1MFDH

The solution structure of a trisaccharide-antibody complex: comparison of nmr measurements with a crystal structure
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
218
structure length
211
Chain Sequence
EVQVQQSGTVLARPGASVKMSCKASGYTFTNYWMHWIKQRPGQGLEWIGAIYPGNSATFYNHKFRAKTKLTAVTSTITAYMELSSLTNEDSAVYYCTRGGHGYYGDYWGQGASLTVSSAKTTPPSVYPLAPGMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGG1-LAMBDA SE155-4 FAB (LIGHT CHAIN)
publication title Solution structure of a trisaccharide-antibody complex: comparison of NMR measurements with a crystal structure.
pubmed doi rcsb
source organism Mus musculus
total genus 44
structure length 211
sequence length 218
ec nomenclature
pdb deposition date 1993-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mfdH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mfdH01
4DVRL 1I1RA 1UJ3C 3CDGA 3V6FB 2DMBA 4JJ5B 5CWSA 3T8XA 2IPKB 4P2RE 4C54A 2A73A 4CVWA 3FAWA 4QTHA 3MA7A 4DVBB 2JK5A 1UADC 5CP3A 4YHMH 4HWUA 1FVDB 3LS4L 4APQC 5FOBA 1MWAL 5DD1L 4U7SA 4Y16A 3U0PA 1OLZA 3B2VH 4K2UH 2D4DA 1DCLA 2XRAH 1H3PL 3RVXD 5F7UA 1F4HA 3D3VE 4HF5L 2CUMA 4QHNB 2X9YA 3RX5A 2M1KA 2VDRH 4XAWH 5L2KD 2BSRA 4NQEE 5J13B 1KJ2A 3HZMB 2EC9U 1K3IA 2APVA 4W6WB 2HLFD 3OSKA 4TOYL 4DFHA 3VXPA 1FFQA 1JMXA 3VG9B 5BXFB 5L2JA 3D0LA 5EIIB 1J1OL 5ILTH 4HXAH 1UJTA 4MMXC 1FL3A 4U49A 4KUZL 3TM6A 4BZ2L 1F13A 3QIUA 5D96C 4TSAL 4OV6F 1HH6A 1IEBA 5GGRY 5IB3B 4R90L 4K94H 5EOCJ 2YZ1A 4UZGA 1FZMB 3KPOA 5HVHC 5B21A 4XNXL 1TQBC 3BQUC 5C9JA 1QFWM 3X13A 1GGCH 3LD8B 4WI5A 2NY1B 4I0PA 1SYSB 3AS1A 1RSFA 1OCWL 3RWHB 3LN5B 4P4KA 4PTTA 1YEIL 3BZFA 5DHVA 4U2YA 3BKML 3KPRD 3OQ3B 4R9HA 3IAPA 4BQ9A 3U0TB 4DN4H 1OW0C 2QADB 1A2YB 4AEHL 3GNMH 1MFCL 2BOBA 3ULVL 4N0FA 1LK2B 1CDHA 2JIXD 4KI5F 3TN0A 3VWKC 5FECB 3GKWH 2DQDL 3GGWB 5KAQG 3C6LC 4R2GB 5D70L 1UH4A 2AQ2A 4OM0L 3HPJA 4JRYD 3LMJH 2GJ6A 3UPAA 1WUNT 2DOCA 4K07A 3ARBB 3RWIB 3WEXA 3A6BL 1NUNB 1G7JA 4TTGA 2W0PA 3AVEA 3BGMB 2XA8H 3DXAB 3DECA 5FB8A 1V7NL 2WIMA 3ULUD 1Z9LA 3CCHA 5HHVH 4KRNA 3PQYD 4QRQA 2B0SL 2VZVA 4OAWA 3SJVE 5LWYL 5JIPA 4Q6YA 1WBZB 5TGBB 5E8NB 1MCOH 1AGFB 2ADIA 3A6OA 4A2MA 1UXSB 3JWNC 4G6FB 1IM9A 5I1KH 3WHE1 1P4BL 4AM0A 3BVNB 3BKCH 2VAJA 1AXSA 2CR6A 5GRYA 4PJAF 1DVFC 1CDIA 1OTUC 2KDGA 4U1LB 2WAHA 3TVMD 1LP9A 1CYGA 2H8PB 3GHEL 1ZLUH 1GPOH 2AABH 1V3JA 1KELH 1YMMA 1HHHA 3GMLA 2IBGA 1WBYA 3DMMD 2DKMA 4BFBD 1F4WL 4NWTH 4V1DB 3X11A 3C09C 4PB0L 4B0MM 4PRPD 2CLRB 4JJ5A 2IPKA 4PJAE 3K1DA 4DVBA 2F54E 4Y4HC 4MS8D 4S1RH 1JF5A 5JXEC 3WLBB 1FVDA 3P40A 2P5WB 4LSDA 4TVPL 5E2WL 3MLRH 2YR3A 1YEJH 1EZVY 3RIAF 2YPLE 4QHNA 2FBOJ 1UZ6F 3G5VB 4QRRE 1NC2B 2XPGB 5EC1B 3CVHH 3HZVB 4JFZL 3HZMA 4QRSB 2XYCA 4FG6C 4NHCL 5BXFA 5F7YC 1NCAH 3ZT6A 5JIHA 1OAUH 1TTFA 3QUXC 4MX7A 1GC1H 1ADQH 2AVGA 1UZ6E 3R8QA 2XQBH 5IB3A 3WNPA 1FZMA 1X4YA 3I2CL 4KK9C 5GRVK 3QEQD 2CSPA 5CKGA 5HHME 5JMOC 3BD5A 4N90D 1SYSA 1J1PH 5A2IH 3RVVD 1VERA 3RWHA 2OZ4H 3LN5A 4D9LH 1U8NB 4MXQC 3RI5K 4C56E 1N2RB 1HHKB 1RULL 1V5JA 4L9LB 1KSRA 1NAMH 1U91B 5B8CB 3L7EB 1FCGA 3U0TA 3LEVH 1QRNE 2R0LL 1A2YA 3HKFA 2HKFL 5MENE 2VR4A 3KWWB 2UWEB 5C08A 1LK2A 4J1UA 1UM4L 4JM2F 3VXNB 5FECA 2C5DC 3VI4F 4JANB 2EECA 3GGWA 1VFMA 3ILQD 4OB5L 1HKLL 5CJQL 3UJJL 4M5ZH 4RGNE 4U6VL 2O93L 4KJWD 4KZDL 3ARGC 3ARBA 3RWIA 5DD6B 5AD0B 4NZUH 3B9KD 3BGMA 2YEZB 4ODVL 1ITCA 3U83A 5DFVC 1MRFH 3BI9X 4NM8L 3DXAA 2OTUB 5C92A 4HWBA 1T22B 4KJYB 3VI4E 4U6HA 1INDL 3LHPH 4D3CH 4KROB 5JORB 2J5LC 1KCSH 1WBZA 4NHUB 5TGBA 5L0QC 1QNZL 1AGFA 3INUL 5ITBH 5GGTH 2OX5A 1UXSA 2X42A 5IJKA 2RQ8A 4P57B 3MV8E 4XCNB 4KRPB 1I4FB 5HGHB 4GQPH 3BVNA 4GKNB 1RZGB 4UINH 2WWMC 4PFEA 4U1LA 3WYRA 5FAAA 5LG1A 2H8PA 4H8WL 4K3EH 3IVKB 2F5BH 3B4NA 1U95B 3MACH 4OLXL 1N6QH 1T89C 3ZT7A 2P5EB 2IPUK 3HB3C 3AXLB 2UZXB 5IESH 4DFIA 2FEEL 4V1DA 5T3XH 3WFHB 5CGYC 4X99A 5A16A 5K93A 2CLRA 3FFCE 4EI5C 2ICWI 2QR0A 4MCZB 4K7PL 2O5YH 4NRZB 4I48B 2VERN 1UKTA 2YD5A 4XP6H 3FB7B 3WLBA 2P5WA 5IWLA 5GGRB 4YHPB 4JO2L 3DROB 4X98B 3MYJB 3Q1SH 1JZ4A 3KLDA 2YWYA 2GTWB 3VGEA 3OF6A 1NC2A 3U82B 5EC1A 1BPVA 2IPUG 1KIQB 5C9KA 4H88L 4LSRL 1KT2A 1OGAD 2IPTH 3HZVA 5BVPL 1E4WH 4OLUL 2C3HA 4QRSA 1CXHA 1QBAA 2IAMC 1OT1A 2DWDB 3QO0B 5I75C 2C4FU 3MSPA 4P46C 4ZAKC 1MJ8H 4CU8A 4QGYA 4I77L 3D39D 1MPAH 5CGTA 3ULVC 3QDME 3K8KA 5D2NE 1CICB 3MJ9H 3DO3A 5GIRB 4CAGA 3TLRA 5ID1B 5GGVH 4XPAH 3OJDB 1YEDB 4PG2C 1IRAY 3ARED 3QRGH 3TBVB 1AH1A 3WDJA 5FKPB 3ROLB 2AJUL 1U8NA 1N2RA 1GXEA 2HT4C 1HHKA 4KKBC 2EIDA 4DZBB 4GS7C 2GFBB 4MGXA 5CZKA 4L9LA 1FGVL 3O6FC 1U91A 5B8CA 3L7EA 1WWAX 1O0VA 5KJRH 3TZVC 3QG6B 1GIGL 3KWWA 2UWEA 1EAJA 1I9RH 5T5NF 3S37L 5DJYB 4J23A 4KJQD 3MREB 4HUNB 3VXNA 3FOLB 4JRXB 3VFVB 4JANA 2A6IB 3NIDE 3ULUL 1FIGL 2CJUH 2C1OB 3X3GH 4FFWC 4HSQA 1FNHA 2R2BB 1FNEB 4G9FB 4JO4H 2CXKA 4ELKB 2J7LA 2AI0L 5DD6A 5AD0A 1RUQH 1KEML 1NL0L 3MMEB 1J86A 1YC7A 2YEZA 3RHWK 5GRJL 3T08A 3GBNH 2OTUA 3DIFB 4X7FC 3LB6C 5H2BB 4L3CB 1T22A 2CIIB 4KJYA 4XP1L 1R3KB 1IC7L 4WUUE 4LLQB 5JORA 1M1SA 2VL4A 3IXAB 3RVWD 2OR9H 3O8XB 4NHUA 2E7CA 3QIWD 5E5MB 1PZ5B 4K23H 3BO8B 1YA5A 5KSUB 4Z8FL 4BA8A 2PXYD 4UV7H 1ZLWH 2H2PC 5DFWH 4P57A 