4BWWA

Crystal structure of spin labelled azurin t21r1.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
127
Chain Sequence
AECSVDIQGNDQMQFNTNAIVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution Crystal Structure of Spin Labelled (T21R1) Azurin from Pseudomonas Aeruginosa: A Challenging Structural Benchmark for in Silico Spin Labelling Algorithms.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords AZURIN
total genus 34
structure length 127
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4bwwA00
2CJ3A 1L9TA 1GR7A 2YXVA 3CVDA 2AANA 4E9TA 4BWUA 2H47C 3C75A 5I6NA 1WAEA 2PLTA 4MFHA 4YSDA 1NTDA 3DIVA 2XX1A 4L0PB 1GW0A 3AG1B 2UXVA 2X87A 3QQXA 3NJNA 3MX0B 5PCYA 2QDWA 3QJUB 2CBPA 1L9RA 2IH9A 5D4HA 3GDCA 3T6XA 3X1FA 3CG8A 1AZRA 4BWTA 2P80D 4G71B 2AFNA 3ABLB 1OCOB 1E30A 4KO7A 3ASNB 1W6LA 3FYIB 5B1KA 2EIMB 3FU7A 3X1NA 2FQGA 2PCYA 3KW8A 2Y1AA 4WKXA 1YLBB 2DWTA 1J9SA 3MBWB 4YSUA 1ETJA 2HXAA 2J57A 4HHGA 2HX8A 3ZIYA 2PPDA 4NB7A 1KCBA 2A3TA 3HEIB 2XVBA 1SF3A 1SDDB 3U25A 1FWXA 2WO2B 3QPKA 3S3DB 3WNJA 1URIA 3OM3B 2B08A 3AG2B 1W8EA 2XWZA 1PLBA 1ZDQA 3WIAA 1GS8A 2XX0A 2YAHA 2QT6A 4HIPA 1RZPA 3NJKA 2BP8A 1KDIA 2I7OA 2FNWA 1AZCA 1CYWA 2OV0A 2AZUA 4PCYA 4DPBX 3T6VA 1QHQA 5E9NA 1A65A 2FT6A 3FPYA 4A2GA 1X9RA 1E5YA 2HRHA 3UAAA 2OCCB 1SFDA 2XV0A 2VSMB 1JVLA 1TEGA 1PZCA 2BP8B 2IAAC 4GXFA 1L9OA 5D4IA 4BDVB 3PLYA 2IH8A 1JXDA 2NRDA 2UXFA 2J56A 1XB3A 1SFHA 4DPCX 1ET5A 4G7SB 3JTBA 1J5CA 1HAWA 3QJQB 1CURA 3SBPA 4JHVA 3X2QB 3ZX1A 3AY2A 1OE3A 4YSTA 4YVNA 4X4KA 1AANA 3OMIB 4YL4A 1AIZA 1KYAA 1ADWA 4WTQA 2BWIA 3FYEB 1AS7A 1T5KA 1HFUA 2YQBA 4DP1X 1QNIA 3PAUA 1M56B 4GP5B 3UADA 1DZ0A 2QDVA 3PXLA 1OCCB 2MRYA 2R7EA 3TU6A 2VMJA 1J9RA 1GS7A 1SNRA 3T9WA 2RACA 4DP5X 2VW7A 1RCYA 2BP0B 3S3BB 3ABKB 1ASPA 3BVDB 4QKTA 2DV6A 2UXTA 4YSSA 2HX9A 9PCYA 3H56A 3NJJA 1TEFA 1OE2A 3KW7A 4DPAX 2PPEA 2JFCA 3SQRA 3D12B 4G7RB 2XV2A 4KNTA 1JZEA 4NERA 1PZBA 2WSDA 4M4RB 2ZWNA 3PCYA 4QLWA 1ZIAA 2PPCA 1PLCA 3PPSA 1B3IA 5B1JC 3IBOA 3FU7B 4G72B 3SBRA 4A2HA 4HZ1A 2DYSB 1MZZA 2P80A 2VW6A 3H4HA 4UF7C 3WNIA 4E9XA 5I5IA 2DWSA 4PAZA 4GP8B 1IBYA 2AVFA 4YSQA 4W9ZA 3GXUB 4DP9X 3OMNB 4E9SA 1BXUA 2IDFA 3PAVA 4AKPA 1SDDA 1AAJA 2PP7A 1KCWA 3JT2A 2TSBA 4F2FA 1CUOA 1L9SA 1OCZB 3WG7B 4DP4X 1FFTB 3NJLA 1OF0A 4E9WA 4JHUA 1ZV2A 1BYPA 1IC0A 1SHWA 1PLAA 1AZUA 2BHFA 4HALA 1ILUA 4A68A 1JZJA 6PAZA 1GSKA 5B3SB 1ILSA 3FSWA 1BQKA 3NP4A 3AG4B 1V55B 2FQFA 3QJSB 3H4FA 5AFAA 4Q89A 2E86A 3FSVA 3UABA 2XU9A 2FJSA 5I6PA 1VLXA 1AZNA 5TK4A 1EHKB 2W8CA 1N70A 1BQRA 1M57B 2Q5BA 5D4JA 4G70B 2XV3A 1AG6A 3EHBB 1MDAA 2PPFA 5I6MA 3V9CA 3IEAA 4AX3A 3PAZA 2GB2A 3HB3B 5I6LA 1NPJA 1DYZA 1NIEA 2VN3A 2BW4A 2VSKB 3NJFA 4N4YB 1A4CA 5PAZA 4W1TA 2VM4A 3EH3B 4HHWA 1HAUA 5LDUA 2YAFA 1TKWA 4DP7X 4G7QB 3AZUA 4E9VA 1AR1B 3NJHA 1JOIA 1JXFA 4KOCA 1AACA 2HLEB 2MTAA 4YSPA 5I6KA 1ET7A 1BQ5A 2JKWA 3ERXA 5IY5B 1GYCA 4YSAA 4FAAB 1E5ZA 4P5SA 3AG3B 1KBVA 1PZAA 5B1BB 3X1BA 1J9QA 1E67A 2H3XC 1A4AA 1SHXA 3BQVA 2TSAA 2FQDA 2YAPA 1N68A 2PP9A 4P5RA 4JKNA 5FC9A 2LLNA 4A2EA 4DP0X 2BWDA 3CVCA 1A8ZA 2EIJB 3X1GA 2B3IA 1SF5A 3NT0A 3CDZA 2GC4C 3FQYA 4KO5A 7PAZA 3SBQA 3FQ1A 3WI9A 2BW5A 2IWKA 1MZYA 2DY2A 4BK5C 1MG3C 1PCSA 3N2JA 5B1AB 2FT8A 2UX7A 3ABMB 1E65A 1WS8A 1X9UA 4KO6A 2HZHA 1AZBA 2IWEA 3UACA 4GY4A 4YVUA 2PP8A 1J9TA 1FA4A 1JZIA 1PNCA 4ZK8A 4BWWA 2X88A 2GC7C 1ASQA 1NIAA 2IDTA 1WA0X 2FTAA 1ET8A 1JVOA 2FQEA 2GBAA 1AOZA 1L9PA 3TASA 5I5JA 4HCFA 1IKOP 2XUWA 1NWOA 4KOBA 5EHFA 1IUZA 2XXFA 5B7EA 1UATA 1SJMA 3OQRA 3NP3A 1NWPA 3ABGA 1PAZA 2GSMB 3T6WA 5AZUA 2EIKB 2CUAA 3FQ2A 2VM3A 4DP6X 3IN0A 4A2FA 1MG2C 1KDJA 3ASOB 3L45A 4KNSA 5B7FA 1AQ8A 2FT7A 4AI7A 3S3CB 6PCYA 1AG0A 1NDTA 5B1JA 4K9JA 4BXVA 1ID2A 4E9RA 3IE9A 1BYOA 2GHZA 3FU8A 1JZHA 1KBWA 5A7EA 4YSRA 2XLLA 3NJIA 4FA7B 3NYKA 1JERA 3FS9A 3ZBMA 4AKOA 3AW5A 3NSCA 4F7KA 1OOWA 5F7AA 2H5UA 2VW4A 1AS8A 1NIFA 1ZIBA 4BXSV 3IN2A 2YARA 4KO9A 1JZGA 3T71A 4UAHA 1A3ZA 5I6OA 2XXGA 1BAWA 1CC3A 1EZLA 3ZDWA 3EH5B 5ANHA 1R1CA 3FSZA 2EILB 2IDSA 1TU2A 4A2DA 1ZDSA 8PAZA 4BDVA 1OCRB 2HX7A 2ZOOA 1GY2A 1OE1A 3G5WA 1NZRA 1ASOA 4KNUA 3FPXA 3X1EA 3RYMA 1BXVA 4E9YA 2CALA 1NIDA 2UX6A 4E9QA 2BZCA 1IBZA 4DP8X 1WA2X 3CZUB 3NSFA 3FU9A 3NJMA 3OD3A 4Q8BA 1KV7A 4AZUA 3QJVB 2Q9OA 4YSCA 1NPNA 2FWLB 2IDQA 1F56A 2YXWA 3DTUB 5I28A 3DKHA 3TBCA 1V10A 1V54B 1ZPUA 1M9WA 4YSOA 1BEXA 3S8FB 4M3HA 1RZQA 2YAMA 3TBBA 1J5DA 2CAKA 1JZFA 1JXGA 1WA1X 2BO0A 1GS6X 3EH4B 4RH4A 4CSPA 1GY1A 2YAEA 3FT0A 5F7BA 1NICA 1L9QA 1BXAA 2BZ7A 2I7SA 1I53A 3UGEA 3WKPA 4ENZA 3QJRB 3TA4D 2IWFA 3OMAB 4F2EA 7PCYA 3UAEA 2GI0A 3EF4A 2N0MA 4CSZA 4UANA 2AZAA 1XB8A 3GYRA 3WKQA 1NIBA 5I26A 5B7MA 2J5WA 2UXGA 3QJTB 2DYRB 1PMYA 1XB6A 3NSYA 2ZONA 2IDUA 4HAKA 4A67A 2BP0A 3CDZB 2YAQA 3S8GB 2PCFA 5I5MA 1W6WA 4AKQA 4HCIA 1PF3A 4HCGA 5AKRA 1AS6A 1OV8A 2GIMA 1CYXA 4N8UA 2W88A 3T6ZA 2CCWA 2QPEB 1QLEB 2J55A 1KGYE 1PNDA 4GP4B 4EF3A 2YAOA 5TK2A 2JXMA 4A66A 4NAJA 2OJ1A 3FSAA 2I85A 1PY0A 4DP2X 2Y69B 3N55A 2QPDB 4YSEA 2EINB 1WS7A 1NINA 3CVBA 2R7EB 2WO3B 2HRGA 3NJGA 1A4BA 1RKRA 4GYBA 3NSDA 2ZXWB 2PPAA 4TXVB 3V9EA 1XMEB 2XYBA
