4BWWA

Crystal structure of spin labelled azurin t21r1.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
127
Chain Sequence
b'AECSVDIQGNDQMQFNTNAIVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title High-Resolution Crystal Structure of Spin Labelled (T21R1) Azurin from Pseudomonas Aeruginosa: A Challenging Structural Benchmark for in Silico Spin Labelling Algorithms.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 34
structure length 127
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4bwwA00
2GBAA 1AS7A 1V54B 1PNCA 4YSUA 2AVFA 3FT0A 3FPYA 3FQ2A 1I53A 4JHVA 1ID2A 2J56A 1SJMA 2HX7A 4GY4A 5D4HA 2PCFA 2BP8B 3OMAB 1NPNA 3NSFA 2Y1AA 1YLBB 2GC7C 3OQRA 4WTQA 7PCYA 1A4AA 4P5SA 4KOBA 3ZIYA 3AZUA 3T6VA 3TBCA 4BXSV 2IDTA 1BEXA 3FU7A 2W8CA 4YSEA 3OMIB 2YAPA 3FSVA 1A8ZA 5I6OA 3CVCA 2HRGA 2GI0A 4E9YA 3X2QB 1OOWA 3IN2A 5I6MA 2OV0A 4KNTA 1NIDA 2OCCB 4JKNA 3X1BA 5AFAA 1OCRB 1JERA 1W6WA 4UF7C 1RKRA 2XV3A 1L9OA 3FYIB 1JZFA 2Q9OA 3HEIB 3SQRA 4G71B 3OM3B 1TEFA 4KNSA 4M3HA 2CAKA 4WKXA 2AANA 2ZWNA 1CYXA 2FNWA 3U25A 2QPEB 3EH4B 3CZUB 3QJRB 1HAWA 4DP2X 3AY2A 4YVNA 1MZYA 3BVDB 1X9UA 3CG8A 5B7FA 1N70A 1JXFA 4A68A 3C75A 4YSAA 1SDDA 1KV7A 2VN3A 2XV2A 2HXAA 5PAZA 2QT6A 2GSMB 4DP4X 4E9XA 2BO0A 2YAEA 1E5YA 2ZOOA 5I26A 2P80A 2ZXWB 1IBZA 1AG0A 1F56A 2TSAA 5B7EA 1J9QA 3WI9A 2XV0A 1RZQA 2VW4A 1BAWA 1JZJA 3NYKA 2EIKB 3D12B 1NIFA 1AANA 2MTAA 2J55A 4KO6A 1AZCA 1JXDA 1MZZA 1NICA 5AZUA 3CVBA 3ERXA 1EZLA 4W1TA 1L9RA 4DPBX 4KOCA 1SHXA 2VSMB 2IDUA 2PP8A 3NJJA 3T6XA 1OE3A 3HB3B 2CALA 2VM3A 4HZ1A 5B1KA 1E30A 2UXVA 3QPKA 1SF5A 4FAAB 2IWEA 1AS8A 2DWTA 4KNUA 3T9WA 3ABGA 1QNIA 2I7OA 2VW6A 3JTBA 3QJQB 2EILB 1URIA 4BK5C 3H4HA 4BWWA 1WS7A 4HHWA 3OMNB 2N0MA 2DWSA 2BP8A 3ABMB 5I6PA 2JKWA 1RCYA 4GP8B 5TK2A 1GSKA 3GYRA 3IE9A 4M4RB 5I5JA 3H56A 3X1NA 1MDAA 1SHWA 2UX7A 4N8UA 2IAAC 4AX3A 2IH8A 4KO7A 2FQEA 2PPFA 1PZCA 4YSRA 4GP4B 1EHKB 3KW7A 2OJ1A 1N68A 4KO5A 4Q8BA 2DV6A 1XB6A 2IWKA 3DKHA 2NRDA 1JZEA 2RACA 2QDVA 2DYSB 3WKQA 2WO3B 2FQDA 5B7MA 4YSQA 1AS6A 3NP3A 3IEAA 3RYMA 3NSDA 3EF4A 4E9QA 3ZBMA 1BQ5A 2GC4C 2XXGA 2BP0B 5D4JA 2PPAA 4F2EA 1BYOA 4AKOA 1ZDSA 1GR7A 3NJLA 1BQRA 2XX1A 7PAZA 2XXFA 1A65A 1GY1A 2ZONA 4UANA 3WNJA 2X87A 2XX0A 3JT2A 1AACA 1ZDQA 4G70B 2CBPA 3IN0A 5IY5B 3TU6A 4ENZA 3AW5A 3S8FB 2IDQA 4HCIA 4A2EA 5A7EA 2LLNA 1JOIA 4CSPA 4E9VA 4W9ZA 1CUOA 1E67A 1GY2A 1NDTA 4HCFA 4HAKA 5AKRA 2HZHA 3MX0B 4RH4A 3FQYA 5I28A 2CUAA 4G72B 4YSPA 1JZHA 1M9WA 1JZIA 4HIPA 1JZGA 4E9TA 3PAVA 1SNRA 1JXGA 2XLLA 4YL4A 4AI7A 3ABLB 4YSCA 2HX9A 4DPAX 1AZUA 2GB2A 3IBOA 5EHFA 2PP7A 2I85A 5I6KA 2UXGA 3FSZA 4G7QB 1ASPA 1PF3A 1NWOA 3V9EA 6PCYA 2IDFA 3S3CB 2A3TA 4AKQA 5B1BB 1CURA 1GS7A 1AQ8A 1OF0A 1J9SA 1QHQA 4DP5X 2BW5A 4GP5B 4YSDA 5F7AA 4AZUA 1KDJA 1PCSA 3KW8A 1OCCB 3G5WA 2IWFA 3PXLA 4N4YB 3QJSB 1IBYA 2Q5BA 2IDSA 2BZCA 3AG2B 2YAQA 2EIMB 4JHUA 4DP1X 1QLEB 1M57B 3DTUB 1BXAA 3NJNA 2IH9A 2BWDA 5ANHA 4AKPA 1L9TA 1TU2A 1ILSA 2BHFA 2YAOA 3ABKB 1SF3A 3EHBB 3PLYA 2GIMA 3AG1B 3WNIA 2WO2B 1ASQA 1IKOP 1ET7A 2CCWA 3FU9A 4HHGA 4DP0X 3TA4D 2VW7A 9PCYA 1PLAA 1ASOA 3PPSA 1PY0A 2BP0A 1GS6X 3H4FA 4K9JA 1A3ZA 4YSTA 4UAHA 1DZ0A 1ET5A 5B1AB 1XMEB 5I5IA 1NTDA 2YXWA 1SFHA 3T6WA 1AZRA 1FWXA 1W6LA 1AG6A 1WAEA 3PCYA 3CDZB 2HX8A 4DP6X 1ADWA 3OD3A 4Q89A 5FC9A 3UAEA 2H5UA 1MG2C 4EF3A 1J9TA 2AZUA 1CC3A 1AZNA 1L9SA 3FS9A 4A2HA 2DY2A 2X88A 8PAZA 3NJFA 3N2JA 4E9SA 5D4IA 4DP9X 3T71A 4BDVB 4GXFA 3FPXA 1OE2A 4G7SB 4HALA 3SBPA 3NJIA 1ZPUA 3NT0A 4TXVB 4DP8X 1KCBA 3V9CA 1FFTB 2YARA 4NAJA 3NJGA 3PAZA 2YAHA 1OE1A 1PZBA 1NIBA 4FA7B 1SDDB 2B3IA 1TEGA 2XUWA 1IUZA 2VMJA 1CYWA 1PMYA 4X4KA 1BXVA 3BQVA 3ZDWA 3SBQA 2WSDA 4F7KA 3PAUA 1V10A 3AG3B 3NJKA 2R7EB 4ZK8A 1NIEA 4E9RA 1JVLA 1NIAA 2UX6A 4A66A 1MG3C 1R1CA 1KCWA 1L9PA 2FWLB 3NJHA 4F2FA 1L9QA 1XB8A 4E9WA 3CVDA 1BQKA 2YAMA 3NJMA 2QDWA 1WA2X 2AFNA 2P80D 1PLBA 1SFDA 3UAAA 3EH5B 1ZV2A 2YQBA 1AOZA 1KDIA 3S3DB 4YVUA 3UABA 4BWUA 1RZPA 2FT8A 5I6NA 3NP4A 4YSSA 5PCYA 3X1EA 3T6ZA 2YAFA 2W88A 3FYEB 1PLCA 4DP7X 2J5WA 4YSOA 3ZX1A 2XYBA 4BXVA 2BW4A 1PZAA 3CDZA 3FSWA 4QLWA 1KBWA 1OCOB 2PPEA 2Y69B 3AG4B 2YXVA 4NB7A 3N55A 1NWPA 2FT6A 4BWTA 3S8GB 3WG7B 1VLXA 1KYAA 2FJSA 1NZRA 1ZIBA 4BDVA 3MBWB 1AAJA 1AIZA 1NPJA 1ZIAA 2FQFA 1A4BA 3DIVA 2PPCA 2J57A 5B1JC 3QJUB 1WA1X 4L0PB 1T5KA 4PCYA 3NSCA 4DPCX 3FU8A 1GW0A 2BZ7A 3GDCA 2FT7A 1OCZB 1WA0X 2H3XC 3GXUB 5E9NA 3FQ1A 1DYZA 2XVBA 1V55B 1HAUA 2AZAA 1HFUA 3UACA 5LDUA 3UGEA 3FU7B 5I5MA 2UXTA 4MFHA 2UXFA 3ASOB 2R7EA 4NERA 5B3SB 2GHZA 2BWIA 1ILUA 1TKWA 3EH3B 3QJVB 1JVOA 2EINB 1M56B 1KBVA 1IC0A 3X1GA 1B3IA 4QKTA 3UADA 2FQGA 4CSZA 3WIAA 1J9RA 4GYBA 2TSBA 2JFCA 4A2GA 1A4CA 2PLTA 2VM4A 2EIJB 1GS8A 3X1FA 1X9RA 3ASNB 1J5CA 3FSAA 3SBRA 5TK4A 1GYCA 1PNDA 1AR1B 4P5RA 4KO9A 1E65A 1ET8A 1PAZA 3QQXA 1BXUA 1J5DA 2FTAA 2HLEB 2HRHA 2I7SA 3S3BB 1BYPA 1UATA 5B1JA 2VSKB 4G7RB 1FA4A 2QPDB 6PAZA 4PAZA 1AZBA 2H47C 2XU9A 1E5ZA 2MRYA 1OV8A 2E86A 2XWZA 2PP9A 5F7BA 4HCGA 1XB3A 3QJTB 1ETJA 1KGYE 4A67A 3NSYA 3TASA 1NINA 3WKPA 4A2FA 1WS8A 2PCYA 1W8EA 3L45A 4A2DA 2DYRB 2B08A 2JXMA 5I6LA 3TBBA 2PPDA 2CJ3A