2ZG3A 4XCNA 1I4FA 5HGHA 2FBJL 2AJVH 1RZGA 3NA4A 3KXFE 5EOQH 1CF8L 3IVKA 1U95A 1HCFX 5HD8D 2VKXA 4DW2L 1UM6L 2WWKT 4OLWL 1T5XB 1K4CB 2P5EA 4G5ZL 4RX4A 3AXLA 4YDJB 4KK5D 5E8EB 5KVGL 1JWMB 2VLJD 4PJ5B 1FYTB 3WFHA 3SE8L 5I17B 2P43B 2W38A 1HDMB 4X9FA 4MCZA 1FG9C 4HPOL 4NRZA 4I48A 4I0KA 5IFJB 3FB7A 4PLOB 3C9NB 3RDTD 1RZFH 4U1HB 4HWEH 2AK4D 1YYLH 2BZDA 2Y9RT 3L5HA 2FECL 5GGRA 3TNNA 4YHPA 3QI9C 3DROA 5GRWA 4X98A 3MYJA 3VFNB 2ADGB 1HN1A 2GTWA 4L8SB 4UTBH 4EEEA 5JQHC 2NY4C 1K8DB 1KIQA 2V5TA 1UCBL 1LEKB 3ESUF 3PWPB 5DJZB 2X4UB 4B7LA 1YEFL 2E3VA 2PO6C 4BKLB 1S5HB 2DWDA 3QO0A 5IBLD 1DZBA 2XZAL 5EBLB 1F90H 3IDNB 2WBJD 3MLYL 4G43B 4WI8A 5ERWB 3N9GL 1HZHL 4M8VA 1CICA 2QQQA 5FYJD 4D2NA 5GIRA 1R0AL 4LPXA 4XPBL 2EIBA 5ID1A 1XGYH 4OIAA 2JJVA 4ZOEA 2ITDB 1YEDA 1WZLA 4LLAA 3TBVA 4Z5RB 5FKPA 3ROLA 2MQ0A 3QUYB 1VFAB 4DZBA 2GFBA 4P2QD 3B3IB 3ZHDA 5HBBA 3BWUC 3MR9B 3QG6A 1LK3H 1WIPA 1RZKL 4IRZL 5D1XD 4O5LL 3MREA 3EYOB 5F21B 3FOLA 4XPGL 4JRXA 3VFVA 2A6IA 3BWAB 2C1OA 2IH1B 5J89A 4YUEH 2R4RH 1FNEA 3VXUB 5EORH 4G9FA 1YMHB 1F2XK 4ELKA 4GAYB 3MXVL 4WVRA 4YDKL 4P49A 4N1CA 25C8L 4HLZG 3MMEA 3MJ8B 3O6ML 4NOFA 3FONB 3VRJB 2RB8A 3RU8H 3DIFA 5H2BA 4ZO9A 3AS3A 4L3CA 2CIIA 1RUML 4H8WC 1I9JH 1R3KA 3RZCD 4AIXA 4LLQA 4GW4B 3OR7B 3IXAA 5KSBF 5DVKA 3O8XA 2K1MA 5T1DH 4NZRH 5E5MA 1PZ5A 2H32H 3BO8A 4LSPL 5KSUA 3B5TA 4W4OC 4B7IA 3RVXC 1OD9A 3PG2A 4HGWB 3RJQB 1DSFL 4R97B 5DD0H 2JJWA 4YDLC 1J8HE 3ME0A 4ZNEA 1KJMB 1WFNA 1MLCB 5I9QC 3IKKA 5FYKH 1K4CA 1QBLH 4LARH 2HLFC 4YDJA 5E8EA 1JWMA 4PJ5A 3FO9B 2YD8A 3HC3H 3I50L 1J1XL 1WEJH 3G6DH 1LO0L 5I17A 1HDMA 4OLVL 5EZIL 1U41A 1EV2E 1QRKA 1AGBB 4TN9A 4NQXB 1EFQA 5IFJA 2BMKB 2VXUH 1PAMA 5F71A 2VLKD 1SY6H 3C9NA 4OF8A 4YAQB 4U1HA 4LFHG 4J3VA 4HS3B 4L3EE 3BZEA 4U4BA 5B4MD 1Z9SA 3Q6FB 3VFNA 2ADGA 5DUML 4L8SA 1JMZA 1RJYB 1K8DA 4PJXF 5BQ7B 2X4NB 4H26B 1FFRA 1LEKA 4JPWH 2VLRD 1E28B 1G9MH 3PWPA 1UC6A 5DJZA 2ED7A 2X4UA 2Y36L 4NQCE 4BKLA 4OFYD 1S5HA 1FDLL 5KW9H 3G6JB 3QAZB 1DBBL 3NCYS 5EBLA 3IDNA 4WV1C 4G43A 5ERWA 1HYSD 3IU4L 1SM3H 2I27N 3B5HA 4WTZG 4PJXE 1MREH 3IJSB 1AY1L 3LV3B 1KENL 1F4XL 2NX5E 1BREA 5IJVB 5CLWA 3ULUC 2ITDA 1BFVH 1GGIL 3JVGC 3QIBC 2P8LB 4Z5RA 2D7NA 4XWOD 1F3DH 3LQAH 1ZEAH 3QUYA 3PP3H 1VFAA 5D5MB 4PJ9B 3MUGB 2R4SH 2H3NB 2Z31D 3B3IA 2V2TB 5JIKA 3MR9A 4ODWB 4QRPB 5EA0H 1BQLH 2BVYA 4KK6D 3SDAD 5E99H 4DGYL 1WISA 1T7YA 1UA6L 3EYOA 1QPXA 1ULVA 3O9WD 3BWAA 2HVJB 4K3JL 3SE9L 3TVMC 2IH1A 3CZFB 2PR4H 4KVCL 5FV2A 3VXUA 4E41B 1FPTL 3G5YB 1QSFE 1YMHA 2J6EH 1SJHB 5ACMA 4GAYA 5I1CH 3RL2B 3DMMC 1X5FA 2EH7H 4M48H 3HUJB 1C16B 3ALWA 4ZDHB 4FABH 3MJ8A 4JO3H 5I16B 3FONA 3VRJA 3DV6B 3VGBA 3NABH 2MNUA 4K71B 1MF2L 4GW4A 3OR7A 1HSBB 4OJFL 4S0SD 1BP3B 4MS8C 2IGFL 3EJJX 2X4TB 3WNOA 3MLZL 5DJ6B 3O3DB 3MFFB 2HT3D 4YBLB 2IBBA 3H7BB 4HGWA 2YN5A 4NZJA 2CRIA 2BDNL 2YHGA 4LU5L 1KACB 4U1SB 3UZEA 1KJMA 4ETYA 4PGCB 1OSPH 1MLCA 5ENWB 3EBAA 1M71B 4AMKL 3TJEH 4F9PA 1NCUA 4OSUL 4X83A 2VQ1B 2W07A 3FO9A 1RZIB 4LIQH 4CJ0A 3VGDA 4IRSC 3GRWA 3QCTL 1AGBA 1F8TH 4NQXA 4N9GB 1OAYH 2BMKA 1G9EA 2IANB 4KFZC 4YAQA 4YNYB 4F2MB 1RUAH 3KPTA 2QJDA 2WMPA 4HS3A 3RVVC 1A6TB 3FMGH 3Q6FA 4OIIH 1TETL 1MCIA 1JNNL 4X9BA 3ZE2F 2CLVB 1LDPL 2Z8RA 4KDTC 4BUHA 1RJYA 1R5IB 2YKLL 5BQ7A 4EUPB 2X4NA 4H26A 3ZKXC 1E28A 5FYJL 4FQJL 3VW3H 4F8TA 1QBML 3ILQC 4OQTA 3G6JA 3L9RB 3U4EB 3WHXB 1KIRB 1A7QL 4G8GB 4KJWC 4LLMB 3ZE2E 5JXAL 4BFEA 1YNKH 4LL9A 1H3WM 1NCTA 1RZKC 2PYEE 3B9KC 3SKNB 2OJZH 3IJSA 2YMXL 1J5OL 3D2UB 3LV3A 5C3TA 4NGHH 5IJVA 4X7EC 3RAJH 4ZSOE 1BBDL 4Y8DC 2ZKHH 3X12B 2P8LA 2VUOA 5D5MA 4PJ9A 3MUGA 3RNQB 3I9GL 4WI7A 3RZWA 2H3NA 2EO1A 3O3AB 5GRZA 4MD0B 2V2TA 3ULVF 1MQKL 1FGNH 4ODWA 4QRPA 4YXLH 5I1EL 1N5YH 1A7RH 4TQEL 2NY2D 1QLFB 5IV2B 3LZFL 3ZKQD 1S7VB 4ZO7A 5FGSA 3MLSH 1FORL 2HVJA 1GGBL 1T2QH 3CZFA 4YDIH 1BOGB 3VU2A 5EWIL 1OAKL 4PJCF 1SJEB 4GRWF 5E7BA 4E41A 3G5YA 1SJHA 4DUWA 1JV5B 3T0VA 2DQEL 1MAJA 1MVUB 3RL2A 3HUJA 1C16A 2BC4B 4ZDHA 3ULVE 1KCLA 1W72H 2P47B 3A6CH 5I16A 2ZCKL 3QNZB 4KHTH 5GJTL 2YD4A 4OF0A 3DV6A 1VCAA 3PDOA 4IIQB 4A6YB 5D6DA 2DJUA 3BUTA 2Q8BH 1RMFH 1OP3K 2BNRE 4GMSL 2QTEA 5J6HB 1RURL 3BGFB 1HSBA 4JHBA 3EHBD 3OKDB 2X4TA 4PJCE 4GRWE 1FAKT 2ZUQC 5DJ6A 5C6PB 3O3DA 1KCRL 3MFFA 4NC0B 4NFBA 1MLBB 5FUZL 3H7BA 4XBEH 5ESQB 4OI7A 2VXTH 4RAHA 2PTTA 5SWSD 3U30B 4U1SA 1R3IL 1A1MB 1FZKB 1RHFA 4Z7WB 4PGCA 3TYGL 5ENWA 5CCKL 1FCCA 1M71A 5EUKB 4NBXB 1FYTD 4KKCD 5GGSY 5C0AE 1DQMH 4QY8B 2VQ1A 1RZIA 4KQ4L 3PWJB 3DVNB 1C7SA 5BW7A 3KJ4C 5ISZE 2LVEA 3LCYA 2ZOKB 3V4UL 1D6VL 4MNHB 5A2FA 1FN4B 4ZXBB 1N6VA 2NY3D 3QUZB 2AXGB 1PG7L 3AY4C 4N9GA 3QXTA 1XGUB 3T0EB 1CL7L 2IANA 3S5LG 4N68A 3EO9L 5E8PB 1HIML 4YNYA 4F2MA 3AREC 5CD5D 1K3ZA 5C0ND 3C08L 2CLVA 2ZP0T 3GO1H 4JEGB 1R5IA 4TULH 4EUPA 1SBBA 2WV3A 3U9PH 4MQ7B 4KJQC 3MBXL 2AEQH 4TVPE 3MPCA 1NMCC 3MV9B 4M1DL 3U4EA 5F7EL 3WHXA 2FO4B 1KIRA 5L9DL 3TJHD 5J12B 1TTUA 4G8GA 4LLMA 5DJ2B 1NGXB 1AHWC 2VR5A 3SKNA 2FB4H 1Q72L 1JWSB 3D2UA 3BISA 4QHKJ 4S1QH 1QLRB 2E8YA 3LS4H 3X12A 1MWAH 4OTXL 3BDYL 4Y7MA 1TTGA 5E56A 3RVWC 4UNVA 4O51B 3RNQA 3QIWC 1H3PH 1A7OL 3O3AA 5C0RL 4RBPH 3PHSA 5ALCL 4LSQH 2PXYC 5GS0D 2EEAA 4HF5H 