV4A 4M7LT 4FQ1L 4O2CA 4QKXB 2XBTA 2EEFA 2YARA 3UJIL 1XCTA 3VD9A 5J6HB 1H3PL 3Q6FB 5E2VL 3QUYC 1PCXA 2HT2D 1X4ZA 3N42B 3ML9A 2R2CA 1NINA 2M26A 1RLWA 2RD0A 4QRRB 5E5UB 4NQTA 4J5VA 4UWQB 3UC0H 2JB6B 4HLZG 3KJ6H 1CDHA 1HH9B 3M1CA 4KC3B 1KV7A 5D2NE 4NQUA 4NQXA 5DJ6A 4OLVH 4QOKD 3V4PL 3X12B 4HMDA 3TNMB 3GKWH 5AB1A 1FZJB 2ERJC 1OP3K 1KB5H 5TF1H 5D1ZB 3LXCA 1TUPA 5CSGA 3TH3T 3SQRA 1NIEA 2Z7YA 4JDZA 1BF5A 1VGKA 1YPZE 1QEWB 5D71H 2JCCE 4O2EA 2WYZA 3RWCB 4KZDL 5ECGA 5H37A 2EVFA 1SDDA 1NEZG 4N2FA 3TBTA 1MCBA 1EMTL 3L95B 3T2NL 2OJZL 3VFSA 2EE3A 2R39A 2VKXA 3HAEB 5EO1A 4GRLA 4CC0A 5C70A 3K8LA 3ZYOA 4AY0A 1EFXA 2P8MA 2EIBA 1UCBH 2CUHA 4FQCH 2F7PA 1FE8L 2IV8A 1GS7A 4YHZH 5E51A 3WLWD 3GMPA 3MJGX 4NWUH 3WEXB 3VWJA 3JQOB 3NAAL 5F44A 5CM1A 4JZJA 3AM8C 1CDBA 2XFXB 4ZD3L 5GRUH 4JZOB 5JORA 2EH8H 4WU7B 5JQIB 3D25B 3LXAA 5I26A 4GKNA 4IBZA 1I3RB 1RJZA 2J6EA 1ZV5A 4PG9B 5HI4D 2QFRA 1JD7A 4IIQC 4XPTH 4XMVA 4UAOC 5LBGA 2F5BH 1MHPH 4RGND 5TDPB 5D5MF 1GS6X 4PJGE 1EAQA 5T5FH 4OLZH 1SY6H 1CS6A 3CH1A 4CU8A 4LHUD 1D9KC 1YN6B 4NQDB 4GO9A 1MRDL 4I1PA 4J39A 2DQHL 2VXSL 3OJMB 4PLKD 2CKBH 3BSHA 3K4AA 1KPRA 1MPAL 5CD5C 4G9FD 2IAMA 4NAMA 5FW8A 3AXLB 3STBA 4HF5L 4PJAF 5IP4A 2VDRL 5DURB 2CO6B 5B1BB 4KZCA 1MEXH 3STZB 3L4ZA 1ZLWH 1JL8A 4OCWL 4PJIF 4KRPB 1M6OA 3WNPA 3WYRA 1S7XA 5HYFA 3V95A 5A2FA 3D52A 3I50L 2X70A 4X8CA 5FDYA 1S9VA 4OD2A 1ZE3H 3SE9H 1ZVYA 1ZEAH 1T66D 2Z65C 4GRLC 1AR1D 4ZUTA 4B9FA 2FGWH 4I4WB 3WNLA 1QFWI 3ES6B 2M2DA 4PJFB 3RURA 4LVHB 3DV6A 1MVUA 4G80B 3DV4A 5FEBA 1IQWH 4JQIA 3F7QA 3HNTL 3IE4A 2NY5L 4H26B 3VXME 3QFDB 4AE0A 5AVUB 3DYMA 1Z0NA 4MKMA 4GRMB 3TONA 1N5YH 3BUBA 2E6QA 4K3JH 