1FO0A

Murine alloreactive scfv tcr-peptide-mhc class i molecule complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
115
Chain Sequence
KVTQTQTSISVMEKTTVTMDCVYETQDSSYFLFWYKQTASGEIVFLIRQDSYKKENATVGHYSLNFQKPKSSIGLIITATQIEDSAVYFCAMRGDYGGSGNKLIFGTGTLLSVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ALLOGENEIC H-2KB MHC CLASS I MOLECULE)
publication title Crystal structure of a T cell receptor bound to an allogeneic MHC molecule.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 25
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2000-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fo0A00
3V6OA 1JHTB 4Y19B 4AIZA 4LLDB 1IFHH 4K71B 4Y1AE 5MENB 1U3HB 1ZA6B 2NY1D 3QI9D 3AXLA 4QTHB 1A4KA 3QDJB 5ID0B 4RAVA 4Z7NF 5I1CH 3CMGA 3PQYD 5FO8B 4MDJA 1V5JA 4KROB 3DSFH 3QCUL 1T21B 5F9AC 4Z7WF 1Q9LA 4EKXA 3A6CH 1NGPH 3D39D 4P23C 2ESVE 5IUSA 2A1WL 4C59B 1D5IH 1CFVH 5LQBH 4Z8FH 2DBJA 3FQUA 4PV8A 1N5AB 1N0XL 2DMBA 3BAEH 3LH2L 4TUJA 5GGTA 3KPSE 2BVYA 3MLUL 1JIBA 1D9KB 4QHMB 1M71B 3CK0L 7CGTA 3W2DH 3VWJD 1EH9A 5AD0A 4X80L 5TE7L 1T7ZA 1WBZA 3DYPA 4JHBA 1AXTH 3WN5A 5FA3B 1ZLVH 2J8HA 5GS0C 4FTVE 5IB2B 4KK9C 4HBQA 4PJEE 2WBJD 3VGGA 1W0WA 3NABH 1U92A 3L5WB 3RZCB 3WSQL 3MZTA 5E6ZA 2XQYG 4NKIL 5D5MF 3H9SB 1I1AB 3QQ3B 1SYSA 5KSBE 5EC2B 3PL6C 2GUOA 3RPIB 15C8H 2HG5B 1LEGB 4AMKL 4Q74A 4WWID 3UP1A 1X5GA 1F3DJ 3SE8L 4GKZB 3ME0A 4QT5A 4A6YL 3LKOA 5D7IB 4PJ7F 1MCWW 2APTA 3B83A 1C08B 4XNXH 1YEJH 1UC6A 1FJ1B 1EXUA 4N9GB 4NT6B 4D8PA 1XGPB 4M1CC 3U7YL 1DL7L 2LAGB 3F5WB 2DL9A 3EYVB 3BGFC 4PPTA 3MXVL 5F3BA 5K9OB 5D93B 5DTFA 2ICES 2GY5A 4NZTH 1G6RB 3OBAA 2P5WA 5B4MC 1WCQA 4G42A 1AGEA 2APBA 3P77A 4OLUL 4Z7QF 5IFJB 1YY9C 4PUBL 1UVQA 5HHNA 2I9TB 3CH8A 4YDKH 5DD6B 1I85A 2A83A 4XWOD 5F7LB 1BX2B 4YBQD 1J8HD 5E8NA 3P0YH 1JN6A 5IT2L 1NMBL 4ZOCA 4X4ME 5DQJB 1ADQA 1KB9J 4LK4A 2DM7A 4P23B 5CZXD 3WFHA 1T22B 1TJIL 3ZLQC 1QKZL 4ZXBD 4CU6A 3W0WE 3CGTA 5A2LH 2A9MH 2BHYA 4F3FA 1G84A 3UROR 1JV5B 2FIKA 3FOMB 5E0QA 4LVNC 3MV8B 4N8VG 4LLQA 3H9HA 4IDJH 5I30H 3MV9B 4H8WL 1DQMH 3PIQB 4NKMA 3MRGA 2PYEB 3MRCA 2J6EH 4U3HA 2E9WA 2Z31C 1PD6A 4KAQL 3B5TA 3V4UL 1BZ9B 2HJLA 1JRHI 2Q7YA 4WI4A 2JIXB 3G6DH 1MRDL 5KN5B 4XP5H 1DLFL 3NACL 1F3JA 3DTXA 3S34H 3AS3A 1GPOH 4IRZH 4XNYH 1F4YL 3BKML 3WFDH 4M3JA 1PG7W 3MLYH 3OZ9L 3V6BR 3DIFA 5GRJL 1JGDB 4HUWB 3B5HA 2OJZH 2VXTH 3RKDD 3PL6B 4PRHB 4YPGB 1TCRB 1G9EA 1KCUH 3STLB 2DKMA 3FT2A 2C3HA 5CUSH 5KG9B 5E2TH 1P9MC 3OAUL 2WAHA 1YJDC 2BNRA 4MD5A 1DSFH 3I3BA 1G1YA 2DYPD 5CILH 3STZA 1EHLL 3EYSL 1MFAH 1WT5A 3MRRB 1HINH 3D2UB 2XN9A 4G8FB 4YEFA 2GITB 1TXKA 3QDGE 4L29B 2FH6A 4HX1A 3C60D 3TA3D 4HUXA 3QEQD 3VFSA 2YRZA 3G6JF 2FL5A 1KIQB 3PWNB 4JKMA 4ZTPH 1A6AB 1XR8B 2ED8A 4M43H 4XCEB 1MCOL 2X4OB 2BRRH 2VO5A 4LLVA 3ARBD 2LU7A 4R8WL 3WXWH 1RJYB 4UNVA 4XHJD 25C8H 4WI2A 1N59B 1GH7A 3E8UH 3S35X 2J7LA 1S5IL 4KV5E 1R5VB 5HYIA 4LVHB 1QSEE 2H45A 4L1DA 4PGJA 1GC1L 4K7FA 3IJSB 2FATH 4D9QE 3D9AH 3LHPL 5EO0B 2VLJE 3TP4A 5KSVB 4X99B 1PFCA 4I0PC 4TPRH 3ARFD 1QBLL 1I3GH 2G5BB 4U49A 4OI9A 4RBPK 5IMMB 1XF5B 2JJSA 3NCYP 3RDTC 4K9EC 2ENSA 3FT3B 2IFFL 4LVNB 4XTRD 1CWVA 1IILE 1FLRL 2VUYA 4OLZL 5E6ID 5A16A 1PVHA 1QLEH 2EDNA 3X12A 4UI2A 2D7PA 3AS1A 2HA1A 1MWAL 5F9OL 4X7CC 2IFGA 3OKNB 2BMKB 2NY0C 2VKWA 5AYUH 2QR0A 3IDYC 3BX7C 1M4KA 3QNZB 5TH2B 4PJIE 5D6CA 1SVZA 1IQDA 3H6JA 1DDHA 3WMSA 2WUBH 1JGVH 4S1QH 4LVEA 4QOKE 3QUYA 4NRZB 5F7WC 4EVNB 5B8CC 3ARDB 3UJTL 4NWUH 5JO5A 2RFXA 1ZT7B 4X6FB 3O41A 2OTUA 3TO2B 4NN7C 3LEVH 4JY4A 3BKJH 2AEWA 1YMME 4S1SL 4Z95H 5IMKA 4FP8H 2BHUA 1AE6H 3C5JB 1JF1A 1EBAA 2V9RA 3O3DA 5F1NA 2A6DB 2VZ1A 3KPNA 1QSFD 5E9DB 1BAFH 4JQVA 4MJ2A 5ABDE 4M9PA 3MBXH 2F5AL 1CDUA 3FRPG 5KVDH 1YEFL 3KS0H 2C3GA 1CR9L 3L3OB 5MEPB 4UIMA 2E7LC 3HS0A 4QF1B 3C6LB 3EYFA 4XXCC 1ZT1A 5BZWA 4JFPB 4W4NA 1QD0A 1NKRA 4F7EB 3MYJA 1HYSD 12E8L 1NFIA 4K7PX 4ZODA 3X11A 2W07A 3TZVC 3UJJL 1ZXQA 1J0YA 4NZUH 5EU6B 4YHML 4FXGA 3HB3D 3MCKA 1GAFH 1ZAGA 5C71A 1CFSB 4XGZB 2XA8L 3LQZA 4MDIB 5FOJA 4L9LC 1XCTA 1IKFL 3VCLB 3QZWA 3HPLB 5FYJL 4MJ4A 1IL1A 1D5ZA 5CEZL 4MNHA 3WYRA 4XHQA 4JRXE 4OLYH 2CR6A 4I0PB 4QNPF 4W4OA 2NTFB 1RPQA 3I2CL 3I84A 1U8PA 1WBYA 3O4OB 3QHTC 4PJHE 5C0BA 3LEYL 1FH5L 3RDTB 1OVZA 2F9BT 3QNYA 4JFYB 4N1CA 4J4PD 3HI6L 2DM3A 4G6ML 4Z7VF 1MJJB 4BFBD 3MCLL 4X6DE 4C83A 1AHWC 4LGRB 4AT6B 3U0PB 1I8IA 2X89A 1X4ZA 4JQIH 3ISWA 2APFA 2NY0B 4BH8A 3IDYB 5DJ8A 1UB5B 1RULL 4CW1A 3F6IA 4LSPL 1K4DB 4TNWK 1SY6L 5SWZE 1FGVH 2F5BL 1X5IA 1BQHB 4OD1H 3W11C 1T3FB 5IIEB 2CLVA 4Z7OF 3THML 4WNQB 5EU7E 4P9MH 2X4PB 3H9YA 2PCPB 5D71H 4PY7A 1YEHL 1CQKA 4NN7B 4TVPD 4MXVE 2EEDA 3L1OH 5SV4A 1EUUA 2XZCL 1A0QL 2FWOA 3HRPA 2IMMA 3OKLA 4POUB 1J87A 4JKLA 5CBAB 2X41A 3C87A 3RUGF 4YHLH 1I7UB 2Z35B 4DZ8A 3KYKH 4Z0BL 1U93B 1GGBH 3JTSB 2YEZB 3D3VB 3H3PL 2HN7A 4QHNA 5DLML 3P9WB 3KXFD 4ODUA 4EI6B 1CFNB 1LP9B 4P2QD 5HBBA 4NO0D 4NQCA 4IOIA 5DURB 1LHZA 1T5WA 1MFEH 4AENA 3DGCR 3VMPA 1SJEA 3KYMB 3PV6B 1NUFA 32C2A 5J6GA 2R0LL 4ALAL 5T33H 4K23L 2LVEA 1CXEA 3TZVB 5DFVD 4BQ6A 1B6DA 1JVKA 1MJUL 4OKDA 4YWGL 3RWIA 3CVHA 3ARWA 2VXUL 4J6RL 3T0XA 2D7OA 5E8PA 