2FEDD

Structure of the e203q mutant of the cl-/h+ exchanger clc-ec1 from e.coli
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Proton transport,membrane protein
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Separate ion pathways in a Cl-/H+ exchanger
pubmed rcsb
source organism Escherichia coli
total genus 48
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fedD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fedD01
3QIWB 5EUOE 2F54D 1WFOA 1YMMB 1B0GB 3D69B 3GSRA 3VH8A 4MA7L 3T3PF 4RMVA 4OGYL 4LQ1A 4M8QB 4QXGH 1YMMD 5E94A 2ZUTA 2EC8A 1I1AC 5B8CC 2F54E 3MGTA 1KTRL 3KYAA 4Q58C 4DFIA 5CLTA 3DX6B 1C8PA 1DBAH 3BPNB 4HX1A 3SDXA 1YMME 1NMCC 4NZTH 4NZUL 4CKVX 1OW0A 3LHPH 3FO1A 2YUVA 2OXHA 1WIUA 4U1NA 4FABH 1CLZH 2QQLL 3NABH 3RI5K 4Y19B 4O4YH 2DJUA 3EYQC 1MJ7L 5F1IA 5CJ8A 4WWKC 1A9EA 1UH2A 3LKPB 3HFMH 2W1NA 2YXFA 1MUJA 4AENA 3UBXB 1MFNA 2HVKA 4MJ6A 4BK4A 1JV5B 5CGMA 2ARWA 5JDSA 4N68A 2R0WH 5DJ6A 5EU3A 4MZ3A 4ETQA 4J6RL 1F4AA 2X7LA 4Y19E 5FYLL 5GSVB 1S7VB 2MFNA 4LSVL 4YHNA 1TJIH 1V7MH 1UA6H 5EUKB 5ID0A 3ALWA 3H9YA 3TPUB 3V5DA 2AV7A 1INDH 1SY6A 2W0FB 3CLEH 1J1PH 1CFSB 4JDVB 5F70A 4D0CB 4ZQKA 3S8WA 3FT3B 3X13A 3CSYA 1HCFX 5I66B 4XB8A 3AS2A 5LGHL 5DRNB 1N5YL 6CGTA 4O02L 1G7QB 1CGSL 2VXQH 4NO0B 3PDDA 3L6FA 4N8CH 4XHJC 4K7PX 5KTEL 5JTWA 1L6XA 1N4XL 4NO0D 3DSFH 1K4DB 2FIRT 1XCQA 4UI2A 3OKNB 1T1XB 3DGCR 3MRJA 4NC1E 4PD4J 5FO9A 1Q9WA 2MCPL 4GXUN 5SX5K 1GGBH 3C6LB 5FA4B 3ZKSD 3SE8L 4P3DB 1RZJH 3UTQB 4L8DA 4NM4H 2FH6A 1AGBA 3EYQD 4FQHA 3C6LD 4YE4L 1GC1C 2YXMA 3EZJB 1ZVSA 1EMTL 2CDFA 1OAUH 3WUWG 4JANB 3WFCH 1QBMH 3AUVA 1OP5K 4XVSL 3GI9L 5D7IF 2A2QT 3MNZA 4DAGL 5SWZB 3QEHB 2WZPD 1IGJA 2FB4L 3MV8E 3GJEA 1T7VA 5GISL 4G6MH 3UTTE 2ADFH 4OFKA 2FJGA 3ARDB 4RAHA 1FORL 3C5ZC 3IDGA 4NC0B 2DTML 4ZO6A 5SWZD 1HWGB 5JR1L 4CBPA 3HRZA 4YQXL 1NBQA 4WI5A 3O4OB 5HYJA 3ARDD 1NUGA 2O5ZL 2HFGH 3HC0A 4S1RL 2EYRB 4YNYB 3GMLA 3MNVB 4U3CA 2GUOA 1T1WB 1A5FH 2OSLA 4I48B 3T65B 1HKLH 4D3CL 2EDXA 3S97C 4JO2H 3U48A 5C9JA 4X6CA 1FAIL 1KN4L 4PPTA 4P9HC 1JPFB 4XHJD 5J3HD 3Q1SL 1WBZA 5FB8A 5LQBH 5D7JC 3EGSB 2C1PB 1JPGB 1AR1C 1XAUA 4GG8B 4XMPH 2B8OT 1JK8B 2IAMA 1U8HA 1F2QA 2NY4C 1KB9K 1ORSA 2FSEA 3BRDA 4PBWD 3BP6A 1A6VH 1F11B 2ZOKA 2AS5M 1QEWB 3CFBB 3PGDB 3S36X 5DJ0A 3GHBH 2HYMA 1T5XB 4UAOB 4OF0A 2FR4A 1BZ9B 1NBZA 2IFFH 2XI9A 5DK0A 5EIIB 3HI5H 2NNAB 4HT1L 2HFFA 4L9DA 5GGUA 1CN4A 2HA1A 4P0DA 5DD6B 3VGHA 5EC1A 2O61A 3UO1L 4M9PA 4DWHA 4YDKH 3WFDL 1T6VN 1NCUA 1GGIH 1DFBL 2H1PH 1FYTE 1MNUH 4KKAD 1EHLH 2X9XA 3O0RL 3AS0A 5F8QC 1WAAE 3WLBB 3C5ZD 1MI5A 3F6LA 5A3IC 1H5BB 4A6YH 2BNQA 3L3DA 3LRSA 1Q9OA 1VKXB 2V9TA 3INUL 2BRRL 1ZGLB 5FCSH 3O6KL 2CR3A 4NNYB 3ARSA 4U6VL 1M7XA 2E5EA 3O6FC 1KNOA 2E3VA 1QSFA 1QSEB 1R5IA 5DD3L 2ICWA 5TE4L 3V7AG 3KR3L 1DLHA 1QSED 4QYOB 5CEZE 3QI9C 4L4VA 5GRVK 2VZSA 1ND0A 3MRQB 4P5MB 1OAXL 4KUZH 1EVUA 4PJDF 2XFXB 3E1F1 3TH3T 5DD5H 1QRNB 1B4JL 3I2CH 4JFQB 1T2QH 4YHIA 4NBYB 1UWXK 4IOIB 1IAII 1EEYA 4OLXH 1QRND 5DJ2B 4YZFE 4NOBA 5F96H 4PJHF 1IGCL 1DSFL 3VFOA 5FV1L 5MP6H 5HDQH 3VFSA 4LSSH 5C0JA 5C0EB 2BHUA 4PGBB 3OJDA 4GW5B 5IT2H 4E5XB 4GXVL 3R8BB 2D7TL 4W6WB 1BF8A 2BHYA 1FSKB 3QFJA 4KHXH 4X98A 2PN5A 1EEUA 1B2WH 2BMKB 4J3OC 2DWDA 4RNRB 1NCWH 4G8GD 2WWKT 2VXUL 3O81A 4PJ8C 4Y4KA 5C0CD 4L9LA 4I18C 4PY7B 1INEH 4AMKL 5H37G 2IBZY 3SKOA 1TVHA 1JWSB 4KTDL 5EUOF 4DKEH 3GO1L 1D5ZB 1EXUA 1BHGA 3RNKB 1BGXH 5CZKA 3DXAA 4YHKL 1G6RH 3LQMA 1L9NA 1BD2A 1P5VA 5BV7H 4LEOA 2R0LH 4WHYG 4KTEL 4MDJB 1J5OH 3FOMB 4OLUL 2NXZC 3IFPA 2ICWJ 4PJCB 5IMLA 5T33H 4NRXA 5T3XE 4TQEL 1IL1A 1J0ZA 1UWGL 2VO5A 2X4OB 3OXRB 4MXQC 4DOHB 5B38A 1S9YA 4QHKJ 4XNZB 1A6PA 3KPOB 2N1KA 4UTBH 1IMHC 4ODTH 2O93L 3CXHJ 3QQ9C 1DQDL 1HSAA 5E6ID 1TVBA 5BVJA 4PJCE 4S11A 5EO0A 3LRHA 4LVOB 5HGAB 1CT8A 3IDJA 4JHAH 2BOCB 1S9XA 4XNMA 4OT1L 2PR4L 5E8EB 4DOHE 4M5YL 4G6JH 2AVGA 3WDHA 4WIQA 1ZHNB 3T1WA 3FO2B 3HI1A 3BSZL 4WW2F 2Z9TA 4ZMAT 5DUPH 5GZOC 5BZDA 5IEKA 4XNQB 1JVKA 5CZXC 4LKCA 4MXWL 4S2SA 4P3WA 2QJDA 4FQ2L 3JSSA 5BZWA 4NHUB 4FQXA 2EDRA 4Z5RB 1A14H 3W2DL 1BLNA 4HIHB 4X5XA 2MOVA 5EZOH 4XC1L 1WVZA 4X9IA 1RY7B 4P5TB 1QKZL 4O58L 5D8JH 4XCFH 3SDAA 2YS4A 5KVDL 3T2NH 5E4IA 3S96A 4G3YL 4P5TD 1KB5H 1QACA 1Z9OA 3W82A 3ARBB 1UM6L 1SJXA 3U4EA 3VWKD 1AQDA 2B20A 5IF0B 5DRZA 1C5CH 2XZAH 1W0VB 5L9DH 3ARBD 2AEPH 3MR9B 5ICZA 3VWJA 1KIPA 1JNJA 1NEUA 5I1HL 5KBNC 1MFDH 1ZLVK 4TSAL 5JIPA 1TDQA 5T3ZL 1CLOL 3O2VL 5ACLA 3OHXA 4PUBH 5T1LA 5I15H 4F37F 3B3IB 3LKNB 3ETBF 2CUIA 4PJFA 5IJVB 5ESVB 5I0DA 5GS0H 3DJ9A 4RQQB 5DA4A 3S37X 2VAAB 5DR5L 1Z9MA 5E03A 2NR6C 2Y1VA 5DC9B 4JFFE 5I8EA 3S9DB 3RHWK 1OSZA 2BVUA 2DTSA 4PJ7A 5EPMB 4QRUA 4QRRA 4LRNH 3VXUB 3VGBA 4I2XB 1BIIA 2JK5B 4NNPH 3C5JB 1EBAA 3MRFB 2QV2A 3LPFA 2N7AA 4OIBA 5I17B 2E7BA 2F53B 1I7ZB 1Z5LB 2AJXH 3CMOH 3QXVA 3ZTNL 4YK4C 2AEIT 3U6RB 2X89A 5GZNC 2DMBA 2LV4A 4ZFOA 2F53D 3AMKA 5FHAL 3LKRB 3KPSB 3VXUE 1FZKA 5F44A 3TVMC 4I2XE 5L8KB 3LN4A 4U31A 5CD3A 3LB6C 1NCDL 3WJLA 2Q6WA 3KPSD 3MC0A 4FTVE 4L3AA 2HFEA 5F3BA 4KDWA 1KJ2B 1V05A 5JUEL 3IAGC 4GW4B 3NAAL 3B9EA 3DMMA 1K8IA 4UV4L 4LLYB 