1PLGL

Evidence for the extended helical nature of polysaccharide epitopes. the 2.8 angstroms resolution structure and thermodynamics of ligand binding of an antigen binding fragment specific for alpha-(2->8)-polysialic acid
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
215
structure length
215
Chain Sequence
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLYWYLQKPGQSPKPLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCFQGTHVPYTFGGGTRLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGG2A=KAPPA=
publication title Evidence for the extended helical nature of polysaccharide epitopes. The 2.8 A resolution structure and thermodynamics of ligand binding of an antigen binding fragment specific for alpha-(2-->8)-polysialic acid.
pubmed doi rcsb
total genus 53
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1995-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1plgL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1plgL01
4KI5F 1I9EA 4QTIH 1ZGLP 4RAUB 2WP3O 1YNTB 1MQKL 5CEYB 2LTQC 3HZVB 3MJ8B 5BS0D 1AQDB 1S7QB 3QFJD 1MRFH 4FFWD 1YQVH 3JWDL 2DLIA 3ARFC 1LO2H 3TBVB 5BZWA 4GAGL 3SDXA 5JHDE 2NY7L 1URLA 5C0GB 4PGEB 4QXGH 4LFHG 1ETZA 4EI5D 3I2CH 3DVGA 1A22B 4XC1L 3QIUC 2AXFA 3ARGB 1Q9KA 4P4KB 1SEBB 4XC3L 3KHOA 3TJHD 3VRLE 5IQ9B 5KAQF 3O3DB 5IGXL 3S88L 4JZJB 4PJEB 1EAPA 4KK8D 1AR1D 4JDTH 2NX5E 4YDVB 3RVUC 4RBPH 3RHWF 5FM5M 1PX4A 4P2OA 2HT2D 2Z35B 1LEKA 3I02A 2XTJC 3THML 3IJHB 4WV1A 2FIKB 2XKNA 1KIRA 1S7XA 5C7XH 1FIEA 2OI9B 5GGQL 3HLAA 1JBJA 5B22A 3QYCA 2FX8H 3QPQD 3N1PC 2LU3A 2R29H 4F9LC 3GSVB 4Y8DC 1DBJL 5M7QA 4NHUA 4KK5C 3D2UB 4NUGH 1NFKA 3RI5K 5E2JA 2CKBL 2H3NA 5E99L 3T3MF 1N59B 2I27N 5E5MA 3EOAB 5E6IA 5IB2A 4N5ED 1S5HA 3QXAB 1D3CA 5E1AA 2RCSL 2VZ1A 3DV6B 4IOSD 3KPSD 2EIDA 5C0EA 4RGNE 1CD9B 1P7HL 3O9WC 1HQRA 4XCCH 1LEIA 3TWCH 3ARBB 4MZ3A 5E8DL 1VADA 4Z78A 3K0WA 4WUUB 3OBAA 2R2CA 3LIZL 5DJ8B 4JY4A 4L1HA 3VH8B 3QIUD 4GS7B 1NAML 1TCRB 4F7MB 3L5JA 4M02A 4DAGL 3MYZA 1YN7A 2V9RA 5LGHH 1MCOL 5GZNC 2Y06H 3EBAA 1F4XL 4NRYB 1KIQB 2EZ0C 2NTFA 3O2VL 4PJ5B 3L7FA 4IJ3C 1S7VA 4Y4FC 5GISL 2ITDA 3RVWC 2DQIH 5LVEA 1U8NB 3H9HA 3U1SL 2A9NH 4MZ2A 4FXGA 5SWZB 4AEHH 3KYMA 3LEYH 1U2CA 4OF0A 1FYTB 3IDNB 4G9DB 2ICWI 5DURB 3RGHA 4Z7NF 5D7IA 4NQDA 1U8QA 1ZS8A 1BQUA 2E9BA 5E5RB 4KK5D 3LQMA 2ZOKA 4G7YH 5KS9A 4CVWA 4YGVB 3MLVH 4XCEB 1KB5L 3V4VL 1S5IH 1YDPA 2EYTA 5D7IF 5FHBH 2OLDA 1RMFH 1YUHB 4CBPA 4LBEA 1NBYA 5K9JL 1MIEH 3BZFB 4MNGA 4X0KA 3O9WD 5DVMA 5M95B 4P2YA 2RAMA 3G08B 3TVMB 2X9YA 1PYWA 2EDWA 3DHMA 2VXVL 3EAKA 3UZQA 3WUWG 2IADB 1ORSA 2GK2A 3P2TA 3QEQE 5TJWK 4K7FA 2GKIA 4RMVA 4OTXH 3A6BL 2CLVB 3LB6C 3GKWL 5GZND 4G43B 3WIFA 5IB4B 3QDGB 3AAZB 1N0XH 3TO2A 4Y4FD 4ZS6C 2FX7H 4I13B 1RJYB 5C0JA 1XEDA 3RVWD 2J6EH 32C2A 5IV2A 1J0JA 2EDFA 2H45A 4P0DA 3EHBD 1MVUA 1H5BA 3EYQC 3GEWB 5EUOE 3RKPA 1C5BH 1XGQB 4EDXA 2L4OA 2GHWB 4TTGA 2YC1A 3O11B 4QHNA 3M45A 1MCSA 4M9PA 3PWLB 4OZFG 4JO2H 4QRUA 5SWSA 3GIVB 4HZLB 4KZDH 1FGNL 4PJGE 3W5NA 5IOPB 3ZKNC 5H35B 1D6EA 2FJFB 5CLTA 3ALXA 5TGBB 3DX6B 2DTML 3C09C 3UC0L 2BVQB 2E7CA 1HEZA 2XV6B 3IU3A 4XNYL 3FJTA 3RA7L 4ZOBA 1IGTB 3TBWB 1H8NA 4U1HB 2BNQA 5T5NG 3TYFB 1BOGB 4TUJB 3WDHA 1QKZL 1QQDA 1FAIH 3B5TA 1FZMA 3D25A 5HGGS 2O5ZL 4N1HB 3KLSA 1NMCC 1ZT4B 4PJBE 1ACYH 1CU4H 1ZHKA 4QRSA 4MQXD 5J1AA 4BFIA 2HTLC 1U8PA 3BW9A 1ORQB 5H37G 4GMTH 4RX4D 3LB6D 3TCLB 5GGRB 3VFUB 3VFWB 3DGCR 3C8KA 1TZIB 1II4E 5DJ6B 2CUMA 2VIRA 1MJ7L 1F4YH 3SDDA 4L4TD 3P0VH 4KGJA 1AGDB 3TO4C 1BQHA 3VXMB 5L2KD 1IGYB 2WUBH 3P4LA 4PJ9B 1KCLA 3V5KB 4QNPE 2YWYA 5CIPH 4C58B 3GGWB 2KPNA 5JTWA 5DQDL 3INUL 2F74B 3SOBL 4NM4H 3ZKND 2AEPH 3SKJH 3I3DA 4QF1A 4IBLT 2R0KH 4OZFH 5CEZD 3C08L 1AI1H 4KVNH 1OOAA 1T0NB 2F53D 3NFNB 5IVNA 1M05A 1P9MC 5DTFA 1JWMB 3B5HA 4G9FA 2DICA 2ZUQC 1VGKB 1TLKA 3G6DH 1DL7H 1IAMA 2GITB 3ZZ1A 2IPKB 2HTLD 4LPUA 2FHFA 5F3BA 4N8CL 4OCRH 4FN0A 5IEHA 3DXAB 4TSCL 4X5WA 1EFXB 1DP0A 5JPNA 2W9DL 3LMJL 4NGHL 4HS3A 4YR6A 1A6VL 5H37H 1L7IL 3BPLB 1OP3K 4Z7UE 5FF6A 1IQDB 4HWEH 4LEOB 4F2MB 1ZANH 3TO4D 3AB0B 3D85A 3FONB 4G6ML 4ZYKB 4TPRL 4L3ED 5DQJB 1MFEL 2CGRH 2B1AL 2YR3A 4PY7A 4XBPB 4HXBH 1ZLVK 1E27A 2VLLA 1BWWA 3BXNA 4AYFA 3QDJE 5KSUB 3A0OA 4YJZL 1JI1A 1DVFB 2VN7A 4JRWA 4PYHA 2WV3A 3B8SA 4LSTL 5F9WB 2FWOA 1IT9L 1IE5A 2JELH 1J1XL 1NCCL 3BWUC 1UWGH 4EKXA 3KPTA 3V6FB 3LRSB 1SY6A 2XZCL 3HI6H 1QBAA 3GSOB 5DS8A 1WCBB 4RZCA 1U8KA 2G60H 4IMKA 3N9GL 4Z95H 3IT8D 4DJMA 2F9BT 3WFCH 5J3HC 3OR6B 1A1MA 1S7WB 4NZRL 1XCTA 3NTCH 4OFYD 1UZ8A 4OD2B 3CFEA 5DD0H 4CVZB 3D0VA 4YDKL 2D4DA 3M8OL 4NCC2 2G75B 1M71A 1BQSA 3E8UH 4HS6B 1F3DH 4XX1E 5J6HA 2VR9A 4JB9H 4R9HA 1E4JA 2B2XH 3QDHA 4WHTA 5FYLE 2NNAB 3PWPD 4XPGH 2IPTH 3WD5L 1KGCE 1ZHBB 1GZPA 4POZD 2YRPA 4DKFH 5T33L 1HILA 4HC1A 3RWFB 3FO2B 3VGHA 4MXWH 2GSIB 1EO8L 5GRJH 3RBGA 4G5ZH 1YECL 2FHCA 3STBA 4HULB 4YO0B 3RPKA 5D72L 1NGZB 4GG6A 2KQMA 1R3LA 1S9KC 2PXYB 4PV9B 1TQBB 1DBML 5I6XC 3BN9C 5H94B 4BJLA 4KK6C 3MNZA 4ZS7H 1GAFH 4GG6F 4X83A 25C8H 15C8L 3MBXL 3VXRE 2ZCHL 3VFVA 3EJYC 4K7PL 4NO0D 1FFOA 4UINH 3WFHB 4HIEA 4KK9C 3P4NA 3D18B 4ONFH 1J1OL 4CU7A 3MRPB 4JN2A 3BJLA 3RKDD 