1NANI 1MFNA 3MRBB 1KBGL 5E4EC 5C8JB 4EN3D 3VRLF 3QFJB 3O8XB 3IXTA 1CG9B 5F7EH 3TGXA 3QIBC 5ESAA 5AZEH 1MJ8H 4HKZB 1LMKA 1U8JB 4XP6H 4J3XA 4KK5D 2HVJB 1XEDA 4OZGF 3MRIB 3CLEL 2P44B 3U1SH 4YE4L 1AHWB 4P59L 4R9HA 5HYJE 2OZ4A 2VDOH 3IDIB 3O6LL 3IF1A 3B2VL 4HUVA 5JTWA 4HWBL 3FQTA 5EIQA 4FQXD 2OS7A 4PRNA 4PGEA 5CGTA 1QEWA 4U33A 4JGMA 1J86A 4HWZB 5AAWA 4MXWH 2YA1A 3U46A 2GIYA 3EGSA 2DLEA 1SEBB 2IH1B 1TNNA 3ZE1F 2EDHA 2XI9A 4M1DL 4HULB 3KPRD 5DUML 3UC0L 4M7LH 4GG6A 4ZQKA 4FFZH 1UKSA 1A02N 4PJXF 4W6XB 2F74A 5DJAA 4ODHL 4F33A 2DTSA 3OHXB 2XXMB 1J7VR 4JFZL 4NGHH 3ZDYF 2E27H 3GSVB 2H2PD 4JM2D 4J3UA 4Y5YB 4HGKC 4LKXB 4KI5C 1GGCH 2HVKA 1XIWD 1TZGH 5FHAH 5BW7A 5C08B 4HCRH 4KJPD 5FECA 4NO5B 4Y19E 1DQLL 1I8LA 5DYOB 1KPVB 4NBZB 1I3VA 1AY1L 1IFHL 3SGJA 3OG4B 3TO4D 1NGYB 1CD9B 3T0WA 5T3XE 1LD9B 5EZIH 3WN5C 2PO6A 3VXQB 4ZTOH 3SE3A 1S9WB 4Q58C 4GAYA 2R69H 4YXKH 4MJ6A 1TJGH 3TT1L 1T0MA 1UYWL 3BFOA 1GGUA 4BSWB 1IEBB 2QBWA 4JFEB 2VL4A 4LIQE 4J3VA 2DM4A 3A6CL 1TJHL 5T1DH 5IBLC 4ZUUB 2R2EA 2C7UB 4MAYD 3O6FC 1CFVL 1KXVC 1JPGB 3BRDA 3SDAD 4NKQB 2EKSA 3WFCL 4AL8H 1D5BB 5E4EB 3QRGH 5T1MB 4Z78B 5K59E 1FAIH 3IETA 5D1XC 5CMAB 3V5HA 1KCLA 2VTFA 4YBLC 4LPTA 2BZDA 2FJHA 4EUPA 2V5RA 4M9OA 5CZVH 2Y5EA 4XP1H 1U2CA 1WV7T 2XQBH 3UZQA 4MNGA 2BNQD 1R0AL 5JW4Q 1MAML 3FZUC 3O9WB 2ZUVA 5IEKA 1HCVA 5GJSH 3SOBL 1ZHLA 3REVA 4RFEA 4AIZB 1KLUA 2CRMA 4IM8A 2N56A 2ICCA 1BM3L 1I85C 3AXLB 3RX8A 1A4KB 2A74A 2D7TH 3SBWA 2EC9T 4RAVB 4JFFA 4FQIL 4MDJB 2IANA 3SGDH 4KTEL 2MCG1 3MRMA 4M48H 1Q9LB 2EZ0D 5D7IE 4WHCA 4YHNA 1JF6A 1HNGA 4Q2ZA 1YEJL 3ARXA 3FQUB 4PV8B 4JHWH 3BP5A 1QLFA 4TUJB 1I1CA 3S97C 1TZIA 5A2IH 4NZTL 5DMJB 4NNXA 2E6JA 3WJJC 4F58H 5L2KE 3CFCL 4NQSA 5AD0B 1I7RA 5ECJE 5BRZE 5BVPL 1T1XA 1WBZB 1DBMH 4LQ1A 4YDKL 3WN5B 4PJ8A 1EUTA 4EIGB 4WFEE 3PHSA 4D9RD 4DKFH 1V7NH 1KGCD 1VKXA 2WINA 3QIUD 3P0YL 1W0WB 1U92B 3QPXH 3IDUA 3ZKQD 5SWSD 1ITCA 3MBEA 5EUOF 4D3CL 2OL3H 5FFLA 1SYSB 4D94A 2VDNH 1DBJH 1X7QA 3BP4A 5M94B 3WLBA 2VRAA 1L0YA 2PF6A 3RVTC 5IGXL 1CDIA 3F58L 2GUOB 3RWHA 1J8KA 1YECH 2A9ML 4HH9A 3RGVA 4NUJA 4NQEE 2IQAA 3HE7D 4DFIA 4DGIH 4QT5B 3QDMA 3LKOB 2YD6A 2HH0H 4WFGD 3MV9E 4IDJL 3ZE2E 2PTTA 4DVBA 1EXUB 5C09E 4D8PB 1WT5C 3VWKA 1KEGH 4YGVA 5E1HB 1X5LA 4AZ8A 5F3BB 1JPSL 3LKSA 3LN4A 3O45A 5DTFB 4ZFFA 1J0HA 2BERA 1U8KA 1IAOA 2QTEA 2P5WB 2DKUA 1FNFA 4KRPD 4OCXH 4G42B 1AGEB 3P77B 3ZT7A 2E7BA 4P99A 3SE4A 3S34L 2R9HD 5CWSA 43C9A 3PP3H 3WFDL 3G5YA 1UVQB 5HHNB 2CPCA 3S98A 5HVWA 2A83B 3P40A 4A2LA 1EMTH 4OV6F 2OJZL 5E8NB 4PRHE 2PTVA 4PJ9D 5DHVA 1JN6B 4GAJH 5HJ3A 1KCUL 2FECI 5ITFA 1WIOA 4FQCH 4HIEA 4N68A 4XI5D 3X3GH 2HFEA 3O6ML 1Q8MA 2DIBA 4R7NA 3BQUC 4LPYA 4MHHG 3VD9A 3WFHB 4C56D 4GRWH 4R4NC 1INDL 4F3FB 1ZLVK 2FIKB 2JJSC 2DWEA 4WW2A 3PGDA 2FD6L 5BV7L 4P4KA 4G80A 5IB3A 5FM8A 3OKDA 2W0KA 4ERSL 4LLQB 4DGVH 1V7MH 3SKMA 3H9HB 3CXHJ 1U8QA 3DXAE 4ZTPL 4NKMB 3MRGB 1AR1D 1AKJD 5HI5D 3HLAA 3MRCB 4IRJD 3LV3A 2CRZA 3FO1A 1S3KL 5EWIL 4BK4A 2HJLB 2Q7YB 1JNNL 5GHWL 2YPVL 5FGCB 3RWJA 4V1DA 2APVA 3E8UL 4LNRA 4FABL 4HXAL 4RMRA 3C08H 3IRPX 1F3JB 4WFHD 3DTXB 3QUYC 5HHOD 5KBNC 1Z0NA 4G9FD 5DUPH 4R4FL 1E0OB 1EV2E 4OUUA 3WKNA 3D9AL 2VLRA 4UDTA 3DIFB 4XCCH 4H0HB 2FCBA 2I26N 3BSZL 4G6FB 1U3JA 4UV4H 3FO2A 3D25A 3FT2B 4IRSD 1YQVH 3VFWA 4IHOA 5T5FH 3WDIA 2BNRB 4NIKB 3KR3L 2V5TA 4MD5B 1QLEL 3MLVH 5CJXC 2GJJA 3STZB 3T8XA 3RP1A 2XN9B 4OT1H 2YBRA 5F8QC 5AYUL 1C5CH 4HX1B 2M26A 1EFXA 3F7VA 2FB4H 4HUXB 3VFSB 3CD4A 3D85D 3CDYA 2FL5B 4KDTA 4RGNE 1W8NA 3WNNA 5JDJA 4OQTH 3FN0L 5J3HD 4S1DD 5CP3A 1HE7A 4LLVB 5ADPH 3FMGH 1IEAA 3OB8A 2R56H 5IB5A 2KUTA 3O2DA 4X6CA 5FYLL 4FZ8L 2KQNA 3UTQA 1CDBA 3BKJL 5EU4A 2B39A 4Z95L 3SDYH 3JWNC 3H8NA 2PKDA 4K7FB 3QYCA 4UILH 5HGAA 4OAWA 3C60C 3RBSA 5E9DE 4GW4A 1UM5L 2VAAA 4PJBE 4Z76A 2HFTA 4W4OC 3NZ8A 3GK8H 3MBXL 2VZVA 5DJ2A 2GSGA 3QCVH 4WI3A 4OF3A 4XBGA 3ARBC 1G9NC 4AEHH 4M6OH 5A16B 3DRTA 3X12B 4UMGA 4CJ1A 3GRWA 1OAXH 3L3HA 1ZEAH 3EOBA 2WIIA 1DJSA 1HH6A 1KN4H 1VENA 1SM3H 2QR0B 1I9RL 4PJCA 4XMKH 5C07D 2H2SD 3LKNA 5I1KH 3K4DA 6FABH 5EU6E 2H9GA 4NZUL 5D6CB 5C0CD 1IQDB 1GAFL 4KKNA 1DDHB 5INDA 1RUKL 5F9WC 4DVRH 3QUYB 1HQRA 3IAGC 4MNQD 4WV1C 5JO5B 5B38G 3EFDH 2RFXB 4XTRC 3E6FA 3MGTA 1HXYA 2OTUB 3JXAA 3O41B 4OLYL 3EYQD 4P9HH 1FFRA 4JY4B 5TE6L 5BO1H 1NAKL 4UQ3A 8CGTA 4M7JL 2I24N 5IMKB 1BFSA 3MTRA 2CK0H 5HD8D 1JF1B 3O3DB 1UH2A 2EDBA 5F1NB 2VDRL 3QQNA 3KPNB 5D7JC 1A5FL 4R90H 4Y16D 1E4WL 1X4XA 1CGYA 4G8GD 3UTPD 2EC9U 2ZNXA 1UH4A 4LSVH 5LKNA 1FGVL 4UIMB 4X5WB 3HS0B 2VZ3A 3UO1L 3EYFB 4ZSOA 1XR9A 4MB5A 1ZT1B 4OD1L 5BZWB 4OCYH 5EIIA 1NMCC 3MYJB 1NFIB 3X11B 2WUCL 3ZKMD 2B4CC 3K4ZA 3AMKA 5TPWL 4FXGB 3MCKB 3T0DA 3QUZD 2MOVA 3LQZB 4OLXL 3PG2A 1XCTB 3QZWB 4HQQH 1IL1B 5BZDA 1D5ZB 2M1KA 3WFBH 3MJ9A 4MNHB 4X8JA 4NCC1 1U8PB 2DL2A 3Q0HA 1WBYB 5C0BB 2DTMH 1QLRA 4MCYA 3QNYB 4Z0XA 5FV1L 4LASH 4MWFA 1G0DA 4R26H 4C83B 1I8IB 3UAJC 4BH8B 2RIKA 5DJ8B 1ND0A 2O5ZH 3WL9A 3CU1A 5I6XB 1B4RA 4CW1B 3V52H 2EIDA 4RRPA 1ZTXH 1BIHA 1OAZH 1LE9A 2VE6A 2JKXA 1NEUA 5I2IA 5D8JH 1U8HA 4S0TD 2CLVB 4XPHL 4UIKH 3S37X 1Z9SA 3QFJE 4PY7B 2BVQA 4HZLA 5F7EL 4IIQC 2FWOB 