1MFEL 3KPSE 5D6DA 5JXAL 4Z6AT 1U95A 3IKKA 1WQVT 4ZAKC 4FFYL 4JRYA 5D71H 3ES6B 1MCOH 1CDUA 2NX5E 3GSUB 5TDNA 1TCRA 1IM9A 3BVNB 5J06A 3MCLH 1JWMA 1S7UB 3U4BL 4QT5B 3SE3C 4GG6E 1MJJB 2FX8H 1KUMA 2DQGH 4NRZB 1HXYB 3H8NA 4WHCA 3BRFA 1FFQA 5IHLB 3GKZA 2ATKA 3W0WA 4KMTH 3IVKB 1JWUA 2IALB 1JCKA 3V5HA 3GSQA 5CBAA 1UZ6E 4J3SA 3MRGA 3VRLE 1U91B 1ZXQA 4EBQH 3WYRA 3BZFB 5CZVH 3QRGL 1WTLA 1CXHA 4JY5L 4A6YA 2WIIB 3UJIL 4ZSOA 1U36A 2YKLL 4Z9KB 1WAAF 1MRFL 2XICA 4PRPA 5TF1H 1PBYA 4M00A 4Z0XA 1NANI 5J9PB 5D6CA 2CGRL 2NZ9D 1NPUA 2FECL 3BKCH 3WNOA 4I9WE 3MRBB 5GS1C 4V2CB 3VMNA 1B6UA 5IB3A 2ZSWB 5IFJA 1QLEL 4HWBH 4GKSB 1IBGH 3S88H 5KVFL 2C3VA 4XPFL 2F5BH 3FO9B 3GI8H 3QWOB 3ARPA 3EYUL 2XA8L 3GIVA 1JZ6A 2H9GB 2J7LA 3R0MA 4K9EH 4YXKH 3AROA 3I6KA 3BH9A 1TLKA 1RK1B 3QIBB 5HPOA 3H2WA 2VE6A 5KVGL 5F71A 3VE0B 5JW4Q 1MEXL 5A2LH 5HYEA 2Z91B 2BVEA 3QIBD 5GGQL 1P4LA 4K7PL 4MDIB 1JF1A 1DUZA 1YNKL 3AC0A 5IV2A 3DV6B 2EDKA 4L4JA 4YZFF 5I1GL 5IBLC 1IARB 3P30H 3MOBH 3S98A 1F58L 2HLFD 4N9OB 5CGTA 3ZDZE 1Q9LA 4Z95H 3HC3L 3QXAB 4KUCD 4P2OA 5I1IH 5KS9E 3F58H 3HG1B 1S7QB 5I19H 5E2TL 4MCYA 5GGSA 3HG1D 2UUDH 4Y5YB 1NFDA 1T66D 3BN3B 1QFHA 2V2WA 2XTJC 4NN7B 4P23C 2D31A 2CKBB 3SGKA 2HRLA 4EI5A 1HIML 1MF2H 2GHWB 1RZKL 3HG1E 4X9BA 1FN4A 4LLQA 1I8LA 3STLA 3WSQL 3MYJB 4R90H 5CJOL 1VFAB 4FMKA 1KYOJ 1NFIA 1RIVH 4Q97A 2PNDA 3BGFB 5LAXA 4UT6H 2IH3A 4JM2F 1ZT4A 5LCVH 4WFED 1C12B 4BFIB 3DX8B 1CDIA 2FGWH 2Q86B 4B50A 3KJ4C 1NL0H 4HK0B 5TE7L 3BGMB 3JTTB 2GAZA 4JGMA 1MIEL 2CMRH 2QQKL 1ZK9A 3EOTH 4OCYH 5TE6H 3SDXE 5FDWA 4D0DA 5I1EL 4QTIH 3WIHH 3EO1B 3BD4A 5BXFB 3IJYB 4TRPH 5KOMC 4KK8D 4AM0B 4UILH 5HPMA 4PJCF 4L8BA 2AXFB 4PRHA 3OAZH 1E27A 2Z31C 3EJZD 3GBML 5KOVC 2E6PA 1MY7A 4KDTC 4P46A 2BDNL 3LDBC 3O6LL 2Z35B 3OG6B 2CDEA 5IESL 2Q7YA 2I07B 1CD8A 3PWPA 3S36L 1LO4L 1JMZA 2OL3B 1BZQK 2HAZA 4MNGB 4UZGA 2A0LC 3K2UL 1DQJA 2HRPH 1UJ3B 3SDDC 5I75C 2XV6B 5I8KH 4H20L 1KB5A 3UYOD 1S5IL 1S5HB 2PO6C 4PJEB 5F9OL 2WUBL 2HH0L 5HHQB 3WUZA 3IXAA 3OZ9H 1QLFA 2ENSA 5JORA 1K4CB 3QQ3B 4XMLH 1X5KA 1Z9LA 1JPSL 4GSDL 3B2UD 1AC0A 1DDHB 3SY0A 1CLYL 4XXDA 4MNGE 1RK0A 3ZE0E 1X5AA 3T0AA 4LLDB 2D03L 3LMJH 1II4E 1QSVA 1FO0B 3PG2A 4KQ4L 5C2BL 4OCXL 1C1EL 4L8DB 3HS0B 4LCIH 5E2WH 5IBUB 2X70B 1CWVA 3WIFA 3QAZC 4GQPH 4NT6B 2X05A 3OGOE 4X8JA 3GMMA 1NBYA 1UKTA 1LP9A 4M62L 1AE6H 1OF2A 2D4DA 3DUSB 3MRLA 2R4RH 3BYTA 2CK0H 4XP9H 3VFVB 4LHUB 2K7PA 4NFDA 3DVGA 2R4SH 43C9B 4JFYA 4EVNA 5IQ9B 1JNHA 2AXGB 2V5SA 5GRXG 4BSJA 4LHUD 1P7QD 1EEZB 4MQTB 1GGCH 3VFWB 3HAEG 3GKWL 1NAKH 4LFHG 3WV0A 5I6XC 3RVWD 4J4PC 5L88L 3KPMA 3TCLA 1BWMA 1J0YA 1R0AL 1N6VA 4OD2B 1XIWA 1B0WA 1IGFH 1S9KC 4ODXB 1NGWB 4MJIB 4R96B 1J86A 4L8SB 1BQHA 1F90H 1MJUL 35C8H 3PWUB 1DN0B 3U7WL 2A1WH 4MJID 1MPAH 4OZIA 2EXWC 2NY1C 4S0TD 4H0HB 4NWTH 3QXWA 1W8OA 4IOFC 4Y2DD 1LK3H 3C8KB 3WKML 4RWYL 4TPRL 3D39A 1BFOB 3J8F7 4AT6B 2PCPB 1C08B 1AGEB 3MMEB 2CIIB 1BEYH 4NIKB 4X6DA 5IB4B 1AGFB 4KDVA 3ARZA 5C0GB 2Y5EA 1RSFA 2FL5A 4WY7H 3ZLQC 2B1AL 4ALAH 1NEZB 3MACL 1VFBB 1VESA 1MCIA 2DOCA 2NMSA 4OLYL 3D1MC 4KJQC 2J6EH 3VXMB 2YD2A 2VL5A 1Y0LB 3KGRA 4FQCH 4XPHH 4GG6F 4MWFA 2VDKH 3U82B 4OAWA 3CDFA 1FDLL 4LCYB 3GSXB 5EU6B 3MRRA 3L7EB 3P11L 3LV3A 1FGVH 2FZ3B 2A38A 4G9DA 3G04B 4G5ZH 1JE6A 1YN6A 2Y7QA 3AAZA 5EU6D 3VXME 5DTFA 1O7VA 3MODH 2Q87A 5K9JH 1K8DA 4TNWF 1UZ6F 4NO3A 4TNVF 3VRLF 4JREB 3WXWH 1MREH 4LLUB 3DX9A 1CE1L 2A83A 1TITA 2ZKHL 5EU6E 4XNUL 3KHQA 4XBPB 2Z4QB 1INQB 4Z7VA 5E4EC 5D72L 5T1DL 2DQTH 5CKGA 4GAFB 4OD1H 2EECA 2NY1D 1PYWB 4HWBA 3S4SB 5F7WC 5JA9A 1J1XH 1DBMH 2VIRA 4AEFA 4R97C 1JFQL 2XG4A 4QHMA 3T0DA 1HHJA 1KCVL 1AHWA 3FZUD 4Y4HC 2ZP0T 1FGNL 1MRCL 1RD6A 4TULL 4Y4FC 1IGMH 2R1YB 1XR9B 2XZCL 3ULUE 2VH5H 2OTWB 1PZ5B 5EOQL 5EU4A 4HV8B 2OLDA 1T1ZB 1MLBA 4U05A 4X80H 4WO4B 3VG0L 1ETZA 1F4XL 3VXOB 4AZ8A 4WNQB 2GJZA 1MFCH 1JJUA 4HJJH 2CXKA 1CD9B 4WO4D 4X4MA 3S34H 4O2EB 3CFEA 1HK6A 1T03L 2F5AH 3MLSH 2J5LB 1DEEA 4FQ1L 5GRWA 4W81A 3R06A 3ZDZF 1ZTXH 3REWB 5E9DB 4UTAH 3BT2H 1X5YA 5KS9F 2HJKB 2BSRB 4HGMA 3ZDYE 1IC1A 4PR5A 2LABA 5E9DD 1I8IA 4KROC 1CF8H 5F9AC 3GSOA 4NYLA 5IMMB 3MV9A 4R0LA 2XYCA 3DVNB 1U8NB 2YK1L 3C08H 1EXUB 3S37L 4G8IB 5E9DE 5HBBA 2IQAB 1UWEH 4P4RB 3PJSB 2QR0A 4JHWL 1V3LA 3M8OH 1L6ZA 2EO1A 3QPQC 4NRXB 1RIHH 1CLCA 4N0FB 2I60H 3CLFH 4LSDA 4MA7H 1U8MA 1N26A 1MFBL 5C0FB 3OKKB 3MUJA 5CLWA 4NP4L 4DKAA 5FECA 3QG7L 5CWSA 4LSRL 5JOFA 4LEXL 2YPVL 3FN3A 3PGCB 3WIHA 2DIJA 3SE4C 2YZ8A 2BC4B 2AQ1A 2JJWA 2X4UA 1AI1H 3QIWC 1NGPL 3SDXF 2APWA 1T3FB 3QUMA 2QQLH 5SX4H 2APBA 1ZLSH 1JGLH 5J0BA 1LEIB 3DO3A 4Z18A 1MHCA 3BXNA 1T2XA 4OFYA 3QDMA 4IRSA 2I26N 4PRIB 1T89C 5IB5B 3MRMA 1FZJA 2UZIH 4Z76A 4WCYL 5BZDB 4X7TA 3ZE1E 1ZT7B 5IHZB 1CR9L 1NAMH 1VGKB 5B39G 5IBTL 4RSVA 3WLWC 1KC5H 3FRPG 1CICA 4N9GA 3LKOB 4JLRA 3HR5A 3VFUB 5B3JE 3D3VB 2JJSC 2X6MA 4J6RH 4WW2C 1KGCD 5FYLH 5I18H 3ZSSA 4HIIB 4LSVH 1HHHB 4WI8A 2E9JA 5A16A 4PRIE 2V7NB 2WWMC 3MZTA 1NJ9A 5EORL 3BIKB 3JV6B 2ICEB 2GQHA 4HGWB 5CEZL 4FQQB 4I0PD 3D3VE 4UU9A 2VDPL 1MHHA 4Q9QL 2LU7A 3H9ZA 1VB9A 2IPTH 4RGNE 3CVHL 5DT1L 1RUKL 3BQUC 3W9EA 3IU3B 1HCVA 