1UWXK 3Q5YA 5IBUG 1QLFA 4XNZC 5IV2A 4NWUL 1S7VA 2V9QA 3HI5H 4ZNCD 3D6GA 1LGVA 3FB8B 1RZ7H 5EUOF 1BOGA 3VFMB 5HD8C 3TPUB 1T66D 1JV5A 4KK5C 5DD5L 1UYWL 1MVUA 4KUZH 2GT9B 2BC4A 1ZT1A 5EPMB 3QNZA 3SKJL 4PJHE 2WLZA 5FIEA 1WJ3A 2OP4L 5GJSL 4IIQA 4HJJL 4R26L 4A6YA 4H1LG 4XNXH 1NCCL 4ERSH 5J6HA 2IFFL 2FYYB 5EUOE 3OKDA 5DRXA 3RDTC 5CJ8A 4PJ8B 1FNGB 1YEIH 4NNXB 1JI2A 1MLBA 2VXVL 2ZJSL 3BKMH 4NN7B 5IHZB 2R56H 5ESQA 1FC2D 3DVFA 1FZOB 5K9QI 4GQ9L 4AEHH 1MFCH 3ULVH 3FFDA 4MNGB 5JZ7D 1MFBL 1A1MA 4ZMAT 1FZKA 3IFLL 4Z7WA 3EDJA 4M7JL 1MIML 5EUKA 2MCPL 5D70H 1HNFA 3C5JB 2XZCL 4QY8A 5IBLC 3RWGB 1WTGT 2Q86B 5D8JH 1ZA3B 1RK0B 4GRWH 3PWJA 3DVNA 1JPSL 2ZOKA 4MJ4A 2EE9A 5SX5H 2WBJC 2W0LA 4HIJB 4MNHA 4RMRA 2R1XB 1FN4A 1OAQL 4ZXBA 3QUZA 2AXGA 5FA3B 4OCYL 3K8LA 1V7NH 3F7QA 1GRWA 3T0EA 4U1JB 2FJFB 5E8PA 1HHIB 1XGRB 5LWYH 2XTLA 3SDXB 3UYRL 3EIFA 4HCRA 4HEPG 2YD9A 3TP4A 4O9HL 3GSQB 3V6OC 1EO5A 1P4BH 3DGCR 4F7TA 4YH6A 5D1XC 1IQWL 2CKBH 2WBKA 3MODL 4MQ7A 1MEXL 1WIUA 4LRIA 1KCVL 3CH1B 4NDMB 3ZTNL 1I1YB 4EBQL 2BNQB 3U0WH 5EBGA 3MV9A 3BDXA 2FO4A 2F19L 1QSED 1IGYB 4LVOB 5DI8B 4EDXB 3A67L 1OF2B 1HINL 5DJ2A 1NGXA 1B4JL 2ZWLT 5GS1C 3KYKL 4DN3L 5LAXB 1JWSA 5EC2B 3LKQB 1CD0A 1MCKA 2A77H 2BRRH 4O4YL 5DTFB 1QLRA 3RZCC 1RAMA 5GGVY 2P24B 4LASL 3MOQA 1WWWX 4TVPH 1SJXA 2AXFB 1J10A 4O51A 1H5BC 2AXHA 2E9BA 3KPRE 5DT1L 2CGRH 1RIVL 3VXMD 4FOMA 3V6ZB 3NGBC 4JHWL 2EDHA 3B6SB 1CIUA 3C8KB 3FHQA 4WEBL 3FKUS 3ULUF 4I18A 3WL9B 4Z78B 1WGOA 3FB8A 2W0FB 2X89A 1D7FA 3VFMA 5AUMB 3TPUA 4YDVB 3SDDB 4GG6F 4JRYE 5HYJB 1OQXA 2Q3ZA 3TBTB 5F6HJ 4OD1H 3HC4L 3C5ZB 2GT9A 1YECL 2ZZUT 5EPMA 1MHEB 3I2CH 1KCUL 4G80B 3ULUE 5JHDD 4P2OD 4GT7A 5GGSB 2P49B 3NPZB 4Y19B 4WEMB 2FYYA 3AFLA 2A6JB 3M8OH 5F6IB 4EN3B 4PJ8A 1CFVL 1FNGA 2VDQH 4NNXA 4PJBF 3MZGB 4X6BB 3H9HB 4HUWB 5DQDL 5B4MC 5IHZA 1RULH 3NACH 4X4ME 4NFDA 4PGEB 3SE3C 1FZOA 4XCFH 2EDRA 5TPWH 4WHDA 1FQ9C 4MNGA 1UH3A 4HQQL 3JV4B 5IEHB 3JV5A 3TWCH 3BKJL 2GW5A 4G3YL 5C0CB 4Z9KB 3OKNB 3WFBL 1YQVH 3C5JA 3KHOA 4OV5B 1PY4A 3RWGA 2Q86A 4PJBE 4KZDH 1ZA3A 1RK0A 2KQMA 4ZOBA 1TJGL 4RRPG 4PRPE 4HIJA 2R1XA 4OCXL 1HYSC 1CL7I 4J4PA 3JWDL 4JM4L 5FA3A 4HGMA 5T5FL 5IUSA 4P2RB 1H3TA 1OPGL 4MVBD 4U1JA 2VZUA 2FJFA 1OM3H 1DEDA 1HHIA 1XGRA 1YEKH 3SDXA 5IB4B 1QNZH 4XWOC 2XACC 3INUH 1MFEL 5LGHH 3GSQA 3RIFK 4XMLL 4PGDB 2Z31C 3D3VB 3SDAC 4KK6C 1KN4L 4L1HA 3TV3L 5JQ6L 3CH1A 4NDMA 5FM4A 4NQEB 4X8XA 1I1YA 3WD5L 3O9WC 3RY4A 5ETUB 2BNQA 4WRLA 4LCUB 1MCJA 4LQFH 4BH7B 4YXKH 4HKZB 2FDBP 1IGYA 5DI8A 1XGPB 3ZSTA 4EDXA 1NAMB 1OF2A 4OCRH 2FGZA 3IETB 5IMKB 5T3ZE 2XWTB 1CLYL 5GS0L 1DBKL 2NLJB 5LAXA 3C6SB 5HVWA 5EC2A 3LKQA 3QEQE 3OXSB 5F1IB 4K7PH 2Q8AL 1P7KB 1P53A 4UB0L 5DTFA 4HG4K 2F58H 1BVKB 5F7MC 3UYOD 4HHAB 2P24A 3LRGA 3DWTA 4PRID 2BFVL 2AXFA 4LKXB 3BZ4B 5T1KD 2D7MA 3QEHB 3MOBH 4F7MB 3TT1H 3V8CA 2HT3C 4F15C 3V6ZA 3CDCA 4XWGL 3LEXB 3B6SA 3RUGF 3C8KA 2HKHL 3SE4C 4H88H 4LSRH 2FSEB 3WL9A 1JRHL 5IROA 4Z78A 1TJIH 4OLUH 4X8JB 2W0FA 1EK3A 3ZHLA 3UEZA 4JQVA 5J3HD 3CGTA 5AUMA 4YDVA 3SDDA 2BVOB 5HYJA 3NCJL 1U58B 3C5ZA 5CINL 3CVIL 1DUYB 4LDOB 5BO1H 2BERA 4P2CG 2UY6A 2QQKH 1MFDL 4HH9B 4YHKL 4K8RD 1MHEA 4EDWL 3H9ZA 4G80A 4K9EH 1QLEL 2Y72A 4LOUD 3U7AA 5GGSA 3UDWC 1JUFB 4XCYB 4Y19A 1CLZL 1N7ML 2R0ZL 3RPIB 2A6JA 1A7NL 3SJVB 1TZHB 4P23B 4EN3A 1UXWB 4CMMB 3PXJA 4X6BA 3H9HA 4HUWA 3DI2B 1S9XB 4MAYB 3RA7L 4F37K 3HPLB 3UTOA 4PGEA 2XWJB 3EAKA 2CPCA 3GBMH 3JV4A 4GBXB 5IEHA 2D2OA 4NRYB 2BJMH 5C0CA 3OKNA 2OTPA 1FO0B 1YY8B 4OV5A 2QSCL 5I18L 3QDGD 3VWJB 4M1CD 2PNDA 3QJHB 1QSZA 4HZLB 1FZJB 4B50A 2X4PB 1NL0H 2WLYA 3QHTC 5LVEA 5J1SC 1OTTC 3GK8H 5GRJH 5DZNA 1UM5H 4HS6B 4PJAB 4P2RA 3I6LD 4CL7A 2K7QA 1T20B 3EGSB 3FQUB 2HH0L 4M1GH 2F54B 2OL3L 3O3UN 5F88B 4LSUH 1NBVH 5JW5B 5EZOL 1TQCC 5HGBB 5ACZB 4Z8FH 1A0QL 4PGDA 3D3VA 3BRFA 2YPLB 3UJTH 3OMZA 2VDMH 4CNIB 2DQJL 4QRRB 2NY2C 3WKNA 1QFPA 4M7LT 5EU4B 4QNPE 5JIIA 4NQEA 5I73B 4DW2H 5D7JD 4LCUA 4CMHB 4BH7A 4F7PB 3IRPX 4HKZA 3RWFB 1UZ8B 1XGPA 1NAMA 2C3WA 4I9WD 3IETA 1NAKH 5IMKA 5E4EC 5AG9A 2XWTA 3SE8H 5F1OB 1G9NL 3ZE1F 3L5JA 2NLJA 3F7YB 3C6SA 5DQJB 3BRGC 1QBBA 3OXSA 5F1IA 1X4ZA 4HPOH 3PL6D 1P7KA 1WBXB 1A9BA 1NC4D 4RGMC 4KXZI 1HH9B 5HHMB 1BVKA 4HHAA 1GH7A 3ALPA 4XAKD 3EHBC 3A0OA 4LKXA 3LH2L 3BZ4A 2Q6WB 4U6TA 3QEHA 3BMVA 4C56B 5IK3B 4F7MA 2XXCB 1BQHG 3CSPA 1NKRA 3VE0B 4YXHH 3ZE1E 3LEXA 1QRNB 5T3ZH 5MENB 2NZ9D 1UCBH 3WFEL 2APFA 1ODAA 2FSEA 3HI1B 4JGUA 1DBJL 3RGHA 1YYMH 4X8JA 3MGTA 1S7WA 3DUUB 2DL2A 3AS0A 3P9LB 1PDKA 4V2BA 2BVOA 1C5DB 5GGTA 4KKCC 5J11C 1U58A 1NGPL 4G6ML 2IJ0C 5DLML 1DL7H 1DUYA 5DHXB 3S7GA 1B4RA 3N9GH 4HH9A 1IGMH 1KGCD 3MLXH 1R0AH 2NY3C 4XPBH 2C9AA 1E4KC 4XCYA 4BSVB 2W9EL 3RPIA 1P2CB 3SJVA 1TZHA 4P23A 4OT1L 2PKDA 1UXWA 4CMMA 5FV1L 3P4NB 1P5UA 5CD5C 1S9XA 4MAYA 1QKZH 1T0NB 3QHFL 5C0NC 5CGMA 3NPSB 5J8OA 2VC2L 3FO2B 5KOMC 2CR3A 1FRGL 3HPLA 4OCWH 2XWJA 3OJ2C 4KTEH 3JWDC 3T2OA 3MV8B 4IRZH 4ZTPL 1MCSA 4OFIA 2DQFB 4I8DA 2NTSP 4GBXA 2A6KB 4Y4KB 4Z7UF 4NRYA 2ZNWA 4M61B 1FO0A 1YY8A 4N0CD 3AROA 1ACYL 3VWJA 1Z3GH 1I3GH 3SDCB 5BV7B 2VLJE 3T04D 3MXVH 3QJHA 4HZLA 1FZJA 3TJHC 2Y06L 2X4PA 1U8JB 1AXTH 25C8H 4LP4A 2DKUA 1N6UA 3X17A 