1FO0A

Murine alloreactive scfv tcr-peptide-mhc class i molecule complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
115
Chain Sequence
b'KVTQTQTSISVMEKTTVTMDCVYETQDSSYFLFWYKQTASGEIVFLIRQDSYKKENATVGHYSLNFQKPKSSIGLIITATQIEDSAVYFCAMRGDYGGSGNKLIFGTGTLLSVKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ALLOGENEIC H-2KB MHC CLASS I MOLECULE)
publication title Crystal structure of a T cell receptor bound to an allogeneic MHC molecule.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 25
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2000-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fo0A00
2E6JA 3V79C 5A2LH 1XCQB 5BVJA 3TT1L 4QXGH 2WWKO 2PTTB 5IVXE 3DVNA 4MCZA 3BP5B 1D5MB 4PGBA 3ZHLA 2Y06L 2CIKB 3DECA 5B38B 4O2EA 3OB0K 1NUNB 4P5TC 5F1IA 4LPTA 1P4BL 2X1OA 3I75B 2VDPL 4AEEA 5HGBA 3HUJB 4D9RE 1BWMA 5F21B 2DOCA 5FA3A 1J88A 3BWAB 3DX9B 1I9JH 3N06B 3G04A 1GJIA 3B6SA 1WIPA 5J1AB 3WIHH 3AB0B 4APQA 1NMCC 2J3SA 3DARA 3MRCA 2ZOKA 4U6VL 5J89A 3HE7D 1DQLH 3UPAA 1TNMA 4KMTL 2OM5A 1I7RB 5IIEB 4TTDD 3LQMA 2NY7H 2C3VB 3LKNB 3MCG1 2VUOA 2IAMB 1GGCH 4JCLA 3BQUB 3MNVA 3QUMA 1EIBA 3TJHD 1WAAA 2FB4L 1EZVY 5FK9B 4DN4H 3B9AA 1A7OH 5JQHC 3VXPB 4GRMA 1VB9A 1JF1A 5IBLC 2XZQL 3QWRA 3IAPA 4E5XA 4XWGL 1MCPH 4XPBL 1N2RA 3G6DH 1QOKA 4YXKL 2J8HA 3UO1L 4CDHA 1S78D 4JQVA 5ALCL 1S8DA 2YUZA 3HE6D 4X8JA 5DUPL 3NTCL 4X7DC 1U8PB 5C0ND 4OI7A 3LN4A 2EDOA 2FX7H 4OGYH 4RIRB 3G9AB 4P2QE 4XPHL 4JM2D 2H1PH 3S5LG 3M8OL 4W81A 3MLXH 2XKUA 1OTTC 3GI8L 4LASH 5F1OB 2Q86B 1JF6A 4UT7L 1S3KH 4HW6A 1NGYA 1FSKB 5DR5H 4WI3A 1NC2D 4NCC1 1SM3H 3ZDXF 4RWHA 3RKDD 2ZKHL 3O6LH 1LE9B 5SV4A 1NGWA 4HGWB 4HBCH 1ZHBB 3FOMA 1REIA 5JIPA 1BF2A 2AJYL 3GIZH 4LSSL 5KANI 5J11C 3BGFC 5IJKC 5ANMB 4DKEL 1KB9K 2H9GA 3T0BA 4KZEH 2BNRE 4XP5L 3O8XC 4DW2L 5GZNC 4J4PC 2BFVL 1XIWD 2EXWC 4U6HB 3IYLW 5KS9F 5I75C 3K4ZA 5EFIA 4DAGL 5DRXB 1Q9OB 3RY6A 1A7BA 1OM3L 1FG2B 5DUMH 4QRPD 5GRUL 2EICA 2IADB 2EDTA 4FQXD 4XP4H 4KMLB 3SOBH 3DOSA 3L1OL 5B39G 2VDMH 5BZDB 2ADFL 1FVDB 1EEUA 5DJ0B 4YZFE 2DQHH 2FLBT 5C7XL 5GRWA 3NGBB 1NCDH 3NH7L 3THMH 3ILQD 4P4RB 3FAWA 4YK4B 4XVSH 3EYSL 2XZAH 1HCVA 2YC1B 1TJHH 3GMRA 4LRNL 4NC0B 4P5MA 4Y1AE 2IH1B 4WCYL 43C9B 3X13A 2FGWH 1LO3L 5IB1A 4OLYH 4Y2DC 2F5AL 3CZJA 4Y19D 1QLRB 4I9WD 2ENYA 2AQ2A 3QDGD 1MFDH 3MV9E 3SQOH 4M61B 4ZUWA 4GW1A 3VH8G 5I18H 1RSFA 2FWOA 3E2HC 5BOZG 4GBXC 1MCOL 1AC0A 5CINH 3U79A 4HXAL 1KEGL 2VITA 1JBJA 1MPAL 3D2UA 5ID1B 4JHAL 1U8JB 1PX4A 5D6DC 1I3RB 4KKBD 4JFYA 1HH6B 1A1NB 3WS6A 1BOGB 3TZVB 4FQQB 1AKJD 3S37X 4PJCA 2ZCLL 1DQJB 2DJSA 5JIKA 4R0LA 3RL1B 3FQWA 1CE6B 4GAJH 4JDTL 3S37H 3SDYH 3RGVB 3BAEL 4UILH 4KH2A 2ITCB 1K4CB 4X5WB 4K3DH 3LHPH 1X5FA 4ONGL 5ISZB 2RFXA 3QJHB 1FL3A 4KVCH 4J1UB 4XP9H 4LPYA 5J4MA 1N8ZB 4WHDA 4D0CB 4L4TD 2NR6C 3OG4B 3VGFA 3KPSE 1I8MB 5ADPH 3IT8D 4NQDD 4JFDB 1TTFA 1QZ1A 5D2NC 4ODSH 3REWB 5HHOB 1YPZF 1A5FL 5DEFA 3UYPA 4FTVA 3BKCH 5AWNL 4WY7L 4J3XA 1CD0A 2J4WH 5C0AB 3T09A 3WIIH 1EDQA 3L3DA 5MP6L 1IGYA 1A3RH 4HPOH 4HKXA 5DJAA 4UT9H 4NO0A 3UPCA 5AYUH 1GYAA 2F9BT 3PGDA 4Y5XA 5E94A 1FRGH 3O9WD 1DQQA 4QHMB 1I7UA 5EOCH 2CDFB 2D31A 4J8RB 5BMFL 4X83A 1KN4L 1YZZA 4LU5L 1OW0A 1E6JL 4GG6E 2C1PB 5JIIA 1UKTA 5C0IB 2PW1A 2CKBL 2PCPB 4NZRL 3RWHA 3O2VL 3P77B 4XCYA 2O26U 1KCVH 3D3VA 1MHEB 1RURH 4PLKC 2XA8H 3DETC 5JUEL 3DX8A 2I9TB 1J05B 4YHIA 5DJCA 1S7VA 1T3FA 1UENA 3BW9B 2DDQL 5E4EB 5AYQA 4FRWA 2EDQA 1BFOB 4E42B 4NN6C 1G7PB 1LDPL 5E56A 5EU6A 5EU7E 2ZP0T 4M7JH 4P4KD 1E6OH 3MFFA 5FO9A 2PXYA 2G5BA 1T04B 2AGJL 2Y07H 4UNTA 2WUBL 1IAOB 4OCWH 4XNMB 1FFOA 1IBGL 4U0QB 3CAFA 4DQOL 2O5ZH 3SDXB 4MVBD 4RGNC 3PIQA 3CU1A 1X5HA 3HAEH 4LL9A 4Y8DC 3MJ7A 3UMTA 3IJHB 3G6JA 1PZUB 3GJEA 1H5BB 3C08L 1TTGA 2CLZA 4Z7QE 4MLSA 2Z31C 1VPOL 2BVPB 1WCQA 5F9OL 5KSUA 3T4AB 1LO2H 1D5ZA 2X1WL 5GS0C 5KJRH 1RULH 4GAFB 5JXEA 4XAWH 4P2OD 3HR5B 4HK0A 5HYFA 5JO5A 3PWJB 3QRFM 4PJFA 4WFHD 4G9FA 5D7JB 2R8SH 1E28B 2HT3D 4QRTB 2F8XC 3P4NA 2YK1H 3RTQA 2X7LA 1JK8A 4ZS7H 4WU7B 2GJ6B 3T08A 4YBHA 3CVHH 3F7PC 1MFEL 1I7TA 4WUKH 1KCRL 5IB5B 1CGYA 1F4XH 1KCLA 3INUL 4Z6AT 5MEQB 3TT3L 1AP2A 1X6NA 1MCDA 3UYRH 1YYLH 4FZ8H 3WLBA 3O6KL 2FJHB 3UTPE 5J1SC 2VAAA 2X9WA 4M9OA 3O3EA 3QNXB 3K3QA 4WWID 4C58B 2JJSA 4U1SA 4EVNA 2JIXD 4Z7QF 4Z7UF 2J6EL 1NLBL 3BEWA 5MI0C 4CNIB 3IB4A 3VXOB 2M8XA 4OKVB 2KQMA 1UWGL 4H88L 5DD3L 4KJWD 2A0LC 2CRZA 3D18B 1S7QA 1JF5A 4GSDL 4L9LB 1VGEH 1J7VR 3SE4A 3SPVB 4JFOA 1FORH 4B41A 2I27N 4UDTA 1LQSR 1LMKA 2EIZB 5LVEA 3WJLC 5J8OA 5GSRB 3CH1B 4S2SB 1B0GB 4HUVA 5DJZB 2XZCL 4G80B 1T89A 4LEXH 3RVVC 2VYRE 3ULVC 4IJ3C 2J8UA 4JO2H 3ZKNC 3W2DL 1R3HB 4RGMC 1CICB 3WNOA 1JPGA 2DQGH 3RHWF 5D1QA 5IVXB 4KQ4L 2YPVH 3RVWC 1MJUH 1N59B 1VFMA 1DE4B 3I6LE 4M7KL 1Q38A 2XOTA 4KKLC 4HC1H 4PUBH 5CMAB 3F58H 5TDPB 4OQTL 5HHXH 3PQYE 5KSBE 4S1QH 1X5ZA 5DRNA 3ROOA 3N1MC 2MQ0A 3CFJA 5HVHC 1CXKA 4K94L 1A3LH 3U48A 3VXRE 4JFPA 4N1CA 3ULUC 4LK4A 4FFWC 4P5TA 3WUWB 1FH5L 3WXWL 3PABB 1CXEA 2JK5B 3U9PH 1IAKA 3FT2A 4EI5D 2B4CL 3HS0A 3HZYB 1YQVL 2F53D 3IAGC 3P0VH 5CJQH 3EDDA 3B9VA 3HG1D 3QG6A 5KOMC 1P2CA 1TNNA 1R3KA 1WIUA 2W0PA 1Q1JL 4I5BB 