1ADQL 3QPQD 4X5WB 1CL7L 4LFHD 2MJWA 3KPTA 1GGTA 4R9HA 4PJIB 2EXYD 2FO4B 1BPVA 4Y5VA 1HHKA 3MLTA 4LPXA 1MFAH 4X8XA 1PSKH 4CVXA 3BJ91 2EICA 5KTEH 3ZE0F 4J3WA 1FFPB 4RAUA 3BWUC 3UROR 3W39B 4DTGH 2XTLA 4QGYA 4X6FB 1I3VA 4YXLL 1RU9L 1Q72L 4NSKA 3VFPA 1F4WL 1FNFA 2MCPH 3DHJA 3OKDB 4PJIE 3N1PC 4XTRC 4R2GB 5FM4A 3RGVB 4AY0A 1PZUB 4IS6A 3VG9B 4F7CB 4KC3B 4U6HA 5F21B 3P73B 4G43A 3LQAL 2AJUH 1G7PA 3QJFB 5J6HB 3LZFL 4YE4H 3RGVD 1HSBA 1HXMA 3ZYJA 1SEQL 2MCG1 4KHTL 4WUUB 1EMTH 4OQTH 1RVFH 5F6HJ 5IR1A 3TNMB 4UIKL 1DBBL 4HS8L 2B4CC 1R3HA 3BYYA 4WUUD 1JZ2A 4PJ7E 3OF6A 5IJKA 4U3HA 3RA7H 3DECA 4HPYL 2H26B 3Q6GH 1Q0YH 1IQWH 4NM8L 3UP1A 1AXSA 3ZKMC 4WUUE 2DTMH 4XBEH 1YEGH 4DK6A 3SKJH 4WWID 5T3XL 1DUYB 2OTPA 4FQJL 1WFTA 3FAWA 3AMLA 4S1RH 3MJ9L 5GGTH 2DI8A 4X9GA 5AD0B 4WI3A 5IFHH 2IG2H 1H3XA 5GGVH 4NKMA 1SBBA 3T3ME 3L7FA 5INDA 2X4NA 5JZ7C 1SVZA 3QSKB 2UV3A 3BO8A 3UJTH 5GS3A 4HUVA 1DEDA 1FAIH 1WZ1L 3CH1B 1EJOH 1IAOA 1ZMYA 3NN8A 3ROLB 5B21A 3KXFB 1LE9A 3IYLW 3OAYH 2J6EA 2X4SB 4X6CF 4G6KH 1JUFB 4P4KD 3L5IA 2KBGA 4KKBC 5D2NA 4PGCB 3KYOA 3KXFD 5MENB 5F1NA 3ARFA 4XHQA 3ZDXE 2I9TA 2OR9H 2E7CA 5MEND 1WBYA 1LHZA 3EJYC 4OKVA 1Z0MA 3UAJD 3UXFA 4ZFFB 3UTSB 3GMRA 4JG0L 5DFWH 1E4WH 1A3QA 2JCCB 3X14A 5MENE 2DI7A 3D18B 15C8L 4YDJB 4UQ2A 4AH2B 3VFNB 5F7EH 3UTSD 4HT1H 2B0SL 4KGJA 2IPKB 2FJFA 3UO1H 3WFHB 5MERB 5TQ2H 1ACYL 3MBXH 1F3DJ 1JYNA 1A2YB 3UTSE 3FT2B 1XCTB 1DFBH 4N1EA 4NJ9H 1FZOB 3KPRA 2JCCE 2BNRA 3QIUB 5ECJE 5CBEB 1EGJL 5EFIB 4JRXD 2A6DB 3LN5A 3ECBA 3QIUD 2BRRH 4MMZC 4PRPE 3RZCB 4GBXA 1T80A 5DF0A 4PJGB 3I6GA 2ID5A 5GJSH 2G5BA 3O3DB 4J1UA 3P4LA 5ALCH 3RZCD 1A1OA 4EI6A 1U8LA 2HLAB 2NPLX 4OV5B 1LE5B 3S3JA 2CSPA 1VERA 1IM3B 2NW3A 1F6AA 1E4XI 5K59E 4XP4H 3QRFM 5TE4H 4HFUH 3PE9A 1YQVL 2EZ0D 3ULUF 1RJZB 3KR3H 4KPHL 2JB5L 2A73B 3BD5A 2A74A 4ZUVA 3MLWH 4PJGE 1KJMA 3RZWA 5KSAA 1D5MA 5DJCA 4H1LB 1G9MH 2W9DH 5FYJU 1N2RA 1NDGA 2A6JB 2DD8L 3HMWH 1CDGA 4XI5D 3SJVA 5TPWH 1RHHA 2ZPKL 4QLRA 2VQ1B 4O2CB 1E28B 4Q2ZB 5AEAA 5HHPA 4RA3A 4KJWD 3G5YB 1AIFB 3OBAA 3TN0C 1F2XK 1QR1A 2C1OB 5KW9L 2XWBA 3QJHA 5HHOB 1PLGH 4N0UB 2G2RB 1XH3A 4K3JH 2C9AA 1NGYB 2PXYA 5E8OA 1R24A 4NQVA 3HPJB 1IEBA 1UC6A 2EIBA 3R1GH 5DSCA 5HHOD 2BNUB 4GXVH 4JFDB 5D7JA 2MWCA 4YX2L 5EO1A 1HHIB 2DQEH 2NY7L 4KRPB 4WVRA 3T0VA 5CUSH 1G6RB 2PYEA 4HC1H 5BV7B 5FGSA 1NDMA 4JFDD 3O3EA 3U0WL 5HHOE 4N0UE 2FIKA 3CU7A 3DTXB 3E6FB 5E7BA 1A7NH 4QCIA 1IAKB 3UC0L 1P4BL 3TZVB 2ILLA 2PW1B 3BN9D 3GO1H 2UY6A 2ORBH 2YMXH 4WFFD 2FRGP 3TZVD 3EIFA 3FFDB 5B3NA 3H6JA 1M1SA 1QO3B 2JJVA 5H35B 5GS2H 1OQXA 3PABB 1T5WA 2DQJH 2FBJH 4JM2C 5JO5B 2KL6A 3N1FC 1GZPB 4OLUH 3LEXB 4U1KB 4WFFE 4MAYA 5EOCJ 5C70A 4JE4B 5KG9B 3VCLA 4KVNL 2VISA 3TO4B 2ICWI 2HFTA 5HHMD 4KZEL 4IIQC 5DJ8B 2UY7A 4ZG1A 4N1HB 1DVFB 5F9WB 2X4QB 4FA8A 3NZHH 3CXHK 3T2PA 1GHFH 3FOLB 4JZNA 1FC2D 3C09B 1DQDH 3LKSB 4QHKI 3WN5B 3KPQA 4ZNCD 3UPRA 3A6BH 3IU4L 2XWTA 4HKZB 2VLKB 4LSPH 3FB6A 3B6SB 1CYGA 1GAFH 4YHLL 2W0KA 1EX0A 3O6FA 5FF6A 1ULVA 1XGPA 3ZE1F 4HZAA 3C87A 2VLKD 4NJAH 4K8RD 4PRHE 5LVEA 3VJ6A 2YD5A 4JQXA 3BSZH 3FL7A 5B3JF 1EH9A 2ZCLL 4JN1L 2XWJA 2WW8A 3GSNL 2DDQL 5HI4D 2E6JA 4O9HL 1KTKE 4FQ2H 3RPIB 4LVOC 2B2XH 4OB5L 5FOBB 1RZFH 4F8QA 3CDGB 3JWDC 4J23A 2YBRA 5DEFA 5FUZH 3VA2C 1XF5B 4NBXB 2AJSL 1PQZB 1TQCB 1FNGB 2DQHL 5HYFA 1AP2B 3AREA 2V2XB 1QKZH 4G9FB 2IPUK 2RFXA 3P3YA 4NQSA 5KVDH 2CDGB 3WNKA 1CDYA 4PP2A 2DBJA 3C8DA 4G9FD 3D25A 2GK0A 3H7LA 1JNLL 4LPUA 1E0OB 5MEPB 2HTLC 3PDOB 3TNNB 5JIKA 4ACPA 1C5BL 3N85L 4QTHB 5MEQB 3FQUB 3K2MC 4YUEH 4DZ8B 3TBWB 4PJAB 3LH2L 5I1HH 3OXSA 5CHNA 5MEOB 1NLDL 3RX8A 1MCJA 1JNNH 4PJIF 3O2VH 4B7IA 5FEBA 2IBGA 3BFOA 5CILL 1WIPA 3EUUA 4OQTA 2DLFH 1J7VR 5HHNB 3K8LA 2YD8A 2LE9A 2KH2B 1I7RA 4PJAE 3JZ7A 5D1QB 4AQOA 3RP1A 2VLLA 1BJ1H 5DR5H 3WIIL 4MXVE 1L4IA 1Z3GL 5JPMA 1J0HA 3ESUF 4L4TA 4JKMA 3QDGA 3ZTJG 4WFGD 3X3FL 4F58L 2HJLB 2R2EB 1RZIB 4RGOH 3T0EB 1XF2A 1S7RB 3RVVD 4PJ7F 3VH8G 5EZLB 1NKOA 5ITFB 1EAJA 1S7SA 2CKBL 2YUZA 4XZUA 1YEHL 3KWWB 1ITCA 3MLPA 4PRNB 3RPKA 5KAQF 3T0ED 4MD5B 5GGTA 4WFGE 3MYZA 5DZLA 3TJHD 4JZJA 1UXWA 1X5FA 3V52H 4E41B 5FHAH 4QRSB 2CXGA 5CINH 3RHWF 3RL2B 5L2KA 4OZIE 4CDHA 4YFDB 4PB9L 4D9QD 3K8MA 2VN7A 2KZ1B 3RKDC 1ED3A 4LBEB 4M48L 1NCDH 4U7SA 1H15B 4X4ZA 5I71B 3WJJC 5JW5B 2I9LA 3IGAB 3SQBA 4X6DE 3GMPA 2FYYB 2GFBB 5ALBL 4EN3B 1YMHB 5HYIA 3TBYA 4E41E 3X12A 1AC6A 1BX2B 1MFEH 2EDWA 4QXTA 2WP3O 1BP3B 4O2FA 1F3RB 4O00A 5F6IB 2JELL 4F57L 1UEYA 3K0WA 2R56L 1NC4B 5T5FL 2WBJC 1I9JH 1OTUD 3KPPB 1TJGL 5D7KE 2M8XA 3ZDXF 1NC4D 5EC2B 3WS3B 3U4BH 1OP3H 2DQDH 5BRZD 1GIGL 1WISA 4DFHA 2J4WH 4WI4A 1OM3L 4UQ3A 3L9RB 4TN9A 3O4LB 3RAJL 3RWDB 3EFFA 4J3XA 1PW3A 4P57B 4LSQH 2DQUH 2IADA 3O3BB 5DVOA 1SY6L 3U1SL 2Z8WC 4AIXA 2FBOJ 4HIXH 4MVBD 4EJ1C 5BW7A 3A6CL 3HE7B 4KY1L 4MA8L 2OL3L 3O4LE 2UWEB 4ORGB 4OZHA 3T8XA 3HE7D 4R7NB 3DBXB 1CGVA 4P59H 2JCCF 1T83A 4ZS6D 4Z7VE 3CFDA 3NBNA 4QF1A 5JOPD 3H7BB 3H9HB 3V4UH 3HB3D 4TSCL 5ENWA 4IMLA 5J11B 2CGRH 3EW3B 1G7HA 1EA9C 2IF7A 4LOUD 4PREB 4KJYA 1JGDB 3F7YB 2UWEE 2AKRA 5JOPE 1XF1A 5CP7A 3QO0B 2FX7L 1QA9B 1OWWA 1KJVB 4U1MA 