1MJ8L 2EICA 3OKLB 2CUMA 3WE6A 1ACYL 1FN4A 3BXNA 3ILQD 2OCFD 3U1SL 4OV5B 4OZ4A 4DZ8B 1UXSA 1BECA 4P5TA 5L8JB 1QBAA 4OGYH 2NZ9D 2VDOL 2KQMA 2NY6D 1XZ0A 1DQTA 1Z0MA 1MCCA 4QHNB 2HN7B 2QJDA 3TN0C 1I8LC 4JFDD 3FQWA 4ODUB 4EZMA 4CN4A 3SGJC 4NQCB 4IOIB 4TUKH 2OXGA 1AQKL 3KHOA 1TETL 1T5WB 1KENH 2PO6C 3FB8A 1Z9MA 4AENB 2HLFD 2R0KL 2HMIC 4NWTH 1SJEB 3QIWA 4ETYA 1FDLL 32C2B 5J6GB 3FFCE 3V0VA 4YDLB 2AJYH 5I75B 2GJ6D 4FFZL 2BK8A 3BMWA 4N5EC 1FZJA 2ZUQB 3CVHB 3RWIB 4BSVA 1DUYA 2VYRE 1FGNL 3NPZB 5E8PB 5I73C 3VGAB 2E27L 4AYFA 1I1YA 4XAWL 3F7YA 3GSNA 3IXTB 3GMQA 2CKBL 5C08E 5ESAB 1BHGA 4HCRL 3U0WL 1T4KA 2MQCA 5F1SA 4WO4D 1A47A 1H3PH 4ESKA 3BIBX 5IHBA 1P53A 2YUXA 2VR9A 4M7ZB 3BJ91 2XG4A 4R0LC 5IW3A 1DZBA 2MQ0A 2DWDA 3IF1B 2HT3D 4HUVB 5HYEA 2BOBA 3FQTB 4PRNB 5J06A 4JFEE 4PGEB 1GZQA 3VXSE 5C0JA 1QEWB 5IFAH 5IVOA 3QP3A 2O26U 2X1WL 3BZ4A 3U46B 3EGSB 5FKAA 5KVFH 2APWA 2H32A 3BMVA 3SBWC 3O3EA 1ZHBA 1WK0A 1YQ2A 2A38A 4MQXD 3MC0A 4AL8L 3VA2C 4GG6B 1FHGA 1UZ8A 4ZQKB 5HYSA 1FAIL 4HH8A 4LHUD 3GJFH 1QNZH 2F74B 3TNMA 1A6VH 5DJAB 3WIHH 5JW4M 4OGXL 2CMRH 1KB5H 2F58H 3I6KA 4F33B 1NBVL 5CZVL 5F93C 5L8LB 2P7TA 4YIQA 2HVKB 2XTJE 3SJVD 1CD0A 3CNKA 5C0IA 2W0FA 5GJSL 5FECB 1INEL 1K9TA 3DURA 5DWUL 3V6OE 3W5MA 4D2NA 4FQ2H 4HBCL 1BMGA 3VMNA 4PJ8C 3BO8B 2PO6B 1ZVSA 5CP7A 4GAYB 5HI4C 4MJ6B 1HKLL 1T0MB 1U8OA 2C26A 4PJFF 3G6AA 3QUXD 3TWCH 2H2PC 1CD1A 4M48L 4OFYD 4YZFE 3LQAC 2R2EB 4ONFH 3S4SG 3QULA 3NCJH 5FCUH 1DQJA 3VRIA 2EKSB 1PJ9A 5I73B 3IU3A 4XP4H 4OJFH 2W0LA 2EH7L 1OPGH 3IETB 3TO4C 3I85A 1WEJH 2R2CA 2QHRH 3V5HB 3GBNH 1ZANH 1HN1A 4E41D 4OUOA 3LS5H 2MTPA 2FJHB 3L7EA 4EUPB 2O61A 3VWKC 3L5JA 1P7QD 3HNTL 4MJ5A 3GMNA 4GRLC 4WTZA 3ARTA 1JZ6A 1VFMA 1P4BH 4MNGB 4TSCH 2LQRA 4HC1A 3FFDA 4XC3H 3PJSA 5IEKB 5JHDA 2KL6A 4OKVA 4MAYC 1IGIH 3LPFA 4CMMA 4WI5A 1EEZA 1ZHLB 5LG1A 4RFEB 3REVB 3QPXL 1KLUB 4HIXL 2XNAA 2OL3L 1LO2H 2PXYD 2VDNL 2A74B 5F70A 4BFEA 5JQHC 3V8CA 2VLLA 2NY5H 4JFFB 4G6AC 1FIGL 1WISA 2IQ9H 4LSTL 3CCHA 3VFGH 1YDPA 1WCBA 2IANB 4MZ2A 3MRMB 4OZFH 1RJZA 3RIFF 1MIMH 5D1ZD 4OB5H 4YHNB 4Q2ZB 5KANG 1OCWL 3HMWH 3PQYA 4UINL 3BD5A 5E8DL 3HR6A 3BP5B 1QLFB 1JWSA 1FL3A 3D39A 4WW2C 1TZIB 4AJ0A 1CF8H 4P4KC 2P8LA 5B21A 4NNXB 4NKDA 1WAAA 1NBQA 4NQSB 2Q87A 4LMQE 4NM8L 4OLEA 1I7RB 4ZFOA 2J4WH 1T1XB 5CSBA 4KJYA 1YEDA 1S78C 1IGMH 4PJ8B 3R06A 4W81A 2JJUA 4N1HB 1VKXB 3MA9L 2WINB 3WUWG 4PJ5A 1QQDA 1TTGA 5JOFA 2H1PH 2BY1A 4ZAKD 1NAML 2CO7B 3RVWC 3MBEB 2CIIA 4FQCL 3X3GL 1VGEH 2DQDH 3N06B 3L3GA 1X7QB 3BP4B 3WLBB 3ULUH 2WBJA 3MRKA 1K3IA 3IDNA 4LSSH 1RZ8A 3RA7H 1Y0LA 2W38A 3RWHB 3VJ6A 4HH9B 3RGVB 4NUJB 4P3CH 2IQAB 4BA8A 4GKSA 3ULVE 4I13B 2X70A 3QDMB 1V7ML 3B5GA 3T08A 4UZGA 2PTTB 2UVFA 5LCVH 4DVBB 3CZJA 4N1EA 2AJVL 4OCSH 4HUMB 4PRID 3RNKA 1YPZF 3VWKB 3EJYD 4YGVB 3S3PA 5D7IF 3K4AA 3LN4B 3LKSB 3O45B 1U3YA 3EDKA 4ZFFB 1NSNL 4NUGH 1IAOB 5FGCE 5ITBH 4KDTC 4L9DA 1Y6NR 2R1WA 4NRXA 5CWSB 43C9B 3KWWA 3G5YB 4ZNEA 5IQ7L 2RQ8A 1ZT4A 2WNGA 1WWWX 3V6ZA 5A3ID 2MSPA 3MUY1 1KJ3H 2FX8H 5DHVB 3VGDA 5JQ6H 5HJ3B 5EOQH 5IVXE 4Y4KD 1PBYA 5ITFB 3UTSD 4HIEB 5FAAA 5T5FL 2HFEB 2BNRE 4CNIA 4R7NB 1RIUH 1N8ZA 3MLXH 1WJ3A 2COQA 4OIIH 2XZQL 1FCGA 4OT1L 2Q8BH 2AQ2A 5ISZA 1C5CL 2G75A 2DWEB 4WW2B 2R9HC 3PGDB 2OP4H 4P4KB 4G80B 5IB3B 4O58L 3OKDB 2FB4L 4LLMA 3SKMB 2NW2A 4DFHA 1QP1A 1IQWL 4ZYKA 3V7AE 3ELAT 1U8QB 4RFNC 3QHZH 4Y4FC 4OQTL 3DX8A 5DD1L 4DUVA 3HLAB 4HJGA 4YHIA 5ADPL 3LV3B 3FO1B 4UAOC 4XI5C 2R56L 4KWUA 4JZOA 3RWJB 4V1DB 1HK6A 2H26A 4K94H 4LNRB 1GOGA 1SEQH 3WS6C 2J8UA 1F4HA 1FE8H 4C55A 1R5WA 4OUUB 4UILL 5CINH 5IG7A 3AUVA 4AY0A 2EIZA 2VLRB 4UDTB 3I6LD 3BH9B 2ATPA 4AQOA 1OTSD 3K80A 3FO2B 3D25B 3EDJA 5HI5C 4XBPA 3VFWB 4IHOB 3VFTA 3SY0A 1UJTA 4M6OL 5DC0A 2EDWA 4KJWD 4W6YB 1SBSL 3NA9H 1G6RL 4ZO9A 2HT2D 1OAXL 3PP3K 4ZG1A 1ZEAL 1M05A 3SQOH 1P4IH 5AZ2H 3T8XB 5DK2A 3T65A 2YBRB 1SM3L 4Y2DD 4GMTH 2DI8A 1EFXB 3F7VB 5I1KL 1LILA 3TH4T 5IHLB 4YAQA 5F7FA 5BS0D 2WP3T 4GQ9H 3MRHA 5D70L 5HI3D 2D7NA 4PG2A 3ZSTA 2A77L 2QQLL 4KKBD 4IRSC 1IEAB 4OF8A 3TA3A 3SKOA 3QEQA 3LAFA 3QUMH 5I1DA 3EFDL 5IB5B 4OGZA 1U91A 2D0HA 5E2VH 4X6CB 5I76A 4XVJH 4S11A 1KB5B 4WWKA 3FJTA 3UTQB 1EPFA 5EU4B 5F1OB 4OZHA 3BZFA 5DEFA 3W82A 3ORJA 1FVEA 4K8RD 1RZKC 5HGAB 5HGHA 4YLQT 2E6PA 4OAWB 5DJCA 2CDEA 3CLFL 4GW4B 2V7NA 2VAAB 4ZPVA 4Z76B 1PY4A 3UJIL 4XH2A 4S0SD 3NZ8B 3MCG1 3HC3H 4UU9A 2CXGA 5DJ2B 2GSGB 2P8PA 1WFOA 4HJ0D 4F7CA 1GGIH 3AM8A 3O4LA 4FNLL 4S1DC 3B6SA 2YA2A 4XBGB 3EZ8A 4YFLF 3DRTB 1KELL 2OLDA 5GS0L 3ARFA 4NJ9H 2ESVD 4RFNB 1EO7A 3L3HB 1OSZA 3EOBB 2WIIB 4L3CA 1HH6B 4OCYL 5LGHL 5E56A 4M6AA 4PJCB 3LKNB 4WVRA 4BFIA 4YHKH 2H9GB 3LDBC 3DYOA 2IPKA 3FQNA 2W9EH 5INDB 1YEGL 2IPUG 1HQRB 2DQFA 1HIML 5GQBA 1AC0A 2E5EA 2EDJA 3OR6A 3HMXL 5IW6A 1WITA 4HQQL 4NHCH 4YX2H 2JCCA 5KSAC 3E6FB 5K93A 3MGTB 1HXYB 2XKUA 1FV1A 1IRAY 2H3NA 4UQ3B 5C0BE 2DTML 1YMHA 3ZL4H 3JV0A 3MFFA 2X7LB 1MQKH 3HCVA 1UXWA 4I0CC 5D1QD 5FUCE 2F8OA 1W0VA 4QLRA 4W70A 4R26L 1JZ4A 5FYLD 4S1RH 1F6AA 2WP3O 3EO0A 2O5ZL 1Y6MR 2KZ1B 3V52L 4GKOA 5DQDL 2CUIA 3SDXA 3U9UA 3LSOA 1H3WM 4PFEA 2DQTH 1OAZL 2ADFH 4QRQA 3EYQC 4ZSOB 1XR9B 5T1LD 5EIIB 3I3EA 