3O6MH 1RIUL 3FFCB 3O6LL 4HS6A 4PJAA 4X4XB 4U6YB 3ZTJG 2EDEA 4QHLB 1T20A 3EGSA 3FQUA 2Q1EA 4K7PX 1ED3B 2F54A 4JHAL 4JQIH 4FQIL 3ET9F 5F88A 4FQPA 5JW5A 2AK4E 1JF6A 5HGBA 5ACZA 4LSPH 4R0LB 5JW4R 4GW1B 2MPAH 1GGUA 3O2DH 4P99A 5GS0C 2YPLA 1U9KA 4CNIA 5BOZG 4QRRA 1SMAA 3BYYA 4UOJA 5EU4A 3REWB 5D6CB 3TH2T 4WHYG 2DRUA 3OGOE 3QZWG 3OAZK 4F7PA 4LCCB 4Q9QL 1UZ8A 2ZUUA 2J88L 4X80H 4XPTL 1NUGA 1U3HB 4BFGA 3QCUH 3I50H 2LAAA 5GHWL 3HMXH 4U1GC 4AT6B 1LO0H 4TNVF 3F7YA 5FYJE 5DQJA 3QDMB 5D2NB 5EZIH 4XPHL 2GCYB 2QEJA 1WBXA 3KPMB 1EJOL 1HH9A 1HQRB 4C4KO 3OZ9H 1FNSL 3I85A 1IMHC 2Q6WA 4PJ7F 1N4XL 3GJEB 4C56A 5IK3A 1IC1A 1QSVA 2IMMA 4JFOB 4P2QE 5HHPB 2Y6SD 3V6OE 3WIHL 4RISL 1S3KL 2ICES 3VE0A 4Q6IC 1MCDA 5DUMH 2E6QA 1QRNA 1QFOA 2VDLL 5FYLH 5MENA 4HBQA 3UX9B 3QHZL 4K8RL 3HI1A 4BELD 4OCMC 5JZ7C 5MEQB 3S37X 5E94B 3TNMB 3DUUA 4RMTA 3P9LA 4I1NB 1F4YL 2H32B 3VXRD 3SEPA 1DBBH 4PRAB 2BHUA 3QT2A 4AEFA 5BVJB 1CTNA 5HHQB 1F3RB 2ORBL 5F7FA 3CLEL 4QLRA 1HKFA 1S7UB 4M6NH 4P5TD 1F4XH 4BSVA 2WUBL 4WUUB 3AS2A 1P2CA 1NCWL 2FHCA 3BW9B 2VAAB 4WEUD 5BZWB 3V0AC 1YDPB 4TUJB 3P4NA 4PLNC 1T0NA 1IL1B 3FO2A 4AL8H 4WW2C 3K74B 3MV8A 2ZCHH 2DQFA 5MERA 3UBXI 2A6KA 4Y4KA 1RU9L 4GAGL 3KPNB 4K3JH 3HN3A 4WTZA 4M61A 3SDCA 5HSFA 3QXAB 3VFWB 4WIQA 3V5DB 1U8JA 1F58L 2FX9H 1GOHA 1PX3A 3H9SD 1U42A 3VFUB 5DMYA 2AJXL 3ILPB 1TITA 4GLRI 1N3NB 4YFLF 4F58L 3FFCA 3BAEL 4X4XA 5B39G 4TTDD 4U6YA 4QHLA 2HTLD 5AZ2H 4KHXH 1B2WH 1MF2H 1ED3A 1HNGA 2VLKE 3OB0K 3MCKB 2VUYA 4FZEL 1EEQA 3MLZH 1IILE 4R0LA 4D0DB 4GW1A 1N8ZB 2KZ1B 4DAGL 4R4NC 2DQTL 5KSAD 2B5IB 1G9NC 3EJZD 2WQ8A 2FD6H 3MCLL 3PHQB 5DVMA 5INDB 1QP1A 4LU5H 2VLRE 1VESA 2W0KA 3I02A 3REWA 4DOHE 1X44A 5D6CA 1D5ZB 4GKOA 4KMLB 4XMKL 3PXHA 4LCCA 3V0VB 3LDBB 1T1XB 5IBTH 4OSUH 1PLGL 1BVLB 5D7KD 2Q3AA 2X4OB 1UJ3B 4F3FB 2IQ9L 1IM3B 3QDMA 3PABB 4HS8L 2GCYA 1G7MB 3KPMA 1TJHL 1VPOL 4P2OC 4AY0A 3ORJA 3F5WB 4APQB 4UIMB 2L0DA 5TJWK 3EDDA 3GJEA 4UBDD 5HHPA 4JFOA 5SWQB 5FO7B 3BFOA 5C6TH 5ITFB 2J8UF 1IT9H 1PGRB 1TETH 2V5MA 3U7WL 3LVEA 5JPMB 2DQCH 1OP5K 4ZFFB 2A9MH 1QYGL 5FYJH 5MEQA 4FQJH 5E94A 2H1PL 4N5ED 3H3PL 4RFNC 3TNMA 2H32A 1I8MB 1MCWM 4JHZA 5L88H 2IC2A 3KPPB 4BZ1L 5JDJA 4JG0L 4LGSB 4PRAA 1A7QH 2J8UE 5D96B 3S5LB 4U3HA 4KI5D 2WW8A 4IOSD 4Z7NE 5BVJA 5HHQA 2DQIL 4U1NB 4YHML 5HVHB 1TQBB 3BQUB 1J5OH 1A4KB 5M95B 1S7UA 4HK3J 3WFCH 4K2UL 4HJGB 5T3XD 1BBDH 1LO5B 3S88H 4MVBC 4XH2B 4WUUA 4WY7L 3BW9A 5BZWA 1JGUL 1YDPA 4TUJA 5CD3B 5DC0A 4EI6A 1IL1A 2KZWA 2NXZD 1T7XA 3MTRA 3O81A 1BAFH 3G9VA 5DJCB 3UTQA 3WDIA 5ABDE 2ADFL 3VWKB 4PPTA 3B43A 1J8HB 3PHOB 5I66B 5ILTL 4HXAL 3KPNA 4NN6C 4V2CB 5FFLA 3C6LB 1GGBH 1ZS8B 2IBZX 4EQ2A 1XGQB 5ECJE 3QXAA 4XP9H 3VFWA 2DQEH 1A3RL 2OBGA 3V5DA 1CXFA 2DN7A 5EOCH 4ONFH 3N50A 3VFUA 3ILPA 1N3NA 3I6GB 4DKEH 4KH2A 2XFXB 4PUBH 4GMSH 5IBUB 3RY6C 3MCKA 1H3VA 2EC8A 2V7NB 4DN4L 4D0DA 4ZOCA 1N8ZA 3MROB 3GNML 4L3EB 2Z8SA 1A14H 5DYOB 3PHQA 2XIDA 1DVFB 5INDA 4ZS7L 1R3IH 3AU1B 3BT2H 5L7XH 1L6XA 1D5ZA 3LMJL 5CCKH 5JOPD 4QTIL 2ZUYA 3NN8B 4NQCB 3V0VA 4H1LB 1T1XA 3G08B 1L0QA 3K80A 3L3HB 2O26U 1BVLA 4L4TD 3X14B 5BS0D 1GGTA 2X4OA 1FSKC 3C09B 5LGJA 1UJ3A 5HHVL 1D6VH 4LLDB 1IM3A 3D0VB 3VXOB 3BZEB 1NUDA 4JKWA 4PJXB 4N0UE 3PABA 4HIHB 4K8RC 1RVFL 1G7MA 1KC5H 5JA9A 3LOWA 4Y4HB 1SJVA 2NX5B 4LOUC 1JYVA 3F5WA 1CL7H 4APQA 3HE6A 1HIMH 1I1CA 1LNUB 4UIMA 4WI2A 3SOBH 5I1KL 1ORQB 4PP2B 2V2WB 5SWQA 5FO7A 3BKCL 5ITFA 4KMTH 1CGUA 5K9QG 3MYZA 5HDLA 5JPMA 4L8CB 3CK0L 4ZFFA 2RFXB 1GPOL 1KELL 4CN1A 6FABL 4RGND 4OLZH 1YNTB 4NWTL 5H94B 4PGJA 3KPPA 3QUXB 1QSFB 3C87A 1NLBL 1NGQH 4RMUA 3S5LA 4J3XA 2DQUH 1VEOA 2X41A 3JZ7A 4JM2D 3HI6H 4U1NA 4S1RL 1Q72H 1KPUB 3BQUA 1A4KA 4WJ5B 4IBLT 1PFCA 2W9DH 2FGWH 4HJGA 1PVHA 1LO5A 4U3CA 3BEWB 4XH2A 3OPZH 1BFTA 1YEJL 2V5RA 3SO3C 3BDYH 4YGVB 5CD3A 2XKSA 3ARVA 1A7OH 1U6AL 2BNUB 5JW4Q 5AYUL 1L7IH 3CVHL 1EH9A 1OW0A 4UT7H 5DJCA 1BZ7B 5SWSE 3C8DA 4HT1L 3VWKA 4NWUH 3VG0H 4YEFA 1J8HA 3PHOA 3P73B 5I66A 5TE4L 2HG5B 4JQXC 3C6LA 1IKNC 1ZS8A 5A3ID 4HK3N 2Z9TA 1XGQA 1ADQL 5D7JC 2XQBL 3B9AA 3ARGB 4HUVB 5D72H 4MXWH 2XN9D 1EO8H 2VITB 4Y2OA 4G8IB 1X5LA 2R29L 1V8HA 3HRZB 2MFNA 2R2EB 3I6GA 5JO5B 4R26H 5FGBC 2OZ4L 3BX7C 2XFXA 3MRMB 3PL6C 5BOPA 4LVHC 2IFFH 2P45B 2J5LB 2V7NA 5C2BL 5L0QB 3LKPB 4M4RA 3LEVL 5FO9B 5FHBL 3MROA 4L3EA 2I5YL 3KG5A 5DYOA 2VXVH 4NKMB 4F57L 5FM5M 5INCB 5CSZB 3RVTD 1JHKH 4PG9B 4O2EB 1DVFA 3AU1A 3IFLH 2NZ9C 3P2TA 4FQ2H 4M5ZL 4WWID 4JFFD 3QWOB 2ICWB 3RWCB 2ZCLH 1MWAB 2DYPB 1U3HD 3QISA 3NN8A 4NQCA 4NZUL 4ODSH 2DLHA 3UTTB 4H1LA 3G08A 2XZCH 2VDKL 1R6VA 3L3HA 3I3BA 2R9HD 3DETD 3X14A 3QWRA 5I15L 3WJLC 2MKWA 4L4VD 4LLDA 3LHPL 3D0VA 1B6DA 1OAQH 4KKAD 3VXOA 4EI5B 4N1HB 2PYEB 4PJXA 5KG9B 4HIHA 3GMQB 4OCYH 1J87A 1KCSL 1BD2D 1EGJA 2FLBT 4Y4HA 5JXEA 3ZLQC 2NX5A 4K7PY 5ITBL 2VE6B 3RWDB 4ZSOB 1ZGLB 1KF9B 1XAUA 1GYAA 1C1EH 1LNUA 3OL2A 1NCBH 3QH3B 4HUMB 3VD7A 5CP7B 1T1YA 1ORQA 5C07D 4PP2A 3UYRH 2V2WA 1FYHB 3B83A 4IMKC 3EFDH 5DD3H 1A3LH 4L8CA 4K3EL 2F5BL 5I1JL 1WK0A 2RFXA 5FDYA 5LBSH 1N6QL 4LBEB 3GZKA 4X4YB 1CZ8H 4WO4D 1KCVH 5IESL 3ZTNH 1CDBA 4MJID 4OI9A 2IAMB 4AQ1B 4EBQH 1P7QB 3MLTB 1YNTA 3QO1B 5I75B 2F8XC 5T3XL 