chains in the Genus database with same CATH superfamily
2Y5TA 2NY3B 5CFAA 1OWWA 1V54B 1PNCA 5E1AB 4DKEH 4Z3GA 5C2UB 2XJLA 3MACL 4PJBF 4RRPM 1ZVNA 4PTUA 1ID2A 3RUGA 1FYTD 2HX7A 2XWXA 1XGRB 4MJID 2PCFA 5D4HA 5T1KD 3MOBH 2YS4A 2YN5A 3FKUS 4HWUA 5BMFH 4WGKA 1N0XH 3OQRA 5LHDA 5DJCA 1HKLH 1EO5A 3VXRD 4P5SA 3UEZA 4B0MM 4D9QD 3HVNA 2XTLA 5G5DB 4L0ZA 1ZWIB 3NFPB 3NZSA 3V4VL 1I9EA 5C0AB 2W8CA 5EU5A 4GRWB 3I6KB 1JGIA 1PU0A 1AHKA 4PRNB 4KQ4H 2HPTA 2NY3C 3IFPB 5IGXL 5IVZA 3NAAL 5EO9A 4LIQH 4A6YL 4EKXA 5E08H 3CZFB 1G6RA 4I13B 3K6OA 5AW0B 1FV1B 4FXLA 1RKRA 4JHAL 2AAVA 2H6PA 4LLUB 1HCYA 1TSHA 1UWGH 3APCA 3LX9A 3NCJH 2HG5A 4H4NA 4WCYL 4LL1A 2XZCL 3MXVL 1BWMA 4YOKA 3C6SB 4MA8L 3S6CA 2JJVA 5GGQL 3WBDA 3RIFK 3EH4B 4F24A 1C08A 4FN0A 1MFAH 2WWMD 3GSNB 1RZJH 5GRYA 4NIYE 1I31A 2Y7SA 1KV7A 1ZLUH 1BGXH 3MA7B 4I0PD 3HG3A 3DVNB 3FBKA 4PJ7E 4RRPG 1PSKL 1G9NH 1FNGA 1G7QB 4I1RA 1ICTA 3U9UB 5JORA 2MPAL 2G3XA 4WWKD 2HT4D 4HGMA 4B97A 3DOHA 2IPUK 4W6YB 3T0XA 4FTVE 5CBAA 4Z95L 3VNYA 3CIQA 2FL5A 4HCRA 1U4FA 3FFOA 3KXFE 2R1YB 2APFA 2MTAA 2J55A 3MRNB 4FHJA 4A7UA 3QRFM 4GG6B 3B9VA 1OTTC 2BMKB 3D6GA 3L3HA 4ZQKB 3T0BA 2YOAA 2IBZX 1QRKA 4GIPD 2PP8A 3PGCB 3MACH 3O8XD 5B1KA 2FJFA 2X4SB 1T83A 5HYSA 3ISRA 3GTTA 4KNUA 5DZOA 4YLCA 2FJHA 2RQEA 3RIFF 2UY7B 4WWID 2EDQA 3QDGA 5ADOL 5IHUH 5FYJH 2YMXL 4AGLA 4M6OL 4B9GA 5I5JA 5IBUB 3MO1B 4JFPB 2LTQB 3V0FA 4XBPB 3D34A 2PXYA 2CWRA 2YD0A 3KW7A 3MJGX 3BXNA 5DQJA 4G1MB 1FYTB 1MCDA 1BZ9B 1PJ9A 2BSDA 4MJIB 5T1KB 3WTYA 4FRWA 5IGXH 1ZA3A 3LY6A 2Z34A 1M7IA 1J8SA 3GXTA 3VXRB 3VVWA 4G9FE 1IIKA 5J1SC 4JHAH 1FE8L 1QFOA 2X53A 4MCZB 3MRRA 1MW2A 3AAZB 4LSUH 4N0RA 2ZWKA 3MXVH 1NH6A 4TYUA 4YUEH 1AC0A 3K2KA 4MA8H 2AJYL 4BQ6A 2ZUWA 5GGQH 4N24A 5C0IB 2VMFA 2LTQC 5HVFB 3BUYB 4BFIA 4LO9A 4CMMB 5GGRY 1D5XA 3CFJA 1ZDQA 2YLKA 4UM9A 4CC4A 3VFOA 2OP4H 4G7VH 4XN2A 3VXUD 2QQKL 4HOMA 1W0VB 3MRGB 2W0KA 3GKZA 3FQWB 5DJXB 4HCIA 2K7QA 1WZLA 4OIAA 3F83A 3PDGA 4K5PA 2VLJA 3C60C 3ZTJG 4KTEL 4I2XB 4PHZA 3ZGHA 4Y19A 1B6UA 1AO7A 3KPNA 1FO0B 1TZHA 1H6EA 3E80A 3WTVA 3T3ME 4JNXA 3PAVA 3GMQB 3V5DA 4PH8A 4EUPB 5BV7C 4WEMB 4X8XA 4AI7A 3H2PA 1EVTC 4JM2D 3EDJA 3PPEA 3FCGA 4MS6A 1ASPA 3KBPA 1ZT4B 5MEQA 3V9EA 5IW1A 2NX5E 2LU7A 1KJ2B 4MASA 2PW2A 2MIZA 1JHLL 1LVEA 5IOKA 5EUOB 5ADOH 1FIGL 3MLRL 4XCCL 5J6GB 5SWSE 1AQ8A 2YMXH 5SV3A 2CCLA 4XCFH 4OH2A 5EOCL 2VAAA 3RVXC 4AUYA 2ZWLT 2BZDA 4G2AA 1SPDA 2E75C 3HUJB 3O8XB 5T8IA 4YHPA 4JM0A 4N4YB 3QG6B 2ICWA 4IIQA 1NCWH 1U8JA 5KSBB 1KULA 4WFGE 5EU4B 2DQDH 1XDTT 4W9IC 4O02A 2C9XA 1T66D 3GIZL 1EIBA 4N8PA 5E1QA 1CFBA 3BQUA 4XB7A 3FQXA 3QVAA 4JG0L 1FE8H 5IBUG 4AKPA 3F6IA 4DUVA 2HLAA 4DAGL 3CXHK 4H0GA 5DJ0A 3RKDD 1EEQA 2AJYH 2PO6D 4LNRA 4RNRA 3H0TA 5A2AA 5CJXA 3RFZC 4QHLA 3HI1A 1ASOA 3EXLA 1JNJA 3RWCA 3RWIA 2IANE 1LP9F 4YSTA 1A1MB 1T7XA 2R39A 3DVGA 3KH4A 4DJMA 1M2OA 5IHZB 2Y7LA 4F7CA 3O8XC 5B38A 1GKEA 1SJVA 1YEGL 2QQKH 3LSOA 5F88B 3INUH 2P45B 4Q89A 2XPGA 3UAEA 3W38A 4BRVA 4EF3A 4MAZA 1PIGA 4NBYB 2DLTA 5KYXA 4AZ8B 1DBMH 1OP5K 3H9YA 4KTEH 4YIQB 3NJFA 4NN6B 2JB5L 4GXFA 4OZFB 2D0HA 4D7PA 3IGKA 1LO2H 3VD0A 1M4KA 4DFIA 4X6CB 1V3LA 3RVVC 5CSZA 3VXUB 2IDCA 1AY1L 1G9ML 1EDYA 4LCCA 4GMSH 4XN9A 1YEKH 4HC1H 4E41D 2J8UA 3BZEB 5ETUA 5I15L 3NOIA 2MFNA 1JHLH 1OGAD 4IJTA 2DQCH 3BQVA 4KKCC 4N2NA 3WIFB 4NO0D 1FIGH 4XCCH 3NA9H 2FGZA 3DBXA 4BQBA 1FHNA 3D2UD 1GIGL 4QHPA 5EORL 4EUPG 4PRAA 3QO1B 3QH3B 4GPVA 3GRGA 5I6XB 4U2ZA 4ELKB 5DRNA 3MUHL 1L7IH 1IAOA 2VKWA 4JM2B 1BQUA 4HWEH 4Z78B 1WBXB 2UX6A 3RIAK 1H3PL 2NSXA 4C55A 3LHAA 4NM8H 4G5AA 3FB7A 4HFUL 5C0EA 2FVNA 3VMOA 1YY8B 4DO5A 4N2MA 5DUML 1UH4A 3RVTC 4FDWA 3QFJE 4JFWA 1LO5B 2XV6B 1LYQA 2DBLL 2PKDA 3FTYA 5H2BB 3GIZH 3RJQB 2X1PA 3MRCB 5IB2A 4Z1PA 3F7QA 4JG0H 4Y4KD 2HLFD 4WEUD 4DAGH 1KIQB 2XTJB 3C5ZD 3DI3B 4F8PA 1P4BH 2P28B 3VXPA 5KVMC 1GPOL 2R0ZL 1ZV2A 3APMA 5GIRA 3SKOB 2D3NA 5L2JA 2OXHA 3WEAA 4E36A 3IRZA 2X7LB 3F12B 2WIIA 2H9GA 1B0GA 2N7BA 3ECVA 3HC3L 3OKNB 3HNVL 5I6XC 3PAYA 4X8JB 5JZ7D 2KBGA 2YMTA 4JM2C 3QYNA 5SX5K 2UV3A 4K3HA 1CXKA 4KTGA 4P2AA 5MEOB 1N67A 1RQ5A 5L0QC 1M6OA 1YEGH 1CLZL 1A7PH 3EBIA 5T3XL 4ACTA 1P7HL 2JCCF 1OSZA 4G9DB 4PVLA 3RURA 2WIMA 3MV7E 2PO6B 4H8WH 1MCRA 5DJZB 4AY0A 2XIIA 4G6AD 4L2LA 3MLSL 4C8XA 4NB7A 2XTJC 4JPVL 4KMTL 4LLYA 1GGUA 1TOXA 2CE6A 1DJGA 3JTSA 2EVHA 1SBBA 1PZ3A 2DQUL 1A9EB 3TZVD 1TTGA 4OFIA 4N2EA 43C9B 3VSVA 3FB5B 1G9MH 2PPCA 4NZDA 3ALWA 4MDRA 4WWPA 4IDJL 4TLSA 1T5KA 2VL5A 4FI7A 3ESUF 3NSCA 1KGIA 1OAJA 3BUDA 4XGZA 2E7LA 3MRFA 4MX7B 1RUQL 4N0CD 1SJEB 3OHXB 4GKNA 4OF3A 1SXBA 3Q5YA 3ZR6A 5EORH 1E2VA 5JOPD 3LRMA 3MMEB 1X7QB 3BSZA 1HYRC 4OZ4B 2UWEB 4WK4B 4GRWF 3GMOA 3IF1B 4Y89A 4M5ZL 4UILH 1GYAA 3ZMEA 2V2WA 3LEVH 3N1GC 2C4FU 3KHOA 4NERA 4Y4FD 3W0WD 1X5YA 3P4NB 5DWUH 4FXGA 4ICXA 1NDMA 3HI6L 2APWA 4JJOA 2XKUA 2DBLH 1C5BL 1OGAB 3ULVF 1P9MA 3MKGA 1VF5C 4S1SL 4JK0D 1XGQB 2VOTA 1NMBL 4CJ0A 3DJTA 3O45B 3D2UB 2PABA 3WXVH 2FEEL 4WU5A 4YWGL 5CP7A 1T80A 3VI3F 1DJWA 4FNRA 2GFBB 4JDEB 2OR9L 3Q2NA 3ARFB 4KMLB 4A04A 4J3WA 1RVFL 1XF3A 3OHXC 1A4CA 4HT1L 4NN7B 2HRPL 4U1HA 3V5KA 1QLEL 2UYLB 3L13A 2W60B 5MENA 