3OX8B 4ZUUB 1TETH 1FO0L 4HUXA 2XNAB 4WTXA 5DDHB 4EEEA 5K59F 2XN9A 1IC7H 3EO0A 3PXJA 5HJ3A 4KFZC 3STZA 4U6TA 3FTGB 4EQ3A 4PJGF 3LKQA 3T4AB 3T2QA 3CSPA 5AZ2L 3UZVB 3GHEL 2IANA 1V3MA 5I1AB 3BHBB 2VABA 5HI3C 1MVUB 3ILQC 1MEXH 1EAPB 3CFKB 2X1WL 3RWCB 3FO0H 1YNKH 3K81A 4R8WH 5HD8D 2HT3D 1OSPL 1FH5H 5IFAH 1IZKA 2GTZA 4P9ML 4WI6A 4DVRL 3OR7B 3HC3H 5EU5B 2NW2A 4V1DD 1ZHBB 3JTSA 4LP5A 4W4NA 1KEGL 5E2TH 4DVBA 2BX5A 4WI2A 5ABDE 2W60B 3L3KA 1B6DA 4XVUC 3C5SA 3TBVA 1JPTL 3SE3A 1QBBA 1S7WB 4JFZL 3K4AA 3U4AA 1QBAA 1JZ5A 1K85A 1AR2A 5BMFL 3V4PL 5CJOH 4X4YB 2VJXA 5JNYA 2AK1H 3FQNB 1QNZL 1T0MB 5TH2B 2AK4A 4JY6A 4QXUL 2JKXA 1KCRL 4RZCB 4C56A 5D1XB 1JN6A 1D9KB 1NCCH 2DL2A 4IRJB 1N64H 1QQDB 3WL9A 4OZGA 4CADA 4DCQA 5HY9B 1BBJA 1N0XL 1NGZA 4WENB 1M7IB 5TE7H 5D1XD 1D9KD 2IFGA 5GHWH 2D0HA 4IRJD 4WEUD 1FZMA 2WM0A 5EOTA 4EDXA 1G6VK 5DHVB 1W72H 1OP9A 4TOYH 3CAFA 2P49B 1UM4H 3PL6B 4FFWC 3OB0K 1B88A 1C5DA 5F3HA 1I7UB 3MRNA 2NYYC 3PL6D 1CZ8L 5HHXL 1LD9B 5JOEA 5D5MB 3SKMA 4AK1A 1YJDC 4N0RA 4HCRL 2XPGA 2BDNH 3O6LH 5ICXA 4XPBL 1GSMA 4LU5L 3C9NA 4U7KA 3S36H 3QG6A 4JJHA 3SDCB 1CE6A 4ZXBA 3CUPB 3QNYB 3ULUL 5HHVH 5DRXA 4JKPL 1IJ9A 1ZVYA 3G6AB 1FL3A 2ZNXA 1JHTB 4UNVA 3SDCD 3OTTA 1E6JL 3AXLA 3QWRA 4GAGL 1S5IH 5E8DL 3FAXA 4LVNB 2R69L 4Y8AA 2XKNB 1BOYA 1UQSA 4BZ2H 1QSZA 4HKJB 5FA3B 5LGJB 1HQ4A 5I9QB 4H5SA 3C6SB 4LLMB 1A7BA 4MB3A 4U1LB 1JPSH 2OQJA 5GIRA 2VQUA 4PGDA 5E8PA 5GRVL 4Y16B 4APQB 1CFVL 2D03H 4H8WH 2FATL 1G7LA 3ABZA 2GEEA 5FO7A 3WFEL 4LVHB 4OCXH 3MJ7B 2C3WA 1C1EH 25C8H 4Y16D 4RCAA 1P1ZB 2VXVH 5BS0A 4P23A 4ONFL 4PB0L 3SKUD 2LVCA 3FN0L 2CLVB 1YYLL 3P0VL 2HVJB 3GJFH 2DLEA 2AP2A 2PKDA 3QULB 4FFWD 2FEEL 5IUSA 3OPZL 4AL8L 1D6VL 2UYLA 4HF5H 1A7PL 2RBLA 2DRUA 3IJSA 1SYVA 4PJAF 2R8SL 5GJSL 12E8H 3SE9H 5EO9B 2CRMA 3GKWH 4MXVF 1I4FB 1S3KH 3P4OB 4H0GA 1CD1B 4LDLB 4O51B 4MJ4A 4QXGL 5IM7A 4NQCB 2NXYB 4POYA 5AG8A 3D0VB 3HE6A 2JIXA 5ESAB 2EH7H 4NUJB 4NQCD 1XGRB 2AW2A 2OX5A 2NXYD 5B4MC 2QBWA 4UNTA 2DI9A 4Q6IA 3WKMH 2BSSA 4S10A 4OZIF 3GSVA 4TPRH 4HKBB 1DL7H 4FABL 5F9JA 4MHHI 5DUML 4TTGA 3NABL 3IAQA 2H2SC 2BFVH 4O4YL 1DQQB 4L3CA 3KLAB 1VCAA 4QRTB 4FHBD 4L8SC 4X6DF 3EOBA 3QA3B 4YWGH 3RL1B 1OHQA 3HFML 2E9WA 4OF8A 4U1IB 1U8KB 3MA7B 1KCSH 4N8VA 4WTZA 4P5KB 3RTQA 4AEEA 3QP3A 4HG4K 4K7FB 4S0SD 4M1CC 4K23L 4NDMA 4HWUA 5E8NA 3T2OA 4HIJA 2YA1A 3L5WB 2BRQA 1VSCA 1V7ML 1UA6L 5C0RH 3LOWA 4YBQC 1D6EB 2V6HA 5E95B 5C07A 3MLRH 2IAMC 3ULSB 4AEHH 1FNHA 2PO6A 3O9WA 4PTTB 1INDL 3MRIB 5I1LA 4X7FC 3CLEL 1J1PL 1N8ZB 2W65B 3TO2A 1T22B 1K2DB 4JJ5A 4UIMA 1HI6A 4XGZB 5FFLA 4MD0A 2BVPB 3UYRL 5HYQB 3IETB 1A6ZA 4GS7B 1G7JB 5C2UB 4I1NB 4R4FL 4MQSB 4QRQA 3PV7A 2VXQL 3OAUL 4LHJB 3GK8H 1CE1H 3BUYA 2P4AB 1F4YL 2AJ3B 2ZKHH 1ZANH 4XCYB 3D2UA 3FFCB 1HDMB 2D4FA 2J1KA 4JVWA 5D72H 4CNIA 3DSFL 2VSCA 2X4TA 1CGWA 5TQ0H 1U8LB 3FFCD 3KPRE 4Z7VF 2NLJA 1ZHLA 4CMHB 3ARGB 1Z9SA 5IMOA 2ZUXA 2R0ZL 3AB0B 5EA0H 1GGBL 3FRUB 1AGDB 2XIDA 3ARGD 4KGLA 1RZJL 3FFCE 2H2SD 3G5VA 2UWEF 1FGNH 4NM4L 5C0BA 3QUZB 4FXGA 3K3QA 5DC4B 4ODHH 4TULH 2E9BA 3G5XA 3TA3A 1U58A 4MA1C 4ELMA 3WNLA 5DI8A 4J4PA 3EZ8A 5DJXB 4KH2A 4BQCA 2MHAB 5JDJA 3ROOA 3QUZD 4I77H 3QNZA 3D85B 1OAUL 3FQRA 3U36A 3B2VH 3WFCL 3DURB 1QBML 5DHYA 3IS0X 4LNRB 4MNQB 1AO7B 1LMKA 3REVA 2YUXA 2P8PB 1O0VA 4OGAC 4HFWA 3RDTB 3D0LA 5ID1A 2EIZB 5BQ7A 5D7SL 3G6DL 4TUOA 4WU7B 3RWEA 4LIQE 4G6ML 1AO7D 1DE4B 4MNQD 2OP4L 2ADFL 3QHFH 4G8EA 4JQIH 1GGYA 1IT9H 1GL4B 1YUHB 3KS0H 2GTWA 4L8CA 4UT7H 4MNQE 1AO7E 2HFGL 5C09B 4ZFOL 4ONHA 1ZGLP 4C57C 1P84K 5D96C 3QH3A 4E42A 5SV4A 4YXHH 4HS6A 3F12A 1SBSH 4URTB 5C09D 4LKXA 3EYVA 4JDZA 5DVNA 5H94A 5LQBL 3K4ZA 2BOBA 4JKLA 3MRHA 5FYJD 3QUKB 1TZHB 3TM6A 2WSKA 5DJAA 4D8PA 4GAJH 4JHWH 5DEGA 3U0PB 1PY4A 2GJJA 2VDLH 5GSRB 1BZ7A 1NGXA 4Y4KC 5FYJE 1A6VL 1G1CA 1JHLH 3MBEB 2A9MH 4L9LC 1Y18A 2DYPB 2QHRH 3IDIB 1U3HB 1VACB 1MFBH 4KVCH 3GHBL 3QG7H 5D93B 2DYPD 2OTUA 3JV4A 2YN3A 2IFFL 1W72A 1U3HD 2FH8A 3VFTB 1NAMB 3NZ8A 2UZYB 4JB9H 5HGBA 5KSBB 2A6KA 1FJ1A 4LLVB 1NGPH 1FPTL 3DRQB 1S8DB 4BSVA 4ZNEE 4YDKL 1HYSC 2D9QB 4F2MB 4YGVA 3V6ZB 1MNUL 4NN6B 1EHLL 4RIRA 4I5BA 5IW6B 2DKUA 1GPOH 3O8XA 5E6ZA 4HIEA 1WCBB 4PJ9B 4PGEA 3RNQA 3UTZB 2Y9RT 4Y88A 2ZUQC 3P4NB 1ZLWH 5J1AB 1SMOA 4ZFZB 4I13B 4PJ9D 5AG9A 4FRWA 4YHZL 1EV2E 4WDIA 4H25B 3B9KB 1EBPA 4QHUB 3L3HB 3PWJA 1LNUA 4YEEA 1CXKA 2YD3A 1WBXB 4U7MA 4QEGA 4MX7B 1R3LB 4Y1AA 4Q74A 4F7MA 1K3IA 1YDPB 4HUKB 4I8DA 2G60H 4J3UA 4KK6C 1VFUA 1ITBB 3BP4B 4JFEB 1IQDA 4HAGA 4QKXB 4FQXC 1KPVB 5DD5L 2AERT 5I16B 4HMDA 4CVZA 4OUUB 4RGNC 3I2CL 1T2QL 4LP4A 4OLXL 3QXDA 1X7QA 3W11D 1OAZL 3GJFK 1A3LH 3MV01 4N5UA 5F96L 1D5BA 8FABA 2VZVA 4R4BA 4JFEE 3M1BA 4JFXA 3AY4A 3SDAC 1ZWIB 5D4QA 3AS1A 3DXAD 3QNXB 5D9SA 1BBDL 5HDQL 2C7UB 1CFNA 4GUPB 3NFPB 2QADC 1ZOXA 1XGUB 2HT2C 3PHSA 5IT2L 3ARVA 2ICES 2JJUA 2CQVA 2EDHA 3VXSB 4MCZB 1JRHH 3VWJC 1X9QA 1FNEA 2FCBA 5IWLA 1I3GH 1NCWL 3B8YA 1RZJC 2GI7A 3GGWB 2NY2B 3VXSD 2J88H 1P4IH 4JQVA 5EUOA 5JW4R 3BZ4A 5HGHA 1INEL 2NY2D 2Q3ZA 1KG0A 4DKEL 4FQLL 3VXSE 4N90E 1BGXL 4UIKH 1U8OA 2F54A 2ITCA 1VPOH 3MREA 5F6HI 1G6RL 4HUUA 5BV7L 