4XNQA 1NGWA 3SPVA 4UIKL 2GYSA 4P2OD 1A6UL 3O2VH 1GZPA 4TSBL 3TJEH 2YD9A 2W0PA 4F7MA 3S3JA 4WUUE 3OF6A 5CD3A 2CDGA 5CD5D 3VXRA 4Q7DA 5BZDB 1CXKA 1EGJL 3WO3B 1KIUA 2AEQH 4X8JB 5DVKA 3GBMH 1OW0C 2AXFA 2B0SL 1MFDH 2FH8A 1QLRB 4MCYB 4LLYA 4Z0XB 2GAZA 4MWFB 5D2LA 4TUKL 1RIVL 4E5XA 5IESH 2VJXA 1KENL 4JG1L 3NMEA 2WQ8A 2AJ3A 4OCWL 1ND0B 1EHAA 3ALXA 3WL9B 2AJYL 5DK3A 1QSVA 4Y1AA 3TV3H 4GRWE 4TNVK 3LDBB 2FZ3A 5ACLA 3EYOA 4KY1L 4PP1C 2VE6B 5H37H 3QEGH 5JNYA 1LE9B 5L88H 4M6NL 5I2IB 2JK5A 1U8HB 4JY6A 3T3PF 4U1MA 3O3UN 4PBXA 1YJDL 5HGBA 3T0ED 1MCFA 1N64L 2BVQB 1XGUA 4HZLB 1CZ8H 3GMLA 1UQSA 5FOBA 3WE6B 2DBLH 1FN4B 3BXNB 1H3PL 4JN1H 3VXUE 1YEIL 2OR9L 3EOTL 5DJYA 4OZ4B 3PXHA 4EQ2A 1UXSB 3KPSA 2C4XA 4P5TB 1X5AA 3AB0C 2B1AH 5C7XL 1XZ0B 4KK8D 2NR6C 3BDYL 2VKXA 1N7MH 3OKEA 3TCLA 3FQWB 3V5KA 2D2OA 5IFAL 3AC0A 1QRNE 3PWLA 4X7EC 2R39A 3L3JA 4NO3A 3FB8B 5D7SH 4WFFD 2QKIA 2UY6A 5E2UH 4FTVA 5KTEL 3QIWB 4FZEH 5FM5M 1LP9F 3V0VB 2MQ3A 1M6OA 4OD2A 1M7IA 5L7XL 1QBMH 1QNZL 1L7TH 1T0NA 5BVJA 1FZJB 2Q76A 4Y4HC 4BSVB 1DUYB 2NZ9C 1RZ7H 4K9EL 3F65A 4YC2C 2D9QB 1I1YB 1S8DA 4RA0C 3F7YB 3GSNB 2DAVA 4F7PA 5D2NA 4NNYA 2HTKD 4XCFL 3GMQB 1PG7H 5J57B 2BFVH 4DN4H 1T4KB 1MFCH 1P2CA 4G3YH 1HWHB 3NN8A 3K3QA 1NLBH 5FF6A 3INUL 5D7LA 3BD3A 4NP4H 4G7YH 3EFFA 5C6PB 3MMEA 3W81A 3O0RH 3UYOD 2DWDB 3KLHC 4ZDHA 1UH3A 1MRFH 2BOBB 1J1XL 3DO3A 1GZQB 3PF2A 5KSUA 5C0JB 5FUZL 1MHPL 4M7KH 3BZ4B 2R1XA 5FKAB 1A1NA 5GS1C 2H32B 4ONFL 1H3VA 2K3TA 3O3EB 1ZHBB 2E9IA 4FQXA 2VLMD 1F90L 3OGCA 4ZD3H 4X4MA 1KC5H 1J1PL 3QH3A 1UZ8B 2NXZB 5HYSB 1YYLL 1WEJL 3LZFL 43CAA 3ZDZF 2AAVA 2QHRL 5I9QB 1ZANL 1GGYA 3TNMB 3X13A 3KPRA 2VH5H 3TVMC 2HTLD 1A14H 1UWGH 3LS5L 4NOFA 3W0WA 4L4TE 5SX5H 3I6KB 5F96L 3WD5H 5TDNA 1G9NH 1RUAL 4GQPH 2P7TB 4KC3B 5HTSA 4YIQB 3M1BA 2HJFA 4PY8I 5J12C 4KFZC 1VACA 5JHLH 1P4BL 4TSCL 3AB0B 5HHMD 1MCPH 5C0IB 4JEGB 2W0FB 3DURB 5DQ9A 1DBKH 4JM2A 3MLSH 1G7QA 3QFDA 4ORGA 1LO2L 2ORBL 2P4AB 4CUCA 1ZVSB 5CP7B 4MS8C 2IQ9L 1U8OB 3G6AB 1RUML 2IANE 3VFGL 4OLVL 1I9IH 1IC7H 1IBGH 1CD1B 4KH2A 2X09A 1MIML 5EZOL 3P0GB 3P0VL 1RHFA 3QULB 1TCMA 5JIHA 1DQJB 4U2YA 3VRIB 2X1OA 3IU3B 4KMTL 4YC2B 5GRVK 3WUZA 1PX4A 2EYTA 5GGSA 3B43A 4HLJA 1OTUD 5EOTA 3MA7A 5AWNH 2O61B 3L7EB 4X6EA 3PP4H 3CFIC 4RGOL 2J4WL 3QDGA 4MJ5B 3ALWA 1PY9A 1IGML 1NQBA 5IMLA 3BPNC 3FFDB 3PJSB 3HAEH 5JHDB 4OKVB 1OARH 1F5WA 4PRAA 4CMMB 4QEGA 2H1PL 1EEZB 1UWEL 3GJFK 4MHHI 1RJLA 1TVHA 4HS8H 5C6WH 2XNAB 4L1HA 5DFWH 1XFPA 2LAAA 2WWKT 2DQDL 2DQHH 4OZFG 1D3CA 2VLLB 5K9QG 1HH9A 4P5MA 4CU7A 4ENEC 1O5DT 2PN5A 3CCHB 3IJYA 1QSEA 1WSST 1YDPB 1WCBB 2NY1B 4P3CL 5EIVA 1T03H 4HFUL 4L4VA 4I18A 1RJZB 3QDME 1RJCA 4M5YL 3FHAA 1SQ2N 4OCLC 3U2SA 1QFUL 1FPTH 3PQYB 1FNSL 2BC4A 3OXRA 1NCUA 5F89A 1UWXH 3DETC 1FNLA 5LWYH 1OAKH 3KLDA 1JWSB 5EFIA 1FL3B 3D39B 3CFJA 1XGYL 5DD3H 3TBTA 2P8LB 5LGJA 4QHKI 2VQUA 1CIDA 4NN5C 5C0AE 1GHFH 4NKDB 1PX3A 3CMOH 4NQDE 1B4JH 4KTDH 4NOBA 5EN2A 2DB8A 4KI5F 4ZFOB 4MXQD 4PRBA 1H8OA 4QO1A 5GGQH 1LO5A 4KJYB 4U0QB 1YEDB 4NZDA 2AP2A 3R06B 2VC2H 4PJIA 3D0VA 4ELMF 4PJ5B 5JQ6L 2Y25A 4N90D 1QQDB 1BFOA 5JOFB 2X9XA 5GRUH 4A2MA 1KTDA 5K9JH 4LGPB 2DQJH 4WU7A 1BGXL 2CIIB 3M45A 4C4KO 3GHEL 3L3GB 1ORQA 1RIUL 1BJ8A 3QIUA 3UX9B 2WBJB 3MRKB 3IDNB 4OIIL 1RZ8B 2D3VA 1Y0LB 1YMMA 3MV7D 1NMAH 3VJ6B 5HDQL 5BJTA 1T89A 4GKSB 4ZFZA 2OP4L 2X70B 1DR9A 2X9YA 4GSDL 5KS9A 4J7RA 1NFDE 4HG4J 1RK0A 3QHZL 2F53D 4EI5A 3WS3A 4PV9A 1E6OH 2QQKH 3RNKB 1DN2A 3HE7A 3RTQD 3GIZL 1QACA 1WTGT 4KZEL 2I07A 1KN2H 5IHUL 4TVPH 4V1DE 3FN3A 4WUKL 2W1NA 4FG6C 1FO0H 4PG2C 2F8VA 1EEUA 2R1WB 4NRXB 2NX5E 4WDIA 3KWWB 4L8DA 1ZT4B 5DT1L 2VLRE 4OD3H 4OM0H 3V6ZB 1JGLH 5CCKH 4QRPE 3TIDA 1X5FA 4K3EL 4YDIH 2P5ED 4Q0XH 3EJYC 3QA3A 4CNIB 2XA3A 3Q5TA 1N8ZB 1QHPA 4JRXA 3N1MC 1K3ZA 2ZOKA 5IBUB 3SQOL 1CLOH 1P4IL 5AZ2L 1U6AH 4PJHA 5ISZB 2G75B 1OAQH 2YKLH 3G5XA 4GMTL 4LDEB 2Y6SD 1DUZA 1N2RA 5HHXL 5EO9A 2NW2B 3DECA 5DD5L 3CVIH 4QCIA 4X6DA 4ZYKB 3VXMD 2IALA 2AJXL 4ZFGH 1NC2D 3HI1A 3DX8B 2YS4A 1CLYH 4HJGB 4YHIB 1CLCA 4TULH 4AG4H 1YEEL 5BOPA 3OPZL 3QUML 4HDIA 4YHYC 2Y5TA 4JZOB 5SWZA 3KGRA 4GXVH 4JCMA 1JNLL 3OJVC 2H26B 1AKJA 3A6BH 4PJAA 4HS3A 2XY1A 1VA9A 2J8UB 4KDWA 1G0YR 5HYFA 5MEND 1Q38A 1R5WB 5IG7B 2EIZB 4XXDA 3GMMA 2Y07H 3QDJD 1A2YA 1DBAL 3CSPA 2ATPB 5HHOA 2NYYC 1S7WA 5CGMA 1FYTE 2NCMA 1E4KA 1GGIL 2QQNH 2WMPA 4N8VA 4XBPB 5FK9A 3VFTB 3FB5A 3LOWA 4APQA 3SY0B 4Z7WA 5E5MA 5CIPH 1A4JA 1E4XL 4NJ9L 3KVQA 1Q0XH 3MGOA 1M05B 1MCJA 1E6JH 2E3VA 5DK2B 1B0GA 3T65B 2CQVA 4M3KB 4GS7C 5HDOA 4PJCE 2VXQL 1CICA 5DJ0A 2YN3A 1OQOA 3QWRD 1F13A 4YNYA 4YAQB 1RZIA 1JZ3A 4MA3A 3MRHB 4JM4H 1ZK9A 1UM6H 4TRPH 4NBYB 4BELD 3TA3B 1A7OL 3SKOB 3QEQB 5GZND 4YX2L 3D85A 5I1DB 2Y36L 5IWLC 3GDBA 3LQAH 3BYTA 1OL0A 1KCKA 1U91B 4H20L 3NH7H 5I76B 4WWKB 3MLZL 1P5VA 1LO0H 3Q5YA 4OZHB 1UB6A 3BZFB 1Y18A 4F8TA 5DEFB 4TVSa 1FVEB 5HGHB 4Y2DC 1BQLL 3H9SD 5DJCB 1I1AD 3IFLH 2CDEB 5D5MA 1INQA 2V7NB 4LF3A 4ZPVB 4XH2B 5GJTH 4HK0A 4KGJA 4UU9B 3TT3H 2P8PB 2KZWA 3N1GC 4F7CB 3V0WH 3O4LB 3B6SB 1F00I 5KVGL 3UDWA 5HPMA 1JP5A 2GY7B 2FO4A 4DK3A 4V2BA 3ARFB 4I5BA 2DQTL 4ZSOE 4PJ7A 1OSZB 4JO4H 4M8QA 4L3CB 