chains in the Genus database with same CATH superfamily
1E4XH 1L9TA 1YO4A 2ZOLA 4WKZB 3SDAB 2ZWLT 4FG6C 2H0PA 1BAFL 3NAAH 3GSUB 2V5MA 2B2XH 1G9EA 4DVRL 4Y5YC 5D1QD 1TXKA 1S7VA 3G5XB 1E3ZA 2WIMA 5DUML 2EKSB 1SDYA 35C8L 5D8JL 3L7FA 5D72H 1HHJA 12E8L 4N85A 1JTOA 4BWTA 3T8XB 2DLGA 5IZ7A 1H6UA 3ASNB 5L4FA 3T0ED 5HJGA 1NAML 2BIPA 3FO9B 2CO4A 5AB1A 4R83A 1S2EA 3ULVC 3ARBB 4PQXA 4HS6B 3ZE2E 4H8WL 5JXEA 4QTFA 3V5KA 3NDYE 1A7NL 1KUMA 2IANB 3DOSB 1K4DA 3C60A 1Q9OA 2Q86B 4L5FE 3ZIYA 2VUKA 3FO1A 3MYJA 4PJIB 2W80C 3ESUF 1AE6H 4L3CB 1U8JB 1FLRH 4QRSA 5FK9B 1JGEB 2ZCKH 1ACYL 2A99A 4ZTEA 3S3DB 5C7XL 5I17A 5I30L 1MCBA 5BVPL 1IC5H 1ND0A 1R34A 3SKOA 2DL9A 3QEQA 3HRZC 4FQCL 4OLUH 4XNZC 3BPOC 2V7HA 1DDTA 5E94B 5F9OH 1HYSD 3HUJF 4S1SL 2MPAL 2NUPA 4V2BA 4Y1AA 3FQTA 4WWID 5I74C 4QRBA 3VACA 3PF2A 3KLHD 1BX2A 3QJFB 3K2KA 3S37L 3ARXA 4AXWA 1M2VA 3QNZB 4HH8A 3NPZB 2AZUA 4RIRA 2DMCA 2GFBA 2XCMC 5I6XB 3GBML 2X10A 2NY4B 4APQA 2IH3B 4AYEC 5J57B 3T1WA 1H5BC 1L0QA 1EFXD 3WNNA 1EBPA 2VDPL 4JVWA 4P4KC 1E8XA 5AB2A 1YNLH 5JW4M 4F8QA 2ZP8A 4EKJA 4FRWA 2HTKD 4MMZC 3F65A 1HQRB 1XGRA 3KNBA 4G7SB 1A6AA 3JTBA 5BS0D 4J3WA 2QQNL 5EOCL 3HNTH 3ZHDA 5EPMB 1D3CA 3MRMB 2ITDA 3ZE0E 3VI4B 2OULB 2JKSA 3QUZC 5GJTL 4G1EA 2ZG3A 5E4AA 2VXTL 5EIQA 3W1ZA 1F8TL 1JHLH 4NHCH 1HWGB 1SXCA 2PN5A 5BW7C 5T3ZL 3HG2A 4F2MB 4P46C 3IGAA 1M56B 2PXYD 4ZXBB 1DZ0A 4Q9RL 1M42A 3O3BB 5C0FB 2YGPA 1H9DA 1GPOL 1CFNA 1G6RH 1YEDA 2LFGA 2JIXB 3JXAA 2ICES 3OGOE 4Y19B 1VEMA 2VMJA 4XPTL 5LB1A 3RVUD 1H3VA 4CADB 1R3HB 5BUAA 3IDMB 1ES0B 3JTSA 3FT3B 4W9LC 2OMYA 2F53E 3BFOA 5G4NA 3HS0C 1ASPA 2WLIA 3MFFA 2X1QA 4O2CB 1W0YT 1S5HA 5JHBA 2D7OA 2IGFL 3ZHFA 3SDAA 2UZYA 5J4MA 4NQDB 1OTUC 2Z31A 2KS0A 5AD0A 3L1EA 2FHFA 1M1SA 2Z8VC 1YPZF 3VXMB 4LO9A 1ADQL 1MEXL 4Q52A 4DEPB 1DVUA 1ZV9A 2EYSA 1KIRB 4K7PX 3VVWA 2ZP9A 3QIWA 2H3KA 1G4RA 4FI8A 5D7JC 5GJSL 2PWGA 3P9MA 4W6XB 2IPUK 3SODB 2YQ3A 1A7OL 1R3JB 2ZICA 3QNYA 1AHWB 5L0QB 4TQHA 1JG9A 1QFWL 4NQQA 5C2BH 1HWWA 4JM2B 2E9JA 3KDMA 1XH3A 5EU6E 2BSRB 4JFUA 4A2HA 1LQSR 3OHXB 4KKLC 5EBMA 4WJG3 4FG4A 4IGBA 9CGTA 2DWSA 5DS1A 5J9PB 5LQBL 3DGGB 4S1RH 3UYRL 4AEHH 2AVFA 2COVD 3FRPA 3DX0A 4DP9X 4JPWL 3ULVD 3SPVB 2A6IB 3IDIB 3FKUS 1CIDA 3EG9A 5A43C 2J8UB 3S4SB 2UY7B 4B3EA 5CLYA 4O02A 5GGQH 5DJCB 5L88L 2MMXA 5DO2D 1E4JA 4NFDA 1WQVT 3GB7A 1DL7L 3VDBA 2DQEH 2ZUSA 4HMEA 2HRLA 2YD6A 4R4BB 3K7UA 1XZ0B 5CGBA 5ENWA 2I9LB 5DD3H 5C0JA 2EIDA 2A77H 2I27N 1MJJA 4HUWB 4OQTH 2ISDA 3NP4A 2WBKA 4U0RB 1XF4A 1V7NL 5CEYA 5IUCA 4Q9QH 3R18A 5IB4A 2KPWA 4I0CC 2R1WB 3RQ3A 2VR9A 3MUUA 4H13C 1EERB 4KJWD 1W72B 1WFOA 3D0LB 4I2XA 1GYVA 3SGJC 5GZND 1TZ8A 2Y1ZA 3ECWA 5EO1B 4GUQA 2WXGA 3BKML 4Z0XA 4P4RB 4NENA 1D9KD 3ATDA 4UNIA 3ZY7A 1MDAA 5HHQB 4K3DH 3QULB 1TJHH 4NBXB 1UUNA 4L1HA 4N2CA 1N7ML 2VM4A 4FX5A 4Y5VA 1G87A 3UYPA 1FC2D 3HB3D 4ZMWA 5LDUA 3TEUA 3IS1X 1KLFA 5AW6B 3O3DA 4LF3B 4KQ4L 3KYKH 2NZ9C 1B2YA 1TYRA 1UWEH 4G11A 4NIYE 4YHPB 4JHZA 4NM4L 2ZPKH 5IMKB 2IXQB 2OM5A 4HBCH 2XWTB 3AACA 5I73C 2CKBL 3MFGB 2DQTL 1AR1D 2BIOA 2VC2H 4KHTL 4P5SA 3AG3B 1A6UH 4LCYA 1PQZA 4H8QA 1T2XA 3DK0A 4I0KA 3B7TA 1L9NA 3DBXA 3WLWD 4M1CC 1WV7T 4BQ8A 5BRZB 5CAYB 2YWZA 3CUPA 5ADOH 2X28A 2WWMC 1WBXB 1KV3A 3DHMA 2WLJA 4Z78A 1OD7A 4YO0A 4YHZH 2DJUA 2VDKH 5T1JA 3G3LA 3QDMA 3QFJB 1IM9D 4A2EA 5KOMC 3UTSB 3RX8A 3VXSA 1SN2A 2J71A 3OKEA 4LDCA 3OLGA 2K3HA 3NIFB 2X38A 2EDTA 2HRPL 2VITB 3OZLA 1ZEAL 1T1XB 2E74C 2DL2A 3VWKA 5HYJD 2C9VA 3RBGA 1CICC 5AZ2L 3UIYA 4AL8H 3DJZA 4NPJA 4X5PA 4IQHA 4XMPH 4LPXA 1IAOA 2YD1A 4YX2L 3REWB 3PY9A 5EUOA 1J9TA 2ZKMX 4A7GF 4XODA 1NPUA 3QEUB 5F9JB 4TLTA 3B8YA 4RAVB 1TTAA 4KRMB 1CR9H 4KI5C 4EI5B 3OQ3B 1MVUB 3FT4B 4J27A 2HLFC 5KVGE 3ZDZF 2VDLB 4NUPA 5KTEL 4Q14A 3DTXB 4OM1H 3W0WE 1RZJH 3T3PE 3OQRA 4N8VB 4XOAA 2XA8L 3HKZA 5BVJB 1MCDA 3BVTA 1VZHA 3KR3H 4NP4L 2EH8H 2GSMB 4OD2B 3T6WA 1JHTA 3HE6A 5FM5M 4K0OA 2P44B 3K5RA 4RDBA 2Z9TA 2VXQL 3N6YA 5AW1B 3UG5A 1HH9B 4LQFL 3L45A 1OGSA 4AQAA 2CGRL 5SX4H 3TPUB 1GJWA 3AREA 1MH5A 3OZKA 4JY6B 4X6DF 5SX5H 1WAAE 4FXKC 1H8LA 3T0EB 2WQWA 3ZQ9A 5AOIA 4NC1C 5A7EA 5CEYB 2YRPA 3RG1C 3HNVH 3NJIA 3BVVA 5F89A 3LS4H 4TUKH 4DVBA 3GKWH 3U2SA 1X6NA 5DA0B 4F7KA 4EUPH 3TV3L 1MI5E 4NRZB 4ZNEE 2H5UA 1TTGA 3GSRB 4PEEA 1ZIBA 1ODAA 2R56H 3S5LA 5JQHC 5JTWA 2DQFB 2MPVA 1JPFA 2ZKHH 1TG8A 4P4RA 3IN2A 3OX8B 1A5FH 4PVNA 5CR1A 1PJWA 4WJ5B 1WWBX 3P2BA 5I6OA 4FI7A 1BVLB 2HFGL 2HVJA 2OW6A 4HOXA 4X9IA 1R1CA 3WS3B 4ZOCA 3ZYJA 4XPAH 4BDVA 2HX7A 3Q8AA 1QZ1A 3OLEA 3RY6A 4YHYB 3O6LL 1N26A 5KVGH 2CRYA 1FFPA 2BP3A 2WXMA 1BXVA 1SYSA 3JVGC 4DP8X 3MLXH 3H42H 3WN5C 1TQUA 4QOKA 1KIQA 5IMOB 1VEPA 4UZSA 1PZ3A 3ZTDC 4PJBF 2IO5A 4JG1L 4JW3A 2NZ9D 1T5WB 1JL8A 1NMAL 1IGYA 3IDGB 4AGQA 3GD1C 2PKDA 4YE4L 4ERSH 4MCZA 4P5TB 4MJ6B 1D5XA 3MNDA 1O9VA 2ZXCA 3P77B 4NKOB 2Y24A 3QDGB 3KLAB 4P4KB 4Z18A 1F56A 1MAKA 3MLSH 3O2DH 1LLAA 3DTUB 3NGBC 2QFRA 1I1FA 3ZE2B 4JE4B 3EJZD 4Z5RA 5GZOD 1NFDE 1S9KC 1FYTE 3KH3A 3PV6A 4TTDC 5FDWA 3P0YH 3I50L 5C0CB 4HJJL 3SY0A 1IFGA 4EXKA 4RGMC 5DJZA 1ZLWH 1FH5L 2O93L 4JGNA 1U58B 4HWNA 3GI9H 1YSOA 3B9KA 5DQ9A 1CICD 2ADFL 1TQVA 