4BWWA

Crystal structure of spin labelled azurin t21r1.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
127
Chain Sequence
AECSVDIQGNDQMQFNTNAIVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords AZURIN
publication title High-Resolution Crystal Structure of Spin Labelled (T21R1) Azurin from Pseudomonas Aeruginosa: A Challenging Structural Benchmark for in Silico Spin Labelling Algorithms.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 34
structure length 127
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4bwwA00
1ASQA 2H3XC 4BWTA 2I7SA 3ZX1A 3BVDB 2BO0A 3T71A 1X9RA 4Q89A 1KYAA 2VW4A 3KW7A 2UX7A 4HCIA 2GSMB 1KV7A 1SF5A 1KDJA 5B1JA 5I6OA 2H5UA 6PAZA 1CYWA 1CUOA 2XV0A 3S3CB 4E9QA 5AZUA 1AAJA 2IAAC 4NERA 2YAPA 3GDCA 1TU2A 1J9QA 4KO9A 5TK4A 1BXVA 1L9SA 1EZLA 8PAZA 3AG2B 2WO2B 2UX6A 1ETJA 3TBBA 1AZUA 2PPDA 4L0PB 1E5ZA 2YAQA 1AS7A 2IDQA 1SDDB 1CYXA 3AY2A 3UAEA 3OM3B 3OMNB 1AZNA 4HCGA 3TBCA 1PZCA 3X1GA 6PCYA 2AZAA 1HFUA 1ILSA 1FWXA 1GR7A 2DY2A 1F56A 1AG6A 1SNRA 3H4HA 4PAZA 2UXFA 3PLYA 3T6WA 5I6KA 2EINB 1PLCA 2XV3A 3UACA 3DKHA 4TXVB 3EHBB 1OV8A 5I28A 2J57A 1TEGA 2AFNA 1A65A 4E9TA 3UABA 4F2FA 5TK2A 1AR1B 2ZOOA 1E65A 2Y1AA 4YSOA 2BHFA 3N2JA 1IUZA 3ZDWA 3HEIB 3DIVA 3NSCA 3CVCA 4DP6X 4GYBA 3FS9A 2BP8A 3NJMA 4E9RA 2QT6A 3U25A 4E9VA 5IY5B 1EHKB 2QDWA 5B1JC 4UANA 1MZZA 5I5JA 3TU6A 3PCYA 4Q8BA 2CCWA 2FQEA 1NICA 3T9WA 2P80D 3JTBA 2AANA 1QNIA 1FFTB 4M3HA 1W8EA 1GYCA 2XX1A 2GI0A 1IBYA 2HX8A 1ZPUA 1PAZA 3PAZA 3ABLB 3ZBMA 2BWIA 1E5YA 4MFHA 1L9OA 1BEXA 1QLEB 2PPAA 2IH9A 2CALA 3D12B 4KNUA 2Q5BA 1SFHA 3SBPA 1OE3A 3QQXA 3MBWB 4YSAA 1N68A 1NIDA 4GP8B 4UF7C 2J5WA 4AX3A 3IN0A 3FQ1A 1ET7A 1GS7A 2H47C 2BP8B 5D4IA 4CSZA 1IBZA 1OCCB 5FC9A 2RACA 5I6MA 4W9ZA 2JKWA 2OCCB 4KOBA 5A7EA 2DWSA 2HXAA 1AACA 4KO6A 4BDVA 2HZHA 3ABMB 2PPCA 2HLEB 4YSDA 2FQGA 5I26A 1OF0A 1PZBA 3ABKB 2TSBA 3PAVA 1PCSA 3FU9A 5I6LA 5B1BB 1JZHA 3S3BB 2FWLB 3NJHA 1WAEA 2CBPA 3IN2A 3CZUB 4YSTA 2R7EA 4A2FA 4W1TA 1DZ0A 1ZV2A 2BZ7A 1PLAA 1MG3C 4YVUA 1E30A 1NPJA 4BWUA 4YSUA 4A68A 4HALA 3NJGA 2PCYA 2PLTA 5B1KA 2VW6A 1ASOA 2Y69B 3OMAB 2PP9A 1A8ZA 1KCBA 2FQDA 3WKPA 3AZUA 3CVDA 3T6XA 1J9TA 1RZQA 1AG0A 2E86A 3FT0A 1M9WA 4E9YA 2PPEA 4AKQA 4P5RA 2GC7C 1WA1X 3UGEA 1KDIA 4BK5C 1SHXA 3QJVB 1X9UA 4BDVB 2BP0A 3WIAA 2J56A 3FPXA 1JZIA 4QKTA 4E9XA 4G7QB 2FT6A 4HHGA 4FAAB 1BXUA 1IC0A 3NP4A 5B7EA 4F7KA 2DYRB 4YSRA 1RKRA 4YL4A 4YVNA 2IWEA 3HB3B 1AZBA 2R7EB 1GS6X 1UATA 1SJMA 1NIBA 4ZK8A 3X1NA 1N70A 1JERA 2VMJA 1ASPA 1V10A 2XLLA 4DPAX 4DPBX 3AG1B 3SQRA 1GY2A 4BXVA 1WA0X 5F7AA 4N4YB 2VM3A 1A4AA 2FJSA 1JZJA 3NYKA 3UADA 3NT0A 5B7MA 1CURA 1T5KA 3QPKA 1NZRA 4UAHA 4A66A 2YAOA 5EHFA 1PY0A 1OE2A 4HAKA 1JZFA 2BWDA 3X1BA 3S8GB 2GB2A 1MDAA 2DV6A 3AG4B 1MG2C 4G7SB 1KBWA 1ZDQA 4HIPA 3EH4B 4DP7X 2BP0B 1OCZB 1KBVA 2YAFA 3FQ2A 4DP1X 5AKRA 4AKPA 3BQVA 3MX0B 2YXVA 4A2HA 3NSFA 2XVBA 5I5IA 2WO3B 2IDUA 1NIFA 3GXUB 3S8FB 4KNTA 4AI7A 2B08A 5D4JA 2YARA 1L9PA 2EILB 2PP8A 1XB3A 1V54B 2VN3A 2XUWA 1WA2X 1XMEB 2AVFA 1AOZA 3RYMA 2IDSA 1ET5A 1PLBA 3EH5B 1AANA 4WKXA 2YAHA 3TASA 1WS8A 4DP2X 4DP5X 1PZAA 3PAUA 1BQ5A 3WI9A 4JHUA 4HZ1A 1ADWA 4GXFA 1BYOA 4M4RB 2HRGA 1NTDA 1NDTA 5B3SB 3QJUB 3V9CA 2XXGA 3H56A 4DPCX 3CDZA 2YXWA 2CAKA 5ANHA 2YAMA 1M57B 3GYRA 4JKNA 1HAUA 3V9EA 3X1EA 1ZIAA 1RZPA 1IKOP 2ZWNA 3EH3B 4DP0X 1OOWA 2MTAA 3G5WA 4N8UA 1URIA 1JVOA 1JZGA 3H4FA 4NAJA 2PPFA 1W6WA 4A2GA 3FYIB 4FA7B 4YSEA 2PCFA 2I85A 3NJKA 2LLNA 5I6PA 2EIKB 2QPEB 5E9NA 3X2QB 1GW0A 1OE1A 1AZRA 3CG8A 3FSZA 4RH4A 5I6NA 3FSWA 4A67A 1NWOA 2HX7A 2FT8A 3QJQB 1AIZA 2WSDA 1L9QA 1GS8A 2GIMA 4X4KA 1NWPA 2VSKB 3QJRB 4AZUA 2IWFA 2JXMA 5PCYA 3FU8A 1PF3A 1CC3A 1B3IA 1BAWA 1HAWA 2FTAA 3OD3A 2FNWA 3N55A 2BW4A 2A3TA 3WNIA 1BQRA 1MZYA 4DP9X 1TEFA 3CDZB 3PXLA 1BQKA 4YSSA 2UXGA 2GBAA 3AW5A 1NIAA 4JHVA 2VM4A 1L9TA 4P5SA 1AZCA 7PCYA 1OCRB 2X87A 1DYZA 1ZIBA 2IWKA 3NP3A 4NB7A 3X1FA 1AQ8A 4F2EA 2FT7A 3NJNA 3IE9A 4E9SA 3TA4D 1E67A 4YSQA 2B3IA 1AS6A 1JXDA 1J5CA 2IH8A 3C75A 1FA4A 3FSAA 4CSPA 5I5MA 1BYPA 4G70B 1A4BA 1XB8A 2UXTA 4DP4X 1ID2A 2W88A 1AS8A 4HCFA 1SF3A 3S3DB 1RCYA 3OQRA 1VLXA 1A4CA 4K9JA 4A2DA 2FQFA 5D4HA 4GP4B 3CVBA 4E9WA 4DP8X 1ZDSA 2JFCA 2MRYA 1J9SA 9PCYA 5LDUA 2AZUA 1ET8A 1QHQA 2CJ3A 3KW8A 1J9RA 3FYEB 3OMIB 5F7BA 1KCWA 2J55A 3SBRA 3SBQA 2UXVA 2OV0A 4A2EA 3NJFA 3EF4A 2I7OA 2ZONA 4HHWA 2YQBA 3ABGA 2XWZA 4BWWA 1PNCA 4KO7A 4YSPA 4AKOA 4KNSA 2VSMB 3UAAA 3WKQA 3NJIA 1OCOB 1V55B 1TKWA 1J5DA 4WTQA 2NRDA 3ASNB 1JXGA 3WNJA 4G72B 4BXSV 2BW5A 4KOCA 2XYBA 3QJSB 3WG7B 1PMYA 2DWTA 1WS7A 3IEAA 3NSYA 3L45A 5B1AB 3T6VA 3FQYA 2CUAA 1SHWA 3ASOB 1GY1A 1JVLA 1L9RA 2IDTA 5AFAA 2YAEA 3FU7A 3NJJA 1A3ZA 2GC4C 2GHZA 2DYSB 3PPSA 4GP5B 1XB6A 2QDVA 2X88A 2P80A 3NJLA 3T6ZA 1NPNA 2N0MA 3JT2A 1M56B 1R1CA 4G7RB 4YSCA 1PNDA 1SFDA 3ZIYA 1YLBB 2Q9OA 2XV2A 4KO5A 4QLWA 3ERXA 2W8CA 2IDFA 5PAZA 2XXFA 2PP7A 1KGYE 2XU9A 1ILUA 1NINA 4ENZA 3IBOA 1GSKA 2BZCA 1I53A 1NIEA 1SDDA 2EIMB 2OJ1A 2EIJB 7PAZA 3QJTB 4GY4A 1W6LA 3DTUB 2TSAA 1JZEA 1JXFA 1JOIA 2QPDB 3FPYA 4PCYA 4EF3A 1BXAA 2VW7A 3AG3B 5B7FA 3NSDA 2ZXWB 3FSVA 2HX9A 4G71B 2XX0A 3FU7B 2HRHA