2Z91A 4JFXA 2ZUXA 5ALBL 1I1RA 4YHYB 2D7MA 4BFIB 3BUYA 2K1MA 3GMPA 3TJEL 1UKTA 2IPKB 3FQNB 3R1GL 5KVEL 3QAZB 4RAUA 4TUOA 5FGBC 2DQFB 3OR6B 5F97E 4F7TA 3GKZA 4P49A 5IW6B 2AGJH 5H8DA 3K1KC 2JCCB 2M8XA 2XKNA 1PG7X 3CXHK 2AEQL 5LVEA 3VXTA 1FV1B 4AEIL 2H3NB 3QWQB 1YMHB 4MNQA 1RSFA 3JZ7A 4H1LH 3MFFB 5A40E 4PLJC 3HCVB 1UXWB 1VHPA 35C8H 1T5XA 4P23D 1W0VB 2IMNA 3ULSA 3DV6A 3G04A 2Q7NA 5IESL 1J5OH 4Z7UE 1RD6A 4DWHA 1F6AB 1AGCA 3EO0B 4RX4A 5B3JE 3SN6N 4U4BA 4U6XB 4EDWH 1H5BA 1T20A 3ULUE 2A9NH 3MV8D 3TV3L 5GGVL 3SDXB 3U9UB 1CYGA 3LSOB 4P2RE 3TNNA 3IS0X 3QEGL 4QRQB 3BT2L 5L9DH 5DC4B 2XWJA 4XNQB 1A1OA 3U9PH 1NGWB 2PYED 2QLVB 3SPVB 3MODH 3HFMH 1S7TA 3IKCB 5CSZA 1KG0A 3WV0A 1GZPB 3I9GH 2JIXD 5D7KD 5GS0D 3D0LA 4G7VH 4HMCA 5AG8A 4PY8J 4MZ3A 4CRPA 4F7MB 2IEPA 4KK9D 1UT9A 1VFAA 5CD3B 1U95A 2CDGB 1NBZA 1JMZA 3GEWB 3VXRB 5IM7A 3NIDF 3LEXA 5F1IA 4C58B 5B39G 3GI9L 4R7DA 3QUZA 4JPWH 3HG1D 2B1AL 2J5LB 3PL6D 2AXFB 4KJQC 1FNHA 2HKHH 4K3JL 1N7ML 4L3EE 4LLYB 4IJ3C 1RZJH 2EE6A 3O6KL 2DF3A 2GAZB 4OFVA 2Z4QA 4MAUH 1KJMA 5D2LB 1AO7E 2P49B 4E5XB 5D7SL 4NCDA 4M93B 4XAKD 1EAJA 2AJ3B 4M1CD 3D2UD 3JV4A 4MJID 1JTOA 2IF7A 2IAMA 1F2XK 2OXHA 3MSPA 4Y1AB 4RGMC 1ZMYA 4B7IA 2FZ3B 1KEMH 3IFOA 1QBML 3EYOB 5B4MD 2P48B 5JNYB 3QJFA 3UBXG 2JK5B 2VMFA 4JY6B 4POZC 3U7WL 4U1MB 3SCMC 1YY9D 4B5EA 5DA0B 3ARGC 3VGBA 1CFTA 5HGBB 4RDQF 1WZLA 2Z8SA 3F62A 5E8OA 1XGUB 2A1WH 1FG2A 5I15L 2BFVL 3GMLB 1CCZA 1UQSB 4QHUA 5I74C 5FOBB 3BGAA 1KPRA 1NLBL 1L6ZA 5JA9A 3LH2H 2L7JA 3NVQA 3PGFL 5KJRL 4G7YL 5DJYB 3RL2A 3MLUH 1SJVA 3ZE0E 2AVGA 3CK0H 1T66C 1MRFL 2OI9B 3FAWA 5L2KA 1TFHA 5DR5H 4J3TA 4TQEL 3OKEB 5K9KA 3TCLB 1KPUA 5BRZA 3V5KB 3VD7A 4WRLA 1OD7A 3PWLB 4XPFL 1T7WA 4NO3B 1SHMA 2QKIB 1MJ7H 2ADIA 4NFDA 4FTVB 2YPLD 5FGSA 3WSQH 3P11L 4PLKC 3ARQA 1M6OB 3HE6A 4OD2B 4NKIH 5DVMA 1F8TH 1C5BH 3OQ3B 1T0NB 1EEQA 4QHKJ 5BVJB 2Q76B 3ZKNC 2VH5L 1UWGL 3T2NL 3WD5L 1G9NL 3CDFA 5F71A 1A6WH 4NQEA 3SE8H 1S8DB 4F7PB 4A6YH 5D2NB 5JHLL 4NNYB 4URTB 3I75A 4Y7MA 1FP5A 3SGDI 3PXJA 1P2CB 4KQ3L 5F9DC 5C86A 3NN8B 5C09A 1EHNA 5FF6B 3U7YH 3MLSL 5D7LB 1SY6A 2Y06H 3HUJF 1I1FA 2J12B 3EFFB 5IROC 3T0AA 3U4BL 4PB9H 5E9DD 3MMEB 3JWDC 4TTGA 3UZEA 4ZDHB 1AGDA 1ZE3C 4OLUH 2OQJA 2VQTA 3EDDA 3QPQC 5JW4N 4RGMB 4PUBH 1IC7L 5KANI 5IFHL 1IBGL 2R1XB 2K9UA 3ILPA 1A1NB 2QADC 1AJ7L 4OF6A 4WCYL 5DJ6A 3LB6C 3ZT6A 4FQXB 3SGKA 2VDLL 3OGCB 3QH3B 5DMKA 1DTUA 4I18C 4HGWA 5EU6D 43CAB 3VH8A 3EOAA 3X13B 1TJIH 4I3RL 1BBJB 3KPRB 3W0WB 5AWNL 4HKBA 4GG6F 4DW2L 5TDNB 1G7PA 1A21A 1JPST 3V6FA 3C09C 5DEGA 4HK3J 3M1BB 2HJFB 1FZKA 1VACB 4FQ1L 4I0PD 2MPAL 4HGMA 3DXAA 4JRYD 3VXPA 3TBSA 2VWEE 5DQ9B 2LE9A 4JM2B 3RDTD 1G7QB 4HS8L 3B9VA 4KAQH 4LCIL 1XIWB 3QFDB 4M8VA 4P46C 3V4UH 4X7SL 4ORGB 1MQ8A 4JPIA 4LDLB 5C3LD 5F88A 5HHPA 1DLFH 3NACH 3KYOA 2NY0D 2CD0A 2A0LD 4N0UA 1RFDH 1F4YH 1T03L 4ODTL 4FQJL 4QXUL 5IB4A 4X6BA 3OZ9H 1K2DA 1I8KA 5GRJH 2C9AA 3IXAA 1EZVY 3PQYE 5E00A 3QQ9C 1WFUA 2G5BA 2CH8A 4CADA 1OAKL 1T2JA 4OFYA 1XGRA 3D39E 1T89C 2EYTB 5GGSB 3WNMA 2ENYA 1CE1L 5EOTB 3SE9L 1EHLH 4HWBA 3DI3B 3EYSH 1RV6X 2G60L 2IC2A 3CMOL 3MA7B 4GW1A 5E7FA 4EI5C 4KTDL 4X6EB 2A6JA 3KS0J 3OSKA 3RUGA 5GGQL 3QDGB 2IGFL 1JHKL 5F7HA 5IMLB 4E41A 3W5NA 4LQFH 5A2KH 3E3QE 4XB8A 4PRAB 1MCOH 2V9TA 3R4DA 3D3VD 1P7QA 3UZVB 1RJLB 1TVHB 2X1PA 4R8WH 2ICWI 2Q20A 3ZTNH 4UBDC 2NY4C 2AXHA 5SX5K 1OTUC 1A8JH 2VLKD 1HH9B 4P5MB 4HIJA 1S5IH 4PJDF 1NMAL 1JF5A 3IJYB 5I8OL 3MREA 1QSEB 3SO5A 1B3JA 1GC1H 5L8KB 3TZVD 4L4VB 4I18B 1ZGLM 3LHPH 1RHHA 4F37K 1EA9C 3LS4L 5DA4A 4PJBA 3U2SB 1IZKA 2BC4B 3OXRB 5FYKD 1N6QL 5F89B 1ZLUK 1OGAD 3C09B 2R0ZL 5EFIB 2IFFH 3CFJB 2VB5A 1FLRH 4NZJA 5D1ZA 4OLZH 3TBTB 3QFJD 2P45B 3PV7A 4HZAA 5LGJB 1KN2L 5JW3L 3TBYA 1MWAH 5F9OH 1FO0L 5GRZA 5EN2B 2L0DA 3CH1B 5CJOL 4PRBB 2FX9L 1BVZA 1LO5B 3FOLA 1PSKL 3CC5A 3PDOA 4FQHA 4ONGL 4MD4A 4I9WE 3DROA 4G6JL 4PJIB 2LABA 5CCKL 3D0VB 1A7QH 2GTZA 1BFOB 3NIFF 1KTDB 3H7BB 4WU7B 4B7LA 3HPLA 5EU7C 5FUOL 1ORQB 3MZGB 5MEQA 3QIUB 3W11D 4JO1L 5FIEA 4S1SH 2GFBA 1YMMB 5EA0H 1U6AL 4K3GA 1TPXC 1T2QL 5I0ZA 5BJTB 1BFTA 1MLBA 4P2CG 4QRSA 5I8KL 4ZFZB 5KS9B 5GRWA 4D0DA 3CVIL 1RK0B 4F57L 4EI5B 4ZFGL 3WS3B 4PV9B 4KKLC 4LPUA 1YEFH 3HE7B 4U0RC 2ZWLT 4AG4L 1CR9H 1MHCA 3QR2A 1J0ZA 2R8SL 2I07B 1FAKT 4GXVL 2DDQL 1W72H 5C08D 4C57C 3A6BL 3TPKA 1B88A 2J8UE 4WDIB 5GGRA 3R0NA 4MGXA 12E8H 1I3RA 4L8DB 4OCRL 2NY4B 3UJJH 3ARYA 4KRPB 4YHMH 1UWXK 5EBWA 3TIDB 4LPCA 3MOAL 4PJGE 5IOPA 1CBVL 3LMJL 1NJ9A 3QA3B 3ZO0A 2OM5A 4JVUA 2PR4H 5C92A 4M5ZL 1WUNT 3NA4A 4JRXB 5C1MB 3I2CH 2ZOKB 1Q0XL 2BSSA 4HD9A 2DD8H 4PJHB 3LEYH 2R0WH 3SDCA 4N0CD 1NC4A 2HFFA 3G5XB 1DUZB 4R6UA 1C7SA 1I9JL 1N2RB 3OJDA 5DJXA 4R2GB 4G6MH 5EO9B 1JNJA 3MCLH 3VFNA 4QCIB 3QIBD 4X6DB 4Y8AA 4JM4L 2IALB 4WW2F 5I8CA 4XPTL 3HI1B 5C0FA 4TRPL 1HILA 1RULH 3QEQE 3R0MA 5JIKA 5D96C 3BD4A 4LSPH 4MMXC 5E70A 4HDIB 2Y5TB 2IG2L 5SWZB 3LQAL 3UCRA 3E6HA 2VR5A 3FO0H 1AKJB 1H8SA 4PJAB 4HS3B 5EC1A 3THMH 1BOYA 2X44D 4XXDB 1QFWL 3BP7A 3IFLL 3GMMB 1PQZA 1A2YB 5GJTL 5HHOB 1S7WB 2XZCH 2W59A 2J6EA 3LRGA 1TPXB 1JI1A 3O4LE 3V0WL 5F6IC 4N8VB 5FK9B 1ITBB 3FB5B 4APQB 3QNXA 5T1KA 4CVXA 