2QFPA 1XIWD 3MNZA 2EDBA 3OGCB 2DQHL 3HNVH 2BOBB 5FUOH 4ABUA 2N1TE 5AOLA 3MLTB 1VACA 3S3PA 4KTYA 4LKCB 1SEBA 1T0MA 3T0EA 4KJYB 3AUWB 4Y4KB 1CLZH 4LLDB 5D7IE 5T3XH 3S3BB 3C5ZB 1Q9OA 3RWGB 2Q7YA 3DV6A 4XAKE 6PAZA 1KTJA 3PWNB 3CU1A 3ATEA 1E5ZA 2MRYA 2CRIA 3MLSH 4N2OA 3OAYH 3QHZH 2ATAA 4NWTL 4JPVH 4KHTH 2FZ3B 5DZAA 3QJTB 4UTBH 2ZKYA 1PZSA 5LGHL 5TF1L 3QUKA 4YO0A 3ARFC 3KNBA 3NSYA 4NN7C 4M7JH 5TDPA 1CGWA 1AR1D 1G6RL 3RE0A 5JPNC 3F3HA 1I7TB 4UUJA 1O9ZA 4WHTB 1PJWA 5DC9B 3UYOD 5JNYB 2F53D 2QJDA 1FVDB 2Q6WA 2EE2A 1MFMA 1NDGA 4LRNL 3ARPA 3GDBA 1RUQH 3C5ZC 1UENA 2BP8B 2K6WA 1BBJA 4MQXD 1J12A 1KLUB 1BJ1H 5IJCC 2DPKA 5LLIC 4FE9A 2JNZA 3OWEA 3ZDZE 3D3VE 4AL8H 2VO8A 1SVBA 4RZCA 5CU9A 5CLYA 4FNLL 4QRRE 3VTMA 5DGQA 4OCRL 1X5GA 4ESKA 4AQZA 3KLKA 1WFOA 3X12B 2F7QA 3QUHA 3GSXA 3U1QA 4AE1A 3QQ4B 2GJ6A 1WFUA 1PFOA 5KS9E 3BAEL 5J56B 2IH1B 1H5BA 1S7SA 2VQUA 4S1SH 2HRGA 4HCRL 3BVTA 4IHBA 5KVFE 1NMBH 1UT9A 4Q56A 3FFCE 3JQOB 4XPAL 2WZPA 1L5GA 1AD0B 4YWGH 3QZBA 5D70H 2NW3B 2IV8A 4UV4H 3REVA 2OR9H 1JGEA 3T04D 1RVFH 4HT1H 2XV3A 1P7QD 4M1DL 1JPFA 1VGKA 3FAWA 4QRQB 5LWYL 4KK9C 4Y4FB 3W0WB 4NCC1 1IGTA 4PJHF 4JJ5B 3EUUA 2WNKA 1E6JH 3W2DL 2QPEB 3QEUB 5D7KD 3NSJA 3ECUA 2H26A 3AY2A 3CZGA 4YVNA 2ZUXA 3SDAA 2AQPA 1HL4A 3TBWA 1TUPA 2OMUA 4QYOB 3S34L 3C75A 3UIZA 3G5YB 2VN3A 1EX0A 4N0CC 4OCSH 3K74B 1KBGH 1KEMH 4X7SH 3VI4F 5EF1A 1BAGA 1XIWB 4GG8A 4L1HA 4NWTH 1XX9C 1SOQA 2A9ML 2D0FA 1JAEA 5I8EB 3SGKC 3H55A 4G8EB 4WI4A 4ELMB 5CLTA 5GXBB 1IKFH 5KVDH 1NIFA 4H0IA 1G6RH 2AQ3A 4OJCA 5F89A 2WQVA 3DTDA 1JZ7A 1CXHA 2YGVA 2JI1A 4Y5YB 3F5WA 3KPSD 2JK5A 2AMUA 5HDOA 1W80A 4JPIB 5BQ7A 1SHXA 2KZBA 2VSMB 5IM7B 2CKBB 1SOXA 3T1WA 4HZ1A 1OTUD 4G8IA 3CLFL 3TC9A 1TVHA 1CL7H 5D1ZA 1BQLH 5LBSA 4DQAA 1YRKA 1U92B 3E3QE 3O6LH 4LEOB 3CFNA 5E8OA 3ZTEA 2WXPA 2JJUA 3MR9B 3QEHB 3VFPA 3MOQA 5I6PA 1XIWC 5BZDA 5IBTL 4LHJB 2OMTB 2DQEH 4NKIL 1SHWA 2D7MA 1FNFA 2IAAC 1AQKH 4FTVA 5L8JB 5JQ6H 4X5PA 3MV9E 4KO7A 2EVIA 3P77B 2RQ8A 4HUXA 4AGOA 5K1VA 1R5VB 2SODB 1NEZA 4Y5YC 4JG5A 3NACL 3PDDA 4OFVA 4HCRH 1MLBB 5A3IC 4GINA 2RACA 5BRZD 5EMYA 4LSPL 1RPUA 4MXQD 1Z7JA 3U9PH 1F3RB 2I69A 3L2NA 1MFUA 1VB9A 2IADB 1FLRL 3IEAA 1VKXA 5IMOB 4JZNB 3IETB 4H7VA 1MI5A 4M1DH 2I07A 4KKQA 2D03L 4QRAA 3LN5A 4HV8A 4LB8A 1OAKH 5I17A 3ES6A 1IV8A 4ZD3L 1RD6A 1AXIB 1WG3A 2XX1A 5CZXC 3IU4L 3EFDH 4KKPA 1H0DB 1THCA 1G0YR 5G2NA 4QRBA 3N5AA 2FX8H 3S34H 3RJOA 2NR6A 2ROXA 3BLPX 2EUWA 1FZKA 4IU2B 1CFSB 1OLLA 2ZAIA 4IHOA 2HJKB 3X14A 2VLKD 5E5LA 1UB5A 1YNTF 2VZ1A 4OFYA 5JO5A 3B5GA 4GMTL 3UAJC 4WSGA 4NN5B 4HEPA 1P7QB 4P3CL 2Z3FA 5JPMC 3AFLA 5K59F 2COQA 2VDPL 3BFWA 1LK2A 1YEWA 3HC4L 2P5WE 4G9FA 4X6CF 1NDTA 3MA9H 3HJ0A 4GXUM 4OJAA 3MU3A 4PGDB 4LVNC 4UQ2B 2O4EA 4WW2F 1RULL 1T4KA 4K3JL 1PFCA 4N1CA 4O02L 1U36A 4X9GA 1BF8A 3QPQD 1QUNA 4HJGA 4NHUA 5AW9B 4IOIA 1OOAA 4A38A 1AZUA 4URKA 3PQYA 2XVLA 3VD3A 3FONA 5AYUL 4Z7AA 3MLVL 5BUPA 2PWHA 3TGXA 3I6SA 2DM4A 2DIJA 1YJDL 4NN5C 4UT6A 3D06A 1RP9A 5IQ9B 5D1QA 3OKOB 4YPJA 1BEYL 1WUNT 2I27N 2YXMA 3MJ8A 3HR5A 3KPSB 2XIBA 2X6UA 3MRQB 5KVEL 1I8KA 4NKDA 4Y9FA 1K3IA 2Z6FA 3JV4B 3JTTB 3FQUB 1OCCB 1X5KA 5L6YH 4PUBL 4X6DA 5JIPA 4NKOA 3QA3A 4TUJB 1JPGA 1GL4B 4LLMB 3VQ2C 5DR5H 4LSPH 1BF5A 2IOMA 2PTVA 4JFXA 4DVBB 1K5WA 1B4TA 2IH9A 3BP7B 4NRZA 2WKOA 4K7PL 4YEFA 3DLQR 3D85D 4ZT1A 2NX5A 1ILSA 2GY7B 2XFXA 2R9HD 1RZIB 1XD0A 1KCKA 3U0TA 1KPRB 5I16B 1BMWA 1H8NA 1G7HA 1U58B 2OZ4A 4FADA 5EDSA 5SWSA 4ZD3H 3WEBA 2F54D 5KBLA 1S5HB 4I3RL 1A3QA 4MAYA 1JYNA 4F33A 4RX4A 3B9KA 4K9JA 5C97A 3GUFA 3W9EB 1ET5A 3T4AB 3QULB 2NY6D 5B1AB 3LXUX 3PHQB 4XHJD 1F4YL 1U3HC 5FLUA 1THAA 3BAWA 5I5IA 3FCSA 1QATA 1A47A 4IMKC 1K5NB 4GMTH 1A1OA 4XWGH 4P3CH 4HMEA 3MLYH 1LXMA 3QJHA 1X4XA 2J3SA 2DWEB 3HC4H 3HG1D 4GAFB 2WYTA 1JI1A 4OZHE 1RUML 4IBQA 4XMXA 5C0FB 5I24A 2P7TB 2J88H 3M45A 3TWCH 1ULVA 1AI1L 2WVVB 4HYTB 1MJ8L 2I32A 3JWNC 4XP5H 1RULH 4K3JH 4RMUA 5DQ9A 4JO3L 4G7SB 4DZBA 4EJ1C 5HD8D 4QAWA 3Q06A 2I9TB 4YMPA 2YJQA 2HFEB 1KG0A 2IANA 1MHHB 4BSJA 2Z93A 4MJ6B 3T4AC 3H6AA 4P2OA 3H9SA 1IM9A 4I7ZC 3QNZA 5CP3A 5F7DA 5AYUH 2WXRA 3L95A 3MLVH 2O61A 1SDDB 4PW4A 4S1RL 2IH3A 1UJTA 2XUWA 2UWEF 3WFCH 2BWQA 1CYWA 1MNNA 4YFLF 4N2GA 3VFTA 2L4OA 3T2QA 1BEYH 4F7KA 1QOKA 5ESVB 5JTWA 4ZXBD 4TQPA 4FABH 4N5UA 1NPUA 1WGOA 4Y5XA 3SYQA 1NIAA 1EJFA 5I73B 1A3RL 3VRLF 1TO5A 3L5IA 5DJ6A 3EFFA 3R1GH 1FL6B 2HKHL 2IPKA 4Z3HA 4XNMA 1TIUA 4DZ8B 2R51A 1O75A 5F1IA 4PM1A 4ANWA 5T33L 4QOKA 1DFBL 3S35L 4ANVA 1I4FA 2VDNB 2Q76A 4QHNA 2R4RL 2GITB 2WBXA 3QHFL 1BQKA 2H3NB 4G8AC 5FYLL 1CLCA 2C3HA 3H2WA 5GGUB 4A7QA 2AFNA 2WLZA 2IF7A 1PLBA 1T5XB 1E8YA 2EH7L 4X99A 5EOCJ 2DMCA 2X9YA 3HIZA 3M46A 2XBZA 1XH3A 4I3RH 4G80B 5GISH 5L2KB 4J1UA 3KWWA 1JPSL 1XGUA 2YJLA 1UGNA 2C9QA 3D25A 4RMRA 5I73C 1WH0A 1F4YH 3IDGB 4BH7B 1MCQA 5LKNA 1E3ZA 2R69A 2YZ8A 2FSDA 4JM4H 2Z1KA 2BIOA 3BSZL 2ZYSA 1ZE3C 3CC5B 2RMNA 2GJZA 1X5XA 2VDLH 4NZJA 1CGXA 2X12A 5F3BB 3OPZL 1E5AA 1XR8A 3CDZA 4ZPTB 2EEXA 5KYUA 1MFBL 1JFQH 4QLWA 4N68A 4LRIC 1SJHA 2F54B 2PPEA 4WWOA 1AI1H 3NZHL 4QJ5B 5IQMA 5JUEL 1ZHNB 5F7EL 4RIRA 5FGCB 5ICXA 2E76C 4HX1A 3C2AH 2NY6B 2CK0L 