1PLGL

Evidence for the extended helical nature of polysaccharide epitopes. the 2.8 angstroms resolution structure and thermodynamics of ligand binding of an antigen binding fragment specific for alpha-(2->8)-polysialic acid
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
215
structure length
215
Chain Sequence
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLYWYLQKPGQSPKPLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCFQGTHVPYTFGGGTRLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence for the extended helical nature of polysaccharide epitopes. The 2.8 A resolution structure and thermodynamics of ligand binding of an antigen binding fragment specific for alpha-(2-->8)-polysialic acid.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords IGG2A=KAPPA=
total genus 53
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1995-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1plgL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1plgL01
4AEFA 3C60D 3LDBC 5KG9A 1WFOA 1G7PB 4JM2B 3T0XA 1HKLH 1NMAL 4ZUVB 3K4AA 2GSIA 3UZEA 1QSFD 4F58H 3NPSC 3HAEG 4YXLH 2IQAB 4YNYB 4POYA 4H25A 1S8DB 4FXKB 3E6HA 4JN2A 5IJKA 1FSKC 3AGVA 4IRSA 3BKCH 3G04A 4LF3B 4JB9L 4L3AA 3SE9L 2BOBA 3W2DH 3SCMB 4HC1H 3DVGA 1KIQA 3GSUA 3PHSA 5EOTB 5SV3A 4X4XB 1BMGA 3O41B 2I24N 1OAXH 4DJMA 1FZKB 1IILE 1QO3A 2BMKB 5EIIB 5TDNB 3NOIA 5C6TL 4J8RB 1DVFD 1XIWA 5C2UB 1I85C 4JFEB 4KKCD 4KUCF 4LSPH 3VRIA 3H9ZA 3QH3A 1IQDA 4C54A 1JFQH 3A6CL 5KS9F 1EHAA 3T3ME 1W72L 4DW2H 4ZDHB 5JO5A 4Q7DA 1OB1A 3BGFC 3JV6A 2FR4A 1CBVL 2HLFC 5DJ0A 3VXSD 4JRXE 3ARQA 4TTDC 4HZLB 2IBZY 3MLWH 3ZHKA 2ZCHL 4Z0BH 2DM7A 5E5RB 3FT4B 3RY6A 4JDTH 4HSQA 4Y4FC 5HGHB 2IMNA 4X6EB 4APQA 1CDGA 3U2SA 3MRPA 2P8MA 4XP1H 5J89A 4DN3H 2OM5A 2JK5B 3BIBX 1M6OA 1A3QA 1T7WA 4U1KB 15C8L 3DRTB 4D2NA 3WFDL 2YD8A 5GS2H 1LEIA 1I7RB 4LEOB 4GW1B 1BM3L 2ZNXA 3NGBC 1U92B 1OM3H 3MA9H 3LKOB 3C5JA 3OAZK 4HXBH 5KN5A 1PKQB 1ZKAA 4ISVB 4MWFA 2EEBA 3S96B 4ODSL 5C9KA 5D2NB 3NFSH 3IFPB 1IBGH 4G8GE 1MFDL 2DYPB 1C7SA 4B41A 1UXWB 3PWUB 4FFWC 4WEBL 1PY9A 3MV9D 3FN0L 3TVMA 1GIGH 3HAEA 4FXGA 5INDA 4MHHI 4H1LG 4JY4B 5I15H 2H3NA 1HYSC 3MODL 2WANA 2XQYK 3I6GA 3WFHB 4PJBE 1GHFL 1IGJB 2AEIT 5BMFH 1VGKA 4U6HB 4R90H 2E7CA 2C1OB 4ZS7L 1WJ3A 2Q86B 2ZKHL 1WQVT 4AMKL 1DLHA 1VSCA 1FNGA 3LN5A 4Y1AB 5EA0H 2FZ3A 3SJVA 3TV3H 4O4YH 3P30H 4HAFA 3VFSB 1NBYA 4RIRA 3IFNH 1QHOA 3O3DA 1GOHA 4D9RE 4WJ5A 5IVXB 1ZLVK 1NMCC 3P11H 3WFHA 2YPKA 1HXMB 3I2CL 3QRGL 4LHUB 1BZ9B 3UTTB 1UC6A 1UKSA 1Q38A 2WBJA 1INEH 1IMHC 3HZVB 2V7HA 4G9FA 3VMNA 4PD4K 1D6VL 4XGZB 1S7XA 3I3BA 3T09A 1N6UA 4GXVL 1N4XH 5MI0C 1UADC 3S4SG 3U0WH 1DUZA 4X80L 4RAUB 3P0VL 3QUYD 1QR1B 2DTSA 1EMTH 2YXFA 5A2IH 1GOGA 3LRHA 4UI2A 5C09D 4NZUL 3WLWD 3DECA 2Y72A 2F9BT 5C6TH 3TN0A 1KPVB 4GRWF 1UQSB 1I7RA 4LEOA 5HI4D 3EJZD 4UINL 3QUMB 4HULB 1A1OB 1HHHB 1ONQA 3ULUL 2PW2B 2QQNL 5DTFB 5EZOH 3WFCH 5I75C 4U6XA 1S7XB 5BV7C 2HWZL 4MD4B 3TBWA 4UB0L 1MJJA 3RBGA 3ALWA 3K2UH 4RAVA 4WUUE 4AL8H 2FJFA 2HT2C 3CJJA 1QBLH 1KIPB 3ME0A 4Y5YA 4N0UB 4HWNA 1DR9A 1FNHA 3VA6A 5K59E 5M7QA 3MJ8B 4Y4KD 4X99A 4JQXC 4NGHL 4PGEB 4G6ML 3LH2H 2VRAA 3GSQB 1JRHI 5T3XH 2GKIA 1QEWA 1QRNE 4OF3A 2GCYB 3RFZC 1MWAB 2GJJA 1ADQH 4J8RA 3MLUL 1D5XB 5HYQB 1MWAH 4FQLL 5A16B 1RHFA 3HNVH 5IHBA 4Z8FL 2ED7A 1JV5A 3AB0C 1CDUA 4GBXB 5BW7A 5GSVA 3VXSB 3KS0H 3NFSL 2E7MA 2W9LA 2QHLA 3BZDA 3VGFA 1BD2D 2Y1VA 2APXA 4L4TB 3RWHB 3ULSB 2XY2A 3WLWC 2NY3D 1Q0XH 4IRJC 4WFFE 4OCNC 3FB7B 2DQCL 4M8QA 4ZUWA 3V0WH 4JG1H 3TT1L 3RWFA 4G9FD 2E6PA 3H0TA 4EDXA 3ARFA 1ZHBA 4M1CC 4LVNB 1A6TA 43CAB 3QWQB 5LKNA 2F5BH 3IKCB 5D7SH 5ITFB 2RGSA 2FX7H 5L6YL 4MCYA 1OSZB 4PLJC 4S1QH 3VGBA 1YQVL 1OPGH 3T0AA 4JREB 3U4BL 1SY6H 4LLDA 3QWOB 5EU7C 2CK0H 4IS6B 1DEDA 2P5ED 4P59H 3I02A 3PG2A 2XXMB 3H8NA 3IFNL 3RP1A 4R96A 4NKQB 2MSPA 3C8KB 3CDFA 2VLMD 1HZHH 1GOFA 3KYOA 2CD0A 3M17B 4JPIA 2YRLA 2DIAA 4JFQA 3MXWH 4BFIA 1BFVL 1RUPL 4LSTL 5LCVL 2ZCKL 4G8GA 3CMGA 3SBWC 1CXLA 4H0IA 5DGQA 5AD0B 3EJYC 4D0CA 1B6UA 2E7BA 3NZ8B 1KPRA 4P3WA 3UX9B 4GXVH 2AQ2A 4JFDE 1B2WL 5GZOC 2V2XA 3F58H 4WEMB 4GLRH 1T80A 1PG7W 1EJOL 5SWQA 1ORQB 1A1MA 2X1QA 3TBYB 2O5XL 1AR2A 4NZDA 5T5NG 3FRPG 1FG9C 3BYTA 3T2PA 2VLLB 4ODTH 1Q9KB 4KK8C 1N59B 1LVEA 5HXMA 2BP3A 4XP4H 1FGVH 1G84A 1FE8H 3IETB 2HJFB 3KPLA 4OIBA 2Y5TA 2P5WA 3ULVF 5BV7L 5EOQH 1I3RB 1CQKA 4N1HB 1I3GL 1WAAE 5FOBA 2CPCA 2HT2D 4HCRH 3AUVA 3GIVA 4ZUTB 3CX2A 4XNUL 5FHBH 1TVHB 1A7QH 1C08A 5HVWA 2YUVA 2CIIA 4NJ9H 2QSCL 5C0DB 4JRWA 4LQFH 3HUJA 4FQHB 4PRBA 1LK2B 3BZFA 4KRPD 3UTQA 1R3HA 1JFQL 2XWJA 3A6CH 4NGHH 4M6OH 4YC2C 3DGCR 3F7YA 3QUXC 3LKQA 3C60B 3X3FH 2J12B 1GZPA 2A2QT 1ZK9A 3UC0L 1ADQL 3U0PB 3X12B 1AHWB 5CKAA 1J0YA 1QSEB 4DQOL 3CFEA 4R2GB 3O6KH 3DX9B 4MAYB 1XMWA 5EWIL 5IT2H 1F00I 5C0CE 3WN5B 5HYEA 3PDDA 4LSUH 2EDBA 4HIEB 1JUFB 1UEYA 1NCWH 1WIUA 4ZD3L 2V7NB 3O4OB 4D0DB 3DMMA 3HTLX 3MJ7A 3DIFB 1BIIB 3SGJA 4Q9RH 3BT2H 4H0HB 1JCKA 5FYLE 4N8VA 1P4BH 4L8DA 1V7MH 5IK3B 2VDPL 4GRLD 3LKSB 2UZIH 4YDVB 3O6FB 5FYJL 1QSFA 1EAJA 2IPKB 3JTTB 2PF6A 4M03A 3TESA 2OJZH 5HGBA 3SKNB 3C09B 5C0GA 1IBGL 5BZWA 1OOAA 5IVOA 1EAPB 4PGBB 