4NQEA 4J6RH 3V52H 5JXAL 5CJQH 2MQ3A 3MRCB 3QQNA 1BD2D 4ODTL 2APFA 3AAZA 3V79C 5E7BA 2J3SA 4FFZL 3ZR6A 1AGDB 3GM8A 3WTSA 3LKSB 3QIWD 3MGOB 3MV8B 3WJJC 4ALAC 1NCAH 2ZUTA 3ZGHA 1JHTB 3GSVB 2BS9A 5BZWA 4DEUA 1XT5A 3GMQB 1VENA 4Y9CA 1G9NL 3GWJA 1P7HL 3KPQB 3VWKC 2A9AA 1RL1A 4DUWA 2Q8BL 3FTVA 1UWGL 3Q13A 3QUXA 5IB2B 3ZE1E 4KI5D 3LH2L 3ZRCC 3ZZLA 2FR4B 4OZFG 3QIWA 3TBYB 3UTZA 2G75A 1MZZA 3ZTJH 4LSTH 1DDHB 4TQIA 4DKEH 3LRSA 5FUCE 4JFUA 3WY3A 4OCYL 1HHHB 1CGVA 4NFDA 2BNQA 5B7FA 5E56A 4OM0H 1SBBA 4A67A 4HU2A 3TVMA 3IRCA 1LK2A 4Y16D 3OJDB 4Q9RH 1F2QA 3BSZA 2FO8A 4DVRH 1JS4A 5J3HC 4U3XA 3ZUCA 1BFOB 5C9KA 5B3SB 3ARYA 4ZAKB 4TUKH 2Q87A 1D7BA 3DSNB 2OYLA 4ZOCA 1CLYH 5IFHH 1A6WL 1I31A 3FTSA 1KXTA 2Z31D 1PY4A 4MA7L 2NSQA 2V5YA 3SDAC 4KJPD 3PGFL 2GVYA 3FBKA 4X7SL 1BQKA 4HSQA 4HEME 4M7JH 4N0RA 3OPZL 2YFNA 2CPCA 3S3JA 1IC1A 1OD7A 4HKZB 3E6FA 3NJHA 4YSPA 3BPOB 4JZJC 2OYPA 5JHDD 4AL8C 3OGCA 3HOGA 1CE1L 3V4VA 5HDBE 4AV5A 1SXBA 4WI6A 3UZEA 1E8ZA 5JPMA 1S8DB 1MFBH 3MV7E 2C1OA 3MV01 2GAZA 4CU7A 2XG5A 5DU7A 1B9ZA 4RESB 4FG4A 1L6ZA 1UD3A 2FEEL 3MRJA 2D2CC 1RIHL 3PXHA 3HLAA 1R3HA 4B9ZA 3LSOB 4LHUA 4NJ9H 2F18A 3FTUA 5CEYA 3QORB 2XWBB 1BBDH 5DRNA 4F7EB 4V2BA 5DHVA 1BXVA 2CHWA 4UNTA 4D7PA 3B9DA 1UENA 1CR9H 2XV0A 4N2IA 1B4LA 2WSKA 1RVFH 2NY2C 4B97A 4WI0A 4A7GA 3BO8B 3OKLA 5HVHC 5EA0H 2ZOTA 1QVOA 3DBSA 1WZMA 2H3NB 3NSDA 3GZQA 2PXYB 1GZPB 1BIIA 1S7QA 5A16B 2DEYX 4ODXA 4KUCD 4X7TA 4A2LA 5FYKL 1RZKL 2J1KA 4F1ZA 2VLJD 4EVNA 4XODA 1WVZA 2ODHA 4N25A 3D25A 4NQVB 4K3GA 3LQMA 4YDKH 5MI0B 5HSFA 4W9HC 5C08D 4D94A 3S8WA 2JLLA 2Z92A 4M56A 4OIAA 1KY7A 4WFGD 3H4FA 3WD5H 2WZPD 1Q9LA 5KZCD 1TQCB 3QSKB 