1ROCA 3K1DA 2D3VA 1ZIBA 2HTKD 5I9QB 4N3UA 2W59A 4Z7QF 2D31B 1AAJA 4RGOH 3NABL 1MF2H 2N59A 5D7HA 2DBJA 2J57A 3HG1B 4M93B 5LNEA 2HFFA 2BOCB 2P1YA 4FZEL 5CD5C 4MNGB 2WJ7A 1WA0X 1T1ZB 4WI9A 5A7BA 3GXUB 4X5QA 1IBFA 1R5IA 3IU3A 5C71A 1FI8C 4ZFOB 5HGHB 1E8ZA 4KH2A 5LDUA 4AG4H 3Q5OA 4QNPF 2WLNA 2VABA 4M6AA 5KANG 4NQEE 2LVCA 3WNMA 3WJLC 4D0CA 1R5WB 5I9QC 2BWIA 1FZMB 1HI6A 5E8PA 1M56B 5T33H 1F4XH 1DFBH 1LO0L 3ARUA 4GW5A 3S35H 2O6DA 1NOAA 4EDWL 4F9LA 2A6DB 4M93C 4XOCA 1ZS2A 1JNHA 5CGBA 1KIRA 1J9RA 3QI9A 1P69B 3C5SB 4UZUA 3DMMD 3ARBD 2VDRB 2EH7H 5C0ND 2B9BA 3WN6A 2MJWA 4GUPB 2JI3A 3CLWA 4PJAA 4AEIL 4P5KA 4F93B 5HD8C 5KAQG 1GS8A 2EYSA 3IM1A 4NKMA 3BAXA 5GRWA 1XCQA 4U1NA 5TK4A 4I3GA 5FYKE 3IVKA 4N90E 3LIZA 3UTZB 5AB2A 3SY0A 1DL7L 1JK8B 3IAPA 4JR9L 2P52A 2YC1A 3TF7C 3U2SB 1ML0A 2A6KB 1N2RB 3BSZH 4W6XB 3TO2A 3J7HA 3O6ML 5ICYA 3K4ZA 3ZRFC 1DBKL 4LVOB 1A6AB 4GXUN 1BVLA 5CJOL 3FQRB 4N9GA 1L0QA 3NZHH 5ID1A 5JUEH 5F7EH 1EEZA 1KZQA 2VUKA 3CXDL 1XF5A 1ETJA 1KJ3L 2KPWA 4H2AA 5AKSA 2BHYA 1UYWL 4LDLB 2CK0H 2IXQA 1BIHA 1BG1A 4WNJA 3C6LD 1MRDL 3G5XB 4W9HC 4W9KC 5HYQA 3BPNB 3TYFA 4CL7A 1YPZA 3IJ9A 3NABH 3CHQA 4CGTA 2BCKB 3UTQB 3FRPB 4EI6B 4M1CC 4ZOAA 3A6OA 1PEWA 3ETBJ 3KDMA 4XHQA 1SDAB 4HWZB 4HF5H 1AD9A 4LVOC 2A74B 2OMYB 3OJDA 2H2SC 3OR7B 2ITFA 1YEHL 5DDHB 3K8KA 2DTSA 1SGKA 2FIRT 3JV5A 5EFIA 5J6SA 7CGTA 5A2IH 4F9PA 1F1DA 2AXGA 3UBGA 5AOJA 2OMWA 3DDFA 4LSQL 2O6FA 3FO1A 3GJFB 5MEPA 3VFVA 5SWQA 1S9WB 5IB5A 4HKJB 3BPNC 2HG0A 4I5BB 4HXBH 3SKMA 3X2QB 1FFPA 1OOWA 2R2HB 2JQAA 4WRLA 2GHWB 3PP3H 3GMPA 3B6SA 3JWDH 2GPZA 2JB6A 2Z0BA 1S9XA 4JFZL 3GSVB 3NVQA 5T3ZL 3QCVH 4PJIB 2A74C 4AEIH 5D2LB 1CF1A 1HILA 2K6ZA 4HUUA 2RFXA 1LEKA 5CBEB 3DHPA 3DRTB 2CAKA 5LBSL 4QRRA 3EYVB 3KLSA 3BDYL 2C9PA 2CHNA 4XZUB 1DL7H 2JLPA 1SMDA 2A0LD 4JR9H 4QYAA 4TLKA 3S5ZA 2B4CC 2ESVA 4DCQB 5INCB 4PJBA 2KHAA 3I9AA 3S4SA 3EADA 3O6MH 3GSUB 4YSAA 1MHCB 5KS9A 1DBKH 5JHLH 1RUAH 1MCEA 2HXAA 3AQZA 3CFUA 3QG7H 1AXSB 2JKRM 3TEZA 2BVOB 1BZDA 2JV6A 4E9XA 1OZUA 3QNXB 1P5UA 1OZTG 3TCLB 1S7TA 4PJHE 3VD9A 4AWJC 4PJFB 3CXDH 2H32A 1KXVC 1MCNA 4CVXB 3BEWB 1K72A 1MRDH 1QW9A 2EEFA 4NUPA 4DEUA 1AZCA 1LEGB 3AWEA 2BRQA 3CVBA 5AZUA 3U7WL 3VI4E 1QLFB 4PTTA 5B39B 2FEEI 2XG4B 5GGSY 1RK1A 3NIDB 3FNKA 5IIEA 3UZEC 5DURD 2R8SH 3HZMA 4KK8D 1SF5A 2VC2B 3LB6D 3SO5A 3QS2A 1AS8A 3LS4H 4R83A 3IJHB 1YEHH 2QZQA 3H4HA 1YVLA 5IROC 4K3EL 3C6LB 5EIVA 5T5FA 4TQIA 1GOHA 5D6CB 2Q2LA 5JHDA 1NEUA 2P4AB 2XQ0A 1CG9B 1DJIA 2FD6L 4LSQH 1VGEH 3PP4L 3FRPG 1DUYA 5F96H 3ILDA 1YY9C 1PZCA 2D7QA 4I3SL 2LQRA 1UZ8B 1N68A 2VGLM 3VA6A 5JW5A 3UTSE 4PP1C 5FGRA 4X4YB 3P0VL 5DVMA 1TU2B 2C3VB 2ZYIA 4LCWD 4NSKB 2I9LA 1ZT7B 2XVGA 4NZUL 3M86A 5T3ZH 7FABL 4PQXA 1U3YA 3DX3A 4PLJC 2LLLA 1V27A 2EDFA 2GC4C 4QRSB 4ACPA 1G0XA 3GSRB 4O58H 4L05A 4U6XA 2XY2A 1OP3K 2XY1A 5HDBB 2CJSA 4JN1L 4AQ1C 1BYOA 5LBSH 2WD0A 3BDYH 3KH3A 5F8RC 4H1LB 1NCAL 1ZS8A 3EGSA 3EFOB 4UT6L 3QDMB 1T04B 4WNSA 2GK0B 1EZVY 1NKRA 2BC4A 2LOEA 4MZRA 1CICD 2P8MA 2EZ0D 2J44A 3MQIA 3WHXB 2CLZA 3OAWA 4Z3TA 5SWZE 1BM3L 1Z9SB 1IGYA 2IDQA 4O5LL 3QUXA 4XNDA 3HPJA 1N12A 4I77L 3REWA 5HHPB 1LHZA 1XZWA 4MNQD 4YQXH 2YMOA 1Y18A 1HK6A 4ZODA 4AJYV 4GH7B 4YSPA 4I0KA 3EH1A 2VR7A 3L6FB 5FB8B 3U7WH 3NDZE 2J72A 3ETSA 2XLLA 1BREA 1C16A 3VXMB 2ZUUA 1HU8A 4YDIL 5ACMA 3S0PA 3WY1A 1SQMA 5F0LB 2OZ4L 4D0BB 1UKQA 1SXAA 2XQYG 1OWRM 2RJMA 3V6FB 1OGPA 3UCRA 2XWBB 5KVGH 1B0RB 3VXQA 2BY3A 2QGDA 3RBGA 4UNVA 4HFWB 5BW7A 2P5WA 1H9VA 2FD6H 5DHXB 5B39G 3PP4H 3TBVA 3ZN6A 2CUHA 3UTOA 4AZUA 1A4JB 4YSDA 4DGYL 3FUNA 1KDJA 1DJSA 4I3SH 1KIPA 5E2WH 2YZ1A 3C2SA 4JZOA 2EADA 4FZ8H 5TTRA 3NCBB 5D6DA 1L6XA 3P0VH 2KZKA 1BECA 3FQNA 3TYGH 1DJZA 1GGBL 4M5YL 1OB1A 3MXWH 4P46A 5HPMA 2WWKO 5HHMD 3BGFB 2Z7WA 3HJEA 1HS6A 3CHPA 3VFNA 3WEXA 3O11B 3AG1B 1F90L 1JZ6A 5CGMA 1KB9J 4HHGA 4JY5L 5EBMA 3MREB 3D0VA 3S5LB 1CGVA 3BKCL 5AEAA 4BQ8A 3RA7L 1NCAH 2VDML 2X70B 3S7GA 1T5WB 3LQMA 4HKXB 4YHZL 1EWHA 2W91A 1A3ZA 4M9OA 3K6FA 4JCLA 4IRJB 5E6ID 3QUYC 3UTTD 1HX0A 1ZJBA 3VFMA 1UWXK 3LB6C 1REIA 1BM3H 4AOFA 4BZ1A 1K6QL 4LPUA 2DQTL 1J9TA 3BGFC 2F1AA 1CE1L 4K7PY 4J3OC 4I77H 2ZJSL 3HS0B 1X5ZA 4DO4A 2DOCA 4YZFE 4UWQB 3SGDH 4XOAA 4XBGA 4XNUL 3MYJB 1RMFL 4PEEA 2PW1A 1CO1A 4Y5VA 1AGCA 2GTZB 4JY4B 4JY6B 4WWNA 3ENEA 5KYYA 2V8LA 3F7YB 4TQ8A 3U4BL 1DQLL 5H37G 3U6RB 4R96B 1HH6B 3OLEA 4NHCL 4YDIH 2EDEA 1A6TB 2GBTA 3RVWC 4X98A 1JN6B 1E4HA 4K9EC 4AC4A 4IRJC 1PZBA 5A43C 5AENA 3FT2A 1KTDA 2Z35B 2ZX8A 4MNQB 2VXUL 1A7QH 3OKLA 4OZHA 2R69L 1MAML 2BRRL 4NDMA 4JO5A 1UJ3A 1V7ML 5EEUA 2N56A 1LP9A 3NJKA 4PY7B 4ZS6C 5C07A 4O2CA 4OFKA 2QSVA 2YEQA 5KBKA 5MHSE 1TKWB 3BP4A 3CSFA 4ZO8A 5HGAA 3UL4A 1U95A 4HUVB 5KSUB 2EZ0C 2ATPA 1EJOL 1GGBH 1L9QA 2ICWI 3O9WA 5DK0A 1UOKA 4QRUA 1I1FB 1QO3A 2WSKA 2KLTA 4Y16A 5FUCC 1HHKB 4RFEA 4MLSA 3Q5TA 4P2RD 3DX8A 1F90H 3L9BA 1QBMH 3DA0A 5CP3H 1DVTA 2NY1C 1HQ4A 1Q4NX 3VQLA 3OR6A 1XGTB 1FORH 1FGNH 1ZD6A 3BLBA 3RA7H 4S0SD 5A16B 1AR2A 1J11A 1NA8A 1OW0A 1WCQA 3PWVB 2HT2D 4M8VA 1IEAB 3PUUA 5E6SB 1Y07A 3P4OB 4J3OG 5HHMB 3TCXA 1OY3B 4GO9A 1WT5A 2PYEE 1KT2B 1W72B 2OTUB 1YN6B 2APTA 1ONQA 