2R0LL 5KVEH 3G5ZA 5IW1B 5ACZA 1J5OL 3KJ6L 3QDGE 1HOCA 1OY3B 3QIWA 2OZ4H 4Q9BA 1YMMA 1B0GA 3D69A 5T33L 4M6OL 5D2LB 3JUZA 3G6JA 4WI9A 1BQLH 3FQTB 4M8QA 4U6XB 3I75B 4U1GC 5F1SA 4FQXD 4UTBL 1PJ9A 3DX6A 4O2FB 2XRAH 3RVXD 1IVLA 1A4JB 3BKJH 2ZUWA 4MLIA 4WRLA 4EDWH 5D2LE 3IXTB 3GB7B 3U7YH 4G7VL 1WZ1H 1RUQH 4IEFB 4JHAL 3WJLC 4LQFL 4MS8C 4G6JL 5CJBA 3LD8B 2G75B 3BE1H 2GSGB 3HLAB 4Y19A 4W6XB 3DMMC 1A7RH 2VZ3A 4YHPB 4WUKH 2COQA 2AAVA 3PWLB 5DUPL 5D6DC 3LKPA 4IHOB 2BHZA 3UBXA 1QVOB 1JV5A 2IADB 3BDXA 1CGTA 2ERJC 2E27H 1T1YB 4LMQE 1A14L 3CFJB 3HZMB 5GSVA 3BEWB 1S7VA 2WINB 4BQ9A 2F19H 4HDIB 4JG0H 4XWGH 1FNAA 2G5RA 3HNSH 5EUKA 4HUMB 2VMFA 1P6FA 1QFUH 4MHHG 3TPUA 1XZ0B 5JXED 3UPCA 5K33A 5D8JL 2CO7B 4XCFL 1KLFA 3GZKA 2DB8A 4DZBB 3MRCB 5AAMA 2W0FA 4D0CA 1CFSA 3CU1A 4JDVA 3FT3A 1UGNA 1IKFH 1YEDB 1BFSA 1Q8MA 2X1PA 1C5CL 4MZ2A 3AVEA 4RGMB 7FABH 5I66A 4XAKE 3UPAA 4QRRD 2AEPL 1WT5A 3VGAB 5DRNA 4OZHE 1PDKA 1MFDL 1G7QA 4YIQB 4NO0A 4F15B 4FFVC 3EOYG 2DQCL 1X5XA 3NFSL 4PUBL 5I15L 1K4DA 3BWAA 4OCWL 3D48R 3X11B 3CSBA 5IB2B 1A7OH 3OKNA 1S9VB 3FQWB 1T1XA 5GS0L 5F7LB 4PG2A 1JTOA 3S3SA 1CFBA 2X9WA 3C6LA 3BH8B 5FA4A 4HK3J 2ESVB 1YQVH 1J1OL 4P3DA 4KPHH 3UTQA 3OJVC 2CLZB 2ESVD 4BQ6A 5J13C 4DGVL 3C60B 3DGGB 4OF6A 4WEBH 2R0KH 2WANA 3IDNB 3GIZL 4YFEA 2IANE 2AJXL 3CMOL 4LK4A 4XWOD 1DBJL 3C60D 4WV1B 4JANA 1HKFA 4U0RB 5C0NC 2R39A 2NCMA 1BQHG 4Z8FH 5SWZA 1NC2B 3QEHA 5KW9H 3ARDA 3GDBA 1NC2D 1MCDA 5AUMB 2R1WB 2BVTA 3TESA 3G08B 4KI1A 4ZUSB 4XVTL 3VD3A 1W8NA 5IVXB 5HYSB 1UCBH 4P2OC 2NTFB 2EYRA 4YNYA 2OR8A 1YYMH 3EO9H 3MNVA 1F45A 3RQ3A 1T1WA 3PNWB 3EOAB 2JF1A 5I76B 4I48A 3VD9A 3T65A 5D71L 5GS2D 1MCOL 1NCTA 2OK0H 1HILB 2HG5B 2LTQB 1P4BH 3OWEA 2GT9B 3MCLL 4XAWH 1JPFA 3SGKC 4EI5C 4FFVD 1GRWA 1KJ2H 1A1MB 4PJ5B 2FX8L 2DQGL 4ONGH 3EGSA 2C1PA 1JPGA 5C08B 4GG8A 1I8LC 1SHMA 5E5MB 3LQZB 1JK8A 4Y5XB 4PJ5D 2E7LA 3EDJA 4KMTL 3PHOB 3O41B 4C56E 2EDNA 4ZDHB 1F11A 4U1HB 5DXWA 1NUNB 5ELIA 5CD5C 1QEWA 3CFBA 4DN4H 3PGDA 4EBQL 4XXCA 2AXJA 4OBRA 3O6ML 1T5XA 5C08E 5CZVL 3QDJB 1RZ7L 4XVJH 1BZ9A 2X41A 2M2DA 5EIIA 2NNAA 3KS0J 2H32B 5LXGH 5EZJB 4W6YB 5DD6A 3QDJD 5TF1L 5C0ND 3IU4H 3MRDB 5AWNL 5GRZA 3BKCL 2VXSL 3TO4C 5E5UB 1U0QA 3DPBA 4HWBL 1IBGL 3S88L 3WLBA 5F9WC 1H5BA 2F5BL 3GMNB 4CN1A 3CC5B 1VKXA 2DDQH 5E08H 1G9EA 3B5GA 4K71B 4RMUA 4K3HA 1DLFH 1ZGLA 3GI8L 4NNYA 1FVDA 3NIDE 4NQEB 3LRGA 4PV9B 4P46C 1A1NB 4YXKL 1ADQA 2W91A 1QSEA 5D1ZB 3H9SB 4NQED 4NZRL 3RJQB 4AEIL 5MHSE 1YQ2A 2GSIB 1CGUA 4EI5D 4QYOA 1U8PB 5D1ZD 3H9SD 3SOBL 3IDMB 4P2CG 3MRQA 4P5MA 4GO6B 3QHTC 1EFXB 2XFXA 3O45B 5LWYH 1JNLH 3MOBL 3OSKA 2FWOB 1QRNA 2ZCKH 3HZVB 5H37H 1OB1B 4Z95L 2VC2H 1C5BH 4JFQA 2YC1B 1EFXD 3BPLB 5I1IL 4IOIA 4X99B 3LSOB 3WHE1 1S78D 3LH2H 5DJ2A 2B1HH 4PP1D 1KJ3H 3VXNB 4WHYH 4BKLB 2VUYA 3NACL 3VGFA 1BF2A 4IM8A 2H6PB 5CFHA 1P7HL 3DROB 4GKNB 2C3HA 5C0EA 5IHBA 4HPOH 4PGBA 4GW5A 3STBA 4E5XA 1FFOB 5GS0C 1LILA 4WTWA 2DM2A 2FX9L 3PV6B 3BZEB 4HBQA 2BMKA 4RNRA 4M1GH 4LDOB 2X1QA 3JXAA 5FGCB 3L5JA 3U2SB 3VA6A 4GLRH 4UT6L 4OGXH 5LCVL 3Q2CA 3TPKA 4PY7A 5DO2C 2FGWL 1JWSA 5L2JB 2BXZA 1D5ZA 5DMGC 1NL0L 4LAQL 1XIWC 3RNKA 3U9PL 3MJ9A 4S1DC 2CMRL 2IEPA 1GOGA 5JQHC 3EOTL 4OCYL 2FLRT 5FGCE 5TE6L 4BELD 1NUFA 2QSCH 3OJ2C 4QTIL 4MDJA 3PWPD 3WIHL 3FOMA 2WLYA 2WV3A 4PJCA 1I75A 4TRPL 4M48H 1L9MA 1FFRA 2EKJA 2D9CA 1B0RB 2OI9B 1CXFA 3V6FB 2X4OA 3OXRA 3BGAA 5D2LF 1P7KB 3ORJA 5ALBH 2DLIA 4ISVB 3KPOA 3UZEA 4CVUA 4WI7A 2JELH 3OGCB 5HGAA 3QUYB 1HQRB 2A9NH 4HEPG 2BOCA 1RUMH 5E8EA 5SWSB 3QUYD 1ZHNA 3FO2A 1GIGH 1OM3H 2NY6C 5C07E 5SWSD 3RAJH 4PBVC 5F88B 2HRPL 4XNQA 1JIBA 1QPPA 3MCG1 4GXUM 2EC9T 4NHUA 5SWSE 4Z5RA 3U1SH 1IAMA 3OZ9L 1IGIH 2J8UB 2AEQL 3SCMB 4HIHA 5FYKU 4KY1H 5D7LB 1D5XB 2VLJB 3WUWA 5IB1B 1YECH 5DO2D 5C6PB 4YHMH 4P5TA 1OLZA 3SCMD 3LMJL 4F9LC 5D7LD 1FRGH 3ZKXC 1XF3B 1ES0B 1TMCB 4M7KL 1RZGB 4LCIL 5E2WL 4OZHF 1BFVL 2P8MB 3GSWB 2G9HB 4LNVA 4BQ8A 4UNUA 3ARBA 4TSCH 2J8UE 4LPTA 1OQOA 5IF0A 5D7LE 1AE6L 2VLJE 1W0VA 4GW1B 3MR9A 3HN3A 3BMWA 5EBGA 2R4SL 2FX7H 5HVHC 2AGJH 2XZQL 1FO0H 3SPVB 1GGCL 4UOJA 1P6AB 4ELME 2Y07H 4L29B 3TT3L 3B3IA 3DSNA 1WFUA 3LKNA 4OSUH 4K9EC 5SX5H 3MGOB 5IJVA 5ESVA 1A6TB 3UDWA 1MCQA 3S3PA 4RQQA 5FKPB 1IGFL 4CMMB 2VAAA 1RJCA 1WWAX 3L1OH 3ZL4H 1F90L 1T0NB 1BM3L 3MLZH 35C8L 4ODWB 2A1WL 5EPMA 2IC2A 1MPAL 3VXUA 2R2HB 3HNVH 2F9BT 5EDXA 3C5JA 4WFHD 1OSPH 3BW9B 1LK3L 4CU7A 3MRFA 1HE7A 5I17A 4P9MH 2F53A 1I7ZA 1Z5LA 4NN5C 5ICYB 1BEYL 3U6RA 4RBPK 4QWWC 4NQDB 4K2UL 3LKRA 3KPSA 3OKMB 4OJFH 4LLWB 1M05B 4RMRA 4HKXB 4WY7L 4NQDD 4ALAL 1KLUB 5FDYA 2ATPB 2Z92B 1U2HA 1MCPL 3RGHA 1KJ2A 1W0WB 4GW4A 4R0LC 2J6EL 4LPVA 4NQDE 3FONB 1MELA 1WEJL 4FQCL 4LLYA 3VFRB 3HTLX 4XPHL 2J8OA 2PW2B 4CRPA 2ARJB 2P5WB 1QNZH 4R4NC 3ES6A 3GSUA 3BVNA 2P5WD 4G5ZL 2XT1B 2X10A 4LRIA 3ULVD 1N0XH 1S7UA 3GRWH 4QT5A 3MODL 1MJJA 5K9JL 4NRZA 5BJTB 1HXYA 4OZGF 4Q0XL 1MREL 1MCRA 3IVKA 4C55A 5DMKB 1MVFA 2IALA 4LCCB 1EHNA 2QHLA 5C71A 1U91A 4FXKB 2DQTL 3T77B 5TDOB 4OD1L 1JZ8A 1ZT1B 1KT2B 3BZFA 4ETYA 5L6YH 1DBML 2B39A 1IKNA 2WIIA 2EKSB 3MFFB 4LARH 4IRSC 2VDNH 4HCRH 1FVCB 1PY9A 3MROB 