2C4FU 4FQIL 1JGLH 4XPTH 3SDCC 3ARTA 3GNMH 3QIWB 4D2NA 3NIDE 1AGBA 1TIUA 4L9DA 1IEHA 4GKZA 4M00A 5HDQL 1BVKA 1NFDA 3MRJA 4I48B 5KSBF 3VI3E 2ADIB 3KJ6H 2VDKL 3CFDA 3JZ7A 4OCMC 3DTXB 3MACH 43CAB 1HQ4B 4ETYA 12E8H 1BZQK 1TCRA 2VISB 4NN5C 4QEGA 4HZAA 5EZOH 2VXQH 4BSVA 3ARFC 3EFDH 5EUKA 3VFVB 1HILB 4J2XA 4LLWA 4U1LA 3NA4A 3GKWH 4HEPG 5AZEL 1M6OA 3CSPA 1XF1A 4OD3L 3EO0A 5ESQB 1A4JB 1DQML 4P2QB 4P5KB 4NJ9H 2BNQA 3QCVH 3BKML 1RZKL 3VA2C 3TBYA 3FJTA 1CGXA 1ITBB 4P3CL 1J8HD 4L4VE 3VXTB 3LS5H 5C09B 4EOWL 1AO7E 2APTA 3VI3F 1IZJA 4XPAL 5DTFA 3EHBC 2KPNA 2Q6WA 1CFVH 3I2CH 1A6TB 1KXTB 4LCWB 4OFYA 1XH3A 5DJ2A 3HI5H 2H6PA 1WT5C 4H1LA 1CF8L 5I73C 3WHE0 3N1PC 3TCLA 3V8CA 1PY4A 5F7WC 3C09B 1CBVH 3SHSA 1KLFA 4XBPA 3C8KA 1ZT4A 3LRSB 3RVUC 5HYIA 5ID0A 1HN1A 5E8EB 5D9SA 5IJKA 1YEGL 5ERWB 2HWZH 5AG9A 1IQDA 5KZCD 2FLRT 4L8BB 3RNKB 5LGJA 1EUUA 4HKZA 3O8XA 3MRFA 4OZHA 3V0WL 2UZYB 5IM7A 4J4PA 5FDWA 4PRHA 5T3XE 3GSUB 3VMNA 2G60L 5C2BH 5KSVA 1J0IA 1BLNA 1JHTB 1S7UB 1RUAH 3CDFA 3C87A 3ZKMD 3AXLB 3IF1B 3KPQB 5DQDH 4WVRA 1MUJA 3NIGF 1F3RB 5IQ9A 3SJVD 3GRWL 3ECBB 4WO4D 5B3JE 4Y1AB 1RVFL 3VFWB 5E8PA 5GRJH 5GS2H 3ZE0E 2LQRA 3T1FB 3U46B 4G5ZL 3QYCA 1FZKA 5CEYB 5I8OH 4MXWL 1ZS8A 2E27H 1A7PL 1HIML 3EGSA 3BHBA 2W92A 4QTIL 2AJVH 4R96B 4MAYB 3TO4B 5CZKA 1JNLL 4TULH 4S11A 1MWAA 1LEGA 5FGBC 3VXUD 4GBXA 4PP2A 3QULB 4XAKD 3CPLA 4O2CA 1QA9A 3VGGA 1I9JL 3I6KA 3IVKB 4L3AA 5HYJD 3MV8B 2VLRB 5D6DA 4F7CB 3TO2B 3WIHL 4P99A 2X4PB 3OJDA 1IC5H 2VZ1A 3M07A 3SKNA 5B3JF 5HDBE 2EDWA 3MCLH 1ZLWH 4IOSD 1T66C 2B1AH 3ZE0F 4PJ8C 5J6GB 3MJ8A 2W9DH 1JNJA 1PKQB 3AFLA 2NY7L 1K9TA 1KJMA 2BSRA 3FZUC 5IP4A 4R9HA 2XG4A 2YXFA 1JYNA 1CDGA 2VLLB 3KPSB 1S7WA 3LKPB 1ZLVK 3MO1A 1A7OL 4B0MM 1GGTA 1QFUL 5EB9A 2XG5A 5EH1A 3QIUC 3PV6A 1MCPL 1X5AA 2MTPA 5C0RH 4LGRB 3KLHC 1S7XB 3T3PE 5JMRA 3Q3GA 3QIBA 5SWSD 3OAUH 3ZSTA 3OZ9H 4XPGH 5D2NA 2P46B 5EC1B 3S3JA 2YRLA 1BVLA 2X9YA 3GMOA 4PJHA 2XKNB 1UFUA 1ODAA 2H1PL 4RWYH 1N7ML 4KC3B 4X8XA 3MLXL 1KJVA 4ZODA 3T2QA 4JQXA 1MJ7H 4M7ZC 2GAZB 3RAJL 1BAFL 4HS3A 2OZ4A 4LASL 3GMQB 4MNQA 3UPRB 3MLSH 1S3KL 1I3UA 3RBSA 3VG9B 2VZ3A 4IS6B 5BS0B 2EKJA 4GG6B 1JE6A 5F89B 1WZ1H 2AEIT 4BZ2L 2P5WA 1MY7A 3HPLB 3O2WH 4JDVA 1RK0B 2BXYA 4KTDH 4GLRI 5DJ6A 5EG6C 1IQWL 1KB5A 1RZFL 3GIZL 5HGDB 3MLZH 5EC2B 5HPOA 1K8DB 3LB6C 2DQEL 2QADB 4KZEL 4M5ZL 4B50A 1W0VA 1J1XH 1WFUA 2NY0C 3HMWL 4LSUH 4LHQB 1JZ4A 3VWKA 3SDAD 6FABH 3VRIA 5IF0B 5C8JA 3R8BB 4M3JA 1HSBA 3VDAA 4JFXB 1FZOA 1CXFA 1ZHLB 5DURD 5DUML 5K9JL 1OCWH 1UVQA 3QEHB 1UQSB 3TA3B 4OZGB 1C5BH 2AXFA 1AFVH 1NGZB 1EK3A 2FHCA 4N5EC 1J0KA 2ATKB 1UXSA 3SOBL 2WBJC 2VDML 3FQRB 2IMNA 3CU7A 3MYJA 2XT1B 4R3SB 4HHAB 2DQHL 2FEDD 1FQ9C 1NFIB 2V2WB 4Y5YB 1R5VB 4G6AC 4YO0A 4HCRL 3THML 4OFDA 4CGTA 2V5SA 2Z93B 5DMGD 4ODHH 3JWOC 3QZWB 1C16B 5JHLL 1I85C 4QOKE 3VJ6B 1H9VA 1TJHL 4HZLB 3MZGB 1A7QH 1U3HB 3BFOA 2BOBB 1JPSL 3QXAA 2FGWL 3FQNA 5GS1C 2Z31A 2DTML 4Z78A 4UAOC 2R1XB 1YNKH 5H35B 4F15C 1Z5LB 5DS8A 5I18L 2CR3A 2QR0B 1HEZA 5ACZA 4XNZC 2OYPA 3CFIC 4MXQC 5L6YH 5CINL 4WFGE 4F37K 1MSPA 1QRNE 1Q0XH 3O3UN 5I1DA 4YHZL 5I9QB 3U30B 2EO1A 2H3NB 3KYMA 1VKXA 1KCKA 2V5RA 4CMHC 5FYKD 4PRNB 4I0PA 3RPIA 3SDDB 2W60A 4A6YA 4D9LH 4QCIA 1G9EA 4CU7A 3C8DA 5EO9B 1MAJA 5CEZH 1DUYA 4QRQB 3OHXA 2B1HH 2VLKA 4GAJL 3H9ZA 3FB7B 1INQB 3C6LB 1FO0A 3IDGA 3OR6B 4PV9A 5E99H 4JHBA 5HPMB 2YPLA 4IRSD 4DGYL 4WWKA 4Y16C 1BEYH 1NBYB 3P2TA 4K3DL 3OKLA 2CXKA 1SYVA 1H8NA 3NFNA 2FX8H 4KVCL 4PJXB 3MRGA 3MXWH 3DGGB 1YNTB 3ARED 2F74A 3WV0A 5IEHA 2NW2A 2KKQA 2NXYD 3OKNB 5E8OA 5D7SL 4WUUA 2K7PA 1ZSDA 1RQ5A 3WJLA 2DKSA 3D85D 4ODSL 1CLCA 3TFKC 1FGNH 5CP7A 3SE8L 2XXCB 1NSNL 1N0XH 3BGMB 4PTTA 4LVNC 3DSFH 2J4WL 3FN0L 1K5NA 3PQYB 4GLRH 4XVTL 3P0GB 5EBLA 4PB9H 1JYVA 1EHLH 3FONB 3PWNA 1HZHL 3VXRB 3QI9D 5IOPB 4FQ2H 2LV4A 4HPOL 3MV7E 5LG1A 5EOCJ 1RZJC 5GGVH 1FRGL 5EOCL 3D69B 5CUSH 1FNEB 1RUKH 1LEIA 3VE0A 1VESA 3QG7H 3U9UB 4RAVB 1KCVL 3BUYA 2HYMA 3PWUA 3QEQE 1PX3A 4I3RH 2XA8L 2XRAL 3KJ4B 5SWZD 2AV7B 3VI4F 5I8EA 3HC3H 1VGKB 1XGRA 3SDCA 4QRRE 3WFHB 2X2YA 1BF8A 1UM6H 2IBBA 4J3WA 1OSZA 5FCUH 1UEYA 2HAZA 3KR3H 1SEQH 1ZVSB 4K7PY 4BZ1L 3QQ4B 4BUGA 1PYWB 4ELKA 2WINB 5ECJE 4OBRA 4YHML 4UU9B 3I6GB 3ARFA 3PWLB 4XCNB 5CIPA 3EIFA 4PRIA 4X98B 3X12A 1V3JA 4D0DB 1OPGH 3GMMA 4NM8H 3SE3A 1A02N 3ES6B 1A6ZA 1FAIH 3S96B 1LO2L 1NEZB 2OR9H 1AO7B 5C0DB 1RULL 4XAWL 3WJJC 1CQYA 4OLZH 5EO0B 4HXBH 4YBQD 3TN0B 2X4TB 4FA8A 4JRXA 2GSIA 2R23B 1L0QA 3QDMD 4LBEA 3MLRH 2NY2D 5B3NA 4LLMB 3RDTD 4NO2A 4CU8A 2CDGB 1WFNA 4K9EH 3DMMD 4DKDC 1F4XL 4U1MB 1AGEA 2VOTA 4NP4H 1B4JL 3MUHL 3UYRL 1YYLL 3BP4A 3AAZA 1F2XK 5D7LD 3H0TA 5JOPE 1NQBA 3V4PL 4P2RA 5D5MA 3O2DL 2A38A 2ZUQC 4KQ3H 1JI1A 1CD8A 1A6AA 5DJDA 5D1ZC 3F5WB 2EE6A 5D1XB 5H2BA 5I19L 3T3ME 1VGEL 2IGFL 5JQ6L 5BZWB 3FOLB 4F7MB 1LD9B 4N0YH 4Y4HD 1FORL 5IG7B 4BFBD 4QT5B 4QHLA 1NGPL 5KW9H 2DLTA 3TVMC 1B2WL 1MCRA 3BEVA 4HKBA 5LAXA 4NQCD 4X4YA 4ZNEE 4LEXL 5IGXH 2ZUVA 3SKMB 1EHAA 4UQ3A 2CLVA 3MLPA 4ZFZB 5E5UB 3DHMA 3UP1A 1CZ8H 4PJIA 3D0VB 4LKXA 4DCQB 2EDKA 1XGUA 5FM4A 1EAPB 5JOEA 3F58L 4Y4KB 3MGTA 1UB6A 3LSOA 3C9NA 1U92A 3FFCA 5ENWB 2NNAA 