4YO0B 3IDXH 1CDYA 5BV7B 1CU4H 4I1NB 1KTDA 3LRSA 3MBXH 2CGRH 4TUOB 1OP3K 5FF6A 3NCEB 4X7TB 4IDJL 3BD4A 1FQ9C 1OT2A 2ARJQ 1I8LA 2GJ6D 4KVNH 4JZOB 9CGTA 1BQLH 4R7NB 2A6JB 1YNKH 3TNNA 1HHKB 3RTQD 2QLVB 1UM5L 3EYFA 1MQKH 2IWGA 4GRLB 5FYLL 2I9LA 3CSBA 2ORBH 5HHOE 3WUWB 1BOGB 4PBXA 5KVFH 1ZMYA 3UTTA 5D5ME 1NPUA 1EEUA 4OQTL 2AEQL 4J1UB 1VACB 1UB5A 1YUHB 3AMLA 3L3HB 1GL4B 4PJ9C 5C09A 3D87B 3B2VL 2J7LA 4NQVB 1WBZB 1BZ7A 5JORB 2KKQA 2J4WL 5J12C 5MHSE 2YC1B 3SPVA 2E7LA 4URTB 1JGEA 5CEZD 4E41A 1FL6A 2FECL 4PJAB 1SJEB 1NC2B 3FQTB 1LEGA 3MRKB 5DMJB 2NXZB 1N4XL 4HS6A 4HUVA 3BSZL 3U0WL 4LLVB 1G9NL 1BQHG 1NLBH 3DGGB 4WFGD 3CLFH 4PP2B 1ZGLB 5CP7A 1A7QL 5DI8B 4RDQF 3SQOH 2ICWJ 3WL9A 1H3PL 2EYRA 4PJGF 4HH9A 3LQAH 1IC1A 2W60B 2A77L 1P69B 1ZT1B 5E2TH 3V5HA 5DD3H 3K7UA 3CCHA 3ULUH 1A3RH 1MH5B 4WTWA 3IB4A 2YKLH 4EZMA 1S9VB 2Y7QA 3QEQB 4XXDA 5FYKH 4BKLB 4DK3A 2GJZA 2VQUA 5L88H 3VDBA 4IMKC 2AEWA 2C5DC 4PP2A 2FH8A 2VAJA 4D8PA 1Z0MA 3AFLA 4DKFH 5I6XB 4NUGL 4DQOH 3P0YH 3P3YA 1CTOA 3JWOL 3EYQD 4NNYA 4XGZA 4YDLC 5I8CB 2D9QB 4EI5C 1NCDH 3W5NA 5ID1B 3LH2L 5C09E 5DR5H 1M4KA 2XTJE 5JR1L 3OX8A 1N5AA 4S11A 2E27H 4U1IB 1YMHB 3JBG7 2XKSA 2JJTA 4L9LC 2JTDA 4HS8H 4FG6D 2KBGA 4J1UA 1L0YA 1YEEL 4HG4J 4PJIB 5HD8D 5J6HA 1SVZA 5JW4M 5DJ8A 4I9WD 3TZVC 1XGYH 5DUPL 4YHKH 5DLMH 2QKIA 5HPMB 3UROR 2Z8SA 1H8SA 1LO3L 4X5LA 3HHRB 3HR6A 2JB5H 1JWUA 3BH8A 4TQEL 3KYOB 1J1PL 3PWPD 1WCBB 3BQUD 2YD4A 4BZ2H 5B38A 2F53D 4KTDL 3HMWL 1MRFL 1NGWB 3MV7E 1RZGB 1MQKL 4P49A 2G5BA 3PWPB 1QD0A 3LEVH 4QHLA 5F6HJ 2PYFA 3AREB 3C8KA 2UYLB 4GG8B 3FCTB 3G6JF 3RA7H 5BVJB 1RUKL 4KGJA 2DD8L 1C1EL 4PJEE 3H42H 2H1PH 4EIGB 5LXGL 3HMXL 3DX8A 3T0EA 2CMRH 3LKSA 4YDVA 3I50L 3O2WL 1U8KB 4M6AA 2OXGA 1JYNA 4ACPA 3BIKB 5HVFB 5T1DH 3QAZC 4E9LA 2MPAH 4ZAKB 4OIAA 2L7UA 5LCVH 4BM7A 2VXQL 5EU5A 5BS0E 4K7PY 5FA4A 2NW3B 1VB9A 2H32A 3TO2A 5KVMC 4L4VA 3WD5L 1P7HL 2LQRA 2VIRA 1CLZL 4PRHD 4AJ0A 2NR6D 4Z7OE 2VLRA 3SQOL 4RGOL 4QXUH 1DE4A 3SQBA 2R0ZH 3O11A 1Z2KA 5D2NE 2VKXA 1QFUL 2EDJA 3JUZA 4M7JH 4MXWL 4CNIA 3VXUB 3CUPA 1W0WA 1HHJB 3EZJB 2YOCA 1S7UB 1UFUA 1A6PA 5E08H 3IDIA 1FAKT 1KLUA 5C0CD 4JDVB 1DSFH 3KLAB 2QQKL 4M7LT 4XNUH 4U6HA 5I71B 4FA8A 3GSVA 2XNAB 1NDGB 4FFYH 5IM7A 2XWBA 3WS3A 4PD4J 5LWYL 2P48B 1F2QA 2VDML 2PTTB 2DWEA 4XB8A 1NCNA 1NFDB 4FFZL 4ODXB 4ERSL 1A21A 4XXDB 3D48R 3KYMA 5SWQB 5CZVL 3QRFM 1E4WH 4O9HH 1JPTL 1ZT1A 3ZT5A 2IPUG 2IQ9H 1V3KA 2NY1C 5KSBB 3WL9B 4R7DB 4K8RL 1HQRB 5TJWK 3U7WH 2VZSA 4F7PB 4Q97A 2EDNA 1DBJL 1J88A 4JKLA 5KANI 1IKNC 5FCUL 5KSAD 1P7QA 1RZIB 3IDYC 1D6EB 4LSQH 4DZ8B 1NAKH 2X6MA 4RAVB 4EKXA 4ZFGL 2C4FT 2WUCL 4Y5XC 2EDXA 2UZIL 1RZJH 4X4MA 2D4DA 3PL6A 1BZ9A 3HRZB 5DRZA 3R1GH 4PJ7B 1EUUA 5HYJB 4PJHB 1LDPL 1FYTD 3Q2CA 1J1XL 5I17B 5LVEA 4MZ2A 3V0VA 4WHYH 1CLYH 4WDIB 5IW1A 6CGTA 3BP7A 3HRPA 3HI6L 3AREC 3ZTJG 5I1JL 2GTWB 5FM5O 3U46B 5DMGC 4F80A 2CMRL 1D9KB 1ES0B 4K94L 3SKMA 5JPNB 2PCPB 1ZEAL 1SJHB 2E8YA 4YXKH 3V7AE 4J3UA 3D25B 1AKJB 3RL2B 5DMIH 3BMVA 2MHAB 1RZFL 4LU5L 2ITDB 2CO7B 4TVPL 1UXWA 2VXQH 3LOWA 5HDQL 4XX1G 3PWLA 5E8OA 1T1XA 3BW9B 3L7EB 1IKFH 4BZYA 3T2QA 5B4MC 3VFGH 2VE6B 4NPYB 1Q94B 4Z18A 3PHQA 4JRYD 4Z76B 3LHPH 4AEHH 1FLTX 4I2XB 4KVCL 3WIIL 2H9GA 3FQRB 1BQSA 2HT4C 4ZXBD 1CFSA 2BZDA 3LDBB 1MY5A 5BVPH 3U46A 3MNZB 4ZFFA 4Y4KC 3C5ZB 2ZUWA 3FT2B 2EDLA 4NOBA 3AXLA 2N7BA 3SJVB 2VL5A 2B0SL 4U7KA 1IM9D 5D7LE 3PQYE 1WZMA 4M7JL 4P2CG 4X99B 1OP5H 4MXWH 1RFDH 1MI5D 3L3GA 1PD6A 3HN3A 3D39D 1INQB 2Z93B 1BIHA 1QLRA 3QEHA 1IC7L 3ARGC 2FATH 2ARJB 3F5WB 1RY7B 4DGYH 4EXPX 3BFOA 4M9PA 4X4ME 2CKBH 4NQCA 3PGCA 1MCQA 4RMVA 3LKNB 3SOBH 1QFWL 4OLWL 3IF1B 1G9EA 4DZ8A 3DUSA 4M3JA 3QJHA 5EH1A 1TTGA 3S98A 3KXFA 1IC4H 3FN9A 1JNHA 4QTHB 2GY5A 3ELAT 3DI2B 5E2JA 5JLZB 3ZE1F 4LLWA 2XN9E 5DWUL 1A1NB 5FYKD 2FL5B 2ERJC 1BEYH 4JFHD 1JZ3A 3ULVH 1WEJL 2OP4H 1BD2E 5D6CB 4YHNA 4X6FB 1O5DT 2E3VA 4TUKH 3ILPA 3RGHA 4K8RH 4Z7WE 3ARDD 1X44A 1XF5B 4EEEA 2HVKB 1XR8A 1NCCH 2LU7A 4PTTA 5CP3A 3T0EC 1OCWH 3O6FC 5JOFA 5J11B 1M7IB 4F9PC 2HJLA 3EDDA 3B5HA 3EYOA 4LSQL 3Q0HA 5JOEA 3TJHC 3SO3C 5A2LH 3MXVH 4Y16C 2XNAA 2MCG1 1E4XI 4ZFGH 1FVEA 3VG0L 1IL1B 4HJJL 4IOIB 4X5XA 2GITA 4M02A 4LKXA 3KDMB 4LASL 2HH0H 3QA3B 5D2LF 3HI6H 5CJXA 4PV9A 4XVUC 5E5MB 4I4WB 1MJUH 1B0RB 1LO3H 2JB5L 3DXAE 3QQ3A 3KS0J 2ZP0T 4TQEH 3NBNA 1B9ZA 3GRWH 3RAJH 4GRWB 3I6GB 3KPSD 1CXHA 3OGCA 2Z31A 1Q72L 3IU3B 3GIZH 4KK8D 2CLRA 1ZXQA 1MY7A 1AGEA 4IRSD 2NW3A 3ROLA 1N5YL 3UTZB 3E0GA 4LSDA 3O0RH 5F9JA 3FB5B 1AGBB 2APFA 2V9RA 5I8EB 1A6WL 4G8FA 1P84K 5B4MD 3RA7L 2PXYC 1CICD 2B4CC 2DD8H 3QIWC 3QQ3B 2NY3C 3NIGF 1SJEA 7CGTA 1X5GA 5IG7A 4PV9B 5FA3B 3CFJB 2ZUXA 4JQXA 1IFHL 4JEGB 4JCMA 4QYOA 4NN5B 3RWJA 5FECB 3TO4B 4I0PB 4M6ML 2FGZA 3X14A 1KC5H 3EO1A 2X70A 2H41A 1I8MB 5I1KL 2DQJL 3VXMA 1Z0NA 3STBA 5EN2A 2WWKO 4KKLC 2BVOB 3CFCL 5ERWB 2ZPKH 3QT2A 4FTVE 4RGNE 1HKFA 3QIUA 3RWFB 3MV9E 1DVFA 1XIWD 1ROWA 1T3FA 3MREA 1K2DA 3DO7B 5IVZB 4M6NH 1RIHL 5CD3B 1E0OB 3AREA 3D9AH 4M5YH 1AHWC 4PRPA 5K33A 4TSBL 1Q8MA 4HGWA 4U49A 5F1NB 4X9GA 2E9BA 1AXSA 1HE7A 3BUYA 2EYSB 2IJ0C 3ZSSA 5IBLD 5DQDL 2WUBH 1LD9B 3HS0A 3OR6A 1UH4A 2YBRB 2AJYL 3D69A 3PGFH 3MV7D 1A5FL 4HQQH 