4Z7WB 5E5MB 1A4JB 3UPRA 1LDPL 4ODWA 1LO3H 1LEKA 4Z0BH 3QXVA 3MGOB 5ANME 4BQ9A 1B0GB 1MH5A 2B2XH 4UUJA 5DLMH 5HGDB 1CICB 3P9LA 2IBGA 5DJ0B 4KI5D 1H5BC 4YNYB 1U3HC 4XPGL 2NY2C 1C12A 1RZIB 4MA3B 1ZLSL 3QCTL 1NL0L 3WNOA 4Z5RA 3TJHD 1EBPA 4X4YA 4ALAH 4K23H 1CDCA 3FFCA 2AGJL 4KROC 3MFGB 3Q48A 3D85B 3ZT5A 1FC1A 1HWGB 5J56B 3WNKA 3GO1L 5HDBF 5GSVA 2AXGA 1UB6B 1Y18B 2VXUH 2P47B 1PLGH 2Y72A 2ZJSL 2Y9RT 4J6RH 1KBGH 3RY4A 1R3IL 4X6CF 35C8L 3U4AA 3VDBA 2FHFA 5D5MB 1INQB 5IBLD 2UWEE 4LF3B 4X7FC 3O6FD 4HK0B 1D9KC 4CMHB 5GIRA 5FO9A 4O00A 1DANT 1JYNA 1QSFE 3N50A 4EDWL 5HPMB 2FO4B 1CGVA 4YE4H 4I5BB 4P59H 4JDTL 4PJ7B 2I60H 1BIIA 4J23A 4M8QB 3QEUA 3O6LH 2Z91B 4JFXB 1B0WA 2CR3A 2DQGL 3RZCC 2IAMC 5IVZA 3VXSA 3BUYB 3GMPB 3BDBA 3FZUD 2P5WD 4M1DH 1K4CA 4TUOB 4X4ZA 4F7TB 1WZKA 4FS0A 1A7NH 3UC0H 2XKNB 4H1LG 1J11A 3WIFA 3VXTB 1X3DA 4JPWL 4RFOL 4MB3A 4DZBA 4G9DA 2NMSA 2HKHL 4MNQB 5TF1L 3PE9A 4JFZH 4OGAC 1MCRA 3JV5A 1T5XB 5D2LE 3EHBC 3ULSB 1DVFA 2XT1B 3DV6B 3G04B 3PWVA 1AGCB 4OM1L 1DQLH 1H3TA 1AY1H 1H5BB 1T20B 3MLRH 5DEZA 2NY2B 2ZSVA 1Z2KA 2AJSL 3BOVA 1KEML 2GHWB 3O2DL 3TNNB 4JVPA 3W9DA 2XWJB 1EO8L 3TT1H 1A1OB 5B38A 1UYWH 2VSDA 3L5XL 1MRCL 4YFEA 1S7TB 5CSZB 1KG0B 5AEAA 3HE6C 4BFGA 3IDGA 3D0LB 1TJHH 2F8XC 4LU5L 1VFAB 3I3DA 3WFCH 1U95B 1NBZB 5IM7B 2XWTA 3LEXB 5F1IB 5CEYA 1S9KC 4TVPE 4F9PA 1IZJA 4R7DB 3QUZB 3NZHL 5FO7A 3SEPA 1MCEA 3GRWL 1TTFA 3RVTD 4G6FD 3P2TA 1I9EA 3MRQA 4H0GA 5DR5L 3B9KA 5DJDA 2ARJQ 2Z4QB 1OWRM 2V7HA 5D72L 1KJMB 2BNRD 3GSQA 1L9MA 1R0AH 1MAMH 1MJ7L 4J1UA 2XN9D 3KXFE 3JV4B 3U83A 3SOBH 4RMTA 2IAMB 4P2QE 1IAIH 2V2XA 3N9GL 2D03L 4LARL 1BM3H 4RA3A 4O02H 3IFOB 3RWDA 1F8TL 1C5BL 2VDML 2B5IB 3QJFB 5J8OA 1NGXA 1DQDL 1MSPA 4XPBH 4FQIH 3VW3L 1UZ6E 4GT7A 1A6WL 1CFTB 1IVLA 4HIIA 4KTEH 1KXTB 1TVDA 4MB4A 5D2NE 5E8OB 1FG2B 5DO2C 2RGSA 4QHUB 1T0PB 5ENWA 2LTQC 3TYFA 1KPRB 5D7LE 3T0EA 2Y06L 5LAXA 1EHXA 3BQUD 3RL2B 1U3ZA 2ICWJ 4PB9L 1C1EH 4XBEL 4R4ND 3WEXA 4QXGH 3CFCH 5L2KB 5K9KB 1KPUB 2YA0A 2EXWC 5BVPH 5BRZB 1P6AB 2MCPH 4JN2A 2Y1VA 1JRHL 2GSIA 2EIBA 2ADIB 1A7PH 2FYYA 3ARPA 5FKPA 1DE4A 4LP5A 4LVHC 1RZKL 3HE6B 4D3CH 2FEEL 2WSKA 2E6QA 1NGQL 1OT1A 3KPRE 4B41A 4HIHB 1K6QH 5IGXH 1CLZH 3F58H 3QB7C 3QUYD 1MCHA 5JOPD 4NQEB 2V2TA 2P46B 3T2PA 3I75B 4X5XA 3H7LA 1YYML 3GMOA 4PGZA 4WI8A 4L8CA 4YXLL 2EH8L 5C09B 2ITCA 3W39A 5F6HI 4MVBC 2V5YA 1S7QA 5K9QI 4XVUC 1I1FB 2V5MA 4I77H 1JPSH 4BUHA 2PYFA 1FVDA 5IK3A 2A6KA 2ADGA 4RGNC 1AGDB 3BUTA 4F15B 2XQYK 2OMNA 4LSDA 2OQJB 4R96A 3VG0L 5HHQA 3AREA 1RFDL 3OB0H 4FQPA 3ARDC 1MF2H 1BREA 3ILPB 5DVNA 5DJ6B 1YNLH 2CK2A 1MELA 2EDOA 4GW5A 5GSRA 3NCMA 5IVXA 5DMKB 3D48R 3O6MH 4OFIA 2OK0L 4DQOL 1FZMA 4HGWB 2YUWA 3VH8B 3MO1A 1XF1A 3D1MC 3EOAB 1J1OL 5C0DA 2LTQB 3MUGA 2R1YA 4HKBB 1INDH 4KRNA 3S8WA 2CJUL 1G7PB 2FJGA 4WENB 3V6FB 5DEGB 1HCFX 2FD6H 3G5ZA 4RRPG 5BV7H 5DMYA 3AY4A 4ERSH 1FZKB 3J7HA 4LQFL 3DXAB 3VG9B 3C6LC 3VXPB 5C0BD 3FCTA 3TBSB 1OTTC 4UV7L 4F80A 1BPVA 4K8RH 2BNQE 1S3KH 5EWIH 3ZTNL 1JNNH 5GHWH 2YPVH 4JPIB 3LY6A 3GSWA 5CHNA 5F88B 5I1JL 4G6KH 4BH7A 4FABH 4HXAH 5HHPB 3KYOB 5DVLA 2DQIL 5MP6H 4N0UB 4ETQA 2X10A 4R4FH 4L4VE 2YOCA 5IB4B 4X6BB 1T83A 3GSNL 3K2UL 1K2DB 3IJHA 4HCRA 1I8KB 3IXAB 1DANU 4NO2A 3BSZH 2X5PA 5E00B 4GXUN 3MLPA 3SGEH 3O4OC 4CADB 2ZUSA 1X6LA 2A73A 4DCQA 4DN3L 1XGRB 1CDHA 4L8SA 1Q9KA 4E42A 3KR3H 4DUWA 2BVTA 5C9KA 3EOYG 3HC4L 4FMKA 4WHDA 4GW1B 3MPCA 2A6JB 4KK6C 2YD4A 3RUGB 2A0LC 1KJVA 4YHOH 4OF0A 5D7JD 2DJ4A 2R4SL 4E41B 4RGNB 1BQUA 1A7QL 5DMIL 3FN0H 4K55A 3F12A 3CFBA 1P7QB 4HK3N 4XVTL 1KNOA 4LCCA 1II4E 4D9RE 3S4SA 1KGCE 4NQCD 4I2XA 3ZHDA 5FYLH 4FZ8H 5I16A 4HIJB 5SWSE 5EA0L 3MREB 4X9HA 2UY7A 2PETA 1RHHB 3T3MF 5KS9E 1UM5H 4RNRA 4PJBB 3EW3B 2ZCLL 4PGBA 4UNUA 1A7RL 2HFGH 3SDCC 5IKCA 1ZHNA 1WFTA 1OAUL 1BJ1J 4WFGE 3AGVA 5D1ZB 5H35A 5E95B 4X5WA 3TBYB 1W72L 3RBGA 3O11A 1AGFA 1MCBA 1HI6A 1F58H 3ZDXF 5A1AA 4L4JA 2G9HA 1MI5A 2DJSA 5C0EA 1I9RH 3FOLB 3CC5B 3PDOB 1PYWA 3QO1A 4FQHB 5JXAL 3ZYJA 4MD4B 2X4UA 1WAAF 3DROB 5JOEA 3UAJD 4QRRA 2GTZB 1RUKH 4KI1A 1KLFA 1M1SA 1VADA 1TQCB 5TQ2L 2BVPA 1FVCA 3REWA 3CX2A 3I50L 3HZKA 2PR4L 5MEQB 1NCAL 1RZGA 2YMXL 3O8XC 5TE6H 1NAKH 4LP4A 2KBGA 2GFBB 4M7JH 2DD8L 3ETBF 2R0WL 1GGTA 4HUKB 4K2UH 1MLBB 2VIRA 4QRSB 3WHXA 3IFNH 1F4AA 2VDRH 5GRYA 3IDMA 4HC1L 4D0DB 1FC2D 1CXFA 1A5FH 4KKCC 2DIJA 3OJ2C 1E4WH 4QRUA 2OL3A 1MHCB 1AGBA 3K81A 3WUWA 2E7CA 3UYRH 4OZIE 2FGWL 3UO1H 1RUQL 1VFUA 3FO0L 1SVCP 4PJAE 4KHXL 4AM0A 3RTQA 2ZG3A 3TN0D 2XKSA 2WLYA 5GGRB 4U6VL 3S3SA 1E4XI 4NQUA 4LAQL 3VGEA 4FN0A 1I3RB 3C5ZA 2WUCH 2EDKA 5TPWH 2PO6D 2DQEL 3QG6A 1QR4A 5EBWB 4J12A 4WFHE 5HHOE 4KUZL 2HMID 4WUUA 3BWUC 3NGBC 4OLXH 2DQUL 4Z7NE 5IOPB 1CK0L 1T1ZA 3DVGA 4LRIA 3L95A 1NJ9B 3ECBA 2WV3A 4U7MA 2E7HA 3EYUL 4Z7WE 4WTZG 4Y5YC 4OV5A 4N5ED 2N7AA 4O5LL 1LO3L 5DFTA 2BSSB 2R23A 5IEHA 2P5EA 2DLIA 3FKUS 3VI4F 3UTSB 4BK5A 4HWNA 3SDCB 1MCWM 2B2XL 3KDMA 1NC4B 2HFFB 3RNQA 2BY2A 3OJDB 5DJXB 2DM2A 1FRGH 5ICZA 3VFNB 3DI2B 2X4SA 1B90A 1IC5L 1L9NA 5I8CB 4YUEL 5C0FB 3QT2A 1MHHA 1TENA 2E7MA 4P3DA 1HILB 1EAPA 2YWYA 3NIGF 4XNMA 2MKLC 1OWWA 4PIRF 4LCYA 3RX5A 3BZEB 3E6HB 4N5UA 3X3FL 