chains in the Genus database with same CATH superfamily
4FJ6A 1KTKE 3U7YH 4DKEH 1DJXA 3PU7A 4Q89A 4WLCA 1ACYL 4OFPA 3ISRA 5JUEH 2VZSA 2AQNA 3BZEA 4JDVB 2VDLH 5KBMA 3B6SB 5MENE 1S5HB 3AB0B 1U3YA 2P52A 1EZVY 1AAJA 3MRPB 5A2IH 3OLGA 1ED3B 4KKCC 4Y5VA 8PAZA 3PFUA 2QMJA 1TTAA 4ZNEE 2WO4A 1KTJA 1JNLL 4MTMA 1R24A 4CMHB 5ADOH 4HVBA 1ITBB 1CYXA 2EO1A 2DS4A 2G0LA 1RUKH 2NXYC 2Z31A 4X7SL 1AGBA 7CGTA 1GC1L 1SVZA 1JSYA 4HIXH 1ILSA 3R1GH 4F7TB 1ZLUH 3PWPD 32C2A 4J23A 4AG4H 4UV7H 5CNHA 3N44B 3OR7B 4RFEB 3PLYA 3SY0A 5I6KA 2F53A 3K0YA 3AT0A 5F88A 2NY6D 4PJ6A 3M1BB 1JHKL 5A2BA 5CGTA 4MMYA 3HI5L 4ONHA 3FCSB 4NQED 3WNOA 3HE7B 3QJZA 2L7JA 4K94H 4GQRA 5A2JH 3GRWA 3TVMB 3D51A 3UZEA 4XX1G 3RI5F 1E65A 5FV1L 1WZLA 1WK0A 2OK0H 2D3VA 2V17H 5CFAA 4KKRA 3SCMD 1NGXA 4FE9A 2ZXGA 5FOJA 1D5MA 3UBHA 1G5AA 3QUZA 4MRCA 4E9VA 2K45A 1TOXA 5GHWL 1TVBA 2QDWA 2EDDA 3QBTB 1JGVH 4FNLH 4UANA 3B5TA 4Z0XA 4UIKL 5D1QB 1S7RB 3KHOA 3CV5A 2XRAH 5IOPB 1INEL 3CUPB 2C5DC 3PP4H 3SKNB 2D03H 3JWNG 4GBXC 3NIFF 3VXUB 3IKKA 4FMKA 1Q94A 5GIRA 4CVUA 3WS6C 2QPSA 3PJSA 2Z8VC 3JTSA 1N5YH 5IKCA 3QCVL 1NDGB 5GRJH 4F15C 3OF6A 2YWYA 3VD1A 3NPSC 5GS2H 3HTLX 4ANUA 1WYJA 3KPNB 3VI3E 1XXDC 3AU1B 3KDPB 4M1DH 4BK5A 4DZBA 3MRBB 5JW5B 5CO1A 4FCAA 3FN3A 3CK0L 3GMQA 1FC1A 4LBAA 4X2UA 1MWAA 3ARGB 3DBXB 4AQAB 1TQWA 5C0GA 5SWZE 4A7VA 1WISA 5FHBH 2P1YA 4GAGL 4JANA 2FBRA 5E7FA 3Q3GA 1BVNP 3ZE2B 2V4LA 3VWJA 3FU9A 3HE7D 4G11A 1FL3A 5DHYB 2WC7A 2VAAA 4AZ8B 5J1SC 2XTJC 4OZ4A 3DVNB 4Y88A 4AGOA 3U9UB 5EIQA 2X1WL 4IHOB 4U49A 3IDYC 3MLXH 3PWJB 4GW1B 1TLMA 3STZA 1MG3C 4H4NA 4H25B 4PWIA 1ML0A 4ZXBC 3QORA 4LSUL 4ADIA 4AJ0A 2FE0A 3VXME 2J1ZA 4JM2A 4NNXB 2WWKT 5D1QD 1FE8L 2KL6A 3LPWA 2YMTA 1JTPA 3EDFA 4K8RC 1ZLVK 3WKPA 3AZUA 5I8KL 2ADGB 3VTAA 3JZYA 3O45A 2XQBL 1JPTL 4HKXA 5D2NB 1QBLL 2XWJA 2H32H 4N90E 1IGIH 4AK2A 1KPRB 2GC7C 2M2DA 4ODWA 3FCTB 5LUMA 2AXFA 4X7TA 3VXUD 3PV7A 3QUXB 5D71L 1CD1B 2Q20A 4MNQE 5DHDA 2AQ2A 2ZUSA 1X9UA 3E6FA 2OXGA 2X9YA 1JZIA 3MV01 3DO3A 4RIRB 5KVFH 3L4VA 3H9SA 1RK0B 2E6JA 3SE6A 4OFYD 4NQDE 1IC0A 4NQVA 2H9GB 3U4EB 4D0DA 4C4BA 4ELKA 5F96H 2RJMA 4U4IA 4YIQB 4GI6A 4ABUA 4OM1L 3WDIA 1MREH 4WWOA 1LEKB 2JCCB 4XPHL 1BA9A 4IIQB 1RJLA 4XVSL 4DPAX 4U33A 4M5SA 4BXVA 5LWYL 3EDJA 3ARGD 3GS7A 3CHPA 3UADA 1WHPA 2VM3A 4K3DH 3PXHA 2J7LA 4Y7OC 2E9WA 3FN0H 3QI9A 4NX0A 5CAYB 4N68A 4PJGF 4AGQA 4QHLA 2G9HA 4JFPB 4WFHD 5B3JF 1ADQA 2OM5A 4ETYA 4QXTA 1H3XA 3AREB 4ZOAA 4KKLC 2KZWA 5E1AA 4UTBA 4XZUB 4LPWA 3MUY1 3OAUL 1MLCB 4HIPA 5SWSE 2WQXA 2BP0B 3FQ2A 4X4ZA 4HWBL 1G9NC 4D3CL 1T1WA 2OSXA 1UWXH 5C09D 5IQOA 3LDBC 4I5BA 2V9UA 1P5UA 2H2PC 2BK8A 1G7QB 3RJOA 3LNIA 1MFAL 3WAJA 4W9IC 2FLMA 4NRXB 4FTVD 2LU4A 4M1GL 3VGEA 2WLLA 2VMCA 2VLMD 2XPYA 1ZV5A 4OT1L 4ANWA 4HK0B 1F41A 4EUPB 3L3JA 4KNTA 4AI7A 5E03A 1LO0L 1RZ7H 4M1CC 1R17A 2DM3A 4MXQC 2R2BB 1D6EA 1I7RB 1MRFH 2RFXA 2RR3A 5E70A 3JT0A 4GW5A 5KEZA 3G5VA 5D1XA 3QUXD 3H9HB 3D2UD 3HJ0A 4HUKB 3QAZC 1OB0A 3T0EA 2G3ZA 5L4MA 2GEEA 4PJGB 4WKXA 3QPQC 4WV1B 4CJ0A 2W0LA 2CLRB 2DB8A 1N8ZA 2B20A 1A6TB 2HLAA 1BQHA 2F54E 5C0JB 4NKOB 4BINA 1DJSA 2HVJA 3JXAA 5IHZA 5DHVH 2IXQB 3H55A 5ITBL 1B9KA 1U3ZA 2NZIA 5FECB 4OD2B 5I16A 4L23A 3THMH 4OGYH 1VGKA 2WLIA 2R1WA 5C0IB 3P0YL 4X6DB 3VB8A 4PG9A 3T3PE 1UH3A 3IPFA 2OZ4A 2IQ9L 1N9PA 5HHOE 4L8BA 3ARED 4YXKH 3MODL 3QIWA 4K2UH 4YC2C 3JV5A 3VI4F 2AJVH 2NZ9D 3EFFA 3JVFC 1XH2A 4GMTL 4KMQA 5I15L 1D9KC 1FZKB 4N8UA 2AS5M 5IM7B 2FL5A 2YK1H 2UZPA 1Z3RA 5E9NA 5C0AB 4CVXA 2JIXA 3HG1A 5GGRA 5BZXA 1GOHA 1NFDF 2AI0H 1S46A 2W0FB 4Q9RH 4XN1A 5DJ2B 4Y5XA 4EN3D 4FJZA 1MFEH 1AQDB 3U2SA 3DTXA 1BAWA 3IS1X 2ZCHL 2Z64C 3RWDB 3HPJA 1CLZL 2WGNB 1IC5H 4MD0A 3CVHH 1DSYA 2FUQA 2PTTB 5E8PB 3ESPA 3AQZA 5FGSA 1BQKA 4YSSA 3KBHE 2OPCA 3D05A 5L2JA 3SPVA 3K6OA 4YPGB 2LW3A 2EC9U 1I4FB 5CLTA 1FO0A 4KZCA 5AVYB 5J1AA 4TOYH 4X42A 5JPMA 3B43A 3GKWL 4LPVA 3QYNA 3BPOB 5FLVA 3IMTA 5E95B 3R8BB 3VI4B 4ZUWA 3IDGB 1AO7A 4RZCA 5EUOF 1I8UA 4KJYB 1NFIA 3SKJL 3NZ8B 3QJOA 4KH2A 3M07A 2Q87A 3P73B 4QRPB 2HTLD 1IEAB 2V0AA 5CUSL 2NOYA 4DN3H 1JNHB 1R19A 4NQQA 1KEGL 2GJ6E 5LBSH 4KAQL 4NQSA 1J5CA 1OK8A 5KANG 4XZ4A 4GQ9H 4S1SL 2IPKA 3K80A 5EPMA 3NUKA 2YD4A 2QSCH 1MQKH 3FT9A 1QLRB 4G70B 4C57C 3ARPA 5LCVH 4DP4X 1LNUA 3IE4A 3CHXA 2W88A 1A14H 1Q9WB 1WWAX 2WTRB 1UYWL 3HUJE 4GRLC 4LLMA 4BSVA 1B4LA 4X5WA 3H42L 4YBLB 2I25N 4GT0A 1YC7A 4JVWA 2ADJA 2V3EA 3LSOB 2AXJA 4UB0H 4NJ9H 3A0OA 4YHML 3VGBA 1OQXA 2ISDA 3RX7A 2BIHA 4N2IA 3WIHA 5I1JL 4MHHG 3MRNB 1KBGH 1QR4A 2OTUA 1N0LA 1OM3L 3M1CA 1GGCH 5MERB 2O5ZL 1SMOA 1Z5LA 4XT1C 2OV0A 3NJFA 2I7OA 5HI5D 1TR7A 2CDEB 5CILH 5ID0B 4MNHA 2VRAA 4XBPB 5FM5O 2GY7B 3CSBA 4PLKC 4IKIA 3TN0B 2CO7A 3T4AB 3WFBL 4NIKB 1A6UH 4QRPD 1ES0A 3QO1B 1V55B 1R3JB 2CKNA 2APXA 5F7MC 5JHDE 2Y4SA 3ASWA 2IDCA 3WU1A 3KGTA 3SE9L 1WSST 3PWVA 3K2KA 4FEMA 1L0QA 5GJSL 4BZ1A 4TUUA 2NT1A 3P40A 4KK6D 4WUUA 2F1BA 4PJ7A 4XC3H 4KK5C 3VD2A 2QR0B 2R4RH 5T5FL 3EYQC 3B7RL 2NUTA 2VDNL 2Q6WB 1JE6A 4WVRA 5CJQL 5T1MA 1JV5B 1T5WB 2B4CL 3EF7A 4JFEA 4JMNA 4ZFOA 4HKJA 3EAKA 4NBZB 1FYTE 2DYSB 4MMXA 3GRWH 1EANA 3NIGE 2J1XA 