5EG6C 4P3CL 3VMNA 1KJ3L 4P46B 4ZAKB 5H94A 1BX2B 1QSFA 4LLUB 4QHKI 1U8IA 1HINH 2VZOA 3VXSD 2O5YL 1B4JH 3ARSA 5FYKD 3KYKH 4XP6L 4KTDL 4NO0D 1KPUA 4WJ5A 3BRDA 4U7MA 2A2QT 2YUXA 1TCMA 3FT2A 4JFDD 3BEWA 2BNRB 2BXYA 4HK0B 4MWFB 4U1KB 3BJLA 3KLHD 4PJCB 2KH2B 4GS7B 1A8JH 4KXZH 2BNUA 3O6FB 1GGYA 3BYTA 5IOPB 3TZVB 1W8NA 3KXFD 4BZYA 4JHWH 1BZ7A 4OIBA 3SQOH 4WEBH 3HAEH 1U3YA 3NFPB 3P73A 2VL5A 2HG5A 1MJ8L 5B3JF 4X4ZA 4YEEA 3HTLX 3ARGA 1MPAL 3E3QC 4HH8A 5C0AB 4HUVA 4O00A 1YC8A 3HC4H 2I24N 3MJ9L 5T1MA 4WW2F 2Z4QB 4RDQF 2VITA 4XP5L 1ZT4B 4G8IA 5ISZB 5GGVL 3JV0A 3HRZA 2R2EA 5JO5A 3O4LD 1Z5LB 4HIIA 4R4FH 2IH3B 3MRMA 1PG7X 4YFEA 4CDGC 1JZ8A 5B3JE 1G0DA 3D85B 5KJRL 3LKPA 2DL9A 2QQLH 5FO9A 4P5MB 2JCCF 4PGBB 1DQDH 1I9RL 4NKMA 1YEEL 2Y6SC 5INCA 3RGVD 5F9DC 3RNKB 5CSZA 4HJ0D 1MHHB 4PG9A 3MLWH 4O2EA 2CJUL 5I74C 3X3GL 2UZIH 1S7SB 2P4AB 4MZ2A 43C9B 4CDHA 5EU3B 4JO4L 3QWOA 2ICWA 3RWCA 4UV4H 1MWAA 4G3YH 2DYPA 4GKZB 1A1NB 1LO2H 3UTTA 5IHBA 1VEPA 1PYWB 1QSEE 2A1WL 2JCCE 2IMNA 3ARDD 5K59F 1EMTH 3E6HB 2X10A 3O6KH 4FXKB 1YQ2A 4EI5A 2HMID 1GJIA 1X5HA 2PYEA 3JWDH 5KG9A 3GMQA 3HNSL 1RHHB 3CSYB 4UILH 1R24B 4P5TC 5MI0C 5HYFA 2VE6A 4ZSOA 4UV7L 3ZO0A 1ZGLA 2KKQA 5HPMB 4P2YA 4JFED 3QH3A 3FB6B 5CP7A 2DD8L 1WAAF 3QI9B 3RL1B 5K59E 3BUYB 4FFVD 3VXME 1MFEH 1J0IA 4Q74A 1QD0A 2R0WL 3ZDYF 2J4WL 4O02L 2NY4B 4LBEA 1KN4H 4X4YA 4RRPA 4X6DF 2FZ3B 4Z7VF 4DKFH 1E27B 3JTSB 4LSVH 2IAMA 2YD2A 2PO6B 4ZUVB 1P7QA 3MLTA 4NPYB 3QO1A 1SQ2N 3HE7D 3N85H 4P46A 4ZAKA 1UKQA 1WAAE 1BX2A 2AERT 4LLUA 4DGIH 1GCFA 5DURD 1TFHA 1KB9K 5IHUL 2GITB 3KPSD 4WENB 4PJHB 3GB7B 2V5YA 1RZFL 5JHDE 4HWEL 3QEUB 1ZLSL 5FGRA 4Z7VE 4TTDC 4UB0H 2HTLC 2R39A 4PG2A 2BNRA 4G7VH 1DTUA 4KAQL 4HK0A 4MWFA 4U1KA 5EUOB 5M94B 4F80A 4PJCA 4UTBL 3I75B 4G7YL 3O6FA 3MRFB 5EU7C 2NMSA 3L6FB 4OZGF 3S9DB 5IOPA 3TZVA 2YBRB 1HHJB 2CDGB 5DZLA 1FAIH 5KSAC 3FJTA 1D5BB 1DEEB 2EZ0D 3EJZC 2QHLA 4NJ9L 5F6HI 3NFPA 4D9RD 4NO2B 4U05A 4IJ3C 1F90L 3B9DA 4PJDF 3DX6B 5C0AA 2EDDA 3WMSA 2JTDA 3NCJH 4OZGE 1PSKH 3P9MB 5CINH 2Z4QA 3VFPB 1EFXD 1ZT4A 1MQ8A 1XGYL 5ISZA 3PWUB 1Z5LA 2GY5A 1HHGA 1BQHB 1QLEH 2IH3A 3F58H 2R0ZH 2LU3A 1MCQA 3D85A 3E8UH 4ZYKB 1LK3L 1TENA 4PS4L 4WFHD 4P5MA 3HAEG 1U2HA 2VN4A 4H0GA 4PGBA 4XRCB 4M7KH 4UBDC 3RA7H 1WICA 1DP0A 3RNKA 1MHHA 4YDLB 3UTSE 1S7SA 1X5IA 4YUEL 43C9A 5EORL 3HA0A 5EU3A 1CLOL 1G6RH 5L2KB 4ZPVB 5I9QB 2NY6D 4DKDC 4NQVB 4GKZA 2CK0H 1A1NA 4G6AC 3CFKB 2KBGA 4N5EC 4DQOH 3MLVH 1QA9B 3FCTB 1PYWA 4JGMA 2XI9A 3RU8L 2I25N 3E6HA 4KI5C 4FXKA 3T3ME 2VWEE 4I3RL 1I3VA 1RHHA 3CSYA 1T5WB 5D1QD 3RJDA 5T1DL 4NZRL 1R24A 2HH0H 3CNKA 3WFZA 4GLRH 4KGLA 2YPVH 5HPMA 1G7LB 2EYSA 4ZO6A 3W39B 4C59B 2OL3H 2DM4A 3FB6A 4PRIE 3WIIH 5EZOH 1FL6B 1XFPA 3JV6B 3QI9A 3RL1A 3WNKA 3BUYA 3KAAA 1CIDA 1CXLA 4YE4H 3F6IA 2NZIA 1A0QH 3KPRB 2DTSA 5E2UH 1KYOJ 1LILA 4Y8AA 2NXZC 4WHCA 4Y4FD 4QOKD 5FYKL 4FXLA 2JIXB 4UTAH 4XB8A 2FZ3A 1E27A 3JTSA 3QUXD 4NCDA 2PO6A 4ZUVA 1KB5H 5KS9E 35C8H 4NPYA 2AW2A 1IC4H 3HC3L 4C57C 1B0WA 3GM0A 3G6DL 3RVUD 2JE8A 4XB7A 4JRYB 4WV1B 4KJPC 4ELMF 4AZ8A 3JWOH 3GMNB 3R06B 5F70A 1CDUA 2GITA 3QCVL 4HC1H 4BQCA 4PJHA 3GB7A 1W0VB 1SY6L 3P11H 4UNTA 3QEUA 1JYNA 3PQYB 1OD7A 3O2WL 3QIBB 4M43L 3C2AH 4IOIB 5EUOA 1EZVX 1Q0XH 1A6WH 3I75A 3BPLC 4HEME 3MRFA 2F5AH 3L6FA 4JPWL 3E6FB 2YBRA 1EVTC 1HHJA 1G9ML 2CDGA 3QZWB 1D5BA 1DEEA 3QDJD 5TE6H 3DTXB 3WUWG 4NO2A 1DBJH 3TVMB 1U0QA 1H15B 5FCSH 3TCXA 4XC3H 3L3GB 2OYPA 3DX6A 3QDGE 1SM3L 4ZO8A 1JK8B 2YUVA 3DMMB 4PJBB 1JCKA 2D0FA 1AO7D 3PV6B 3VFPA 5CAYB 5HHOD 4PRPB 3CMOL 3GJFH 4XC1L 1BFVL 3PWUA 3I6LE 1BQHA 2YPKB 3LQAL 1VA9A 2HAZA 2W9EH 4ZYKA 5TQ2L 5EA0L 4WU7B 1BQLL 4W4OA 3CFJB 4XRCA 5E99L 2D9QB 1S8DB 3QHFH 5HGGS 2VC2H 2W92A 2NW2B 4ZTPH 4UQ2B 5E6ZA 2PR4L 5L2KA 1ZHBB 2FATL 2J6EL 4ZPVA 3ZE0F 3BP5B 4NQVA 4RGNC 2FHFA 3D48R 5AG8A 5I1CL 3CFKA 4M48L 2YD3A 1QA9A 3FCTA 5DZOA 4FABL 5EO1B 1NGYB 5EO9B 4NM4H 4I9WE 4MA1C 2EYRB 4X7TB 3NABL 4JM2C 4IRSB 5DWUH 1EO7A 2BOCB 1T5WA 4JE4B 3QEQB 3P0VH 3GSNH 3DRTB 1J9CT 5K9OB 1G7LA 2B1AH 4JHAH 3W39A 1JPST 4FQIH 4BQ6A 5E4IA 1EIBA 3JV6A 3O4OC 4ZPTB 4JFPB 5DEGB 2G5RA 1ZA6B 4ALAH 2LVCA 5BRZD 3KPRA 5IW1B 5I2IB 2D31B 3QPQD 3V4PL 3ZKXB 3L3DB 3OHXB 3WXVH 2JIXA 4YGAB 3B9EA 3TJEL 1XH3B 1XF1A 1AE6H 4CUCA 4MAUH 4LIQL 1SEQL 5B39B 5A3IC 5FXCH 4JRYA 3FQXB 2EKSB 2GJ6E 2DDQH 2XV6B 3NFSH 4WV1A 1EEUA 1OB1B 2YC1B 5GHWH 2C3GA 3GMNA 1F8TL 2X2YA 3B9KB 2FHBA 1KGCE 1OAYL 4TSBH 1W0VA 1CGXA 5HY9A 3WSQH 4XPHH 1ZTXH 1RUAL 1RJLB 2AAVA 5I1AB 1EJOH 1LP9F 3JVGA 3PQYA 3VFOB 3BHBB 3FMGL 3QIBA 4OIIL 3UO1L 4IOIA 3S35L 2YRZA 3ARFC 3PDGA 3OAYH 3LN9A 3QULB 4MDIB 3WIHH 5IGXH 2A83B 4UOW0 1RD6A 1S3KH 2XG4A 3QZWA 4X4MA 3VW3L 1J0ZA 3RVTC 3WHE0 5J06A 3PE9A 3DTXA 3QHZH 3CJJA 3TVMA 1LP9E 2EDTA 1H15A 3RKPA 5IKCB 1F4YH 3VD5A 3L3GA 2EO9A 1YMME 1HI6A 1YNKL 1JK8A 3DMMA 2OJZL 3PV6A 2R9HC 2GJJA 3DETC 4NGHL 3RAJL 4PRPA 3CUPB 4ACPA 4P9MH 4KKAC 3U2SB 1YY9D 5IVXF 2YA1A 4LSTH 1A64A 1CGYA 1L9MA 6CGTA 1IGTB 2ZUQB 3KNBB 1NCWH 3H42L 1KLFA 1FGNL 4YXLL 1N5YL 4WU7A 3CFJA 1Z2KA 3LEYL 2MOVA 1KEGH 2V6HA 4XHJD 1R5VB 1RZJL 4U7KA 1S8DA 3IDUA 1QUNA 4I3GA 3MLSL 4OZFH 2NW2A 3UXFA 1T2QL 3MZTA 4TVPD 4UQ2A 4YDIL 