2RJMA 1UJ3A 5EC1B 2NQCA 1PZ5A 2F54D 4XPHH 1OSPL 1PLGL 3B9EA 2VNCA 4N0CC 3BP7B 5D5ME 4O9HH 2UZYB 1PQZB 4NPYA 3T4AA 3BN9C 5C70A 4JFFD 3VGHA 1ACYH 5ALCL 4CVZA 2IAND 1IGYA 3QNXB 4HUUA 3VXUA 4GJTB 4KRMB 4XPAL 5T1KB 3NTCH 4CVXB 1NEZG 3WCYA 3UPRB 2XTJC 4LEXL 4LHUG 2ARWA 1LEKB 4ODWB 2W60A 4PJ7E 3ALPA 2I60L 1FL6A 3O9WC 4M61A 1MH5B 1SJXA 4UUJB 3B2UC 3V6OC 3P9LB 3BVNA 2O5XL 1QRNA 1AQKH 3N85H 1C12B 1TETH 2R0KH 4DGYL 1FDLH 4Z5RB 5C07E 4X4YB 2CLZA 4XCNA 1FQ9C 4JQXA 1A7NL 3FFCB 4Z7QE 4LOUC 4YHZH 5C0CE 3JWOH 4PJ8D 5JZ7D 4HG4K 1IM9A 5HI4D 3ZMRA 5CSGA 5GSVB 4CN1A 3NGBB 4DKAA 2AXGB 4JREC 4MNQE 5JDSA 1FGNH 1MIEL 5ETUA 1UA6L 1OM3H 1CFQA 4XAWH 2VZOA 3AVEA 4DEPB 4F9PC 4OFKA 4OQTA 4OZHF 2CKBH 4D0CA 3U0WH 4JFHD 4N0YL 5GZOC 5GIRB 5FO9B 3MUHL 3TJHC 5JLZA 4IMKA 3B9KC 3UBXI 3E2HB 5J7CC 3MLRL 2R29L 4WU5A 3QRFM 3QDMD 3BO8A 1X9QA 1WIPA 1BIIB 4G8GE 5HY9A 3UTPE 3QEUB 4UT7H 4FFVD 2NNAA 3VWKD 4OF5A 4UDUA 5ERWA 4C54A 2PNDA 3VI3F 4GRLD 5IVZB 3VXSB 3WKMH 1IGCH 2G5RA 5IF0A 2AK4A 1K4CB 3Q6GL 5IBUG 1MPAL 2UZIH 3RIAF 1ZGLA 2NXYC 5F6HJ 4BQCA 3WIFB 4EXPX 4FXLA 4U1IA 4LBEA 4G6AD 1KJ2H 2ID5A 4DZBB 2WIMA 1EDQA 1D5XA 4G9DB 4OGXH 3STBA 2JCCF 2QEJA 4L4TA 1NBVH 1Z5LA 1NLDL 5DMGC 1YEKH 2WLZA 4LFHG 5HVHB 2ICEA 1DVFB 2XTJB 3OKMA 5C3TA 3PWVB 2VN4A 4XCYA 1INEH 5DWUH 5E99L 4GUPA 1F4WH 4HBCH 1WQVT 1IAIL 3D18A 4IBLT 4P4KD 3BN3B 2ZSVB 4O02L 1X5HA 3G6JE 3W9DB 1HKLH 3L5HA 4XPBL 5B38B 2R2HA 3OV6A 5F7YC 3U4EA 3SDXF 1S78D 1HKFA 2UZXB 3AFLA 4EJ1C 3IDGB 4Q9QH 2WWMC 4V1DD 4JREB 9CGTA 4RIRA 2XWTB 3RVWD 5JXEA 5CEYB 3HNVL 4B53A 8FABA 2EH7H 1V05A 3ULVC 1QFOA 2VLRD 3BIAX 1C1EL 5I8EA 5FO7B 1BVLA 4QXGL 3GHBL 4LSUL 3MRQB 1SBBA 2NZIA 3B9KB 1JGEA 4KXZH 3HNTH 5DJDB 2MCPL 4U6TA 3UTTD 2V7HB 2GTWA 2P42B 3HG1A 2R4RH 3GSQB 2X4TA 2VQ1A 3O3AA 2ZNWA 5H94A 1A7PL 2HT4C 4JFDE 3HMXA 4J1UB 5FYJE 3OL2A 5HSFA 4KUCD 1SMAA 5CEZE 3AREC 4HIXH 2V2XB 3BI9X 3KNBA 3RWDB 3CX5K 1P7HL 4MJIA 1K6QL 1NGXB 1FIGH 2D0FA 3WFEH 1CLZL 2WQRA 4LSTH 2GJ6E 2BCKA 4HT1L 2NXYB 4HIIB 3BDXA 3RI5F 5ADOL 1TZHA 3FB6A 4JANA 1OCWH 4UINH 5ENWB 3TYFB 3RVXC 2RCSL 5E8DH 3T0EB 4WHYH 5LAXB 2OSLA 4LPXA 4I77L 4U7SA 3DV4A 2LU4A 4I0KA 1FORL 3GZKA 5C0AA 4PREA 4PBVC 3WEXB 5T3ZL 4NQDA 4NM8H 5E1AA 1UM4H 4QTIL 2Y4SA 1MF2L 4JN2B 4LPWA 2P8MA 2GSIB 3K8LA 4Y4FD 3MA9H 2FYYB 1UEMA 1YNLL 1DE4B 5FKPB 1NAMH 3C2AL 4EDXA 3QXUA 1EGJA 1FSKC 3U6RA 1F6LL 3O81A 3T1FA 1LQSR 3AROA 1T83C 4JO2L 4PJEF 2YPLA 3RHWF 1X5XA 2O5YL 5EOCH 2Z31A 2HLAB 4PYGA 3ZKXC 2ZSWA 2O93L 3Q2CA 4O51A 5KSBF 2R2BA 4NC1E 2FBOJ 2V2TB 3ARSA 4LCWD 1FBIL 3NBNA 3EDFA 4X5XB 4QNPE 1L7IL 1NFDA 3GMOB 2P24A 3GBLA 4MX7B 4L8CB 1EVUA 2AJVH 2ITCB 3W39B 2C5DC 1S7QB 4K8RL 3ROOA 3SJVE 2PYFB 4FA8A 1FVDB 1NSNH 5IK3B 4Z7VE 3IDJA 4LVOB 2QSTA 2A6KB 2ADGB 4G6KL 1UCBL 5KVMC 1P9MA 5MP6L 4N0UE 5HHQB 4R96B 3AREB 2NX5A 4PTTA 1RQ5A 5IQ7H 4LIQH 2QSCL 4FHBD 2K7QA 4TTDC 5JPMA 2VDKH 3CFKA 4QRPA 3BH9A 1B0RA 4Z7OE 2VSCA 3MLWH 4GW5B 5GSRB 5GRXG 5IVXB 1JPFA 1G7IA 1FZMB 4RMQA 4O2FA 3MO1B 4JQVC 2AK1L 5C0DB 1RZFL 4ISVA 3MUGB 2XZQH 1FFOA 2R1YB 1A6TA 4ZMAT 2FJGB 3RUGE 1IC1A 2YSSA 3V95A 3AS0A 4YHOL 3G5ZB 1ULVA 4O58H 1M7DA 4TSAL 2QQQA 1PW3A 4E41E 1IQWH 4DAGH 1WBXA 4IOFC 2E9BA 5EZJA 3FCTB 5DD1H 4YK4B 1YNKH 3GJFA 5AUMA 3WIHA 1FNGA 3GSWB 4JRYA 5CHNB 2X9WA 1I7TA 1FNEA 1KB5A 4BH7B 2EEAA 5C6TH 5I1EL 2OBGA 2LV4A 4OQ1A 4ETQB 1FSKB 1BBDL 4QY8A 1K8IA 1HSAA 3VD4A 3C6SA 3DMMA 3IJHB 4ZS7L 4NO2B 2YD5A 1S9YA 5E5RB 4POYA 1Q72L 3B4NA 1FYTA 3ZKXB 2HFGL 4JPKL 2A73B 4DCQB 3U79A 1JHLH 5KSAD 4L8SB 1Q9KB 4E42B 1LE5A 5FUCC 3VRLE 3L7FA 1SBSH 4BQ8A 1G6RH 3OB0K 5B8CA 3NAAH 5LBSH 1F58L 1Q9WA 2BNUA 3FONA 1A9EA 5I6XC 4OZGE 1KJVB 1URLA 1H0DA 3S36L 4R97B 3B8SA 1MEXL 3NCBB 5D70H 4LGSB 3S35H 2A77H 2QQLH 3F12B 4BM7A 2VN7A 4YFDB 3CFBB 3QHFL 1KNOB 1REIA 4LCCB 3S4SB 1CS6A 3C5ZC 1VCAA 2ZUTA 1QFWM 5C0RL 3ARVA 4I2XB 4UTBH 5I16B 5GGSY 1I8MA 3ZE1E 3QIWD 4QWWC 2FX7L 4K2UL 1EK3A 2E7LA 2X7LA 2JJWA 3IFNL 4NRYA 3JUYA 1XF4A 3CLFH 2VLKA 1D6EA 4PJXE 1IGFL 4RNRB 3UJIH 4KV5F 1YC8A 4PGBB 3WXVH 4EXKA 3OX8A 4FNLH 5IKCB 2BSTA 1ZHNB 2IJ0C 3ZDYE 3RI5K 3S5LG 4NNPH 5IP4A 1KELH 5H35B 2JTDA 3KLAA 3UYRL 5GS0H 1MLCA 4U7KA 3MOBL 3O11B 1AGFB 5DZOA 1HI6B 1NCBL 5LGHH 3LN9A 4UTAH 1HOCA 2G9HB 4WI6A 1MI5B 5C0EB 4OZFA 1H3XA 1ETZB 4YDLC 3QO1B 1PYWB 5I75C 2X4UB 4JAMB 3C2SA 4U3XA 5FM4A 4QRRB 4JPVL 2XXCB 1YEGH 2AABL 2ZUQC 2BY3A 3H3KA 1VADB 1HIMH 2BVPB 3HMXH 3X14A 1FVCB 3REWB 4PJIF 3VGAC 3HZKB 4JR9H 2Z8WC 4PP1D 1RZGB 3WO4B 3CAFA 2MFNA 3UTSE 2DI7A 4Q9RH 1PKQA 2VIRB 3WHXB 5FYKU 1TTUA 2VISA 4ACPA 1BLNA 4M7ZC 1BJ1H 1FRGL 1F42A 1MCKA 3JWDL 3IDMB 2EDDA 2HAZA 4Z7UA 2BY0A 4HF5L 4X7DC 3DX7A 1TQBB 2YD8A 1QFWI 2DLGA 4JY5L 3Q1SL 4QRUB 2OL3B 1QZ1A 5DQDH 1AGBB 3WUWB 4HSQA 1A22B 1DQQA 1MY5A 3SDDA 4P2RA 2NR6D 1HHHA 4FXKA 4AM0B 1ZVHA 1A6ZA 4U1KA 3RTQB 1A6UH 3C5ZB 4KMLB 4XVSL 1OP9A 4O9HL 2X1QA 3RVUC 4TSBH 3QG6B 1X6NA 1E4JA 1JWUA 3VFPA 4U1LA 4HPYH 4WUUB 3VXNA 2UV3A 2N7BA 5HXMA 5ELIA 4NSKA 1T1ZB 3DVGB 2OJEA 3L95B 3ECBB 3I6LE 4M4RA 3NTCL 2FR4A 1EGJH 4Y4HD 4YR6A 5BW7C 3F7RA 4XNZC 2BHZA 2R23B 5IEHB 2P5EB 1I3UA 2B0SH 4MYWB 3KDMB 4L3EA 2NY3C 3RNQB 3BRGC 4QXTA 3DGGA 