5JW4M 4HK3J 4JQIA 2ZE0A 3EYUH 3LEVL 3U0TA 4P4KD 2CIIA 2XACC 4FZEL 5I23A 3UTZA 1OB1B 4Q9CA 3OHXB 4O00A 5D7KE 2FAUA 2WVVB 1IM3B 3N0AA 4XBEH 3ZR6A 1GSKA 1U3HB 3L3DA 1P4BL 3N1GC 2VABB 3ARDA 3DTUB 2LQRA 2XBDA 3AWFA 5IMKA 1JGDB 4JO8A 2X4OB 4F8QA 3FPYA 4EQ2A 4PSPA 3QP3A 1A02N 4B97A 4OZGF 3MO1B 2VW7A 2NW2B 1BVNT 3OZ9L 1CF8H 1OAYH 2VKXA 3WFDH 1CR9L 1RXLA 4TNWF 2W60B 5DI8A 5J6GA 2OL3L 4RGNC 2Y5TB 4FABH 2EJ1A 4YGVA 2XETA 4F7PB 3BVDB 1CD8A 4Y1AE 3IGLA 1ZLVH 1D2PA 4ZAKB 1KV7A 3BUIA 5FW6A 4GAJL 3HLKA 4HWNA 1ZLWK 4P4RB 1NLDL 1BLIA 2E27H 1ZJBA 4JFFB 4GRMA 1UHVA 3CH1B 4HIHA 1QKZH 1T5XB 1MWAH 2GFBB 5TK4A 4R4FL 3KVDD 2BNUA 3IGFA 4U7SA 5JTWA 3Q6GL 4PHXA 5CZXD 4I7ZC 1FFRA 2W9DL 1U4EA 3SQBB 1WF5A 2AZAA 4NO2A 4GW4A 3LQAC 3SDCC 1GYWA 1VESA 1GR7A 2DY2A 3CH8A 3BEWA 2H2SD 1PKQB 3EJJX 5LG1A 4GKZA 4IGBB 2EDOA 4GUPB 4P5MA 4P3CH 2WIIB 4PAZA 2DMGA 4YK4C 3DX3A 1A1NA 2YS4A 1LP9E 4WK4B 4PR5B 5EG6C 1C7TA 2ZXBA 1HI6B 1IM3D 3L13A 4M00A 4V1DE 1ZA6A 3QE5A 1AQKH 3UZQB 3OKYA 5DEFA 3ARBB 2OW6A 4BQ9A 2GITB 1CTOA 1G84A 3GMPA 1QVOB 4QWWC 4ESKA 1YECL 3A6CL 5ETUB 5CLYA 2EKSB 2W94A 3KLQA 3MZTA 3EHBC 2P3YA 1NKOA 1SXBA 3JV0A 3SE4C 1MJ8L 3UAFA 1IE5A 1NQBA 3TCLA 4KXAA 4LVHB 5JIKA 4GG8B 4UM9A 3CMGA 3BVNB 5L4IA 4JZJA 3UYPB 2DBLH 4LVEA 5B8CC 1QWNA 3EG9A 3G04B 3AACA 3J07A 5DJDB 3DBSA 1BFSA 3SKOB 4KHXL 4AW7A 1CFTA 1BW8A 1WPCA 3PWUB 1G4MA 4M8RA 3SD5A 3J2PA 5MEPA 1FGNH 3JWDC 2O61B 4JHBA 4J3OH 1CZ8L 5JZ7C 3Q9QA 5B38G 2YD8A 3BDXA 1ZPUA 3PNWA 4HKZB 2VDOH 4HFUH 3E6HB 5GGVY 3VFUB 1GOFA 3D1MC 4O4YL 4ZZKA 4ZUVB 1BMWA 1GIGL 2D3NA 2NQDA 1YEIL 4PJIE 1ADQH 4GXUM 1G7LB 4JPVL 5CCKL 1USZA 4XCYB 2Q7YB 4NP9A 2D7TH 4F8TA 2VUKA 2R56H 4UTBH 4M8QB 43CAA 4NXKA 5EN3A 3B2UC 1ZT4B 2A6DA 4TVPD 3QUML 2RACA 2VZ1A 4W9ZA 3S48A 3OKDB 3MNZB 4OCSH 4OCWL 1FGVH 1G1CA 1M1XB 3FJTA 2V8MA 4YSDA 2F9BT 4M48L 5IQ7H 3ARBD 4B53A 3Q5TA 1LXMA 4XVUD 1JZHA 5KVDH 1FL6A 1IEBB 3ZQ9A 5B21A 3ZKMC 4J8RB 1MFBH 4BCYA 1DBBL 1S7QA 2B8OT 2BZ7A 2ZOLA 4AXWB 5JIQA 1ESOA 3DUHA 1FVEA 4AM0B 3BPLB 3MN8A 5EFIA 1C5BH 4PMEA 3FRUA 2CMRH 5DURB 4QGYA 1BX2A 1AFVH 3H3BC 1DQJB 3TH2T 3BAJA 1KY6A 4LHUB 3WUWB 4HXBH 4L3EB 3S5ZA 1D7DA 3W3BA 3VQMA 4BM7A 5EBMA 2WNXA 3BGAA 1BD2B 4Y4HC 4XB8A 3UZVB 5AW2B 2VE6B 3UERA 1WLHA 3QJHA 1EHNA 4HP5A 2AEPL 5C6WH 4R4BB 2X6VA 3NK3A 2OZ4H 4ZUSA 4NZDA 1EZSA 5BV7H 3HB3B 4WJ5B 3MUGB 3W1ZA 1GS6X 4AT6B 1NIBA 2Q7AA 3CIAA 1P4IL 1FLTX 1PEWA 4RX4A 1PVHA 2BJMH 2EUWA 3DNKA 5AOZA 3D18A 4E42B 3MJ6A 4HJGA 2YRZA 1BM7A 2MHAA 4B60A 4PGJA 4S1RL 5FKPA 4KGLA 1U93A 1XT5A 2AABH 2FX7H 4UYQA 3T65B 1SOXA 1Z7JA 3N40F 3DURA 2ICEA 1EXGA 1S2EA 2R69A 1DQDH 3MMEB 3C5ZA 5C08E 5EZIH 3W9EA 4Y9FA 4JDEA 3WS3A 1H8SA 2VISA 4ONFH 4DQOH 4XOBA 4QTIL 5EA0L 4MB4A 2VXUH 2VMFA 3PHOA 2OSYA 3FTYA 1LTXA 3MLSL 1VZGA 3JUZA 3O6MH 4TRPH 5AKRA 2E75C 4N1HB 5H94B 2QGDA 1F42A 2OZNA 1OTUD 1S7XA 3QDJD 3QNXB 3MX0B 4L37A 3V0FA 5JQ6H 2KZ1B 1D5XB 3PUUA 5DURD 1B2WH 2WO3B 2XG4A 1KTCA 1FO0H 4KWUA 3DXAE 5E2UL 2GUOA 1GGBL 4ZG1A 4IOSA 5F1OB 4HQQH 4RSVA 1B3JA 4LHUD 2AJXL 1KTLB 2BC4B 1R33A 2SODB 1DDHA 2J8OA 4U0RC 5KW9L 4XNBA 1BAFL 4KGJA 4E36A 3QIBC 1XMEB 3TF7C 2IPTL 1BD2D 3L5WB 1M05A 4Y5YC 5IMMA 4I3SL 3IETA 4B9ZA 1Q9OA 2A9DA 2YAHA 3FQWA 3PDOB 2PWEA 5CBEA 4AV5A 2FECL 2LVEA 4N86A 4PJFE 4QCIB 5IW6A 4OD1H 1Y7VA 1UUSA 2P26A 4ZS6C 1ZOXA 2A6JB 3B9KA 2BCKA 4M4RB 3IJYB 4XN2A 4J8QA 2F5AH 4N2LA 3SDYL 3ZIMA 2VDMB 1YHPA 3C6SB 4NQEA 1MCWM 1KELH 1LQSR 3FOMB 3VI3F 3IRZA 3CDCA 4B5ZA 2WSKA 5EBLB 3MUUA 3QFJE 5ANHA 3RL2B 1V05A 5CD3A 1S5IL 3UP6A 1BIIB 1NGZB 1HAUA 3V9EA 3VFGH 1M7IA 1FSKB 2DTMH 4ZUTB 4ZW5A 1FNEB 1DUZA 4Z78A 4HUVA 4HZAA 1WQVT 1IKOP 2FD6L 4PJ9C 1MHHA 4I8DA 4MBOA 3BX7C 4U1SA 4NAJA 3WIHH 1AY1L 4JRXD 3H4FA 2R8SH 4Y4KA 1QSEA 3GMRA 2GYSA 2X5PA 4F57L 3EGSB 3LKOB 3BYYA 4PB9L 1R3HB 1TQCC 2BRRH 1BEYH 1ZT7A 4X6FB 3CG8A 3QRBA 4RFOL 3K2IA 4NCC1 2WCPA 3TT3H 4LVOC 5L2KE 3WKMH 2FEJA 1NWOA 4FQQA 5JHAA 2AJZB 2VXVH 2LHAA 1FV1A 5M7QA 1BFOA 3EFOA 2OYMA 5EO1B 1PG7H 2PXYB 3O11A 1AIFB 1NCOA 2WVUA 4HT1L 4DP9X 2B1OA 2OYKA 1B4JH 1NDMB 3ZT6A 1XCWA 4AL8H 3NFPB 3BWZA 4OLXH 2YPLB 3AW5A 4XMXA 4F2ME 1TITA 2CNZA 4Z5RB 4YPJA 4BZ1H 1GKOA 2HT3D 3T8VA 1LD9B 6CGTA 5TD4A 5JXEA 2H26A 4WI8A 1CGWA 3WTVA 5SWZB 2VDQH 3KYKL 4JJ5A 4AC4A 5MP6H 3L3KA 2L04A 4O02A 2XQ0A 5CP3A 5FYJH 3T4YB 2O6DA 4W4NA 1T2QH 1XMWA 4GKNB 5H2BB 5F89B 3R4DA 4MJHA 5J12B 1JVKA 4LAQH 2NCMA 2IIJA 3Q2VA 3CFBA 4UBDC 3W11D 5F6IC 2A83B 1WICA 1KCVL 1XAUA 2ALAA 4HMEA 3VXTB 4DGUA 1VPOH 5DMGC 4KRPB 4JQIH 1ZLWH 1EQWA 1E0OB 4IRZA 4M7KH 3UMNA 2UVEA 1OZUA 4LSQH 3VXMB 3EOBA 1XGZA 3II2A 3B4NA 3T3ME 2R1XA 2JK5B 1WWWX 1SF3A 4UMGA 5I0XA 1QX1A 1RCYA 1JZ6A 5IUSA 4BQ6A 4RA3A 2Z7ZA 3L9RB 2ZKYA 4JE0A 4GFXA 3ZSTA 3CFEA 2ITFA 4DO5A 5D4HA 4GP4B 3S5LB 3WJLC 4U6VH 5D70L 1F45A 5JDSB 5JQHC 5KG9B 4DP8X 4D8OA 1SYVB 1CO1A 3GF8A 3GXPA 2NDGA 3KVPA 3C60B 3DO4A 3GHBH 4KVCL 1F00I 3MYJB 2ZSWB 3NFNB 5EZJA 2AV7B 1C5DA 3HCVB 2CCLA 1A1MB 2PXYD 4NQDB 1V7NH 2EVFA 4XI5C 2HH0H 2YFNA 3EJTA 3HMXA 2CNYA 3BC9A 3CGTA 5LNGA 1IGCH 2ADIB 1KCWA 2NR6D 2YPLD 2DLFL 4LMQI 1YJDL 4LSPL 3VXOA 1T1XA 2CBOA 1U8IB 3JWNC 4YXHH 3F62A 4FFVC 3OXRB 2FIRT 