1UWEH 5F9OL 1J0HA 4OD3L 4U31A 3ARPA 1ZHBA 5IVXE 1OGAB 2R8SL 4BUGA 3BP5A 1C7TA 1RU9H 4GAGH 4WO4C 5GSRB 3SBWC 3GSRB 5J1TC 1T21B 3E3QE 4LAJH 4YO0B 4O2FB 5ACLA 1W72L 5CP3H 5EO1A 4ZTOL 1NGYA 5EO9A 4HMCA 3A6CL 4KHTL 5HXMA 4OI8A 3KJ4B 4KKLC 1CD9B 4DZ8B 2EYRA 3QJFB 5EN2B 4X7TA 1RMFL 2NY0D 1Q9OB 3D39B 5AEAA 5ICXB 3QFDB 2QQNH 2BOCA 1ZHNB 1BM3L 3QEQA 3TT3H 1FNLA 2MHAB 3D1MC 5K9OA 4YZFF 3AREB 1MI5D 4MMZC 4FZEH 4ZPTA 2R0KL 3NAAL 3ARRA 4JFPA 5DEGA 3KLHC 1ZA6A 3L1OH 4DAGH 2CMRH 2VXQH 4KDTA 2DQTH 5IW1A 4S10A 4UDUB 5KANI 5I2IA 3DO7B 2D31A 3MCLH 5C08E 1CGSH 5I8EB 3L3DA 1DQML 4S0TD 4L1DA 1XH3A 1U8QB 4OUUB 1NMCB 3TO4D 4YZFE 2ESVD 3VXRE 5B39A 4JY6B 3FQXA 2EKSA 4L8DB 2GJZB 1OB1A 2YC1A 3EYVB 3QR2A 1AHWB 1G9MC 4WFED 1NMAH 4MCYB 3B9KA 4U33A 5DHVH 1FLRL 2IQ9H 3DLQR 1FH5L 4HS8H 1RJLA 5I1AA 1M7XA 4X9HA 1JGVH 3VFOA 4FFYH 4Z7QE 2EDOA 2Q7NA 2DICA 3QIWB 5HYEA 3QULA 4MDIA 1EPFA 4TULL 3FZUD 2A83A 2PXYB 2Y07H 5JW3L 1FFPB 3U7WH 5GXBB 1X9QA 3NTCH 3RGVC 4XNZB 2AEQL 3NCYP 3LIZH 2EEBA 4HJ0C 4JO1H 3LQAC 4JZOB 1TXKA 2H1PH 2EDWA 4OLYH 3H3PH 5IKCA 4B41A 3MV01 3MRJB 5F8RC 4BZ1H 2FB4L 4GMTL 4JG0H 2VLJB 3ARDC 1QFWI 3VFSB 3H9SE 2PF6A 2DQIH 5HI4D 3CUPA 4S1QL 3DBXB 3FB5B 2HMIC 2O5XH 4RFOH 3U2SA 1CDGA 1F42A 4N0YL 4MQXD 2AEWA 2COQA 4WY7H 3GFUA 1M05B 3KNBA 2BRQA 4LSQL 4R8WH 3RDTB 5C0BD 1JGUH 3EUUA 1X7QB 2AQ3A 2CO6B 3FN9A 2AK4B 5EU7E 5HJ3B 5E2VL 1R5VA 2VISA 3HNTH 4FFVC 5C7XH 3HI5L 3F8UB 5E1HB 1WLHA 2EEDA 2F15A 1XIWD 4NJAH 4O58L 1RZ7L 2ADFH 4YJZL 4BK5A 4CRPA 2HA1A 1OGAA 2WP3O 4NQDD 5GSRA 3GSRA 1LEGB 5CEXB 1T21A 4YO0A 1C5BH 3MXWH 4O2FA 4M7ZC 4PP1D 3HE7C 3BEVB 4M02A 5D7KE 4QWWD 1A22B 1A3RH 4TNWF 4DZ8A 2WBJB 3QJFA 5EN2A 1OWWA 1Q9OA 3D39A 3DGGB 4ERSL 5ICXA 3QFDA 2UWEF 1ZHNA 1JNHB 2G75B 3AY4A 3VFTB 3IDIB 2MHAA 1JI1A 1KV3A 2R56L 3AREA 4OZFG 4P59L 3HMWH 1F02I 2RBLA 4FMFA 5KZCD 3RPKA 2G9HB 4P2QB 4FFZL 4UDUA 3OXRB 3P4MB 3DO7A 4OFDA 2ATPB 5IMLB 5D1XB 5I8EA 4ZS7H 2EZ0C 1CDJA 1U8MB 1CG9B 3S3PA 1U8QA 4OUUA 5D8JL 4QTIH 4JY6A 4JRWA 4L8DA 2GJZA 5IMMB 2BSSB 1AHWA 4KI5E 5GS1B 1TCRB 4MCYA 1JTTA 2F74B 1PQZA 3QIBD 2AJYH 3LRSB 5F9AC 1B88A 4FQQB 1H9VA 4UT9L 5E95B 1RVFH 4IRJD 5T3XE 1OT2A 3RZCB 4XZUB 2YK1H 3WUZA 2LFGA 5KVDH 1H5BB 3QIWA 1SVCP 2J1KA 3LQZB 2YS4A 2PXYA 4HKBA 1IAIM 2CKBL 5CUSL 3NGBB 4XMPL 1FFPA 3N1FC 2O5ZH 3CK0H 3U0WL 2Y4SA 4JZOA 6FABH 1GVIA 3NA9H 5EBWB 2NY6C 1A7BA 2P5EE 3MRJA 5FCUH 1GSMA 2JB5H 2KUTA 3V6FA 1RZJC 1NLBH 2VLJA 3VFSA 1TIUA 2A77L 2BRRL 5ALBH 2N7BA 3CXHK 5DDHB 3STBA 3DBXA 3FB5A 4ODUB 4L8BB 1QR4A 1D5IL 2MMXA 5D1QC 3V2AR 5GGUB 2MQCA 5IB5B 2CGRL 1M05A 2VLKB 5DJ0B 3RDTA 3H0TB 4LCWD 2P44B 1X7QA 1ERNA 2AK4A 5HJ3A 2DQGH 1CTOA 1U6AH 3KYAA 2YZ8A 5AYUH 2NCMA 1BFOB 1TZGH 4X5XB 3DNKA 3DYOA 5BJTB 4HT1H 4Y4FC 5D7SH 5DC9B 3TFKD 2VLRB 5EIIA 5TE4H 5E03A 4PV9B 4OD1L 4DOHB 2LTQC 5JOPE 4GRLD 1LEGA 1TZIB 5CEXA 5HDOA 5T3ZD 4OGYL 43CAB 3BEVA 3K4DA 4IRSD 3RVUC 2HYMA 4L4TE 3QUKB 5BS0E 3LKSB 2EIZB 2WBJA 5F97E 1MJUH 1YNLL 4NSKB 3DGGA 2R29H 3CXDH 1F3JB 1JNHA 2G75A 3M8OL 3VFTA 3IDIA 3QEGH 2VDQL 4MXVF 1T7WA 2XZQL 1IFHH 3BN3B 1VGEH 5MHSD 5F7NC 3T0XA 3NACL 5C2BH 4QXTB 4ZUUB 4XCFL 5FHBH 5TPWL 2BY2A 4LLWB 5E9DD 2G9HA 4P2QA 2I5YH 4HWNA 3V6OA 4F57H 2Z92B 2HVKB 2Z31B 3BIBX 3QUML 1U8KB 3OXRA 4LPYA 3L5IA 3P4MA 3TWCL 4DKAA 5IEKB 3KGRA 2ATPA 3SDAB 2EH8H 5IMLA 5D1XA 5I1IH 3GSXB 2ED8A 5JLZB 3ZKMD 5BMFL 1U8MA 1YQVL 2HFTA 1CG9A 1NCNA 4MXVE 3O9WB 2UYLB 2OXGA 2B1HH 3K46A 2VDKH 2H41A 1L4IA 3OR6B 5HDBF 3PJSB 5F8QC 5IMMA 2BSSA 1TCRA 2J8UB 4RAUB 5I15H 2F74A 3QA3B 2ZSVB 4N5UA 1AP2B 4OF7A 3LRSA 2ARJQ 1OM3L 3EOTL 4FQQA 4Q58C 4YHYC 1YEKL 1LD9B 2F53D 4Z95H 3HRPA 5E8NA 2IG2H 3RZCA 1WZ1H 4XZUA 4ODTL 4XCCL 3BH8B 5IQ9B 5LGHL 4BSJA 1YPZF 1YZZA 5CMAB 1H5BA 3LQZA 4YQXH 1JE6A 5EU6D 4F15B 1CQKA 5CIPB 4B5EA 3MLUH 1ZLUK 5I1JH 4PD4K 1VENA 1X6LA 3VFGH 1CFTB 2J3SA 4LQFL 4YXKL 1VACB 5EBWA 1CK0H 4OCRL 3ZZ1A 3ETBF 1A47A 1YPZE 3V6BR 4P3CH 1KJ3H 4K3GA 3IS1X 4JFQB 5CS7A 4E9LA 2XN9E 1ORSB 4JPIB 3V0WH 5DDHA 1MAML 4KTDH 4ODUA 2F58L 2CRMA 4L8BA 1PD6A 4GH7B 4J6RH 3TO2B 5CSBA 4QF1B 4Y0GA 5GGUA 1FVEB 3MOBL 3TT1L 5I19H 5IB5A 3MJ7B 2VLKA 5DJ0A 3H0TA 1LEIB 3PDDA 3VGAC 1ZVSB 5DA4A 3G5VA 5TDOB 1PY9A 2XPGA 1P4IH 1IQDB 2VYRE 3GSUB 3NCBB 3SE3A 1BFOA 3NCEB 1G7PB 4X5XA 1TJIL 4D0BB 1Q1JH 5IP4A 5BJTA 4UUJB 1Q94B 2G60H 4MQTB 3QPQC 1WSST 1NKOA 1MHPH 2VLRA 3HC0B 4JFFE 1LE5B 3IJYB 4PV9A 4I18C 1TZIA 3EW3B 1IJ9A 1A6VH 4OFYA 5FYLD 5D93C 5BO1L 4DEPC 1V3LA 3NOIA 43CAA 5CJXC 2QQKL 3QUKA 1AKJB 3T0WA 3LKSA 2EIZA 4K9EL 4NRXB 1N0XL 4XP5H 4L4VE 4DTGH 4NSKA 4GXVL 2YUWA 2QKIB 2AV7B 4LDLB 1F3JA 3AC0A 4N0UB 1BD2E 1NJ9B 3S8WA 5JOFB 4NO3B 4NKOB 4Y89A 1TQCB 1ROWA 3DV4B 5C07E 4QXTA 4ZUUA 4LLWA 4WFGD 5IIEB 1FE8L 2Z92A 2HVKA 1YEEH 2Z31A 3GBML 3O45B 1U8KA 4M9PA 5IEKA 3SDAA 2BJML 2XKUA 4FNLH 2NY2B 3GSXA 5JLZA 1O7VA 3W11D 1MCBA 2IALB 2ZUTA 3TA3D 3O9WA 2UYLA 4MJIE 4HGKC 3D18B 5GPRA 3SCMD 4TUOB 2A1WH 3OR6A 3PJSA 3GK8L 3CFEB 1UM5L 3VXSE 5DMIL 5E4EB 2DIJA 1I8KB 2J8UA 3DSFL 3KPQB 4POUB 3MFGB 4RAUA 5FYKE 4RGOH 2N56A 4M1GL 3QA3A 2ZSVA 3HAEB 1AP2A 3HNSH 2O61B 4FA8A 4LSUL 1NBVL 4RGMB 4JFDE 1YY9C 2FJHB 4HFWB 1TMCB 3BH8A 4Y2DD 5IQ9A 2YRPA 3CLFH 