1K6QH 1SDYA 1OF2B 4RAVB 4CU7A 4NO5A 2DQTH 2J5WA 3EJQA 3H42L 2OX5A 1CE1H 1YYCA 3HRZA 3D0LB 2ZJSH 4UBDD 3MRMA 4YH6A 1XT5A 3O4LA 2WMPB 1E28A 3IK2A 5DRZA 3GRWL 4XNUH 2IALA 1RMFH 3IJ8A 3PV6B 3VW3L 2AEPL 4HVBA 4P23A 4RGNB 5E6IB 2OCJA 1SLWA 2XPZA 3WLBA 1IQDA 1JV5B 3UTTB 5EBWA 2BVEA 1DQLH 5D72H 2MOQA 1IILE 5DHVA 1ND0A 1ORSB 4YDJA 4HK3J 3UFIA 3BN9D 2J4WL 4AENB 1NGWB 4JPWH 3V55A 1ES0B 2QKIB 1JPTL 5GSRA 4OV5B 4FLRA 3L9RA 5BUAA 3SYPA 3B8YA 3VACA 2ENPA 2VXUH 4JMXA 4C56E 3FZUD 1UA3A 1NFDF 3LIZL 1DYZA 4F8LA 6FABH 1CLOL 2R69H 5L88H 3DPDA 1MAMH 4R7DB 5CN1A 3CE1A 4F2MB 2MQ0A 4X7DC 1V7MH 3JVGC 5EZJA 3TBTA 1SUJA 4ABQA 1MLCB 2ITDA 8FABB 1U0QA 3T0DA 3IMRA 4RGNC 3L7EB 3QUZD 5E6IC 3GLEA 4G5ZL 1MIEH 4CW1B 5B3SB 1P7BA 2D3JA 1MHEA 2JCCA 2HFGL 2QLVB 4Z7OF 5C9JB 1IT9L 2WCPA 2HKFH 3U2JA 5JIQA 3UADA 4Z7WB 2QKIC 1P4UA 3HC0A 4CSZA 1R0AH 4TVPE 3VFGH 4N26A 3ZQXA 1BIIA 2DLIA 1I9JL 1QRNE 4FLHA 4ZMZA 3GK8L 3KYNB 5DVPA 1RZJC 4XN5A 4CN1A 2GSIA 4TL4A 3CVIL 1P5VA 4ONGL 5DEFB 3SSGA 4RISL 1PNDA 1DVFD 1G9NC 2BIIA 4P59L 1NGYA 4NQEA 3IDYB 1TTBA 3JVFC 4F58L 1G7JA 4ALAH 4L4VD 1W16A 2I7SA 1D7DA 4FKKA 3BUQA 2JIXA 2VXVH 5DS8B 4P2RB 3FBQA 1GOGA 3TN0A 1BVKB 3V4VB 1G7PA 1J8HB 2IV9A 3G6JE 3V0EA 1S9YB 4ZO7A 1WTLA 2YFNA 4LLVA 2PP9A 4PJ5B 3MLPA 1WBZA 1IGFH 1YSOA 4LCYA 4L8BA 4U1JB 4QKXB 4LBEB 4B9YA 3N9GH 3VW3H 3HPLB 4A6YB 5BO1H 1YYML 2WB1A 4JZJA 4L2YA 1BX2A 1EZSA 4QTIL 1D9KD 2FX7L 1D5BA 1DLHB 3Q9PA 4RZKA 5K9KB 1KXTB 1RPQA 4WIQA 4MD4B 4JFDA 2J4WH 2CO6A 3LJ3A 1IJ9A 2DIBA 5AZEL 3RX5A 3IDYC 1JPTH 3DDGA 5GRVL 1DDTA 2YA0A 3ARTA 2AGJH 2OK0L 1QSEB 5J3HD 1W0WA 3QBTB 5IMMA 4IYKA 4U4IA 1ZGLP 3TPKA 2ARJQ 1YLBB 2EICA 15C8L 1MFEL 5FLVA 1VPOL 3CZEA 3QORA 1F86A 3GXIA 3UC0H 5KVFL 1M7DB 2H8PB 2IDTA 4NPYB 4XCNA 2QBWA 4UQBA 4LKXB 3D0AA 1F4HA 3O6FD 5I1AB 2HFGH 1ZV9A 1TYEB 3OMIB 3PFUA 3D87B 3PV7A 4YC2B 3MLWL 2IQ9L 2EXTA 2JJTA 3WELA 1IT9H 3K6SA 3RWEB 2C9AA 3NCMA 4RSYA 4OLXH 5JQHC 2Z65C 1I9JH 4M1GL 3HAEA 1JERA 2VNCA 5AAMC 1MWAA 2ILLA 4OVUA 3GK8H 5D1XB 5FS5A 3CH1A 3QUZB 3FYIB 3VWJA 4ZMPA 5I66B 4Q6KA 2Y25A 5JDSA 3CVIH 1MCPH 2F7IA 3W37A 1FNSL 1KCLA 3MRKB 4PP2A 3NCCB 4JN2A 1YMMD 3BN9C 5IEKB 4F58H 1MIML 3SPVB 5F1NB 1QD0A 4BFBD 5T5FL 1Q0YH 4AGNA 2ZYHA 4GKSA 5IB3A 1MH5B 4YC2C 4GLRH 2K8QA 4UOZA 5IBLC 4N2CA 1G1YA 3ATFA 4ZFZA 3AWGA 4Z5RA 3SDDA 1QEWB 1A6VH 1N4XH 2Z91A 2P80A 3IDUA 1KBKA 1JGLL 4J4PA 4H8VA 4GI8A 5IZ7A 4WJG3 2KKQA 4OV6F 3TEXA 1RZQA 2Z0UA 5D1XC 4L3EA 2YGPA 1DDHA 3ARGA 1TTRA 4L4VB 1ACYH 2X0WA 1TJHH 3X13B 2C1PA 1UWEL 4Y9CA 5E1HB 2AABL 1CGYA 3F58H 4OW6A 5AZEH 4HLJA 4JFOA 1S3KL 2EDJA 3LHPL 3WOVA 4APXB 4BFFA 1G7LA 1QZNA 2ZT9C 1HESA 3EYFB 1RHHA 3LN9A 4NRYA 2QR0B 3L4XA 4FHBD 3M1BB 4V1DE 1F0LA 2VW6A 3N1QC 2DWSA 2FHCA 1VPOH 1NFAA 4PJHA 3VQMA 3OZ9H 2ZOLB 4CMHB 1P1VA 1DP0A 3IAQA 3MRHB 5IVXF 1Z5LB 2VZVA 2XWRA 3S96A 3WFBH 3S48A 1MDAA 2UX7A 3RP1A 4A7VA 5I1GL 3N50A 4XC3L 3UPCA 2RCSL 1JWUA 2H32H 3R18A 4ZO9A 1RURH 2WOBA 3VI4A 1XCTA 4Q8BA 3FOMB 4X50A 4HQQL 3A6CH 2VXSL 3HB3D 1JRHH 3MTXA 4XCEB 3P2TA 3NPSB 1UXWA 5ANME 5ISZD 4M1GH 4XO3A 4M62H 1S7QB 4KK6D 3P69A 2SEBB 5ERWA 4YK4B 1MUJB 2IFFL 1QA9B 3EF4A 1OO2A 3KG5A 3ILPA 2FYYB 2WQRA 1F6LL 2XXGA 3CGTA 4FFZA 2OMZB 4Z3FA 3O6FB 4WWKA 32C2A 4N28A 3OKMA 3C8HA 2VN5A 5IB4A 4B60A 4O00A 1BQRA 4MTMA 4ODWA 3W9DB 1NC2D 3FUJA 3N41F 3EJUA 2WCSA 3VD2A 3HMXH 2E7MA 2ZAHA 5GGVY 3O41B 1CFNB 3DO3A 2DM3A 4XODA 3JT2A 1IVTA 1HTYA 2NCMA 2ZUQB 2AKRA 3KGSA 3OQ3B 3ZE2F 4HJ1A 3EGDA 4FG4A 3R4RA 4QGYA 3EGXA 3NPSC 5CWSB 2AJZA 3S98A 4C59B 2V7HB 1JGLH 2ZD0A 4YK4C 1B2WL 35C8L 4LPWA 3NRFA 2NW2B 1YMMB 1LILA 4FQIH 2VXQH 4MSWB 4XWOD 4DN3L 5GGTH 1JWSA 1UWEH 3MV8D 3UP6A 4Z9KB 1YMHA 1RIVL 4P4RA 2ICES 3I02B 3UEQA 4KY1H 3CSTA 4JPKL 1UOLA 4G8FB 2GCYB 5H94B 5JMRA 4G7QB 1GGCL 5FKPB 2J6EA 4J6IA 1TMCB 2ZUQC 1K8DA 5DD3L 2DD8L 5SWZA 3RDTD 4PJCE 5D1ZI 4LAQL 3WGVB 1RAMA 1J8KA 1NLBH 4AVKA 5DZVA 3N1MC 2X6VA 5DMKB 1FVCB 4P2QD 1RSYA 5E1GA 1Q1PA 2VZUA 3G6DL 2F0CA 4NZRH 3D18A 4BZ1L 5GZOD 5E6RB 1TDQA 1NC4B 1ZLDA 1CD1B 1GZPB 4HBCL 4LHUA 5I1GH 2FR4A 3GSWA 1YDPA 4PS7A 4XC3H 3IPEA 3PNRB 1I7RB 3TH4T 4Z0XB 1PAMA 1YNTA 3TFKD 4HQQH 2VXSH 4JHUA 5HHVH 4NJ9L 1EHXA 2K4WA 4LVHC 1AFVL 3CQPA 2I25N 3PWUA 3TPUA 1N3NB 2YA1A 4NZ8A 4ODSL 1UACL 3RBSA 4E0RA 1FAIL 3DROA 3UO8B 4E42A 2CLRB 4W9CC 2GIMA 4LVEA 2V8MA 5GS0H 1XL4A 4AE0A 1VEMA 4K94L 5FDWB 5DJDA 1GMEA 1NUGA 3ZKXB 2EEAA 3FO2A 1TQBB 1IAIL 2N01B 3A4DA 4GSXA 3LH2H 3ROLA 3VXTB 5JW4M 4ELDA 5AVXB 1P2CA 1VFMA 4H8WC 1P0SE 1UVQA 2EYTB 3BD5A 1TVBB 3WKMH 5ISZB 4URTB 1C1EL 3RRQA 1KFGA 2AV1A 3IJSB 1F4WH 4Z76B 1WAEA 3NZ8B 5C09E 3FU3A 2X4UB 4PHXA 1V8HA 1U9KA 3VFUB 5D7JB 35C8H 1G9MC 5D7SH 4HG4J 1I1AB 3WHE0 2LT9A 1TO4A 4HS6B 4KRPC 3ULAB 4RVBA 4AYID 1WHPA 4F1SA 5HYFA 3S97C 5LGKA 3ZKXC 1GGYA 5GZNC 1TQBC 4FQXA 2ADYA 5TF0A 4F7MB 2ITEA 4KGJA 4L29A 5B4MD 1OGTA 1KN2L 4JPKH 4KI5D 1E9PA 2AQTA 3U0WL 1N6UA 4C83A 3PDOA 3MYZA 1JZ3A 4ZDHB 5KG9B 1BWWA 3SE4C 1EBPA 3QHTC 4U05A 1X5IA 5DD3H 1HHIB 5BZWA 4YN3A 5HP5A 1QLRB 4D94A 3WFEH 1AMXA 4P49A 5D7JC 5ALBH 3G6DH 3MV8B 3SYCA 3PAUA 2AQQA 5KZCD 5DJ2A 4POUB 4M6ML 4BSVB 2OTPA 2B77A 2F61A 2VM9A 