3MJ9H 3MA9H 4ODXB 3SCMD 2H2SC 2LFGA 3MRMA 2R1YB 2CKNA 3P11L 4GRLC 3T3MF 4MCYA 3HFMH 1RJLB 1IGJB 2ARJB 5CD3B 1X4ZA 1KPUB 5FGBA 3DUHA 4M5YH 4P9HC 1HHKB 1Z3GH 4HWBA 3WFZA 4F33A 3IDUA 3RZCD 5FYJH 3U9PL 1U3JA 2XWBB 4M6NL 3LN9A 1RZ7L 2HG5A 1OAQH 3QSKB 4WW2F 4JPKH 3VMOA 1EJOH 1FNLA 4MJ6B 3MRHB 1DVFA 4XPTL 5JOFB 1JGLL 2D2OA 1HHJB 1JZ2A 4NO3A 1H3XA 1YN6B 3LKQA 1QSFB 4Q6IB 1FDLH 4LDEB 4KK6D 3ZE1F 3TBTA 3Q6GL 3KJ6L 4PJ5D 5KG9A 3OKEA 1MNUH 4OM0H 3MACL 1A8JH 3PHQA 4PRPE 4TVPH 2PO6D 5E6YA 4LCCA 12E8L 1I7ZB 1XR8A 4U0RB 5EZOL 1I8IA 1RHHA 4JQIL 2EKSB 1D9KD 4G8FB 1F58H 1CK0L 2DIJA 2P5EE 3GKWL 4LSQL 3RA7H 3ROLA 3NCJL 5L2JB 3ZZ1A 1FZJB 4R4ND 1AY1H 4FP8L 2HJLB 4QYOB 3HMXL 4ISVB 1U8IA 1P6AB 5C07A 1A6WL 4X6EA 1IL1A 1DSFL 4RZCB 4MA3B 5GJSH 4WENB 4JE4B 3MRNB 1YEHH 4P59H 2AKRB 4F37F 3LS5L 4NFDA 2F8OA 4JN2A 1MCNA 3HB3D 4HUWA 3I2CL 2NY4C 2R0KH 5MEND 4O2FB 3FO1B 1UKQA 3BP6B 3VXQB 1ERNA 1T5WB 1KLUB 3OJ2C 5FYJD 3HI5L 4X4ZA 3TJHC 3QXTA 5FB8A 1EFXA 2AV1A 4HQQH 3LS4H 5DQ9A 4OD2B 1P7KA 5LGHL 3VD3A 3RIFK 5EBGA 1IKFH 1F11B 5JLZB 1CBVL 4XP1H 1YMMD 2F54B 1J0JA 4HJGA 3D3VE 4NQSB 1D6EB 1QKZL 4XZUA 5FXCH 2ESVA 1S78C 2VSCA 5FO8A 4JY4A 3VWJB 2HWZL 1EVTC 1Q9WA 3MNZA 4QTHA 4B7IA 2K7QA 1MH5A 4ZPTB 5K9KA 1BVZA 3DXAD 5TDOA 2WZPD 5GGRB 1RUAL 3QCUL 4U1HB 5HYSG 3SO5A 1TVBB 2QQKL 3JTTA 5DQDL 3DRTA 1U8KA 2NTFA 1HH9A 2WBJA 5T1KD 1LO4L 1QLFA 4WJ5A 2EXYD 3O6MH 4Z7VA 1RZIB 1ZA3B 3KWWB 3U0TB 3G6JE 4JRYD 1CLYH 5CSBA 4ZS6C 2OK0L 3F62A 4U3CA 4QHNA 4LPWA 2FEEI 5EBWB 1BQHG 3IXAB 4FQ1H 1I85A 3QNZB 4ONFH 5I8OL 1EFQA 3V9FA 2E27L 1TVHA 3B4NA 5D7KE 5GS1A 2GI7A 1E27B 2AJVL 1A14L 4PJFE 2X4QB 1K3IA 1G84A 3LIZH 1GGIH 1HHHA 1XIWC 4PJ7E 4PGCA 5EDXA 3C8HA 4TNWK 1JV5B 4NFCA 4U6YA 4FQXC 3UTTB 2BMKA 2Y5TA 4X5XB 2P4AB 4L3EE 1IC5L 4PJBF 3UZEA 3IU3A 4K07A 4YHYB 1IRAY 3BIAX 2OSLB 3L3IA 1M71A 1NH6A 2WQRA 5GHWH 3OPZH 2B1AL 5CBEB 4G6FD 4XHJD 3VXNA 1U8OB 5T1MB 4G9DB 1G9NC 2W9DL 1W72A 3FCTB 5GRVK 5I1KH 5JPMB 1OARL 4JKMA 4NQEB 4Y16A 3BZEA 3WN5B 2FD6L 4C56E 3VXMD 3UJTL 3IKCA 4AK1A 1S9YB 2Q7YB 5HHME 1UH4A 4W4OA 2AXHA 1BOYA 2E9BA 4PJ7F 1KJ2B 2UY7A 1KJ2H 4Z7WA 5JHDB 2V6HA 4X99B 4KV5E 4PBXA 1LILA 2D7TH 4PTUB 3NZHH 3QO0A 4JANB 4XH2A 3HC0B 2J8UE 3OZ9L 4XPGL 4P57B 1NUFA 4CADA 5L0QB 4PJAE 2UY6A 5D70L 2EO9A 3DVNB 4MCZB 4OT1H 4PGBB 2HLAB 4YIQA 4QRSA 4KHTH 3O4LD 3KLAA 1TJIH 3S6CA 3BKYH 2GTZA 2PR4H 3I84A 5F1IB 2NY5C 5TQ0H 4HIXH 1PQZA 4EEEA 1DBKH 3MLSL 1FIGL 1AD9A 2DM3A 3G5YB 5FA3B 4NBXB 3VDCA 3X3FH 2YUWA 3G04B 3TIDB 3PDOA 3NFSH 3O2WL 2VZSA 2BY1A 3B6SB 4APQB 4KV5F 2H8PA 2AK1H 4KTDL 1JUFA 5IBUG 4FXKA 3MRCB 1MCJA 1WZKA 2ZOKB 2W65A 5GISH 3MLZL 4PJAF 4QRRB 1M7DB 3KXFE 1J1XL 4Y2OA 4YGAB 1OF2A 5I66A 3S4SG 4LSUL 1MRCH 5KVEH 3MNVB 1M1SA 3QUMB 3QUMH 3QXDA 1BD2A 6FABL 1R3IH 3C5ZB 5DDHB 1P84K 4NNPL 4GRMB 3HRPA 1JF1B 4JKLA 3LRGA 2UWEE 2QSQA 5D7IE 4E5XB 5INDA 1FJ1B 1AFVL 1X5GA 1Z9SA 1NDGA 3IDYC 3JUZA 1GSMA 3CVIH 2AJSL 2F8VA 3O9WC 1MI5D 3NA9H 1S8DB 4WU5B 4X8JB 4D94A 4ZG1A 1UH3A 3LN4B 4ODHL 2LU7A 1T20A 4LSRH 1QPPA 3AS0A 4NZUL 1CGWA 5GS3A 3BSZL 2EH7H 1CD1B 1S5HB 1NBVH 1V3MA 4U1KA 1NGYB 4PG2C 2FH6A 3S5LA 3R4DA 2EDFA 1RZGA 5DHVA 3ZKXC 1G6VK 1Q0XL 1OQOA 1MCFA 1XGTA 1AE6H 2UWEF 4P4KC 5D7IF 5EUOE 4OCNC 2YD7A 3SO3C 1NGWB 1RIUH 3B83A 4PY8I 2Y4SA 3T2NH 5GZOC 3QFJA 4ESKA 3FOMB 2B7DT 4UINH 4BQCA 3K7UA 5IWLC 4D9LL 3ARUA 2YKLL 4MVBC 1R24A 2H9GB 1MRDH 2B1HL 5J12B 3CMOH 4GOSA 2R0ZH 1Z2KA 1S9KC 5E99L 3QO1A 1BEYL 2UZXB 1NCAH 4KAQH 4NQVB 2HFTA 2FX8L 3BGAA 2C1OA 5F8QC 1FE8L 3JUYA 3MXWL 4OZHE 4KRLB 5SX5H 4UTBH 2AQ1A 3PNWA 2HT3C 5EUOF 3QDJD 4Q58C 1FGNL 3KPRD 3TVMA 4KDTC 1SBBA 4XMLH 1N0XL 2IG2L 1O0VA 4HDIA 5B39A 3GMRB 4P5MB 3TYGH 3DSFL 4PGDA 4JKKA 2FBOJ 3X13B 5M94B 3QEUA 4U1NA 5IB1B 2GHWB 4OZFH 4PB9L 4IOFD 4AENA 4GW1B 4ZUUB 3BVNA 5C0AD 5I16A 1VACA 2AK4D 3SGEI 1MJ8H 3L95B 3BE1L 5F1NA 3W11D 1OAXH 2NY6B 2VITB 4KJWC 5GGVL 4NKQB 1YC8A 3D2UB 4N0FB 4KJQD 3RIFF 4GRLA 5CUSL 3VH8A 4JFYB 4U1GB 2E7MA 5EZLB 2BVQA 3QG7L 4CU6A 1IGIH 3R0MA 1J12A 4R0LB 3QUXD 3FQWB 2OI9C 3RL2B 4I3RL 4YPJA 1U8QA 5ICYA 5CLTA 5I1HH 3T0ED 5ITBL 3HC3L 1TZIB 1VFAA 4FS0A 2ADJA 2RFXB 4KK8D 4CRPA 2FATL 1FL3B 1UM6L 1F00I 1YA5A 5E7FA 1JVKA 5FCUL 2Y72A 2P7TA 3BX7C 2DL2A 1SEQL 1SJXA 3QCTH 4IDJH 2ENSA 2QHRH 2P5EB 1DANU 3ZL4H 3NPZB 2EIBA 5DEFB 5DGRA 1R5WA 3UJJH 2APFA 2UVEA 4YFEA 4XCFH 1IC1A 1KACB 4LHUD 5E9DD 4RSVA 2VXTH 2HMID 1OPGL 5JDSA 3OL2A 3NCYP 3L3DB 3RP1A 4M7LH 4WFED 3GSNA 3GK8H 4PJHE 1IGYB 5IHUH 4UOJA 4PLJC 1YY9D 5K9QG 2C4XA 3D5OF 2ERJB 2IPUK 4HKXB 2HH0L 5DJAB 1GC1C 4HXBL 4TNWF 4Y5XB 3PGDB 3HE7A 5E94B 1Q0YL 1DQQB 1I7UB 4XGZA 4H25A 3R8QA 3LMJL 1B90A 4MXVE 4RMRA 1XGYL 2YS4A 2PW1B 2XWJB 4RMVA 4HUNB 3RWJB 4K9EL 1T6VN 3IDIA 3CX2A 3O6FC 4Y89A 3D3VB 2BK8A 2GJ6D 4C4KO 4ZUSA 3DX8B 2IQAA 1G0XA 4ZOCA 5C0EA 4KK5D 5BOPA 4YHIB 1S7VB 2V9RA 4X0KA 2RB8A 1Q8MA 2FZ3A 4KQ3L 1BFVH 4JJ5A 4DKAA 5EU6B 1DQDH 3HE6A 4KRPB 5IVZB 5GSVA 3S88H 3L7EA 3MFFB 3MR9A 5FO9B 2PXYB 2GT9A 2G5BB 2XNAA 4N0YL 4H8WC 4JM2A 1FFOB 1L6XA 1P7QD 3GBNL 2OS7A 2JJVA 3SGEH 3EDEA 4OM1L 1JZ5A 1K4DA 5HTSA 2NZIA 3PIQB 5GGQL 5I1LA 2UVFA 3DJ9A 4NZTL 5BV7C 4YHOH 3MJ7B 3G6JB 3LEVH 