3KPRA 4XVTL 4LKXB 4ZPVA 4IKJA 4OJAA 5ALBH 5FYJU 3WIHH 1E4HA 3FUHA 1VADA 5CCKL 4P46A 3L6FB 4PY8I 3TC9A 3X1EA 2B08A 2J5LC 4XC3H 1NC4D 3RYMA 1ZSDB 4XPGL 1MRFH 1ICTA 3SYAA 5D6CB 3LEVH 4QYAA 5KSAC 1AR1B 3MUGB 2X9XA 3QJVB 4CKQA 2PPDA 4YR6A 4NPJA 5CU9A 3QAZB 2WVVA 2K4WA 3PGCA 1ZLWK 3ECBB 3O2VL 1DCEA 5CHNA 4UT6H 2DWDA 4G7SB 4G42A 1BX2B 4IOFC 4KK9D 4HGWB 4W9LC 4HQQL 3IXTA 3PGDB 1UA7A 2XU9A 1A14H 5K9JL 2UYLB 4E41A 3TFBA 4G80A 2B1HH 4OJFL 5CCJA 5IVNA 5MENA 5INCA 3LNDA 2G30A 2ADGA 4U7KA 2A6KA 1XF1A 4IMLA 1OKEA 3IDUA 4WKZA 5FV2A 4FMFA 3BWUF 4BA0A 5JIHA 4D2NA 3WFEH 3H3PH 2IBZY 3IK2A 4BKTC 3C8KB 5FGBC 1KG0A 4WCYH 5JHLL 3GSUB 4M1DH 4XP9H 5HGAA 4F2MB 5GS2H 1ES0A 3BP6B 3MYJB 4FRWA 4IDJL 1BQHB 3RWJB 3STLB 3X3GL 4E9QA 3QG7H 4OZHE 1HNYA 4HS8L 5TFSL 3HG5A 3U4AA 1DQIA 4M7LL 3NFSH 2WSPA 4JPWL 1E9QA 3TVMD 1YSOA 2ORBH 3EOTH 1BFVH 1JPGA 1XCTB 1FO0H 1NCNA 1ACXA 3AACA 4R5VA 5GGTL 2X89D 5FLUA 1L9SA 3B9KA 3K7UA 1JWMB 4FG6C 2YGNA 4R3SA 4Y16B 3BH8A 4OY9A 2GYSA 4P59L 1NBZA 4H0GA 4YWGH 4JQIH 4OCRH 3MPCA 1PSKH 2VW4A 3CHPA 4G7RB 4R8WH 4KZ0A 2YJQA 2P80D 1KFAL 2PO6C 3MZGB 4ZYKB 5LCVL 3QJFA 2Z7ZA 5D1ZA 3VMOA 4BZ1H 4JK0D 2EQDA 2O61B 1TPXC 3HE6C 1XDTT 3RDTA 3EAKA 1NGPH 2G3ZA 3MLUL 2J8HA 3WLBB 3RI5F 3PV7A 2CGYA 2ESVD 1NC4A 2R1WB 4PJEB 3BAIA 1CD1A 2HFGH 3U7YH 2ROXA 4WNQB 3HAEH 3AU0A 1FFPA 2PPEA 1UXMA 4ZAKA 1ZWIB 2YA1A 3GXNA 4GRWF 1AMXA 5F7DB 3BN9D 2BFVL 4BH7A 4GRLB 1WGOA 1TLKA 3JTSB 3QIUA 1ZVSA 4LCWE 2WZPA 4Y7MA 5J6GB 3FF8A 1YA5A 2MNUA 3P2BA 1LE9B 5CJXA 3KYMB 2ED8A 2WLIA 5DUPL 4UM9A 1NC2A 4TSAH 2JMRA 3B9VA 1LHZA 3ARTA 2XFXA 2AQSA 4ABUA 3AS3A 1QFWH 3V0DA 2YQGA 5E6IB 1KN4L 4D3CH 1EX0A 4YHLH 