1N8OE 3QUXA 5F7DA 5KYWB 1KCVH 1BQHA 4AQ8C 1FNLA 1FVDB 4G43B 4XMKL 2PTVA 3DO3A 2LFEA 1HU8A 1NUFA 2CDFB 1CBVH 5FUOL 1YYCA 2DDQH 4PR5B 1DN2A 5JW5A 4KI5D 3NIGF 1HXYB 2Z92B 2P45B 4ONHB 4Q4EA 5EULV 4XN9A 5HHPA 4HWBL 2LTQC 4V1DD 4MYWB 4RFNB 4NUJB 2NR6C 2B15A 4PB0H 3FQXA 5TTRA 1X5JA 4PJ5B 1CYGA 3B43A 1C5CH 4OFQA 1WLHA 4RCAA 5KYYA 3VRIA 4H26A 3QCTL 1PAMA 3D2UD 4ODWA 4QKXB 4EN3A 3CZGA 5DEGA 1ONQB 3FT2B 1BAGA 4N2AA 1G7JB 4ZNCD 1DJHA 4EO5A 1B4TA 1H3XA 4BFNA 4EXPX 3O11B 2E3VA 3GTNA 2V9RA 4BYHA 1SOQA 1RUPH 3BWAA 3TJPA 1CE6A 2VDRL 2X6UA 2P8MA 2OXGB 3FN9A 3G5XA 3N1PC 4JO1L 1XCQA 4MX7A 1A1NB 3FB5B 4O00A 4ANKA 4I3RL 3WFBL 1GYWA 2P5WD 4U3CA 2JMRA 3BKYL 3V6OE 1S46A 4TUUA 1T80A 1NBYB 2G9HA 3BEVA 3VXNB 5HJBA 3F6IA 2WGXA 3SBWA 3W39A 3DTDA 3VA6A 3GS0A 4DKAA 2FYYA 1WAEA 2ODHA 3MJ8A 1R0AL 2MTPA 5HI5C 1T7WA 3AG1B 4HLZH 3T77A 2CRMA 3K8KA 3QQXA 4A7QA 2OSXA 5HDQL 2D4FA 3ZKQD 5F7FA 3CG8A 5HGHA 2XPYA 2B0SH 5BV7B 2L04A 3ABLB 4J3SA 1CLZL 1W6LA 4KXDA 3ZR5A 3HPJB 1IAIH 4OI8A 4G8GA 2ZX5A 3K6SB 3VD4A 3CFCH 4MD0B 1RUQL 4WFFD 4X5WB 5F96H 1H3PH 2Q10A 1DLHA 4WKXA 4XC1L 1JDDA 3EJPA 3U7YH 1U95B 4H4NA 12E8H 4CC1A 4KTYA 4GKLA 4PRBB 4N26A 1Q9WA 4LLVB 1U8PA 3L8QA 3EXJA 3VSQA 1NCBH 2L7EA 3MGTB 3L1GA 4UTAL 2A3TA 2GIXA 1TFPA 4W6WB 3SD5A 3X12B 4UDTA 3QJHA 3NFSH 4AXWB 4P2QB 3F7RA 3O3UN 4QHLA 3S48A 3GZQA 3L5XH 2JCCB 5B21A 4HVBA 4I0PD 4YZFF 1FJ1B 1FQ9C 2NXZB 1QAWA 3N1QC 3WIAA 4PJXF 4DQAA 3C2SA 4Y16C 5J89A 4PP2B 1VB9A 4ANXA 2Y5TB 5EH1A 5DMIL 2FB4H 4MXQD 1NM4A 1G94A 2H3NA 1RU9H 3QT2A 3P11H 5EU4B 3GTTA 3KWTA 3JWOL 4K3HA 2AQ1A 3VH8B 3QO0B 2FT6A 3QUXC 1FSKC 4I1PA 2DOCA 4S1SH 5AKSA 2AXGB 3FNKA 3L3GB 2MSPA 1WCBA 1D9KA 4NQSA 2BIIA 5E0FA 2JQAA 3G04B 4Z7NF 4G6MH 4K4KA 3A22A 1QOKA 2IH8A 3V8CA 1U93B 1ZLSL 2X41A 1FLTX 1RIUL 4PJGA 4HA1A 1ZT7A 4JN1L 1NCCL 1XB3A 4ZXBA 4F91B 3OAUH 4Y9EA 3IPBA 1JI2A 2AK1H 3V0VB 2EO7A 3EDEA 3MVSA 4RRPM 4PJ5A 3ZX1A 4W4NA 5IEHB 3TFKD 1VACA 2ZWZA 4U1LB 4A37A 1UB6B 2BWIA 5DVNA 3VM7A 4DN4H 2GK0A 4UDUB 1AS7A 1HFUA 4WFFE 4XXWA 5D4QA 1AIFA 2BOBA 1SJVA 2QHRL 3HC0B 1RY7B 2W9LA 4AMWA 1RMFL 3E8UL 4UNVA 3AT0A 3WXWL 4QXVA 2QQNH 2EYRB 4LLQB 4XPBH 3UAJD 2NNXA 3LN4A 3VX0A 3CFUA 4OB5L 2X4TB 2J21A 3QGVA 4UQAA 1YUHB 3F00A 4OCRH 2X05A 4ZUWB 5LKNA 1F8TH 4NHCL 4XO5A 2X1PA 5LAXB 3RFZC 1YVLA 4N8VG 4NNPL 2ZXGA 3KCPA 4RAUA 4ETQA 3ZL2A 3REVB 1VGKA 2R0ZH 1JWMA 5IB5A 3PP3H 4N25A 3GXDA 5DJ0B 3EJQA 2B77A 4K7FA 2PPEA 1UWGH 2FYYB 2JFCA 3BWSA 4Z3JA 5L4MA 3G5ZA 3CSGA 4J6IA 4UQIM 1XF2B 3V4UL 5EIIB 2I60L 1M7DA 4MHHI 1IGIH 5CEZE 4MQSB 5D7LA 1JIBA 3N43B 5C0GA 4X0KB 5HGHB 4L05A 5C9KA 5EZJA 4WW1A 5FCUH 2WMPB 1KJVA 3VXOB 5JUEH 3CFKB 5AYQA 1A7RL 3R7RA 4PIBA 3OR7B 4YDKL 4O5LH 1DZBA 4I77H 4X6DA 4PGZA 2WUCH 4OLXL 3TZVC 1Q9WB 4W9ZA 3VCLB 5LDSA 2ENSA 3GXUB 4C83A 3I2CL 3SO3C 4F27A 1H3WM 3T65A 5K33A 5A40E 2AW2A 4NBZB 4UDTB 2BH0A 3B7SA 1KCWA 1QUPA 2OMVB 3AM8A 3HE6D 3KPQA 1EHXA 5T1DL 4Y16B 3DMMD 1KIUA 1KTKE 4RVBA 5C71A 1C5DB 4ABWA 5BVPH 3MLVL 3BAWA 4BK5A 1L9SA 2VDOB 4JG9A 2WB7A 3VDAA 1ZWIB 3ARED 4GLRH 4E9WA 5LUMA 3BQUD 1KGWA 1OT4A 3OGCA 4XBMA 1OANA 2QPSA 1J0HA 3BYTA 4U1MB 3RVWD 4UQBA 1XF3B 2DWDB 1AZUA 1ZA6B 4GB9A 2OYLA 3WEMA 5JDSB 5H37H 2FLRT 3GJFH 1GSKA 5ALCH 1XF5B 5AZEL 5KBNC 1B9KA 3AG4B 4FMFA 3FQ4A 5D2LB 3SKMB 2AJYL 2QGBA 1A1OB 3B34A 4HIJB 3FO1B 3MYJB 2VWEE 4FQXA 1CLYL 3MRPB 4NHUB 5MEOA 5IWLC 3UC2A 4W70A 3TYFB 4JQVA 2OMXB 3QIUD 4KKNA 4PJBA 3CQPA 4WFED 2XWRA 2P8PB 5FGCB 1LVEA 1FIGH 4GG6E 2VLJA 3IEAA 5GS1B 3VI3F 3FRUA 5IOPB 2ESVA 1KJ3L 2GUOB 4YLBA 3S3PA 1ZE3C 3LSOB 2CHDA 4NO0A 5CIPH 2MCMA 3WTUA 5E2WH 1FFNB 4Y4HD 3OVUB 4A7VA 3EXLA 4LASH 2DD8L 2R9HD 4PJEE 4PRPE 3LOWA 4X4ME 2NNAB 3VJ6A 4LLQA 1GSMA 4K3DL 2DQ6A 3SE8H 4E41A 4B9YA 5FO7A 3BN3B 4L8CB 2J6WA 3O3AA 4HKZA 1G6RL 4QNPF 5F1KC 5FA4B 5AVYB 5DSCA 4F7EB 2QGDA 2ZZUT 1PZ2A 5J11C 2IEPA 1YNTB 2G3MA 4LDLB 1I7UA 1UA6L 4F1ZA 2FBJL 1SHXA 3ZZ1A 3BQVA 5F70A 3ZE1E 1QKZL 3VXRA 1CE1L 2A9CA 4G9FB 4NM8L 1TITA 2AABH 4MJ5B 3IJSB 4JRLA 4K9EC 3VG0H 2BY3A 1DBKL 4DQOH 3BHBA 1QD0A 3G6JE 5C07B 1WWCA 2VKXA 2AQTA 4GUCA 4U6TA 1ZE3H 1U3YA 5I5RA 4RFNC 1AD9B 4S10A 1MG3C 5B1AB 3RAJH 2GI7A 2O26U 3WE1A 1DCLA 3O0LA 4AQ1B 1X9UA 3O4OB 3II2A 3ZYZA 2MJWA 4GY4A 3STLA 3U4AA 1KFGA 4NQEA 4BFJA 4D94A 1DQIA 1IJ9A 4AQEA 4YXKL 3ZTNL 4NDMB 1E7VA 3BXNA 3OKMA 4GKZA 1WCQA 4C4KT 4A2LA 5TF1L 2ICWB 2D7PA 4JPVH 4R90L 4NQDA 4XMUA 3D30A 3VGEA 4XOBA 2PR4L 2J43A 3IMWA 2XVLA 3M45A 1OTSC 3PAYA 3QWNA 3WIHA 2WXPA 1ZS2A 5HDBE 4ELMF 4L5FL 5I1KL 2RQ8A 1A3RL 5I75B 4HISA 2QVTA 1AXTL 4FEIA 5KSUB 1OY3B 1KPUA 3HJEA 2CR3A 3A6OA 1IU1A 3D39E 3FQWA 4XVJL 2CO6A 3S3CB 4GSQA 4ZOEA 3LN9A 3FCTB 4K9JA 3KAAA 3BVNA 2DQFA 2B14A 1I8MA 1ID2A 4X9YA 1EJOL 3UMNA 4MCYA 2GTQA 1KBWA 1D5BA 2APSA 4P5TC 3MROA 4Y2DC 3RGVD 1I1YB 3PDDA 1WUNT 3VSTA 5IROA 3BRFA 4DSYA 3MMEA 3NFPA 3BKCH 4OCLC 4LEBA 4P04A 4UI2A 3FUFA 4PD4K 4F1SA 3DXAE 5GZOC 3ZIMA 3ATEA 4UQ2A 4Z1PA 3UL4A 1FFPB 3ZVVA 1FL5A 4KRNA 5I76B 5IESL 4IOFD 1IQWL 4JPSA 3CAFA 3MYZA 2DH3A 1KY6A 1BFOB 2QVMA 1EZUA 4J1UB 1PW3A 2GBVA 32C2B 4TUKL 1XGYH 4MA3A 1XHHA 4UMGA 4XVTH 5F6HI 3TV3H 1ZLEA 3JV4B 3PWPE 4KK5D 3DRTB 2EILB 