4NC1E 3IGAA 5JW4N 2EH8H 1NMAL 4ZD3L 4LLQB 2CLZB 5ESVA 2Y9RT 1II4E 1NC2A 2X40A 4R4FH 2VH5H 1CZ8L 4KI5C 4XBEH 1Z0NA 2X70B 2I60H 1D5ZB 1CICD 1J9CT 2C26A 2BNUA 1MQ8A 1YN7A 4HK0B 5JO5B 1RY7B 4PJFB 3MJ9L 3MA9L 4G9FB 3ARZA 2R15A 2X7LB 5EA0H 3HFML 2R2HA 4D9RD 4KROB 1I7TB 1BMGA 1QBMH 5FGSA 1XIWA 1IEBA 4L3EB 1Z3GL 5C08E 5IB2A 2JCCE 3ZKMC 3ARGD 5FUOH 1HK6A 4QRPA 4ALAL 3QHFL 2V9TA 3O3EB 2XKSA 4FQXA 4N0RA 4AL8H 1OAQL 2BERA 4U1SB 2BRRH 1JZ7A 4WTWA 3VFOA 1DP0A 2EDRA 1ZA6A 2NXZB 5M95B 2IPTH 2UZIH 2JJUA 1S7QB 1GAFH 4LARL 3KPLA 4C56B 2MHAA 4JFOB 2I07A 4P3WA 2Z8WC 4N1EA 5TGBA 2P48B 3QIWD 1NAMA 3WNNA 5HHMB 2XFXA 3CFEA 4TVPL 1A22B 1RMFL 4HUVB 2EYTA 4KZDH 2JELH 2BXZA 3AU1B 4Y19A 5J57B 3QDGA 5E7BA 3RU8H 5IFHH 4WUUE 1WEJH 2J8UB 1L7TH 1CFBA 1F58L 2FBJH 2LTQC 3U6RA 4HGMA 1JPGB 4PJAB 5D1QB 3RUGE 5HYQA 4FFYH 5DWUH 2JCCF 5KSAD 3ALPA 4YXLH 1AY1L 5DK3A 3IFPA 4X6CE 3GHEL 5DRNB 1U8MA 4P2QD 5B4MD 3ROOB 4BQ8A 3IJYA 1AKJA 1NMBL 3CFJB 4P59L 5EOQH 2DAVA 1X5JA 1PLGH 4QHUA 1ZLUK 4P5TB 4S1RH 2R0KL 1MHHA 4XTRD 2F19H 1CXIA 4XMPH 3RKPA 4HQQL 5C92A 3FQTA 5ACLA 3O4OC 1KIRA 1KT2A 1IAKB 3FT2B 1X4XA 4KKAD 3A67L 4DOHB 4Q9QL 4L4TA 1EZVX 1IKFL 4XP1L 3QG6B 1Q72H 3RUGF 3KXFB 1P2CB 4LHUG 3D39D 3LD8C 3KPOA 4HKJA 3V52H 4NQDA 1N5AA 1AGBB 3RNQA 3OF6D 4X6CF 2BNRD 4GKZB 1BVKB 1NFDB 3MRJB 4ACPA 5IESH 5F3HA 3CFDB 4O9HH 4F57L 4ZXBD 1TCRB 3B9KB 2P45B 3QDHA 1HKLH 4BSVB 2V2XA 3DHJA 5EUKB 3VU2A 4J6RH 4LLWB 2KL6A 3GDBA 4U1LB 4WW1A 5C0CD 3OV6A 1M6OB 3DVGA 3EO0B 3CJJA 3HNSH 2VDQH 5LWYH 3BPOC 4QGYA 3T2OA 3TWCL 3O9WA 3TF7C 1SY6H 1X44A 4FMKA 3G5VB 3TBYB 3C5SA 4FQ1L 3GIVA 5I76A 2MKLC 5ICZA 3DIFA 4ONFL 2ARWA 1A21A 1FNSL 2I26N 4ZDHA 2HVJB 2VQTA 5DTFB 3MV9D 1T1WA 5ILTH 2D0FA 1N0LA 3SGDH 1G7LA 3BPLC 4YUEH 4U7MA 1J87A 1GGIL 4PG2A 5IUSA 3SDAC 4H1LB 5EIVA 4H1LH 2OL3B 5IW1A 1CGSH 3LPFA 4MAYD 4NHCH 3T04D 2ICWI 3MMEB 4WNQA 3ZTJG 5F7FA 3ZMRA 4LPXA 3PV7A 1QHOA 2BOCA 4P4KA 2P24A 4XBPB 3C8KB 1KN2H 1VFUA 1ZT4B 3BDBA 4KI5F 5CJOH 4NPYA 2ZPKH 2MOVA 5ID0B 2NY3C 1OAKH 2FEDC 4EIZC 2Q3AA 2ED7A 1WICA 5D9SB 5J11B 1H15A 2I5YH 5IJVA 4DTGH 1IQDB 2R1WB 4P2RE 1T83C 5C71A 5LGJB 4HKZB 5IFAH 3O8XB 3MRFB 4OZHB 4K8RL 4G7VH 4H20L 5IM7B 5FDWB 4PJ9D 5DC9B 2YUVA 5KSVB 1CQKA 1BLNB 5I75B 1SJHB 5E08H 5GGTH 5E0QA 2XI9A 4GMSL 1HHGB 1KENH 1P69B 4Q74A 4YGVA 1KJ2L 4P2OA 5FO7A 3NCYS 1MUJB 3KPSD 1T2QH 1OP3K 1T7YA 3V6FA 5IQ9B 4TN9A 2D7TL 3NZ8A 3DYPA 1MREL 4OCSH 4WV1A 3NZHL 1QSZA 5E8PB 4LLUA 3WUWG 3T0DA 4YEEA 4D0BA 4LQ1A 5T3ZH 1SMOA 1FZKB 3PXJA 4PJIE 1MFNA 3TBVA 4OT1L 4NN7C 4BFEA 3GSRA 2B0SL 4KHTL 1OTTD 1PSKH 3WE6A 1ZS8B 4EJ1C 1L9MA 4LOUD 3EGSB 4LPUA 1CDJA 3BHBB 5KN5B 3BKYL 3OAYH 4H5SA 3J8F7 1I8KA 3KDMA 5AD0A 1XF2A 1MWAH 3D1MC 1LEGB 4Y5VB 2JIXA 4U6XA 4GBXB 1FYTE 2BVOA 5KBNC 4PP2B 3CPLB 3CLEL 3K8MA 4O2CB 1QA9B 5FOJA 3I6KB 1BQLH 4MJ5A 2DLFH 2PYED 1YJDL 5I1IL 1I8LA 3AREC 2YMXH 5TDNA 2AK1L 4HH9A 1SMAA 3OJDB 5DRZA 4TTGA 4R97C 5CHNA 3SKNB 1XGQB 1P7HL 3A6BH 5EU5A 5GISL 5JW4M 2DB8A 2VDOL 3WIFA 3GJFK 1KCUL 3MJ8B 5GZND 4D8PA 3KPNB 2KUTA 4O00A 4ZUVB 3UTOA 5B22A 5J06A 1KJMB 2BSRB 4OIBA 2QADD 3QUML 4MJID 1S7WB 3MO1B 3SKOA 3QI9C 4UZGA 4DFIA 3PV6B 1JTOA 4OLXH 5F6IB 3MRQA 1T03H 1F13A 1PVHA 1EERB 3CMGA 3HNTH 3Q3GB 2V5YA 4M43L 3TBWB 2W59A 3QIBB 1HYSD 3NA9L 1G6RH 3GFUA 1BIHA 5D2NB 5DVKA 5E03A 1HXYA 4YAQA 3CVHA 3OAZH 1BVLB 1CFTB 2W1NA 2A1WL 4M8QA 3HRZA 3GMOB 4RISL 3QPQC 4PJHB 4LSRL 1QQDA 4NNXA 4Y2DD 4XNYH 2Z8SA 2GK0A 1KJVB 1JHLH 2EH7L 5DZLA 4OAWA 4G8EA 4EI5A 1NBVL 4HS3B 1HHIA 2F53A 4RX4D 1XR9A 4N9GB 1TQCC 5ITFA 1ONQA 1U95A 4GQ9L 5F9WC 1U3HD 4X9IA 5L9DH 3HG1A 1U91B 1INDH 4G7YL 4MJ2A 1AI1H 2P5WB 2ICES 4M6OH 4JDVB 1AE6L 1NLDH 1RIUL 3U7WH 5I1CH 5DJ6B 2BZDA 1L7IH 3GM8A 1KB5B 4GH7B 4UINL 3MGOA 2Q3ZA 4TRPH 3HLAA 5J6HA 4NDMA 4BSWA 3WL9A 1IAIL 1MRDL 1W0VB 1BREA 2EZ0C 3SDDD 5ABDE 2R0ZL 2AQ3A 3FQXA 5DVNA 2ICEA 3VWKB 2X1PA 3VD7A 3C6SA 1B9ZA 2CUMA 1NCAL 5DJYB 4HC1A 4NN6B 1HWHB 4NNYA 3VRIB 5C8JB 3U0PA 3C6LD 4YC2C 1CXHA 1H3VA 3QH3A 2NR6D 5DO2D 3MLUH 1EEYA 5IB3A 2AXFB 1UXSB 1J8HA 5T1DL 3MYJB 1GZPA 3QBTB 3AMKA 2O61A 1AIFA 2H26A 3MBXL 2P49B 5CEXB 1RU9H 4PJEE 4YO0B 1ZEAL 3W9EB 4XMLL 1KGCE 4LVHC 3RDTC 5L8KB 1DL7H 4XCEA 1RFDL 3DMMC 5HJ3A 3TYGL 3ZTNH 2FIRT 1AR1C 4MB4A 3NACH 3QXAB 3FQNB 1V8HA 4Z78B 1BZ7A 5B8CA 4WGVB 5IHLB 2X1QA 5DS8B 5GS0H 3PQYD 4HLJA 4KI1A 1HEZB 3WCYA 3VFMA 5ACZB 1MJ8L 4LRIC 2OBGA 2H45A 3FN9A 2V7HA 1NC4D 4NGHH 4QNPF 4Y4HC 5C08B 2W9EL 4I0PB 3RPIB 1IGIL 2W60B 3CH8A 4A6YB 1OTUC 4QCIB 4PLKD 5CZXC 4PJEF 4LCUB 1IT9H 1DUYB 4ZAKC 3OHXB 2VLKB 4HG4J 1JGDA 3IDGB 1FO0H 5IV2A 3VD9A 4FZEH 5I1HL 4PV9B 2YPLB 2DLHA 2X4NA 2DQDH 1KTLA 4WWKB 3OKLB 3SJVA 4R26H 1CS6A 1NCUA 3L5JA 5J3HD 5MI0B 1R0AH 2E7HA 4WO4A 1XF5A 2NZ9C 4H26A 1LP9E 2EYSA 1WSST 2F74B 5IEHB 1YEDA 2NW2B 5E8OB 3SCMC 4WUUB 2G2RA 1ZSDB 4JPWH 1GHFH 3DPBA 3RWEA 3ZL4L 3FRPG 3V0VA 4POYA 4K94C 4PTTB 3UJJL 3BD4A 4AIXA 3LEYH 4IJ3B 4TSBH 4XCFL 3ULVH 4PY8J 2NY1B 1OP9A 3VXUA 4G6JH 3GSQA 1K5NB 1FNGA 2IANE 3DBXA 4TYUA 5FKAA 3DV4A 2R2EA 4NC2B 1BECA 5EBLB 1P1ZA 1T7VA 5DJ8B 5HYJA 3GK8L 2BHZA 3H9HA 3PWNB 5IHUL 1RIHH 5JW5A 4XNQB 3QEGH 5EN2B 4HK3N 3D48R 2B4CC 