1VCBC 4JCWA 3OGCB 4XHJD 3CVHL 3QORD 4P06A 5HI3C 3SSGA 4Q9QH 5DYOB 1MFVA 2EDQA 3L2MA 4UTBA 1XZWA 3T3MF 1HE8A 4AZ8B 1EK3A 2NUPA 3NSJA 4UQ2B 3UGXA 1ACCA 4JHVA 1XIWD 4XP5H 4U1IB 4QTHA 4MVBD 3UJJL 4POUB 5CEYB 3P54A 5DRNB 2FHFA 4WGKA 1YO4A 4EIUA 4DFHA 1Z66A 1JTTA 2R0KH 4XBEL 3TZVA 2EEAA 4H44C 2ZWLT 2XKNA 4A2GA 1T6BX 2OMVA 1TJMA 2YC1A 2X7LA 3NRQA 3VDBA 1YEFL 3HE6A 4M6MH 5EIIG 1AZCA 2H3NA 4WIQA 3BVXA 3UBXG 1AQHA 1GGIH 5A6MA 2J8UA 4NPKA 2O5YL 4N2HA 4WGVB 4X7TB 5FB8A 4J6IA 1JZ7A 2ZUQB 2X70B 4Q7DA 1AS7A 1S9VB 6FABH 1M1SA 1YEJH 4MNQD 1T1XA 4LEOB 5JHDE 2QKIB 3U83A 3S37X 2Y7NA 4UV7L 5JW3H 2UY6B 3L3DA 3GMLB 1F58L 4LCWB 2HPTA 3RX5A 3EJTA 4J3XA 4LFHD 4GKOA 5IV2B 3HJEA 1TEYA 4W9DC 2D7TL 3HCVB 2PTUA 1U8NA 4X9BA 4KROB 1CLVA 3LKOB 4DKFL 4MD0B 4NO5A 1JGVL 1U3HC 1RY7B 2YGQA 3SDYH 4MFHA 4LLWA 5I17A 2W94A 2DQCH 4PYGA 3SJVB 4G6FD 4UM9D 2ENJA 2XYCA 5AB0A 1ZLEA 7FABH 1O75A 1TCMA 3HZMA 3OAZK 4IRJD 5GSVB 4ZTPH 3H0TB 2CBTA 2VM4A 5GS2D 4EN3C 2OMUA 1T7XA 1NFKA 3HW7A 4CSZA 2Y24A 1TCRA 1TVBB 5B8CA 2WYHA 4Z7UE 2WKLA 5BMFH 4OZIF 1M7UA 3LIZH 3ZKSD 3SE8H 3R4DA 1G84A 1NTDA 1D7FA 3ZZ1A 1RUPH 4JRXA 1GGUA 1PX8A 2XXMB 5L2KE 4HWBH 1IIKA 4GW4B 2OSWA 4OIBA 1P5VA 4EF3A 3BVVA 1FYHB 3U9WA 4AUUA 2VR7A 5ELIA 1NANI 4F58H 4U4IA 4JKWA 4POZD 3T2PA 1UWYA 3B9KC 2ZOLB 2FX9H 1D5ZB 3ZDYE 1SEQL 3CMOH 1IBGH 1HHHA 3CJJA 5ITBH 2J88H 3FT2A 5ES4B 3SE6A 3TVMB 1JUFB 1J87A 1MVFA 2EACA 3MYJA 3V4PB 2Q7AA 3FQWA 4Q2ZA 5FECB 4LQ1A 5DR5L 4AW7A 2FE0A 1Q8MA 1JGEA 3QCTL 2QADB 1CQKA 4L18A 3B1TA 4ODUB 1U93B 5DZOA 5C7XL 2ADFH 3AITA 1Z9LA 4P2OC 4DH2A 3CE1A 3LX9A 4PJ9B 2BNRE 3WV0A 2DL9A 5CINL 4FABH 1UM4L 4Q6IA 3KR3H 1CDYA 1V7ML 3G6DL 