2JCCB 5JHLL 3C6SB 4HIXH 4BUHA 4DZ8B 4HUUB 1A1OB 4B7LA 3FB6B 3NCYS 5J12C 3WIHA 3ARRA 5A2JH 2VXQL 3JTSB 4NRZA 4FQIH 3RTQA 4U49A 4YXLL 4NJAL 3WDJA 2WBJD 4HUWA 4QTHA 1N4XH 3RVTC 1AO7A 3UTSD 1AFVH 4GW4A 3FT2B 4A6YA 2WIIB 3MJ9L 4GG8B 2FD6H 4P49A 4NNYA 3KYOA 1KFAH 5TPWH 1F8TL 4Q0XH 1W72L 3JV6A 5HHNB 2GY5A 4Q9QL 5LGJA 2ZUXA 1ZVHA 5E2TH 1RK0B 1HCVA 1SYVB 1TENA 4X7SH 1L9MA 1CLOL 4U1GC 3QIBA 1WEJL 1QFHA 1X6LA 2EC9T 4I18A 4JM4L 4IDJL 4PBXA 4XZUB 4KK6D 3P0GB 4HBCL 5K59F 1A7PH 3MRHA 2FRGP 3CVHB 2MHAB 1KTLA 3EIFA 3QJHA 3EJYD 1A47A 1QR4A 2H1PL 1K4DB 2BY2A 1CE1H 3LKPA 2IG2L 3C5JB 4KK9D 2HRPL 2VLRB 2DKSA 1I8IA 2G9HB 2IBZX 4UTBH 2FR4B 3HR5B 1A6WL 5D7LE 1YPZB 4KTDH 5HGBB 5GSVB 5I74B 5B8CC 2Q8BL 4ODSH 4OZGB 2DQUH 2IFGA 3QDMA 4JCLA 4NUJA 1I1AD 2Y07L 3VXOA 1D5IL 4WI4A 1GSMA 4YDJA 5EOQL 3EGSB 3RVTD 1TZHB 5DUBB 2BSED 1QSFE 4PRPE 4GRMA 4PJDE 4WI8A 4X99A 2D0HA 3L3DB 1UEYA 5B39A 4R90H 5EORH 5TFSH 4KRLB 5HVWA 5KG9A 5DC9B 2YHGA 4KVCH 1T5XB 3V6OE 1P1ZB 5EH1A 5EO9B 1R5IB 3KJ6H 5I8EA 4M8QB 2QBWA 1CK0L 3KLHD 4PJAE 3NFSH 3RZCC 4HZAA 2C1OA 4KUZH 4MA1B 4P5TB 2ZOLA 2X41A 3HR6A 3RWJA 3T04D 4ZXBC 1RPQA 4OM1L 3MRKB 1BD2D 3RWIA 3PL6B 3ULVE 4GAYB 4P9HH 3VJ6A 3SCMD 3TZVC 2LAGB 3PIQB 2OJEB 4GSDL 3S37X 2C3WA 1BFTA 1ADQL 4PJBB 4RMTA 5GGSB 4A2MA 5DD1H 1CXKA 1KYOK 3MUHL 1H3GA 1OAYH 3DETC 3SDYL 1KJ2L 1N5AA 5EG6C 2LABA 4JO4L 3FB8B 5IFHH 4WHYH 1QRKA 3OB8A 2H8PB 4YE4H 1JF1A 4DN3L 1JNNH 3BI9X 1DBAH 2EIBA 1ZTXL 3IFNH 2P42B 4HMCA 4RRPA 3L3HB 4EUPB 4KHXH 4NQCA 1MLBB 3F58L 4R26H 1J5OL 1U91A 1CL7L 1M1SA 4X6EB 1NUGA 4IRJB 4QLRA 4JVPA 4PJ8C 4LSPL 5I1IL 1U58A 3JVGA 4LASL 4M1CD 2Q86B 1YEIL 2ESVA 4Y4KD 3UYPA 4FQ1H 2X05A 5T1DH 2DQFA 3MNWA 4S10A 3AU1A 3OX8B 1XIWB 3VH8G 4N9GB 3WXWL 3ZTJG 4HV8B 2XPGB 3B9KD 4FQQA 1ZLUK 5HYFA 4QRTB 1G7QA 3I6GB 1INEL 3RZCD 2BSRA 1LGVA 2YD2A 3PUCA 3EFFB 4LVOC 1B9ZA 2E7LA 3P4MB 4MB5A 1Q1JH 1H3WM 2A77L 2BVUA 1HK6A 4GRWF 2IANE 2DWEA 4MAYA 1UWEH 3TZVD 2F5AL 1JZ3A 3B43A 3ZDXE 2QQNH 3ZE1F 4BH8B 2HTKC 2DQTH 4HXAH 5K33A 3QR2A 2OL3A 1A64A 5HPMB 1CICC 1U8LA 3DETD 4BUGA 2DQJL 4D9QE 1SM3H 5F6IB 3RWEB 2HG5B 3QPXL 1X4YA 2P45B 4PGJA 3SGKA 1OP9A 3TA3C 3MR9A 3OGOE 5JXAL 1T03H 1A9BB 1OT1A 4R4BB 4I3SH 2PW2B 1U6AH 3DJ9A 1YMMB 4G8FA 2JJTA 1T1YB 4FNLH 3KPRE 1E28B 3V52L 2E5EA 4OBSA 4DCQB 2CK0L 1JGLH 2DM2A 5K9KA 3WYRA 3RU8L 3SGEI 4PRHE 2VZTA 4XMLL 3NPSB 4WFHE 4PJ8D 1WIUA 3VFGH 1AD9B 3MREA 3LEVH 2H6PB 3B3IB 2AQ1A 2QSVA 4HJGA 4M5YH 3QI9A 3ZSSA 1NPUA 5C6TH 1KC5L 2FATL 1D5ZB 2OMBA 1YEFH 4NDMB 3VXPB 3O3EA 1YC8A 4ETYA 4HKZB 4YPGA 2R8SH 3HRZA 1CGVA 1JE6A 4YHIA 3DVNA 1WBYB 1JNHA 1OW0A 4GQ9L 2OP4H 4KI1A 3MJ7A 1DUZA 2HTKD 4LQ1A 3V2AR 2GK0A 4ZUUB 3VRJB 5KVMC 1CICD 5FOBA 3IJSA 3OR7B 2DLFH 2OBGA 1WZMA 4P46A 2XI9A 2VH5H 1I8KB 5T3XE 2BC4A 5D1QC 5HYJB 1LVEA 4LCUA 4CJ1A 3BO8B 2BERA 1A2YB 4NC1C 1MIML 3F5WB 3SGEH 2BMKB 4NM8L 1CFBA 4OGXL 1BEYH 2WQRA 1A7NL 2EKSB 1ONQB 2BNRB 4KV5E 4PTUB 3QG6A 1J11A 2C26A 4G6JH 1FO0L 2RBLA 3MRNA 4RFOH 1NH6A 2WANA 5FO9B 1KPUA 4Z76B 4H20L 4MGXA 1DJSA 2EDLA 3IDJB 3ULSB 2AJUL 3GHEH 1DQJB 2ZCKL 2GAZB 2VSDA 4RMRA 2YKLL 5LAXB 1TETL 4Y1AE 3LS4H 5DK3A 2H9GA 5DFTA 4NO3B 4DZBA 3VD4A 2F19L 1FSKB 4R7DB 2VDOH 2VXSH 2X9XA 2XA3A 5T1KB 4GXVH 2B4CH 4CDGC 4MCYB 3BP4A 5IJVA 5BS0A 3QFJA 2IAMC 4D3CH 3MRFA 4M48L 2MKWA 2ZKHL 4G42A 5AAMA 5DUPL 4UTAL 4Y19D 5L2JB 4QRRE 1DUYB 2FB4L 3O81A 3R0MA 4C55A 3IDXH 4EI5A 5D1QD 1FQ9C 2PW1B 5T1LD 3VRIB 4MJ5B 3LN5B 3L3IA 3BH8B 5IMKA 3STLB 4TVPD 1JHKL 1XF5B 1LK3L 2W0LA 3PWNB 2MKLC 4LVHC 4NNXB 5I9QB 2W07A 4HLJA 4QRQA 3VI3E 2VZSA 2HFFB 5EIIA 1S7TA 3HPJB 3KS0H 2N4IA 3T1FB 4WU7A 3T2OA 2GSGB 1RUAH 2IBBA 5SX4H 2QQQA 3NFPA 1SQ2N 2DAVA 3O6FB 3WHXB 1M7IB 2P5ED 2QSQA 1NBZA 1QPPA 2JE8A 2NY0B 2I9TA 4RFNB 1NFDE 4DGYH 4OD3L 2BVOB 3IDYC 2Y5TA 1U3HB 1XGYH 5HGHB 5CJXA 4Y7MA 5DMIH 4DTGL 1RZJC 5DC4B 3MV7E 4QXTA 2IQAB 1BREA 1WAAF 2VC2H 2VDKH 4N8PA 1IGCL 1TPXC 3EFDH 4OCMC 2VN4A 2FJHB 3QO1A 3OJDB 4DUXA 5L88L 3KPSA 3ZKSD 5FO8A 2BRRL 4NKMA 2C4FT 4UB0H 3QWOB 2YXFA 4LRNH 4ERSL 5D7LB 3DYMA 4KFZC 5KJRL 4LDLB 4U31A 1WICA 1R5WB 1MOEA 2M8XA 4HJJH 4NKOA 4HHAA 3QIUA 5JA9A 4TOYL 4Z7WA 1UC6A 1ODAA 3O6KL 3L7EB 2DLEA 5DJYA 5I76A 2X4UA 3MFFB 1HWGB 3W9EB 3TBSA 3LY6A 4PRPB 4ZAKD 4MNHB 2DIJA 1CLZH 4JFEE 4OLZL 5C08E 1BIIB 3ORJA 5KSAB 4L9DA 1JHLL 1N2RA 1Q9LB 2CKBB 3B9VA 2VKXA 3U36A 3S4SA 2A6KB 1S9XB 1CGTA 3MLXL 4TTDC 1AGCB 1S7UA 4CRPA 3SDAB 3L1OL 5L0QC 2VR4A 1Q9WA 4Y88A 4PGZA 1LK2A 1CD1A 5BV7L 3CFBA 4JZOA 4AQ1B 1G9ML 1QFPA 3MCKB 4JDZB 5C86A 4Y5YB 2DM4A 5GGUA 2AEWA 4MA3A 3WKMH 3K8KA 1NAMB 5CWSB 1IQWH 1XF2B 4G8EB 4KI5E 3REVB 1FBIH 2YN5A 3U4EA 1A1NB 1MCWW 5J8OA 1W8NA 5GHWH 3O9WA 5GGVH 3GHBL 5IHUL 4MCZA 1NGXA 2X2YA 5KZCB 2BCKB 4MD5A 4JM2B 1MCCA 2RJMA 4J3WA 4GW1B 4C4KT 1FCGA 5CAYB 2J8UB 4IRSD 5DUMH 5ANMA 4LCYA 5GRXG 1KEGL 4OZHB 3JV0A 4L5FH 3VDAA 1KXQE 1HNFA 2EE3A 3IGAB 4HWBH 3UJJH 3GMOA 5DZOA 4Y4FA 2CIIA 3GSNL 3CZFB 3DO3A 1NGYA 4KU1A 1S3KH 2JTDA 1KB5B 1JGDA 2HVJB 3E2HB 3ZL4H 1D6VH 4TTDD 3IFOA 2ZSWA 1GL4B 2VZUA 3K4AA 4FFVC 1TJHH 3KYNA 1V7NH 3K2UL 4NQTA 4S1DC 5F7EL 3UXFA 1RFDH 5TQ2L 2EH8H 4GKOA 1PAMA 4TSAH 1NCUA 4MWFB 4O2FB 5DYOA 2P7TA 3E3QC 3DUUB 1W2KT 1DDHA 1YEHH 