2ZOKB 2NY0D 1I1AC 1TQTA 2LFGA 3EYOB 4HJ0D 5CEXA 1ZSDA 2AJSL 3KPOA 2NY7H 1CU4L 3CZKA 4LASH 4LSVL 4XP6H 2DH2A 2FLRT 3BZDA 4HS3B 4DUXA 4KZEH 3WJJC 1FFNB 3P3YA 4HK0A 1T2JA 3RDTB 1AFVH 2HSIA 2ZQKA 1D5ZA 4DESA 1BW8A 4JFHE 4ODSH 3C8DA 3IMWA 2D73A 3SGDI 1E4KC 4L3FA 4P2QB 4D7BA 4DKTA 4ZFFA 4HKBB 1ERNA 4K94H 2XA3A 2P8PA 2D0GA 3WD5L 3B2DC 3ECBA 4BCXA 2DYPA 1FZJB 4Q6IB 4FQHB 3S9DB 3QPXH 3G08A 4MAUH 2EDDA 3KDPB 1HHJA 3QEQB 2YPLE 3EJZC 3O0RL 4PW3A 1QPPA 1U8HA 2AQSA 2FT8A 1C1EH 2FSEA 5I6NA 5ICZB 1T6WA 4WV1B 4AW7A 2X6CA 3SPIA 3X1EA 2KC0A 3T6ZA 3SDYH 2AEIT 1NBQA 5LG6A 2EUXA 1D6EB 3HE7C 5C0JB 4E41A 1GJUA 4JKWA 1U33A 3LV3A 3FB8B 2GY5A 3EDFA 2C4FT 1EHLL 4PRPE 3QDGD 1T1WA 1T0NA 4HLZH 3FUMA 4I48A 3MODH 1BAFH 3GXDA 4KI1A 4R90L 5HDQL 2PXYD 5E8DL 3O2DA 4FLSA 3OSKA 3GJEA 1X5LA 4YXHH 3U0WH 3D39E 4X0NA 4PTUB 1UA6L 3RUGB 1FSKB 4AL8C 3BAYA 2K6YA 2PCFB 4PCYA 2NDGA 4PWHA 4WV1C 5F21B 2IBZY 2R29H 2PYEA 1BV8A 1WIUA 4MVBD 2YEVB 4JHWL 4OKVA 4KKLD 5DJCB 4HIIA 4KMQA 4MMXB 3EOYG 1QFPA 4KV5F 5FO9A 1YEFL 3T8XA 3TESA 3AMKA 1H19A 2R83A 4HPYL 4IKKA 1NSNL 1T2QL 1SEQH 5EZPA 3RWDB 4IBUA 4ZYKA 3L1FA 5EU5B 5D7LD 5FGBC 2HH0L 2EO9A 4AT6A 2O26U 3T8MA 4ADJA 1NGQL 2C26A 3GBEA 4FTDA 1GCFA 3KYMB 3BPLB 4Z7NE 1G6RB 4YBHA 3U36A 1GYWA 1FSKC 3WSQH 3BUPA 4GYBA 2OPCA 5KZCB 2H6PB 5GHWL 5FYKL 4C56A 2HG5B 1CYGA 3WD5H 2WUCL 2ATKB 4HJJL 2BM3A 4MMXC 1GJWA 2VLJD 2R1XB 2JWYA 3ASNB 1F02I 3OAUH 1S78D 4G6KL 3STZA 3SY6A 1NCTA 3O0RH 2F8IA 1C08B 1GSMA 1AO7D 1NAMA 2FATH 2CO7A 4PLOB 5B4MC 2DW5A 4NO3B 4KI5C 1L6PA 4R97C 1GYVA 1TQSA 3GZKA 5I18H 5IUCA 3OVUB 4NQDE 4TTDD 1FNGB 1U2YA 2LU3A 3BPLC 5JORB 2ADGA 3RGVA 4OZGE 4O4YL 3P2BA 4OB5L 5CBAB 2R1WB 1DBBL 1EHLH 5LGYA 4KX7A 4GO8A 1QRNA 4XAWL 5E99L 1E4WL 2XWTA 3SD2A 1R4XA 3L3HB 3WTXA 1QHOA 3TBYA 3L3GA 1HIML 4R90H 3P3SA 4HIEA 5HDQH 4JS7A 1MWAL 3NK3A 2KUTA 5E8DH 4LXFA 5C0CA 1UA6H 5D9SB 4JO4L 3VWKB 5HYSB 3MOAL 1AS7A 1DQIA 5I75B 4YAQA 2FJHB 1A6ZB 4JHWH 4N25A 1TSRA 3HTLX 5IT2H 1PKQA 4QO1A 5IJKC 3HHRB 3QDGB 1JWMB 3BQUD 3SPJA 1PY4A 1YEFH 5HHNA 1ZEAH 3QJOA 4WUUE 3GBLA 3IDIA 4OUUA 2DJ4A 4HPYH 1NSNH 1T2QH 3UZVA 2PXYB 4OLUL 5FM8A 2HH0H 3OKEA 3BXNB 1FBIH 1NGQH 3PL6A 4GRWH 1WFMA 2AP2A 3SEPA 1ZA3B 3G5VA 5F3HB 1TR7A 1B88A 1V3JA 3I6LE 5I6OA 4WHYH 3CVCA 3OLIA 1T83C 3VWKC 1XMWA 3LPFA 3PWLB 2KDYA 5I75C 4PRHE 5I8OL 3MRRB 5GHWH 4JKNA 1P1ZA 3ULVH 3EJPA 2WLJA 4C54A 5JW4N 1A7RL 1KF9B 2BVQA 2X4TA 1A0QL 4G71B 3HZKA 2WCGA 1BCIA 3W81A 4U6VH 1O6SA 5FUZL 2AANA 1A3LH 1MEXH 2ZWNA 3S2AA 4BFIB 1ZHBB 3GZOA 3CZUB 3T3PB 3IRPX 3OAZK 4UM9B 3BVDB 3LQAH 1LD9A 3VFOB 4F8OA 1R17A 4Y4HB 4OT1L 4M7KL 4MVBC 4YHNB 1XBDA 5EZLB 5AOMA 2RHEA 2JKLA 5EIIB 2F53A 4RQQB 5AG9A 2BK8A 4RDBA 3BWZA 2EO1A 3CWGA 1NL0H 1AOHA 2VLJB 2ZOOA 3NA4A 4LFHG 4O4YH 5IW6A 1MJ7L 1DBBH 3LYRA 4GKLA 2H45A 3TJEL 4Y19B 2WLKA 2TSAA 3C5JA 4EIUA 1AO7B 5DEGA 3WI9A 3ULUF 3UBXA 5FF6A 1KENL 1TZHB 3A6BH 4OCMC 2Q1EA 3BT2L 3A21A 3V5DB 2GSGA 5CM1A 5F7HA 4LARH 1A7NL 4GRMA 1HIMH 2DB8A 4JVPA 3HAEH 4W68A 4PJGE 4R5XA 1QPXA 1D5MA 5D93B 4JO4H 3MCYA 3SKJL 4WO0A 3SKNA 3MOAH 2CIKA 4FFZL 4LDOB 3KM1A 3GUTB 1TITA 2CALA 2P26A 4HMCA 4JGMA 4Y4HC 2PW2B 1PW3A 1FCGA 1NBYA 1P4IH 2IWEA 2W80C 1RIUL 3ZYZA 4DOHB 2FCBA 4EOWL 2ADJA 2I7OA 2VAAB 4M29A 4PRIE 4Y1SA 2OMVA 2BNRA 3HRPA 5E2UL 3RZCA 2CO4A 2LVEA 2EDXA 1E3FA 3LZQA 1G5AA 5D55A 3CZLA 4YHPB 1FJ1A 1BD2B 4TSBL 2ICWB 3FB6A 1U8JB 4X8GA 3BH8A 4YR6A 3MLZL 4TTDC 4U33A 4MB4A 5BPPA 4O02B 4FGMA 1KOAA 1H8OA 2DV6A 2CPCA 5EF2A 2H2PD 3BQUB 3HLAA 3D48R 3FQXB 4PJDE 3RGHA 4GEJA 3QUMA 5I8OH 2CBMA 3IDMA 5IVXE 1L3NA 4FL4B 4WI0B 5TPWL 1LO4L 2C7UA 3SGEH 5A2KH 1FL3B 1IC4L 5DJ0B 1W91A 4LNRB 4RNRB 1A21A 3H0TB 4GQRA 4XO4A 1A7RH 4QHLB 4V1DA 3F84A 3K4DA 1A0QH 1IBGL 3HOGA 1Q0XH 3RWCB 1KZYA 3V6OA 4ABWA 2W0FA 2LGNA 2X4PA 5AVZB 5FO7B 3DVGB 2J6EL 5EPMA 3SZKC 2F5BH 4F7CB 3BIKA 3GHBL 3PF2A 2ZONA 3T09A 5B38B 3JWOL 1CDUA 4ZUWA 3LSOB 1TVDA 4OT1H 5FYLD 1JNNL 1MREH 2XPGB 2X87A 5F9OL 2XX0A 2OMNA 4UQCA 3TIDA 5A2FA 5GJTL 2NTFA 5J7CC 5KYXB 3BQUC 4X8CA 1MJ7H 3TJEH 4A2EA 2LLNA 4FL4C 5EU6E 4QAMB 3ILQD 1CUOA 4BIKA 4FYSA 2EXYC 5F0JB 1A66A 1CI5A 1A7NH 1JV2B 3HG0A 1XH0A 4LSSL 2G30A 2XZQL 4IBSA 1IC1A 1KELH 3CN4A 5EIIG 4ZFQA 2CK2A 4LCCB 1WC7A 2DL2A 4YHYB 1NGPL 1U42A 2XQBL 4LCUA 4JHZA 5EB9A 3MNVA 3G04A 5ETUB 1UM5L 3N91A 2P5EE 1ZRUA 4H8HA 4GBXD 1KJ2H 3AADB 2VH5L 1NWOA 1RIUH 2Y1VA 4HGKC 3ETBF 4MCYA 5IF0A 3P9LA 5BRZA 1QR1A 5GSVA 4LEXL 2VR6A 1PX8A 3V0IA 4NLAA 5E2UH 4K4KA 5DRNB 1IAOB 1TLMA 3E6FA 4DETA 2ZUTA 3NCFB 3B2VL 4TSBH 5F7AA 5MEND 2HWZL 3FB7B 5C0EB 3MRDA 4XMTA 3APFA 4OM1H 1J1OH 2YEZA 2KLSA 3MLZH 2VDOL 2BXYA 3H54A 4JE4B 2X41A 2QGCA 4LCCC 5IB2B 2UZXA 3T0ED 2F7PA 3WIHH 4YHYC 1E0OB 1U8OA 3MSPA 3P11H 5IR1A 1A4KA 1LO4H 4TUKL 1IC4H 3VXPB 1DEEA 4GS7B 5ANHA 4FQ2H 2BHFA 3D8MA 5GIRB 1ZVHA 1IBGH 3JV6A 2OXHB 5L2JB 4PJCA 3WNIA 2WIIB 1SXCA 2H9GB 1B0GB 4L1DA 5T5NG 1OCWH 1VADA 2AJ3A 4RETB 1DUZA 3L9EA 1R3LA 3V4LA 5C0AE 1ANUA 3GHBH 3DNKA 2AXJA 5EG6C 1DQJA 3FCUB 1NTDA 1SFHA 1IC5L 5B3JF 4LSDA 1PBYA 1MG2C 2HJLB 5F7MC 4LLYB 2EVFA 3HNTH 4D0DA 4GS7C 4L1TA 2RTTA 5C0BA 2CO2A 2E0PA 4OZFH 2CCVA 5B38G 4N6QA 3TL5A 