2XQYK 4XOBA 3U4BL 2W88A 1YEDA 2VMDA 5ESQB 4RFEA 1JWSB 4H8VA 4G6KH 4MNGE 1UOLA 3BFQG 4FNRA 3UTTA 1Y6NR 4G7YH 4YN3A 4ZOEA 5I1KH 3I75A 2J1YA 1KEGH 1BJMA 4DGYH 4NUGH 4AXWB 3KXFA 3KYKL 3VYOA 1GW6A 5DZVA 4DGUA 1IM9D 4LSVL 3Q01A 1S8DA 4UT7L 1J8SA 3KLAA 4I5BA 1FORL 1YMHA 2BSCA 5E24E 2DQUL 4QEGA 2BS71 2G3NA 1YEGH 2AJ3B 2MQCA 4JFOB 3TFKC 2WM0A 3O4LD 1FFPB 2CK0L 4J3WA 4XZUA 5ADOL 4PGDB 3TCLB 1R24A 1KBGH 4MXVE 4WKXA 4F37F 1DCLA 1XGRA 2V6HA 1E30A 3DPDA 2H0PA 1JPTH 2VDPH 4XN5A 3QCVH 3FT0A 4XMLH 4WDIB 1HILA 1CXHA 4X5PA 1K6QL 4N0YL 1LE9A 5FYJD 2GIYA 1BIIB 5DD3H 1S7QB 5A16A 4P46D 3E0GA 2XXFA 4MAYC 1A1OA 2Z31C 2WBJA 5HVWA 1RPQA 4WHTB 3WIIL 3OC5A 4I77H 1KZYA 2WXQA 4HPOL 4UM8A 2XZCL 5AB2A 5C0AA 5FYLD 3BT2H 3WNKA 3L4UA 1BQ5A 3G6AB 3FU5A 3W56A 5IR1B 2M8XA 3MBWB 5DXWA 5JPNC 1GMIA 4I89A 1ED3B 3FFCD 5DSCB 2N01B 4M3KB 3KZ8A 2P49B 3GXMA 1X9QA 2V7NB 2MNWA 2VDKL 1HHIA 2R29L 1AGCB 4B7IA 1WCBA 4P9HC 4YHKL 5E1AB 5HDBB 5JA9A 4XN7A 1SZNA 3D18B 4UBDC 4ORZC 2BCKB 4CADA 4ZMAT 2LOEA 4UTAA 1YMME 1MLCA 4X6BB 3T1WA 2EDJA 4Z8FH 4K07A 2BOCA 1J05A 4WK4B 3FTWA 1IC7H 2CWRA 4RBPK 1KXVA 3T3PE 1DZ0A 3G5WA 1SN2A 4HIJA 4QT5B 5C71A 1LEIB 1JXJA 2WXPA 3PWUB 4ZMOA 1RK7A 4AC4A 4KDWA 1YY9C 2YGVA 4JFFA 4M6AA 2ADYA 1IBYA 1XSKA 3PGDA 5EU6E 1N59A 1QG3A 3FU8A 5C2BH 1KJ2B 4OD1H 4JN2A 2ODIA 3U0WH 1NPJA 1RJYA 5DEGB 5SX4I 2DIAA 3LKOA 5EBMA 4YC2C 2Q9OA 3CQFA 4PVBA 1QASA 3MRNB 4MLSA 3US9A 1A7RH 4IMLB 4BZ2A 1ITCA 1DBJL 2CRIA 1UWEH 2CXGA 2YIHA 1M1XA 4PRPA 1NMAL 2H6OA 5I76B 2YXFA 4WFHE 1JZJA 1H6FA 4KPHH 1GZQA 3O3EB 4RMWA 5IJKA 3U9UA 2PWFA 3FQXB 3C5SA 3H0TA 1IBBA 1ES0B 1MIEL 2OMUB 3BP6A 4U3CA 4Y1AE 1NJ9B 2C9RA 5F9WC 3RWJA