5J9PA 2R2BB 1CICC 1IGML 3FMGH 5I1JH 4GRLB 3NPSB 4XPBH 1EUUA 4YC2B 4D9LH 3MRBA 4XP1L 2EE3A 5EU7C 4OFPA 3NIDF 2ZSWA 4GKSA 3BPOC 4GRLD 5DUBB 2C26A 1JPST 1WV7T 4X80L 1GJIA 2NY3B 3FCTB 1E6JH 3FO9A 3VXQB 4R4BB 3QWOA 1P9MC 1MFCL 2R69H 1KEMH 4OCSH 2H9GA 4JM4L 2NY3D 3SGEI 2XACC 3S34L 4LIQL 1MQKH 2DM7A 3GJFB 3P2TA 4PG9B 3T0XA 3MLSL 1YY9C 3QQ4B 2VLRB 1RK1A 5J6GB 2RCSH 3QIBA 1KPRB 1OTSC 1CS6A 3TC9A 4OD3L 3QUXB 5I73B 3U30C 3VE0A 1CDJA 1CFVH 2B5IC 3RWIB 2Z91A 2VLRD 4Y5VC 4X7DC 3RWJB 3MCKB 3QUXD 4MDIA 1IAIH 1FNSH 3CVIL 3DV6A 4PB0H 3KNBB 3FN0H 2YWYA 1YYLH 1KCUH 1UWXH 1KCKA 1YEFH 4ZUTB 1TNNA 2VLRE 3P0VH 3IRPX 5I9QC 3QXAA 3C08L 2NQCA 3IRZA 2YR3A 2AEWA 3HG1A 3RWGB 1S7QA 1QFWL 1JP5A 1WUNT 1H8SA 4Y5YA 5L7XH 1RIHL 4LASH 2CKBA 2I60L 3CLFL 3WEXB 3G6JB 3RIAK 1KTLB 1CXIA 4QHLB 5FYJL 1FFNB 3NMEA 2WP3T 4M6AA 1HEZB 1MCBA 4S1SH 1RUAH 4M5ZH 3QB7C 3MYJA 4KAQH 1VFAA 4DJMA 4BZYA 3E2HB 4HEME 3O3AB 2Y6SD 5IJKC 3UJJH 3BP5B 5L0QC 1AI1L 1UB6B 3MRPB 3MLUL 5I1DB 1C12A 3G6JE 5BVPH 1DQLH 4BFIA 3DX8A 2OMBA 1CVSC 2Q86A 4RRPG 1D5IL 1XR8B 4HK0A 5DUMH 3BGMA 1ZLSL 1JGLL 2E9IA 3JTTA 1OAYH 3QZWB 4CGTA 1A9BB 4C54A 3RY4A 2UZIL 3UTPD 4NKDB 3VI3E 1U41A 4ODUB 1NAML 3EO1A 5BXFA 4M7JH 1CK0H 3IJYA 1KC5L 2EDOA 1MHPH 3HC4H 3GMQB 4AM0A 4ELKB 1GVIA 1BVKB 4K23H 4ZTPH 5I18L 4LPYA 2AXFA 1JGEB 3N06B 5D2NC 4HJ0C 1T4KB 3PHQB 4RFOH 4ODVL 4ZUWB 4XNXH 3ARFC 3BUTA 4TTDD 3CX5K 3DUUB 4KZDH 1NSNH 2FEDD 2KKQA 2Z35A 2IPTL 4MQXC 2YD7A 2I07A 1RURH 1UYWH 3UYRH 2GK2A 2OL3A 1RFDL 1I1AB 5B8CB 4R4FH 4HLZG 2DKSA 3U46B 4MNGA 2PYFB 3OAUH 2MQ3A 1UJ3A 2APFA 1F4YH 1MFAL 1I1AD 1PGRB 1PSKL 3ZHLA 1NMCB 1QP1A 1S5HA 3D87B 4PJEA 4NO5B 3BWAB 4N5EC 5HHQA 3HAEH 3HI6L 4DTGL 1CVRA 1K4CA 3QQ3A 1JGVL 2CRYA 4IRZL 4X7CC 3FKUS 5AYQA 1DDHA 2J8UF 2R0ZH 4LLDA 2IBBA 3BD3A 4WWKB 2R9HC 1FO0A 2VUOA 4DN3H 4GH7B 4XX1G 2AJUL 3HS0A 4GBXC 2IBZX 3IDXH 2X70A 4WWKD 1N5AB 2WNGA 4NT6A 4U0QB 4KQ3H 3DETC 5T5NF 1L7TL 4ELMF 4EUPB 4OQTL 3FT4B 4ERSH 3DX7B 3DUSA 4HWZB 1RVFL 1ZLVH 3VFVA 4LHUA 1Q0XH 2ED8A 2WLZA 1KLGB 5IQ9A 43C9A 5J12C 2AXGA 1ZEAL 3W9DB 3MLVL 1EEZA 3CDYA 2VQTA 5D7SH 3G6DH 3RA7L 3VFWA 3Q6GL 2C4FT 1Q0YL 2OP4H 1IQWL 5KSAC 1OD7A 1QRKA 2XY1A 4XBEL 3ARFD 1YEGL 2H2PC 5DQ9B 4KTYA 1URLA 4OD2A 3VRJB 3SKJL 3IF1B 4JAMB 4ODXA 1NGWA 4MJIA 1H0DB 2BSTB 4R96A 5GGTL 4L8SA 4HJGB 5IFHL 1W0YT 5LKNA 2IG2L 5GGVL 3PWUA 5SWZE 1DN0A 4J3VA 3LIZH 2E8YA 5I30L 3UJTL 2ADJB 5DYOB 3C8KA 4J7RA 2PXYC 1EJOL 1A0QH 1J0KA 1AH1A 4JPKH 1M6OB 2EE9A 5FO8B 1BFOA 4AT6A 3ZKNC 2PCPA 5DK2B 1C08A 3MMEA 1AGEA 2CIIA 4G6KL 2YRZA 1ORQB 5IB4A 2P5EB 3TFKC 3MQIA 5BCAA 1AGFA 3J7HA 4RDQF 5C0GA 3SBWA 1U6AH 2FECI 2P5ED 2OR9L 5CMAB 1NEZA 3RWFB 4JR9H 5CJXA 4B41A 1VFBA 3F7VB 2R1XB 5EULV 4M9OA 2P5EE 5F1OB 4M4RA 3VXMA 3VXRB 1Y0LA 4R26H 1XGQB 1E6OH 1E4WL 2HT4C 3RBSA 5F7EL 1N6QH 3VXRD 3T1FB 4LCYA 3SO5A 4MA3B 3GSXA 5EU6A 4Z7WB 4I0CC 2C5DC 1SYSB 4X6BB 3L7EA 2WUCH 4KRMB 1FPTH 2EDYA 2FZ3A 4MAYC 5TQ2L 3PP3K 3G04A 3MBXL 3MBEC 3C5ZB 1FG9C 3VXRE 4NJ9L 1J9CT 1EPFA 2NY0C 1JZ7A 5KSAD 4HWNA 4PS4H 2A6IB 4LLUA 4HCRA 5KSVB 3DV4B 4Z7WE 3GM0A 1H3VA 4XBPA 2Z4QA 2CIKB 1INQA 2DQIL 1FVDB 1MCWW 3N1GC 4YHZH 3V79C 1VA9A 2VDMH 4PJXB 5ALCL 2K3TA 2XXCB 1T2JA 1PYWA 3AM8A 4KI5C 3S4SA 2DICA 2EH8H 2RQ8A 4XP4L 1NANH 2Z93B 4JQXC 3QFDB 4HFUL 4XB7A 1KCLA 3ZKND 5D7JD 4HUNB 1HHGB 3MLWL 2NY4B 3MUHL 4PJXE 1AR1D 1G9ML 1HINL 1J87A 3LN9A 2PYED 2P24B 2W9DL 1LK2B 4UDTB 2R1YA 1XR9A 1ZA3B 3B9KC 1QSEE 2NY4D 3HMWL 5TPWL 2OTWA 4G8FB 3KLSA 1PZ5A 4XRCA 1AGCB 2LFGA 4HV8A 1ZS8B 1N7ML 1T1ZA 1OAZH 5ADOH 3H3BC 4XCEB 3AREC 4PRAB 4WO4A 1QD0A 3VXOA 4WNQA 2ZOLB 3Q6FB 4HZLB 4LF3B 1FL5B 3E6HB 1PLGL 2HT4D 4K3JL 1KB9J 4H1LH 2ICCA 3VGDA 1BBDH 1QRNE 1OT2A 3R1GL 4O2EA 2L7JA 3LEYL 5J4MA 3S35H 4KKLC 4G8GB 4MAYD 2DQEL 1V3JA 5CUSL 4HC1L 3FB7B 5C0CB 2EDLA 5EG6C 3REWA 5E9DA 1LEGB 1EO7A 4K07A 2HJKA 4D0BB 2BSRA 4EXPX 5JMOC 5A3ID 5HGDB 2RHEA 1A7NL 4NKOB 3F62A 1U92B 3ZYIA 5DLMH 5IMMA 4G8GE 2C4XA 3DVNA 2ORBL 2YMXL 1U8NA 4FQLH 3VFMB 3O6FD 5C0CE 1UVQB 4G8IA 2IQAA 5C86A 1NGQH 4P4RA 3PJSA 2DQJL 2FBJL 1QHOA 5F7DB 3KJ6H 3QI9B 1ZHKB 1JHKH 4M6OH 3TIEB 4N0FA 3QI9D 1S7XB 2VOTA 4M1DL 4N0YH 1JI2A 3U79A 3QEQB 5C0FA 1A4KB 3OKKA 3V6OA 5E6IB 3G6JF 3WS6A 1UEMA 5ISZB 2CK2A 2VDOH 1KFAL 3HMXL 1YPZB 1H3WM 3NZHL 4JZJC 1GHFL 3PGCA 3I9GH 3QEQD 3EYFB 4KXZH 1UB5B 5ISZD 2BC4A 2QSVA 1AXTL 4CJ1A 3A6BL 4LSPL 3ZT6A 3SGDH 3VGEA 1SEBB 1GAFL 1MRDH 1T3FA 4G7VH 1QBLH 4LQFH 3VI3F 3QEQE 4OI8A 4LSUL 4NJAL 1Y6NR 5ISZE 5CKAA 3DYOA 3KG5A 1LEIA 4NKIH 3LPGA 2Y5TB 4MB5A 4PRIA 5C8JB 5IB5A 1ZLUH 5IHZA 2AV1B 1ZT7A 4KKLD 1VGKA 2BVQB 3W5MA 4DW2L 4H26B 4PJ8B 2B2XL 1RZFL 3LKOA 4K8RH 3VFUA 4I18B 3D3VA 2CRIA 5C0DB 1OVZA 5FUZL 4PJ8D 3C8HA 4HIIA 4BZ1L 1OTTC 1HHHA 4IMKA 3E8UL 3WUWB 2V7NA 1KIRB 2Z0BA 1NCAH 4F9PA 4PRDB 4ZO7A 3BIKA 3VWKB 2EDTA 3JV6A 2ICEA 4HGWA 2E7HA 4FQQA 2NXZB 5D70H 1BJMA 3S6CA 3EHBC 4P2RB 1YEJH 3RUGB 3IU3A 4L4TD 2HWZL 2NXZD 4X5WA 5BW7C 3MRKB 1LO3H 5KSUB 4YUEL 4P2RD 1RI8A 1FHGA 1F13A 4PJIA 2FO4A 5BO1H 1RJLB 4MXQD 4PGZA 2HKHH 5DGQA 1JNNL 1T83C 2DQCH 1FFPA 3NFSH 4P2RE 3QQ9D 4OCWH 4WHDA 3RUGE 3W39A 4X6FA 5CGYC 