2GQHA 5KSBB 5SX5H 2D7TL 5I16A 4RWYL 5J9PA 1JK8B 1U8OA 4TNVK 1QEWA 1M7DB 1HKLH 4IS6A 4P3CL 4P4RA 5DD6A 4POYA 4PPTA 4H25A 2YXMA 1GZQA 1SBSL 2HLAA 3RNQA 1QLEL 4G6AC 3I50L 4OFPA 4MJID 3DECA 1XGUA 5F6HI 4FZEL 4K9EH 4IIQB 4I9WE 2DQDL 2LQRA 1BAFL 1CFNB 3TYGL 4IEFB 5I1AA 3IKKA 4QXUH 4RX4A 5ICYA 3CU1A 5E1HB 5I1LA 1HH6B 3LSOA 3VD9A 1G7IA 2W1NA 4XNQB 5J13C 3LPGA 4L8BA 2KH2B 4L4TA 4JFHE 3Q6GL 4Y2DC 4PJHF 2R9HC 3IDGA 4D9RE 5L2KA 4M6AA 1LE5B 4RQQA 3VA2C 1MY5A 4WWKD 4OSUL 3NIDF 4ESKA 5BQ7B 4UOJA 4NQED 3T4YA 3BGAA 4KQ4H 4UAOB 1T1WB 2F54B 3G04A 3MRIB 5FK9B 4KJYB 3LRHA 5HHME 1BZ9B 1PZ5A 2PYFA 4KKAC 2CRIA 3LPWA 3S35H 3BD3A 3H7BB 3WE6A 3EYSH 5E08L 1G9NC 4Z7NE 5DJAB 2WP3T 1J05B 3U30C 2F53A 3QWRD 2HKFL 3KXFD 5IR1B 4S1SH 4I0PC 1JPSH 3CSYB 2G5RA 2D7OA 4PRAA 1RQ5A 3DBXB 3SBWC 4LCWD 2W65A 3LHPH 5DJ0A 2CDEB 1V3KA 5D7IE 3ZE0E 4NQDE 5MI0C 3ULUL 5D6DC 1R3HB 4G6AD 1IC4H 4TSBL 5EU6D 4PREA 5FDWA 4FQPA 1G7PA 1L7TH 3QULA 4M5ZH 5CUSH 2Z8VC 4CDHA 5E2UL 3DRQA 3HN3A 3MMEB 1P4IL 5DWUH 3GRWL 4OI7A 2ORBL 4MNGE 1MCBA 4N0FA 3MLZH 3QP3A 2XYCA 4Z5RA 4G3YH 5GJSH 1AXTH 3WIIH 4LHUD 3VCLA 4L8DA 2NY2C 3GJFK 2M26A 4YUEL 3L5XL 3CVHH 4XCNB 1KCKA 2R9HD 3JUYA 5GS0L 3TO4A 2FO1A 1A6ZB 3VWJD 3X3FL 4WJ5A 1FE8L 2GJ6D 3O3AB 4LL9A 2OM5A 1EEYA 5J6GB 1DR9A 4L3EA 4LLVA 1NCDL 2VWEE 3H6JA 4EUPG 1RAMA 4S2SA 3F7YB 2EDYA 3U0WH 5HVHC 5I8KL 4KKAD 5DR5L 2OK0L 3T2PA 1LD9A 4WI6A 1AGEB 4HS8L 2F5BH 4BKLA 1V3JA 1NMAL 1G6RL 3V5HB 1A6UH 1JUFA 4RGOL 5SWSE 1T80A 1QBBA 3D3VD 2Q8AL 3WN5B 4KRNA 4NNPL 1X5FA 4K94L 2I24N 1E4WL 5F1OB 5CJ8A 4OFYA 2P43B 2BNQE 1MY7A 1BQLH 4FQJH 5KVGH 5IMMB 4YX2H 1MH5A 2R4RH 3QRGL 4DWHA 3MV9B 1P7QD 2GI7A 4MVBC 1VACA 4YIQA 3QQ3A 2XXCB 1KLGB 1OGTB 4MX7B 1XR9B 3QXDA 4LNRB 1YEJL 3PWPA 2AGJL 4ZDHA 1AGFA 4U6VL 3D9AL 2ZUTA 2YPKB 4JHBA 3H8NA 4H8WL 3GNMH 4I48A 4KWUA 2OX5A 1RK1B 5C07D 5GZOD 1CDIA 2HJLB 3RIAK 4U1NA 3QO0A 5CP3H 5FECB 4S1QL 1TIUA 2EEDA 3O6LL 3GI9H 3GDBA 1QSED 4EUPH 3S98A 5HI4C 4NYLB 1LO4H 3IFPB 2GT9A 1KCRL 3ZYOA 3FQWA 4NO0A 1N5YH 4AL8H 3QUKA 1JHTB 1T0PB 5DC0A 2XKUA 3GSRB 2E9JA 3EOBA 3MROB 2JJUA 1E6JH 3K8MA 3IJYB 3GK8L 3GSWA 1MHEA 3DURB 3KYKH 4NCDA 4ONGH 4DGIH 4PRNB 5DVOA 3I84A 1RZKC 4IMLA 4NOBA 1ZHNB 3L6FB 3MLYL 5F89B 1OGAD 4WUKH 4N8VB 5DHYA 3UZEA 1BGXH 1MAKA 4G9FE 2WBJA 2ZG1A 3UTSA 3RAJL 1I7TA 3BKYL 4HUXA 1B2WL 4Z77B 4P57A 2QTEA 4GAJL 1F3DJ 4D8PB 2X4SB 1Y6NR 3VU2A 3FT4B 1TVDA 2V2XB 3EOTL 5IB3A 5ECJE 4U6HA 3BWAB 4QRPB 4ZNEA 4LKCB 3VFTB 1C7TA 1IGIL 1EIBA 1SJHB 2Z0BA 2P8LB 3CFCH 1R3KB 5HI3C 4M7JL 1T89A 3OGCB 4TUKH 4LFHD 1C16A 4Q6IC 5HI4D 1U0QA 1C5CL 2LVCA 5CHNB 3DGGA 2V7NB 1LWRA 2Q76A 4V1DD 3JUZA 4AIXA 4IOFC 4MYWB 1ZLSH 3T0AA 4B5EA 3LEXB 1BVKA 1J9CT 5IHZA 1OCWH 1HXYA 2FYYA 5FHAL 1C1EL 4IOIB 4NJ9H 1T22B 2LV4A 3FHAA 5DMGC 2PTUA 4JPIB 1X5ZA 4M7LH 1RZFH 1QR1A 1MHPL 1W72B 3HAEA 4M43H 1GHFH 2B0SL 1WBXB 5KN5A 1EPFA 1I1AA 1LP9A 3RY6C 4CW1B 4UV4H 2R2BB 5HYQA 4HD9A 3NZ8B 2ICEB 1U8MB 3RY4A 5HY9B 1LP9F 4X9IA 1AP2A 5JR1L 3WJJC 1UACH 1I7UA 1AD0B 1ES0A 1RJZA 5J0BA 1IGJA 1UXWA 2Z91A 5C2BH 4UT6L 5DA0B 1REIA 4K7PX 3MSPA 3GSQA 1OPGL 1MRFL 5CEXA 4P23C 4WU5B 4YGAB 5BMFH 3H9YA 3GSUA 4XPTH 1J12A 4LPXA 3P77B 5HI3D 1S9YA 3O41B 1BD2A 4CGTA 2B20A 1UWXK 3CX5J 1CLCA 2VDQL 1RULL 3EYFB 3SCMA 3I2CL 1LO3L 3MJGX 5EZOH 3MGAA 4HIHB 3ARDC 4M03A 4M6MH 3CCHA 1HIML 3ZDYF 2VISB 4GG6E 1NC4D 4LEXL 2XWJA 2ZUWA 3UTTD 5C0NC 2IALA 4X80H 5B3JF 4KRPC 5C9JA 5HDOA 5DMGD 1DQLH 5JPMB 1MRDL 1D9KC 4ODBD 4MXQC 2NY3C 3SKMA 4J1UB 5B8CA 3AFLA 1P69B 3BKCL 3U9UA 1P2CA 1MAMH 2X5PA 3FQXA 3QDAA 3GSXA 4ZSOA 3K1KC 4NFDA 4RAHA 4K55A 3C60D 3VXSD 1T5WA 3BPNB 4KJPD 3CXDL 2BSSB 1U95A 2ZNWA 2IMMA 4JLRA 1FFNA 4Y4KA 4G80B 3X13B 4OCYL 4H1LB 3UCRA 3PHQB 3ZLQC 3QIWB 3ILPB 4NUGL 3K46A 3B9KA 1MREH 4LRIC 5C71A 1S7SB 5EZJB 3PWJB 2WWKO 5GSRA 1PQZB 2BVTA 2EDKA 4U1JA 4P23D 3RZCA 1AO7E 1VERA 4ONHA 1KJ2B 4HGWB 3MRJB 1CLYH 3QRFM 4XCCL 3TWCL 5E0QA 2LAAA 5C70A 1DLFH 3TZVA 4J4PC 1JZ4A 5DO2C 2X4PA 5I15L 4NRXB 4BH7B 3ARDD 4JAMA 3EOYG 1XGPA 5C0ND 1KTDB 3WS3B 4B0MM 5IMLA 2KBGA 1FCCA 1PZUB 4M61A 4CNIA 2DLHA 2Y06L 3JWDH 2W9EL 3VWKB 2FDBP 2YD6A 1EO5A 3CLFL 3U2SA 3PP3H 1D9KD 4MXQD 4GAGH 2NY3D 2VRAA 3IDMA 1OB1A 5F9JB 1CIDA 3WL9A 3V4PL 5IBTL 4K71C 4OF7A 5I2IB 1BM3H 4F7CA 3D0LA 1MF2H 1UH3A 4CVXA 3SDCB 3TT1H 2JIXD 4DEPB 4XC1H 3TIDA 1ORSB 3L3JB 2AJYL 4PJ8A 4TNVF 5IGXH 3S88H 3KNBA 2OSLB 5HGAB 5DJXA 4K8RC 1UVQB 1K4CB 1HYSD 2R2EA 3S8WA 1HSAB 3BJ91 3P11H 5HHPB 2GJJA 4G7YL 3DI3B 3MLVL 3QDME 5JLZA 3C2AL 4M4PA 4YHLL 2OTUB 3THMH 1S5IL 1KENH 1S9VA 3BGMA 3QQ4A 5FHBL 3HFML 3VD5A 1RMFL 1RV6X 3FFCD 1WVZA 1FN4A 4UQ2B 5GGQH 1TVHA 2V7HB 1HKFA 3TIEB 4G8GB 4JRYD 1VFBB 4G6KH 2XNAB 8FABB 1IRAY 3S34H 3FT3B 3MRGB 4HWZA 1B4RA 3LKRB 5INDB 2YPLE 1I8MB 1EJOH 5C0CB 5ICZA 2CKBH 1QLRB 4EXKA 1K5NB 1KV3A 5C0DB 1CICA 1ZGLB 3VFNB 3P9MA 3SJVE 1PX3A 2ADGA 3LKQB 4GT7A 2RCSH 3EJZC 3U79A 2VL5A 2W0FA 4APQB 1SJVA 4QYOA 2Q7YB 1F3JA 1WBZB 4H88L 4BQ6A 5D7JC 3HI1A 4XHJC 1WT5A 4N0UB 3ULVH 4JHWH 3LIZH 1C5BL 2QV2A 3BIKA 1MSPA 1QNZL 1HHKB 4PJCA 1NAMH 3MXVL 5SV3A 1S7RB 2PYED 4JFYB 4DAGH 1IM9D 4JHAL 4JO2L 4ORGA 3BSZH 4K8RD 5T5FH 1T20B 1KTKE 3BKMH 1F4XH 2CLRB 4O51A 2UZXB 3SGJA 