4BFFA 2ITEA 3VQ2C 4MNGA 3PHAA 3CU1A 3KJ4B 1R3IH 2XN2A 3QXDA 3L9RA 4E9YA 3W11C 2JTDA 2UX6A 4YGAB 3WMPA 3MLYH 3GEWB 2ZOTA 4AQOA 1OB1A 4L8DA 1K9TA 4L37A 2A38A 3QR0A 4FFTA 3CFEB 5L7XH 3HHMA 2PMZA 2DJMA 4Y2OB 1NGYB 3EOYG 3O6LH 3MRGA 3MRLB 3EO0A 4F5CE 4JL1A 3JWNH 1YEJH 3W3BA 2C5DC 3FXIC 5HHQA 1N12A 1G1KA 2J2ZB 2JB5H 1JK9A 3IJSA 2FL5A 4OR1A 3SY0B 4YSCA 3HE7B 2GJ6B 5H2BB 4I0PA 4RGNB 5DD0H 1MCEA 2QELA 1SVZA 1AD9A 1OGAB 5DD5L 3S8FB 4M3HA 5F7DB 1ZEAH 4UUJA 1YEIH 3O9WB 2C9UA 2OMZA 2IXQA 5AVVB 2I9TB 4XWGL 2ENQA 5D7JA 5AVWB 5FV2A 2CLVB 1PYWA 2D31A 2GPZA 1J5HA 3EH4B 3WYRA 4LLMA 1RFDH 5KSAB 5F1NA 5FECB 4JFXA 3NOIA 1P0SE 1T1ZA 2X89A 2ZF9A 5IROC 1HESA 3SJVA 4ENZA 2DQIL 3PJSB 4KY1L 1A6VH 1GGUA 3OMAB 2V8MA 3MA9H 5JXAL 1WZ1H 5EU7E 3UTTE 1X7QB 5BJTA 5CIPA 2BHZA 1REIA 2OX5A 1I1CA 1BZ8A 1NIBA 1ZTXL 1JGLH 1N64L 5FO2A 1RK0A 1YMMA 4ZFGL 1MUJB 2GJ6E 3IDXH 2FJFA 1XB6A 3ZKNC 5DHXB 4K71C 2V3DA 4MASA 2XVKA 5E2TH 5BRZD 1JPTL 1KCVL 3LRLA 4AKQA 4NP4H 1ZS8B 1G0DA 1OEZW 3MODL 3NCBB 1G5GA 3RTQC 4QRPD 3FQRB 1NC2A 3DUHA 1T1WA 2W88A 2XZQH 1EEQA 4L48A 4RSYA 5IMLB 4GBXB 3PE9A 2MHAA 1Q94B 4PGEB 2MCG1 2M26A 2WP3O 4ZFFB 4AK1A 1A14L 4QXUH 4RAVA 3CMGA 2HSIA 2I07A 3K6IA 3VDCA 2EXWC 2VDMB 4PGJA 3BP7B 3VRJA 3L4TA 2XY2A 4HOZA 3KVQA 3QAZC 4ELKB 1WFTA 4OZIB 1M9SA 3G08A 4Z3EA 1S4IA 3DVNB 3V7MA 1I7TA 5DJDA 1IEAA 4HS8L 3WUWA 2O6FA 4CW1A 1CXHA 1GR7A 1QPXA 3FH8A 4GAJH 4Y16D 4Y9FA 5E1AB 4BCYA 3D4YA 5CINL 1UD8A 3DRTA 5SWZD 3QQ3B 2CIIB 4LHUB 2JKRM 5ID1A 1ITBB 3AREB 4LSRL 5B38G 4YSDA 2JB6B 1L7TL 1GW0A 1KEGH 4UZGA 3EDFA 3EHBC 3RWCB 1TCMA 5HGBA 4FTVA 5HD8C 3G9AB 2X6AA 2UVFA 3GPEA 2UWEB 3T2NL 4X7TB 3QQ9C 2J8OA 1S7VB 2A9MH 1JP5A 4LRIA 3B2VH 3B9KD 4Q58C 2JCCA 3MOBL 3NIFF 4D3CL 3IXAA 4ZFOA 1AFVH 4TF4A 1FYTB 4X4ZA 2E46A 4Q9CA 4Y2DA 1FJ1A 1CXKA 4BIKA 2HVBA 2FL5B 3U2IA 2FATL 3GMPA 4JO4H 1RUKL 1U91A 3LEYH 1WWWX 1IMHC 5I1AB 3T0VA 1T1YA 5DK2A 2YMXL 1SF3A 3K8MA 1VCAA 3NCMA 2WO2B 3CFCL 3QPKA 3C08H 3WNJA 3U0PA 5BV7L 3LQAH 1GGBH 3IDYB 1KB5H 4PJ7B 4AIXA 4ZOBA 2IANA 3GSXB 3FB7B 4IOIA 4L1TA 3VGBA 2AK4B 2CLVA 3RI5K 3LPPA 2WZAA 2QT6A 5FKPB 2NX5B 4HIPA 1I82A 2O6CA 1D9KB 3UTOA 4YDJB 1LTXA 2NUTA 4RWHA 2ICEC 4KAQL 1FPTL 3KS0J 5D6DA 4DPBX 3H0TB 1EK3A 2ICWI 2OJZL 3BSGA 4HEPG 3NSJA 4A2GA 1X9RA 1KG0A 3BUDA 4IBZA 1O6SA 4JFHE 1JD9A 3DX1A 5TDOA 4EDXA 3UBHA 4BQ6A 4PW9A 2Q87A 1LDPH 1UB6A 3CHXA 4GXFA 1KGJA 3EFFB 2FLMA 2O5XH 3PLYA 1TMCB 2ZJSL 1M2VB 1Y18A 3BT2L 4H7VA 2J56A 4KJPC 3DO4A 2Q76B 4B53A 3S2AA 2OSWA 4MNQD 4APQB 2R0WH 1DVQA 1KCRH 1XSIA 1BVNP 3MLZH 4PJFB 5HVFB 4EKXA 1R3KA 5JOPD 4Z7VE 4AWJC 5BOJA 3WO4C 4NWTH 4ZPTA 2VUOA 4MCMA 4NJAL 4PJEA 3WN5A 1MIML 4E68A 3D85A 2DQJL 4V1DE 4UCFA 1MNUH 1QSFB 3DIFA 4WO4B 4PRHD 3TZVD 3QRGH 3D6GA 4ETQB 1ZGLM 5E03A 5C3IA 4FXKA 4JUSA 3IPEA 2X1WL 2BNQA 3D87B 4DN4L 3TBSA 4QO1A 2KI6A 4MQ7A 5BQDA 1V05A 4XO8A 1RMFH 3B9VA 1WE5A 5EIVA 1AD0B 3WFCL 1JYWA 1MHEA 3TO4A 3FUMA 2DMKA 3MV11 4FNPA 4X5XA 5EZJB 5EEZA 4IRSC 1MPAH 5KUMA 2X4NB 3LQMA 3UZEC 1JJUA 4ZPVA 4JJ5A 5D7IF 1OM3H 4G7RB 4YR6A 3U4EA 3OR7A 3BW9B 1LK3H 1AI1H 1ONQA 3FT2A 4V1DB 5D2NE 4O2CA 2DKMA 4TOYH 4W4OA 2GSGB 2WNKA 2ZXDA 4XNQA 3MBEB 2GVYA 1W8OA 5EB9A 1P4IL 4JUTA 3LEVL 1UWGL 1TU2B 1B3IA 3NN8A 4CAGA 1MDTA 2BCKB 1K8DA 3RVXD 4MZ3A 2ZUQC 3DX7A 4G8AC 1WWAX 3ZZSA 1VAHA 4JDZA 4FQXC 4E9XA 5HD8D 3R8QA 4D9QE 3UZQA 4GS7C 1P2CB 3K8LA 1SJEA 1TZHB 4ALAC 2O6DA 3O8XD 4NQDE 3VXNA 3H2WA 3QCVL 3KDMB 4RZKA 2K78A 1ZHKA 2IDFA 1A7RH 4JZOB 4R96A 3RPIA 3G7TA 3T0BA 5KVEL 1AAJA 4KJQC 2H45A 1LEIB 2E9WA 2R9HC 2TSBA 3V0EA 3QNFA 1NBVH 3IMRA 2VDLH 4KRLB 2FX8H 4JVPA 5E5RB 4X7FC 2N7BA 4N3UA 3C12A 3OG4B 4MAYA 4NC1E 1BIHA 4PLJC 4PCTA 2P47B 3RIFF 4ECNA 2AEOA 3FFDB 1ZV2A 5IHWA 5GGTA 1IC0A 3CDGB 1SHWA 4KVPA 4N68A 5C09E 2NUTB 1EJ8A 3RHWF 1MCRA 4YC2B 3TNMB 3PNRB 4K3EH 4FQPA 2XWJB 3KYNA 4XRCA 3ZKXC 4MZ2A 4G8IA 4HG4K 3UG3A 4AT6B 3EFDL 1OO2A 2ZX8A 3QBTB 1QW9A 1BXXA 3DVGB 4OLVH 3EJSA 1KT2B 4HUKB 2NQCA 1NEZB 1CDJA 1VLXA 2Y25A 3ULUF 2ADIA 4PWKA 3ZYOA 1FBIL 2JI1A 2JQMA 1BG9A 5LWYL 3VFTA 2Z64C 2F74A 3K6NA 2VZVA 2J1KA 3LIUA 1JAEA 2IH1B 2ZOKB 4GQ9H 5C0NC 5C7XH 2EKSA 1KEML 3MNVA 1B0GA 2PPFA 2ALWA 2VDRB 2QMKA 1IVTA 2XXCB 4Z7IA 2VJ8A 3O3AB 3VGGA 1XVSA 4DWHA 2BW4A 3MLUL 4GQQA 2BY1A 4PP2A 1URLA 3PHQB 2MPAH 1XGQB 3ROOA 1SN0A 1N5AB 4G8EA 2AQNA 2G2PA 2ZIDA 2X3CA 4DP7X 5KS9E 4M7KL 3NIFE 3P4NB 3L4VA 5GSRA 2CH8A 4UAOB 1T66D 5KBMA 4ORGA 3KPNA 1XBRA 3PWJA 3N1GC 1T7XA 2W65B 4ZMVA 3IU3B 3ARQA 1HVXA 1J18A 4BFGA 2VAAA 4NQSB 1PZAA 4JREB 3CHPA 4LT7A 1MKFA 1VZGA 4NYLA 4XBPA 2YUWA 1ZK9A 1KBPA 4WEUD 3ZTEA 3KD4A 2TSAA 2DTSA 2DMHA 3ECBA 2PP9A 3E8VA 4JDTL 5ESVB 5A1AA 1FDLL 4MA8H 3F7YB 1PTZA 2BX5A 5FC9A 4MS8C 5EOCH 2H7WA 1PG7H 1WTGT 4N0YH 2ZYIA 1MWAL 4YR6B 2I5YL 4UT7H 4X50A 1WF5A 2D3VA 3DMMA 3NT0A 4IKKA 4ODXA 3TS8A 1QSVA 3QNXB 3WNLA 1M7XA 5AAMC 3WJMA 2O30A 4JHWL 4P59H 3NH7L 4W4OC 1XIWC 3SJVD 5KOVC 3Q43A 4JFED 4ETYA 2F6AA 3RUGF 1AZBA 1EDYA 3QDAA 1DBKH 1YECH 4Z3FA 5JUEL 3DNKA 2OL3A 2VSCA 2IOOA 1ZTMA 1BD2D 1KTJA 3O0RL 1JNHA 1KELL 3IDNB 5E5LA 3QPXL 4W9GC 4K94L 1R17A 2C34A 2CLRA 3ZE2F 2W0FB 1CDBA 3VWKB 1KENH 3D34A 1KCUH 4XNYL 