1JGVH 1VERA 3TZVD 1LO0L 5A43C 4JFHE 3FRUB 1ZOXA 5IMOA 3JV5A 5ACLA 3GSQA 2K1MA 1EBPA 5B39A 4P2RE 3B6SB 5D4QA 2H32B 2OQJB 4K7FA 5EU5B 5F3HB 3N1FC 1CGUA 1A9EB 5D7LD 2DQUL 3VXSE 1HILA 4G6KH 2BJMH 4JLRA 5T3ZL 2IBGA 4FFZH 3QDHA 3VA2C 5ADPH 4ODHL 1TJIL 2BSED 4CVZB 1FZOA 5IROA 3TBTA 4GAJH 3CX5K 4NNXA 5C0CA 1RUML 1QFHA 2E6JA 4WIQA 2Z92A 2WW8A 3HG1B 3HI1A 3HE7B 5CBEA 1J8HE 4MDIB 4U1LA 3SJVD 4D8PB 1K4DA 5ADOL 1FBIL 5JW4N 1MJ8L 2R0WL 1B90A 4QHLB 1RZKH 1CFTB 4JFXB 1PSKL 1YEDA 4GT7A 4J6RH 2ZSVB 5D72H 2MTPA 1H3UA 3LPGA 4HUWB 3TA3A 2QQQA 3DGGA 5TE7H 4J3WA 2CSPA 3QWRA 1KNOA 2R23A 4JQIL 3B9DA 4RMUA 1R5VA 1UWXH 3IGAA 2YUZA 1IC5L 4KQ3H 1CE6A 4OF6A 2NY4C 4PP1C 4I0CC 4PJ7F 2IANA 3HLAB 2X4SA 1T4KA 3V4PL 1MFCH 3LPWA 4Q0XL 2AK1H 4Q58C 4MD5A 4LVNC 2JIXA 2PXYB 5F9DC 3GSNH 2KL6A 3C8HA 4X0KA 2PYEE 4OLXL 2P24A 4M6MH 5JA8B 4RISH 4F9LA 1FL3A 2DI9A 2JCCF 3FRUA 1FG2B 2DWDA 5C09B 5DK0B 4PJGA 4B0MM 3VXRB 2V2XB 3HC4H 1AO7A 3IDNA 2YBRA 2A73B 4H1LB 3UTTE 5DZLA 5JMRA 4RMRA 1AI1H 1AJ7L 1W2KT 4J3TA 2VXTL 5TE4L 1IAMA 1T7VA 1FVCA 3KJ6L 3WJLC 4OTXL 2X89A 2NY0D 5ILTH 5FYJD 5IHLB 3S37H 2WUBL 2ZOLB 3F8UB 2DMKA 3GK8H 5EC1B 1AQDA 2ERJB 4N5EC 4LHQB 3C5JB 3MLUH 4JO1L 4OV6F 1K8IB 4IBLT 4XRCB 3WIHA 1MWAL 4FQLH 3SKJH 1PEWA 3RI5F 1LDSA 5FKAB 2EECA 4N68A 1I7ZA 4GFTB 1S7QA 1EAPA 4PGBA 3P4MB 4LVOC 2GJ6E 1U42A 2FBJH 3P73A 4AEEA 4HKZA 3BHBB 3TM6A 4ALAL 5JA9A 5EDXA 5T3XE 4RSVA 4Y0GA 4C58B 1C12B 1ETZB 2LU3A 4UOW1 4FQIH 1KLGA 1WICA 2AV1A 2EE9A 2P8PB 4PBVC 4WGWB 4ORGB 5F6IB 4GG8A 1Y18A 1UWEH 2YK1H 1IVLA 1MRCL 4ELMF 1S9XA 2OK0H 3MACH 5FYLD 1QFWM 3V79C 1TQBB 4FQJL 3V9FA 1W8OA 5KW9H 4X8XA 4KHTL 3X12A 1YEFH 4PRPE 3FFDB 1DQLL 4NRZB 1VPOL 5J6HB 1C16A 1VACA 5FO8B 4LVEA 4XB7A 5AAWA 4AENB 3UMTA 3EFFB 3FQWB 1WEJH 3GB7B 3DUUB 4TPRH 2C3VB 1A8JH 4YFDB 1B0RA 2R0WH 3BP5A 4UBDC 3SGDH 1CXFA 3VXPB 4X4YA 5D72L 3ARGB 5EZIH 3G6JA 1PYWA 5EO1B 3QUML 4NCC1 1RVFL 3NGBB 5ESVA 3W0WD 5FUCC 4PJFE 4RAHA 1I3RA 2BOBB 4HHAB 2NTFB 4N90E 5E99L 1AE6H 3V8CA 3LRSB 5FF6B 2VDNL 1LNUA 4L3CB 1C08B 4Y4FD 1U3ZA 5L7XH 2GT9A 5INCB 4HIHB 4CU6A 1BBDL 2UV3A 2Z35B 4Z0BL 2UY6A 1W72A 4JDTL 3VFTB 1GZQB 2P5WE 1D5ZB 1M05B 4OFPA 4UOW0 3TZVA 3QAZB 3PGDA 4XCNA 4NQXB 1BVLA 4YHOH 4KPHH 3EO9H 3EO0A 2W92A 2X1OA 3A6OA 4BSJA 1EGJL 4MLIA 3QJFB 4DUXA 3GIZL 3QDMB 3SCMC 2VR9A 4GQ9L 2L7JA 4ZODA 5TE6H 3WNPA 1A1MB 1N5YH 3IT8D 4HUXA 1OM3L 5BV7H 1DZBA 1JNLL 4U1LB 4BH7B 2DLIA 2V2WB 3MOAL 4DTGL 3HE6C 4DGIL 4HCRL 3K1KC 4NNXB 5C0CB 4PJ9A 4IMLA 2DQIH 1TZHA 1YECH 5E6IA 4P48A 1G6RA 1KTKE 1BVKA 1IAOA 1ND0B 4EN3B 5EBLA 5IWLA 1N2RB 3M07A 2G75A 1MAMH 3CLEL 4BYHA 1NC4B 5H35B 3H6JA 1FC2D 3GK8L 4IMKA 4G6AC 2GQHA 3MGTA 1NC2A 4G43A 1GGCL 4WV1B 1FL3B 4R90L 5IMLB 2OSLA 5EUOB 3MRDA 3OG4B 3U30B 5C71A 3NPSB 5CHNA 1JZ8A 4WENB 1CGTA 4ZS7H 5BJTA 1FJ1A 4GQPH 2HTLC 3QFJB 4GKZB 3VXOA 5ID0A 1QQDB 2BVQB 1ZHLA 3P9MA 4Q2ZB 5C9JA 3EOTH 2QADC 3MLZH 3HLAA 2JKXA 3QDJA 3QFJE 4MYWB 4EBQH 2H3NB 4O58H 4WTZA 2I27N 4JY4A 3DJ9A 1CFVL 1G7IA 4N1EA 2BY2A 1B0GB 1T1WB 2JJVA 1BGXL 4IEFB 3G6JE 4Q9RL 2AJYH 3IDGA 4PYHA 3MQIA 5DDHA 3ARTA 3PGFL 3SGJC 4FQ2H 3ZT7A 2VXSL 5FYJH 4S1RH 1JWMB 3DLQR 4I3GA 4TVPE 5F72S 2BOCB 5HHXL 2IAMA 2OJZL 3OWEA 5ICZB 2I26N 5CSGA 4DN4L 4JFFE 4WW1A 5D7JA 5I19H 1BJMA 4FQQA 4L8DB 5IQ7H 3EO1B 3FB8A 4JFPB 2VDOH 3IKKA 1TZGL 1H3VA 3FQNA 3Q48A 3N1QC 5BZDA 2Q20A 3VWJD 2DQUH 1X5YA 3OJDA 2X1WL 5EZIL 1UM5H 3Q3GA 4KHXH 2HTKC 4HUVB 1REIA 4J12A 4X8JB 4V1DB 5HYJD 5J4MA 1TJIH 5F7DB 1OAZL 4X9BA 2HWZH 1VEPA 1TITA 4G8FB 3RWDB 4BSVB 5JW5B 1GGBH 5T1MB 4XPGL 1TETL 3O3UN 3E6FA 4ZG1A 2YD7A 3P4MA 1NANH 1UQSA 3PQYA 1OTSD 3TN0B 5GIRA 3NMEA 1J0HA 4QTIH 1WTGT 5IMOB 2YN5A 3MNVB 2CKNA 5GS2D 3RVVD 4JFYA 5IMKB 4JGUA 4MNGB 1ZA3A 2RJMA 4ZNEA 1GZPB 3TYGL 5I6XC 3LV3B 2JJUA 4CVXB 4YDIL 2ICWA 3W9DA 5HI3D 4ODVH 1X5KA 4DGVH 3MZGB 5C70A 5SWZA 4B5EA 5T5FL 3WE6B 5ERWA 3I3EA 2DQIL 2V9TA 3TA3D 2X4UB 3M1BA 1K2DB 4GUPA 1T3FB 1CF8H 3TIEA 1Q9KA 3CXHJ 1IM9A 2DQCH 4JG1L 2FJGA 3KPTA 2H2PD 1KYOJ 3MLYL 3IETA 3M8OH 4WW2C 1V3JA 3RX8A 3MPCA 4NWTH 3VDAA 2GTWA 2R4RL 1F90H 3WO4B 2D31A 2J88H 3HC4L 3LQZB 3QUXA 5F44A 1DFBL 1V7NL 1FL5A 3RGVD 3GSOB 4ZO8A 4GLRI 1P1ZA 2BC4B 4KJYB 4NQTA 3ZL4L 2X40A 1ORSB 4I8DA 5J6GB 4PYGA 1I1AC 2VXTH 4HK3N 1R5IA 3HCVB 5E56A 4MXVF 5C7XL 3MRIA 4S1DC 1AR1D 1MCEA 1NBZA 2AJSH 3OKLB 1TJGH 1HZHL 3WFDH 3EJYD 2DI8A 5CD5C 3FQUB 2B4CH 1S5IH 5HYJE 3B9AA 1WF5A 1KJ2H 3H9SB 5E2UH 2FX9L 3O6ML 5DJXA 2NMSA 2QSQA 4KI5F 3ZKNC 4BQCA 4IRSC 2D31B 2DKUA 2FO4B 3BKJL 3F58L 4DN4H 4NRXA 1SMOA 5C07D 3DRQA 1TVHA 2MQ3A 5EU6D 1NGQL 5IQ7L 2P8MB 2O5XH 4O02H 3ECBA 4W4OA 3BGMB 3REVA 4K9EC 5KSBE 4ODWA 5D2LE 2XIDA 3DRTA 3MODH 2RFXA 3VI4F 3ZDYF 5FK9A 2VXVL 5FUZL 4I5BA 1JTOA 1MSPA 2VDKH 2XZAL 5DF0A 2NYYC 3NCYP 4N0CC 4XBEH 4NO0B 3K8LA 2XN9A 1DQLH 4QOKE 3NA4A 4OZGA 4XBGB 5IR1A 5FGBC 3T0BA 4GBXA 4DK6A 4CU8A 1NFDE 1JV5B 3LN5B 1L7IL 1I1YA 1ORQA 3QI9C 4PJHE 3MTRA 3QUXD 4TTGA 4O00A 2EH8L 2FHFA 8FABB 3O4LB 1KEGL 4RGNC 1YMMB 2OTWB 3QULB 2O61B 1K4CB 1AR1C 3UYOD 1YQ2A 2DTMH 3VFRB 3S36L 3ZDZF 4Q74A 3ARFC 1JI1A 4LIQL 5KS9E 5ISZD 5L7XL 1I1YB 4OLYL 5FGBA 4OIIL 4IRJA 4OZIB 1T0PB 3NABL 5ANMB 1EMTL 3LKNA 4UAOB 3GJEB 4LQ1A 1NMBL 