5J3HC

Human insulin receptor domains l1-cr in complex with peptide s519c16 and 83-7 fv
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
116
structure length
116
Chain Sequence
b'QVQLKESGPGLVAPSQSLSITCTVSGFPLTAYGVNWVRQPPGKGLEWLGMIWGDGNTDYNSALKSRLSISKDNSKSQVFLKMNSLQTDDTARYYCARDPYGSKPMDYWGQGTSVTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptide S519C16
molecule tags Hormone receptor/immune system
source organism Mus musculus
publication title Insulin Mimetic Peptide Disrupts the Primary Binding Site of the Insulin Receptor.
pubmed doi rcsb
total genus 26
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2016-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j3hC00
2MHAB 3BW9A 5F7LB 3KYMB 4JRYE 3BH9A 3UAJD 4LCUB 4RX4D 1NBQA 5BRZB 4RGND 4HUVB 4NJ9L 3DVGB 3BRFA 4JFPB 1I8IB 4R4BA 1G7QA 1C16B 1ACZA 4N8CL 2VZTA 3UZQA 1Q0YL 2IPUG 4LMQI 2WBKA 2DRUA 3B4NA 4G6FD 1EAPA 3MUHL 5FV1L 2C3XA 1QBLH 4WI5A 3AM8C 3MRHB 2Z31A 4CN6A 2PTUA 3L3OA 4OGYL 1A9EB 1MVUB 4TVPH 1J11A 2NTFA 2LTQB 4KJYA 1GVIA 2IALB 3O4OC 1H5BB 1T2QH 3EO0B 3QB7C 2VWEC 4QF1A 5K93A 3C2AL 3OB0H 4IJ3B 4LFHD 3WN5A 1T1ZA 3GSWB 1CLOL 1I7UA 5BW7C 3ZMRA 1BVKB 1ONQB 4K3JL 4F58H 2D9QB 2FWOA 3QXWA 3AROA 5E94B 1B90A 4NIKB 4Z78B 4PG9A 3S36L 4QXUL 1X44A 1VA9A 1JPSH 4HKJA 5E03A 5IMOA 1YNLH 2PO6C 1CXEA 4CNIB 4Y19D 4IRJC 3TBSA 1D5ZA 3QUML 1MHHA 5F1OB 1JHKL 3DRTB 5E5UB 1HQ4B 1I1AB 3QPQD 1LK2A 3O45A 2R1XB 4ACPA 1FJ1B 1DLHA 1WCBA 1AXSA 4NWUL 5I6XB 3BAEH 4J3UA 3VXMA 4HJJH 1VEPA 4Z7OE 2ICES 5KOMC 2AEPH 1Z9LA 4HIJA 1T7VA 5CSZB 2VN7A 4KGLA 4Z7WF 2ZG3A 3JV6B 4JEGB 1Q8MA 5I1IH 1LILA 1R5IA 1HXMA 1P69B 1OP3K 2C3WA 2YD5A 1MFBL 4P5TA 4ZMAT 1G0YR 1WGOA 3SDCB 1DZBA 2DL2A 3S3SA 1DR9A 3TA3B 2MTPA 4OQTL 3DTXA 2GJZB 4XVTL 4PRPD 3L7EB 4NDMA 4GG6B 1I85C 4RGMB 3ZKNC 3AY4C 4P4KB 4N9OB 4X5XA 4GRWH 1XH3A 4LLDA 1KB5L 5A2KH 2J6EL 1KJMB 4EDWL 3GB7A 