2HG5B 5B8CB 1S5IL 2HA1A 2F8OA 1E90A 4FQXD 1UVQB 2DTML 2CQVA 1U8QB 5GGUB 4Y5YA 1FNFA 5ICUA 2CKBB 1WC7B 4F7MB 4YXKH 2D03L 3QH3B 1Z5HA 2OTWB 1D5IL 3JUZA 5CJBA 2Z4TA 2X9ZA 4GG8A 3BAIA 3UROR 4ONGH 2GABA 4JMXA 5J1AA 3ZT6A 1A7OH 4QOKE 1A25A 2FT7A 2WXLA 2VXSH 5AW0B 5C2BL 3TWYA 2WLHA 1TYEB 5A2LH 3SY6A 5IR1A 4BCZA 2AKRB 4AEIH 1A6ZA 3K72A 3HR5A 4BXVA 3CIAA 5I1KH 3RIKA 4Y4KD 5I0DA 3GZKA 3DIDA 5AZEH 2P4AB 1BM3L 5FYLE 4S1RL 1IQDA 5JA8B 5E7FA 3RDTA 1A4JB 4XVJH 3FS9A 3NSCA 1EGJL 4U6YA 3MDJA 1FYHB 3QUML 3U30C 3INUL 3HG5A 5B8CC 4FD0A 4U1GB 1UEYA 4J23A 2E8YA 4YZWA 4ENEC 4CSTA 3O2VH 3AU1B 1AGDB 1SYVA 2Y7LA 1D6VH 1EEYA 4OTXH 2XXGA 5DD6A 1PZDA 4LIQL 4MNHA 5FYKH 2VRKA 1MCHA 1ZDSA 1GGTA 1UWXK 5HPMA 1OCRB 5E2WL 1CFVL 4HUVA 2HYMA 4MA7L 1HHHB 1Q0YH 3ARDA 5GSRB 1TFHA 3UYOD 4KFMA 4BZYA 3S96B 1NIDA 4I7ZC 4OQTL 2FVNA 4W6YB 1MXDA 3V6FB 1SBSL 4X4YA 3P40A 1D7CA 3ETBJ 5AW8B 1B88A 2WQAA 1Z5LA 3RNKA 2P28B 2OI9B 1R3IL 2WAHA 5TE7L 5KSBA 2GITB 4BH7A 2YRZA 2VO5A 2VISB 1IKNA 1MW3A 1QFPA 4AZUA 1MVFA 4WHTA 2AJVH 5KSAA 2K1MA 2Z7ZA 2NW2B 5D1ZI 1NPNA 1Q9LA 1QRNA 2FWLB 3CC5A 3LB6D 3MLTB 5ANMB 4AYGA 4HPYH 2W0KA 3OJVC 1IGYB 4R9HA 4YSOA 4H8UA 3QC6X 4HZAA 1P5VB 3QEQE 4G80A 1PIGA 5ESQA 3AWFA 4LEXL 4NM4H 3ETBF 2C7UA 4HIXL 4TVUA 5IJVA 5CN3A 1L9QA 2H1XA 1DFBL 3W9DB 4Z0BH 1QSEE 2FJUB 1T2QH 4R2GB 3B1UA 4JFWA 3LZFH 3NCJL 1T0MA 1XAKA 4MWFB 5DD5H 5AW4B 3VTMA 3ZTNH 5I8CA 3DOHA 1ZS8A 4P2AA 3BSZL 5EA0H 5EUKA 4XWGH 2N0MA 1U8OA 3IDYC 4QAMB 5FDWB 3GUTB 5D5ME 2XKUA 1J1XH 3I3DA 1S3KL 3C09C 3Q48A 5FUZH 3VWJA 2PR4H 3MA9L 2YWYA 3MRQB 4KGJA 2VE6A 2PABA 5A6MA 2EDDA 5JW3L 3HZVA 2DMBA 2GBUA 1J05A 4LVHC 1QMUA 3D09A 3VFNB 5ID0A 1OP4A 1CYXA 4N8UA 4ZAKA 2F5BL 4IRJD 5EEVA 1NGWA 3CJJA 1QSEB 4PW3A 4AL8L 4HT1H 4LZKA 1DTUA 5G5DB 2VGLM 2JXMA 2X6MA 3NEXA 4BUHA 4OU3A 2WLZA 4CW1B 2XWBA 2CU9A 2PO6C 4KRPD 1YQVH 2ERJC 3ZSTA 3S36X 2XZQL 5BUGA 3FQXB 4P3DA 1OAQH 3QDMB 3QFJA 4WUUA 1SHSA 2QLYA 4PW4A 1MAMH 1XTMA 5C0BE 3BKCL 1P6AB 2F53A 5SWSD 2Y06L 5E8DH 3RVUC 4LK4A 2J44A 4TPRH 1RZ8A 5IG7B 4ZMAT 4XCYB 1QSFE 2VITA 3CCHB 3D39A 1I8IB 1A6WL 1KB5A 4LCWE 4YBQC 2VXQH 4DHLA 1BFVH 1Z9NA 4S1QL 3E1F1 4XHJC 5DLML 4UTBH 2YIHA 3IF1A 3MNWA 2XJKA 4Z7WF 5CZVL 2PUQT 4UM8B 2W92A 4J3OD 3SKUD 1F4AA 2X87A 3L08A 5IQ7L 5E9DA 3MNZB 3RWHA 3RUGE 3S8WA 3GDCA 4YHNA 4KFZC 4F8NA 3GMPB 1G9ML 3MLYL 1OCOB 3I9IA 4FLHA 4KO7A 1MCCA 5HHMD 4GW5A 1WFUA 5J5EA 3L3OA 3D69A 5F1IB 3TN0C 4BH7B 1AKJB 2R56L 3HFMH 3R4DA 2DAVA 2GCYA 4WIQA 1VA9A 2DWTA 5D7HA 1C8QA 1FGVH 2XWTA 2A73B 3VNYA 3FF8A 1QTYT 2APFA 4YLQT 3V0IA 4F3FA 3HBPA 5TQ2L 1Q9LB 4L4VB 4JKWA 4MMYA 4TQEH 4JY4A 5I2IA 5E6RB 3QZPA 1UXLA 3TPUA 3V52H 3A4DA 2EE0A 1ZCRA 1W72L 2WNWA 5B38B 1M05B 5HYJE 5BOPA 2EEXA 4PJ8C 3ZKSD 2R1YA 4OKVB 2V5SA 3UTSA 1BDYA 1KIPA 3HN3A 4HK3N 2H8PB 3ISRA 2E27H 2J8UE 2AVGA 5E95B 1CWVA 1G6RB 4FQQA 1H19A 4DKFL 2WVUA 3MRGB 3MRLA 4RWYH 3GINA 2RA1A 4UV4L 3T6VA 1G0XA 3U6XS 4KUCF 3V9FA 1A65A 3CFMA 3D25A 3U1QA 4EBQH 4FL4B 4NIKB 2HN7B 1N64H 4FI6A 4ZO7A 4EZMA 2M1KA 4JKMA 2XVGA 4FYSA 5T3XD 3VTTA 1BJ1H 3ULUE 1FUNA 4PJ7E 4KJWC 1EUTA 1K8IA 2XN9D 3KPRE 4JL2A 4MXWL 4UUJB 2D7QA 3OAZK 3MRRA 5D7JB 4Y4FA 3EO9H 4UMSA 5SWZA 6FABL 3UPRB 2ICEB 1YEEL 2OTUB 5C6TL 2H9GA 2YJLA 3FYEB 3RNQA 4L8SA 4OJYA 5LG6A 1J8HE 1GKEA 1YY8A 3HMWL 5K9KB 2XFXB 3IJ7A 4DP1X 2A83B 4TUOB 1OGAD 2ODIA 3BX7C 3UZVB 4JFPB 4JCMA 4LDEB 4FJYA 1OCCB 4WFGD 1KBBA 3KYMB 1B6UA 1Z3RA 3MLZL 2F7IA 5CLTA 1A6TA 1WT5C 2FJFB 1VACB 3MC0A 2BNRE 5GS0H 3GMLB 2VW7A 3MV7B 4CDGC 1NGQL 2HX9A 3NFNB 4LAQH 4OZGA 5ISZA 3UJJH 3TJHC 5BRPA 4P46B 1MFCH 3T0WA 4GAJL 1UTDA 4HQQH 4PJFE 4K73A 1INDH 4AENB 5TDNA 3PUUA 1I8KA 4U1SB 2LVEA 1H8OA 4IRSA 3D12B 4LFHD 3SQRA 3DETC 3ETSA 5TFSL 4X5RA 3TIEA 43CAB 3CX2A 1A9VA 4ANUA 2FO4B 2WTRB 3U9PL 3MLWH 4GSDH 1ZLUH 4I4WA 1JWMB 4QCIB 5FV1L 4MBOA 5I66A 5HGAB 1KLGA 1HH6A 1SRDA 5TE4H 4BKLB 4CA4A 3HUJB 2R23B 2BNRB 3ARBA 3HI6L 2J8UF 3MUZ1 3QRLA 4FN0A 3K71B 1FNGB 2JCWA 1VFOA 1QBMH 3IPFA 4JO1H 2YPLE 4Q0XH 5SWQB 5I6XC 5D1QC 3PJLA 1F41A 1RZGB 3LEVH 4E9SA 2QKIB 3TN0D 3MKKA 4EZLA 4GOSA 1RUKH 1U8JA 3BJLA 4WTXA 4Q56A 1GGYA 2JKLA 2PP7A 5FYJD 4FZEL 3CVHB 4HFUL 3S36H 3ABZA 4NCC2 3LZQA 4X4MA 1ZHBA 4L1DA 5EZOL 4TVSa 2QL1A 3QCVH 4YIQB 4C83B 1QR4A 1BYPA 1CFQB 2NUPB 3FQTB 4LKXB 1NEZA 4R8WL 1QEXA 4Y88A 1IAIL 1Q1PA 2VDLL 3Q6FB 4DEUA 5C0RH 1KIUB 4XVOA 4ZFQA 1L5GA 3WHE0 3GPSA 4NNYB 3TZVA 4BRVA 3WTXA 2RHEA 3FSWA 4J7RA 3UJIL 2QQQA 5C0BD 1SJHA 3FU3A 4MS8D 1UEMA 2JJTA 4RGOH 2PW1A 3BUTA 5LXGH 4IRZL 3OGCB 3BE1H 4NJ9L 5ELIA 5LGJB 1N5AA 4G8EB 4B9KC 3N3EA 4DUWA 4QRRA 1GJIA 4G70B 4LLWB 3FUJA 5F1SA 3KNBB 4B9IA 4LSSH 3D2TA 1NMBL 2K6ZA 2P5WB 5I1GL 1IEBB 1ZT1A 4JLRA 5MEQA 3NJFA 2OZ4H 3VI4A 5J11B 1LEKB 1SZNA 4X6CA 1HNFA 2CDGB 4K5PA 5D1XE 2ZX6A 3VFOB 5K59E 1OPGL 5DT1L 2GT9A 4LMQI 2MCPH 1L0YA 3MRCA 3AC0A 5I1IL 1RUAL 1S7XB 3QHFL 1X5HA 3KPSA 4OZFA 2ITFA 3VI3E 3JWOH 1CFNB 4OF7A 5BS0E 5I1CH 4ZFOL 3VFSA 1R3HA 3B56A 1CZ8H 2VDNB 1YDPA 4EOWH 2A4CA 4JZJC 3VRIB 1UJTA 4UOQA 5FA3B 3OPZH 4N3TA 5D7SH 5GIRB 4WO0A 1J9QA 1YPZE 4R0LA 3Q2NA 1VPOH 4AGNA 4AV5A 4IBUA 5KSAD 1ZLSH 3H9ZA 4OGQC 1PD6A 2NY7L 1IGFH 