3BAEH 1A7NL 3T3PE 1G9ML 4H26A 3Q3GB 3KVQA 3T65A 3TJHD 4YHOL 1P53A 2PUQT 1YJDH 3FOLA 1AXIB 4U1MA 3MMEB 1GAFH 4YEFA 5HYIA 4XZUA 5CJOL 3MLYH 3B9VA 4R0LA 1J8HD 1HINH 3TPKA 1P4BL 3FQRA 4LIQE 1GPOL 2HN7B 3WKML 4DCQB 5F1SA 4UB0H 2ZJSL 5EC1A 4CJ0A 3C5ZA 2B1HL 4L9DA 4RAUA 2DYPD 4HW6A 1O0VA 3UTPE 5CSZA 4CMHC 25C8H 1YECL 1S7RA 1QA9A 1XR9A 3GMNA 4U6VH 4X6DA 4NQUA 4ZNEE 5C7XH 1MQ8A 2OL3A 1Z6JT 3F65A 4PJEB 1UENA 1BQLL 1NAMB 1WBYB 3WS6C 4ZXBC 3RNKA 4Y4HB 4JHZA 2BNRB 3VGGA 4Q2ZA 5C9JB 5IFJA 2BNRE 1YZZA 2VABA 1KJ2L 3GKZA 4JKPH 3UJIH 1FG2A 5EC2A 1JPGA 4G6AD 1DUYB 1T5WA 3FFCE 3TPUA 5DD6A 3QA3A 2YPVH 4U3CA 4G6JH 1YEIH 4Z7OF 1KIQB 3GSUB 5C0JB 1LP9F 2F58L 4OZGB 5IR1B 2XFXB 3BPCB 1T04A 3B2VH 4FMFA 2UY7A 4MNHA 3W5MA 3MV8E 4IRJD 1T6WA 1UZ8A 2HKFL 2UVFA 5FCUH 4KROD 2IANB 5F7WC 4QRRA 1WBYA 4XVJL 4NP4H 2Q8AH 3VXME 2YS4A 1TNMA 1SQ2N 4OD1H 4P2QA 4NN6B 5LBSH 3NIDE 1JMZA 4FG6C 3ZDYE 5EU7E 5GJSL 5HHXH 5HGGS 3HPJB 1SY6L 4AT6A 5IB1B 3TO2B 3TO4D 4A2MA 1X5HA 2K9UA 2GFBA 3LKRA 1FZMB 4P59L 4ZPTB 1L7IH 2Q7NA 4APQC 1ZLWH 5FO7A 4Z77A 5GGRY 3MO1B 1IGTB 4K94H 1DBMH 3T08A 3PF2A 3BIKA 3TH2T 1S9WA 2VZVA 2X4TB 3WDJA 1KEGH 1A6AB 3OR7B 1OGTB 5CLWA 4GO6B 3JTTA 3FRPA 3WFBH 4OF0A 2HTKD 3IFOA 3A67H 1HQ4B 4OCWH 3VDCA 3PGCB 4HWBA 1DL7H 4P9HL 1G1YA 3GMQB 4OLYH 1B2WH 3TYFB 1GGBL 3MC0A 4XPGH 2VYRE 2EICA 3JWDL 5J06A 4NKOB 2KZ1B 4H88L 3RI5K 1TVBB 4P2OB 5ALCL 3JWOH 1NGWA 4LCUA 4J3OC 4HXAH 1NCDL 5D7KD 1JYWA 1H5BC 5IW6A 4MJ4A 3L95A 1LILA 3AROA 3S35X 4HWBL 2XPGB 1YY9C 2VZ1A 1OP5K 3PWJB 3DYOA 3VFUB 2DLHA 1OQOA 1OB1B 2FATL 1HK6A 4PJAE 1G9MC 3D3VD 4HBCL 2B1HH 3NA9L 5FV2A 3S37X 2CKBL 2NNAB 5DJ2B 5TQ0H 1KN2L 1RULL 1CD8A 4YHKL 5DLML 2R2HA 2GIYA 3ULUD 4MJIA 2NXYD 1QFWH 1MF2H 5EBWB 4YK4C 5F70A 4W4NA 4Z0XA 3ZT6A 5JXEA 4A6YA 4AIOA 4Y4FA 2XV6B 4R6UA 1GIGL 1XZ0B 4MS8C 4M6OL 1QQDA 2BVQA 5I15L 3X3FL 4RA0C 3M8OL 3FO0L 5A3ID 4I3RH 3KPOA 1CDIA 4POZD 1U92A 3QDJB 1IGYA 5HHOB 5BMFL 3U4AA 1G7PA 4IIQC 4WI5A 1MCKA 3LEVL 4JQVA 2D03L 4LCWA 1BEYL 2J88L 2Y36H 1ZWIB 4KU1A 4UV4L 3L5XH 4WO4D 3P9WB 5DHYB 2V5TA 4MJ6B 5I9QB 3GMLA 4G6JL 1XFPA 3S34H 2XQBL 2A83B 3L9RB 5KAQF 4QRTB 5HY9A 5C08A 1QRKA 5GRXG 2VXUL 3NFNA 1CD0A 2DQDH 4WUKH 2HFFA 3QFJD 3AS0A 4ZD3H 3QUYA 3MJ6A 1KJMB 5J3HD 2VLRE 4U0RC 3MXVL 3QXWA 3MRGA 4RZCB 3NN8A 3IRPX 3O6MH 3KNBB 4F8TA 1OARH 3N0PB 4YFEA 4G8EA 3VRJA 3MRLA 4NSKA 4KTEH 3RJDA 1IQDB 4XNXL 5DK0A 3P0VH 3V7MA 1A6VL 2HFFB 4Q6YA 5IOPA 1RK0B 3U0PA 3NCJL 4OQTA 1U3HD 4U2ZA 3IDJA 3I6KA 4E41E 4YWGH 3MJ9H 3OBAA 5TDOB 1CK0H 3KXFE 5DJAB 3O41A 1Z5LA 1G7HB 4YZFF 3RAJL 3C9NA 5KVDH 3KPNA 1S7WA 5DGRA 3FO1B 2H6PA 2DWEB 1BECA 1Y6NR 5INCA 3BRGC 1N5AB 3TZVB 4OCXL 3O0RL 4WFED 4K2UL 5LG1A 4LNVA 1A6UL 5A3IC 4XVTL 4OCWL 3LS5L 4OF5A 4YBHA 4FXKA 5C6PB 5KVFL 1FVDA 3SEPA 2BK8A 2EE6A 2FIKA 2NYYD 4OZIF 1E28A 3OKMB 1RSFA 3K2UL 4LRIC 1QBLL 3WUZA 4MDJB 2W07A 4XCEA 5I1GH 4X6BA 4NHUB 2ADGA 4LFHG 3I6KB 4HMEA 3IDJB 4K9EH 1OW0A 2EH8H 2V5SA 3QPQC 1JF6A 4OZ4A 1RZ8B 4WU5B 3MRRA 4YDLB 3CNKA 1PGRB 4E0RA 2CLZA 5FGRA 2AJZB 5EBLB 2V17H 1WVZA 1V3LA 4OT1H 3VFUA 2GYSA 5C0GB 1A7RH 1KPUA 3W0WB 5SWSD 4NO2A 1BQHB 1RJYB 2J6EA 1CCZA 4I0PD 1X3DA 1NLBL 4MNQA 4YX2L 1NMBH 5JXEC 1INDH 2DMBA 4LVHC 1TJHH 5ISZB 4NQDD 4HJ0D 3U7WL 1I8KB 4EI5B 4NO3A 3V52H 1EH9A 1DBJH 3IFLL 3L3DB 3NAAL 3LD8B 5DD3L 5IIEA 1DN0B 2FB4L 3L3GB 3CSGA 1NKRA 2P5WD 4JFPA 5FYKL 2RCSH 3STZB 4KJWD 1NQBA 3KPSE 5I76A 1IGYB 5HHOA 2JJSC 2CRZA 4M7LH 1FO0L 5IEHA 3WXWL 4K7PH 1KIUA 1OPGL 4UIKL 3W9EA 4CADB 1BOGA 3QNYB 3QB7C 2CK0L 2WM0A 1F11A 4XCYA 1H5BA 4TNVF 1BBJB 3S34L 3ARBC 3D3VB 1YEGH 3QNXA 5AYQA 3G9AB 1U3HC 3RWIB 5SWZB 2VUYA 4XRCA 4MJIB 3LN4B 4ZPTA 5C0AE 3NZHL 3MRJB 2G60H 4HK3J 3NTCL 5GZNC 2MOVA 3VWJC 2VZOA 1F45A 4CAGA 5E6ID 2NX5D 1EHLL 2OXHA 3V4UH 2VLJE 4PJ5D 1N3NB 4RMTA 4QNPE 5KSBF 2W0FB 2LVCA 3MLSL 3O2VH 3DURB 2XG5A 5C0BD 1GSMA 2NNAA 5HGBB 2B5IC 3VFGL 3JV4A 2MFNA 2BVPB 1FIGL 5ADOH 2YPVL 1MJ8H 3UZVB 4LL9A 1JF5A 1A6VH 3U1SH 5D8JH 5HI3C 4OCSH 4GSDL 4F9LC 2D7TL 2E9JA 1H5BB 2R1YA 3NCJH 3L1OH 1MCDA 4JFDB 4KY1H 2M8XA 3BP7B 2CK2A 2C3WA 1GC1H 5A2FA 5T1MA 1ERNA 1J1PH 5I1HH 3EOAA 5KZCB 3EYSH 1CLOH 4BZ2L 2YSSA 4F3FB 4PGCB 1F5WA 1P7QD 3ARGD 1I9JH 2ZUQC 3V5DA 3SDAD 3BPLC 5D1XB 1VGKB 3BGFB 3OKNA 2Q87A 4AQOA 3VD3A 1IC7H 5GS1B 3OJDB 4OFIA 1RZKC 5E4IA 3UXFA 2W0PA 3NZ8A 2ADJA 1C5DB 1MFCL 2CDGB 1P4LB 1CICB 1LO4L 2AK1L 2AK4D 1T66D 1R5VB 3I9GH 3DX9A 3D85D 4YIQB 3RHWF 3OMZA 4LK4A 1K8IA 3WFEL 1KJMA 4UZGA 3VFPB 1TTFA 5ETUB 1BZQK 3MLXL 1X4YA 1N8ZB 3BPNB 4PTUA 5L2KA 4WI4A 3HG1A 3HI1B 5CBEB 2B1AH 5CGMA 3HUJE 2WIIB 3EDEA 4YPGB 4OI8A 4XCFH 3HC0A 2Q6WA 5ICYB 3AY4A 4KWUA 4P9HH 4U1MB 1CD1B 4M1GH 3WS6A 3QXVA 4N9GA 3ZO0A 1DQTA 1KIRA 2NX5A 4U05A 1A2YB 2Y5TB 2I5YH 3OAYK 1X6LA 1SY6A 1CLZH 4H8WC 3N1PC 2Z4QB 3PDOA 4PJGB 3IU4H 3C60C 4XAWH 4QXUL 4RWYL 3U7YH 5DFVC 4XMKL 2JJSA 1YEKL 3OPZH 4OFDA 1NCWL 3NFPB 5DK2B 3B6SA 2BVUA 4JO1H 3RWHA 4P2OD 3F12A 1UJ3C 3BZEA 1YDPB 4NIKB 3OXRA 4CNIB 4RFOL 2H6PB 4MHHG 3VFRA 1T03H 3FQXB 5A40E 4NN5C 4F2MB 1K85A 1N26A 1MRDL 2B20A 3HC3L 2G75B 4LLWB 1DANU 2VLRD 4JO4L 4G8EB 3VRJB 3L3KB 3TFKC 2FWOA 5EC2B 1WWWX 5JZ7C 2ZSWA 2EYSA 4CUCA 1HHIA 5GISH 3OJMB 2GCYA 1MF2L 2I9LB 