1WG3A 1FZMA 3LB6D 3CX5K 4LCYB 5GGQL 3K8KA 3RNKB 1J8HD 2YRPA 3DIFB 3U4AA 1BBDL 1BDYA 3GBNL 5FOBA 5F71A 1X3DA 1FAIL 3EO9H 1SLUA 4NS0A 1JXGA 3APMA 4L0ZA 1W9XA 4J3OG 1LDPH 1TJMA 3QWOA 4M6AA 3CVIH 3RWHB 1P6WA 3RWCA 3VFMA 1XIWC 4F9PC 4KRPD 3RHWF 5SWSB 3NSYA 2VO5A 2O6FA 3L45A 4TNEA 2BVOA 5LNEA 3WIIH 2ATKA 1U42A 1H5BB 3CN3A 3IRPX 3VXMD 3GHEH 3O8XA 4OZFA 4JKPH 1TTBA 3MSPA 5LGHL 1DE4A 3JVGA 4TQ8A 3T3PF 3F12A 2PTVA 4JO4L 5L6YL 2X88A 5I75B 2ICWB 2P80A 4R83A 4ODVL 4N90D 5DSCB 3CXFA 4P3DB 2DQTH 2VH5L 2HKHH 4N87A 2EAEA 5DQJA 3G5ZA 4FYRA 2R4SL 3RGVC 2Q1EA 4WTXA 2ZXCA 1WD9A 4MMZB 2ZF8A 3PF2A 1OO2A 1PZSA 1CDCA 1E27B 1TG8A 2V7NA 2N3JA 1GJWA 3K6NA 3R8QA 1JI1A 2IH1A 5E00A 1OANA 2V7HA 2CA4A 4WENB 4XHQA 1EMTH 3D0LA 1RY7B 3WFCH 3F5WB 3BUPA 4KJQC 3PQYA 4LLUA 4M93C 5GZNC 3LS5L 1OGAA 1VERA 1YEFL 4X80H 3IDJB 5EC1A 4MB1A 3FU7B 1JJUA 3WNPA 1WH0A 2AQPA 2OMXB 5T1KA 1BQHG 1BECA 4UQ3B 4RNRB 5HHOB 4JPQA 3V6FB 1YA5A 1CL7H 3EO0B 3LOWA 5B1JA 2H5UA 1P9MA 2AJSL 2WINB 4FQ1L 4HJTA 2NXYB 4LSSL 3NEOA 1SLWA 4N2HA 4TUKL 1AQMA 3B2PA 4TLKA 4LRNH 4XNUL 3X12B 3EXLA 2CHXA 4QF1A 5E6SB 2JKRM 3AG2B 2UX6A 5TDPB 5IBLD 1Z0NA 1FIEA 4NNYB 4OCLC 1WAPA 1DBKH 3MLYH 3KLLA 2J3SA 1JF5A 5EC2B 5ECGA 5DGRA 1RZKL 2VRQA 4NKMA 5E8EA 5FYKE 2MCMA 4R7VA 1AZNA 2EVIA 3ELAT 3HI1A 2W91A 5K9JL 2Z1KA 2YUVA 4X5XB 1UXWA 5FB8A 4O2EB 5IB1B 3UBXA 1G7IB 3A5VA 4D0CA 3WOVA 5ADPH 1SQ2N 5F1IA 1J0YA 3V6ZA 5C2UB 3AFLA 3X14A 3IKCB 1EUUA 3QHFH 4OVUA 3UYOD 3HS8A 1YG9A 4JVUA 3V9FA 4BFGA 5A2KH 1EO5A 4S1DD 3WNLA 1CGTA 1F3DH 2LT9A 1RPKA 4JO5A 4AMKL 5GSVB 4CKQA 1QMUA 2AJUH 2XZCL 3D52A 1AZVA 3FFOA 5DWUH 5ANME 2VR7A 1R0AH 3DDFA 5E2WH 4DP6X 4H0LC 2YKLL 3ULUH 4H1LA 3EUDA 3IDNA 2GJ6B 5IZ7A 4FTDA 4GBXB 4NO0A 4JGJA 2X4QB 3QUHA 1XFPA 3NQIA 5F3BA 1PDKB 2WNKA 4NXSA 1O7VA 4KKCD 5HHOD 1MFDL 3U30C 1I8MB 1QNIA 3D0VA 2PYFA 2LU5A 4WNJA 2PCPA 4LCIL 3VGGA 4DAGL 4F15B 4TTGA 5J1TC 4F7CB 2JNZA 2BNQA 2NXYD 3C5JA 3H9ZA 2HRPH 1JWUB 2R0KH 2XWXA 3HUJB 1CCZA 1QLFB 4PJEA 1JD7A 35C8L 1C12B 1RJYB 2VQUA 4WRLA 3TBSB 3GNMH 3L1GA 2R69H 4OBRA 2OX5A 3UCQA 4IIZA 4XNXH 4Z77B 2EVJA 2DKUA 3N9GH 4P3WA 5AVQB 4E41D 5AVUB 1S78C 1E3FA 1U2CA 1BQSA 1VGEL 2O1AA 5MI0C 1ZHBB 4GO9A 1OCCB 2E59A 5KOVC 2XTJB 2CLZA 2LTQC 3ZHFA 2BVUA 3FTWA 3HC4L 3NIGF 3IDYB 4QHUA 4Z8FH 2EIZA 3LZOA 2V9RA 3RDJA 1U6AL 2OSWA 4M6ML 4ZXBB 3V0IA 3VRLE 2CBPA 4X7DC 5CEXA 4K5OA 4GSXA 4FX5A 5DJYA 1QFWH 1F6LL 3S88L 1YN7A 1I1CA 3WEAA 5JHDB 4MWFB 1OM3H 5D1ZI 5JO5A 2EVGA 3MV8A 1CICC 4GBXD 1UCBH 1Y1UA 4XX1E 4AUYA 4QAMB 3BYTA 3V0HA 1M7XA 3CSYA 3MCG1 3W39A 2BSDA 2Y1ZA 2QVIA 3M7OA 4QY8A 1AG0A 2A7BA 4HUMB 5F7DA 1FZJA 4RA0C 2NPLX 5D7IB 1F5WA 1S7SB 2HKFL 3C6LC 3BZFA 1A4JA 1FJ1A 4ZT1A 3IMBA 5F9JB 3RKDC 4LLVA 1AJ7L 2YBGA 4RESB 1DQTA 4M7ZC 5FS5A 5JA8B 3BDBA 3ILDA 5T3ZD 1HCYA 5SV4A 2BP5M 4OV5B 1X5IA 3JWNE 1BVKB 2VLJE 3OG4B 1NBCA 2EYTA 1PY9A 4XVTH 2XN9E 1KGWA 5AOLA 4HF5L 1I3GL 2ENQA 1OF2B 4XP1L 4XXCC 2CLVA 4HH9B 3IF1B 4LOUC 5EU5A 4UQDA 1RK1B 3STLB 3N42F 2NY7L 1ZANH 2CK0H 1L7TH 4G5AA 4APQA 5LXGH 4PVMA 4WU5B 3KYOA 2WZAA 4GLRH 2WAHA 1OWRM 3O3BB 4CU7A 2W5PA 2XTJD 4ZYKB 3FQNB 1EX0A 2VXQA 1VEOA 5EU3B 3V0WL 1CI5A 1RZ8B 4P59H 3L5IA 1EEZA 3CFKB 4ZXBD 4KBPA 5EF0A 4DUVA 3LDBB 5DK0A 3S8GB 3X1BA 5HI3D 1FBIH 4H8WL 1HC1A 4YBHA 1LP9F 1WIUA 3ZHKA 3SE8H 3ENEA 3K71A 2CGRL 2KUTA 1X4YA 3BSZA 3D9AL 3BXNA 1S9YA 4K94C 5JHDD 1RUPH 2WXRA 4AIEA 1AGCB 4AJWA 1MCPH 2DWEB 4NQXA 3EUUA 3A23A 4JCWA 4L5FL 5ICZB 4ZPTA 2GK2A 3FO1A 1CE1H 1HTYA 3QAZB 4EE2A 1RULL 3HRZA 4X9FA 2DLIA 2Y6TE 3QT2A 4X5RA 1J10A 3OXSA 4HAGA 3DSNA 1H15B 1QSZA 4ZTOH 4O02H 5CP3H 3SQOL 5JOPE 1ZVHA 2AEQL 2L7UA 3LHAA 3T0BA 3LPPA 5KJ7E 1KYUA 1WA2X 3MR9B 4BUQA 1T22A 2WLHA 5ACZA 1AOZA 1MPAH 1IGFH 1B6DA 3PWLA 3F04A 3UTTA 4LCCC 2FBJH 3L17A 2EE3A 1D6VH 3T1FB 4XMUA 3TASA 3LNEA 3WEXA 1U33A 1HHJA 4UT7L 1NFKA 1TYJA 1QSFA 5I0WA 4JHUA 5I1DA 1IEHA 3HN5A 4IRZH 3QULB 4YHIB 4HPYH 1E42A 1IAOB 3SDXA 2YRBA 5IQ9B 4WU7B 3SGDH 4M5ZH 4V1DB 1OHQA 1KG0B 4P06A 2ZYSA 4PJIF 3LHPH 4KKLD 4YC2B 3VFOB 4ACTA 1QPPA 5HYEA 1YEKH 4U1MB 3KJ4C 3FSOA 4JQVA 3L4UA 3O6KL 1D9KB 2CAKA 5BQ7A 2C7UB 2BHZA 3VU2A 5KTEL 2P8MB 2CQVA 2H8PA 2AERT 3OZLA 1M57B 5I1IL 1FAKT 4PJ8C 5FWQA 3Q05A 3WJJA 2H2PD 1UKTA 1I8KB 4LRIA 2FYYB 3ETBJ 4JFOB 4G3YL 4JHAL 1MCJA 1P6AB 4M62L 4QI3A 1MHCA 5I74C 5G5DB 5HYJB 2DM7A 1FNGB 4M1CD 3HMXH 3MJ8B 4MXQD 5FGBA 1HSAA 4ZTPH 3P9LB 2XC8A 3CLEH 3GUTA 1UVQA 2J2ZA 2WKGA 3RFZC 2G2RB 4DN4H 1SLVA 1JZ5A 2XDHA 4YHPA 4KZEH 1ID5I 3L48A 2WSDA 1L9QA 1IL1A 2AK4B 1FCGA 3QPQD 3F7YA 2XN2A 3DHJA 3MLUL 1N2RB 2OR9L 3PNRB 3QUGA 1TMCB 3L3OC 4UM8B 2JB5L 1MZYA 5EORH 4LNRA 2JJUA 1HNGA 3MRQB 4YX2H 1JDDA 3ZJAA 2Y7OA 4IDLA 2GBAA 5DR5L 1FP5A 2VN4A 1XDTT 4PJBA 4GQPH 3T08A 3GK8H 4BSJA 1KSRA 2G5RA 2J6EA 5F7HA 5IQMA 4IM8A 1FC2D 3WGUB 2X87A 1ZVNA 4OSUL 1XXFC 5DCCA 2KZBA 3FXIC 2TRHA 3MRLA 5ALCH 2FT7A 4V1DD 5I1GL 1CPUA 4OZFH 4XCNB 4E9SA 2G5BB 3SEPA 5SV3A 1EVTC 3IB4A 4CBZA 5I1AA 4H88H 1JXDA 4AE0A 3EBGA 1GRWA 2FWUA 3KE0A 3UH8A 4YDIH 1D9KD 5IEKA 3WELA 5DRXB 4GRLB 4TS6A 5TDNB 1JK9B 3MOBH 1FCCA 3KWWA 4NC0B 2HFFA 4NNPL 4BH7A 3N43F 2C8NA 1JFHA 2ZWLT 4N8PA 1J11A 2H6PB 