4PJCF 2R15A 3QXTA 1I85C 1UXSA 2X4NA 3O2VH 4KAQL 2W60A 5J89A 2GCYB 2X7LA 4RBPK 4OIBA 4NQCE 1FJ1B 43C9B 2ZZUT 3FO1B 4NKDB 4PJXB 3U1SH 5L6YH 3Q0HA 3KDMB 3GJFA 2V5MA 2GTZB 4M6NL 2ESVE 1WC7A 4I2XA 4ZFFA 2A1WH 4YHML 4OBRA 4JFXB 5C6PB 4R7NB 3T0ED 1ACYL 1CU4L 4GRWE 2OR7A 4GFTB 4MQSB 1FO0B 4Y19A 3V4VH 4H0IA 4PGBA 3CSBA 4GMTL 5BRZB 3ZE1E 5ADOL 5D1QA 5D2NC 3EJZD 5T1LA 4OI8A 1I8LC 1DFBH 2ADJB 3GSNA 4I5BA 4GBXC 1UCBH 3ECBA 1F4YL 4X6CB 3BEVA 5ID1A 5D7JD 2C3HA 4XHJD 1OLZA 2ICES 1K3IA 3T65B 3GBNL 3G5YB 4ZODA 4YBLB 1O5DT 3FQNB 2VXVH 4ZD3H 3VG9B 1AIFB 3ARUA 3G6JA 5B38A 3A6BH 4E42A 3KPNB 4W6YB 3RNKB 3GKWH 3FQUB 3G6AA 4P2RD 1NJ9B 3GMNB 3SKJL 5T3ZE 2P5EA 4NWUH 3P0YL 4KVNL 4XXDA 3O8XC 3BGFB 5ALCL 2DS4A 2VLKD 4LLDB 4MNQD 3I6KB 5ACLA 3WLWC 1VB9A 5I19L 3RL2B 3A6CH 3GMPA 5TH2A 5TDPB 3NA9L 3MCG1 1GGBL 1CFQA 3GO1H 3BVNA 5C0BB 3JBG7 4AENA 5ERWA 5DZLA 2IH1A 4PJFA 5C0FA 4L29B 2DTMH 3UC0H 4XNYH 3NA4A 3RA7H 2CJUL 1T04A 5F7HA 1QFWM 1R3IL 4X8JB 1QKZH 2AV7B 1YQ2A 3O4LD 3TM6A 5C09D 4RNRA 4JFDB 2M1KA 5EBLB 2O5ZH 3CDYA 1NAKL 3RIAF 1CQKA 1ZANL 1OTSC 1KIPA 4ZAKA 1MWAA 3SPVB 4TYUA 2DB8A 1UJTA 5I17A 4FFZH 3T1WA 2CGRL 5ITFB 5DVNA 3UBXB 1I7ZB 4F3FA 5T3XH 3KS0J 3JV4A 1MJ7H 1G0YR 2C1PA 3S96A 4W4OC 3KPMB 2JELL 5FEBA 1W0VA 3AREB 3QUXB 3O8XD 4N9OB 2CDGB 1CDYA 1Y18B 2K1MA 3B2UC 3Q6FB 4GLRI 4KDWA 5EBWA 5IK3B 5F88B 4WW2C 2G60L 2FO4A 3INUH 4MDIB 4J3VA 4KROB 3EO0A 4QOKB 5IW6B 4R3SA 4TVSa 3BZEA 5JA8B 1FL6A 1PVHA 3C08H 3H9SB 5EBMA 3UPRB 5E56A 4FTVD 4RMQA 3EYOB 3T09A 5DD0L 3DMMB 4ZQKB 4JVUA 1G7MA 4L8CB 4IRSA 3IDIB 5C0AD 3V0VB 3QFJE 3OKNA 5CBEA 1FVEB 3CFJB 1PKQA 1NGPL 1NDGB 4WNQB 1OTSD 5BV7B 4XPGL 3ARGC 4O9HL 1XFPA 4P4KC 4CN1A 3IVKA 1BZ7A 3IRZA 4N8CH 4JZJC 2VDML 1W0WB 1FZJB 1N7ML 3PWVB 4G5ZL 5D2LA 4TSCH 1ZSDB 2AXGB 2W9DH 3LMJH 5IF0A 1RI8A 1FYHB 4NGHH 5KVDL 1A6VH 4HPYL 5AEAA 5HXMA 1L7IH 2Y72A 4YFEA 3BUYA 4ZS7L 1GAFL 3ROOA 5AD0B 25C8L 4XB7A 3DX8A 2JJWA 5FGRA 4N8VG 1A6TB 1TQCB 4DKDC 4PJ7A 1H8OA 2AKRA 3B2UD 4NBXB 3MOBH 1H3PL 1XGRB 3WNOA 4ODXB 2E27H 4PJ7F 4W68A 3KPQB 2ENYA 4L9LC 4LSTH 1A4KA 1IT9H 1J1XH 4FFYL 1MLCB 4MJIA 3HZYA 5JNYA 2MJWA 4NT6B 3P3YA 1HSBA 3ARBC 4AY0A 1Y6MR 3UTQA 3UTOA 3L9RA 4HK3J 1H0DB 2ITCB 3HNVL 1JPFB 3N9GH 2FGWH 3ARGD 2FD6L 4P4KD 3HE7C 1BBJB 3H0TB 4UDUB 3T8XA 1IEBA 5I1CL 2JF1A 1XF3A 3MYJB 4NZRH 4DN4H 5E2TL 4Z7WE 4F7PB 4YDKH 4P3DA 2R0WL 4WW1B 4U1IB 3LDBB 3TC9A 5MENB 4WWKA 1GC1C 4OCNC 4NQEA 3EJJX 5EOCL 4E5XB 1XCQA 5KVFH 3OKOB 1A7PL 4X98A 2I9LA 3ZYIA 1Q0XH 3WD5H 3GB7A 3IKCB 1A4JA 4HKXA 5JMRA 4NQXA 1RJCA 2XTJE 3RBSA 4JFPB 3C9NA 1CE1L 3CJJA 3LCYA 4OGZA 1CCZA 1EO8H 2YPLB 5D72H 4N68A 3D2UD 4K3HA 4ODWB 3QWRA 3KXFA 2Y7QA 4L1DA 3X12B 2BJMH 5IKCA 3SJVB 4LCWA 4YFDB 3C6LB 4KTDL 3QNZA 4ODSL 2ZCHH 1NEZB 5EU6A 5GQBA 2HFEB 5IFJA 1F5WA 2QLVB 3VGEA 5JO5A 1HHIA 3ARBD 4AEEA 4MD0A 5HHQA 1N8ZA 1T6VN 2VZ3A 4WUUD 1Q9OA 4NSKA 1T66C 4Z0BL 3TVMC 3Q48A 3HMXA 1J1OH 3MGOA 4JQVA 3ZTNL 1RU9H 4XHQA 5EORL 5JHLH 2Z9TA 1LO0L 4J6RH 4JN1H 5JQ6L 3BHBB 3P4OA 1TNNA 1U8JB 4KVCL 4LHUA 3VMPA 1A7QH 4O2CA 4PJ5D 3ROLA 4LARH 2EIZB 3VWJA 4YXLH 4NJAH 4PLKC 5ANME 5FKPB 5DT1H 2GJ6A 4K3GA 3QUZB 5JW5B 3DIFA 2XWTA 3I6LD 3BRDA 5SWZD 3MJ9H 3IFLL 1KT2A 4LF3A 4UT9L 1F8TH 1FYTD 1W72H 3FB5B 2NW3A 5DURD 3VXQB 1DN0A 3F62A 3BYTA 3VE0A 1BX2B 2F15A 1OAYL 1FNEB 1ZEAL 1TTFA 4PBWD 4POUB 5EU3B 1CLOH 1P5VA 1OLLA 2P47B 4H1LG 4K3DH 5A40E 1WEJH 3BP7A 4RCAA 4IDLA 1CE6A 4IDJH 4HQQL 3OAZH 3L5WA 5CD3B 3FN0H 4HBCH 1JNNL 1EAJA 1DBAL 3NN8B 3BT2L 3D3VA 1OP5H 1K8IA 1U92B 5D6DA 3V7AG 2VXTL 5F6HJ 5EFIA 4DUVA 4KHXL 2DL2A 2P4AB 1NCBL 2H1PH 5CBAB 2J8OA 1R5VB 2IG2H 1T66D 3TVMD 4DVBA 1JWSA 3F7VB 1CIUA 2VABB 2PKDA 1U42A 4HKBB 3VG0L 2CLZB 2SEBB 5T1DL 2PUQT 5E8PB 1KPVA 3R8BB 4XB8A 4KUCD 3FZUD 1P7QA 4P2OC 3AY4C 2DKMA 5AUMA 2Y07H 2X4RA 3QDGD 5F7YC 1IAKB 4LSDA 4X4XB 5EOQH 3VFOA 1G6RB 1XH3B 4J3SA 2Q7NA 5F21B 5SV4A 5FOJA 4JY6B 5AZEL 4PJ9C 2XN9B 1UWEL 5C07A 3NIDE 4HJGB 4I4WB 4L4TE 5FGSA 1BFOB 2IH3A 4HXAL 5GJTL 2CD0A 3L3KB 4JJ5A 1CZ8L 1QSEA 5L2KE 1OT2A 2XQBH 3X17A 1CK0H 3N85L 1WWAX 3CAFA 3FCTA 4E41E 3FOMA 1GOFA 3CX5K 4OM1H 1T03L 1VCAA 4I3SL 2D7QA 4ZUSB 1QO3A 4PB0H 5FYKU 4GSDH 4OB5H 5TE4H 3HUJF 4KKCC 1IAOA 2ZCLL 3TBYB 1I1CA 1ADQH 1JGLL 5ABDE 1Y0LB 2F53E 2HYMA 1DANT 4JRXB 1DLHB 3QEHB 3QHZH 3SDYH 4LAQH 1KJ2H 1OGAA 3FN9A 4LSUL 4U1LA 3BKJH 5EUOF 1U8HB 3PHOA 5HI5C 4DN3H 5DEGB 5BJTA 1AGBB 1R24A 4CN4A 2NY1B 5DQ9A 1VFAB 4PRBB 4FXLA 2V5TA 3OXRB 2BOCA 3FB7A 3V5DA 3WFBL 5DRZA 4QKXB 3MJ6A 1J5OH 2FZ3B 4LIQE 3Q5TA 2GY7B 4H26A 3VXNA 4LSPH 5I1IH 4UQ3A 3VXMD 4LASH 1YEIH 3AB0C 4PJ9D 2OP4L 3MLTB 1FL5B 4G6FB 3WXWH 1ZVYA 5CP7A 3BESR 2G2RA 1JJUA 5CMAB 1HH9A 1SVCP 2NXZB 5H2BA 1BVZA 1ZA6A 3BZ4A 1INEH 1JV5A 4NZUL 3CU7A 3VXUE 4L3EE 3G9AB 4V1DA 1DVFC 3MA7B 1DEEB 5D9SB 5E2VL 5F9WC 4GW5B 5GRYA 4FABL 5IJVB 2F5AH 4NQSB 2DTSA 4KKCD 1SJXA 3LS5L 1G7LA 2F58H 1KG0A 4G6JL 4I77H 1DQML 3KPOA 4RFOL 2EEAA 4OUUA 2CIKB 2DQJH 4ZOCA 3V8OA 1OD7A 2YD5A 1NGWB 4LCIH 4ZUVA 3NIFF 4OZIA 2R1WA 2FECL 1RZGB 5HI5D 4M62H 7FABL 1MUJB 2NYYC 1D5BA 4UU9B 3DXAD 5ICXA 1EUUA 1A8JH 4GUPB 5DLMH 5TDOA 1EFXD 4HKJB 5F7DB 4DVRL 3EZ8A 4QNPF 1H5BC 3NGBB 5DRWA 3V52H 1BJMA 2CK0H 5JIHA 5TF1L 