4TUJB 2CGRL 5LWYH 4RBPK 5DD5L 1UWEL 2GJ6B 4KVNL 2VDMH 1M71B 1EA9C 2G60L 2MMXA 1MRCH 5EFIA 1VESA 3E3QE 2OK0L 3AAZB 1QRND 1Q72H 3RX5A 3OXSB 4Y1AE 3FO0H 3DMMD 4ZSOE 5KW9L 5C08B 1CIUA 5IF0B 2DJSA 3SO5A 4RNRB 2KQMA 3ZHLA 3LY6A 2XA8H 3B9KC 3VRLF 4O9HL 2AQ1A 4HT1L 1Z3GH 1RMFL 2NW2A 3FN3A 5F8RC 2X4OA 4PJBA 3IKCA 2IPKA 4JJ5B 4LRIA 1QSFB 3C2AH 4WO4C 4X4ZA 1GJIA 5GJTL 3UBXA 4NOFA 5F7FA 3T1FA 2EIBA 2IGFH 3VFVB 1I9RH 1GC1L 1HSBA 4X7DC 4HX1A 2K7PA 4KKBC 3WUWG 4HKJA 5KSUB 2E7HA 5C8JA 4Y2DD 5DVKA 5HHVH 3PABB 1IGTA 4Q9BA 4R8WH 2G5BB 3PWPA 5I1KH 5HHPA 3QIWA 5HDBE 3FB5A 3HZYB 1FPTH 1RZJL 5HGAB 3MRQB 1VFMA 4KAQH 1U8OA 2XRAH 3O9WB 3CD4A 2VUOA 3OZ9H 4ODUA 5HD8C 1T1XB 1CLYL 4S1DD 3BQUA 2ICEB 3D9AL 3G5XB 3BP5B 4TSBH 1JGDB 1MHEB 1PG7X 4YWGL 3W39B 1KYOK 4LPYA 1EFXA 3DV4B 5IVNA 3MLXH 4PRNB 2IC2A 1IAKB 4Z7UF 3WLBA 3KDMA 2A6DA 4GH7B 4LCUB 4HPOL 4FQHA 3HUJB 1MCJA 4LBEB 3UYPA 2YA2A 3OX8B 4Y1AA 5CCKL 4KKAC 1SEBA 5DRZB 4K71B 3B9KD 3IAPA 3L3IB 3I3DA 3L5JA 1BREA 3L5WB 4NKMA 4L8CA 2APTA 2VABB 1H8NA 4QRUB 3C6LC 3K2MC 1FGNL 5DJZB 1XT5A 4U1JA 1YPZF 3IXAA 3ULVC 1U58B 4Q9QL 4PJFA 3Q6FB 3UPRB 2BNUA 3FFCA 1MAML 3CLEH 5CP3H 4H25B 3ETBF 4KUZH 3X3GH 5E00B 4OD2B 4HIIB 1B4JL 3MRMA 4D9LL 1HHGA 3KPNB 4GBXC 1Z5LB 5CEZL 4OCYL 1WLHA 1J18A 2DYPA 4PG2A 3TN0C 2NQCA 2X5PA 1A7RL 2APWA 2NY6C 1FZJB 2ATPB 5BS0A 3ZKQD 5KJRH 1T6VN 1LO5B 3DVFA 1IE5A 3WJJA 4KC3B 2F54A 4R97C 5JXED 3RGVB 3QIBC 3QUZD 4WHCA 1XCQB 1U8IA 4HIIA 1PSKH 1WZKA 1A7OL 5L2JB 4AT6B 2IH1B 5GRJL 1J0JA 4JLRB 4OUUA 1KCLA 4FMKA 4N5ED 1MJ7L 2BVEA 2C7UA 3DROB 2F15A 4M7ZB 3WIFA 1IC4L 3GGWB 4R3SB 2N4IA 2FRGP 1FL6B 2NY5C 1BWMA 1OL0A 2WBJB 3ILQC 2QR0B 4Z78A 4PJHF 1FO0H 4QRRB 2N7AA 3I85A 4XTRC 3VXNB 4K7PL 4E41D 1NKOA 4KJYA 4NWUH 5F9AC 2XKUA 3VI3E 1HCFX 1VCAA 4W6WB 4XP6H 4N1CA 3GMPB 4XH2B 5GHWL 2H1PL 5LXGH 1C8PA 3F7VB 2RR3A 4KMLB 3ROOA 4MA1B 1QLFB 3WSQL 3O2WH 4WI9A 2BVPA 4TOYH 2F19L 1LD9A 2EE3A 5EU6B 3QUZB 1E6JH 3P4OA 3TT3L 3FT2A 5EOCJ 5HHVL 4M4PA 5T1DL 2JF1A 3U83A 3IGAB 4X9IA 4PLNC 1EHLH 1T89C 1I7TB 3BPOB 3WE6A 3CXDL 3M45A 2NXZD 1MFEH 3KPRA 4CN1A 4X98A 1O7SA 2FCBA 5J8OA 1HH6A 1HOCB 1XGPB 2HH0L 1H3XA 3PWUA 3G5YA 1KJ2B 5H37G 1ES0A 3CMOL 3D18A 4TRPL 1S8DA 4OZIE 1ADQA 1YN6B 4LMQE 4QHNA 1RZJC 3QXDA 5ACMA 2UWEE 3O3EA 3VGDA 4U6TA 5BJTB 4JJ5A 3MCKB 5IBTL 3OSKA 4CVZA 5GIRB 3WO3B 3IRZA 4L8BB 2DQTH 4PG9B 4AK1A 4YDIH 4W68A 1XCTA 5DJDA 2YA0A 3QEQE 3B2UC 4NO5B 4OI9A 4UDTB 4EUPB 1UA6L 2VLME 5L2JA 1IFHH 1Z9SA 4HFWB 3IFOB 2PN5A 3JV6B 4K3DH 4MNQB 5SWZD 3B5TA 1MHCB 2CXKA 2F74B 4EUPG 2EC8A 1T5XB 2DB8A 1NCAH 5GS0C 4TUJA 2QADB 3QXAA 2BOCA 2GW5A 5TH2B 1BOYA 2A6DB 3RVXC 4KHTH 2R4RH 1CVSC 3TCLA 3RUGA 4Y19D 3MV01 2AV7B 3WXVL 3H9HB 4TTDD 5CZVH 5I71C 1X7QB 2LAGB 1MCCA 1U8QB 2IAMB 1KJ3L 1IZKA 3OKKB 1ZA6B 1J11A 4NO0A 1QRNA 4ETQB 5I18L 1XF4B 2GK0A 2Y9RT 1BD2B 5DC4B 3IU4L 2BFVH 4JY5L 5FB8B 3U7YL 3SE3C 2EXWD 5DEGA 3VH8G 4XMKH 1D5MA 1YEKH 5EOTA 4P2QB 5GRJH 4U1GC 4XBGA 5D7JC 3L3IA 3QUMH 5GXBB 4PTTB 4R0LC 3RVWD 3GJFH 1S5IL 5C92A 3KPLB 2VC2H 1NAKL 4J3XA 1A5FH 4HQQL 3SDXB 1F4AA 1MLBB 1KB5A 2DL9A 4FN0A 3VGEA 4YHZL 3I75A 4LPTA 3ZSTA 1U8QA 5GRUL 1LDPH 5C0FA 3HC0B 2Q6WB 5ICYA 4JO4H 2AS5M 4UILL 4JFZL 1S9VA 2Y7QB 3QEQA 4OFVA 4EI6B 4X4YB 5KVEL 3VXPA 4PTUB 4O02L 2C1OA 3GKWL 3BD3A 3LKPB 3L5HA 3EO9L 2WINA 2VDRH 5T3ZH 4LRNL 2VWEE 5TFSL 1EXUB 5HGDA 5D7LB 1PDKA 3PQYB 3BKCL 1LE9B 5CMAA 4P0DA 2VL4A 4TVPH 3ZE2E 5HDQH 1QPXA 4WWKA 5C0BE 5DRNB 5F3BA 1KG0A 3KGRA 1IKFL 2EE2A 4ZAKA 1FNSH 2MKLC 4HT1H 2Y6SD 5DJ6B 5IV2A 3PABA 2NX5E 5EOCL 4NN6C 5IKCA 4ENEC 2X41A 3RPKA 2AV1B 2P8PA 3HZYA 2XZZA 4EI6A 4KI5D 4CN6A 4LSRH 5E4EC 4R0LB 1L9NA 4C83A 4KKBD 1KXTB 1UH3A 1CBVH 4XCNB 3QQ9D 4QRRE 1A64A 2BDNH 1WIOA 4FQQB 5H94A 1IC5H 3GSVB 3QDGE 2C4FU 3K46A 5J56B 5J7CC 4OIIH 4B7LA 3FB6A 2NY5L 3PHQB 3NABH 4X9FA 5E1AB 5E9DA 3G6JB 4PJDF 2ESVE 4F57H 2AGJL 1A7NH 7FABL 5HPOA 5FGCB 2DJUA 4OQ1A 3MBEB 4LBEA 4HHAA 2CDFB 5KSAA 3QXTA 3ARXA 3P4OB 15C8H 1UKQA 5EO1A 2MQ0A 1PYWB 3HFML 4PJIA 3EJZC 4M48L 1BM3H 2C26A 4IJ3C 4G3YH 1MVFA 4NT6B 3BI9X 1DE4B 1GPOH 4YEEA 4ZPVA 2X09A 4FQCH 5I2IA 3NCFB 5C0AA 5CCKH 3B83A 3WXVH 1JMXA 4L1HA 2V9QA 2PXYD 4ZO7A 4L4VE 4QRPD 2NY4B 3B3IA 5SX4H 4WEBH 3PXJA 3BWUC 4OLZH 3N06B 4WFHD 5KZCD 2QHRL 2PYED 3OJ2C 2R2BB 4LSSL 4I5BB 2PR4H 3VFMA 1NCCL 4QHMA 1PKQE 3WNLA 4EI5A 5F89B 4DAGH 3B4NA 3WIHL 4FFVD 4PG9A 5D1QD 1MFBL 4ONGL 1G7QA 4NHCL 1JZ4A 3S8WA 4QRQB 1ZANH 5J57B 1MCFA 4HLJA 3MNWA 3CK0H 3TEUA 2HG5A 2BRRL 3SDYL 4F33A 1FYHB 3HZKA 2W9DL 3GHBL 1NGZA 2IANE 4O4YL 1KN4L 2YWYA 3GBLA 4H20H 2X4TA 5T1LD 3V5HB 1ACZA 3FB8B 2R8SL 2UYLA 4DWHA 4R2GD 3KYMB 4N8VG 2LABA 3LCYA 4Z7QE 1IGCL 4BKLA 2BY0A 4FQXB 4ODXA 3RVVC 2ZUSA 3KHOA 3RUGE 3LB6D 2YK1L 5BRZA 3WFZA 4NP4L 2Q8AL 2R0KH 3ULUF 2ICCA 4N0FB 3ZHDA 2BNUB 3FFCB 3SGKC 2ZWLT 3NIFE 5LBSL 2QQLL 4MS8D 5F7EH 4LDOB 2IFGA 3OKOB 4FRWA 3TYGH 3VFTA 4B50A 1DEEB 3T04D 1OTTD 5E94B 4PGCA 1L9MA 1CGYA 2CKBA 1AO7B 4M61A 3GSOA 4P5TA 5I8KH 2CUHA 3VXUA 2AK4B 4PJAA 1LQSR 2XZQH 4MJ5B 4LSRL 1XGUB 3O6LL 1DP0A 1EDQA 2J5LB 3PL6B 1DUYA 1T5WB 3EGSA 3ARWA 4L3ED 3FT3B 2OX5A 4NWTL 3VCLB 2D7OA 3TF7C 1YEJH 3RNQB 3O2DH 2X1XR 2VO5A 3WIFB 4LARL 1KEML 5FO8A 1JE6A 