4A7GF 3MRIB 4K3JH 2F7OA 2Z93A 5B22A 4KZDH 4R7NA 5FDYA 2YC1B 5HYJD 3V79C 3HC2A 3S36H 4EIZC 3Q8CA 1AVAA 5E2TL 3CDGB 1S7WB 4N8VB 4ELMA 3R7QA 4FQIL 3U9PL 2CKBA 1XQ4A 2Q10A 2FJFB 2KBGA 3O4LA 2MRYA 2AK4D 3C5XA 3MLWH 3UG3A 4LASH 4G80A 1F4WH 4HD5A 1JMXA 3SJVB 4OGXL 5DJZA 1YYLH 1AMYA 3RZCB 1I31A 1GZHA 4FHBD 1IILE 3KW8A 4LOFA 4XRCB 3O3AA 2PO6C 3TYFB 4WHDA 3GTTA 4L9LC 5CEZH 3ARWA 5ESAB 3PABB 1Z66A 2GY5A 4JB9H 3WDHA 3LKNA 3FK3A 1Z1WA 5B39A 1YDPA 3REWA 3N43B 1N26A 1OALA 4KHTL 2ZQKA 5ESQB 2ESVA 2FUTA 3IVKB 3N1QC 2ENPA 4YXLH 5C08B 1P7HL 3CU7A 2MQGA 4QOKE 4PJFF 2NRDA 3VD5A 3UYRH 3QS2A 4MKMA 5I9QC 1KZQA 4FI7A 3J8F7 5DU7A 1GC1C 3OB0K 1M2VB 4Z7VB 5FUOH 1L5GB 5AAPA 2OMYB 4ZFFB 4NI3A 3I2CH 1F6AA 4GRLD 5B1AB 1CFQA 4XMWA 3TIEB 5F1KC 4N2KA 5I8CA 4POUB 1KULA 1JHLL 1DJZA 1M7DB 3KLSA 4GRWE 5IHUH 4AIZA 4OCXH 1JVLA 4J6RH 1QUNA 1G7JA 4L8SA 4U1HA 2N1TE 4ETQB 1CFNA 4LCWE 6FABH 3D4CA 4JN1H 5I2IB 3PHQA 1QLEH 3LKQA 3N41F 5ID1B 3VD4A 3VFRB 2QDVA 2LAGB 1DJGA 3IWVA 1OSEA 3UDWC 2RD0A 3M6DA 4KDTC 4LDLB 4FLHA 3EJQA 4MVBC 4TUJB 3W0WB 2DOCA 5BS0E 3GSWB 2EUXA 4CADB 1YLBB 2XV2A 2ZX6A 4H1LH 4YDVA 1KXQA 4XPFL 1B0RA 1VB9A 2BSBA 2H3NB 2D7PA 3CTTA 2ZAIA 1NMAH 2OI9C 3MLZL 4NGHH 4XBMA 3D06A 4IJ3C 2DQIH 3SJVD 3ES6A 1H3VA 1PFCA 5DD6B 1M71B 1NKRA 3DPBA 1NCBH 1HL8A 4PLKD 1OGTB 3RVUC 5JIPA 3I75B 3BPNC 4ZO9A 1JZEA 1H6EA 2BXYA 1OD7A 4LT7A 3QZNA 1KFAL 4XN8A 4KI5F 1I7UB 2OMBA 2W92A 1LO3L 3BPCB 5AYUH 3UTPD 2JLLA 4ZZFA 1XV8A 3FMGL 3GXFA 5AVZB 4TVPL 4NZFA 4KK5D 4HBCH 1IM9A 1AP2A 3EYQD 2X38A 4KPHH 3N41B 2CIKB 5C2BH 2KKQA 5C6TL 3LZRA 4KVNH 3WFHB 2CO4A 1CYWA 2GJZA 4K5MA 1CUOA 2LVCA 4G9DB 5AZUA 2K8MA 1CXEA 4WW2C 1RZFH 3RY5A 1HK6A 1TU2A 2OJEB 4PRDA 1I7TB 3SDCB 4XX5A 4EN2A 4PRAA 4F9LC 4W6YB 1U8HA 1SDDB 2V2WA 3QFDB 4FFZA 2DWYA 4YK4B 2WZPA 5CCGE 5L2KB 4URKA 4M9OA 3WTYA 3FQXA 3BH8B 3V8CA 2MQCA 5INDA 4HXAL 4X9GA 3CHQA 5C0EB 1JPFB 2ZXQA 1AG6A 4GJTB 3T3MF 3S96B 3W0WD 4DETA 3ZQXA 2Z91A 3H4HA 3HFMH 3MRJB 1HH6A 5I0DA 7FABH 2FIKA 1JK8A 4I2XA 2C1OA 4F2MB 2B3RA 3EHBB 1T7VA 4LXFA 5BJTA 1KIPA 1NM9A 1SXCA 3AQDA 1XCQA 3FB7A 3KL5A 4QRRE 3UTQB 3QNZA 4EI5C 9CGTA 1WVZA 3UJTH 4RGND 3TV8A 4A6YA 1HZHH 3OKEB 4YSOA 3HNTH 5B8CB 1JZ7A 4XPTL 2K0RA 3KPTA 1DFBH 4IU2A 3H2WA 2QT6A 1WFMA 1R5WA 2NQCA 3MCYA 4G42A 1EHKB 2HJKB 2ZXDA 3OL2A 4I48A 4X98A 4ZQKB 2NY1C 1V7MH 1CQYA 4PTUA 2UWEB 4G6JH 2NCEA 1HE7A 4K15A 4NKIL 1YMHB 4M5YH 2J88H 3IMUA 4J6IA 2CR3A 4P0DA 1T03H 4PJCE 2FWSA 4LSDA 2Z31C 4QO1A 4ZOCA 3VXNA 3MRGB 5D8JH 2CU9A 3SDCD 2VN6A 1ZHLA 3I3EA 2VXQH 1GPOH 4KKPA 3VMNA 4GKLA 1PZ2A 1QRNA 5D2LB 5KVFE 1NUGA 5L2KD 5IVXE 3RNQB 4U1LB 1G7HB 1AD9B 2OLDA 1E8YA 4LOVA 4ODXA 2BY1A 4W9JC 1YO4A 2WTPA 3BE1L 4CC1A 2B2XH 3QQ3B 4JRYB 2BMKA 2YD6A 5CJXA 4GUCA 2YBRB 1EHXA 1AD0A 5EEVA 2EXTA 3BSZH 4P5KA 3FTXA 3K6DA 1UM4H 4QWWD 1RPQA 4JLRA 5FYLE 3UZEC 5GGVH 4HEPA 1ETB1 1NCJA 1KB5B 3L5JA 4QXGL 4LP5A 1QZNA 3O2WH 3EHBD 4S1QL 5DK3A 1D5ZB 1I1AA 3DO7A 5D7LA 3M8OL 3R4RA 5F1NA 4F3FB 2V37A 1OAQL 2QHRH 5F0PB 4YHLH 1WUZA 1INEH 1AKJA 4QPEA 2KERA 2IH3B 1A66A 1DVFA 1XHHA 5EZOL 3IFPA 3FO9A 4ATTA 3BZ4B 4PJ5B 3FQUA 1JG9A 1PLAA 4QT5A 2CBQA 1RH8A 1RHHB 5HGBA 4A68A 4HALA 1Z0MA 3SHSA 5IFAH 1R4XA 1XGYL 2BX5A 2DQ6A 3ALXA 1Y1DA 3ZTJH 5JZ7D 4PJXE 2QQLH 3SPHA 5KS9E 3U0PA 4OAWA 4Y4HB 1RK7A 5DUPH 5B4MC 7TAAA 1L6ZA 3Q43A 4OKDA 1P53A 1AXTH 5IIEB 4ZW6A 1P1ZA 2PPEA 3L3HA 4HWEL 5FO9B 3MJ9L 2W9EL 4GIOA 4H44C 3AJ7A 4WFED 3V6OA 1KDIA 1RUMH 3MI6A 4PY8J 4Y0GA 4BK5C 1G9MH 4L8CA 1LDSA 1WZ1L 5JW4R 2MPAH 5K93A 4KJPC 3F7PC 2EDHA 3OBAA 1MIML 3A22A 1G0XA 3CBJB 2OXHB 1T4WA 1ZXKA 2BSRA 1LK3L 1NCWL 4PS4L 4GINA 4QRTB 2X9ZA 3ZKSD 5F21B 3EYVB 1CDUA 5HHQB 3MGAA 4YL4A 4NI6A 2XWBA 4CC4A 4OZFG 4RDQF 2R7EB 2ZTBA 3NZSA 5KN5B 1N70A 1WC7B 4JRYD 3VWJC 1XH1A 4S11A 3LNDA 3FRPA 2HUHA 2ARJA 5E99H 5HGAA 3VXPA 2ID5A 2YHGA 5D5MA 5FUZL 5J0BA 1OCWL 3QNYB 2X44D 1MCBA 3CSPA 4MD5A 2YD3A 5DZLA 3ZKMD 1HZLA 4K9EH 4JFSA 5DHMC 4E68A 4FXKA 5BUGA 3SZKC 3EDEA 4OF5A 4WO4A 1FFNA 4PJHA 5LB1A 4XCFL 1S9XB 1KTDB 5FF6B 3QORC 4U7KA 3GB7B 4X9YA 4P2CG 3NGBC 4JM2C 4RQQB 1MG2C 2V5SA 3MC0A 1WEJH 3EH4B 4PJ5D 5ALBL 3BAEL 5EOTB 1OCZB 5ACMA 2WANA 3HPLB 5EBWB 3QDMA 2APBA 2HAZA 2APWA 2GK0B 4K7PY 4U0RB 3I9GL 4XC1L 2QFPA 1A2YA 2VDML 3X13B 2K70A 3QIBB 1IFRA 5IW3A 1E7UA 3QPXL 5HHPA 4L2LA 4Y5YB 1J1OH 1FDLL 2J6EH 3DX9A 4XPGH 4Y4HD 3U9WA 4XP9H 2D2OA 3S4SA 1FVDB 3F58L 4XPHH 1C7SA 3OWRA 4XO8A 1JZ2A 4G1EA 4QHKJ 4DJMA 2XUWA 1EDQA 2NX5A 1PSKH 5DD3L 1ET5A 4OD3L 4J3OC 2CBTA 1YN6B 3EOTL 4Z7WE 3TV3L 4GSQA 2VR3A 4LARH 3F83A 5ISZA 1BQ5A 1J1XL 3QI9C 4FP8L 4G5ZH 5CEYA 2H6OA 3U6RB 1TPXC 4BKSC 3IJEB 4O2FB 4MJ2A 5GGTL 4BFOA 1QZ1A 3F7VA 2VZUA 2MQ3A 2I60L 4N6RB 1OAUH 2VERA 4XWOC 2E9JA 3GSVB 5DO2C 2Y3AA 2WJ5A 2AQQA 1TVDA 4MDIA 4MRBA 3ZMEA 1W0WA 4PJ9B 4G8IB 3TL5A 3OB0H 3AQYA 3CDZA 1IC4H 4NYLB 2FH8A 3UBXG 4PREA 4AOFA 2EYRB 1F4YH 2ZWKA 1R5VB 1NC2D 1L7IH 1T7YA 1CT8A 2CKBH 1ZIAA 2YSSA 4GT7A 1P5UC 1GZQA 1TQCB 4HA1A 4HZLA 2DQGL 5DD0H 1TO4A 2X3CA 4LVOB 1JPSL 1J8SA 3CX2A 1URIA 2XT1B 4HCRA 4FFWC 2YJLA 3NAAL 2OMZB 4FA7B 4Y7MA 4G9FA 3Q1SL 3NEEA 1YEDB 2HFTA 2Z1PA 5EU6A 5AENA 1J5OH 1X7QA 4ZFZA 