1YY8B 4P2CG 5JIPA 4ISVB 3RU8H 3TNMA 3MUJA 4XMLH 4LP5A 2IC2A 2DI9A 1X5GA 3FN3A 3QXUA 4L3CB 1XZ0A 1CDCA 1IFHH 4JR9L 3BH9B 4XCYA 1NCAL 3CFDA 3FRPG 4YXKH 5KTEL 1NBZB 3PWPE 2FATH 3CDGB 4Q6IA 2R1XA 3CD4A 4W70A 4YHPB 5DJZA 3HI5L 1T0MB 1DVFD 1IZKA 3WEXB 2H41A 4PGDA 1UB6A 1NC4A 3UTTA 2J6EA 2ICWA 1NMBH 2UWEB 3D5OF 4OQ1A 2N1KA 5F8QC 5D5MA 4C83A 1J7VR 1MELA 3ARFB 3FO9A 1I1FA 1ZT7B 4Z7UF 4CMHB 4JCMA 4NPYA 5D5MF 3WNMA 1RZ8B 5KW9L 1JWUB 4XMPL 4UNTA 3WLBB 1RUAL 1RZJL 2AJZB 3WUZA 3C60A 3VXSA 4M4RA 2HP4A 2NYYD 4NM8H 3GIZL 4QGYA 2GFBB 4OGXH 3BX7C 1A7NH 2EKJA 2H26B 3WJJA 1DE4A 3GKZA 5IG7A 2HT3C 3O2DH 5DMIL 4JFFB 2BNUB 2VDKL 1KELL 2NY4B 5IMOA 4CJ0A 2XTJB 1X5IA 3EFDL 3CC5A 2OZ4L 4P3WA 4P23A 2AJUH 2J8HA 5D70L 3UTSE 2EYSB 3BPCB 2ZCKH 1IMHC 1F02I 1TETH 4LLWB 1YA5A 2X42A 2CRYA 4UB0L 2X1QA 2KZ1B 1MHHB 2PXYD 3WBDA 3Q3GA 3UBXG 3WUWA 2F19H 2P24B 2FSEA 1C08A 1EXUA 3L5HA 1BVLB 3ARDA 2A73A 4ZNEE 1QACA 3T4AB 4AIOA 3WDIA 1J10A 4O58H 4YWGL 3MUGA 3R06B 3FQTA 5AYQA 4M48H 3SKOA 4R6UA 3RJDA 4ZFOL 5DUPH 1V05A 1RZIB 1D9KA 1UJ3B 5TDNB 4UTAH 3UBXI 4F58H 1J8KA 1X5LA 5CIPA 2FB4H 3MNVA 3K74B 4YHYC 3V4UH 2JIXA 1SMAA 2C7UA 4JFQB 5F44A 4Z0XB 4OZFA 1YMHA 1JHKH 3B83A 1LK3H 2YA0A 2O61A 5FO7B 1KUMA 5CSZB 3L95A 2VDLL 4M9OA 3O3BB 3ZHLA 2HT3D 1LO5A 3FRUA 1INQA 4LRIA 1SYSA 1LP9E 3WKML 1VGEH 5BOZG 3FFCA 1F13A 5F9DC 2VJXA 3DTXB 3VMOA 2JK5A 5JOEA 4JRYA 2XIDA 2AK1L 2W92A 3N06B 5MERB 1I3GH 2LFGA 2YBRB 3MV8B 4G8IB 3B9DA 4MA1C 4P5TC 5DF0A 4ETQB 1WCQA 2R2HA 4DTGH 3PL6C 1HNGA 5IW1A 5ESVA 3U83A 3OJ2C 1FNGA 2VITA 4L8SB 4L5FL 3D69A 3VXTA 3UJJL 2V2TA 4U1MB 3ZMRA 5L88H 1I9IL 1RSFA 5J9PB 3ZDYE 2BRRH 3OAUL 2ATKA 4YHOH 2VLRD 5DSCA 1KBGH 3HCVB 3HZMA 5B3JE 2A83B 3T3PF 3TPUA 5DEFA 1HOCA 2I07A 5MEPA 3RWCB 1PLGH 5I30H 3ZL4L 4HC1H 2D31B 4TOYH 4UMGA 2AS5M 2ADIB 4ZUTB 3X11B 3O6KH 2PYEA 4JEGB 4PR5A 4NCC1 3RWDB 1TJHL 1IM9A 5ETUA 4ZTPL 3U0PA 5FUOH 1NKRA 4XRCA 2M2DA 1Q0YL 3IF1B 3O45B 1MRCL 4PJHB 4OGAC 1WTLA 4NO5A 5GRVL 1RFDL 3VFSA 1E4KC 2BVPB 4IRJC 2A6DA 5EWIH 1DBBL 3DHJA 2VZVA 3NACH 5F96L 4Z7VA 1P4LB 1CDGA 1KJ3H 1XIWC 4LPYA 1HZHL 2QQLL 2PO6B 5E94A 2GJZB 1CF8L 3L1OH 4D9LL 4E41B 5F3HB 1J0HA 3LKSB 3MRCB 4M7LT 4Z7VF 2YOCA 5BV7H 1MCPL 3FO0H 4X6DF 3RUGA 2W38A 4P5TD 2QJDA 3T0EA 4K9EL 3VGAB 1UQSB 1QA9B 4HFWB 4OD1H 4XAKD 4BSJA 3PL6D 5IVXA 3WXVH 2OXHA 2ZJSH 3C09B 1LEGA 1ZK9A 3RUGF 1Y6KR 1T1XB 5IVZA 3SKNA 2E6JA 5F9AC 3P9LA 4AIZB 5IVXF 3TN0B 4M00A 3U46B 2VMFA 4DOHE 3GHBH 5D7JA 5IHUH 5F6IC 4PJIA 1OTTD 3GMMB 3LAFA 1MCJA 4PJDF 5EC1B 1NMCB 4RFEA 1QOKA 5J4MA 3W5MA 4N0CD 1F6AB 3VFPB 3MRDB 2P8MB 3CH8A 1KEGH 4PJIF 5MEOB 1BF8A 5TE6H 5IBLC 4JKPH 4OGAD 1I1YB 2QQKL 4JFOA 1NEZG 1UM4L 2VE6B 1I85A 4P2RA 3BDXA 1UM6H 4IRJD 3S35L 2AERT 4JANB 2Q3AA 3RPIB 2VAAA 2HLFC 3PGCA 4YXHL 3SO5A 2HJKB 1XIWD 3AMLA 2KDGA 2RFXB 3UTZA 4TUOB 4FQHA 1JPSL 1ERNA 3OHXB 4Q2ZA 1IAIH 3G5XB 4I18C 3DX7A 4X6FA 2VLKA 3LHPL 4MNQA 3VXUB 1EEQA 1P7KA 2Z92B 5FA4A 5F7EH 5CCKL 1IC4L 4UIMA 5TQ2H 2DDQH 4U4BA 2Q3ZA 5ACZB 1L7TL 4M5ZL 5CUSL 5IT2H 1BJ8A 3D39B 1T4KA 3MRMB 1I7RA 2D7TH 5D2NA 1I8LA 3BOVA 1IC1A 3PABB 2CO7B 4P3CH 2R1YA 3O4LA 4G3YL 5C09A 3WIIL 3HPLB 4AM0B 1SBSH 4WFFD 3CDFA 3BMVA 4FZEH 5JQHC 4XBGB 5FB8B 4R96B 3G5VB 2EDOA 1S9WA 3TYGH 1L9NA 2QKIA 5AZ2L 1YMMD 4PLJC 5I66B 1JGEA 5IBLD 1OF2B 1HHJA 1U2HA 4LVNB 1U9KA 3HNSL 2YD1A 3T0DA 1HDMB 2EDXA 5EU7C 1RIVL 5EPMB 4IRZL 2AJ3A 3MRLB 4KKBD 3Q6GH 1ACZA 1J0KA 2F5BL 4PJCE 1KN4H 3LVEA 4HK3N 4QHLB 2FIRT 2G5BB 3O8XA 3R4DA 4OSUH 5HYSB 1P4BH 1ZA3B 4QWWC 1GH7A 5IB1B 5KVEL 3QSKB 2AXHA 1FSKC 4TNWK 4EI6B 5EU5B 3MZGB 4WCYL 1FVDA 3SGDI 2OQJA 2HN7B 4FTVA 3LV3B 4WI3A 5GRUL 5HJ3A 2Z4QA 2HKFH 4YX2L 4HK0A 4I2XE 5SX5K 3G5ZA 1ZVSB 5C0AA 5IB5A 3CFKA 4U7KA 3E0GA 3H42L 4LCCB 5GIRB 3RFZC 2D7NA 2DM7A 4MB4A 5HYJD 5IHLB 5EOTA 4O2EA 4TSBH 3GMQA 4Y19E 1RJLA 4HIIB 1UGNA 2E8ZA 4PLNC 4GRWH 3DROA 1N6UA 4PLJD 4HFUH 3BQUB 1P4IH 1EFQA 3GRWH 1T21B 2BNRD 4NC1E 3JWNC 3EYVB 5DRNB 5I9QC 4TVPE 3OXSB 2ILLA 5C8JA 1K2DB 4NWTH 3GI9L 4YUEH 4FG6C 1KCSH 5GS0H 1LO4L 1IL1A 3O6FC 4ELMA 1F11B 1IEAB 5IVOA 3X3FH 1FE8H 4XP6H 1GIGH 3HB3D 2VDRL 4QWWD 1CXHA 3SGDH 2FHBA 4RFNC 5DI8A 1YN6A 4GKSA 1U3ZA 4MQ7B 1U3HC 2EXWD 2P5EE 2XWBB 4RAUA 1MCHA 4NQUA 5T1KD 2EE6A 4MA7H 1YNTA 5I8KH 1QBLL 2UZIL 5DR5H 5CEYA 1KLUB 5I6XB 2EICA 3KYKL 5DMKB 3HZVA 3MJ8A 4HS8H 1AQDA 1S7QA 4WW2F 2VTFA 1NMAH 4J2XA 5EB9A 1NQBA 4U6XB 3TBVA 1BGXL 1OSZB 3S36L 4RGOH 3AM8C 3SGKC 2L7UA 5C0GA 4PGEA 2BY3A 2JJTC 5D8JL 3ARGA 4P4KA 4W81A 1SEBA 2DWDB 2DIBA 5IQ9A 3O3DA 1E4WH 3QCVH 3SKUD 4JZJA 2ZUYA 3QUML 4PJEA 1Z9LA 2A9MH 3N1GC 5LWYL 4YDVA 3W0WB 3QRGH 3V8CA 5CFHA 2Z35A 5LKNA 3CFCL 3QI9C 4PJEF 3IJHA 4FG6D 3DUSB 2FIKA 5LXGH 4PV8B 3O6FD 3TH4T 2AGJH 3LN4B 3OKYA 3I85A 3SDAC 5INCB 3D9AH 2NY0D 1MHCB 4H8WH 1T1ZB 1OCWL 2Z31B 3GSVA 1U3HD 3D2UA 1X3DA 3MRRB 4M7LL 1N59A 3EOAA 4S1QH 3O6LH 3QXAA 1GHFL 5I8OL 4RA0C 3DV6A 1YEEL 1M4KA 4XBEL 3B8YA 4XWOC 1KCRH 3ARBA 3V6BR 1OAXL 5D7LD 4WUUA 1FIGL 3ZKQD 5JXEC 4W6WB 4JM2C 5I1DB 5ESAB 5DJ8A 3VH8A 5DRXB 2VLJB 1TCRA 3GK8H 4F7MA 5I1KL 1H8SA 2YEZB 4PRPD 1L6XA 4NRYA 1KIQA 1YYLL 2X6MA 4PJ5A 1EGJA 3L3OB 5KSAD 1HI6B 3HC4L 4F15C 1U8NA 3BKYH 2YRZA 3E2HC 5SWZA 4NHCL 