5CAYB 3RRQA 1SM3H 2DLFL 2YEZB 1EHXA 3OKDA 4S1QH 3RGVA 1CG9B 4ENEC 1J1OH 4J8RB 5FYKD 4F7CA 4F7PB 4F15C 3P73A 4BK5A 3QJFA 1MIML 5J6HA 2YN5A 1R3JB 4HD9A 4DGVH 4RGOL 2ZWLT 5GZOD 4OZ4B 5DD1L 5CZXD 2D0GA 4JFPB 4WUUA 5FYKE 3GUTB 3GIZH 2YOCA 5E0QA 1DBJH 1RIUL 1VADB 3TNMA 5HDBE 1BECA 4B0MM 4M7ZC 3UBXI 3V52L 1B3JA 5CINL 2H26A 4X4XB 1ZE3C 4OFIA 1WC7B 2GYSA 2F53E 5ERWB 1X6NA 2EIEA 3JWDH 4NCDA 5FUOH 32C2A 3P9LB 1NCBH 3CGTA 1DUYA 3K7UA 1HH9B 4XVTH 2ED7A 4JDTL 5F8RC 4I3GA 2SEBB 5K93A 5AD0A 2XY2A 2ZUYA 2ADIB 5ADPH 5DVKA 5E2VL 1NLBH 3S5LG 5IOPB 3UZQA 3O2WH 4L3EB 1I9JL 4U2YA 3CH1A 3ARYA 4WTZG 4YHOH 3ROLA 1IFHL 5ACMA 3KXFA 1WITA 4YBLC 4OLZH 4L3ED 3V2AR 2X4SA 3ESVF 5IKCB 2DQDL 1JUFA 4OCRH 5A1AA 2J4WL 4PGCA 2VXTH 5CGYD 5MENA 4L5FH 2OMNA 1G0DA 4D9RD 3ILPB 4HW6A 4NWUL 1E4JA 4GQ9H 4LSQL 1P2CB 2DQUL 4UB0L 2NR6D 3DRTB 5GRJL 4HIXL 4K94H 2R23B 3WHXB 4D9RE 4ZFFA 2V9RA 4MD4B 3UTSA 5TFSL 3O6MH 1C16B 3VFGH 2XN9D 3TBSB 2JCCA 2MSPA 1RZ7H 2DJSA 3V7AE 3D18A 4YDJA 4AH2A 3UMTA 4XP5L 1KACB 3VFNA 4P59L 3HHRB 3I84A 2IPKA 5GZND 5FM5O 1X4XA 5AWNH 3IDUA 3V4UL 3KLHC 1GYAA 3WFHA 4QXWA 5MERA 2JJTC 1A2YA 4Z7WF 2VXSH 3FT2A 3TVMD 1XCTA 4XBGB 1DQTA 5F89B 4ZPTB 1FZOA 1CU4L 3QIUA 4RFEB 3LB6D 5CBEA 3EYSH 4JG1L 5EFIA 2AXHA 3DVIA 2X5PA 2A6DA 3U9UB 1TETL 3RZCA 2X4PB 4ZAKB 3NCJH 5IGXL 1ZA6B 4PJGA 3B9VA 1IC7L 2P8LB 3O3DA 3LY6A 5AZEH 5EBWB 1U8JB 4ZAKD 2HLAA 2ITDB 4M7LL 4ZPVB 4OV5A 1LE5A 3UTOA 4PJXF 4NZRH 1IM3A 3LEVL 5JW3H 4XC3L 4AEIH 5J1SC 4ZXBC 4P2YA 1A7QL 1RJZA 3SOBH 2A73A 5LBSH 1GGUA 4PV8B 4GRMB 3FO0L 4H1LA 2PTTB 4R8WL 3V0VB 1CFTB 1FH5L 5IFAL 2OJEB 2A6JA 2HMIC 2AK4D 3HA0A 2VQ1A 5ANMB 4O2CA 5C0AB 1E28A 4Q2ZA 3G5YA 2VYRE 3QDHA 1EK3A 1AIFA 5C0AD 1BQUA 1N59B 2C1OA 5IEHB 1IRAY 3MTRA 3NACH 5HHOA 4N0UA 2G2RA 3I02B 1NGYA 3HPJA 3RBGA 3SO3C 4ZFGH 2R15A 2BNUA 4JFDA 5C0AE 5GS1B 4ZTOH 1HHIA 4GRWB 3BPLC 2FX9H 1G6RA 4NNXB 4OI9A 4NC2B 4C4KO 2AK1L 3BKMH 4YR6B 1A02N 1K3ZA 3DTXA 4M61B 3E6FA 4Z7UB 4OI7A 1S9WB 1IAKA 1CXLA 1NCCL 1JL8A 3TZVA 2BVOB 2PW1A 1FIEA 2W07A 1N64L 2IMNA 4LAQH 2H45A 3U9PH 3FFDA 5GHWL 3CFCL 1QO3A 4WFEE 5H35A 4DUXA 3PABA 3GBNH 3HE6C 1U93B 5IHUH 2K7QA 1W72L 2KPNA 5JW4N 3DVFA 5JO5A 4TOYL 1GZPA 4Z7UE 5MI0C 1UM4L 4NUGH 3MXWL 3LEXA 4NKQB 4U1KA 5KG9A 1MH5B 5DD0H 1ZLUK 5DA0B 1CL7I 1ODAA 4PRBB 4QRPB 5EBLB 3TO4A 4Q6IC 4UBDC 1GOFA 1CTOA 2F74B 3QWRD 5DJ8A 4QRPD 3T4YB 1DVFA 3MPCA 3TH4T 1MCWM 2BJMH 2X4QA 5IBLD 3FOLA 3LKSA 3WN5A 3O2DH 3U83A 3WO4C 5DHVH 4HKZA 1ZSDB 1AD9B 2VLKA 4MJ5B 3B6SA 5TGBB 4QRPE 5CSGA 3OG4B 3NCYS 1HWHB 2GCYB 2NY5L 1I85A 5T3ZD 3RTQC 2XTJB 5E7FA 4G80B 1MCNA 5DS8B 2V5TA 1KIQB 5HHVL 5BS0D 2XTJD 4P23D 1R3KB 1NKRA 4IBLT 5DFVC 3P77B 2HTKC 1OT1A 3RPIA 5FOBA 3PQYB 2VR9A 3O9WC 2XTJE 4LSTL 1LO0L 4P2QB 4YH6A 3CDGA 4BZ2L 1TQBB 3PUCA 4KK5C 4MB4A 2AEQH 1XF5A 4F33B 1PQZA 3LAFA 4RWHA 1Z6JT 3PQYD 4P2QD 3N9GH 1FNGA 3KYMB 1NMAH 1AP2A 2YPKB 2V2XA 4BYHA 4H8WL 4G9FA 3L95B 3VMOA 2CO6B 2J12B 3P0YH 3QCTH 4YFLF 4DGIL 25C8L 3PQYE 4M7KH 2CDGA 4PJEE 5DJYB 4YHYC 1BFVH 2VXVL 1CFQB 2YD6A 3ZTJH 3TGXA 3DO7B 3SQOH 5MEPA 3PDOA 3TNNA 3V7MA 1FCGA 3BIAX 4NQXB 1WCQA 4QTHA 5MEQA 3FQUA 2AJYH 1P7QB 5CS7A 3RUGF 4DZ8A 3TBWA 4PJAA 1HH6B 4HF5L 3U0TB 2Z31B 4U6YB 3MJ8B 5MEOA 2XZQH 4KJPC 2M26A 1CDCA 12E8L 3S5LB 3SE9L 3LS4H 2Z31D 3ZT7A 3TT3H 1S3KL 3TA3C 1VHPA 3LDBB 1MLCB 5GGRB 3P40A 5HHNA 3RVUC 5D1QA 4CJ0A 4UUJB 1VFOA 2R29L 2EH7L 3L3GB 4UINH 1BM3H 4Y2DB 2VWEE 3SDDB 5HDBF 5I75B 5IIEB 3IFNH 1Y6MR 2HJLA 2R2EA 1RZIA 1IGYB 3T0EA 1S7RA 2A0LD 2VZ1A 5EZLA 3SDDD 5ITFA 1DL7L 3KWWA 1N6UA 5F7FA 4PRNA 1TZIB 2PO6D 4MJIE 4CU8A 2BFVL 4MD5A 4OKDA 1YEEH 4Y0GA 4E41A 4K2UH 4QRSA 3RL2A 5DQJB 4YWGL 4B53A 6FABL 4M3JA 1KCSL 4LBEA 3SKNB 4BFBD 1H15A 1JMXA 3PWVB 1MCPH 1OAKH 3QAZB 5JPNB 5JW5A 2YA0A 4MAUH 5E1HB 5K9OB 3IGAA 4I3RH 4RFNB 1SJEB 1RZKC 1KF9B 2FYYA 2GFBA 1OGTB 2OBGA 5C0IB 4EN3A 3HZYB 1YMHA 2N56A 1WEJH 5C0RL 1BX2A 5HDLA 1TTFA 4F3FB 2MKWA 1BREA 1EZVY 3MLRL 3L3JB 1KSRA 4ZOCA 1KELH 3WD5L 4ZOEA 4XCNB 4AEHL 1NC4A 1LEKB 3VXTB 4B5EA 3UBXG 2KQNA 3KPPA 5I6XB 1XF4B 1IILE 5EC2A 3WS3A 1M7DB 1MAMH 5C0BD 4DGYH 4RX4A 4WGVB 3FQXB 1TTUA 4HH8A 4J4PD 3L9RA 4Q0XH 3MV7B 4F9LA 5D7IB 3O4LA 3RWDA 3GK8L 3TYFB 4P57A 4HH9B 3FHAA 4YDLB 2FNBA 1ZANL 4U2ZA 3H42H 3MV7D 2NY1B 5IP4A 2DWEB 3O3BA 1QZ1A 5TQ0L 1RHFA 3KDMB 5F7KC 2EXWD 3HE7A 3IDYC 1FE8H 4IOFD 2UWEA 5EA0L 3O8XC 4ORGA 4R7NA 3DBXA 5DEZA 4FG6C 1P69B 4OF5A 4NZDA 3X17A 4Z77B 2QSTA 2AJZB 3H7BA 3H9HA 4ODHL 1JI1A 4I77L 4XP1H 4MYWB 1FQ9C 3GMOB 4PREA 4POZC 3HUJB 1AD0B 1JGDA 3F7YA 4XRCB 2FGZA 3B2VL 3L3IB 3QO0A 1RZ8B 1QA9A 1KJVA 3PWNB 5C6TH 2X40A 3MUGB 3OX8A 4ZUUA 3T08A 2F15A 4TUJB 4KJQD 3DYPA 2XNAA 5DDHA 3OR6B 1E4XH 4YAQB 4LCWB 3QHFL 4JM4H 4JQIL 3RJDA 1IT9L 4J12A 4LIQH 3MGAA 3FTGA 3NPSC 3HUJE 4WW1B 1T7WA 3T4AA 1A6UL 4LCWD 4UT7L 1J8HB 5I1AA 4OD3H 3BHBA 2GITB 5HI5C 1MVUA 1EAPA 4WJ5B 4HS3B 4RISL 1J8HD 3CFKA 5EZIH 3RWCA 1IZJA 2F8VA 4YXHL 3RIFK 2DS4A 1SBSL 5FUCC 3AY4C 5C7XH 3CVIH 5E4EB 2QEJA 5FXCH 3B5HA 1TPXC 4KUCF 3OR7A 3NIFE 3O11B 2KDGA 4R7DB 5EU5A 3LPWA 4R97B 1TJHH 1ZHBA 4Y2OA 3R0NA 1QFWH 2C3GA 5IWLC 3MLXH 4GAJL 4Y4HB 3V5KB 