4L4VD 3C2AH 4K23H 2WNGA 3B5HA 4HIIA 2HT2C 3Q5OA 1AO7D 1LP9F 3GI9H 5IB4B 3ULUH 7CGTA 2VO5A 1AD0A 3HR6A 1BQSA 1LEIB 3VE0B 4R8WH 4MD0A 4U7KA 2PO6C 3L3KB 1PG7W 1W0YT 2AJZA 4Z76A 4JKPH 3BUTA 3HC4H 3T0VA 5F7KC 1D9KC 5C0GA 2X4UA 4X9GA 4NUJA 4YDKH 1U42A 1XGRB 2SEBA 2MCPL 2IQ9L 2A0LD 3Q5YA 3FHAA 4NJAH 4R2GB 5SWSA 1DQDL 1TCMA 3FL7A 1NCBH 3QZWG 4EKXA 1DJSA 3S88L 4EN3C 4ZSOE 2WBWB 3CGTA 1GOHA 3V6OE 4FFZH 4HJJH 1KTKE 3T0WA 4MGXA 2VKWA 2XQBH 5T3XD 4ZO9A 1RZKC 3I02B 3CZFA 5FHBH 4M1CD 4YEFA 5CIPB 1F4YH 4YPGA 4PJDE 4FABH 4NRYA 3X12B 4K2UH 3UTQB 4R4FL 1A6ZB 1CFQA 1QFWL 2I60L 3RVTC 1BBDH 1S7RA 1F4WH 1UJTA 5FF6A 4X7FC 3SY0A 2ATPB 2RCSH 3WDIA 4BZYA 3BIBX 2GY5A 4RCAA 2K1MA 2MKWA 4JRXB 1N6QH 4Y4KD 1BHGA 2GSIB 2APVA 3RZWA 5EZIL 4LBEB 3RQ3A 5A40E 4N0CD 4JVPA 3IS1X 4NO2B 4UV7L 3EYUH 1WC7A 1QBML 3OX8A 1AGEB 3SDAA 5I73B 4V1DE 9CGTA 3BP4B 3AAZB 5FUOL 3UTZA 1R3JB 4PJDF 4FFVC 5TE6H 4AL8L 1JPFA 2A6KA 5LBSH 1LHZA 1UZ8A 4P2RB 5D5MB 2DTSA 1UYWH 2YN5A 5CILH 5DC4B 2EXYC 1A6AB 5DJDB 2NX5E 1U8NA 4PB0H 4IRZL 2Z9TA 4KWUA 5H2BB 2Y5EA 2CLRA 2IPTL 5I1EH 2GYSA 4I18C 3ULSA 4CVXA 2CIIA 4X6FA 4OF0A 4QHLB 3KYKH 5GJTH 1VCAA 3BEVB 4HKBB 5LAXB 4X4YB 4KZDL 2JELL 1F6FB 1OP5K 1K2DA 5HHPB 3RU8L 1ULVA 4UQ3B 1AGCA 1WEJL 1L7TL 2CLVB 1I1FA 2FBJL 1Z6JT 2DM2A 4Q9RH 4I0CC 4FFYL 5DWUL 4N9OB 3OXSA 4PJIB 4LKXB 4C55A 2YZ8A 1E4JA 3MJ6A 3MGTB 3LSOB 3C9NB 1U92B 5DI8A 3WHE1 1KLGA 3AB0C 1LO5A 3MRMB 3NMEA 1FYTB 3EHBD 4LGPB 4MCYB 4M1GH 1PLGL 3VFGH 2WV3A 1CWVA 2AXGB 4Q7DA 4S1RL 4IRSA 3W9DB 3LEXA 4AEIH 2F19L 1J5OH 5CGMA 3MROB 5F97E 4HWBH 4F33B 2NTSP 5D6CA 3UX9B 1PBYA 2AABL 2F15A 3MLVH 2WQ8A 3BQUC 2HG5B 3RVUD 3AREA 1FL5B 4RQQA 3BZFB 3LZFL 1DVFB 3W0WD 5IFJA 3V52L 3D85A 3MRRB 5E2UL 3N50A 3E3QE 4ZQKA 2R0WH 3LKQB 3OTTA 4DEPB 1EV2E 3TBTB 1XCTB 5I6XB 1MFCH 2MNUA 4O9HL 4OJFH 4LCCB 3QJFA 5BRZE 1QEWA 4YNYA 3GSWA 1HKLL 1AJ7L 1RHHB 1UZ6E 3FTGA 4ERSL 4J6RL 5E6ZA 4IRJB 3QI9A 4NKIH 1NCCL 3ROLB 4PP1C 1D5IH 1V3KA 2VDQL 3NN8B 1G7IA 1CCZA 1FSKC 4ODVH 1U8IB 5C07B 4CMMA 4RFEB 1IL1B 5KVGL 1XZ0A 5ESAA 2IJ0C 2A9NH 1A6VL 1KBGH 3JSSA 5DFWH 3WSQL 4QOKD 4KUCF 1E4XL 5F70A 1CGVA 2OTUB 4JN2B 1BPVA 3PGCB 2A83B 1D3CA 3WKNA 4HUWB 5ILTL 1MHPH 1B0WA 4HFWA 4J7RA 3RWCA 3NAAH 1PDKA 4WFGD 5LCVH 5K93A 1I1AD 1NBQA 1CGSL 3LKOA 4NHCL 1FG9C 1QRND 1UZ6F 3QQ3A 5DQ9B 1P7KB 2XACC 2A77H 2UV3A 3KAAA 4ODBD 4S1DC 3DYOA 5ADOH 5DD1H 4OLVH 4HAFA 4HJGB 1RJCA 1S5IL 2R4SL 4X4XB 2ESVB 3D0LA 4HMDA 5FO8B 4GRWE 5DFTA 1OSPH 4PJ8D 3BIKA 4JY4B 2ARJQ 1Q9KA 5DVMA 5CBAA 1VADA 4QTHB 5I8CA 5IFAL 1W0WA 5C0JA 5EPMB 1JTPA 1MH5B 4G43A 3HZKA 1Y6KR 4XT1C 5K9KB 1F3JA 2APBA 4YK4C 1HOCB 5E08L 4Z7OE 3QIUD 5AUMA 2IFFL 2DF3A 3JTTB 1KENL 3KLHD 3CXDL 3ETBF 3DRTB 4MSWA 1U8KB 2NTFB 3GGWA 1HH9B 2WBJB 3KYOB 1K8IA 4GW4A 4OCSL 5IEKA 4BH7B 1MEXH 2BY2A 3QDMA 1ZV5A 4QHNB 2P43B 2X4OA 2FRGP 3EKCA 1JN6B 3RDTA 3HNVH 3JWOH 4GRWF 4TQEL 4AG4H 3DMMA 3EYVA 1ADQA 4PYHA 2KZWA 1PSKL 2OQJA 5GS1B 4DGIL 2E3VA 5H37G 4OV5A 3BPNB 5TFSH 4HLZH 5D7LA 2W9LA 1WBYA 1BQHA 3ABZA 4Q6YA 1MWAL 1KCSL 1HHHB 4PGCB 4M48H 3MV7D 1ES0A 2B39A 3RGVC 4LMQE 4U6YB 4AT6A 1BQLL 2PN5A 4W70A 5IMMA 3ISWA 2QL1A 2BMKB 2Y5TB 4Y4HA 5FM5M 2CMRH 2W91A 2XTJE 3SGKA 3BP7A 3L3IB 1M71B 4QRPE 3LRHA 4I1NB 2AERT 4NWTH 5IMKA 2LAGB 2NY0D 4K3EH 1CT8A 1KFAH 1MCBA 3QEQD 4NQCA 5D2LA 1JIBA 5CJ5A 1OL0A 5T1LB 4JR9H 4ONHB 1W72B 1Y18A 2YD8A 2E9IA 1A1MB 1DDHA 3H6JA 4Y16B 4QRRD 3BZEB 2GCYB 3MRIA 1IGCH 3IKCB 1N64H 4Z7WB 4OLXL 3C5ZD 1J1PL 2EDDA 3ARVA 2ED9A 3SCMA 3EOTH 1WJ3A 3HNTL 5C6TH 3V4VL 4XH2B 4AMKH 4KJQC 5F7DA 2CRYA 4YR6A 3EFFA 2IANB 4CADB 1KB9J 4BQBA 1HINH 4RA0C 4YIQB 1DN2A 4KKNA 5D96B 4N68A 1JHLL 3KLAB 32C2A 3RZCA 3UBXG 1T4KA 1TJGH 5ANME 2GTZB 2OZ4L 1PQZB 1JZ3A 4MXQD 2ADGA 5L9DL 1URLA 1LO0H 1AD9B 1INDL 4KK8C 5DVLA 4U31A 5JMOC 1KXQE 1EMTH 3P9LA 3QAZB 1TQBB 1RZJH 3PDOB 2Z0BA 3IRPX 1AI1L 4M6OL 4JFEE 5E4EC 5EU3B 3STLA 2H8PB 1JUFB 4PJ5A 1L7IL 4JO4H 5D72H 1KB5L 2PO6A 4K7PX 4QWWC 2Y25A 3KS0H 1PY9A 4PR5A 1GGUA 4K7PH 1ZVHA 4OQ1A 4UOW0 1D9KA 3MX0A 1OF2B 3OWEA 5JOPD 5I66B 4PY7A 5HHVH 1QTYT 4JVUA 2WANA 3QXDB 4F2MA 2WLYA 3NPSB 5HY9A 3P3YA 4ELMA 8FABA 3S3PA 2VMFA 1H5BC 1YY9C 2APXA 3MLUL 4PGEA 5INDB 3S4SA 1AGFA 3QA3A 1JWSA 3KPPA 3TFKD 4AH2A 1B0RA 3HCVB 3MODH 1FIEA 3PHOA 1QBLH 1RU9L 1CLOH 1UG9A 2BC4A 2VXVH 2P8LA 5D7JC 1EVUA 4JAMA 1T20B 5MENA 4DGVL 1UCBH 5F3BA 4ZNCD 3ZTNL 4R4BB 3NACL 4R7NB 4PV8A 1INEL 3PGFH 4RAUB 3R1GH 4U1KB 5IQ7H 1F6AB 4HK3J 3ARRA 4EI6A 1YMMA 1U8LA 1P5VA 5GS0L 4U3HA 5TF0A 3S5LB 1RZGB 5DHVB 5JZ7C 1XGTB 1OGAD 4TUOA 3M1BB 1T6WA 3NCCB 3TESA 4NGHL 1IC4H 3IFLH 2X1XR 2NY6D 3QFJB 4EUPG 1PG7H 2FJGA 3DXAA 4L9LC 4A6YL 1T21B 5DT1H 1R24B 5FYLL 4TUKH 3BJ91 2FYYB 4D3CH 2NX5B 3CUPB 3ESUF 5EIIA 5I30H 1FO0L 4FZEL 1BGXL 2CSPA 3QO1B 5T1KA 4LSVL 4R26L 1R0AL 2C1OB 4JRYA 1CICC 2VABB 2I9LB 3PNWB 4PRPD 3JXAA 2YRZA 3DWTA 4JPWL 4ZFOA 1GHFL 4HS6A 3F7YB 3D25A 4YDLB 5DD6A 4HDIB 5B39B 5E1AB 3ULVL 2Q8AH 2P5ED 3D87B 3DVIA 5I17A 1JZ6A 4PGDB 4G6JL 4O4YH 1JNHA 1X5IA 3O81A 4U1NB 4X6DE 2YR3A 3ARGC 3BH9A 3HUJA 2R56H 4AENB 1RIHL 4XNXH 4S0SD 3BVNB 4OIIH 1OWRM 1FVEA 2ITDA 3TNNA 5I16B 2VNCA 1IC7H 2GQHA 5DGQA 5F1NB 