3VRLF 5ERWA 3FONB 1C8QA 2IGFH 1UTDA 4H1LG 1CG9A 4XODA 3QIBD 5D7SL 5EO0A 5FDWB 4P5TA 1EJOH 3DMMA 5I82A 1N12A 3T0EC 1WT5A 4U3CA 2VSKB 5I30H 5IEHB 1SPDA 4HIQA 4TLSA 4AEIH 4D8PA 2ZIDA 4PB0H 1FZOA 1FL5A 4NKDB 3TJEL 4ZS6D 1SM3H 5J9PB 4ODSH 1I9IL 3H85A 4GFTB 1N67A 3TPUB 3NQKA 4PPTA 1P7KA 2DKMA 3O3EB 1RUQH 2EH7L 2DJUA 4TSBH 1T04B 1M53A 1URZA 1Z9SA 5F6IB 1QBBA 3OAZK 4I87A 4PGCA 2X3BA 4LLWB 1TUPA 1JGEA 3QQDB 4AYDC 3CZSA 2E6QA 2KH2B 3N40P 1DN2A 2R0WL 3IE9A 5IMOB 1PG7X 1KC5L 3V0JA 3QIWC 4BFIB 5BV7C 5KYYA 3U0WH 5EZLA 4PGZA 2MCPL 3P0VL 2RHEA 4ALAH 4PJ9D 1OQOA 3GMLB 2IOOA 4PJDA 1SOKA 3AS3A 5D6CA 1TQTA 2VO8A 1MFNA 1Q8MA 1BYPA 1TVHB 2VC2B 4R7LA 3U7WH 2B59B 4D9RE 5C7XL 4DESA 1A4BA 2K3HA 1HL5A 3RPIA 5HDWA 4HUUB 2VRKA 3GBMH 1X7TA 2CUHA 4ZBJA 4PWHA 4ZUUB 5L8KB 1KIQB 3H8NA 1K6QH 2XZAL 1IAIM 2EIBA 4RGOL 4IOIA 2D0GA 4Y5XC 1FFOB 2FQFA 2H6UA 4LQFL 4EOWL 1MJUL 2WOYA 4X6EB 5E5UB 5C8JA 3Q2WA 3A6BL 1ROCA 3NCXA 2V2TA 3C9NA 5DJXB 1R75A 1E4XL 4OY9A 1BGXL 5DZNA 3H0TB 1FFQA 3TBYA 2OTPA 2J71A 5DT1H 4AGMA 4ZMAT 1XL4A 5DMIL 2OSLA 3LAFA 2G75A 2PTUA 2X28A 2XBZA 4MCMA 1ET8A 1QWHA 2XN9B 4N0FB 4TLUA 3RE0A 5JPMC 2B39A 5BVPL 3FFCA 2MKWA 5C9JB 4FYTA 2IAMD 4UNUA 2PYED 5FWRA 2ZSVA 2CJSA 2ED6A 1M2OA 2H0PA 2VLKE 4HHWA 1AGFB 1GW6A 1U41A 4HLZH 2YQGA 2WXIA 1I85C 1K8IA 1LM8V 4JFXB 1HS6A 1XIWB 3FHQA 3LIZA 4XNMA 5DMGD 5KSVB 4LDOB 3UAAA 3BRFA 2AKRA 4YHZH 1C9SA 2GCYB 4EKXA 4XXDB 3NZHH 1DQLL 1JTOA 2EDEA 4PTTA 2E0PA 4WTQA 3BKCL 4FQJH 4FFZH 3VSVA 4ZOBA 2CJUH 4RMBA 2C9PA 4HKBA 1XL6A 3BW9B 1YYMH 2NUPB 5ICXA 4G8GA 3EJSA 3MREA 1NMBL 2JE8A 3P9MB 4N0YL 3K0WA 4NUGL 4A2MA 2IFFH 1IBGH 1FG2A 1ULVA 2GTZB 1HEZB 4YHMH 4CA4A 4L1LA 4XTRD 4F33B 5TDOB 4Z76B 1EEUA 1HDMA 1MW1A 1BVZA 2DJ4A 4XO9A 3SOBH 2R29A 3E8UL 4HOMA 2X40A 4DGIL 3SYAA 3PPSA 1ZEAL 4MCZB 3RGVB 1DJIA 4JMXA 1LWHA 4X7CC 4UTAA 3TBVA 4A6YH 4RWYH 4XI5D 4OKVB 5E1IA 3MXWH 3ZYZA 2I27N 2Q9OA 2V2XA 2A4ZA 3ERXA 1ZWIB 1UD8A 1TQVA 3FKUS 4XPAL 2Y0SA 5DVNA 25C8H 3M88A 2YGOA 4KMLB 4ENZA 3VG9B 2MNUA 4FFVD 4N9GA 4M93B 5JORA 4LEOA 4J27A 3H3KA 2Q86A 3CSFA 3CJJA 1XZWA 3MBXL 1JNNL 4JN2A 3ME0B 4MCYB 5I76A 4J4PD 4YZFE 1IV8A 2GHWB 4WSGA 5GS0H 5DLML 5L9DL 2XY2A 1YMMD 4AL8C 3VNZA 2JQZA 3ZTJG 2FJHB 5KVGH 1MAMH 3IGUA 1XIWD 2AAVA 4R2GC 1P2CA 2ARJQ 1F90H 4WGVB 2IFGA 4Q6IA 3BUQA 4C4KO 5TGBB 4CVWA 3GMNB 4FDWA 5G2NA 4QTHA 3R7RA 1E5CA 2ITDA 4KTEL 3L7FA 1RUAL 5I6OA 2HJFA 1CYGA 1K2DA 3LD8C 1YQVL 3O9WA 2P8LB 2YAPA 4WI9A 5HGGS 1A7BA 4G6FD 3U1PA 2MOQA 1QUPA 1IAKA 3LKRA 4QTFA 3TNMB 1AS7A 2P7TA 5DTFA 4YAQA 1Q1JL 5MEQB 2EDLA 4M8UA 4Y8AA 1VFAB 4I13B 3FAWA 2UYLA 5KUMA 1EDYA 3GGWA 2FCBA 3RGVD 1KMGA 2ZUWA 3IU4H 4F1ZA 3EJYC 1XGPB 1NAKH 2JLPA 3FOLB 4MQ7B 1KN4L 1ZXQA 4TQEH 2Z6FA 3ARDC 1UZGA 5D96C 4KUZL 3TFKC 2KYIA 3CMOL 4KJQD 1PLGH 2Y7SA 5GZND 1S3KL 1A7RH 1RZGA 5T3ZL 2OA9A 5TK2A 3FT3B 1BIHA 1QI3A 2OJZH 1BF5A 1FQ9C 1IMHC 4AGPA 4P57A 3HZYA 2X2UA 2ETWA 1YNKH 4J28A 3WKYA 1ZS2A 1B4RA 1MCDA 3VFTB 1SXAA 1KENL 3TZVA 1A6ZB 3FS9A 1HSBB 2DJSA 4WNQA 4MJ4A 3T2NH 3U30B 3VDBA 1CDBA 2N7SA 3L4ZA 3QHTC 4PRHD 2MQ0A 2EEDA 3L3IB 1BQLH 1THAA 5E8OA 3V5KB 1PX8A 1UT1A 5AEAA 5K1VA 5DRZB 2FQEA 1NICA 5J13C 3S34L 1XF3A 2R0ZL 3RLSA 3MRRA 1KXTA 4KY1H 5E2VL 3UPAA 4DVBA 1DQQB 1KGCE 2C9UA 4JFDB 2IG2H 4FCHA 2LGNA 1MI5A 1RJZB 2VJ8A 1IBYA 2BNRA 2Z92B 1KJVB 2VIRB 2G60L 3QR1A 3ABLB 1VKXA 3NJXA 3ZBMA 4K4KA 3AXLB 4F37F 1IQWH 4K8RL 4YLBA 5MI0B 1RFDH 1II4E 1XGTB 3T77A 5K9QG 3NCCB 3P30H 1R3KA 4B9YA 5ECJE 3RIFF 4R90L 2AXWA 2LTQB 3CZFB 4GP8B 4GRWF 1W2KT 1EXUA 4FQ2H 3E2HC 4A7UA 3UPRB 2E7MA 3FZUC 1RIHH 3KNBB 1NCCL 3MNVB 1R3IH 3IDXL 1WRFA 3M17A 1GHFH 2WWMD 3ULVH 5CMAB 1OF0A 3U1SH 1A9EB 1CGVA 2DQCL 4ZMVA 4LSTH 4HHAA 4UIMA 4LSVL 2QFRA 3DWTA 1CICB 2VZ3A 4NM4H 2XNAB 4JZJC 1EAPA 2XFXB 4H0GA 3CZUB 1LO5A 1R47A 4G1MB 4ODUA 3O2VH 1E8ZA 2JTYA 4RFEA 2X1OA 8FABA 1TQBC 3Q2NA 5HYQB 2OBGA 5BO1L 4XMVA 4FNUA 4YSUA 4FYSA 4OLYL 4J3WA 4LK4A 3QNFA 3C6LB 2PCYA 4UNIA 4A7SA 4Z7UE 3TEZA 1SDAB 2VW6A 3D3VA 3C2AH 1ASOA 3NABL 5C07A 15C8L 4M7ZB 2FQDA 2X4RA 4YDLC 1XCTA 1J9TA 2P5WA 3BT2H 2VDLB 5GRWA 4NUJB 4LKXB 1T0NA 1J86A 3MNMA 1C1EH 4W4OA 3UG5A 1TETL 4JY4A 3KYNB 4JFDD 2AMGA 1G9NL 3TVMA 1DLFH 1AO7E 4OLUH 3WUZA 4XB7A 5I8OL 2BINA 2JTDA 4P2RE 3VW3H 3MA9H 1KLFB 1S78D 1MHEB 3FT2A 1H6UA 4QRSB 4HS6B 3QYCA 3WE6A 4C83A 1BMGA 1IBBA 1AC0A 3B7TA 2FR4A 4UU9A 3OAZH 4YFDB 3X1NA 5DA0B 2NMSA 1L4IA 3W82A 3NN8B 3ZRFC 1GY2A 2DI9A 2WOBA 1BHGA 2O72A 3CXHK 4HCRH 4MD4A 3TIDA 5B7MA 1JZJA 4PUBL 4AEFA 1T5KA 4Z0BH 1GCFA 3CDFA 3O6FD 4OJFL 4UOW1 3ARRA 1YY8A 2L3BA 4P2QB 3L1OH 5JIDA 3V52H 3VB9A 2LLLA 3RB5A 1CICD 5BO0D 1IT9H 1C16A 5T1JA 2EZ0C 1NLBH 2A9MH 5JW5A 3EYOB 3CZJA 1ACXA 3ROLB 4XNQA 2D7MA 4N25A 3C6LD 3H54A 4M6OL 4JFZL 3RKDD 5B1CA 3QEQB 1NCAH 1V5JA 1YEJL 2AEPH 2DJMA 3VFSB 3ULUC 1MRDL 1IVLA 1WGVA 3A21A 2FHCA 2K78A 2NLJA 3OKLB 3NTCL 3DX0A 1WJ3A 4LCCB 4JGUA 1L9PA 1NL0L 2F74A 5J56B 2VWEE 3QZLA 1M7UA 4N2AA 1WDAA 1YY9C 5LAPA 4AVIA 1OVZA 3FN9A 4F58H 5C0CE 4LOUD 3ESVF 4UQ9A 1PLBA 1GOGA 2A6IB 3DHMA 4PIRF 4JM4L 1INQA 1F3JA 1BXXA 3P4OB 4HLZG 3MLTB 5GISH 5JPNA 4PJCF 1PZAA 1ZKAA 3MRMB 3JV6B 2AEOA 3QQ9C 4R96B 