5IG7B 2VDLL 5CIPB 3TJEH 1DZBA 2W60A 3OMZA 4JQVC 3CZJA 1JHLL 5FGBA 2A9ML 2VLMD 4Y4FB 2DMCA 4Y4HD 2CR6A 1G7MB 5FYJH 2QHRL 2X4RB 3PIQB 2V2TA 3IKCB 1S7WA 4KVCL 3QEUB 1KULA 2VL4A 5I74C 4Y4FD 4HWEL 1Q94B 1XGYH 2GJ6B 4X4YA 3FQNA 1T0MA 4JB9L 5TH2A 3HPLB 3QCVH 5BOZG 4YDIH 2YD1A 4PJDB 1EERB 1D3CA 3MLUH 4RZCA 5D1XA 5I1KL 1D9KA 2GJ6D 4A2LA 3RIAF 4I0KA 2DQFB 4IRJA 1M71B 1FC1A 1TENA 1QQDA 3CMGA 5HY9A 4Z7UF 2YZ1A 1D5IH 3V6OE 2D7QA 1M7IA 5DJZB 1GPOL 2IH1B 4PJHB 3O2DA 3VXPB 5DHVA 3TLRA 3BPNC 4JPVH 4EIGB 3PL6A 4PGJA 3QPXL 4M93B 4M6NH 1I7UA 4KROB 3QHZH 2BY0A 4YBHA 3RI5F 1LD9A 5D5MA 4KROD 3BRGC 4MNHB 4I0PB 1P9MA 4ODVH 4Q7DA 2EYTB 1KGCE 1IGTB 2G60L 1CBVH 4HHAB 4F80A 3HAEB 3DLQR 3SDCA 2OCFD 1RFDH 3CUPA 3QNYA 2WAHA 4AG4H 4DUWA 4GLRI 2Q20A 3G6AA 2H8PB 3K8KA 1A3LL 5CEXB 1JHTA 1KTDB 4XH2B 5IROA 1QR4A 1WZKA 4K3EL 4TYUA 2WBWB 4I3SH 2XKNA 3N50A 1Q9KB 1F6LL 3HI6H 2I24N 4HKJA 5FA3A 5LGJA 4JN2B 5ILTH 4PJEF 3C6SA 4M43H 4LLMA 1JGVH 4IRZH 2I5YL 1UJTA 4PD4K 3QIWD 4U1LA 4NCC2 3KYNB 3EDKA 3OJMB 2FD6H 4O5LL 4Y16A 1WT5C 1JRHL 4NC1C 4APQA 1I3GL 3Q5YA 1G84A 1QPXA 3M17B 2CUHA 1R5WB 4R6UA 3MJ7A 1XT5A 3CPLB 2J88L 3RU8L 1AQKH 1P4IL 1P1ZA 4JO1H 5FHBH 4AQ1B 1NBVH 2CLVA 4FZ8L 2HVJA 5JIIA 1L7TH 3BEVB 1FVEB 4WW2B 3WLWD 3QULA 4PG2C 3NCFB 3EDFA 3JUYA 2ZCHL 1VPOL 3C6LC 3JV5A 3L5HA 3IJHB 1ZEAH 5KVEL 3MLVH 1A3RH 2QKIB 1X5HA 3NA9L 2OZ4L 4Y19D 5T1KB 5EO9A 43CAB 1F3JB 1I4FA 3P4OA 2Q76B 1CD1A 2WWMD 4O51A 5T1KD 1BQLL 4MQ7B 32C2B 3BQUB 4NQCA 3FB8B 3D0VA 5ESAA 5JHLH 2EYSB 4NUJA 5CCKL 3BQUD 1XGRA 1J18A 3IFLL 2XRAL 5I30H 3BKJL 4U1JB 1F97A 4EDWL 1JTPA 4GKZB 3U7YL 3OKLB 3M07A 4P4KB 1RUQL 4XP6H 3ARDC 4HKBA 3V6BR 3PP4L 4I4WB 3BE1L 5FM8A 3O4OC 3V4VH 1A7RL 1DQQA 3KLAA 4QRTA 4WUKL 3QA3A 4EZMA 1ERNA 3RL1A 3CIQA 3DNKA 5E5RB 3NCBB 4U1IA 1U8KA 3MA7A 3QEGH 4XTRD 5E1AB 5J3HC 4P5KA 2E27L 3CCHB 1QUNA 3KXFE 4K7FA 4AIOA 2X1XR 2ZJSH 4HXAL 3G9VA 3L5WA 2F19L 4XWGL 3HNSL 4PJBB 3SHSA 2H3NB 1Q1JH 2DIAA 1D6EA 1QFUL 4FZEH 5TJWK 3ULSA 4NHCH 2E7LC 1UH3A 3CXDL 3BP7B 1FG2B 4PTTA 4UT9L 2D7NA 3MRIA 1N8ZA 2W65A 1T22A 5B22A 3BAEH 1ACZA 5DMIH 3MV8B 1K2DA 4QHNB 2W92A 3UTTB 1IKFL 4XGZA 4JRXB 2BVPA 7FABL 2HN7B 5HYQA 3IETA 4PJBE 5T1MB 4U4BA 1G7JA 4XXCC 3ZKMD 3MV8D 3NOIA 4UAOC 1GZQB 2WBKA 3UTTD 2Y25A 5FOJA 4X7SH 5INCB 5FAAA 3ZO0A 3WFZA 1T0PB 2AJ3A 4OFDA 4XCYA 1WLHA 5CEYB 1F8TH 1HDMA 3FFCA 1RMFH 1G7IB 2DQIH 1ONQB 1N0LA 4KKAC 4JRXE 1A7OL 4AIZB 5JZ7D 5F93C 3ARGA 3EFDH 1BVLB 4WGWB 1CQYA 4OLEA 2JLLA 3FRUA 1AGDA 1H5BC 5TDPB 2CLRB 3H0TB 1WICA 4JY4B 4OM1L 5EBMB 5GPRA 3QUZA 5GRUL 4KKBD 3OKEB 4IDLA 4F7EB 1I9IH 3B83A 1HINH 5DJXA 3WMSA 3NPZB 4WEBL 2MHAA 1WJ3A 2R0KL 5KJRH 3WHE0 1AJ7H 2ADGB 3D85A 1FYHB 1I3RB 1TZGL 5FYKL 3DURA 4NPYB 3EJYD 1N7MH 3BPCB 4LNRA 4MNQA 1AO7A 3DWTA 3HUJF 2P8PA 4G7YL 4Z8FL 3RDTA 4OCNC 2EIZA 3ZE2E 4WU7A 1DE4A 1I8MB 4PY8J 1YUHA 2YPLB 2GY7B 3LEYH 1WSST 3CZFB 4GT7A 1IEAB 1OGAB 3ZDYF 1CGXA 1UCBL 3N1QC 5FCUH 5FK9B 5GGRY 2YPLD 1FYTB 3EO9L 1YYML 4C58B 3SDYH 5C09A 1OGAD 1KENH 4EQ2A 3NIFF 4QY8B 3IAPA 3V95A 3LQAC 1FLRH 1FYTD 5B39B 5I1CL 1QHPA 2BY1A 2OK0L 4Q9RL 5JHDB 2F8XC 2YPLE 4XAWL 4N8PA 4JFDE 1OGAE 1VEPA 1KJ2L 4NO2B 2FHFA 2O5YL 1L0QA 5JHDD 2QSQA 3NCMA 4ONGL 3QUKA 1FSKC 1TZHA 4Z0BL 4ZOAA 4RAVB 3MO1B 3U0PA 5HHMB 5GSRA 5JHDE 4Z7NE 1LO2L 2L4OA 5DRWB 3MBEA 4DN4L 2DYPA 3CVHB 4M1DH 5F7YC 4ZNEA 3IDIA 4YPGB 1U3HA 1VACA 4JPIB 5DWUH 5CEZD 3UEZA 4RMWA 1K5NB 4XVJL 5KANI 1KFAH 3HMXH 2ZSVB 3VGGA 2BVYA 1QG3A 2AJVL 5LXGL 5HHME 1NAMA 1CIUA 3VFTA 2OR7A 3TN0B 1AXTH 5KSBA 4FNLH 2M1KA 4LLVA 5SWQB 3DRQA 4R3SB 1S8DA 3PXHA 2J8HA 4FQIH 5HTSA 3TN0D 4F2MA 4LSUH 3V6ZA 4KV5E 4E0RB 5IW6A 5E6IC 3OKOB 3Q0HA 1WCBA 5DHXB 4PJ9A 4XNZC 3UTZA 3MUZ1 3P4NA 5KN5B 5E08L 1DLFL 5J1AA 5JLZB 2VLKE 3OB0H 2H32H 4ZFZA 5F7UA 4DW2H 1YNTB 4TUKH 4MSWB 1AKJB 4H25A 2FEEI 2FJHB 3B9KA 3IFOB 3IS1X 4QHUA 3L3HA 5J57B 4K7PY 1JGUL 4X6EB 1WBXA 1OCWH 1AKJD 4BZ1H 1CCZA 1U8IB 3E8UH 3NCYP 4UOW0 4MX7A 3TIDB 1YEKL 1R3LA 1H3UA 2JB6B 2HJFB 1YDPA 4JM2B 5FKAB 3BP4A 4JFEA 1T21B 3T09A 4P49A 2YA2A 5LWYL 1KPVA 4JM2D 5I16A 2ZCKL 4NRYB 4OUUA 5K9KB 2VC2L 1CDHA 1T04B 2HWZH 4IIQB 2VITB 1BOGB 1UM5H 4G9FE 4D94A 4WHTB 1UZ8A 4P5TC 2CJUH 5T3XD 2B1HL 1KJ3L 3VWKC 4ZOBA 3NFNB 1QLRB 3IB4A 1ZWIA 3R4DA 3QNXA 2C7UA 3ARBC 4HPOL 1H3PH 3NFPA 3O3UN 4GUPA 3RKPA 1XGUA 3WFBL 4OZFG 4BUHA 5FGRA 1G9NH 4K55A 1RQ5A 3VXSA 4MCZA 1I7TB 4M1GL 2P1YA 3GGWA 4LCUB 1MIMH 4KMLB 4OGXL 2KZWA 3CFIC 3ARRA 3MFGB 2YHGA 5DD1H 1EIBA 3TT1H 3FB5B 3UDWC 3L5XH 1RIUH 4W4OA 4M6ML 5C92A 3BDBA 2OJZH 1YNLH 3MNWB 2QSCL 5IW1A 2QQNH 2VNCA 4F7TB 3T0EE 2ZUUA 4BFEA 3BKYL 1EO5A 5D2LA 3T3MF 1S7TB 4U6XA 1YC7A 3FQTA 3I75A 5DJDB 4TVSa 4D9QE 3K1KC 4JDTH 3JV0A 5IVZB 1X5JA 1RJYB 2HTLD 4YDVB 4KKCC 5E2VH 2YSSB 1A4JA 3TWCL 1I8KB 3X3GH 2XQBL 3IXTA 5BRZB 1U8QB 3GB7A 2A9NL 4KU1A 5DURB 1L7IH 1RUML 1IFHH 1N3NB 3Q3GB 2G75A 2GSGA 3HLAA 3WE6B 5DURD 3CD4A 2DLTA 2MTPA 3KYKH 4YHPA 4HUWB 3PWLA 2KQMA 2OYPA 2LAGB 4IHOA 1JYWA 4JFFB 4NWUH 4YO0B 5BRZE 5I8CB 5DVMA 3F5WB 1QVOA 5IK3B 1MHEB 1MY5A 2WK2A 4UB0H 4ZO8A 5GRJH 2C3XA 2KUTA 1IGIL 1T1YA 4JFFD 4E9LA 5CSZB 3CFJA 3HZMA 1EDQA