5ICZB 1RIVH 1AO7A 1H9VA 2X4SB 3N85L 4PJHF 4JG1H 3SE3C 1BFVL 4JGUA 1MHHB 4OCWH 4PR5A 4P3DB 3TM6A 4UT6L 1EAPB 1R3HA 4XNMB 4YHZL 4X6DF 5BS0E 3JWOL 3QIBA 4M03A 5EULV 4LCYB 4GRWB 4KY1H 3M07A 3KLHD 5JHDD 2JLLA 1UJ3B 5E5UB 4M6NH 4MD0A 4WEMB 4WI7A 1PZ5B 5F44A 4GBXA 4PBWD 1OM3L 5A2JH 2C3VA 5EUOE 1YJDH 1WZMA 4NPYB 3T4AB 1N64H 3HNSH 3JTTA 5DRXA 1YNTA 3EO9H 3ZYZA 3OMZA 3BP6A 4CVZB 1IGYB 4HUUB 3VXUB 1YEIH 2OR9H 1BZ7A 4MXVF 3EOTH 5IR1A 1IGJA 2BX5A 2W60B 3C8HA 3TVMD 1FL6B 5BQ7B 4DKEH 5C7XH 4M61B 4UT7L 1T1WB 1EERB 3BDYH 5EU3A 1DBBH 4MQ7A 2J8OA 4ODXA 1EVTC 3WKML 1IGCL 3BVNB 4P9HC 1QRNB 4XC1H 2XFXA 2IPTL 4NYLA 5KTEH 3ZKSD 2CLZB 1S7RB 2UZIL 3H0TA 4XCNB 1MCSA 4P3WA 1J10A 4JG0H 4JDZB 5C0GA 5L7XH 5CJQL 2OTWA 1IM9B 3P4LA 2WW8A 4HWEL 4MS8D 1CN4A 2UVEA 3RVVD 1KYOJ 1KJ2L 4OCMC 1M7XA 4PJ5D 2W65A 4ELMA 5JDSB 2EXYC 1Q1JL 5ETUB 5E2WH 4K9EH 3IRZA 5JXEC 1CFQB 1YEKL 5JW4R 4XCFH 2J88L 2AJUL 5E6YA 1JZ5A 4XNZB 4D0CB 2OMBA 4X9BA 3U82B 1MAKA 3INUH 5JLZB 2ZG2A 2NY3B 3QUMA 1F4WL 4QYOA 4NJAL 1OGTB 4G5ZH 4ELKA 2SEBA 5FYLE 4HAFA 3WDJA 3O6FA 1KTKE 4QXWA 3GMRA 4WU5B 5CZKA 5JZ7C 4W68A 2BP3A 5HY9B 5JR1L 2I5YH 3VA6A 4Q97A 2NNAB 3EO1A 4KHTH 4UDUB 5ERWB 1J1XH 1YPZB 5DSCA 3T2QA 5D1XA 5FUZH 5B3NA 1AD9A 1MHPH 3MBEC 4BUGA 5IF0B 2AK4B 3GJEA 7FABH 1AI1L 1RVFL 4PRPA 3DARA 3UPAA 2BSRA 4Q9QL 4JO3L 2GI7A 1L4IA 2NPLX 1J12A 1F90H 3ZYOA 3LD8C 1ZGLB 2M2DA 1J1PH 1KCSH 3RGVC 1GVIA 5EPMA 3N1PC 4ODVH 1YYLH 1S5HA 5I18L 3S7GA 1MOEA 4I9WD 3RJDA 3LZFH 4F2MB 4U1IB 1NH6A 4LBEB 4NHUA 4ENED 1D5XB 5EBLA 4FFVC 4J3WA 4L4TB 5F96H 1Z5LB 1ZWIA 5SWQA 2VXSL 1R24A 1RUAH 2FEDC 3LPGA 2ICEB 2R4RL 3MRJA 1CQYA 1B6UA 5IBTL 3OKMB 4I3SL 2XG5A 4XCYB 3DETD 5J11C 1BD2D 3CSBA 5ISZD 4GUPB 3SE4C 4O2EA 5ILTH 3D18B 3GSOA 3N1QC 5HVGB 3CFDA 4EOWH 2ORBH 3GM8A 2C1OA 1VEOA 5J4MA 2R2HB 4N8CL 3WFEL 4ZPTA 5FYKH 4Q6IA 4Y0GA 3IT8D 1RUMH 3U4EB 4FFWC 3QI9A 4OLVH 4TNWF 4LFHD 5DS8A 4WIQA 3SHSA 3WJJA 2BVUA 5F7DA 3KPLA 4KGLA 5EZOH 2DI9A 5I1GL 3UMTA 3P0VH 4KVCL 4GLRI 1E28A 2HRPL 4GRMA 4RIRB 3T0EE 5MHSE 1CDGA 4KMTH 5F9JA 8FABB 3BE1L 3QXDA 1IAMA 2YD2A 5I8EB 5DD0L 2GK0A 1BVLB 4H88H 2FEEI 1UM4L 3VD3A 5K59F 4RGOH 3PWUA 2B7DT 1JGEB 4XNUL 1JGUL 4PS4H 3RWFA 2GTWB 3HG1B 5FEBA 2X4TB 5DUBA 2VQ1B 3O3AB 3VWJA 1IEHA 3K74B 2H6PA 5H94B 4OTXH 3WNLA 2VDPL 3AS2A 1UWEH 1Z9OA 4Z9KB 4WFFE 3KNBB 1QTYT 1ZOXA 4FG6D 2VAJA 4MJIB 5EOCL 1NUGA 3IU4L 3BGFB 3LD8B 4NBXB 2BCKB 2QHLA 5B39A 4WHYG 3L3IA 5DRWA 4HFUH 2Q8AH 4M5YH 5EH1A 1TZHB 3FB6B 4WWKD 4JANB 1MCLA 1QFUH 1FNSH 3IAPA 1O0VA 1IM3A 3FQXA 2OSLB 4JCLA 1KTLA 2VR4A 1XGYH 3DV4B 5T3XL 1BZQK 4S2SA 5LXGH 5C0AB 4PREB 3RU8L 2ZPKL 5J11B 4NQDB 4OF7A 3VFOA 5E1AB 2H8PA 2DQCL 3O4LD 4X5LA 3BQUA 2BDNH 1LVEA 1KTRL 2LU3A 4LIQL 3UBXA 2P8MB 1ODAA 5CBEA 2VDKL 3VFRA 1MFBL 1K5NA 1C16A 3MLWL 1CGSL 4AIOA 1BGXH 4EDXB 3U6RB 1J8HA 2VZUA 2ZP0T 3T1FB 3WLWC 3DMMC 3GHEH 2VLME 2YPLB 2XACC 2Z31B 1CL7L 1DN0A 3DWTA 5HDQH 4HEPG 2ZSWB 4M4PA 3PUCA 4O51B 4X7TA 1DLHA 2R2BB 5I19L 4GSDH 3LN5A 1V3LA 4ZXBA 4DAGL 1NFDB 5EG6C 2NYYD 2P24B 4YJZL 4XP9L 3GNMH 3GSRA 5F3HA 2BXZA 1YNKL 1UENA 3ROOB 4HAGA 5ESQA 4AEFA 5HHME 3GIZH 3ZE2F 4KZEH 5IHUH 3IDJB 3CSYA 1UEYA 4WUKH 5C6TL 5I1AA 2HJKA 2HKFL 2YHGA 3PWPD 1VFOA 1DFBL 2NX5B 1W8OA 4PTTB 2YR3A 5CJXA 1WVZA 5DT1H 4EEEA 5F7KC 5JPMB 4FOMA 3CFKB 4X0KA 3ARUA 4QRPB 4K3EH 1B0RB 5T3ZD 5CKAA 4PJGA 4HMDA 4ZOAA 5TGBA 1JHLL 5ICXA 1JPFB 5GGTH 1G7IB 3D6GA 4GMSL 4O2FB 2KPNA 3NAAL 5LBSL 3OF6D 4ISVB 3KPPA 1FFOB 1A6TB 3VXRD 3QDAA 1FFQA 2YSSB 1OT2A 2DYPA 1ERNA 1M7DB 5HHXH 5KAQF 4FQLL 3UEZA 2NY5C 5DD5H 1WBXB 4BQBA 5HPOA 1ED3A 4IMLA 1Q94A 2AJXH 3IS1X 5EZJB 3S35L 4HV8A 4U1SA 4GH7B 4Z77A 2RR3A 3DHMA 3C60A 4LSRL 1YEEH 3GJFB 2X4RA 1MAJA 3NFNA 3OPZH 5AUMB 1FNGB 4I2XE 4JRYB 4BZ2L 3H2WA 1JNLH 4UTBL 1I7TB 1FNEB 4XWGH 4HLZG 3ARBA 4H5SA 4K3DH 4XMPL 2NY7L 4U2ZA 4QY8B 1K8IB 1HSAB 2ARJA 4X4XA 4Y1AD 5FA4A 3C6SB 3DMMB 2VZTA 4QHLA 1DBAH 2EC8A 1JFQL 1S9YB 1YUHA 3T4YA 1WZ1H 4WY7L 3TC9A 3OXSA 4V2CB 1FYTB 3WXVL 1LE5B 3RIFK 4NNPL 1KUMA 3L7FB 3PABA 1E4XH 1GIGL 3GM0A 2RHEA 4K7PY 3VXOA 5B8CB 4NM4L 1T6VN 5ANMA 4WV1A 1Q9WB 2BNUB 3FONB 4UTAL 1MI5E 4ZS6D 4J2XA 1A9EB 3TFKC 4PLJD 2VXQH 3B8YA 5E6IA 5TDPA 1MCNA 2DICA 1H0DB 4O4YH 4ONHA 5JUEH 3ULUC 3KPSD 1T6WA 3B9DA 4QRRE 3LIZL 3SDDC 1HEZA 1A7OH 5D7JA 1ADQH 2V17L 4JR9L 2MJWA 2Y36H 3B3IA 4H20H 1N4XH 4N90E 1UKQA 3DUUA 2IADA 2CGRL 3MLZH 4FTVD 1I8MB 1R3KA 4JZNA 2J2ZA 4Q9RL 5CAYB 1U42A 3ULVH 4NRYB 1BQLH 1XF4B 3HAEA 2VLKB 1W2KT 1D6EB 2UWEA 3MV7E 2C3XA 1KULA 4P5TC 1QOKA 3P30H 3OX8B 3I6GA 2BSTB 5KVGH 4K7PL 2N1KA 4U6XA 3LRHA 4PJBF 1QSFA 3KLAB 2F53E 1MLCB 4L9LB 4KJQD 1OGAB 3QIWC 1HOCB 5ALBH 5D7LD 5IW1A 2MKWA 4OZFB 2A2QT 3IKCA 5DGRA 2Q86A 4NQXA 3HUJA 5J0BA 4MLSA 5CGYC 2DJUA 3VH8G 3R1GH 4HPYL 5KVEH 1YY8A 5KAQG 3SKUD 3KJ6L 4PJFE 3X14B 2F19L 4GBXC 3BGMA 3V4VL 2VXVH 2E9JA 1A3LH 4PG9A 2AQ1A 1I75A 3R8BB 4AEIH 1SMOA 1P84K 2YD1A 3PHQA 2P5EE 4POZD 4AH2A 3RQ3A 4QGTA 3SCMD 1D6VL 1PKQB 3HC0A 3ARGD 1X5KA 2VISB 2ADJA 1BLNB 2AI0H 5C0NC 3TIEA 4K94C 4Z7UB 3KLSA 2LFGA 3DX7B 3W0WD 4KKAC 1IGTA 4J4PA 3UPCA 1RK1A 2IPUK 4IIQA 3VXME 5GGVH 1DQQB 3SDDB 4P2RB 1KCVL 5D6DA 1HHHB 1T66D