5IVNA 4G8IA 4GRLB 3GI9L 3ULUL 2WWMC 1ZLSL 3QIWC 2BVQB 2WMPA 5CKAA 4R8WL 1MAMH 1G9MC 1MFAH 4JY5H 3WD5H 1I7RA 2XICA 1F90H 1FFNA 4P9HH 3VXSE 3VXMA 5CGYC 2JJTC 3LKNA 1U8QB 5ICYB 1ZWIA 3ZLQC 5TF1H 5E5MA 4JG0H 1VFAB 4X6DF 4JZJA 1A3QA 2EDJA 2ADJB 3VXPA 15C8H 2YD5A 2CXGA 4M4PA 1MLBA 4NJAL 4OZIA 1FFQA 2OTWB 4I2XA 4BSJA 4RDQF 4UTAH 2P7TB 5BRZB 5AZ2H 2FO4B 4FFZL 4HJJL 1A7NH 3IDMA 2XQBL 4OLWH 5MERA 1YEJH 3O4LA 4OCRL 2C3WA 4MDJA 5FHBL 1DBAH 4CBPA 3QRGL 1AQKH 1LNUA 1F4YL 1YYMH 2YXMA 4FABL 4K2UL 1YEKL 3CCHA 5JDSB 3EOBA 3LN5A 4FN0A 1T1XA 4KKAC 3GSNH 4JHZA 3SDXF 2IALA 1BBDL 5D93B 4Q9CA 1F4WL 2RCSL 3TYFA 1ZVYA 5CP3A 5DC0A 3HE7B 3C09C 2F53E 4XGZB 5D7KD 4H25B 3HG1E 2XN9E 5I15H 3QNYB 2Q8BH 2JE8A 4LVEA 3EYUL 4S0TD 2DLGA 4JB9L 4UMGA 5DZNA 3GB7A 3N0PB 4ZUSB 5C0EB 3HTLX 4X0KB 3FO2A 4L3ED 3QXVA 1UYWL 1TDQA 2FZ3B 3O3BA 5CILL 5I1AA 4JJ5B 1MI5A 2F5BH 3BRFA 2D7MA 3HE6B 4PB0L 4PJGE 3ESVF 5GSVB 5I1EL 3CSYB 2GFBA 2LAAA 3L7EB 3MR9B 1FVDA 1OTSC 3GBLA 4I4WA 2GT9B 1OAYH 5HDOA 4JM2B 3RGHA 1KJ3H 1WWWX 2VDNH 2VE6B 4P4RA 4C56D 2DI8A 5GJTL 4HUXA 5I1LB 2DS4A 5HHMD 4BK4A 4BFIA 4YWGH 3IGAB 5TQ2L 4XC3L 2WP3T 1I3GH 3B5TA 1J8KA 2DD8H 4MAYC 5ESVB 1QLRA 3TO4C 1NC2B 1T7XA 3WDJA 4QRUA 3F65A 1OQXA 3UZVB 1CL7I 3EYOB 1IARB 5EWIH 3K2MC 4Z95H 1MFBH 4HAGA 4ETQA 2DN7A 4XXCC 1CTOA 1YN7B 3L9RA 2DYPD 2FH8A 3OB8A 4JVWA 5EOTB 1U8JA 3BRGC 2DWDA 1MCSA 5IVXF 1YEEH 3LKRA 3GMPA 3JV6A 5JA8B 3NFPB 5JIHA 1EAJA 2NY4D 3VFGL 3ZHKA 4IBLT 2R2HB 2RQ8A 4RFOH 2FL5B 3TJEH 5F1KC 1XIWB 4PJ9C 1CE6A 1J5OL 3PWPE 1IEBB 3KVQA 4HWBL 5IB2B 2XTJB 2ITCA 2X09A 1QR1B 1K4CA 4QRPB 5FUZH 3EOAA 3MLVL 4FQXB 5DA4A 3VFOB 2EYRA 4DVRH 1ZA6B 5BO1L 3QDJA 2H2PD 4RFNB 1OT2A 1UKSA 3T4YA 3KPRA 4P46A 2R0WL 3KXFD 3KPLB 4IDLA 2MHAB 1G9NH 2Q1EA 4MA1B 5F7EH 5TGBB 2PYFA 1NAMH 5GGSA 3REWA 4OJFL 2XFXB 2VXUL 3EYFA 4LOUC 25C8H 2EYTB 4Y19B 2QKIA 1GXEA 3QDGB 3KLSA 5C09E 1MCHA 4NKIL 2R4RL 3H42H 3B9KD 2AK4A 1EO7A 3HZMA 3L6FA 3V4UH 1SVZA 2OP4H 5HYQB 1D5IL 4ZS6D 4LCWE 3MA7A 2M1KA 2R2BA 3ARPA 3VG9C 3VXUE 1W8OA 3DI3B 5BVPL 4CN4A 1CGTA 4Z0BL 4LEOB 1U8MB 2A9NL 1KBGL 5F72S 4AQ1B 3IJYB 1AKJB 1F3DJ 3P4OB 3QUXA 1A0QH 1UT9A 1VERA 4U1IA 4YQXH 7FABH 4FMFA 2NY5H 3P77A 4JFEB 3T0EA 2QADC 1F45A 3NAAL 5CJ8A 5LCVL 4PD4K 5EU7C 3RFZC 3GSOB 2HKFH 3QHZH 1KIRB 3SQBA 2OMBA 1CI5A 2FDBP 5J13B 4L29A 4E42A 1G7PA 4P2CG 2ZWLT 3KPOB 1TITA 4HKJB 1HYSC 4NQDB 3TA3C 1H3GA 3RNQB 1T04A 1DLHA 1UWEL 4WTZG 3WFDL 4Y4FD 1DBMH 5F3HB 3UAJD 3EAKA 4XNMA 5T5FH 1CL7H 1X5KA 3OKMA 5M7QA 4Y5YC 4LHUA 1CU4H 5E9DA 4KTEH 4OZFA 1U3ZA 5E2TL 3S3SA 4Z9KB 4P48A 2V2XB 1NFKA 1U3HC 3LOWA 4JREB 4NWUH 1UJ3B 2BVPA 3DVGB 5C9JA 4JY6A 5F96H 1GIGH 3T4AA 2X6MA 5SV3A 3O9WB 1UB5A 2ZNWA 1MEXL 1XF3A 4CVUA 3E6FB 3JVGA 4YZFF 1YNLL 4E41E 5DEZA 3PWJA 1FZMA 4XXDA 3OQ3B 3KYNA 3MV8E 3HNVL 1E28A 2VLRE 3P9MA 4QRTA 4X5LA 1MLCA 3MXVH 5I76B 3S9DB 3U30C 5ICZB 3AVEA 3ZDYE 3QUZD 4LSPH 4ZDHB 2GJ6A 3EJZD 2WBKA 4HMEA 3U4EB 3SDDC 2BSSA 3PWVB 5TFSL 4NUGL 4OLUL 4MQTB 1F42A 4MD4A 1G7LB 2E8ZA 3DX6B 4J3TA 3OKDA 1PKQE 5IW1B 2WUCH 3QWOA 3C6LC 1Z9LA 4NRZA 3U4BH 4KU1A 3QUYB 4G8GD 5DO2C 1A4KB 1YEIH 4P4KB 2P24B 5DLMH 3SO3B 2N4IA 2VIRA 4WHYG 4OKVA 4A2LA 4NPYB 2CMRL 2DLIA 2IPKA 1P7QA 3D18A 2EE2A 1RUPH 4NWTL 1H15B 5IJVB 2DKUA 4K3EL 3PP3K 4KPHH 3GSXA 3P0YH 1BM3L 4JR9L 2Q76A 1DTUA 1W72L 3FO9A 3IAQA 3ZDYF 3QR2A 4X9FA 4KKCD 1IGCL 3TEUA 1BJ1H 1R3HA 1CICA 1N64L 1DEEA 3F7QA 1WK0A 3P4LA 4YGVB 1HYRC 4P2OB 3LKSA 3WFBH 4AYFA 1AHWA 4JHWL 1NCWH 2GTWA 4UQ2B 3V6FB 5C6TL 4WV1B 5F9AC 1P5UA 5BS0E 4X6DB 1A6UL 2KH2B 4D0BB 1HINL 3JWDC 4F9PC 4M7LT 2FHBA 1GCFA 1JWMA 3GSRB 2BCKA 3WE6B 3EDFA 4XC1L 3WUWA 1MY5A 1C7TA 3ARGA 3MRBB 4H5SB 1I8KB 4MX7A 5AD0B 1XF2B 2HJFA 3PABA 2JIXB 1LO0L 1ZHKA 4U6XB 3RBGA 2BVOB 5J3HC 3KJ4C 4MB5A 3WNLA 3B8YA 4HWZA 5ALBL 4JG1L 5GGVY 4GW5A 1EMTL 2PW2B 5BQ7A 3E8UH 5GZOD 4FG6C 3VXSB 5T33H 5TDNB 3SKUD 3VW3H 4HH9B 4RNRA 1E4WL 5DRZB 3QIWA 3MNWA 4RMWA 5CHNB 4K3HA 4JO4L 4OZGE 3KS0J 8CGTA 4GG6F 3HAEB 3WIFB 5EO1B 3W81A 4GAGH 5I8KL 4F9LC 1RUMH 5A2IH 2OI9B 4Z8FL 4OCXL 1V7MH 5EU4B 3CFBA 3ELAT 5HHVL 5GPRA 1SYSA 1T22A 4GMTH 2YD2A 1HQRA 4JM4H 4WHTB 4I77H 3VFVA 5KSAA 3TLRA 2UYLA 3SKOB 4K71B 4XBGA 4OGAD 3MRQB 1X5YA 1I75A 4P2QA 4WEBH 3E1F1 1NAKH 4L8SA 5AEAA 4G6KH 5KS9A 1HXYB 4YAQB 3CVHB 2FIKA 2VXVL 1CLOL 4M8QB 2NW3A 3HRZB 3V6ZB 4OZGF 5HHNA 1UCBL 1G7JA 1IGML 1QQDB 2MQCA 4NNXB 1X9QA 2ZUSA 2GK0B 4OAWB 4G8EB 4EI5B 1HHIB 2F53B 2H32A 1XR9B 3PGFL 5ITFB 3R1GL 1ONQB 1U95B 3VG0H 5CEZE 3HG1B 2XN9B 2RHEA 4JPVH 1WBXB 1S9VA 3D39A 5DD5L 3BYTA 5LXGH 4KGJA 1GC1H 4XP6L 3OF6A 2E7LA 2BNRA 2FR4A 4PJXE 3RWIA 2CO7B 2HTKC 1V05A 3IFLL 4XRCA 4Z0XA 3IDXL 2AJ3A 4ZXBA 3MGOB 3QXWA 4UDUB 5JA9A 5DT1L 3HLAB 1WV7T 2EC8A 2XIDA 4TUKL 5C08D 4BSWB 5J6HB 3T8XB 3WL9B 5C3TA 4D3CL 4M1CC 5I30L 4PJGB 2GSGA 1N4XH 1DN0A 3GSUA 4Q2ZA 5C0CA 3EO9L 3RX7A 3FQXB 2ICEB 1JHTA 1FLTX 3C6SB 3AY4C 2FX9H 3U0PB 3V5DA 3AXLA 3PL6D 3MLTA 1WVZA 3QH3B 5FKPA 4R90H 2CK0L 3C5JA 5IB3B 5F7HA 4H8WH 5CLWA 1CG9A 4TPRH 1U2CA 3FFDA 2O61B 3L5IA 4Y4KC 2H26B 3TH3T 4PJXF 1CTNA 4M1DH 2YWYA 3Q6FA 1T2JA 4XMKH 4N0CC 3MV9A 5BV7H 4XCEB 4MWFA 1CFNA 4ZUTA 5HJ3B 2YD6A 4O4YL 