1A14H 4HPYH 1LP9E 5EIVA 1BVKB 1IAOB 2AXGB 3MJ9A 4X83A 5ALCH 2ICWB 3W9DB 3ARDA 3MRHB 2HT3C 2D0FA 5GZND 3HZMB 2NY2B 4QKXB 1NGPL 2R56L 4HWBH 4DUVA 5L2KB 1BFOA 4OSUH 1TJGL 3Q6GH 4CW1A 3DUHA 3E8UH 4GRMB 2OLDA 5DA4A 3VFVA 2O5YL 3C5ZD 3S5LA 4Y1AD 4RMWA 2DQFA 1KT2B 4MJ6A 4WV1C 1JZ6A 4JZJA 4YIQA 1JNLH 1JGVL 2B5IB 1Q9WB 3HNVL 4N90D 3MOAH 4OZFH 1F3DH 1GRWA 5CFHA 4DGIH 2H26B 2ZZUT 4P4KD 1J10A 4PP1D 2ADGB 4OLEA 1II4E 4H26B 4BK4A 1OF2A 4CMMB 1UA6H 1UACL 3GFUA 3MRKA 4I13B 1NGQH 5IKCB 4LSSH 4RBPH 4HKXB 5IGXH 5LGHH 4XP5L 2YPLB 1VFOA 3GMRB 1ZLWK 3O6FD 5DMKA 1WAAF 5DUBA 5IFHH 2BSTA 2R2HB 1GGCH 5D1QC 2WNGA 3LS4L 4HIEA 2J8UF 5DJ0B 4KV5F 1S78D 1H9VA 3EHBC 2FX7L 5IBUB 3ZTNH 5GSVB 3VXSA 1FN4A 5KOMC 2BRRH 3D69B 3SDYH 2VJXA 3CSPA 3DVNA 1HIML 3PJSB 4H20L 1KCSL 5ENWA 1Q9LA 5IMMB 4W70A 1QYGL 2R8SH 1XIWB 2NZ9D 4ZPVB 3HE6A 3PP3K 1HXYA 3UJTH 4I0PC 4XAKE 5DUBB 5DMKB 4Z6AT 4EXKA 3MXWL 1Y0LA 4HKXA 1PAMA 4LSTH 3CFDB 3INUH 5C08E 1ZSDA 2Z4QA 3PDOB 5FYJU 3G5ZB 4FNLL 2BVOA 5F7EL 4AIXA 3KAAA 4LCIH 2BNRD 4YBQD 4MZ3A 1QNZH 3QNYA 2V5YA 4PGJA 5FOBB 4WW2B 3QFJA 4PB0H 2HVKA 3T1FB 2FD6L 2FEEI 1MREL 4QRTA 3FO9A 4GW5A 3GO1L 3BAEL 1LEKA 4P4KC 3D0LA 3MJ9L 5CLTA 2VDOL 4JM2A 2XI9A 5DRWA 5FYKE 2VISA 1TZGH 3OR7A 5C07A 5EUKA 3OKKA 4G8IB 1JPSL 3U9PH 1JNJA 4ODTL 4HV8A 1LP9A 3GSNL 2X42A 4XHQA 4JZJB 3ZYOA 4BQBA 4JFXA 4XP4L 2BRQA 2V5RA 5C0EB 4XVTH 1YEJL 1CYGA 1U8MB 3MGAA 4J3VA 3O2DL 2CLVB 5JZ7D 5D6DC 4NBYB 1E4KC 5JOPD 5MERB 4H5SB 5EBWA 2HRPH 1FORH 1NGXA 3H9YA 3RDTC 3VGAC 4KRPC 4BZ1H 3Q1SL 5F9JB 3QUYB 1P9MA 3QR2A 4ENED 4YHYC 4NJ9L 1KV3A 5D5MB 1JGLH 4I4WA 3LEXA 4OTXH 4KZEH 3L3KA 3ZLQC 3DBXA 4QTIL 2HJKA 2X9YA 1YNTA 3E8UL 3S37L 2AKRA 4LLDB 2PXYA 1QLRB 3ARVA 3MRCA 4XX1E 1PG7H 3ALXA 3EYUL 4OT1L 1BPVA 3SGDI 4KKLD 3PGDB 3I02B 3MGOA 4LFHD 5JQ6L 2MKWA 3R0MA 3ZKMD 1DLHB 5C0AD 2GEEA 4IS6A 3QWOA 3CZFA 2FBJL 5EWIH 2IEPA 2GUOB 3D0VA 4L1DA 4PRAA 1SM3L 4BA8A 1OF2B 1G1CA 4CMMA 4YBLB 4L29B 4QRPB 2YRPA 2JB6B 3BVNA 4XI5D 4ONOA 3CFDA 4FXGB 1CD1A 3HA0A 4X6DB 2EC9U 4M48H 3UTSA 5DRXB 5F1NA 2PTUA 4WWID 4CN4A 3BJ91 5CD3A 4LP4A 5JDJA 1DDHA 3L7FA 1G6RH 3ZTNL 1T0NA 3TJEL 2VERN 4CW1B 3QUZA 3BYYA 1G0XA 1E6OL 2YD6A 5K59F 3IDXL 4NQEA 3DTXB 5IJVB 4F9PA 3IS0X 4FS0A 3ULUC 1I1AA 4DEPC 5DVOA 2OYPA 2NZ9C 3QSKB 3EJJX 2W0LA 4IDJH 4LPXA 2QHRH 1UVQA 4ORZC 3QDGD 3UJTL 3LQAC 5I0DA 4MA3A 1QOKA 4LLVA 4DAGL 1F6FB 5HYJA 5D2NC 1I75A 5B3NA 2YPLA 2UZYB 1A4KA 3SDAB 5IB2A 1QFWI 2OR9H 2Z93A 3MRBB 3WFBL 2XXCB 5E2UL 3QIWD 2ORBL 1UM4H 1YC8A 3H2WA 5E99H 4I3SH 5D6DA 1U95A 5DVNA 5J0BA 4U7MA 2OR8A 5C0AB 1JTTA 4MA3B 3G5VB 4M1DL 1YJDC 2D7TH 5L9DH 4D9QE 1IGCH 4NT6A 3IU3A 5E7BA 5CS7A 4NC2B 2PW2A 4WFFD 5DTFA 4F58L 5HVHC 4TSCH 3TC9A 1JPSH 4U7SA 1JPGB 4HGMA 1WBXA 1Q94A 1KULA 1AKJD 3MNZA 4G5ZH 1U8PB 1IAIM 3WDIA 1KGCE 5GRVK 1N3NA 4NDMA 2AERT 4XBEL 2P42B 2H9GB 4NFCA 1FVCB 4LPCA 3BSZH 1KENH 4M7KL 1GGUA 5I66B 1G9NH 4Q9CA 4PJBF 4DTGH 3BO8B 1VKXB 5EG6C 2HRPL 1FYTB 1RULH 3UPRA 4OFKA 5H94B 3MROB 4Y5VB 2BNQD 4M62L 4P2YA 4LSPL 4M93B 3P9MB 2EXYD 1BWWA 4FFWD 4I18C 4OJFL 4X6CE 5ELIA 4YNYA 4M00A 5E1AA 3IAGC 2VH5L 2V7HB 4ODWB 4XI5C 4ZS6C 4DW2L 3ARDC 2GSIB 4XCCH 2I60H 3VXUD 4PJXB 5IW3A 5IEHB 3MA7A 5GS0D 4G9DA 3VWKA 2G2RA 4U1NA 5IK3A 3BWAB 5I1DA 1YC7A 3F7VA 1A3LL 4LDLB 4QF1B 1JGUH 4LLQA 2WP3T 5EZLA 2DJ4A 1CGSH 1KEMH 1A14L 4HPYL 3AS3A 3DV4A 4EI5D 3VXQB 1SBSL 2JE8A 4Y7MA 2XQBH 1E4XL 2CLRB 3NH7L 4X7SH 3RDTB 3TH3T 3KXFB 3X11A 5D7LA 4QRSA 4DN3L 1SYSB 4P2OC 2HFGH 4P9ML 4PJ9B 4EBQL 3S3PA 4QY8A 5ESQB 5B38G 3RU8L 1ED3A 1OGTA 1GAFL 1AGEB 4XXCA 2E27L 1VFBB 3BESR 4PJEF 3SDXF 3VW3L 1HINL 1KPVA 5FCSH 5JHDD 3JUYA 4HXBL 1MRDH 2OTWA 5SWSE 1AIFB 1NFDA 1PY4A 3VD4A 3SGKA 1WFUA 3BUTA 3D2UD 1J0ZA 2W91A 5D5MF 1CFBA 2C3HA 3HE7A 4PREA 4PJFF 5GISL 4F33B 1U58A 4BQ8A 3DX8B 5F6IC 4LAJH 3CH1A 4YZFE 3QIUC 3S3JA 1LEIB 3MR9A 4XP5H 4KK6C 1IL1A 1AY1H 4DEPB 1D5MB 4OKVB 1M6OB 2VQTA 4NBZB 5IFHL 1GHFH 4WI7A 3OF6D 1QRNB 4OCXH 3BEWA 4ETQA 4YUEL 2R2EB 3RWGA 4I3SL 3LS5H 3BIAX 3QDJE 4PRHB 4O2EB 1DQML 4P4KB 3WLBB 5CEXA 3U6RB 1KTLB 1FNEB 3L3OB 2VR5A 4I9WE 5D9SA 4LPUA 2HFEA 1TETH 2A1WH 3SN6N 1MCWM 5JLZA 4PREB 4HF5H 4L5FL 5DQJA 3NCBB 3TNMB 4JFEA 4GOSA 4LEXL 5IV2B 5D7IE 1NBQA 4GKNA 4KFZC 5FDWA 3QUZC 4KK9C 3PV6A 1HI6A 1P6FA 3O3AB 4R8WL 3U6RA 5INDB 5EPMA 4P5TC 2C3XA 3INUL 3SDDA 2CDFA 3VGAB 4G6FB 3ARUA 4HLZH 4NKOA 4CRPA 1CD9B 1F02I 3J7HA 1A0QH 2EIDA 1JNNL 2AQ3A 3OKEB 1V5JA 3KHQA 4D0BB 1DVFB 1U8KA 5T5FH 5HY9B 1SEQL 2F8OA 3KPQB 3EAKA 4V2BA 1D6EA 1I4FB 5KSAC 5EN2B 3U48A 1UKTA 2AXHA 5KG9B 3RJQB 1I9IH 2Z91A 4N9GB 1MEXL 4Y16A 1UVQB 1ZT4B 1S7TB 4XCCL 4PRIA 3HPLB 3UAJD 3WFCL 2R1WA 1LK3L 4Z9KB 1QFPA 1R24B 4R7DA 12E8H 3VXMD 3G5YB 1U8NB 4KZDH 2A6IB 3H9SA 1HH6B 1QR1A 2AJUH 4PLJD 1VFBA 5F8QC 5IB1A 1DSFL 1JPFA 1PQZA 1DDHB 3L7FB 1G7LB 5F9WB 4BJLA 4F8QA 2DLFL 3Q1SH 1KJ2A 2ICES 4JAMA 2WBKA 1AGBA 1RZGA 5B21A 3U36B 4X7SL 5DK3A 3WHE1 4MXQD 3FHQA 3RDTA 4Y8AA 3C6SA 3Q5YA 3FFCD 3NZHH 5B38B 2WLZA 4BSWB 1UCBL 1B4JH 3DWTA 3N1GC 4MJ2A 1QLFA 3T3MF 3IJYA 4FFVC 3V4UL 2DDQL 3V6OC 3CPLA 5H8DA 2FX9H 1E4WL 1WWAX 4EUPH 5E5MA 3HR5B 2OMBA 1P1ZB 2BC4A 4NC1C 4XNQA 4P23B 2YA1A 4NM4H 4N8CH 2ARWA 1OTTC 5D8JL 5CEYB 