4GAJH 3BISA 5FYLL 3SDAD 2MQ3A 1FYTA 1UYWL 3IDNA 4H0HB 4G9DA 3DX9B 1NUFA 4WGWB 1H9VA 3DYPA 3EOTH 4KY1H 2EE9A 2XZAL 4LDOB 4LLQB 4HCRL 4P9ML 4FFWC 4YGVA 4OJFL 1IGIH 5AG8A 1DQLL 4XCEA 5T1MB 4ZXBB 3BIBX 2D9CA 2OTPA 2R23B 3PNWB 5HTSA 2NXYB 2VKWA 1MAML 1YUHA 1C5CH 3QHTC 3JTTB 4PJ7E 3E6HB 3BZFA 5KZCD 2C3XA 3F12B 5FV1L 3G08A 1A9EB 3TJHC 3TVMA 5JXED 4JM2D 4JO1L 5FHAH 5AAWA 1T7WA 1C1EH 1KNOB 4KKNA 4IIQC 2IADA 1A0QH 3H3PH 2YSSB 5C3TA 3OAYK 4R4NC 1RURL 1MHPH 2CLVA 2NMSA 4M93C 2B0SH 1O7VA 2AQ3A 4JDVB 2AK4B 4G43A 2OYPA 4GKNB 4Y5VB 1AC6A 1WK0A 3EDKA 3QDGA 5F1NB 2B8OT 5IB4A 3AAZA 2ARWA 5D1ZB 2UY6A 4KUCF 5F72S 3SE8L 4RWHA 2DD8H 1CWVA 3ILQC 3ES6B 1CLYL 4JFZH 1XGQA 2IPUG 5JR1H 1Q94B 3O11A 5CJXC 1ZE3C 5E95B 4UAOC 5JW4R 3PWLA 4HMEA 4OQTA 3GIVA 3DRTA 4UT6H 4HZLA 1LDSA 4N5EC 1J8HB 4AH2B 5C0IB 5IOPA 1OPGH 4CMMB 4L4VE 4WEBL 5E8EB 2IBGA 4NQEE 2CKNA 2FJFA 5TGBA 4LVOB 3DX6A 3MTRA 2BVQA 4R8WL 3MBEB 2OTWB 2NTSP 3TBWA 1IGTA 2VDQH 1RULH 4U1HA 1S8DB 1G6VK 1BM3L 3TYFA 1MEXL 1BOGA 1MF2L 4TUJA 1U93B 1LO3H 3TT1L 2EDHA 4D9QD 3E3QE 5FYKE 1HIMH 3SDXF 4LEXH 3KWWB 1ZT1B 3KXFE 1E4XH 3DV4B 1C5DB 1ZT4A 5C0RL 1A7BA 4X4MA 3LKNB 4LCWE 3K4DA 3LKOB 2EDQA 2CSPA 4BA8A 1V3MA 3P11L 4R4ND 2XFXB 3AS1A 4C59B 3TA3B 1MRDH 1ORQA 3AY4A 3TCLA 5EU6E 5GGRA 3VFUA 3BKCH 3VFWA 1KENL 1TZIA 4J8RB 1C12B 5DJ6A 4J3UA 5I71B 4PD4J 5I1GL 3CXDH 3ILQD 1AGDA 4X4ZA 4G6KL 1ZWIB 3VXMA 1N64H 3K2MC 1IGYA 1AE6L 4PJ9A 3CVIL 5FAAA 4OCYH 3V5KA 3S34L 5ENWB 3UJIL 2OS7A 1EJOL 4OKVB 4JVWA 4DGVH 2F54D 3GGWA 3PDGA 2F74A 3UPAA 2MWCA 4YK4B 3KLAB 4M1GL 1ITCA 4P2QB 1F4HA 1T0NA 4NN6C 4ZTOH 1NEUA 1QD0A 2RQ8A 3NFNA 2AXJA 3ULVL 4JHWL 1VSCA 3PF2A 5I15H 3SN6N 3TF7C 1JWMA 4CADB 1RUQH 1VGKA 3L3GB 4ZFZB 2GITA 3BSZL 2IPKA 3NIGF 5T5FL 3QUYB 3BKML 2W9EH 2AJVL 4XP9H 1AXSB 3GMRB 2XOTA 3CLFH 3D3VE 2P49B 1KLFA 3DXAA 1EFXA 3V4PH 5IBTH 1NC2B 3EHBC 5I75C 2VQUA 5L6YL 5IIEB 2VNCA 1IQDA 1DBKL 5FKAB 4LEOA 2AJYH 4NC2B 4F2MA 1LILA 2A1WL 3C8DA 3PDOB 4AT6B 3KPPB 4HUVB 5HD8D 5LCVH 3FONA 1CYGA 2MCG1 5I8CB 4ZYKA 1M6OB 5DQJA 5HDBF 4XBPA 3C2AH 3FTGB 2YZ8A 4YHLH 2WLZA 1YEGL 3W81A 4U1KB 4NC0B 4HWBA 3HFMH 3ZE0F 3ARTA 4RA3A 4UDTB 5KS9F 5KSUA 1VEOA 4K23H 1J1PL 1DVFA 1XF4B 3WO4B 4KMTL 1DFBL 1UCBL 2ATPB 5C07E 5HHOB 2A0LD 1FZKB 2P5WB 3V6FA 4QHMB 4Q7DA 3LRSA 4U7SA 2IAMB 3OQ3B 3MUY1 4YQXL 1QSEE 4ZD3L 4MQXC 3GSOA 3CNKA 1WCBA 3SEPA 3W9DB 4WGVB 2Z8SA 5CJOH 4QT5B 3HUJE 5I1EL 3O6MH 4XNXL 4R4FL 2HVKB 3OR6A 2BP3A 4CUCA 1BZQK 1S7WA 2MQCA 4KGLA 4XNUL 4H88H 4NWUL 4OD2A 4RISH 3PP3K 4LAJH 1IARB 4CVZA 4GXUN 2GTWB 5E4IA 4BFBD 2G75A 1CI5A 3MV9D 4YAQB 1DQQB 4HS6A 1RVFL 1QNZH 3VFMB 4OLYH 2XRAH 1UH4A 3MXVH 5L9DH 3BP5B 3IDUA 5EO1B 4NOFA 2NNAA 1I4FB 4JHAH 3A6CL 1N26A 1ZHBA 3GO1L 3QZWB 5ISZB 4KAQH 3RWFA 3FO2A 1QRNE 1AJ7H 2GSIA 4YO0A 5DD5L 5JMOC 1MJJB 2CRZA 4XP5L 1NGZA 4GJTB 2UV3A 1P84J 2PXYA 5EO0B 1G9EA 1EHNA 3X14B 3OL2A 3IDYB 4PV9A 4WWID 1AKJB 5H94A 2HMID 3UDWC 4M6NH 2JB5L 4YHMH 1XR8B 3R1GL 1JFQL 1PKOA 1RHHB 4LIQH 3F7QA 1JNLL 4LSVL 5M94B 3LQAL 1EERB 3WFHA 5JIKA 5HYSG 1NANI 1A3LL 3D18A 1ND0B 3MRPA 1D5MB 5I1HL 5ACMA 3IETB 2JCCA 4FFZL 3NBNA 4V1DE 4IHOB 3GBML 3C6SA 5ADOH 2A6IB 5DVLA 5T3XL 4DZ8A 4HUUA 1A1OA 3FB6A 2JCCF 3JTSA 1WZLA 3GBNH 3NIFE 1F90H 3BDYH 3NCEB 4NFBA 2JJVA 1MI5E 4YNYB 4OLVL 1A21A 2X89D 2DQEH 3FT2A 2DJ4A 2I60L 1F2XK 2WIIA 4HSQA 4GG8A 3GZKA 4XGZB 3QCUH 1B88A 1MFNA 4YH6A 4QHUB 5HHNA 1B0RB 2X1OA 4ZFOB 5C9KA 3P0YH 3MGTB 4QRPD 1IZJA 4HG4J 2V9QA 5F7NC 4BZYA 1FGVH 2X70B 4RIRB 4LMQI 2CR3A 5ALCH 4IM8A 4XZUA 2NZ9C 1NANH 5E9DB 5I19H 4I1NB 3CVHA 2MHAA 1NUNB 4O02L 3REWB 3NA9H 1GGBH 2EDBA 4XPAL 3ZKXB 1K4DA 3UAJC 3S97C 3C5JA 2VLRA 2WW8A 2WMPA 4XH2B 2G9HA 4OF3A 2FR4A 3NOIA 3HR5A 2CJUH 5ADPL 4YHNB 1YPZA 3VD3A 3UTTE 5HGBA 5JNYB 5GSVA 1R3IH 5JOFB 1B6UA 2J4WH 4OZGA 4XMKL 4ZG1A 5D5ME 4EDWL 4M7ZB 3SO3B 1YPZF 1NAKH 2A74B 5JZ7C 2IGFL 3EGSA 1MCIA 1TZHA 1ZXQA 5DUBA 4POZC 2DN7A 1AH1A 3L3DA 3MOBL 4MLIA 1JGVL 1MPAL 3VXSE 3OKMB 3QIWC 2E27L 4I3RL 3ZDZF 4JQXC 1T5XA 1P1ZA 1KB9J 1R5IA 4L4VB 5FM8A 4Q9CA 1XCQB 4M8QA 3AS2A 1IKFL 5D7KD 4P5TA 1BJ1H 5JHDB 1JPTH 3QNYB 4OZ4B 3PQYD 3MRKA 2NZ9D 4NQVB 2MCPL 3PL6A 5ILTL 1TVBB 4GAYA 5BVPL 1JYVA 2UYLB 3PV6B 2OJEA 3RKDC 2FGWL 3UAJD 4PJBA 1GC1L 2X4TB 3GUTB 5GGSA 5DJDB 1PY4A 3RDTB 3GJEB 3MCLL 2NX5B 2COQA 4XPHL 5EBGA 4YHZL 4DN4L 3FB8A 3WSQL 1A5FH 2H8PA 4O5LH 4HPOH 2WBJC 1B0GB 3QEUB 4HX1B 1UA6H 5CP3A 2Q6WB 5LG1A 2YUVA 4EUPA 3L3HA 4NSKB 5KVFL 1MLBA 3SDCC 1NGPH 2FL5B 4DEPC 5JZ7D 4O9HH 1Q0XL 1E4KA 4X6EA 3NVQA 4IRJA 1JNJA 2EDJA 5J13B 1GGCH 2DJSA 2VDMH 1QVOB 2Q86A 5IEKB 1N7MH 3LN9A 3B2VL 4Y2DB 2IWGA 1KJVB 3OX8A 1XIWA 4E0RB 3QIWD 2XPGA 4HV8A 5KVDH 1Z6JT 2BJML 3BRGC 3CUPB 4HPYH 4M8VA 1EX0A 3CSGA 1WITA 1TZGH 1T89C 4QRTA 2APFA 3I6GA 4RGNB 2ZSVB 3NABL 3IXAB 3EFFA 2B5IB 3P4MA 3SE3C 4JE4B 2AI0H 4PGCB 4LLYB 2X4QB 2BSTB 3HS0B 3WNKA 4Y4HB 1H3PH 2ED7A 5HHVL 4BH8A 1RU9L 5E00B 5FV2A 3U30B 1FH5H 4JRYE 4WO4B 4I0PB 5HPMA 1KJMB 4LSRL 3PGFH 4J6RL 4JN1L 2V5YA 5DFVC 4D0BB 5MEQB 2I5YH 2Q1EA 1X5KA 1A7QL 2PCPB 3AROA 3RWEA 4FFYH 2HG5A 3VWKD 1I1AC 3VGBA 4UOW0 3IXTB 4LARL 4APQC 1KPRB 1O0VA 5DT1L 1A9BA 4R4BA 3H3KA 5HPOA 2PW2A 1MFBL 2DJUA 3BAEL 1YMMA 2AEIT 