1QR1B 3HNTL 4QRTB 3IT8D 2VCOA 3Q0HA 4XN2A 4ZW5A 2HT4D 3OAUL 1CVSC 4H40A 2YFNA 1S7RA 5GJTH 1WZLA 2Y0SA 4DP0X 3DX4A 2P8MB 4G8GE 5JORB 2PXYC 1XXFC 2Q2LA 4FOMA 3K3QA 4QMEA 5T3ZH 1JUFB 2J12B 1OTTD 1AR2A 1NFDA 1Q38A 3PGCA 5ICXA 4LVHB 2Q8AH 1MWAA 3WV0A 1OVZA 1A1MB 1JZDC 5TPWL 4FQ2H 3E8UH 1O7DE 3EJZC 4GIPD 4IHOA 4NSKB 4U6HA 2WB1A 3PU7A 4K3GA 5EF3A 2DBJA 1VENA 4LSVH 1GA2A 2C1PB 1RUML 2YFOA 3TBSB 2FLBT 3A3YB 3QH3A 2ZYRA 1OTUD 2BOCB 1R4XA 5JOPE 4J6RH 3NH7H 4HXBL 4PRIE 4B9CA 3IJEB 5C1MB 2O5NA 1NKGA 4X9FA 4GFXA 5EO0A 4IM8A 3E3QE 3FOLA 5I5JA 3WL9A 1IKOP 2J1WA 1HX0A 4MB1A 1ETA1 1V5JA 5KVEH 3CLFL 4JJ5B 3QDJD 4XX1G 1K6QH 3EGSB 1HL5A 2ZAHA 1U95A 1DVSA 3F7QA 3HS8A 3P3RA 3QRBA 2GSGA 2ZG1A 4XP1H 1WFJA 4R5TA 4WKZA 4UIMA 2J6EH 1NLBH 2GUYA 1E4XI 4UV7L 5FO9A 3SE3C 2WUBH 4BD4A 1H3GA 5B1JA 1TVDA 5SWSE 3P0GB 1VZIA 3PNWB 3UTPE 4F5CA 4ZX4A 1N59B 3X13A 2BY0A 3MBXH 4YL9A 1IC7H 1FI8C 2F53D 1JERA 2IAMD 4S0HA 4GKNA 3I2CH 5L2KD 4F9LA 4N6RB 5AB0A 4PLKD 4AEIL 4Z77B 3WOVA 1LEIA 3NCYP 3DDGA 3Q5OA 4JBSA 2WKGA 4P2RB 4KUZH 3VD0A 3BEWA 3WIFA 1CPUA 4WI0B 4D0CB 7CGTA 1O6VA 2F54B 1KZQA 2DLFH 1EZLA 4GRLD 4PSRA 4CU7A 3MACL 2R27A 1GC1C 1WRFA 3CV5A 1VF5C 4Z7OF 2XNAA 4LSUH 4OJFH 3U6XA 5EF2A 3O4OC 4OZHA 4G5AA 4ISVA 1S7XA 4AEEA 3SZ6A 3RYMA 2P48B 3UH8A 3RUGA 1E27A 3CQFA 3EYSL 4OF0A 3AGVA 2QHLA 5GQBA 3CVHL 3EF7A 1JCKA 3RI5F 5GSVA 4HPHA 3TA3B 2F15A 4CN4A 3TF7C 1XL6A 2NXYB 3QORC 1BD2A 3J27A 4MA7H 5IVOA 2EXSA 1S7UA 1FFQA 1C5DA 2YBRA 1QFHA 4HFWA 3JVFC 5D7EA 4IEFB 4YO0B 1SPDA 3AMLA 4XMWA 3GXTA 2V5RA 1CG9B 2K6WA 1T6WA 4M48L 4JFOB 3QP3A 1JUFA 5TE7H 2I5YH 3PDGA 4UT7L 2QQKL 1NGYA 1V10A 2HT4C 3VFWB 3B2UD 3U4KA 2PO6D 3HLKA 3DROA 4XCCL 4JQIH 2R69L 1AR1C 3MV9D 4YOKA 4G1MB 5ICZB 2KQNA 5KVDL 2EQDA 4PIRF 1GS6X 3G5ZB 4GO8A 2BZ7A 4I89A 4OKDA 4JG0H 1BVKA 4MNQB 4APQD 5A6IA 4N9GB 4AYMC 2OZ4A 3I6GA 5JHDA 3SDYH 3SOBH 2VDKL 4PGBB 2IALB 2AZAA 1XB8A 3EJRA 3WKQA 2HMIC 1YEFH 5AG9A 1KCUL 3UP6A 3WL9B 1JV2B 4Y2NA 2J5WA 5CCHE 4LLMB 1FRGL 4H5SB 4PJCA 2NPLX 1YY9D 5DHYA 3LRSB 1L6ZA 1MCOL 1EVUA 1S78D 3QS2A 3QXUA 3QI9D 4OD2A 5DS8B 4UIMB 3FN0H 4NP9A 4ONGL 4AK2A 4X7CC 3BAXA 1UB5A 1KGIA 3GZOA 5IVXB 2BVUA 2JF1A 1QSFD 1T21B 1XV8A 1L6PA 4WO4D 4I8DA 5ALBL 1QLEB 5GGVY 3UFIA 2QSCL 4MKMA 3BFWA 4RQQA 2HLFD 4NO5B 4FFWC 4NAJA 1W91A 3HAEH 3TX4A 1QA9B 1O0VA 5KTEH 4YDLC 3CVBA 5E6IB 5D5MF 3VXQA 4MJ5A 3NJGA 3IKKA 1RKRA 1GZPB 1C08A 1YUKB 1VHPA 2Y1YA 2ZSWA 4DO6A 1DBML 3LNFA 3INUH 1U8CB 4PJ8D 3V9EA 4CGTA 2KUTA 4NO3B 1RVFH 3FO2B 1YMME 3P54A 1CD0A 4QYOB 5I6NA 4H0LC 3SGEH 3AWGA 3NCXA 2MOVA 4QY8A 3FTZA 5PCYA 1SYSB 1KFAL 3BXNB 4GKZB 1QRKA 1IJNA 4ZO6A 4Z7NE 1TDQA 1DVZA 2ZXBA 1HNGA 2WWOA 5CZVH 5B3JF 1LDSA 5GRUL 4XO9A 1YG9A 2Y1AA 5C92A 1YJDL 2HFGH 1YLBB 1D5XB 4K2UH 3U9UB 1G9MH 5KSUA 4RBPK 4HHGA 3B5HA 4MMZA 2YPKB 2FECL 2HT3C 4MYPA 1KCBA 4X7SL 1XGYL 4HEPA 5T1LD 4FC3E 2H8PA 3NMEA 1N19A 3IRZA 3O3EA 1G6RA 4OGAD 2Y7NA 4UB0L 3VD5A 4WI7A 1URIA 4CUCA 2DLIA 3V6ZA 4GW4A 1PIFA 4NENB 2Z6FA 3RWDB 3GJEB 4HETA 3H42L 2FO1A 4OF6A 5IB3B 1ZT4B 3BAYA 1ZDQA 4KMTL 4TQEL 3R1GL 2WQSA 3B9DA 1FZJA 2NYZA 3LKPB 2XN9E 3P3YA 4P23B 1P7QD 4O02L 4LAJH 5K1NA 2ZCLL 5DQ9B 4XCEA 4XXCC 2WLNA 3TJHD 4OM0L 2WZPD 3F7KA 2XQYA 5E9NA 4R4FH 3V0WH 4YEFA 1T03H 2OL3H 1ZJAA 5JIPA 3UAAA 1BFOA 1FZOA 2OCCB 4GXUN 4LL4A 2ENPA 2V2WB 1LEGB 5DRXA 1Y6MR 4BBWA 5I0YA 3JV4A 2H9GB 3LZRA 1M6OB 3RNQB 1PQZB 5DHYB 4BFOA 4HV8A 4ZTOH 3ULVH 4Z7UF 4LVNC 4PWJA 4C56E 1WFIA 1FSKB 3H0TA 3CUPB 3CN1A 1XCTA 4KMLB 4EBQL 4LOUD 1A9EB 1P5VA 2HWZH 3BAKA 2XWDA 4DK3A 3MGAA 1SHMA 2XG4A 3T8VA 5JIIA 1A6TB 2H32H 4B0MM 4G9DB 5IJVB 1F3DJ 5KYYB 1FP5A 3RKDC 3COOA 2Y4SA 3B4NA 3MRKB 3PQYE 2HPTA 3TA3C 4L9LC 4DGIH 4M62H 3SPIA 1T0MB 3NFNA 4HIIB 3ZPDA 3BC9A 4P46A 1QLFB 2OBGA 4MB4A 2MRYA 1UWXH 5E6IA 4N6QA 5DRWA 1CGSH 5HVHB 1J86A 1SNRA 2CHWA 2RFXA 3WGUB 4MNGE 1QO3A 3D50A 1FG2A 3IDXL 4D0DA 5I18H 2PW2B 3E6FA 5H2BA 1F4WL 4HWBH 3S3BB 1NGPH 1P53A 5MI0C 4C56B 5MENE 3IGLA 3VXSD 1ZKAA 1TZOA 4OJDH 4NQVB 4XNUL 2Q1EA 3E6HA 3FQUB 2ROYA 1HH6B 4PRHE 1BBDH 3E9TA 2NSXA 1I9RL 3VWKD 1OAXH 1IAII 2FEEL 5FYKD 1TZAA 5I76A 3QK0A 4NZJA 1GCYA 5H4YA 4K3JL 2D4DA 1KTCA 1JHTB 3VXPA 2OX5B 1EANA 1HH9A 1INDL 2V37A 4P3DB 2PPCA 5JPMA 5KYUB 2WYZA 1E4KA 3KXFA 5GRWA 3IBOA 1Q72H 1AQKL 2OMNA 3Q8CA 1CFSB 4FQ1L 3ULUD 3QXDB 1BZQK 3C6SA 2RALA 3HFML 3MN8A 3QJOA 1P7KA 5HHXL 3CBKB 2AK4E 4Y7MA 3TO2A 4U1IA 2F19L 1IGMH 5HI5D 1LP9F 3CGTA 3LKRB 2L7QA 4NRZA 5EEXA 2NDGA 1HCYA 1EAQA 1TIUA 2P43B 3A24A 1SMDA 3BH8B 1VFAA 4B96A 1YQ2A 5HHNA 1XSKA 4XMXA 1GOGA 2P5PA 2VLKB 5EBLB 5AVZB 1G7QA 2ZNWA 1ZT4A 3OAYH 5IFAH 2PYEB 3IETA 3VW3L 4I5BB 4Y4FD 1Q4NX 2Z3FA 1TLMA 4TLSA 4ES8A 4P23A 2GBTA 3S36L 1TO5A 5D7IB 5EOQL 1U3HD 2QKSA 1CDGA 1IEAB 5DJ6A 1MJ8H 2G3ZA 2I9TA 2KPNA 2ZF8A 4HX1A 1LO2L 1GIGL 2A73A 4IIQC 3VQMA 2C9AA 5DA4A 2XQYK 2E86A 4R8WH 3ISWA 3WAJA 1X9QA 4KKCD 4X7EC 3U7WH 1T5WA 1AKJD 1HEHC 1I7RA 4N86A 4PGCB 2Q5BA 5BJTB 1XCTB 1RPUA 4AVJA 4UINH 2VN7A 4RGOL 2GB2A 2XG4B 3H9SE 3GUFA 3HB3B 1NIEA 4IRZH 1JGVL 3HC3H 4L4VD 3QFDB 2CBQA 1ACXA 3EH3B 2ARWA 4UT6H 1YEGH 1RU9L 2BVPB 4N8CH 2ZUYA 2WPGA 4M8QB 5I73B 5JW4Q 2ZWSA 4PH8A 