1T20B 1S7VB 3DSNA 3NCMA 3UTPD 2X05A 3O3BA 1VADA 4Y5YB 5LGJB 1EFXD 2H45A 2FSEA 2V2TA 1T7XA 1G6VK 3O8XD 1I7UB 1P6AB 3EYSL 5DHVB 3TT1H 2X89D 3BEVB 2HJLB 3MR9B 1NEZB 4UQ3B 3TVMB 5E6IB 1EEZB 2JJWA 3V5KA 1XR9B 3RIAK 2W0FA 1A47A 3SDDC 1S7SB 4XTRD 5FM8A 3W81A 3R1GL 3O3EB 3MFGB 5BS0B 4YXHH 1PKQA 4FQXA 5GHWH 2QJDA 4ZFZB 2HLAB 1JHKH 2OZ4A 4WI3A 3I9GL 4XP9H 4Y2DA 4L5FH 3SE3A 5A2KH 5D1XD 3WHE0 3SO3B 1U3HB 4YE4H 3E6FB 1OLZA 3LQMA 4KK9D 4N5UA 2ADFL 3T65B 1MUJA 4ZMAT 3IDGB 3RDTD 1J5OH 1UM4L 1EEZA 3D6GA 2VLKD 3L5WA 1IEAA 4L8CB 3HZVA 1MFEL 3DIFA 2NY2D 2J8OA 3K4ZA 2MCPH 4YAQA 5J1AA 5FIEA 5L9DL 2OQJA 3K3QA 3T2NH 2IG2L 2ITCB 1DANT 1VFAB 3FTGA 4P4RA 1D5IL 5F71A 5T1LA 2HRLA 4U0QB 3REWB 1FJ1B 1IAKA 3MV8D 3AU1A 1KB9K 4Y5XA 4P3DA 4WCYH 2OL3L 4PJXA 4PJCE 4YC2B 2P49B 3QH3B 1H8OA 4LDEB 3MRCB 1CQYA 3VXRD 5ECJE 1FE8L 3B8SA 5ENWB 1IKNA 4RFOH 1WZ1L 3CAFA 4KJWC 1T03L 2Q7YB 4KJQD 4XXCC 5EOQL 3UCRA 5CGYD 2HP4A 3EYFB 2EDKA 3JV4B 4LMQI 4BFEA 4JM4H 5BQ7A 3VFNB 1I8IB 4UNVA 1UZ6E 4IRZH 5FHBL 4ZYKA 4JPWH 1XGTB 2RQ8A 1MVUA 5JNYB 2OTUB 1CXKA 1OP3H 4JVPA 4L29A 4QRPA 2VOTA 4Z7VB 2NTSP 3ZE0F 4MB5A 5IMKA 1HNGA 2W9EL 1MI5E 4R9HA 3OAUH 1T21A 3QQNA 1MFAL 1WC7A 3MNVA 1U91B 1JZ2A 3QIUB 3KLSA 3UC0H 3U9UA 1A3LH 5FEBA 2H8PB 3SDDD 3SDXE 4OM1H 1CGVA 5DHVH 3EO0B 3MMEA 1TLKA 4N0RA 4NQXA 4WI8A 3FCTA 3PWVB 5F7HA 1EO5A 4X9HA 5IW1B 3MJ7B 2GHWB 5IB4A 2BCKB 1WAAA 1HCVA 2CDEB 3DXAB 5TGBA 3IXTB 3S5LB 4TUKL 4JFDD 4NQEE 3OL2A 1OSPL 1OCWL 3V0AC 4LCCB 3D85A 3KR3L 4AIZB 2O93L 4RNRA 4AH2B 3MRIB 5GGSB 3ARDB 1F6AB 3IJHA 3MRHA 2EC9T 3MLVL 3PE9A 4NJAL 2JCCA 5HVGB 5IP4A 1MAJA 1UM6L 2HT3D 5GJSH 4UIKH 2EKSB 3O4LA 1NLDL 2EDRA 5A1AA 3T2OA 1NMCB 5LJYH 1OHQA 4YHLH 1AHWA 2EIZA 4EVNB 5MEQA 4XPHL 5IBUG 2WLYA 5DA0B 1AP2B 3VJ6A 1KJVA 3H7BA 1DLFL 4JHAH 4X6BB 5JIKA 2VDRL 1Y6KR 5F88B 5C0BA 1BZ7B 1J12A 3NFPA 3FQXA 4Z7UE 3ZDXF 5FUOL 1FFPB 5DEFB 5I8CA 5C1MB 1YDPA 1WV7T 3LD8C 5JHDA 1W0VB 3EUUA 3IDMA 1KFAH 4J23A 2RFXB 5E70A 1TENA 1WITA 3UJJL 2IQAA 1D5BA 4PJXE 3KLAA 1YN7B 1BQUA 1FVDB 1Y0LB 3JWDH 1ETZA 2R23B 2A1WL 5TDOA 4L4TA 1YPZE 4WHTB 3ISWA 3GHEH 4Q9QH 1N8ZA 2ESVA 4FTVA 1ZVHA 2WMPA 4JFFB 5CJ8A 2R9HD 3SKOA 5C0BB 4H8WH 2OL3H 3H7LA 4X7TA 4RA3A 1MIML 4HUMB 5KTEH 2NY6D 1I9JL 5F7UA 2ZPKL 1MH5A 3MUZ1 4NRZA 3VI3F 3PP4L 1CFNA 2BNQA 1H3GA 1QEWB 4JCLA 3FQWA 3BN9C 3U0TA 1KCVH 2R1XB 1S7SA 4HEPG 3GI9L 3TWCL 7FABH 3DX6B 3LN9A 3OJVC 3OB0K 1H3PH 4OAWA 2W9EH 3V8OA 1NUFA 3C6LB 3ZKND 1FRGH 1WBZA 3QEHB 1P5UA 3ZE2F 1IEAB 4C56D 4GMSL 2B1AL 2A74A 3THMH 3V7AG 2F8VA 5DRWB 5D2LA 4OM1L 2D03H 4NRYA 2AJUL 3UZQA 4UV4H 4Y19A 1AQDB 4QHNB 3VI4E 3VMPA 1TPXB 4GRMA 3P0YL 1GVIA 1TQCC 1S3KH 3K4DA 4E5XA 4Z95H 1QZ1A 4YDKH 2AXFA 3WSQH 3HS0B 2HLAA 1S5HB 1RURH 2NY0C 1CE6B 4A6YH 4UQ2B 2DF3A 5SWSB 4G7YL 4ZAKC 2A6JA 4YLQT 4M5ZL 5GGVH 2NY1B 4XPBH 4JPVL 3H3KA 2OMNA 3S88L 1BF2A 4ODHH 4ONHA 4Z0XB 3MBED 3IDNB 3VRLE 5J13C 4QXWA 2X4RB 3O9WC 5GGUB 3CXDH 4PGDA 4F7CA 2VLJB 5ACZB 2ZCLL 3RL2A 5BQ7B 1JJUA 1UM6H 1WBXB 3IDYB 5DYOA 5EU4B 1KN4H 3D39A 1OT1A 1U8NA 3R0NA 4YHYB 2VNCA 4NZRH 3SKMB 5JPNA 2XOTA 1XGYL 2RB8A 3LB6C 3RUGF 5EUOA 1VGEH 4I77H 1KLFA 5JPMA 1MPAH 4MD5B 5DD5H 3GMPA 3VFSA 3H3PL 1CK0L 3D3VE 3HZKB 3KPRD 5TE7L 2RIKA 1J8HA 1G7MA 2J8UA 1UG9A 3REWA 4D9RD 4Y16D 1BFTA 1G7QB 4XT1C 4JQIH 1ZHNA 1FHGA 3ZKXB 4P2OA 5IFJB 1A4KB 2DQTL 3SDAA 1J8KA 1HDMA 2O26U 1TQBC 1FFQA 4GW4B 1C12A 2ILLA 5AUMA 4EOWH 1CDHA 2E9IA 3UJJH 2EIEA 4L3EE 2NY7H 4F7TB 5I1GL 3BDXA 4NZTH 1IRAY 4U33A 1W8NA 1KT2A 4K9EL 2NPLX 4LCWD 3VWKC 3SKOB 3I6LE 1RV6X 5L2KD 2EDFA 4ESKA 1JWMA 3T77B 1J5OL 5E8EB 4I48A 3QO1A 4PRIE 3UTSB 2XN9D 1LGVA 4LLUB 5IHZB 2GITB 1ZT4A 2ADJB 2CDGA 3QDME 4TSAH 2IPTL 2Z8VC 3Q6FA 2AXFB 4RRPG 3VFMB 4NHUA 2QV2A 4UU9B 3KJ6H 1INDL 1CGWA 3FAWA 3V5KB 3MRNB 2GSGB 1FFPA 4XNZC 3EOBB 5JDSA 3RBSA 4W6YB 5AG8A 3UO1H 5IB3A 1W0VA 2KUTA 1Q1JH 4EN3C 2VC2L 5JORA 3MV8A 4WV1A 5I9QC 4OZHE 5DT1L 5DEFA 1CDJA 5EPMB 4MB4A 1Q0YL 2FGWH 3RWEB 3WXWH 4ALAH 4LHUG 2WBJC 4WFGE 4PJEA 1F58H 5IG7B 4FQIL 4OM0H 1FGNH 5IOPB 3MRGB 4U4BA 5IGXL 2AJXL 4ODUB 1RURL 4RRPA 1MIEH 1ITBB 3SCMD 4A6YL 3DV6A 1NH6A 3OG6B 1DCLA 2SEBA 3B8YA 5D2NA 4D0CB 2W65A 5TFSH 4RX4A 3DNKA 4DKEH 4GXUM 1T89A 4PJ8C 3S35H 5HJ3A 4X6DE 2GAZB 3QCTH 4FOMA 1AQKH 6FABL 3MLSH 2KQNA 4FZ8H 1ZHKA 5AEAA 5KJRL 3DO7A 3LAFA 1AD0A 3S5LG 5C07B 4UUJB 1DJSA 1G0DA 5DURB 1T2XA 5F9OH 5EU3B 3V4VL 4MLSA 3U1SL 4ZS6D 1ZHBB 4XCEB 1E4JA 3TVMC 4KJPC 3T4YA 2DIJA 1H0DA 1MCSA 1MPAL 3QUMA 3CVHB 4JR9L 1QSFE 5DJCA 3P0GB 3CX5J 2WZPD 3AC0A 3KPQA 5C0RH 3E1F1 4UNUA 1YNLH 1HOCA 5F7MC 5F97E 3ROLB 4APQB 2DICA 5JIPA 5IQ9B 4NWUL 3O3AA 3KPPB 4EOWL 5ESQA 1I1FA 3TFKD 4OCMC 3GO1H 4NQDA 5JW3L 5TF1H 2CRIA 1SYVB 3QEQD 1X5JA 3P77A 4MNQD 1I3VA 1CDBA 4HLZG 1ZEAH 4R4FL 3PV7A 3QEUA 3JTSA 4AEIH 4TOYL 4OUOA 1FFOB 5I1IH 1E6JL 2PO6B 4WW2F 4D94A 1D5XA 5HYQA 5TE6L 3I75B 4PG2C 5CILH 2Q3AA 1U36A 3FHAA 4IOIA 1P4IL 4X5XB 4FP8H 4G80A 2EDEA 3PWJA 1KFAL 1ZVSB 4XCFL 2PETA 4P3DB 3O81A 3VXNA 1P9MC 3LHPL 5DSCA 4AEHL 4DZBA 1IM9B 3MREB 2IPTH 3WIIH 4ELMA 2P4AB 4OLZL 2WSKA 5BVPL 2HJFA 4U2YA 4NKDB 1NAML 2H26A 3SE4C 3RRQA 4MA7H 1U3HA 4ZTPL 2VQ1A 1BAFH 1GCFA 5T3XD 2WIIA 3K1DA 4OZHB 3PHOB 1MCHA 4PY8J 