5CMAA 2DD8H 3K0WA 3EYQD 3VGFA 3UJTL 4HG4J 4KQ3H 4GKNA 2VDML 1FJ1B 5FM8A 5CIPA 4XHJC 3ARYA 2R0WH 5SV4A 5F72S 2J4WH 4O02H 1F11B 2XQYG 3SE4A 1CFTA 5SWSB 3IAQA 1NH6A 3JSSA 4PJFB 1VACA 4LRNH 1JL8A 1NAKL 1NGZB 1ZHLB 2KQNA 5C09D 3V4VH 2RCSL 5J11B 4F9LC 4JFQA 1BHGA 1BEYL 4FQXD 4G42B 1RPQA 2J12B 1ORSA 4JLRB 3KYOB 4JPIA 1JZ7A 1NQBA 4D8PB 4FQ1H 3WS6C 5IHUH 2EDJA 1D5XB 2NY0C 3O4LE 2NY3B 3UDWA 1QOKA 4KZEH 3TO2A 1ZLSH 4QF1A 1FVEA 3CFBB 4JFXB 5FUOH 3ARQA 5IMOB 3MJ7A 2N1KA 2RJMA 4KAQH 1LEIA 2XA3A 5I30H 1ZVSA 4YXHL 5TDOA 2Z35B 5T3ZL 4G7YH 1IQDA 3GSUA 4OGXH 1IBGH 3GHBL 3EJYD 3IDJB 1LMKA 1G7PA 1YYML 4D0BA 5B3NA 4UUJA 1Q94A 2A74B 4NJ9H 3HC0A 1LE5A 3IJYA 1JIBA 1PKOA 3GM8A 4Q2ZB 5KVEL 1J05B 5FGCE 3TO4C 1DL7L 5D5MF 1IGML 3MLXL 4NRXA 3S98A 4R3SB 2E6PA 4XCEB 4Q0XH 3T2PA 2QKIA 2AV7A 3MBED 2ZPKL 3OJDA 5F7LB 4RMSA 1MJJB 4N0UA 5IFAL 1KLUB 1NJ9A 4BJLA 1QHOA 4NBZB 4YBHA 5JOFA 1HXYB 4NO3A 1D9KD 4NKOA 4M93C 1DANU 1QKZL 4JFEE 3NMEA 2ENSA 4PTUB 4ODHH 3DV4A 4MB4A 3WUWB 3RIAK 4OCWL 3OKYA 4PS4H 2R23B 4KTEL 5D5ME 5IF0B 3V9FA 1I1FB 5IIEA 5F9WC 2EXYD 5DJYA 3FZUC 3O45A 1T7VA 5E24E 3U48A 2OM5A 1T6WA 5TFSH 4J3TA 1G84A 3DX9B 2R2BA 4PRHD 2IALA 1Z3GL 1G1CA 1U8HB 1CLOH 1I3GL 4AENB 1GAFH 3D18A 2E27H 1AXTL 2R1WB 4TUOA 2GUOB 3KR3H 5F1NB 4E41E 5B38G 5D7IF 1AGDB 3CFEA 1JGLL 5KVMC 3KPQA 4U1GB 2DLGA 3SHSA 4MNQD 3HAEA 4I3RH 5AYQA 3KPSE 4JQIL 5HI4C 2O61A 5AAMA 3P0GB 1RZ8B 4G8EB 4LIQE 2FJHA 4HFWA 2QSQA 2X5PA 1ZLWK 4U6XB 2MPAL 4MQXC 2B2XH 3O2DL 1CE1L 3IYLW 4WWKD 2R15A 1NGWB 4Z77B 5D7IE 4RFEB 1FJ1A 1FFOB 2Y5TB 2M26A 3HG1D 3LSOB 4Q6IB 2F8OA 1FNFA 4PY8J 3AB0C 1F11A 1Y6NR 1Z9OA 5KSBE 1T5XA 5SWSA 1EJ6A 1XIWC 4D9RE 2DMKA 4PJFA 4TSCH 4N8PA 4X80L 2FX8H 3R4DA 3ULSB 2I9LB 1NGZA 1ZHLA 2X4QB 3QCUL 3HMXL 1FYTA 4NCC2 5DMKB 1FP5A 5A43C 4PP1C 12E8H 3NIFF 2HLAB 4JLRA 4QWWC 3KYOA 5F44A 4W4NA 4D8PA 1UH2A 1D5XA 3QCVH 1EX0A 3OZ9L 1E4KA 1J8KA 4LQ1A 3CFBA 4JFXA 2IANE 3ZYJA 2I60H 1MNUH 3ECBB 3O2WH 4M43H 5IMOA 5T1LD 4WFHE 2EDKA 2Z35A 5I8OL 5FYLL 2LABA 2EDYA 4K9EC 3IDJA 4WW2B 1KXQE 1XR9B 3U4BL 1S7QB 2E9WA 2A74A 1MCLA 4GUPB 3GRWH 4Q2ZA 2OL3B 1J05A 4W70A 2HJFB 4YWGH 4I0CC 1T7ZA 1DR9A 1NCDH 3MRLB 4GAJH 1QSEB 2JCCB 3QDAA 3T0BA 4NYLB 4RQQB 5E6ID 4R3SA 4M6NL 4XCEA 32C2B 3MRRB 3H3KA 3CMOH 4XC1H 5D1ZD 1QFWH 1KLUA 1A02N 4BFIB 3K8MA 1HXYA 4HFUL 4IRJC 4LCIL 4CN6A 4PTUA 4AL8L 3WUWA 3GEWB 4D0CB 2R23A 5TQ2H 5IF0A 1TVBB 1I1FA 2ZCHL 4OQTH 1NFDF 1CD8A 4BH8B 3VXMB 1VKXB 3UZVB 4QOKE 3RX7A 1E6OH 3DX9A 1JZ3A 1K5NB 1IKFL 2MSPA 5I71C 1U8HA 1EHLL 4AENA 2FATH 4QHMB 1O5DT 2R1WA 1KFAL 2GUOA 5F1NA 2FX9L 3KS0J 4W81A 1AGDA 1NFDE 3K3QA 2X05A 4KVNH 5L8KB 5AZ2L 4KHXL 1B2WL 2ZUWA 1CBVL 1IGFL 3CU1A 4G8EA 1RZ8A 5DGQA 5JHDB 4P2OB 5JPNB 2HRLA 1M7DB 3PUCA 4Z7VB 4PLKD 4U6XA 4X0KB 4ZD3L 1Y6MR 1OQOA 4HIXL 3DVIA 5EH1A 4J3UA 1NGWA 4Z77A 2FD6L 4RFEA 15C8H 2NNAB 1FFOA 4Q6IA 3LSOA 5LXGH 3JUZA 2HWZL 2EDFA 5CFHA 2L7UA 2JLLA 3QDJE 4EOWH 1EXUB 3V4PH 1N0LA 3WIFB 4RFNB 5IBTL 3TFKC 4AG4H 3ULSA 1MCWW 4WHTB 2I9LA 4CVUA 2X4QA 5BCAA 2OI9C 4GRLC 1SYVB 3C60D 1SEQH 2C4XA 3S6CA 1CXIA 5DMKA 5L8JB 1T83C 2IF7A 2PW1B 5DEFB 1AO7E 2W60B 2HLAA 5KAQF 4KY1L 5HHOE 1LO3H 1VGKB 4ZFZB 1I9EA 4Z6AT 4NQUA 1A4JB 3N1MC 4YPJA 4S1DD 5C6TL 3ECBA 5T5NG 3UO1H 1IT9L 3S35H 4LHUD 1EAPB 2DQCL 4M5YL 1SBSL 2A9ML 3QFJD 1XF4B 4WW2A 4CN4A 7FABH 1RI8A 3QXVA 4WGVB 1XR9A 2E9JA 1S7QA 3MRGB 5GGQH 1U3JA 2OR8A 1FFNB 4M8QB 2VIRB 5L88L 3OTTA 5A40E 3ZKMC 4NN6B 1AKJD 1QEWB 2OL3A 2HJFA 3MLPA 2H26B 4RSVA 3MRLA 1OAXL 1OTTD 1QSEA 2JCCA 3FO0H 1Q9WB 4NYLA 4RQQA 1T03H 4M6MH 5GZNC 4JVUA 5HHNB 3TCLB 3WFCL 1EEZB 3MUY1 32C2A 3MRRA 1QO3B 3S88L 2CDEB 3MV7D 3PP3K 3VJ6B 4BFIA 4PIRF 4EUPH 3DUHA 2FX7L 2UUDH 1KIUA 3IGAB 5H35B 4F7EB 3H42H 1L7TH 4D0CA 2VDNH 1CXKA 4PRIB 1TVBA 2GIYA 1BAFL 3LEYH 1X5AA 2RGSA 5CBAB 3H8NA 5T1KB 5BRZE 3RY5A 1RZJH 4YK4C 4BH8A 3VXMA 2FO1A 2VMFA 1CD1B 1VKXA 1JHLL 2R69H 1DQJB 1L6ZA 3TIDB 3KDMB 4LDEB 1MJ7L 5F9OH 1K5NA 4OD3H 2NTFB 2R8SH 2EDQA 3IDGB 4QHMA 4XP9L 1IEHA 3ZL4L 5KS9B 1LDSA 5EOCL 5C0FB 4ZTOH 5T33H 3PWLB 4ONFL 1YJDL 3WO3B 4OFKA 1KCKA 5C0GB 1WZKA 1I7TB 1FSKB 2CUHA 2OMBA 1JNLH 1FV1B 1CT8B 4DKEL 4HX1B 4HUUB 4PUBL 1B6UA 1DDHB 4FTVD 1WCQA 3VA2C 1BM3H 5SWZD 5JHDA 3GBLA 5JPNA 4P2OA 1M7DA 4Z7VA 4X0KA 4WUKH 3HNVL 2AGJL 1A14L 4YHOL 1FL5B 2BK8A 2X4SB 5DF0A 2R0KH 3NAAH 3VGGA 2OTWB 3ES6B 1ZLVH 1ZT7B 3BT2L 4U0QB 5L7XL 5DK3A 3RTQD 2FR4B 1IGCL 3V52H 3S96B 4MNGE 1EXUA 2QBWA 3BP4B 4JY5H 3NCCB 3WIFA 4EJ1C 1RUPH 3MRDB 2NY7L 4UU9B 1Y18B 4J2XA 1SYVA 5DJDB 3SDXF 3QDGB 1CU4H 5DEFA 2PW1A 2W60A 4HLJA 1KC5L 4OZFB 2DF3A 1FLRH 1VGKA 4ZFZA 5F7HA 2P8MB 4UIKH 3CDGB 2D9CA 5GRXG 1FH5H 2GY7B 1F4AA 2W91A 3SOBL 1A4JA 2A6DB 1A6TA 3W0WD 4KMTL 3NIGF 3SO3B 3J8F7 1EAPA 1TDQA 3G04B 3RI5F 1UWGL 1XF4A 5JW3H 1NMBH 4UI2A 3GI8H 5KN5B 4OLZL 1KG0B 1OTSD 3MRGA 5MEOB 1FFNA 4M8QA 4Q9RL 2VIRA 3L9RA 3W11C 1QEWA 4LPVA 1AGCB 1NGQL 4OM1H 3TA3C 4EKXA 2DQUL 3NIGE 2H26A 5D7JB 3SCMC 3HI6L 4ZQKB 4N0RA 4GMTH 1A1OB 1DUZB 1MRDL 1Q9WA 4BYHA 3SGJC 5HHNA 1IGIH 3TCLA 2AXJA 2W9DL 1EEZA 3QIUB 2FGWL 1QO3A 4BK4A 3IDYB 1CVSC 2CDEA 3F12B 3OPZL 4NQSB 2H9GB 2EE6A 3VJ6A 3GDBA 2FLRT 4LHQB 5FHAH 3PL6B 4LVHB 4N0YH 