2P9RA 1PEZA 1K4CB 1AXSA 2ZX8A 2V33A 3KJ4B 3MDJA 2ICEC 1HESA 1N4XH 3C5ZC 3LZPA 5BRZB 2HRGA 1A7OL 2QL1A 4PJ8B 4M9PA 4PWJA 4Y9CA 3T04D 3IGKA 2DEWX 3L9BA 5IVXF 1FORL 3IJHB 4QRRB 4HUWB 3AAZA 4S2SB 5FYJE 1E4KA 5HHNB 4L4TA 4DPCX 2CWRA 2OTWA 4P2QD 5I74B 2X53A 3RPBA 1K8DB 4K23H 2F68X 5TF1H 2VLRA 2E7HA 5AVRB 3TP4A 2N7BA 3RFZB 2C9QA 4JO2L 4NZTH 4XN9A 1IX2A 1JPST 4O9HL 1E6OL 2WXJA 5D7JA 5KVMC 2O30A 4QYOB 1DANT 1I8AA 3DJZA 2QZQA 3OHMB 4W9EC 5HVFB 5KVEL 5ESVB 1BF8A 4JG1H 3QEQD 2WLJA 4MQXC 1VFMA 1TDQA 2C3HA 4NFDA 1DEEB 4TULH 5SWQB 1F8TH 4LEEA 3UOAB 1BLNA 3L3OB 4PJCB 4JZOB 1ZT1B 2H32B 3BHBB 3LKSB 3MZGB 3KXFB 2K6ZA 4LPCA 4W6WB 3X11B 3N85H 3LIZH 3N55A 1MIEH 4ZMOA 5JMRA 5T1LB 4PJXF 4XZUA 5KS9F 1JGLH 1TEFA 3KBFA 2L7EA 3B9KC 5GS2D 4P46A 1OAZH 3PG2A 1FYHB 1L9TA 3DPDA 2TAAA 3KPOA 4DUWA 1SVCP 4JO3H 1OCRB 5FFGA 4YQXL 1G7QA 1PGRB 3VJ6A 7PCYA 1D7FA 1D7CA 2ICWJ 1A7QL 2F15A 4L4JA 4I77L 1F13A 3HIZA 2X4TA 3NP3A 5BRZD 3QW9A 1NCIA 3MJGX 4PJ8D 1DJYA 2Y36L 4AQ1A 2P49B 2R29H 3AWGA 3EYSH 4QRRD 2MOGA 4WEMB 5HDOA 2R0LH 4Z3HA 4W70A 3GWJA 4ILDA 4BCZA 4X6CB 4HDIB 4Q6KA 4UTAH 4N1EA 4BRVA 5F6HI 3BOVA 2B77A 4Y4KC 1ZK5A 2A6KA 3QUKB 3G7TA 4HEPG 1COBA 3ISYA 4PJGA 4WV1A 5K1NA 5INCB 2AV1A 3SD2A 4CAGA 3IJ7A 3AROA 2MIZA 4FJYA 5C0JA 5FW8A 1RVFH 1SYSB 5TFSH 2KC0A 3HHSA 3P11H 2VCOA 2YIHA 3LIUA 4A2DA 2DQFB 4DGVL 4XP6L 1A7NH 3HZKB 4XCEB 3TGXA 2HA1A 3T6QC 1MEXH 3L1EA 5F8RC 2VOTA 3ZE0E 2PO6B 1GZPB 4BIKA 3KXFD 4L9LB 2Q8BL 2AZUA 3QXAB 5JXEC 1A6VH 2D73A 4KZ0A 1OT1A 5DQDL 5B38B 1MDTA 4P23B 2MEJB 3RFRA 1BQUA 2ZPKH 3GTNA 3RUGA 1YNTB 4OM0L 3LRMA 5E08H 5I9QB 1EFXA 4OIIL 3LEYH 5C0AA 3MV7E 4IMLB 1KB9J 1IC7L 2YN5A 3QARA 2K7PA 2WBXA 4DTGL 4XR8C 2PWHA 1WBXB 2VSMB 3MFGB 5DHVB 4ORZC 5TPWL 3GINA 5JNYB 1KN2L 4Z7WF 1OCOB 5IR1B 1XGRA 1FN4A 5CKGA 3MNWB 1AQDA 1RAMA 1W0VA 4D9LL 1BJ1J 3MBEA 1LO4L 2W81C 3PGDA 4BXSV 4F1SA 1ORSB 2IBGA 2DLGA 3A4EA 3FRPG 3S98A 5T8IA 1TNMA 1M3IA 4TKWA 1QFWI 4NSKB 1WS7A 5E8PA 1UENA 3VX1A 1G7PB 3HZVA 1EBAA 5B3NA 5L8JB 3HNVL 5DF0A 3ASOB 1IGML 4PP1C 2HCZX 3ORJA 2WWOA 1SUHA 1U3NA 3SE3A 2RQEA 2ZJSH 5C0BA 3WD5H 2PF6A 4WW2F 3VI4A 1E4HA 3L81A 4B7IA 2F8OA 1U2YA 4AYEC 3MV9E 3P73A 3NJLA 1M6OA 3UX9B 2OI9B 4IDJL 3VM5A 5J6HB 3AMKA 3CAFA 4IJ3B 3RVWC 4N2GA 2R23B 5IT2L 1TYEB 4CVZB 2Z8SA 3BPNB 1I3UA 1NFDA 2JJSA 1HHKB 4YDMA 1N6UA 5DD5L 4PWEA 2FB4H 3ECUA 3IJSB 3CVHB 1OM9A 3TCTA 3VRIA 4EI6B 4Z7WB 3S4SG 4YGAB 4POZC 2OJ1A 1JUFB 3EOAA 5K9KA 3LQAL 1MCCA 2YGPA 4MJIE 1T1YB 3RWGA 4GAYA 3CFCL 2ITCB 5CINL 2VDRH 5B7FA 4M56A 1KCRL 1QYGH 2QQKH 4OUUA 3QZBA 3JQOB 3ULUE 1U8QA 4PBVC 1BSIA 2IV9A 2YSTA 1EGJL 4WW2B 3LV3B 5AB1A 5C0RH 2WD0A 3KCPB 4AEHL 1ZJAA 5EUOA 2JJVA 1KYAA 1E9OB 2WUBH 2YOCA 2LE9A 5FCUL 5GRUH 4HS8L 3O8XC 4L4VE 1KEMH 3C12A 4AYID 4BBWA 5DD1L 1A7PL 5F0LB 2K4AA 1MUJA 4MBRA 4DNLA 2UZYB 1BV8A 4E0RA 3ZKXC 1JZ4A 2VB5A 4WIQA 2ZF9A 1QO3A 3UTSD 5ID0A 1YQ2A 4MVBD 1INDH 4XBPA 1T7ZA 3JSSA 2YMOA 4O5LH 4XP4L 4BSWB 5KBKA 2I9TB 3TN0A 5I18L 3T4AA 4HCGA 3OMNB 4ISVA 3TBCA 3ZOAA 1DL7L 3JWDL 4K3EH 3AGVA 1R3JA 4PRIB 2Y1VA 4MA1C 4UT6L 1MJ7H 4EI5B 1MRCL 5I8EB 43C9A 4JO1H 1U21A 1V3MA 2O5YH 4R5XA 3DV4B 1HCFX 3T0WA 3T6WA 1PLCA 3ZL4H 3ZXAC 3Q9PA 1UFUA 3Q44A 2EICA 1ZHNB 1GGUA 3CPUA 3BAIA 2L7QA 3OJ2C 3UABA 4PBDA 3D0AA 3BZEB 3LZNA 1T5WA 2QBWA 4OLWL 1HN1A 5MHSD 1K5WA 2BHFA 2NY1B 4AEEA 1UWEL 5AUMB 5DUBA 2F58L 2R51A 1ZTXH 5B1JC 1R24B 1P9MC 1GGIL 3AMLA 4ODHL 3MKGA 1OB1A 3X3FL 1F4XH 2Z31B 4Z7OE 3OHXA 5T3XH 4Z7NB 1AGBB 1O0VA 2X4NA 4DKAA 1KB5L 4KQ0A 2CUIA 1U3HA 32C2B 1MHPL 3NZUA 1TZGL 3WN5A 3CN2A 2VABA 1H3PH 1A9BA 3SY0B 2F53B 1JGDA 1VZIA 1MNUH 5F88B 5DJ0A 5IB2A 4MMYB 4ONHB 4NQEE 1L9NA 3MO1A 2PPAA 2ZKXA 3LRLA 1KCUL 4GG6E 3F7RA 3RGHA 3BP6A 1B0WA 3ZUCA 2HVBA 2X41A 2Y5TA 2SEBA 4YSAA 1N68A 1NIDA 2EUZA 4PRID 5DMJB 3HA0A 1NGXB 4QKXB 5GS1A 4EI5D 3GD1C 4ZAKA 1S9KC 1Z32X 2XKNA 5AWNH 1TVBB 4HJJH 1B88A 4Z0XB 4JUSA 4LESA 5DJCA 3QJFA 4JFFA 2C7FA 5DVMA 1AR2A 2PYEA 1PZBA 2VDKH 1HOEA 4G6KL 2NY0C 1MCOH 2YO3A 3S8WA 1BAGA 4A2LA 4XMLH 3IN2A 5ITFA 4NC1C 4HLEA 2NY1D 3V6BR 1Q94B 5GIRB 5I1KL 1SHSA 2VUOA 3U79A 1TIUA 3GZKA 1NGYA 3JTSB 5IHLB 2EDFA 1G7MA 5IKCB 4IKJA 4BV1A 2OCJA 4IGBA 4OZGA 4KKZA 2Y5QA 2DQEL 4I18A 2Z31D 4JFYA 3FT1A 4YZFF 2GAZA 5E8DL 4PR5A 4DZBB 3RTLA 2C34A 1CXIA 3UJJH 4XN7A 3S35L 1JRHI 3GMQB 2ED9A 4TVUA 4FKKA 5I1EH 1KYOJ 2WZ0A 1W0YT 1MWAB 5C0GB 5AW9B 5T5NG 2F53D 3CCHA 4JANB 1TCRA 1E4WL 3L5XL 5T33H 2EKSA 3FPXA 3E38A 3MAWA 4XNZC 1USQA 2HN7A 2WN2A 5B7EA 1K5NB 3B2VH 3RVVC 5AL0A 5CJOL 4EAEA 4OZ4B 5JR1H 1QFOA 3ULSA 4EDXA 5I1HH 3VXRA 4WUKL 1J5HA 1V10A 2XLLA 3STZB 5I71C 3QUZD 3WXWL 3E1F1 4J3BA 4C8XA 3QORB 4EZMA 4U1JA 1BZ9B 2ARWA 3KEHA 3B7YA 1TJHH 2JKXA 3NGBB 1PZ3A 4JM2B 4NRYA 4NUQA 2H0FA 4A7TA 1O6SB 3PXJA 3CXDL 2G4GA 3BEVA 4OIAA 4KMTH 2UY7A 3KPQA 4CU8A 1MCQA 3O45B 4HKXB 2XWJB 2Z8RA 2HKFH 1DBJH 5IFHL 3AUVA 3LN9A 4XCYA 3E6FB 5B4MD 2OXGB 1GAFH 1OZTG 1TJGL 4Q9QL 2BXZA 2FNBA 4NZRL 3OF6D 2HWZL 3ZDXB 1SEQL 4D0DB 3DYPA 3MNZA 3QEUA 1NUNB 1VF5C 3PL6A 4KJPD 5D9SA 5F7EH 4PJAF 1P69B 2YARA 2Y72A 4U6HA 5E2JA 2WGXA 2J1WA 1RJLB 1IAIL 2EILB 2PP8A 3D39A 3TURA 3QUYA 2NSMA 4Z7IA 4P4KC 