4HPOL 1HHGA 1L0PA 4R0LA 4FJ6A 4HALA 1PYWA 4P9HL 2AXFA 4LSSH 4M48L 2XZQH 2VZOA 5HJBA 5CJQH 1ZPUA 4KU1A 3RUGF 3ZTNL 5KJRL 3BAJA 2UUDH 3A5VA 2A5UA 3A67H 5ACZA 2XQBH 2VL5B 2H2PC 2GJ6D 3O0LA 4JRXA 4B41A 4XGZB 3MRFB 3EDEA 4F7TA 5IMLA 4YBQC 3L5WA 4PLKC 3Q1EA 4GKNB 1LTXA 2YA2A 1C5CL 4LEXH 5CSBA 5AZ2L 1F1GA 4UDTA 1X5MA 4XNQA 4AVJA 4K71C 1IE4A 3HKFA 3D85A 3GIVA 3AG3B 4G6JL 4F80A 2V2WB 3B2VH 4KPHL 2HWZH 1Z5HA 3MGTA 1TZIA 4X7FC 1J0ZA 4FXGB 1NDMB 2D7OA 2ERJB 3Q8EA 2QV2A 2FEJA 3CDGA 3VGHA 3SDAD 1A8JH 2BVYA 4OCXH 4ZAKC 4JUSA 1CF8L 5HSFA 4JKKA 5IQ7H 2QVKA 4TUOA 4TUKH 4WU5B 4R2GD 5CP7B 3SCMA 4N0FB 4KJWD 1OK0A 4UOQA 4JO1L 1XF3B 3V5KB 4U1HB 4DGUA 3LRGA 1PD0A 2J5LB 1E6OH 3O2DL 5MENB 1G9HA 3UDWA 3MNZB 5I71B 4I4WA 4OGYL 4ZOEA 2DWDA 5C6TL 2NNXA 3INOA 3ZJAA 2DI7A 4ZTEA 1K4DA 1VACB 4PJ9C 4QDGA 2CGZA 3BW9A 4OVVA 4QY8B 1SEBB 1T0MB 1FYTE 1U8QB 3DO4A 1RXLA 2Y1ZA 3RY6A 1U8CA 3MUGA 1Q9OB 2ERJC 3DV6B 1R3JA 3L3KB 5T3ZD 3S3JA 4F92B 2VITA 1L9MA 1M7UA 2XXMB 4D9QE 3IFLH 2NNRA 5IB1A 1PLCA 3TNMA 4NGHL 4FF9A 4CA4A 5CCKL 1BQHA 2XN9B 5D1ZD 2FDBP 2HRLA 2X1OA 2Y69B 3QUKB 1TTUA 3KNBB 2YXVA 4AQAA 1OPOA 5TDPB 1NWPA 2EEBA 2W9LA 3W56A 2J5LC 4HPOH 3K5SA 3KS0J 5I71C 4UUJB 4FQ1L 4M48H 3ZTNH 4RFOL 2JKNA 3FN0L 4AW4A 5KJRH 3KPPA 3QO0A 5F72S 5L8KB 4Q52A 4NFBA 4FTVD 2Y2WA 2YPLA 4W6WB 2Q6WB 1NDGB 2D7PA 2DICA 4R7NA 5IK3A 1YAZA 3P9WB 4NQVA 5C70A 1ZLWK 4L8DB 4XNBA 1BBJB 4WUKL 1NAML 1C5CH 1K9TA 4KDWA 5AW5B 4BH8A 4IDLA 3FQ1A 1IAII 1I1YA 4NO2B 5EEYA 4I2XE 2G3MA 4RZCB 4NCC2 4PR5A 3VRIA 4I87A 3EJJX 4X4ZA 1J5IA 2V2XB 3O3AA 3LD8C 1IC7L 3QSKB 4KPHH 4QTFA 1S8DB 2UXTA 4MFHA 3ZDXF 1G1OA 1FNEA 1L9NA 2GJ6B 3TTYA 4UT9H 2BSCA 2R56L 3JWDC 4TVPL 3AJ7A 4PMEA 2BS71 4XNZB 4NZTH 3DX9A 5CS7A 2XKSA 4IBWA 5KEZA 2NR6D 4L4TE 3X1GA 4F8NA 1L5GB 3KBFA 1HL9A 3D39A 2QADD 4QKTA 2EE3A 4TV3A 2VJ0A 3REVB 5M95B 1JZ5A 1JGEB 5SX4I 3CXHJ 2X4NB 4FYTA 2QVTA 3KGTA 4MLIA 4XMKH 1JPFB 1VGKB 2AQ1A 4A2GA 5GRXG 4W4OA 1IGTB 1D6VL 2J8OA 4G9FD 1HL8A 3A3YB 3N1PC 2C5DC 4MGXA 3SJVB 4WNQA 2H26B 3QS3A 3SDAB 1CGSL 1JGVL 3ZT6A 1IU1A 1CZ8L 3TBWB 1UH3A 1Y1DA 1RK7A 2OMUB 2O5ZL 4J27A 1KY7A 2Q3ZA 5IFAL 3CDFA 3QQDA 2IOIA 1BZ7A 2ZTBA 4NPJA 4U1GB 4OAWA 2BJML 1GRWA 4Q4EA 4DK5A 1NFDA 2ED9A 3EF7A 4G7RB 1BA9A 2H47C 4GG8B 5CCKH 2H0PA 5HDWA 3ZQWA 4ZBJA 2DS4A 3N44F 4AV5A 5HDRA 4Z7VE 1GAFH 5C2BL 3SDXE 4CSSA 3BVUA 3HHMA 4R5VA 4KFZC 5F89B 4AJVA 4TSCL 4OLYL 2ZE0A 3DUUA 4FQ1H 5DJ8A 5E2TH 4PD4J 4RFOH 3BCFA 1EJ8A 4GQ9L 3F5WB 2JK5B 1XZ0B 1MCWM 3TA3B 5BRPA 3D5OF 3IBEA 4FFWD 1J0KA 2WYHA 3SDAC 4WTWA 2CJ3A 2CDFA 3KYAA 1WZ1L 3MTRA 3OXSA 3P9MA 1F6AB 2WW8A 3OX8B 5KOVC 3WDHA 4BFJA 4IBTA 4G8IB 5K9QI 4HXAL 4J3VA 1WBYA 4U6HB 4U1GC 2AVFA 3R7RA 4NQDA 1VRSA 3UXFA 4DN4L 1PG7H 4AYMC 4P07A 3VFPB 4J3TA 5BZDB 4H88L 4BRJA 4WW1B 1IGCH 2B0SL 1ZVSB 2B16A 3B83A 2DQGH 2O1AA 2UY6A 2NX5D 2Y07L 3BZFA 7PCYA 2EIDA 3DMMA 2WVUA 3ARBA 5FO8A 1MHPL 4R4FL 3EOTH 4HUXB 3TJHC 4EDXA 1CDHA 3GC3A 2CDGA 5SWSD 3VXUE 2R56H 2VMEA 4MAYD 1NEZB 3H3PL 4N8VA 4RX4D 3B9KD 5GGRA 1Z5YD 3L1OL 3TA3C 4BBWA 2WLIA 3ZO9A 3D4ZA 2F5AL 4EMZA 2O5XH 5FGSA 4PJEF 4UZSA 2Q8AL 2B1HL 5KAQF 4ODTL 1WPCA 3BO8A 4ZPVA 2OV0A 2Z8RA 1WAAE 4RAUA 5JXAL 1VKXB 4GAJH 4WFGD 4X6EB 2VJXA 4NRXA 4NLHA 3M17A 1MI5B 2I07B 3GXFA 4JPQA 3LN5B 4HV8B 3FC8A 3MLXH 5I17B 1SYSA 3ES6B 2NXZB 2WKGA 4A37A 1CFTA 1JF5A 2YHGA 4FI8A 5AG8A 1TNNA 1OSPL 2XG5A 1AH1A 2I60H 4Z7IA 1CZ8H 2WYZA 3AU1A 3AS3A 2FNWA 1Q9WA 1N6QH 1OD9A 2O5ZH 2O5NA 1FZKB 4MJHA 4HULB 2EDOA 4IHOB 3X14B 2IAND 2FWSA 2BJMH 5JO5B 3VTAA 3W57A 4OF5A 3EBGA 3CN1A 4P2OD 3H9SD 1IM9D 1SUHA 3BKML 4QHMA 3TFBA 3BWUF 5KSAA 1HXYA 2WQSA 1LK2B 2GSMB 2XTJE 5FCUL 5ITBH 1R33A 3ZT7A 2YAEA 3LKQA 3MFFA 4PRHA 3AT0A 5EN2A 4H26A 4AYGA 3EZJB 1J0YA 1HVXA 5BO0D 5CF3A 1F56A 4TSCH 1T4KB 1IO4C 2MSPA 5AL8A 1R9FA 5I0YA 1JZJA 2NXZC 3KPLA 1QUNB 4GQ9H 2J8UF 2V4LA 3QUML 4OGQC 1FIEA 4NHUB 4KO6A 4Y7OC 4IOIB 1J8RA 1N7ML 3FT3A 4MMZA 3F85A 3TF4A 4KVCH 1WZ1H 3VJ6A 1JL8A 3PQYB 3RI5F 5LAPA 3FONB 4FS0A 2ZX7A 4HXAH 4B6ZA 2DDQH 4JQXA 4XMWA 1BFVL 4OIIL 4NJAH 4DN4H 2E6JA 1HDMA 3MRPA 3NFNA 1MY7A 5D1QB 5BJTA 4H88H 1DVYA 1IL1A 2B0SH 2G2RB 5FR3A 5IWLA 3MJ8B 3HR5B 4HHWA 2B15A 3F65A 2A1WL 1CE6B 1F2QA 1GSKA 3I9GH 1MHPH 3GRBA 1I8KB 4NKDB 2DMHA 3ZXAC 1E8WA 3K71A 2CQVA 1DQVA 4X6DB 1JPGB 3EHBC 4IM8A 2F5AH 4PJGA 1ZPLA 3HBQA 2E7BA 3CMOH 1WD9A 3L9YA 3O4OB 4FEMA 4KX9A 4NRZB 2NX5B 3TT3H 2LABA 2XFXB 3UPRB 1RZ8A 3NG5A 4XCYA 5I76B 3QFJD 5F1OB 3ZDYF 3U0TB 5D1QC 3NP3A 4M9PA 1G7HB 4IIZA 1ZGLA 3EJSA 5SWSB 1J0IA 4PRIA 4UT7L 3R19A 4F33B 2RIKA 3B9KB 1OSPH 2E9GA 1IGML 1T1XA 4IBLT 1ZDSA 4XX1G 4OIBA 4OIFA 5GRJH 1OM9A 3R06A 5K39B 3FCSB 1UXSB 1W8NA 3TONA 4N5ED 4NYLA 1A1OB 4IK6A 5C92A 2BFVH 3QJHB 1OPGH 3BKMH 5ECGA 4G70B 5FCUH 1Z3GL 3O4OC 4PJDA 2A73A 2X2IA 4JVWA 3S8FB 5F71A 1GHFL 4KROD 4N2HA 3O3BA 3NJXA 4RDQG 3RHWK 1X5JA 3PXJA 2P42B 5IVXA 1UKSA 5J1AA 4E9VA 5DQ9B 4W9ZA 3MV7D 1AGDA 1BDYA 1E67A 1GY2A 2RBLA 4DZBB 4BZ2A 3QUMH 2BSRA 1BMGA 5EIQA 1KG0B 3B9KC 2Z93B 4U4BA 1M9WA 4HIPA 3OGOE 2A2QT 4P2OB 3H9SB 1IM9B 3KYOA 2UZIL 3QNZB 2Z31D 1NMCB 5F7DB 3L95B 2O61B 3SGEI 4AMWA 4GSUA 2IH3B 5DGRA 1BFVH 