3T3PE 1T1YA 3HNVH 1F4WH 1E28A 3SDCD 2R69L 4Q74A 4DCQA 4JPKH 2ZUVA 3S3PA 5C92A 4LSSL 3X3GL 4NN5B 1KF9B 4KKLC 5I1CH 2C9AA 2W59A 1AD9A 1IBGL 1KCVL 2EYRB 2NY2B 4HH9B 2ARJB 2H6PA 3B3IA 1ZMYA 3KLHC 3PHSA 2LE9A 2R0WH 3ARWA 2PYEE 5EU4B 1OAZL 4K3DL 1KXTB 1FC1A 1D5ZA 4WI9A 1KCUH 5F8RC 5EOCH 3FN0L 4MJ4A 1YEDB 4NDMA 3VXPA 1ROWA 3SCMC 4BFGA 4HKZA 3RZWA 4G8GD 5HVHB 4Z7VE 4LQFL 1WBYA 1KN2L 4WHYG 4X6DE 1N3NB 3GMLB 3OKDB 4HF5L 4U6TA 3QEQB 1EEZB 4ELKB 5C0CD 4LOUD 4ZUUA 4MDJB 3VRJA 3HUJB 5DFVD 3AVEA 1HHGB 3RUGE 3U4BH 3OR7A 4EBQH 5CINL 3SQBA 1I8KA 4PG9B 4RAVB 5CGTA 3RI5F 5HYJA 4PP2B 3S35X 5IVXE 4A2LA 3BO8A 1VKXB 1A2YA 4APQD 2VXUH 3F5WA 3AUVA 5D1XB 2BMKA 5EUOB 1Q72H 3QFDB 4Z0BH 4YBLC 3MO1B 2EKSA 1ONQA 4M1CC 2BNRA 3ZTNH 3JSSA 4PTUA 1T2QH 4Y4KC 3C5SB 4GRLB 4X5XB 1LO0H 2AV1B 4UT7H 5JQ6H 2V2WB 1MFAH 4KKLD 4PJIE 5FO9A 3B9KC 4Z76A 1FVCB 3P30L 4PJGB 1JPGB 4LDEB 3IDJA 2XQBL 1QRNB 3ULSA 2ED9A 4JG1L 1DQJA 5ESQB 3QH3B 2GAZA 3V5DB 5LAXA 2BX5A 3EO1B 3BEWB 5E4EC 4F37K 1HINH 5EUKB 1TTUA 4NO3A 4P2RE 5J7CC 4PB0L 5FUCC 2JJSA 3IFLH 1IILE 4UT9H 4R7DA 1BOYA 5T1KA 4OB5L 5TE4L 3ARQA 2NW2B 2YUXA 4MCYA 1JF5A 4D0DB 4K3JH 2YMXH 3WFDL 1ZEAH 4HDIB 1EEUA 2VLKE 3QHZL 4LAQL 4K2UH 4MNQE 4YZFF 1C8PA 3BKJL 4JZNB 5F1SA 5L2JA 4HQQH 1DUYA 4PB9L 4AMKL 5HDLA 1FV1B 5BVJB 5BRZD 3BT2H 5CJBA 5IUSA 2VXTH 2PW1A 3VRIA 2CO6B 3OKKB 4MJ5A 3LN5A 4YLQT 5E70A 3VFRB 1QPXA 1NCBH 3BH8A 1X4ZA 4WFGD 3STLA 4UOW1 1XF5A 2VDNL 5SWQB 3PWNA 5D2NE 1MI5B 4C56D 1R3JB 4NNXA 3VG0H 4WDIB 3O4LE 5C09E 3F7RA 5HGDB 2HFFA 1ZAGA 3HPJA 4LLMB 3T1FA 3FFDB 5JOPD 1WUNT 3AXLB 2GSGA 4MSWB 3CMOH 3O6FA 3WHXA 3QCTH 1M7IA 3BP6B 3OWEA 2UVFA 4NO2B 2BVOA 3AREC 4F7EB 5AZEH 3HE6B 3QUXC 1U3HA 5HGHA 3NZHH 4ONOA 4D0CB 1MFDH 4GO6B 2IQAA 3J7HA 4YC2C 2F58L 5FM5O 4J23A 5GJTH 4I77L 5HVGB 4OCLC 4X4YB 1CZ8H 3SY0B 3V79C 2FJHA 4KROC 5GGVY 5C0BD 3QUMB 3N85H 3OJDA 1F2QA 4OCWH 3SQOL 4F33B 4LCIL 5GS3A 3QWOA 3AM8A 5D7LA 3OV6A 4M62L 3RHWK 3VGDA 4ZUWB 3CX2A 1R5WA 5DLML 3KAAA 3OAZK 1WT5C 1T7XA 3DMMC 2C3VB 2MSPA 1QSVA 1OP5K 2R4SL 4Z7UB 4N90D 3WJLC 1RHFA 2ZCLH 3V9FA 2VLMD 4FTVE 3SE4C 4JFDD 2EDEA 3L7EA 1MAJA 1A6AB 3MFFA 3PJSB 1XGTB 3W9EA 5BV7C 4PRPA 4MNHA 4ALAL 4XNMB 1G9MC 4LSUH 3SGJC 1BIIA 1UKQA 5I1JL 1U8IB 5KSAA 1IFHL 1Q9LA 2CKBA 1G7JB 4YXKL 3M1BB 3SE9L 3RL1B 2A6KA 2BHUA 4PD4K 3QDJB 3V6OA 1J0IA 1S9XA 4LSQL 3WFBH 2FECI 1AGCA 3SDAA 4PTTB 2HJFB 3ABZA 2Z8RA 4EJ1C 3J8F7 4OFKA 5DJCA 1HN1A 5EA0H 3ARED 3MCKA 3QUXD 4JDZA 1NMBL 3S5LB 3O0RL 4Y5YA 3HG1E 1NAMA 4F7TB 3HNTL 5CWSA 1IVLA 3K4ZA 4FQXB 3T77B 3U0TB 1XF2A 4ELME 4G8EA 3K3QA 3REVA 4KROD 1JTOA 4QOKD 1A1NA 3MFGB 2FEEL 2JLLA 4NZUH 3QZWG 2ZG2A 3M17B 5E2VH 4C54A 1WZ1L 3H9SD 3RIFK 5DJ2B 5F9OL 1I75A 4BM7A 2BCKA 1AHWB 1TTGA 3P73B 5JXEA 4JM2A 1R0AL 4FABH 3DMMD 4GW1A 1FP5A 4KRPB 3GM8A 2WBKA 2J8UA 3LS5H 2H2PC 2HFTA 4AK1A 1DQMH 3O2DL 5FA3B 2A6JB 4OZHA 5GS1B 4JM2F 4EVNB 3IGAA 2J8UF 2A38A 2AP2A 3STZB 3QA3B 3CZFA 4OZHF 7FABH 1ED3B 3HC3L 2D0GA 5HDQL 1KB5A 2IBZY 2HVJA 3PV7A 1SJEB 3TNNB 1YNKL 3PWUB 4DVRH 5SX4I 3Q2CA 3LOWA 1AQKH 4PJEE 5TF1H 4O4YL 2BDNL 5DK2B 1NDMA 1VESA 3VXRB 2EEBA 3TBTB 3I75B 5IM7B 2EO1A 4O58L 2CMRH 3C5ZB 5D96B 4JR9H 4MWFA 4O2FA 1NCAH 3ZYJA 5KTEH 4N0RA 4F58L 5KSBA 5E8OB 1JK8A 4KQ3L 4U1SB 4GKZB 3V4UL 1M7DA 3HI5H 5DHVB 4Y16B 4HJ0C 1I3RB 2VQ1B 5KSBF 4OM0L 1A14L 3CH1B 5F7LB 1JP5A 3OPZL 1N6QL 4IIQA 1OAQL 1CD8A 4ZAKC 1UEMA 1CFNA 4Y5XB 2H2PD 2NY5L 3S3JA 3T0BA 3OKLB 1DTUA 2H2SD 2PN5A 1VGEL 4K71B 5KW9H 1HH6A 2Y36H 4HUNB 4XMPH 4WUUE 4BSWB 4XNQA 1SY6L 1RZJH 5A1AA 1UB5B 3EO9H 4PRIE 3OKEB 1T3FB 1FDLH 5F70A 3V6ZB 2LU7A 1GJIA 3GIZH 4OCSH 1I3GL 1LE5A 5MEND 4NN7B 4EOWL 5BQ7A 3T2NL 2J5LB 1T1WA 3JV5A 2F54A 3MRIA 4PJ5E 3PXHA 4OGYL 1KELH 3QNXB 2DLTA 5FK9A 3ULUC 4KJYA 1X5HA 2OZ4H 3DVFA 1Q8MA 2IF7A 4X6DB 2OJZL 1BZ9A 4U7MA 1CFSB 2VSCA 4S0SD 1JL8A 5D70H 2FJGB 2K9UA 4U05A 5E94B 5D6CB 5EIQA 3H7BA 3I6LE 2YPLD 4YHOL 3DSFL 1OARH 1MNUL 5DJAA 1KBGL 3ZT5A 3W39B 1J05A 1A7OL 1FYTE 5GRWA 5IR1A 2Q87A 3CSYA 3SJVD 3DBXA 4WTWA 3C6LD 1PLGL 5I30L 3MLWL 4HC1L 2CDEA 1FZOB 4YDIL 3ESUF 5GS2D 4IRSC 2VO5A 4HJ0D 1R3HA 5FUOL 4YWGH 5GS0C 5FYJU 1QSFB 1IC5H 4Z7WF 4PJDB 1NKOA 3MRQB 5EWIL 5F7WC 3MMEA 2VZOA 3NACL 3WNLA 4PJIB 1X7QB 1KJ3L 5EC2B 4FXKB 4FQCH 1EH9A 4XCFL 4ODUA 4PJAB 4XCNA 4HLZG 4LPVA 1A6ZA 3FO0L 3DO7B 3O3AA 2VDLH 1ZHLB 3QUZD 5J6GA 4BSVA 2Z93B 4HIJB 4OD1L 2BK8A 1GGIL 3QDGE 3WXVL 2ZJSL 3GBLA 1RY7B 3JWOL 2HWZL 3RVVC 3WIHL 3ULUD 3LQZB 3F7YA 4HEPG 5DGQA 2EXYD 4K94C 2X4OB 1AGEA 4HG4K 5TF0A 2AK1H 1T6WA 4A6YL 3V5HA 3CK0L 3PE9A 4WFEE 5FXCH 3O4OB 1UKSA 1FL3B 3WN5A 5GRZA 5TE6L 2AVGA 5GS0D 2FX9L 4JKPL 4FZ8L 1I7RB 1I9IH 3U9PH 4HUMB 2J88H 1LE9B 2DBLL 3SDXE 1UM6L 3OAUH 4P99A 3IRPX 3HZKB 4GBXB 2ZNXA 4RGMC 4WI5A 4H8WC 5CD5C 5IMMA 1VPOH 4S1RL 1JZ8A 2JB6B 1B0WA 4BZ2H 3MV9A 5DEZA 2VQTA 4UUJB 4WWKC 1IAIL 3KGRA 4X4ME 4NIKB 1KLGA 3TT3L 4EEEA 2NY1C 1FG2B 1XR9A 4MX7A 5FYKH 4LNRA 1LHZA 2WINB 4ZTPH 1FPTH 3TV3L 1RUKH 1Q0YH 1FORL 1MRCH 1NBVL 4Q9RL 2IANB 2YPKA 5A16B 3W11D 2DDQL 1IC7L 4HH8A 4HLZH 5BXFB 1DBBH 2DKUA 1L6ZA 3UO1H 5IT2L 5F96H 2XN9D 3RVVD 1RK1A 4X7CC 1B6DA 1WFTA 1HZHH 1EK3A 2QQLH 3MRBB 2HJLA 1DCLA 5FECA 4HGKC 4TULH 1VFUA 