1NC4B 1F6AB 1HOCB 5E70A 4MD0A 2E7LC 3IGAA 5H35A 4F7EA 1L7IL 1MI5E 4Y2DC 1DBML 3BP7B 1DLFH 5JUEL 4UT7L 4PRIA 3JXAA 5CBAA 5T1KA 3V7AE 5E2VH 3EYQC 3VG0L 1CD1A 2I9TB 1DQJA 2JB6B 3TIDA 1BWMA 1NLDH 3KDMA 4O58H 1I75A 1R3HB 1SJEA 2NTFA 4LKCB 3VRLF 3IDGA 2ERJC 1Z9MA 5D72L 4MXWL 2ESVE 5KS9A 4JKMA 1EO8L 4MZ3A 5C0FA 3WIHA 3PWLA 5C0GA 5E08L 4XVUD 1EERB 2ED9A 3BPNC 1I7TA 1QACA 4FQXC 1GZQB 4WFEE 1CT8A 4HX1A 4HUUA 4RZCB 1DDHA 3U46B 2UZYB 4Y19E 2J2ZA 3MRQB 4YHNB 2GK0B 1FL5A 4P59H 2BY1A 2X4SA 4DUXA 4M7LL 1JHKL 3S35X 3M17B 2OTWA 3ES6A 4ONOA 3SKOB 1ZT7A 4FFZH 4LK4A 4FQ2L 4QXWA 4FZ8L 2FR4A 3EJYC 1OHQA 4HKXB 2ZCLL 3S96A 2R1YB 1I1AD 3BP4A 3LS5H 4ONHB 3P77B 4ODSL 4WI6A 1JVKA 3E2HC 4XXDB 3GSVB 3MRDA 4UU9A 1Y18A 1LP9B 3FRPG 4HD9A 1G0XA 5DJDA 1YMMB 4L3AA 1CWVA 3QDGA 1H0DB 4XVTH 2EDBA 5DR5L 3EDKA 4JFHD 5L8LB 1SVZA 4OZFA 3X11B 3F62A 2GK2A 1XGUA 4LVNC 4PV8B 2P8MA 5F9JB 3RFZC 2EIEA 3MBEC 1C1EL 1NCBL 2HFGL 4UT9H 2VB5A 3K2UH 2OR7A 2A6DA 3EYUH 3EFDL 5DD3L 4E42B 1D9KC 5EULV 1A3LL 2N4IA 5C0BE 2PTUA 3BSZH 3G04A 4UAOC 5EFIB 3HE6C 3TH4T 5LBSL 1RQ5A 3BN9D 5CUSH 1CZ8L 5I1DB 2EXYC 4XMPH 5KN5A 3MRBB 4Y1AD 1KG0A 5MEOA 1T0PB 4PJIF 2A9NL 4Y5YC 4JQXA 3S4SG 5IVXB 2P42B 4NQDE 4PJGB 1U2CA 1IKNA 1AGCA 5C1MB 5D7JA 2VABB 4Z0XB 1EHAA 4ZQKA 4YR6B 4XNYH 1A1OA 1DUZA 1VEMA 1UENA 4GRMB 2WWKO 2F8VA 4MX7B 3P0YH 5EIQA 3RHWF 3F12A 5FGBA 4NQSA 2H9GA 4PJIE 1D5IH 1Q0YH 3PL6A 3VDCA 4JG1L 1S7RB 4RBPK 1NC4A 1F6AA 1TPXC 4R4ND 1HOCA 4J3SA 4KDVA 3BP7A 1PX4A 1YJDC 4WWKC 5CJBA 3SQOL 3EDFA 1MH5B 2D0HA 5F1SA 1J0JA 2I9TA 3F6LA 5J6GB 2GSGB 5I74B 2JB6A 3K2MC 3T0DA 3WXWH 1QFUH 2ZSWB 1R3HA 5C08B 3Q3GB 1IC5L 4J1UB 1P9MC 4LKCA 3DSNA 3PNWB 3THMH 5TQ0H 5CILL 3IT8D 1XF2B 3VXRB 2D03H 4OGYH 4XPFH 5F7DB 2K3TA 1S5IL 5IFHH 3WJLA 1GZQA 4DUVA 3V79C 1V3MA 4R4FL 1LQSR 4KPHL 3IFPB 1YNLH 4RZCA 5D7LD 3U46A 1AJ7L 3N06B 4GG6E 2QQLL 4P5TB 5MI0B 2XZQH 3MRQA 4U6HB 1DQDL 4YHNA 2GK0A 5GISH 5I1GH 4LLVB 3GIVB 3WFDH 4IMKA 3MLWL 3QPXL 3M17A 2UZIL 4UOW1 4N9OB 3SKOA 3PGFH 1R3LB 3JTTB 3QUMH 5C0JB 1SHMA 4HKXA 2NR6D 4FP8L 4UV4L 2R1YA 4ONHA 1LO2L 3P77A 3RX8A 1PJ9A 5BMFH 1VB9A 4XXDA 3X3FL 3GSVA 3GIZL 1EMTL 5SX5K 2VLLB 5DA0B 3O6KL 4YFLI 2V2XB 1H0DA 3CVHB 2J8OA 4UILL 3BPOC 5E6IC 5HI5D 5FYJU 3H9SB 2HRPL 3OAUH 4KRLB 4PV8A 4X99B 5F9JA 5J56B 2CLZB 5A16B 1BF2A 3EOTH 3DOSA 2QR0B 5D1ZC 1RIHL 1X5XA 2RR3A 3MA9L 1VADB 3ZMRA 4ODTH 4XCCH 4E42A 2ZUSA 4LCWE 2HFEB 5EFIA 4JJHA 2GEEA 1BBJB 5I6XC 3UTSD 4KV5F 5I1DA 1N5AB 2XTJD 4NN5C 3MRBA 5KSAB 4CW1B 4DKFL 4LSVL 1P84K 3WO4C 2NXYD 4G6KH 1KOAA 4WDIB 1BGXH 2W65B 2XZZA 3N85L 1P5VA 4IJ3B 2OQJB 4L9DA 1X5YA 1KT2B 5IVXA 4PJGA 2QSVA 4DGIL 1BJ1J 4OKDA 3DURB 2VABA 2ZOLB 4Z0XA 3D69B 4YR6A 8FABB 1KULA 3KLAB 1K8IB 1M4KA 1C5CH 4GRMA 4KV5E 1QHPA 1WFTA 1BZQK 4EIZC 2X1PA 1MAMH 1ZWIB 4G7VL 4AEEA 1HXMB 3LAFA 4J12A 1GOFA 4I3SH 1S7RA 1HQ4B 1F2QA 3WLWD 5MHSE 3LN4B 4PLKC 2VNCA 3BGAA 5KSVB 1FAIL 4L5FH 5CSGA 1D6EB 4Y5XC 5E9DE 1MH5A 1DQLH 3OKOB 4NNPH 5J6GA 2GSGA 5D71H 4M62H 4HBCH 4Z0BL 2HTKD 2ZSWA 3Q3GA 4YIQB 5E2TH 1M7IB 2BCKB 2FRGP 1CLCA 4H20H 3TBTA 3PNWA 1PSKL 3AM8C 5F3HB 1XF2A 3VXRA 1N26A 2BVQB 5IQ7H 5F7DA 3C60C 3RUGE 3T2QA 2UVEA 1N0XH 2CXGA 1G7QB 3IFPA 4GXVH 3F58L 1PG7W 2F53E 3E8UL 4HUKB 3V95A 4P5TA 1E4JA 1XEDA 4M7KL 3HZKB 4S1DC 5CZVH 4LSSH 4LLVA 3GIVA 1GZPB 4OFVA 1T0MB 2X1WL 5EU6E 3W2DH 1R3LA 1UB6B 1FE8H 3JTTA 4JZJC 4KU1A 5C0JA 2NXZB 4M6OL 1G6RL 2CO7B 4KRMB 5A2KH 2CK0L 2Y7QB 4YC2C 4MHHI 4DQOL 1PEWA 2DI9A 3MLVL 1NFIB 3V7AG 5GS2H 1JPTL 2VH5H 1D5MB 2VLLA 5KTEH 4QRUB 4P0DA 4NQTA 2V2XA 1YEHH 2FNBA 3CVHA 3HHRB 5DMIH 3GI9H 4P9HL 3SGDI 3DSFH 5CZXD 3H9SA 2CLZA 4GO6B 2R2CA 2YPVL 5ADPH 4RMQA 4X7DC 3WIIL 3P9WB 5IB4A 4Y16D 1Q8MA 1VADA 1KB9J 5DUPH 1ADQA 4YE4L 3WS3B 3UROR 3V5KB 5E2UL 2HFEA 2ZG1A 3NZHL 3BPLB 1FO0H 4X7SH 1BBJA 2WINB 4FRWA 2BY0A 3TNNB 4LVEA 2M2DA 4UTAL 1N5AA 3FQWB 2DQHH 5KSAA 4CW1A 5B38B 1KB5L 35C8L 4Y5VC 5ETUA 2OZ4A 3L5XH 1IC4L 4WDIA 2W65A 4LHJB 1DQQB 5ANME 5DRZB 1AD0B 2OQJA 3EOBB 2EDLA 3DURA 3W81A 3TESA 2VQTA 2ZOLA 5FYLE 4YHZL 3QIUD 3W9DB 3D69A 3GUTB 3JWOL 2G5BB 2RCSH 8FABA 3KLAA 1K8IA 1BEYH 4HC1L 2MQ3A 3ARUA 4L4TB 3P11L 5BS0B 5F7KC 3Q48A 1ZWIA 4ZFOL 1A7PH 1HXMA 1IVLA 3C2AL 4I0PD 3UPRB 1Q0XL 1A6WL 4EVNB 4P4KD 1HQ4A 2F5AL 3NIDF 4HLZH 3LN4A 4URTB 4HPYL 3O3EB 3I3EA 3O3BB 4K7FB 5KSVA 1J0KA 4WFGE 1D6EA 2BSTB 5TE6L 4CADB 4N8CL 3OKOA 3GHBH 3GKZA 3SY0B 3TN0D 4RMVA 2SEBB 3RTQC 2FCBA 2XT1B 5TH2B 4XC3L 4JREC 3UYPA 1UACH 4YIQA 2LU7A 1M7IA 2BCKA 4RGNB 1ZGLM 2GJ6D 5KVEH 4XHQA 5F3HA 3BOVA 4KMQA 2EE2A 2BVQA 1OOAA 4XI5D 4MA1B 3RBSA 2P7TB 3K81A 1G7QA 4JM2B 1JUFA 5C3LD 1F5WA 2ZPKH 5LCVL 3UAJD 1PEZA 3ZKND 4XBGB 1CR9L 5IFAH 3IDXH 1XF5B 5H37H 4MJ6B 2ARWA 3T1WA 3HZKA 4H5SB 2NYYD 3CX5K 3O4OB 1GZPA 4D9QD 1IM9D 1CXEA 1T0MA 4NOBA 1UB6A 1BIIB 5FKAB 3VXTB 2D7TH 1W2KT 2Y7QA 1AI1H 1OTSC 1YMMD 2YRLA 1NFIA 2WZPD 1JFQH 1MHCB 4X5WB 4NM4L 4LGRB 5C6WH 1D5MA 2CIKB 4QRUA 2AJ3B 4U0RC 1RFDL 5C09E 1YPZB 2RHEA 4PJEF 5DWUL 5F96L 1JGLH 1DJSA 5HYQB 3CD4A 2XN9B 3P0VL 4OF6A 1DANT 4Z7UE 3GSNL 2VDOH 5A1AA 2B1AL 4G9DB 5LQBH 2J8HA 2PW2B 4TUKH 1J12A 4ALAL 1GHFL 1DQTA 5L6YH 3WS3A 3D9AL 3V5KA 3W82A 1CE1H 1ACZA 2BHZA 2NY5L