4OF8A 4ZFZA 3LMJH 2YWZA 3CDCA 4K3HA 1CR9L 1JNHB 1WC7B 4QTHA 1HWHB 4GRLC 3IYLW 5DXWA 4HIXH 1EK3A 3MO1A 1SM3H 5I8EA 1VENA 3MLZL 5BW7C 1NMAH 1IEBA 1MCRA 2VQ1B 3I6LD 4HFWA 3UDWA 1CFVH 1U8HA 4K3DL 1DBAH 1FP5A 1D9KD 1OD7A 4OGXL 5EZJB 1QKZH 1BGXH 4BSVA 5CUSH 5C08D 4PRHE 3RVWC 5D1XC 3VFWA 4A2LA 3T8XB 3BPLB 4FABH 3BP6A 1BFSA 2VXSH 3V6ZA 4P46A 4DKEL 2QQLH 3N9GL 2FDBP 5GPRA 3S35L 5DWUH 4HH8A 2AW2A 2DLEA 1I7UA 3SPVB 4XAKD 1E6OH 4UAOC 1FNGB 4FZ8L 1Z9MA 4MNHB 2F5AL 5BRZD 1RMFH 4O2CA 3RIFF 5I8KL 2DQGH 1J05A 1GGIH 3MV8B 5GS1C 1E4KA 4MQXC 4JY5H 2RAMA 2QBWA 5ISZE 1GXEA 4YHIA 3OGOE 3ULVE 3WN5C 5FM5M 5ANME 3WHXA 1FYTA 4KHXL 1I9RL 5F93C 3DVIA 4F7MB 1CGXA 5FAAA 1AXSB 2CUIA 5T3ZE 1KBGL 3ESUF 4JAMB 3FONA 1F3JB 3E2HC 3LZFH 4PV8A 1NFDF 4OUUB 3MLWL 4LARH 2ZCHH 5JHDE 5GRUH 1QSED 1UJ3B 2EZ0D 3BVNB 4DVBA 3WHXB 2FL5A 1VGEL 3OHXA 3RUGB 4L3EB 3BPNC 3D3VA 1U2CA 1DBBL 1G7LA 5IBLC 1LP9B 4TSCL 2M2DA 4HX1B 1T0MA 4P3CH 4YGVA 3GRWL 3MOBL 3Q6GL 1RZ7L 1FIEA 3TO4A 1TTUA 4G9FE 1MHCA 2F74A 3GSRB 3KJ4B 5IW6B 3MRDB 2MNUA 5FA3A 5IMLA 4QRQA 1P4IH 3MJ8A 5HHQB 5FO9B 1X5LA 1AD0B 5HGHA 4K3JH 3FT4A 3IAQA 4ODVL 1FNSL 1NDMA 1T1YA 1CG9A 4G7VL 1KIPA 4P99A 2ADIA 4NO5A 1IGFL 2Y25A 3LEXB 2CJUH 4RQQB 4NQSA 1AO7E 4HUUB 1R3LA 1CF8L 3EOYG 1QVOA 3RGVA 1NAMH 2ENYA 2GJ6A 3UEZA 3GZKA 5AYUH 1X9QA 3W0WA 5BOPA 2BDNL 2DQJH 5J9PA 1CIDA 4CL7A 3CU1A 3LS4H 2FWOB 3CFCH 1R3IH 5TDNA 5EIIA 4PRNA 4J3SA 4LVHB 3RWEA 2CR3A 4F37K 4IIQA 3UTQB 1HH9A 1P2CA 4K23H 4U3HA 3V6FA 2ATKB 3MUGA 1HYRC 2AGJH 4ZAKD 5KOVC 5TDPA 2C1PB 1NGYA 1CE1L 2F53A 2CIIB 1SHMA 3KPRE 2HFGL 4RGND 1LEKB 1RJCA 4P5MB 4PJ8B 1DBAL 5DQDH 1KXQE 4NKMB 4TVPD 1WFTA 5SWSA 4OGXH 4DZBB 1AKJA 1G0YR 4Y89A 3NCCB 4G3YL 1TCMA 5JHLH 1D9KA 2XICA 1K5NA 2R69H 4X6FA 4JFOB 4OZHF 3ROOB 4WJ5B 2A6KA 1F2XK 4FTVD 4Z7QF 3GI8L 1ULVA 4QO1A 4I48B 1IARB 2QADD 1JTPA 1U3YA 2X9XA 3FKUS 3KWWB 2DQGL 4NUJB 4NZUH 4ZOEA 3RQ3A 3NACL 5MHSD 4L8SB 5D7KE 4RFNB 4KDTA 2FECI 3F6LA 4QY8B 5H35A 4G6KL 2XKNB 3DROA 2F19H 2HJKB 4R4ND 3IF1A 5FUZH 4ONGH 3BOVA 1GYAA 2VLRB 5AD0A 4JO2H 1K8DA 3KYAA 2DQHH 4GAFB 3R06B 1AQKL 3LZFL 1AD9B 3VWJA 5KBNC 3OAYH 1JWUB 3F5WA 1CVRA 1SYSA 1RHHA 1T1ZA 5DFTA 4J4PC 5IEKB 5L8JB 3OKDB 4HF5L 5F9OL 4RFEA 4QRPE 3D5OF 1U6AL 5CJBA 3KWWA 4LEXH 4NUJA 4S1SL 2X44D 4G9DB 3H9SD 1HYSD 4TRPH 2FJGB 3DXAD 1FNEA 3L3OA 1BJ1H 4G6MH 2ZUUA 3LQZA 3QZWB 3PWVA 4GW1A 5T3XL 3ZZ1A 4U6YA 1CZ8L 5IJKC 2XN9B 5EUKB 1QBMH 3ZKMC 2PW1B 4LIQH 4E42B 3V95A 4LLYB 1ZT7B 4GKSA 4OZFA 3DPBA 4KQ3L 1A0QL 3OTTA 1URLA 4YK4B 1N7MH 2L0DA 1XR8B 1R5WA 3CH1B 4TNVK 3V4PH 4G8GD 4JPKH 5BRZE 1G9MH 4YHNB 1KIRB 2NX5B 3HE6B 1CL7I 3CIQA 3OB0H 1YEHL 1HH9B 2FYYA 1AGDB 2P1YA 5M94B 4ZUSA 2AABH 4ZDHA 4QOKA 5CJOH 5JO5B 5HHMD 4ELKB 3QULA 3O11B 4EDWL 2O61A 5C6WH 3W39A 1IGIH 2P5EA 4YPJA 4KZDL 4NN7C 5BZWB 1F4XH 4UDUA 1NL0L 3TJEH 2XPGA 5AWNL 1FDLH 3TP4A 2B2XL 4XPAH 3U4BH 4Z5RB 5IB3B 4P5KA 1AJ7H 2EO9A 1T83C 3CXHK 1I9EA 4UBDD 5CSBA 4GMTH 2AK4A 3FL7A 2W0KA 5HI4C 4ZXBA 1T4KB 4AIZA 2LV4A 5GS1A 1CDCA 4OSUL 1UCBH 1CG9B 5IESH 2R2BA 1HDMB 4HKZB 2EEDA 1Y18B 3GSNB 5BXFB 1BAFL 4MX7B 5T1KB 5HHQA 2ZCKH 2X2YA 2OR9L 1KLGB 2VLKB 3QO0A 3SKJL 1Q9OA 1OP9A 3QQ4B 4QHUA 2R69L 1T7YA 3TN0D 1NCTA 3GSRA 4K94C 3RWCA 3N85H 4L9LB 3NVQA 5E5UB 2VAAA 1FFRA 2Z0BA 2E8ZA 2OS7A 3BPOC 4NQVA 3EW3B 2YN3A 3AM8A 2LE9A 2X4RA 2UWEB 1T2JA 2DQEH 5KVEH 3UDWC 5FOJA 1G7JA 3LKQB 3CDGB 2HKFH 4GS7B 4OZ4B 1NFKA 3PIQA 4PRBB 4KRPB 3P9LA 3AS2A 3EDFA 1UB6A 4G5ZL 5HYSB 1A02N 5EUOF 3MNWB 4L8SC 3EHBD 3QFDB 4ONHB 4LNRB 2P8LA 5HPMA 1VPOH 1A22B 2AXGA 3HE6D 4GKZA 4G9FB 5E7FA 3VXOB 5ID0B 1OAYH 2YPLE 5DHVA 3TBSB 4LHUA 4U1HA 5CIPA 1KCSH 4XBPA 3EOAB 2VB5A 2ED9A 5B8CA 5DVLA 1DBML 3BE1H 1U6AH 2JELL 4S1SH 3QHZH 4U1IA 4P23D 4DFIA 4PJ7A 3VWKD 1T83A 4MGXA 5JOPE 5SX5K 4G42A 4LCYA 2FO1A 2X4QB 4GUPB 3TIEB 2EIZB 5HVHB 3MRNA 5F7DA 3FMGL 3GGWA 4R3SA 5ESAA 4GG6B 3KG5A 1RAMA 3T8XA 4HWEL 1KNOB 1LO2L 3P2TA 3OR6B 3QG7L 5IHUH 5I1LA 2NY5H 1IM3B 4JY6A 4Z7WA 2IADA 3GMNB 4JPKL 1QA9B 1VHPA 4IMLB 1UXSB 2D9CA 5E8DH 3ARSA 5H2BA 4P9MH 2YXMA 4WCYL 4GRWH 4WFEE 2HMID 1M7XA 3VG9B 2G9HA 1PEZA 5I1CL 3HFMH 4JRXB 1F4YH 4N0YL 4PFEA 5C0EA 4XPFL 2CDEA 2VDPH 3TBTB 5IB4B 1JWSB 2VDQH 5KS9A 1HNFA 3VXMB 4XVSL 2IADB 4GKOA 1CT8B 4KI1A 5C0IB 4FQ1L 4JM4L 2B2XH 4XPAL 1IM3A 4JY6B 3DMMB 5JMOC 4RDQG 1PLGL 1EVTC 4JFEE 1JUFA 4N8VB 3MBXL 4GMTL 4UTAH 4WNQB 3FB7A 4M8QB 4ZUWB 1BIIA 2YD1A 2PR4L 1YNKL 1RI8A 2P5WB 5I73C 2P44B 3BP4B 2NY3B 1UWGH 3LIZL 3ULSA 2YC1A 1MNUL 2GK0B 4OBSA 3U0TB 1IJ9A 1KJVB 1AXTL 1MVUB 1PG7L 3EYUH 1MFBH 4NHCH 2D0GA 1R3IL 3RVXD 3V2AR 2LFGA 3MSPA 2Y36L 4PR5A 3T1WA 1G7HA 1CWVA 3N85L 1DQMH 4XBPB 3P40A 3H7BB 1EUTA 4KXZI 4XWOD 4LHUD 1H15B 5D71L 2AEQH 1G6RB 1NEZG 1RK0A 3EOTL 3KJ4C 1NJ9A 3IJSA 3SKUD 1C5BL 2XYCA 1OTSC 3GM8A 3GRWA 4QOKB 4EQ2A 5MERA 4PGEA 1I1FB 4C56A 2NXZC 3CFBA 1R3LB 3KYKL 5J1TC 1U8MA 3WYRA 4MAYC 4QEGA 1RUQL 3HI5L 4Y4HD 3TIDA 2GTZB 2R39A 4R26H 1U3JA 1ZGLP 2LTQB 2PW1A 2R0LH 3HAEH 3QWRD 1NLDH 3GI8H 5JOFB 1TDQA 2XTJB 1JNNH 5D7IB 5GGRA 5I19L 5DS8A 4QYOB 3A6BH 4YHPB 3T0EB 4UT7L 3O2DA 5D70H 5GRYA 1ZV5A 4LPVA 3BHBA 5K93A 5KVDL 2ED8A 3FZUD 3O6LH 4IJ3B 3RZCC 3D18B 2WP3O 4M8VA 1UXSA 1LK3H 4YDJA