2VN3A 5E1GA 3VQLA 2VDOB 3QXDA 3QI9B 4KQ3H 2AVFA 4K7PH 3ZE2E 4AVKA 4I88A 1TPXB 2IBZY 4QHLB 2G9HB 3QIUA 3K74B 3VWJD 2DDQH 1E5BA 3FUIA 2BDNH 4APQC 3KLAB 2FGWH 3UJIL 1HILB 4JR9L 5GSRB 3PY9A 4KUCF 4W81A 5E1AB 3WI9A 4IBVA 4YWGL 3HC3L 1F0LA 1NGQL 4ZQTA 2DQJH 5EOCH 3WKNA 5C09E 2PW1A 2VGLM 5CU9A 3QORD 2ZOWA 2BERA 4I5BB 1P5UB 4L3EA 1AYRA 3MOAH 4JM2D 4FQHB 4FTVE 3KDMA 3H56A 4MA3A 2WLLB 5KBDA 3QCTH 2HVKA 2VJXA 3T2OA 3L3JB 5D2NE 1RULH 2XSKA 2VE6A 3DK0A 3ZE1B 1D6EB 2RFXB 4GW5B 3EH3B 3GLZA 3KPRA 1HHIA 2WXPA 5HHXH 1KJ3H 1KGJA 1AE6L 3PWNA 5D1ZA 1XBRA 1JVOA 4P2OA 3NCMA 3WEBA 1CK0H 1JP5A 3HRZC 4LSRL 2IADA 3HN3A 3NJKA 3PGCA 4KTYA 3DX8A 3H9SD 4PS8A 4AVHA 5E5RB 1ECZA 1KIUA 2VLLA 1N8ZB 1YEHH 3VGDA 1UACL 4GKOA 5DS2A 1WZKA 3IFLL 1HKLL 3AC0A 3BVVA 2HLAB 3UGXA 1BQHB 3HFFA 4J12A 4PN6A 5AZEH 3D07A 1XF4A 3QJQB 4WHYH 2JCCE 1GS8A 3MMEA 2K3TA 1WFUA 4J3OD 3GLDA 3GSQA 4PI0A 5PCYA 3VXSA 5IHZB 4Z7UF 4GIAA 5KAQG 1OGAE 4WW1A 2BW4A 4AVJA 1REIA 2VC2L 1HT6A 1L3WA 3QI9D 5HPMB 3GS4A 5I16B 2WLIB 1VGKB 2CHDA 1H8NA 1IIIA 2R1WB 3PXLA 4PG9B 3RRQA 1G9MC 2ENSA 3UC0L 4L8BB 3U2IA 5BV7B 4XWOD 3QIWB 3V2AR 4CDHA 4TL5A 1NPUA 3EFFB 5MENA 5IESL 3TS8A 4JQVC 5D6DA 4NM8L 2JSFA 4ERSL 1G6VK 3KVQA 3V5HA 2FL5B 1U8OA 3WLBB 3N91A 4FFYA 1KTLA 3WJJC 4XP5L 2NZ1A 3L4XA 2JIXB 3HG1B 3Q0HA 1I1FB 4R0LA 1OY3B 4OCRL 5GGRB 1WFOA 2ZOTA 3P4NB 2CGYA 3WTSA 1J05A 4JFVA 4FFWD 5T1DH 4Y19A 4Y5XB 1N64L 4K9EC 3U2SB 12E8H 5D1XD 3WV0A 2F5BH 5C6PB 4I1PA 2YD1A 4JBSA 4Z7UB 5E0FA 3HPJB 4JG0H 3EDKA 1Q0XL 3S3DB 3T0ED 4M7LL 3HAEA 4ZW8A 5L2JB 3SPVB 4UDUB 1FO0B 5J1AB 3WTUA 4L3AA 3T1WA 3NIDB 5JPMB 3WIFA 1RMFL 3AWEA 2Q2EB 4FLRA 4KUCD 4ZUWB 1AO7B 4HH8A 1A47A 3LXBA 1AI1L 2E4FA 1NFIB 3H7BA 1A0QL 2JJTA 2OP4H 4IRJA 4WY7H 3WXVH 4H8VA 2YZ1A 1HE8A 1OPGH 4HUXB 1KCSH 3RILA 2BRQA 4NQSB 4GXVL 2J5LC 4U3XA 4KQ4H 5EEWA 4X6DE 3U48A 4NC1E 4JM0A 2IPKB 1FI8C 2VZVA 5FHAH 2H1LM 3FYEB 3RA7L 3PDDA 4DVRH 5EPMB 1VEMA 4OLVH 3NCWA 1DQML 4XVUC 4A2EA 3QIWD 3OKOB 1JYNA 4CGTA 5IGXL 2VXSL 3ATDA 1LMKA 3M86A 4KNSA 2WZ5A 2BNQE 2FSEA 5I6XC 2X1QA 1ORQA 1MF2L 2AJZA 3JUYA 3NACL 3RQ3A 2GTWA 4LLMB 4BSVB 4Z7AA 5CKAA 4X5WB 4G8EA 1Y6NR 1DN0A 2JIXD 3HG1D 4G72B 3PHSA 1FUNA 2V5RA 3AXHA 3VI3A 2ADJB 5DA4A 3T6VA 1OSPH 1YEEL 3FQYA 4GB9A 2KLSA 5LN4A 1CE6A 4NN5B 4EI0A 5ABAA 1IGTA 4RMTA 1LD9A 5DC4B 4FQXA 3VDAA 2PABA 5SWZA 3ARZA 4XAWH 3VCLA 3W2DL 5J4MA 3T4YA 4GP5B 3K8LA 1F58L 1RZJH 2J4WH 5FO8B 1I1RA 1NPNA 1X4ZA 1P5VA 1Z5LB 4G43A 2O26U 1RERA 4MNHB 1J1PL 1NC4A 4N9OB 3DOSA 2A83A 1GZHC 1AO7D 1BJMA 2ZYHA 4IBWA 5CR1A 3NA9L 2CO7B 2IDFA 3BKML 1KIRA 5HDQH 2IANA 4QRPE 3WSQH 2XU9A 1ES0B 5E8NB 3ZU8A 3VWKA 4HOZA 2E7CA 3TWCH 2EIJB 2YXFA 4TNFA 2WVSA 3WE1A 3PWVB 3J7HA 4R2GB 1OAKL 3WMQA 2IPUG 4FL4C 1I1YB 1N3NA 4PCYA 2VDQB 3ZY7A 3GM8A 2NUTB 2XYCA 4C47A 5DS1A 2ICCA 2IALA 1Z5HA 4XMKL 3FSVA 1PKOA 2L4OA 3G5YA 4JFEB 4P48A 3LD8B 4TNGA 4ZFOB 3D85A 5KYXA 1F1AA 1NAMA 3HW7A 3EFDH 4MNQA 3X3GH 2HTKC 3C60A 1E8XA 1UXLA 2YMXH 2QPUA 3LZQA 1QTYT 3V4PA 4Z3EA 3V0GA 2KDYA 5BMFL 3PS6A 4NQDA 4L8SC 4H40A 3U0TB 2P8PA 3BI9X 3OGOE 3VVVA 5J06A 2V9TA 3UTZB 4D94A 4M6NL 3U83A 4ALAC 3TYGH 1IGYA 1SJHA 1ZK9A 1XX9C 4A55A 1MLBB 4YE0A 3TBBA 3H3PH 4FHJA 3HG0A 3MUZ1 3L3DB 4B0MB 3ARDB 3LMJH 5D96B 5BOJA 5IMKB 3I50L 4GSDH 3V7AG 2YUXA 1KTRL 2XVKA 1PZ5A 2J1KA 3T2PA 3BFWA 4ZX4A 1MY5A 1F56A 4BKTC 2XQYA 3EGDA 5HYSA 3HG2A 3MXVL 3WYRA 4NQTA 4RFNC 5FW7A 1JYVA 4RISL 4JPWH 2IGTA 1AHWA 2UXFA 5DI8B 5J6GB 1X9QA 3H53A 1LO3H 5SWSA 4YGVB 3BKYH 3FF8A 1R9FA 1NGWA 1XH3A 2NNAB 5IB3B 1H5BA 1UM6L 4TSCH 1S9VB 4F2FA 2PR4L 4FLQA 1O5DT 2X0VA 3ZE0F 2VR5A 3CQQA 5TTRA 4GRMB 4WUUD 4HIHB 3BT0A 5JXAL 5J13B 1C5CH 1NOLA 3KGRA 2Y07H 4X8XA 1IBHA 2BP8A 3WFEH 5FYJD 4J7RA 4P3DA 3PV6A 1MH5A 4JFED 1I9JH 2NXZC 2ODHA 1N0XL 2QVKA 2X0UA 3MV11 3QA3A 3QDHA 4FZ8H 3LZFH 4NO2B 3Q7JA 4GW4B 4TTDC 1DANU 3T8XA 3N1PC 4HEME 3BEWB 2BFVL 2WXQA 4GKZB 4P9HH 4YDKL 4AENA 4P5MB 2GI0A 2F54A 1DSFH 2OS7A 5AAWA 5LAXA 1XCXA 1QI5A 1ZA6B 2VTFA 3E2HB 4CMMA 3EJYD 2EYSA 3IDIA 5DEFB 2Z4QA 1EHLH 2VQ1A 4MSWA 8CGTA 4NRZA 4TVSa 3ARDD 1SFHA 3O41A 4A38A 2AGJL 3IDJA 3GMPB 3IDMA 1NUDA 3TFKD 2ODIA 3ZE0B 3DTDA 5HHMB 2OMXA 3U7YL 4DKEL 2J5WA 4JHWL 1MXGA 1RZIA 1DCEA 5JUEL 4JX0A 1TNNA 4HIJA 4A37A 2VDLL 1IBZA 5FC9A 5CSGA 2CG9X 5E9DA 4B0MM 2JKWA 4UM9B 4JZJB 5E6RB 2HXAA 2PPCA 3EG9B 4YDZA 1XF5A 1TQBB 3RWEB 5TDPA 5EU4A 1ZSDA 3W11C 1CFTB 5ADOL 3MV7B 1KB3A 5MEPB 4ODBD 2X7LA 1RUKL 2X70A 4UQEA 1PS3A 4J3UA 4YDLB 4HIXL 3PNWB 4X9BA 4YVUA 3R1GL 5IB5A 3OPZH 3MYZA 1ROWA 3ETSA 2WHVA 3Q8AA 4UV7L 3RHWK 1UWFA 5DYOA 4AG4L 4G83A 5HP5A 5B1KA 5GS0C 3NH7H 1UD3A 1QBMH 3IK2A 2X05A 2E86A 43CAB 4X0NA 1PKQE 4QRUA 3K6IA 2ZG1A 4KC3B 4K94L 3ULUF 4TVPE 2A6DB 5CN3A 2DQDH 4KKBC 4Y2DA 1CGYA 2OK0L 2V17L 1ZHKA 3OJMB 2K4WA 4OB5H 4NJAH 1C8PA 2CO6A 5GRVK 4MA8H 1RURH 4AV0A 3AU0A 3MGOA 5CN1A 3C8KA 3FFDA 5IBUG 2GJ6A 1JGVL 4FNLL 3W9DA 1RKRA 3NFSH 1JYWA 4UUJA 3LRSA 5ENWA 5HHMD 2XRAL 1PDKA 1SJMA 2Z34A 3NOIA 1S7QB 1IKNA 1GTFA 3KBPA 1I1AC 5C70A 4OVVA 1FVEB 3PP4L 2LABA 2D03L 1O6TA 4N4YB 4UM9D 2FJSA 4YUEH 1U36A 3FRUB 3I6SA 2DMCA 1DVFC 3FO0H 2EDJA 1BX2B 5FM5M 1N5YL 3DX1A 1MOEA