5JW3H 3QDME 4LIQH 4YHNA 1BZ7B 4PLJD 5B8CB 3FMGH 1YPZA 2R56L 1HNFA 5GRYA 3V6BR 4NBZB 4XXCA 4MQ7A 4NIKB 4X6BA 3IFNH 3BO8A 1PFCA 2V7HB 2OJZH 5KZCB 3PWPB 3BT2H 3V5HA 4NM4H 4K3JH 5HGAA 2C4FT 1OB1B 5ICXB 5KAQG 3O6FD 4GQPH 1MAML 4Q6IC 1MFAL 5J6GA 4YHLH 4PJ9A 3VFUA 4RMSA 2ILLA 1F90L 4P9HL 1JGDB 1YECH 5IV2B 4D9QE 1GGBL 5TF1L 1WWBX 2VLLA 3KPSA 2X4NB 4JG0L 1KTLB 1SY6A 3LKPA 4HUMB 4TUJA 3SJVB 4NQCE 5EORH 1A64A 5D2LE 4WO4B 1XF5B 15C8L 4JEGB 5FIEA 1P4IH 5EZJA 1T0NA 4UTAL 3H9SE 2EYSB 3NIDF 4OD1H 1YEDB 4YE4H 2ZCKH 4BUHA 1ZGLM 4Q0XL 1YEJL 1VHPA 3RWEB 3DO7A 3VMPA 3TT1H 3V0VB 1DBAL 4X9BA 2ZSWB 4OZ4A 3F6IA 2VL4A 2XY2A 1AQKL 4PRBA 4EDWL 2Y06H 3VXUB 3GSQB 4MS8C 4KI5D 1FNGB 2GAZA 1DR9A 3DBXB 5JNYA 3BD5A 3DV4B 2R2EB 1MIEL 3TNMA 3H9YA 3GMQA 1P1ZB 3FN3A 3FRPA 2VDPH 3GSNL 2PYEA 4EQ3A 5JW5B 1NEUA 1A9EB 2W0FA 4YJZL 1ETZA 3MGAA 4HIIB 3C60D 1IM9B 1RK0A 5DMIL 2JLLA 1AD0B 3VWJC 4MD0B 4JFFD 2FJFA 4O51A 5GGTA 3K4AA 3PP4H 1KTDA 2AJZB 4Z76B 4MJIA 1QR4A 4PJ5E 1PZ5A 2Y6SC 5C0GB 3LH2L 2X4UB 4NUJB 3K1KC 1MCCA 2AXJA 1JWUB 5IF0A 2SEBB 4ZTOH 2XQYG 3ORJA 5SWSB 1C5DA 4XWGH 4XPBH 2HRPH 4NCC2 4ENED 1AR2A 4QXGL 4YXKH 3UJIH 4HHAA 1OAYL 5ALCH 2V2WA 3NCBB 1R5VA 4RBPH 5DUPH 1KJ3L 4Y2DA 1MHCA 4Z7UA 2VDNL 1AC6A 3CZFB 2FO1A 2Z93A 5CJBA 1CE1H 3QZWA 2FECL 4XPHH 4RX4A 2B5IB 1U3HA 4NKOB 1UWXK 4YPGB 5DK2B 5HGGS 4NRYB 4E41B 1I3GL 1I1AC 2R1XA 2XY1A 3G6AB 3GI8H 2HKHH 2ZSVA 4JLRA 3L7FA 1CFQB 3UTSE 4UT7H 4BKLA 1HKFA 1S7RB 5EWIL 5FF6B 5FYJE 4Z95L 3SY0B 5HI3C 5HXMA 4MNGA 2AW2A 1DQLL 1QG3A 2ZKHH 1KSRA 2H3NA 4OFIA 3VRLE 3QDAA 4YHYC 4PRNA 3FB8A 1QFHA 2AJYH 5DZOA 4BYHA 4LSSH 1GGCL 1QSFE 3MV11 2O5XH 4GKSB 3VGAC 2DWEA 4DKEH 1WC7B 5DUBA 5EO9A 1FYTD 3OX8B 4NKDA 2J2ZA 4DN4L 3SDAB 5JXAH 3LY6A 4DVBB 4K8RC 3OR6A 4TVPE 4X9HA 3G6DL 5FUZL 2E6PA 2BFVH 3JBG7 4CDGC 1NBYA 2DMKA 1JPFB 2A6KB 4AM0B 1UZ8B 1OM3H 1G6RA 4DVRL 1NGXA 2ICWA 1P6FA 1U8NB 4B5EA 1YUHA 1B3JA 2FX7L 4OGYL 5HDBF 3ULSB 2KBGA 2GIYA 1JMZA 4CVXB 2CIIB 4X6FB 5F7EL 1NANI 5C6PB 1NAML 5CGTA 5CCKH 3NH7H 2OXHA 2OCFD 1ZLUH 3VRLF 5JPNA 2WK2A 1MJJA 5C0BE 3EYSH 1QRKA 1QBAA 4JRWA 1K2DB 5DR5L 3WNPA 1GVIA 1AGCB 3ZO0A 5KSBA 3PQYA 1LO3H 3H42L 4LAQH 1I1FB 3BZ4A 3IFOA 1SM3L 5IBTH 2OP4L 3O6LL 3LDBB 3OXSB 4IRJD 4CKVX 1NC4A 1IILE 3T3PF 4HBCL 4K7FB 1MCOH 3GEWB 1WITA 3FO0H 2GKIA 4YXHH 5DI8B 5FYKH 1KLGB 5F71A 3RVXC 1YJDC 2F54E 3D69A 1FNEA 1LO5B 2CQVA 1BBJA 4YQXL 7FABL 2E9WA 5BCAA 3U9UA 3KHQA 2VL5A 2ZCLH 2NY5L 2PTUA 1N5YH 4IRSB 3LEXB 3JV4A 2HVKB 1FGVH 2ZOLB 3BAEH 3EJYC 1MCLA 2HKFL 3QHZL 5D6CB 4XP4L 2E5EA 1MQKH 2EDNA 2NY3D 3C5ZC 4F7TA 3WFHA 3PJSA 2NXYB 1BX2A 1NUGA 5CJXC 3VXME 5IFJB 1NCDL 3VGDA 1YDPB 3DUUA 3OSKA 3D85B 1ZT7A 4ZQKB 4XVSL 2XZAL 1DBML 2AS5M 3JTSA 4JQVC 5T5FL 1CL7L 2WINA 1CU4L 4KTEL 4DKFH 5FECA 1ORQA 4OLYL 1A47A 1A5FH 3BYYA 2DI9A 1MFDL 1QEWB 1KG0A 3SQOL 4WY7H 4YNYB 3GSWB 3W39A 1P4LB 4X4ME 3FTGB 3AGVA 5IROC 2J5LC 3GO1H 4HG4K 4NWUL 2VN7A 3O4LE 4L4VA 5MP6H 1GIGL 3S96A 3X17A 2IMMA 1G7IB 1AO7A 3L3JA 3I3DA 2KZ1B 4CMMB 4XVUC 1KGCD 3MSPA 1XZ0B 3QQ9C 5T5NG 1Q94A 3UTTE 3FB6A 2IPUG 5BMFH 2V17H 4F3FA 3S37L 1KN4H 3NABH 1KTRL 5L2KD 3SDYL 4LSPL 3ARBB 2XWTA 4UILL 4AEHH 5E70A 2CDGA 2CKBH 4NZRH 3LHPL 1A9BB 3CC5A 4M9PA 4HFWB 1Y6MR 3RWCB 4XP9L 3ZT7A 2HFGH 1NANH 1QNZH 4GAYA 1QSEE 5J12C 1LE5A 3LKOB 3QQ3B 3U4BL 4NQEE 4CAGA 1CDHA 1OP3H 1YEIL 2HFEA 3S35X 1FFPA 1J1OH 5DLML 1LDPH 5ADPL 3S35H 1EHXA 4NQTA 3D0LB 2DL9A 5JHDE 3BIKB 5E8NB 1RUPL 4JCMA 2VLJE 1Q9KB 3BKCL 4MLIA 3E6HA 1VFBA 5CBAB 5HGHA 1VADB 2JF1A 4KPHL 3MUZ1 3P0YL 1W0WB 4EDXA 5C0JB 1T0PB 3MBED 4WW2C 4QT5A 1MI5E 3WIIL 2DBLH 4LCYA 1OGTB 4G43B 4BK5A 3HZKB 2NQCA 1VEOA 1TTUA 1F3JB 1A3RL 2GITA 1BJ1J 5T1LD 5AUMB 4ZFZA 2OXGA 4UT9L 5E6ID 3C08H 5AYUL 4O5LH 5F9OH 5A1AA 3R06A 1K8IB 1LK3H 4GW4B 5IEKB 1W8NA 4Y4KA 3BWUC 3QPQD 3M17A 3QDMB 5F88A 2RBLA 2NY2B 2X4OB 2NY6C 3RDTB 3GJFH 3V5KA 4N8CH 5I71B 4UIKH 5DYOA 3DMMB 1RURL 3EYVB 2IAND 3MV01 1J10A 1OHQA 1ADQH 5EBMB 3MYZA 4U1GC 3TH2T 5FA4A 4OV5B 3BMWA 1IGJA 1U8HB 4FNLH 5CD3A 1KPUA 1P84J 3INUH 1WBYB 4UUJA 4R0LC 1JI2A 1HHKA 1ES0B 4M7JL 1C08A 4IM8A 1MCIA 4AT6B 4ODTH 1E6OL 1Z9OA 3DSNA 5DRWA 1WAAE 2Y07L 1TXKA 5IMMB 1NLBH 4MJ6A 4OCWL 4Y4HB 3VW3L 2D4DA 1UWGH 3MZTA 4H88H 3ARQA 1HHJA 2ZUWA 2O5ZL 1WBZA 3BP7B 2YD3A 4Q6IA 4GSDH 5FYJU 2G9HA 4M6MH 5IMKB 3VD4A 1WFTA 2EZ0D 4GAGL 4NQCB 5I0ZA 4MQXD 5D2LB 2X42A 3IS0X 3T2PA 4PRDB 1V7ML 1X6LA 1DDHB 4RRPG 1RJYA 3H9SB 2XZCH 4JKWA 1WISA 1JPTH 4GMTL 4YDVB 3LV3B 4AZ8A 3MRIB 3IJSA 4OFVA 4HFUH 5KJRL 1BFTA 5DMJB 1G7HA 1IAMA 1TPXB 1YC7A 4J3VA 4MD5A 1U0QA 4KQ4H 2VZVA 2DQTH 2R8SL 1EGJA 1T1ZA 1NAKL 1K85A 4M7KH 3SCMB 2YK1L 4OLEA 1U58A 2R29H 1WAAF 3F6LA 5CKGA 4ZS7L 4OQTH 4G6KL 5F7DB 4YR6B 3EFFB 1LEKA 2ZUXA 3CVHL 4WUKL 2AVGA 4Y5XC 4XNUH 3KYAA 4K94H 4POZD 1AR1D 1WT5A 2EEAA 4FZ8L 2QQQA 4HX1A 1FNAA 2Z35A 3E0GA 3RZCB 3HHRB 4KJYA 1T4KB 3FO1A 3VGBA 5IK3A 3IDJA 3WXWH 1KLUA 2JB6B 2QTEA 3VG0L 1S7SB 4U1JB 2ADGB 1OT1A 3V7AE 3PUCA 2VR9A 2B4CH 3W0WA 2EE9A 4WRLA 2YOCA 5LXGL 1YQVH 4WFFE 3P9LB 2D9CA 3OKKA 3UBXA 1D6EA 3OKOA 4HWEH 4FQIH 5J7CC 4PJ5B 1OTUD 2P44B 4IIQB 5CZXD 4ZAKD 3RWFA 5C2UB 2PXYC 4V1DD 1H8SA 2VDKH 