3RWJA 2FX9H 4DF9A 4FA8A 3ZTDC 2I85A 2VDMB 3P2DA 5DD6A 3U1SL 4GAGH 4K7FB 4L9DA 2ZSVB 3QR1A 4LLQA 3IDXL 4GB9A 3MGOA 3VFTB 3BP5B 3VYPA 1IBDA 4Z18A 5HI3D 1KWGA 1JYWA 3ZUNC 2HN7A 5HI4D 2OULB 2VR8A 4RRPA 5EU6A 2Y6SD 4Y5XB 4WQOA 4AITA 2QELA 4UINL 1LWRA 1FUNA 3QJZA 1ZT1B 5I8KH 2HCZX 3EFFB 3G5ZA 4NZFA 1GA2A 1U2HA 2F9BT 3KW8A 5EDXA 1KY6A 3E9UA 5F1IB 4IS6A 4QOKB 5EO1B 3O3EB 4WGWB 3RHWF 1I4FB 1U8NA 4P2OC 2Q76B 3DJ9A 4QHNB 5D5MB 4J6RL 2XQYK 4QRPB 3Q2VA 5JYMA 2P5EA 3VB9A 3DURA 1EEYB 4X99B 4FXTA 1XH3B 3PJNA 2YUVA 3ABKB 5DI8A 4UT7H 4KTDH 2WO2B 4J1UB 5DD0L 3KWWB 1IKOP 3KYKL 3L2LA 4CU6A 1ET7A 1IGMH 1G7MA 1XGUB 2BSBA 4Y2DC 3VUAA 3IXAB 3KLHD 2VXTH 4CN4A 3SDCC 2BP0A 4BQCA 5DO2D 3QDJA 3NN8B 1I75A 1T0OA 1Z9MA 5FA3A 4UAHA 5MP6L 3QZMA 3JV0A 1WCBA 2YQ3A 2HTLC 1B0WA 3WDIA 1XGPA 2GJZB 3CCHA 4JFFB 1Z3GH 3HZ3A 5CZVL 1VZGA 1XR8B 3CDZB 5DUJA 4JDTH 3TT1L 5KYUB 4Z3IA 1SJHB 1GHFH 1EDQA 5I30L 3NCWA 2VLME 4RIRB 5FXCH 4Y9GA 2IIJA 4KQ3L 5ADPL 3MJ7A 1LO3H 5DHYA 3L54A 3QDAA 3RWHA 4Q9RH 5EO0A 5G5DA 3WEMA 1N59A 1UD4A 3TNNA 3JZYA 1EK3A 4HIHB 4EKJA 3V9CA 4PS4L 1W0YT 2F19H 2HFFB 5CZRA 1R24B 1N5AB 3U1SH 4KROB 3H1ZA 3IFPA 4ZW3A 5J57B 4MS8C 1NCDL 2D2CC 3CZFA 4R4NC 2AAAA 3IU3B 4ELME 1DBAL 5I1KH 4O2EA 5J13C 3D08A 1CXLA 3F00A 4LLUA 5GRUL 2WXHA 5AKVA 4OCNC 1OQOA 4UINH 2VABB 1DZBA 4XNXL 2UZYA 3MC0A 4S1QL 4ZK8A 3Q2LA 3D3VD 3W11D 1HI6B 5E8PB 1GC1L 2WXQA 3HBZA 4QRRD 4GW5B 1SOSA 5E0FA 2W0PA 4ZMTA 2ESVD 2J8HA 1FL5A 1KIRB 3QI9B 3B3IA 4KROC 3CLEL 4Q2ZA 1OAYH 3CVDA 3U46A 4ZS7L 2BSSA 2VLRA 4NBZB 4PJAB 1PTZA 2EYSB 4ALAC 1UCBH 1RJLA 1XCQB 3ZK0A 5CR8A 2WTOA 3GMRA 3SY0B 4XVTH 5KUMA 3MBXL 3TO2B 4ZQKA 4NC1C 3ZHNA 2WGXA 4ETYA 3IFNH 5CJBA 2VMDA 5ICYB 4WVRA 2Y5QA 3CFTA 3FHAA 3RNQA 4F9LC 2E9JA 5F6IB 1BVLB 5CZVH 2K8MA 2OBGA 3HI5L 3NIFE 4N9GB 1HOCA 4OCWH 5AB9A 3DETC 3LNIA 1QQDA 3QI9C 5ID1B 4QT5A 2ICEB 1EEZB 1E7VA 1XF5B 1KBWA 5ADPH 2IXQB 2WO4A 4L3AA 2VKXA 3N55A 1T0PB 4CKVX 5ABZA 1KGCE 1KB3A 2YO3A 1IQWH 1VLXA 2VE6A 5HYQB 2XKNA 1D2PA 2BINA 1YPZB 3M07A 1KTKE 4PS4H 4PJ7F 2XBTA 2AV7A 2Y06H 3CSYB 2NY5L 3KDMB 4PV8B 4MA1C 3WFZA 1AD9B 5F6IC 3H9HA 4N0YL 1MRCL 3FU8A 4JL1A 4FI6A 4AXWA 3C60A 1DBAH 5EFIB 2ICEC 2B59A 2AXGB 1YUKB 4OD2B 1K8IB 3IB4A 3KLHC 4JL2A 3TTSA 4XNXH 3FO1B 4S1QH 5MEPB 2OW6A 3FUFA 4LOFA 5IV2A 5SWQB 5C0IA 1QFWL 5IB5B 3Q2WA 1WZAA 1XTMA 1RSFA 2BLFA 1GC1H 4F57L 3WKYA 4OJDH 5TDOA 1I8UA 2GHZA 5IJDC 1A5FH 2CXGA 2QL1A 3DC0A 3MV9D 4UTAA 1EJ6A 4GSDH 3GMPB 1TCRA 3B6SB 2JB6B 3MN8A 1S9XB 1W0VA 1RIHH 3NH7H 5BXFA 5DLLA 4F8TA 25C8H 3GXMA 3FQWA 4YGAB 4ZS7H 3CVHH 4AEFA 4ETQB 5DVKA 5B1CA 5H8DA 1HILB 4P9ML 4JQVC 4HUUB 2RFXB 3QUXD 4I2XA 4ZUTA 2EXWD 3W1ZA 4F9PC 1FH5H 1ZTXL 2FE0A 1O7DE 3I74A 3SB3A 2ESVB 3GMQA 4PJBB 4PGCA 3S4SB 2MCAA 4EUPA 3WU1A 1YO4A 4JRFA 3DGDA 2Q3AA 5KS9B 1RZ7L 4OFDA 3T65A 3GGWA 2AVGA 5CMAA 3DX2A 3DX4A 3HI5H 3RU8L 4YDVA 4XZ4A 1I8AA 1ZT4A 1P5UB 4X9FA 1S7TB 2W81C 4L4TA 2CSPA 2OW7A 2XU9A 2MQCA 2H32B 1EO7A 3I6GA 1DSFH 4X42A 3RFZA 2XWJA 3ZY7A 1USQA 4A67A 1LDPL 1ZLVH 2P5WD 3TASA 4A2LA 2Q7AA 2R2BA 4G1EA 4PTTB 2DYRB 1F45A 5FHAH 4AEHL 3QG6A 1TZGH 4UIMB 2NY5H 3FU5A 1BYNA 2AC0A 3FT1A 1M2VA 4N0YH 1MRCH 2VJ8A 1T21A 5T1JA 3HR6A 3FPYA 4I9WE 1MFCH 5FFOA 4P46D 1U93A 4LGPB 1P5UC 5ILTL 1F97A 3SKUD 4BYHA 2YRBA 3OMAB 1PZ5B 3GXPA 5CGYC 5J89A 3PIQA 2G4GA 5JHDB 1P4LA 3FO9A 3PE9A 3T3MF 3FHEA 4Z7VA 1GH7A 2JH2A 4GAYB 5HGDB 1I3RA 4HMDA 1SHSA 3SDXA 1QFWH 2XN2A 1DUYB 5HHQA 2OJEA 1CFVL 3GJFH 5FECA 3VFRA 3BVNB 4F57H 3TOPA 3D7PA 3NEXA 4WO4B 5EC1A 4RWHA 3BUIA 2J20A 5JW5B 5JXEA 2EABA 4J3BA 1WYJA 1DVFA 4G82A 1EHAA 3FSVA 1XO8A 2I9LB 1Q72H 4MZIA 4LQ1A 4WHDA 4KNTA 4OLEA 1R3KA 4MHHG 4YIQA 5LUMA 4HD9A 3TX4A 4KZ0A 2F7OA 4R7VA 1AKPA 1FAKT 1ZTXH 4OLWL 5E8EA 3LQZA 5DEJA 1ZS8B 3EGSB 5E4AA 1TEFA 4M3HA 2GTWA 1KFAL 2FBJL 2MMXA 3MNWA 1YNKL 4FQPA 2VTFA 4WO4C 1O6VA 5E2VL 2MNWA 2CLZB 2FO4A 3MRLA 2CRZA 5LCVH 4HZAA 1IGYB 2XI9A 2CJTA 4U6YB 4BSWA 1J88A 1TETL 3HPJB 3F64A 3OB0H 4RMQA 3REWB 3PNWA 1B2YA 1DHKA 3QIUC 1PCXA 1Y18B 3S4SG 2YUWA 5L2KE 1UGKA 3O81A 4MJ4A 3BKJH 4YXLL 1C16B 4NNXA 5C07D 5C0GA 5HYJE 3L16A 5DJYA 4QJ4B 4J12A 1SYVB 1MCOH 3WO4B 1P84K 2VZ3A 4N2DA 4UQDA 4CVUA 5I19L 4PW9A 5FM4A 5CEYB 4U1KA 4YS4A 1OE3A 2NYYC 4GIAA 1BBDL 5AVVB 3O9WD 2F54E 1KIQA 3VXQB 1ZHKA 4EAEA 1DE4A 4ENEC 1U6AL 2P5WB 3AITA 4NUJA 4Z8FH 3TBVB 3WJMA 5TK2A 3SKOA 2N1KA 3KPRA 1ROWA 1JXKA 1C8PA 1OM3L 5G4MA 4JZOB 4GW4A 1BXXA 3WUWG 2PPFA 2MCPH 4GP4B 4MBOA 1UOVA 1ZLEA 1OB1B 1VHPA 4P46B 4XRCA 2PCPA 4YGVB 4MNGE 4BZ2L 5GS0C 1U8KA 3ATAA 2NRDA 3WO4C 3QXTA 2GVYA 4KGLA 1LDSA 3VXSA 1E2WA 2YPVA 4JFQB 4NC0B 5A2JH 3VFNB 3WEXB 4J39A 3N42B 1J10A 4PGEB 4AVIA 4X2UA 1GCYA 3KLQA 4OLWH 5BW7C 3O4LD 3OC8A 3MUJA 1BM7A 4H1LH 2FBJH 4TS6A 5CLWA 4H5SA 2CUIA 4P23D 4U7KA 3U0PA 1KSRA 4UNUA 5LB1A 4JE0A 3BP6A 2ARJB 4EI5A 3GI8H 1R19A 2Y2TA 3WNJA 5E2VH 3VFMB 5D6DC 2A4CA 1G0DA 4YDLC 3U82B 3B8SA 1ODUA 4F27A 2ITCB 2KL6A 2V7NA 3BIBX 4P46C 2YKLH 2Y36H 4WFHD 4WI5A 2GJJA 4MX7A 1WFNA 4Q6YA 4XN7A 3DSFL 2NY4B 3VE0A 3LMJL 1NGXA 2QZ5A 4KXCA 2Z4QA 5EC2A 4XBGB 2BVPA 4Y5VB 1AGCB 1XD1A 3GTVA 2YGOA 4LOVA 3H3BC 1BLNA 5KYYB 4Q9QL 3CNKA 3OC5A