1CF8H 3VXME 3OB0H 4D9LH 3HMXH 2O5YL 4NYLA 2QR0B 3IFPA 1MCPH 3B6SB 2WQ8A 3QG7L 1OL0A 2ZPKL 1RIUL 3U6RB 1RZ7L 4CVUA 1JHTA 2AABL 2OR9H 3CPLA 2NCMA 3KPRB 5L7XL 3GSRA 5DXWA 4JQVC 3MROA 3DOSA 4PRHB 4PRDB 3IJYA 3DURA 4PRNA 4JRXD 1ZHNA 2Y5EA 3L6FA 3NIGE 3WNPA 5CD5D 5F89A 3IYLW 4N8VA 1KN4L 3VWJC 1CG9B 4X6BB 2DQCH 1YJDC 1G9NH 1P4BL 5FUZL 2NY1D 2X89A 5FIEA 4Z77A 3LZFH 5BW7C 4D8PA 2QQKH 5K9OB 2X4SA 1UM4H 1NFIB 3DXAE 4LKXB 4P59H 3FT4A 2V2XA 2PTTB 1Z9SA 5EIVA 5EZIL 3BWAA 3HG1B 4QRPA 4YXHH 4LKCA 1FG9C 3VFTA 1SJHA 1JIBA 4G6FD 5F7MC 1I3VA 2H32B 2P8LA 1R3KA 3ARVA 5HDBE 1TFHA 4LLUB 3OGCA 3UDWA 35C8L 2NXZD 4J3OC 4EN3B 12E8L 4Q97A 5CHNA 5HHXL 4WW2B 5KS9E 4MA8H 2V7NA 5CCKH 5IQ7L 5FCUL 4ZNCD 1UADC 3LEXA 2CXGA 3MODL 5E8NB 4IOIA 4HFUL 4LHJB 1T22A 2DYPB 2K7PA 4XI5C 3MJ9A 4JPIA 4XPFH 3KPLB 1W72A 1CFTB 1BLNB 2A2QT 1WBXA 3FQRB 4CMHC 4G7VL 4NWTL 1BFSA 2P8PB 1T83C 4CW1A 1KCSL 4R2GB 3U7YL 2R2BA 4Y1AB 1AXIB 1B4JL 1LNUB 3NZ8A 2ICEA 1U8MA 5CJQH 4XP6L 2OL3L 1GIGL 5JORB 1HXMB 2V5RA 5HY9A 5AZ2H 4OV5B 1K6QL 3QB7C 2Y23A 5EZLB 2NLJB 3HNSH 4Z7QF 5GZOC 4WI2A 1AD0A 4JQIL 4MA7L 1RIVH 2NY4C 4IRZH 3RWHB 5T3ZL 2BOBB 5DGRA 5MHSD 4UIKH 1CXFA 2E7MA 4WU5A 1WIPA 1NLDL 1Z9MA 5KOMC 1PG7L 4QRRB 3VW3L 3P77A 3O41A 3PQYA 4U0QB 3EYFA 3LH2L 2XG4A 5KVEH 2ERJB 4NZTL 4HIHA 4WCYH 1GGTA 4NKIL 2VISA 1K8DB 4M1DL 3QCVL 4PYGA 4L9LB 4QGTA 1QLFB 5GRUH 3CFIC 5ITBL 1WGOA 2A9ML 2CPCA 4XI5D 5JPMA 4ZPTB 3ARFD 1UJ3C 1MFCL 1YNLH 2GYSA 4P5MB 4J1UA 3TLRA 4LPTA 2B39A 3H42H 1FFPB 4PRIB 4MD4B 4R0LB 1EMTL 5LXGL 4XVSH 4JREC 1VENA 2BSSA 2J12B 5L8KB 1NFDB 2JCCE 3HE7B 5J1TC 3EW3B 3P9WB 5FYJL 2CDFB 4G80A 4NBZB 3X13A 2GEEA 4H1LA 1CGUA 3MV7B 3PHQA 5IROA 3RIFF 3RVUD 3QIWA 3ILPA 3FOLB 2ZUSA 4BFEA 4JFFD 1WFUA 3QEGL 3PGDB 4JQXA 4JY5L 5DK0B 1ADQA 4EXPX 1S7SA 4U6YB 5EZJA 1CGWA 3PWJA 2NY4D 5E7BA 2XTJD 3QJFB 1PQZA 3ETBF 4MJ6B 1IM3B 1Z5LB 1KJ2A 4HGWA 3MRJA 3O2WL 2VDPL 4N0YL 2KKQA 2VDRH 1H15B 3T0VA 1RZKH 2FLRT 4KTYA 4XVTH 1BJ1J 5BZDB 2KL6A 3KR3H 4NRXA 4BH7A 3HC0B 1QBLH 2UZIH 4XVJH 5CSBA 4L8SC 1KTDA 3WS3A 4OAWB 4JFEB 5C08B 4KPHL 3VD7A 5JIIA 3S5LG 3VWKA 3TEUA 1WIOA 5J57B 3S36H 4H5SB 5F9JA 3HMWL 3LD8B 4X7TB 5I2IA 1D5XB 4GQPH 3SDCA 5D8JH 5KSVB 3K7UA 2VLRE 1HQ4B 4LP4A 3L3JA 2GUOB 1HCFX 3JZ7A 1MCNA 4QCIB 4ZO6A 1TCMA 4QY8B 3QUMH 1YPZE 2OSLA 2O5XH 4KY1L 5HGAA 2HA1A 1UVQA 1K4CA 4ZPVB 5LWYH 1HSAA 5HHPA 2EZ0D 4XX1G 1JN6B 3RGVB 4OZGE 5DDHB 5K9QG 2OTUA 1L4IA 4N5UA 2PO6C 4UV7H 43CAB 4UQ2A 4GAFB 3ZDZE 5ID0B 3SE3A 2V7HA 3NPZB 3TIEA 4G8GA 2PR4L 1VFBA 2YD7A 2XNAA 8FABA 1VHPA 3MV8D 2J7LA 3DRTB 3FT3A 3MRGA 5K9QI 1PBYA 3LKRA 5INDA 1I8MA 5C0CA 3VGAC 1A0QL 3H3PL 1QLRA 1K5NA 5C0DA 1ZGLA 3VFNA 5BZWB 1VFOA 5I8OH 4U3XA 3SDXB 2YA2A 3LKQA 3Q1SL 4WENB 1YEEH 4XBEH 4XAKE 3TN0C 1ETZB 3OZ9L 4APQA 2Q7YA 3DVGB 2HAZA 1WBZA 2BHZA 3C60C 1OAXH 2AXFB 2DD8L 3QQNA 4KJPC 1Q9KB 1F6FB 4N0UA 1FIGH 3RVXC 1F3RB 4JFZL 1OAKH 1JGUH 3NCMA 1EAPB 1HHKA 4RMUA 3KJ4B 1S7RA 4JFYA 1JRHL 4P2OB 5I1KH 4KDVA 1F58H 1LEKB 3ET9F 3U7WL 1T20A 4BZ1L 3I02B 1KULA 2CLRA 2CH8A 1U36A 1YYLH 1WISA 4WV1B 2GCYA 2XKNB 1WWBX 4ZS6D 1KIRB 3HC4H 1S7XB 3QXWA 3WCYA 1FJ1A 43C9A 3HLAB 3FO1A 5AG9A 4NKDA 4PJXA 2BFVH 1YY9C 3EYQD 2PO6D 2E9IA 3KDMA 4NHCH 1V3LA 2GTZA 5FYLH 5EOCJ 4NHUB 1UYWH 4E41D 3ARXA 4JFXA 1FRGH 2H3NB 4PJXF 4DQOL 5E5MB 2XZAH 2EDDA 4R7NA 1F45A 5E6IB 5IB2B 1E4XL 2YPVH 1S5HB 4HCRH 4P9MH 5E1AB 4OJFH 3UROR 1FO0A 5C0EB 3O2DA 1HQRB 1LEIB 5BRZA 1VADB 4Z78B 4JKKA 5IESL 1CVSC 3TN0D 2ADJA 4R97B 4JY4B 4X6CA 4K3EL 3T65A 5DMJB 3RVXD 1TJGL 3G5YA 3N50A 1YN7B 1AY1H 4JO1H 3RRQA 4C56A 4ZOEA 5TQ0H 1N64L 3FQNA 3MLRL 1AIFA 1HYSC 4X6CF 3FRPA 2NTFB 2FGZA 3BD5A 1RURH 3L7FB 2PTVA 3KPNA 2NY6B 1S7VB 2ITDB 3RNKA 4WFFE 4DGVL 4LVNC 3FQUA 5HHMB 1NJ9A 3H9HB 3GMNA 4YFLF 4FXGB 5DHVH 1YMME 3SE8H 5JW3H 4RMWA 2R0ZL 3KYMB 4U3HA 1JYWA 3TCXA 1YY9D 4ZTOL 4WTZG 5D7IB 4F9PC 2I25N 1CT8A 4NQDB 1U8QB 1ZS8B 4FS0A 3U4AA 4LLDA 1TNMA 2ZOKB 3UYRL 3I6KA 3VXUD 5KS9B 3RL2A 5IBUB 1RUQL 5TDPA 1YDPB 5C0BA 2EYTB 4WEBH 2W0PA 4XP9L 4L29A 1NBYB 4LBEB 2WUCH 3D39D 3EZJB 4MNGB 1CTOA 4R8WH 4X0KB 3CGTA 2APWA 4K8RH 2GW5A 5I18H 1MEXH 3CIQA 4X8JA 2AV7A 1PYWB 4JFDA 4K7FB 4LCCC 5EBLA 2BXZA 2CQVA 1G1CA 5C0RH 2HT4C 2V17H 3U7AA 4UNUA 3SPVA 5LCVL 3WIFB 3ARPA 1I9RH 3TO2B 5HYJE 1RUPL 3BQUC 4JG0L 4DK6A 5C0JB 5ITFA 32C2B 3UBXA 5IV2B 1I7ZA 4OIIH 1MVUB 1H5BB 2XTLA 2IMNA 4EDXB 3EUUA 4K23L 3B5GA 2YC1B 5I1GH 4ACPA 4UBDC 2BNRE 1GGYA 3KPMA 1JTTA 4QHNB 3T08A 3AREA 5CSGA 1AE6H 3QUXA 4QRUB 3CVIH 5EU7E 5SWSB 2CDGA 2NR6C 3UJIH 1Y18A 3T0EC 3Q6FA 1D6EB 4JHZA 6CGTA 5IK3A 1GPOH 5F88A 4MDIA 1HEZB 2P44B 3IU3B 4QOKA 5CJOL 5IW6A 4E9LA 1ZV5A 3O6ML 4P5KA 4KJQC 5DFWH 2BNQB 4M1GH 3H9SA 3UPRA 1TXKA 4TN9A 1NLBH 1QQDB 1FZMB 4RISL 3D25B 3EYOA 3DMMA 4ZQKA 2HFGL 4YZFE 4L8CA 2K3TA 3L5IA 1YEKH 3WJLA 1A02N 3IDIA 1ZHKB 4QRSB 3V0VA 3SE4A 5J1AB 1FVEA 3CFJA 4OLYL 4UI2A 2XRAL 4BFIB 3AMKA 5CEZL 1U8PB 5L9DL 2NZIA 3BW9B 1NDGA 4WNQA 2HT4D 1NGQH 3MOAH 1CDHA 5J3HD 1DSFH 3C8KB 2AJVH 3BRFA 2VIRB 4PP1C 1BBDL 1AJ7L 1W0WA 1FZJA 1G1YA 3PWVA 3BQUD 3SDDB 1B3JA 1ZSDA 2AXGA 3A6OA 1WZKA 4ODTL 1NBQA 3MACL 1BQHB 3I3BA 5L8LB 1YYMH 2FBJH 1DBKH 2YRLA 4UBDD 1CR9H 3PXJA 3BE1L 5AD0A 4LIQL