4PR5B 4JO2L 3C2SA 2COQA 2FCBA 2DQGL 4MAUH 1N4XL 1TZHA 2YPVL 1MJUL 2NZ9D 4JO3H 4F2MB 3KHOA 2G75A 2NX5D 5HY9B 4HC1L 4PUBL 4AQOA 4ELMB 4R6UA 2Q20A 2LABA 5HHXL 4S1QL 5AZEH 4OD3H 2CH8A 2HFFA 4F8QA 1DQMH 2VWEE 1A3LL 4QOKA 1ZKAA 2Z92A 4H8WL 3QA3B 1JWSB 1N6VA 3KPPB 4TPRL 2WIIA 2VLME 4XB7A 1XGPB 4AH2B 1B0RB 1ZXQA 5HVWA 1RZKH 3PHOB 4GJTB 4JO1H 2QBWA 2BC4B 4KJPC 4XMKL 2P8LB 4MA7H 1JNNH 3UTSB 4JAMB 1HI6A 5MENB 5F3BB 4EOWH 4M62H 1U93B 1KF9B 2VTFA 4CJ1A 4XPAH 5JW3L 1I1AA 3HKFA 1QRNA 3PDGA 3B3IA 3P0VL 3MUGB 5CJQL 2P8MA 4KROC 4PJCE 1WUNT 3Q2CA 4PGZA 5GRZA 1YMMB 3BH8A 1CF8H 1U8LB 3GNML 5IHZA 2HT2D 1FYHB 2YBRA 3DV6B 5L8LB 5SWQB 4PJ8A 4ODWA 1C7SA 2JJSC 4HV8A 4MNHA 4NHUA 2OJZL 4TUOB 4X5XA 3BT2L 4KTYA 3L3GB 2B8OT 4NM4L 5DQJA 1XT5A 1SVCP 4LFHG 3STZA 2A6JB 2Y36H 2UUDH 4DWHA 4LP4A 2VXQL 5CBEA 1UEMA 3SE4C 2EC9U 3EFDL 1IFHH 4G9DA 4FQHA 2YA0A 5MEOA 1UM5H 3JWNC 3ARDD 1EXUA 3QIUA 5IMOA 5EIIB 4L8DA 3T0AA 4EUPA 1YECL 2G60H 2N7AA 1CN4A 2R9HC 2A74B 1QVOA 4FTVE 2QV2A 5T1KB 4NJ9L 5EORL 1S9YA 4OF3A 3F7VA 3QCVL 4KUCD 4PJCF 5K9QI 5SX4I 4EN3D 4JRYB 4X99A 4LNVA 5D1QC 3VFPA 3S8WA 5C0BB 4YE4L 1RVFH 4F58H 3HC0A 2ZCKL 4P57A 4ZFOB 5BRZD 4G5ZH 4HS6B 1CFVL 4RMUA 2MWCA 4E9LA 3D25B 5DD6B 2HLAA 4MXWH 1RK1A 5I17B 1JGEA 3MV7A 1A7PH 1HIMH 1JNHB 1FNHA 4QTIH 4WI6A 3H3BC 3RVTD 1JNLH 2PTVA 4KVNH 3BPCA 1D7FA 3DRQA 2VKXA 4Z18A 3BH9B 1TVDA 3EUUA 3G5YA 4FQJH 4HT1H 4BA8A 1FVEB 2ITDB 3ALWA 3TNNB 4DZBB 3TIDA 5MEPA 5KOVC 4I3SH 2H2PC 4OCYH 1ORSB 3QEQA 4G6FB 1F4HA 4G8IB 4HSQA 5EU6E 1DBJH 4OKDA 4IOIA 2J7LA 4EBQH 2Z8VC 3MCKB 5C2BL 3QFDA 4UIMA 4QRRA 1M7DA 3PP4L 1FFNB 4QY8A 3VXMB 3JV0A 4I13B 4FFVD 4P23B 5TE7H 3M45A 1ZWIB 3OAYK 3B9KC 5I0DA 3EBAA 3C5ZA 5E5MB 5DDHA 3UZQA 4JZJB 5GRJL 5CJXA 4ZTOL 4DUWA 2D7QA 3ZDXE 1QFUH 4OZIB 1MLBB 1FJ1A 4UT6H 4I2XB 4KHXH 2HRPL 3TPKA 4GS7C 3UJIL 1F5WA 4WU5A 1NJ9A 3DROB 3IDMB 5MERB 3O4LB 4TULL 4MDJB 1CE1L 4G9FE 3EZJB 1N7MH 5FUCE 5L8JB 3I3EA 5E2WH 3MRPA 5IROA 1LNUB 3RHWK 2YA1A 5E2VH 3CX5K 5KS9E 1CD1A 1SQ2N 5IVOA 4NBYB 3RAJH 1S5HA 3CCHB 1BAFH 5DMKA 2OTPA 2DICA 3EOBB 3LN5B 2HKHL 1T1XB 3P9WB 4OFKA 4FQPA 2IALB 5IKCA 3J7HA 3IKKA 4KXZI 3MCLL 4WI4A 3TYFB 3G6JF 4BZ2H 5LQBH 5CP3H 1M05A 3L5WA 1A2YA 1CDBA 4Y4FC 1QSEB 2DQFA 3UAJC 1KNOA 1IQWH 3WBDA 5SX4H 3D39E 3OAZK 3R0NA 4OIAA 1RZFH 2O5XL 5K9OA 3G08B 1WTLA 3EW3B 2DQEH 1OP5H 4PJFF 4HF5H 4M5ZH 3ZHDA 5JXAL 3V8OA 2IAMD 3GB7B 3HMWH 4MHHG 3BQUD 3H2WA 5C0RL 2VLJB 4R7DA 5F7UA 5FV1L 4NQVA 3FO2B 1G7QA 3OAUL 2Y23A 3WO4B 2XTJD 3O3BB 5I1AB 5K9JH 1MI5B 1BP3B 2DIBA 5BVJB 4Z5RA 4ZNEA 2V5MA 5C0CE 2GFBB 4I4WB 4RWYL 4L1HA 4WEMB 4WW2A 5CCKL 4ZPVA 5C1MB 4O2EB 1MJ7L 3QUZC 4HCRH 3EJZC 2E8YA 3U83A 3L3OA 4HUXB 4JGJA 5JHLH 5HGBB 3K8KA 1B6UA 4BFIB 4PP1D 1JPSH 3EYQC 4LAQL 4JZNA 1V3LA 1WZ1L 2DTMH 3U82B 5IBTL 3G5ZA 3VFSA 4QRUB 5I1GH 4ZUUA 1OGAA 4Y5VC 3ET9F 4NKMA 4IEFB 4FHBD 4ETQB 3FO0L 3L95A 4DOHE 2J8UF 3L9RB 4YXHL 3TCXA 4ZO8A 5FYKL 3TH4T 4N0FA 3BD3A 4YHZH 4UBDC 2DWDB 1YPZE 3LKRB 3GMPB 3JV6B 5EZLA 2XQYK 2OLDA 1WTGT 2WIMA 1NFDE 1N5YL 4FXGA 3AS2A 1FGVL 3RL2A 4KKCC 1OCWL 1MAKA 4S1DD 1C5BL 2F58H 4N0UA 4CN1A 4JFED 1N2RB 3DUSA 3RWGA 4DGYH 3EOAB 3F7RA 1TZIA 1AQDA 1C12A 1MQKL 2BSTA 2EYRB 3U7YH 4PRPA 4XI5D 3EJJX 2XXMB 3QDJB 3GMLA 3T4YB 5F6IC 3KPRB 2AAVA 4P46B 5D7SH 1A7QL 3QIBC 2BNQE 2PYFB 2P5EA 5GGSB 4KXZH 4DKFL 1CIDA 3LPGA 5J56B 1EEZA 2HT4C 5E00A 3SE8H 1YNKL 1ZGLP 3EYFB 1NSNH 2QKIB 2C5DC 5F7MC 1TZGH 1NFDF 2J12B 3FN0H 3WJJA 3ZSSA 3GO1L 5L6YL 3W5MA 3QHTC 4XVTH 4XX1E 2FHFA 2AK4B 4JQXC 3HZMB 3L6FB 1AXSA 1FC1A 4YDIH 1HZHH 3QISA 2P47B 3MA7B 2R2BB 3CDGA 2VR5A 5KVDH 4N8VG 4W6XB 1RIVH 1GZQA 1BIIA 2JKXA 3IRZA 5CEZL 2V17L 2PYEE 3NABL 3TZVD 3QUXB 4U1IB 1XF4A 4AEHL 1ND0A 1IVLA 2XWJA 3RWJA 1U6AH 3T0EB 5EFIB 3RGVD 4IMLA 5D1ZA 3LQAC 2XRAH 1J0HA 2HFGL 1QNZL 5ISZD 1KULA 3N1GC 5HBBA 4PRHE 5FHAH 3VWKC 4ZFFA 2DM4A 1ZT1A 3GZKA 4LLDA 4L29B 1J1OL 4OGAC 5B38G 3V95A 2K9UA 4PRAA 1HE7A 4FOMA 3S35L 1H0DA 4MJIE 5IVZA 3QUYD 3WKMH 1DLHB 4BZ1H 4JFDD 5HHOD 4NC1C 2RGSA 3OKMB 4LHUB 3AUVA 5E9DB 4L4JA 2DBLL 4OZFB 5T3ZE 2QJDA 4YHMH 4PJBA 3B2VH 2DQCH 1EHLL 4MQSB 4ZUWB 1H3WM 4ZMAT 4WTZA 2FWOB 4FQ2L 4LLQA 2QHLA 1OLZA 1ZTXH 4Z7UE 4OZHF 4O5LL 2X70A 5C9JB 4JY6B 3L5XH 1LK3L 2R39A 1UB5B 1RUKL 1XF3B 3SGJC 1FZMB 4XXDB 4PJCB 3KYNB 4N8CL 3P9MB 4PJ7A 4UIKL 4OV6F 1MLCB 2VQ1A 2A6DA 4E0RA 1ADQL 3K2UH 1NDMA 5GIRA 3SBWC 4I0PC 4MNGE 2X4RA 2BSSB 4BQ6A 4FNLL 4HJ0D 5JORA 4MD4B 3VFTA 4L3EA 1B4JH 1DBBH 2YEZA 3OKDB 5C70A 4HUKB 3PL6C 3BESR 2P1YA 3KR3L 3QWOB 4NRZB 4ODTL 4UOW1 4U4BA 3V4PH 4Y88A 3O2DH 4WWKC 2VIRB 3TIEA 5TPWH 1O5DT 2IPKB 3UDWC 1BWWA 3P40A 4QWWD 1P7QB 5I19H 3GKZA 4WI2A 1MIMH 3CFKA 3ZTJH 1OD9A 1JGUH 2IGFH 2HLFD 4HUUA 4M6ML 3VXSD 4FTVB 4C56A 5JQ6H 1GGYA 1TENA 4EXKA 3BXNA 3GSXB 5D2NE 1G1YA 2Q76B 2YSSA 4NM8L 5K33A 1NGPH 3FO9B 1DANT 1B2WH 3AU1A 1JPTL 1FAIL 2R69H 3UROR 2OR9L 3B9DA 1UCTA 4HFUL 2NY1C 4NO0B 2X41A 4OLZL 4PJAA 5DFVC 1DEEB 2Z4QA 3CIQA 4KRNA 2DYPA 2DQTL 3LKSB 5KVMC 1AHWB 4HIJA 2GTWB 4MNQE 2D31B 2YHGA 2R29L 5KAQF 3WNKA 3MLRL 4G42A 1ZE3C 5D7JD 4NT6A 3CK0H 2P5WE 3RWHB 4XCYB 1WWCA 4XNUL 4PFEA 4FQCH 2L0DA 1KIUA 4NP4L 4M93B 4L8CA 3P11H