3SCMC 1AR1B 4PY7A 1JWSB 4IOSD 1MREL 4URTB 1VFBA 3IJYB 2QBWA 4AV4A 1IVLA 3EYQC 1E5ZA 1DANT 5EC1A 2VJXA 1HINL 4Q6IC 3BP4B 1FN4B 2MOQA 4XP4L 2BSED 3MRJB 1NCCH 2EDLA 5FGCE 2K0RA 5AW9B 2IGTA 4QTIL 2X1OA 1E0OB 1QSZA 4XO3A 4DFHA 3MRMA 4YBLB 5AWNH 4X6BB 5GZOA 3IU3A 2EDBA 4I0PC 3W0WB 3ZU8A 4ACPA 1XF2A 2Y7QA 4PTUA 2QHRH 2JKXA 4BFKA 1OGTA 2A6DA 3CDZA 2GC4C 4NQCE 4X2UA 3SBQA 3CDYA 3D0VA 2HJLB 2FYVA 3C6LC 1LMKA 4UTBA 1DQDH 2F18A 3N2JA 3I6KB 3TT3H 3UTQB 4AJWA 4JHAL 4U1KA 5CILL 3F7YA 1IGCL 1DDHA 3FOLB 4XGZA 4NXKA 3CFKA 5JHDD 1G9NL 4BH8A 4GXVL 1JZIA 3DO7B 4JS7A 2WLIB 1WZKA 5JHAA 4M1GL 4LOFA 3DX9B 4FQ2L 3EYOB 3SQBA 5DHVA 5KWYC 1JWUA 3DSFL 3T65B 4GRLC 3U0TB 2CA3A 5IHBA 1F6AA 3RWIB 1D2PA 3VFMB 4ICXA 3AUVA 4ONFH 2XXFA 5B7EA 3QWQB 4QRRD 1U8KA 3ZMRA 3VFVB 4O58H 2JJSA 3ZHNA 2C26A 3I02A 3TBWB 1DBAH 2DH2A 3GHPA 3GIVB 3HAEB 4PUBL 4ZMXA 2QPUA 3P4MA 4NEHB 1U8QA 5GGUA 2WN2A 3SE3A 3SPHA 3SDCA 4RRPG 4OLXH 1KJ2L 2GHZA 4AG4L 2E56A 5D2LA 4QTHA 4EI6A 3MV8B 5CEZH 2YN3A 1RXLA 4EQ3A 2X4SB 5GGSY 5KVEE 1YRKA 35C8H 5D8JH 5TH2B 1X4YA 5CSZA 1UCTA 5LGYA 2J72A 2WBWB 1UJ3C 3NZ8A 1NIFA 3FOMB 1A3QA 5HDBB 4HMDA 3VSVA 3MLVH 3HZKA 1ZHBB 2V3FA 1MCIA 5C97A 3I74A 3S7GA 3V4VA 1GGCH 3GMOA 3BGFB 4H0IA 4UAHA 1A7NH 3ZXAC 4NZUL 4LLVA 4JDVB 4HUUB 3AU0A 4NO0B 2VMDA 4BA8A 1H15A 1TU2A 3NN8B 1NH6A 2B1AL 5FF6A 1WP6A 5J13B 4N0UB 5BRZE 2VLRE 4HU8A 5I1IH 1P7QB 5HYFA 2D2CC 3OMZA 2DLFL 3L1OH 1AGDA 3AU1A 3MV9B 1QTSA 3QJZA 4FQIL 4JPKH 4JVUA 4OLUL 4XN7A 2Q3ZA 3DI3B 4MNHB 3SYCA 2XRAL 4OLVL 3EHBD 4LSUL 4OJFL 4ZUTA 3S34H 3NSFA 3FU9A 1FO0H 5GRJH 3FO9A 3QI9C 3BPCB 1KPRA 5EU4A 2XT1B 3FTYA 1C16B 2DQCH 3QUYC 3EYSH 4G9FA 4BJLA 3LRKA 2EDEA 4NFBA 1FAKT 2UWEE 4FKKA 2IDQA 4WGVB 3IKCA 2WGNB 4RESB 3G04A 2YXWA 1O7SA 3BQUC 2K7PA 2HG0A 2ORBL 4DKTA 1FCGA 1IKFH 4PGBA 1QP1A 5AUMA 2LLGA 1U2HA 1WA1X 4WUUE 4L3AA 5BQ7A 3NCWA 4FFVD 3T6QC 4B60A 5EU3B 1R47A 2W07B 2GK0B 3BD4A 4UDUA 3TYGL 2Q20A 4B3VA 4H20H 1YPZA 4E2OA 2CRZA 5I1LB 2C9QA 5IBUB 4AY0A 2GI0A 4MJ4A 4KJYB 4J12A 2EYRA 4J6RL 4WF7A 3GT6A 4LCCA 4I1NB 4KC3B 2G4GA 2EDWA 5HHVL 2XN9B 4YAQB 3HNSH 2JKIS 3K1DA 1TVHA 2NCEA 2VR3A 3F8UB 4YN3A 2A9BA 1C9SA 5ICXB 1W6WA 3VAEA 1IM3D 2NSMA 3P2TA 1MJUL 4D8PA 3ULUL 3F5WA 4OLZH 1Z6JT 1QBBA 3PWJB 5AYTA 3SD2A 2C1PA 2J55A 4BFRA 1PNDA 1CL7I 1M7DB 1ZHLB 1MEXH 5AOZA 1OWRM 1J5IA 3HFFA 4F37F 1YMMD 4QTHB 1ZXKA 2PCFB 5ICYA 4R90H 5AOMA 4DAGL 2DIBA 2R59A 5TH2A 4A6YA 4GO9A 3NACH 5BOZG 4IGBC 1IC7L 3FL7A 4JANA 4QOKD 5CR8A 1I4FA 2ESVE 2WO3B 4PRAA 2O72A 1RJLA 2XICA 2DWXA 2NY3C 2OMYB 4N8VA 3HZKB 4KUZL 4TXVB 3T2PA 1S7QB 1EHAA 3V5HB 4PRDA 1L9MA 4RMSA 1MCFA 4XNBA 2IFGA 3C75A 2VDQH 2Q6WA 4CVZB 4ESKA 1HOCB 1DJGA 3UIZA 4L0PB 4Q6YA 1HHIA 2A1WH 1EPFA 3FHQA 1NBZA 3MNVB 4P2YA 4DGWC 5C3TA 1ZVNA 3TEXA 4YHKH 3ZO9A 2BLFA 1BIIB 4KDTC 3EUDA 4RA0C 3RIFK 3FFCB 3HZMB 5EMYA 3ARPA 1EZSA 3WBDA 1I1RA 2AMUA 2P8LA 2OTPA 4HHAA 4WU5B 5DJ2A 3LQAC 2IOMA 4KK5C 4ORGB 1UACL 5JIHA 3AXLB 1V7NH 3TCLB 1CJYA 1D6VL 3HE7A 4NB7A 1RZIA 2DWYA 3CHQA 3U25A 3KWWB 2GKIA 1JK8A 4IDLA 5JXED 3AABA 3VMOA 1IBBA 1KC5H 3F05A 3IDJB 2HVKA 3GRGA 4KQ3L 2BDNH 3RUGB 1HE7A 1M71A 4DERA 4RISH 4JQIL 3IMVA 1DSFH 1PS3A 4F15B 3NVQA 4X7SH 3W37A 4F8TA 3ARGC 1EUUA 5FECA 1OM9A 2EIZB 3F12B 3J8F7 4R97C 4HWZB 1Z9SA 4P57B 2DQDH 3QHZH 1KNOA 2FBOJ 2FNWA 2Q3AA 3O45A 1RIVL 1EZVY 1QHQA 3C5SB 2SODB 3H6AA 4J3VA 5E4EB 4B5ZA 5CNHA 3DHPA 1M05A 1HZHL 4FFVC 3N85H 2YLHA 1GC1H 4KKZA 5MERA 5KW9L 3JT0A 5CD3B 2FGWL 3M17B 3X3GH 2VIRA 1KIPB 1UZ8B 3L5WA 3NZSA 4XNXL 2X44D 3JUYA 3BDXA 4QUOA 2ZCLH 2VDNL 4MJID 4HPYL 5LGKA 3JYCA 5I8OL 4N2DA 2ETWA 3HRZA 2RQEA 2OL3L 4Z7WA 3DX6B 2KKQA 1UKTA 2W91A 3V0GA 2Y6SD 4I48A 1HAWA 1DQMH 1UG9A 5C0CA 1T0PB 4OVUA 4HC1L 1B6DA 4DGYL 2AJ3A 3W11D 4F92B 1KXQA 2PF6A 4IOSA 5E5UB 2LLLA 4KKAC 5SX5K 1DFBH 2J6EA 2NY0B 4LBEB 4H8WC 5JPMC 2GSIA 1KLFB 5KS9A 3N91A 1KXTB 4DGVH 5L6YH 3LZFL 1I8AA 3NCJH 2YA0A 4XI5C 3H85A 5KYWA 4XWOC 5JPNA 3I3EA 4U49A 2EICA 5MI0B 2R7EA 4G3YH 5I19L 1FO0B 1QATA 4ICWA 1KWKA 4WSGA 1Y6KR 5FFOA 5FX3A 4DGIL 5E2TL 4OIIH 5IGXH 4L9DA 2FGZA 2QTVA 4ZUSB 5AL0A 4OLEA 3ZRSA 4FYQA 1QW8A 3UZVA 5EN2A 5C2UB 1IILE 4Z3IA 2YZ8A 4HJUA 1CGSL 2NY3D 3C9NB 2YO3A 2RD0A 3O6KL 3UTPD 4D0BB 2W0PA 4PBXA 5DC2A 3TTSA 2R2BA 1G7HA 1YN6A 1EHNA 4HUCA 1HSAA 3LIZH 1RZJL 4ODWB 5KVFL 4PD4J 3MX0A 5CJ5A 1AOHA 4X7DC 2BNQD 5EO9B 4M4RB 1W0WA 4JRXA 1KFAH 5EUKB 2EDQA 3RWJB 3OTTA 2NY5H 1UHVA 4D9LH 2WSKA 5BZDA 2FD6H 4UILL 15C8H 3RJDA 4X80L 3H4HA 5GRUH 4ATWA 5FB8B 2X2UA 2E7MA 3IJ8A 3QXAB 2F7RA 2IQAA 3SDAC 3V8OA 5A2CA 4GG6A 4AJVA 1C8PA 4UU9A 1EZVX 2PYEA 3IETB 1E50A 4I4WB 1Q8MA 1DVFB 4S0TD 1U91B 1BQHG 1BXUA 3IVKB 3VO0A 4ZJ9A 1Q72L 4KXZH 1AQKH 3WFZA 1BM7A 2BNRA 5F6IC 2H6PB 3KL5A 3NRFA 3U0PB 2DWEA 3BAEH 3B7RL 4UQ2B 5T33L 1OARL 1G4MA 2Y5QA 2ZKHL 5SWQA 5AL8A 1U9KA 2UY6A 4RNRB 4QRPE 4MA3B 3PIQA 5CJ8A 3F83A 2DQUL 3WIHL 2EXWD 1U6AH 3QUGA 3KWUA 4ZYKB 1DJIA 3E2HB 1HEZA 5GISL 3GIZH 1XXDC 4ZX3A 1RZ8B 4YHLL 2VQ1A 2W1NA 5B1CA 4OI9A 1T03L 3O41B 2OPCA 1FGVL 1OB1B 4JFEE 3RJOA 5F89B 5FYJH 3M88A 5CWSB 4UM9D 5ESAB 1I3RB 2W5PA 1BGXL 5CF3A 2L7UA 5D71L 4JG1H 1GGBL 3OJMB 1JNLH 2BHYA 3GBNL 2Z31C 3DJRA 4ILDA 4FABL 1GJUA 4MRCA 2Z34A 4AX3A 3VD7A 1W72H 4P0DA 4YHNB 3IJYA 2R29L 4PWEA 4KX7A 4DETA 1UM6L 5T1LB 1IL1B 3WKNA 1E9OB 5E1IA 2B1HL 1KTDA 4XE5B 4YFDB 4D7PA 3CX5J 1BZ9A 4QJ3B 1TKWA 4TQPA 3D0AA 2WD0A 4M62L 3FK3A 2BRRH 1EXUB 1JGIA 2ZCZA 2UZIH 1CD8A 3VFRA 4CMHB 1ZXQA 4LCWA 3R0MA 3B9KC 1PYWB 4N2MA 3FSOA 4JCLA 4FAAB 3KXFD 1YEGL 1T1ZB 3OKKB 2HLAB 3QR2A 1EAPA 4PBWD 4W81A 3US0A 3S5LG 3P02A 1LP9B 1SY6L 1TQSA 1BQLH 2WXFA 2GQHA 3DECA 3JWDH 2IMNA 5CFAA 1DUYB 1BCIA 1TZIB 2P5EB 3MV9E 4PJHE 5F6HJ 4XNUH 2RAMA 2P7TB 3WY1A 4D0BA 1CBVL 1A8ZA 4RRPA 2DDQL 3KHQA 4NJAH 1MCLA 1PKQB 3QNZA 4KO5A 1MFMA 4AE0A 3ZRCC 4IU3A 5B39A 1GMIA 2Z7WA 4HD9A 1I8IA 1I1AB 2IH3A 3SOTA 4PJ7F 3AADB 3IF1B 1QO3B 4D0DB 1KYDA 2NY6D 3RZCB 3V0AC 5GS0L 2R29A 1NLDH 1DLFH 3ZE0F 4BWWA 2C9XA 3MNZA 3MZGB 1ASQA 2VDPB 5L9DL 4ZO8A 1K5NA 2DIJA 1WA0X 5TDPB 1U41A 1HHGA 5C70A 1XR8A 3GRWL 5HBBA 4NS0A 2ZAIA 4KOBA 2ITDB 1BVOA 2QQLH 4X99A 1IUZA 2HJKA 4PCSA 1QBLH 3V5DA 5JW5B 4MNQE 1UD4A 1I7TB 1OT1A 5DJDB 1NWPA 2CO2A 5KN5B 2BOCA 1DO5A 1OZUA 5HI3D 5AZUA 2UY6B 3FQ2A 4I3RH 4NPYB 2WINA 3U9PH 3DV6B 1KDJA 3B3IB 4GSDL 3W82A 4L4VA 1CU4H 4AI7A 2GJRA 2E6PA 3CHOA 4L3EE 3CZNA 4K7PL 4M4PA 2J4WL 1Y0LB 2JTYA 2XXMB 1ES0A 3JTSB 8CGTA 3O8XC 3MJ9L 3Q2CA 3IE9A 2Z0BA 4TVPE 4IMKC 4Y1SA 2Q8BH 5T3ZE 5AD0B 1GOHA 4GI9A 4Z7UB 4PPTA 2CUHA 5ESAA 4YPGB 8FABB 5TDNB 2D2OA 1W80A 1ORSB 3CZFA 5F88B 3LD8C 3ARGB 4NQCD 1AXSB 3BUIA 2NXZC 5L2JB 5C0DB 1CD9B 4M02A 1LNUA 4QEGA 1UFGA 2LW3A 3FZUC 1FZMA 3U7YL 2X0VA 2XFGB 4HJEA 4NN7C 3RZCC 3EH5B 4FLOA 4ABVA 1LWJA 2IDSA 2VZSA 5DJYB 5T5NF 2CHZA 5CZKA 2GJJA 3BPCA 4GUOA 4KNUA 4KHXH 1EXUA 3VFRB 3JV6A 2VLMD 4FNLL 4XHJD 3BH9B 4ORZC 3SKMA 2YN5A 1UZ6E 2RBLA 4J3OH 4Y4FB 2YGQA 5EPMA 4KXZI 2W65A 1QEWB 5LNDA 3H9YA 2CPUA 3IKCB 5GGSA 1CXFA 5DMIH 3ZTJG 3GQFA 1KBGL 3AITA 3GLEA 4PS4H 3IGAB 2ILLA 2X4UB 3UTTB 5CBAB 3P11L 1WSST 4JPKL 4LSSL 1E27B 2L3BA 3CU7A 3MLUH 3MKGA 1GOFA 4H88H 4LHJB 4HJIA 5I1GH 3GB7B 3Q5YA 4GJTB 4XN5A 2JJWA 3FQNB 5F7EL 1BWMA 1BD2B 1WBZA 5ILTL 4AZ8A 1L6XA 3V0JA 2BERA 4X8JA 3WJMB 1LM8V 4IDJH 2NNAA 2GJ6D 4H25B 3VJ6B 3E7JA 4H8VA 5J56B 2NMSA 2ED7A 1UXMA 2D3JA 1AC6A 4WEBH 4WHDA 4XAWL 4AUYA 1JPST 4HKZB 2BO0A 2OJEA 4CSPA 1GY1A 4RA3A 3FT0A 3UCRA 5KBLA 2Q7AA 1HZLA 1CZ8L 1RL1A 1JFQL 5CP7A 1N67A 4ZPTB 1JYNA 4R4ND 2IWFA 4GXVH 4P2CG 3KG5A 4PS7A 5BZWB 4ZS7H 1QRND 2AXHA 4P3CH 1FDLH 4MA8L 4XH2B 1OP3H 5A2KH 4XPBL 5ICZA 2ZKXA 1I7ZA 4RMWA 4KK9C 1CL7H 1NEPA 3S97C 4AVKA 2BK8A 1J5OL 4M93B 1RK7A 2DKUA 4TULL 4RMBA 3WS6C 2VB5A 2EYTA 4LPYA 2C3VB 4IBYA 1SM3H 4KTEL 4WK0B 4X6EA 1GZHC 2A0LD 3I6SA 1LO0H 3BZFA 4YHOL 1IV8A 1X6LA 2FJHB 2X40A 2VRAA 3D85D 3RGHA 4NZ8A 4PJCB 1KGYE 2I25N 2UY7A 4KDTA 4RAHA 5E8EA 1AIFB 2BOBB 2CDEB 1DUZB 4XNYH 4BHUI 3VWJD 3RX9A 4FGMA 4HXBH 4K9EH 3T1FB 3BJ91 4OLZL 4G7VL 4TRPL 5FCUL 1P4BH 2Q6WB 4BKSC 1K8DB 4QXGH 4KZEH 3TO4D 4WNQA 4Y8AA 3TJEH 1HE8A 3ZQWA 4M7JH 4RQQB 1WHPA 3F7VA 1DR9A 1WZMA 1XBDA 4LHUD 3OSKA 4JPWH 4KH9A 5DMGD 3AAZB 2BFVL 2ROXA 2AANA 4G6JL 1J9CT 2D9CA 2LHAA 4U6HB 5CD5C 4JZOA 5D55A 1GZQB 4X9BA 2QV4A 3OPUA 4QRRB 4IRZA 2E9GA 4OZGF 5IF0A 2EACA 3KGTA 5T1DH 4OF8A 1JTPA 3MBEC 3MLRL 3QJUB 3DOSA 4KGLA 5SV4A 3MA7A 4QF1B 2C4XA 4ZMZA 4FQIH 4CJ0A 2F8VA 2VZUA 3FOMA 3OF6A 1SXAA 5DD3L 3VGAC 5F3BA 5KSBB 4NWUL 3OZ9L 4AQ8A 1D7FA 2HVKB 5KEZA 3KPSB 2WLKA 3AXIA 2Y6SC 3SGDH 5D1QA 5EF0A 2EAEA 3QEQB 4YHKL 1NQBA 2I26N 3R7QA 4B0MB 2HTKC 1JRHI 1P4UA 2D9QB 32C2A 1YDPB 5K69A 1XGPB 2XQYG 3LVEA 5E9DD 2ADIB 5T1MA 4WK4B 1CLYH 1CFVH 1KNOB 3G6AB 3D4ZA 4X8JB 4HMCA 3APMA 3QVAA 4DPRA 5CJQL 4JRFA 3O2DA 1FIGL 3DYMA 4HYTB 4N2NA 1MCSA 5KJ4A 4GKNB 4AYSA 2YD0A 1MFEH 2AJZA 5IMMB 4G82A 2HKHH 4HULB 2UZXB 3QISA 3TYGH 3N9GH 1USQA 2JELL 3SDDC 3Q6GL 2X7LA 4PCYA 4KQ3H 4P2RA 3FBKA 3HN5A 4HJ0C 2WKLA 1U33A 3K4ZA 3LB6C 3DGDA 1X5KA 3ZGIA 1EXGA 4ODTL 1UA3A 1I3GL 5IVXE 4RGNC 1JGUH 2FIKA 3QG7L 5CJOL 3T08A 5GS0D 1PJ9A 1RI8A 2MQCA 2BP8B 3QHZL 3CFIC 2F1AA 1L9OA 2B9AA 4HKJB 4QHNB 5HJDA 4DUVA 1NCDL 4BDVB 3FUDA 4XPGL 3LS5H 4HBQA 4Y1AD 1UA6H 2ZT9C 4PG9B 3MPCA 2C3VA 3IAPA 5JPNB 1QWUA 3SDXE 1D6EA 3AY2A 4YSTA 4Z8FH 4OIBA 4X4KA 5KVDH 4OY9A 2FJHA 3CXDH 4PRHB 2J20A 5HHOD 3U6RA 4KXAA 4GQZA 5I1LA 1CQYA 1J0JA 1A9BA 3CFQA 5KG9A 4ZDHB 4IK6A 4AC2A 2NW3B 3SQOL 4UQ3A 4FCAA 1QLEH 4URKA 1U8MA 4FNSA 2RACA 2XN9A 4YAQA 5LVEA 4G6FD 4OZHE 1BQSA 4JFOA 5AW3B 4Q2ZB 1JNHB 4BE5A 5IG7A 2UXTA 4X4XA 3BPLC 3PXHA 4OGXL 9PCYA 2CLRB 5CZXC 3MU3A 1FORL 1TEFA 3A67L 3AAZA 4IRJC 3W9EB 3GNMH 3QDHA 4L4TA 4G5ZL 5D2LF 3IMTA 2PXYA 3U4BH 4C4BA 5J6HA 3QZNA 3UZEA 5IF0B 4WV1A 4KX9A 4H1LG 5GRXG 4NKDB 1K4CB 3POCA 4Y0GA 5CD5D 3Q06A 2CMRH 3K74B 3KCWA 1GAFH 3D33A 1T20B 3MRHA 1ECYA 3PCYA 1FVDA 3PPSA 4WI5A 3NPSB 3PXJA 4BKTC 1BREA 5ISZD 3SBRA 1CTOA 1QRNE 3WJJC 3MBED 5DK3A 4OZHB 3NCEB 5KVFH 4MDRA 4TPRL 3DVNA 3QZLA 4KROC 3K2IA 1QWHA 5HHPB 3GSNH 3O6FC 4PRIA 2NLJA 5IBLC 5LAPA 3OKDB 2C3XA 2K70A 5KJ7E 1U4FA 4JFTA 5DZNA 1WEJH 3SDDB 4MCNA 3WTWA 3X11B 1OSYA 2XTJC 5G2NA 4WGWB 4HZLA 3HB3C 1GKOA 1KC5L 1QABA 4B6ZA 4ZMNA 1V3KA 1DN0B 3BZ5A 5HGBB 2FDBP 1OSEA 4JFDA 3TO2B 1NSNL 2ATKB 2JKJA 4OAWB 3N43F 1QACA 3DHJA