4NRYB 1U6AL 1MJ7L 4IOIA 4FOMA 4X6BA 3DX9A 5K9JL 1EX0A 2GKIA 4G9FD 1AH1A 1EIBA 2WBJD 1HKLL 3TFKC 3BKYH 5CKAA 4GW5B 2YKLH 3NPSC 1FNEA 1MCKA 2OBGA 3WNMA 4NN7B 1JGVH 1O0VA 4JY4B 4Y19E 4RDQF 4XBEL 4JFEA 3GMLA 1OLLA 4P9HH 2PYFB 4U1MB 5JW4Q 1YPZB 2CRZA 5T1DH 1TNMA 3O11A 3ABZA 4N1EA 5A16B 2YD7A 4JDZA 3I02B 3BJ91 4DK3A 4MAYB 4I13B 5C0AE 3ZSSA 3NIFF 4HPOL 1JZ8A 5FYJH 1HHIA 2OP4H 4FTVB 2BMKA 5DHXB 4F33A 3LV3A 1CZ8H 4LCCB 1KLGB 5CBAA 5CD5C 3PHOB 3AXLB 2AV7A 3EFDH 1M71A 5EIIB 2F54B 2JTDA 5DQJB 1WBYA 3V4UH 4KROC 3WFBH 5HHME 4PJCF 4Z7WB 3GSQA 3JUYA 3G5YB 3TBYA 3QXUA 5EU6B 2BY1A 4NZDA 3KLDA 1AE6H 4U3XA 3INUH 1A7BA 4LHJB 3EOBA 1JNJA 5D1QC 4FFWC 3NZHH 4MMZC 3TT1L 5HDQH 4LBEA 5IQ7H 3MUZ1 5I74B 3L3JA 2HG5A 4HJ0C 2JKXA 4TULH 4AM0A 1RZKC 1RHHA 1UB5B 3OAYH 4V1DB 1EBAA 4LLQB 3VGHA 2VXQH 5H94A 5ITBH 2IADB 4HV8B 4JRYB 5F21B 4L9LC 4N68A 4Z7WE 3WXVH 1A7PL 3QDJA 4PLJD 5J9PB 3RX7A 5CZVH 4L4VA 1FVEB 3FB6B 1QFWI 2HLAB 3C5ZC 5J3HD 4DKEH 4FQ1L 5A16A 5BZDB 1T22A 1ZVHA 3EDDA 4NPYA 1AGDA 1ORQA 3MRFB 1R3KA 4BFEA 4F33B 3IDYB 1ADQA 3B2UD 1KEGH 1CT8B 4CMHB 1NCNA 5HYJD 5E99L 4YHML 4EI5C 3RIAF 4WENB 4OKVB 3WIIL 5C6TL 4G6MH 1KCUH 1INDH 3BGMA 3S88H 1P5VA 5GGSB 4DFHA 2WW8A 5DJAB 4J23A 4FQCH 2NY5C 5DMGD 4XVUC 1ACYL 3P40A 1G9MC 4HKBB 3D18B 1CFBA 1U93B 3LPFA 3MFGB 1QACA 3MLTB 1S7VA 1T3FA 2P4AB 1IKFH 2DYPD 4NZTL 4MLIA 3BWUC 1MEXL 2E6JA 4QF1B 2R8SL 1JVKA 5JUEH 4E5XB 1F6LL 1OLZA 2Z8WC 1FL3B 4AQOA 4RZCB 1HCVA 2LU3A 2FR4A 2IBGA 4ZAKD 4ONOA 4R7DB 4LLUB 2OSLA 3BD5A 3T2NH 3Q1SL 4S1QL 4FQXA 3Q3GB 3TNNA 2AK4A 2HVJA 4U1KB 3TN0D 2CUHA 3P73A 1YN7A 1C12A 4U7SA 5KAQG 5FYKH 1RU9H 1LK2B 3HUJE 4ZAKC 1T7YA 5GPRA 1ZSDB 4XP1L 4DN3L 1QQDB 4L4TE 2DBLH 5JW4N 3P77B 5F1NA 1F5WA 3LOWA 4KY1H 2HVKB 2CPCA 1FH5L 3C6LC 2BOBA 2APBA 5C0GA 2HFEA 2FX9H 4NQCB 1F11B 4OF3A 5MP6H 4EN3C 4A2LA 1CGSH 4PJAB 1LO5B 1AD0B 5A40E 1FLRH 3VCLB 5D96B 2E5EA 3MZGB 1JPGA 2F58H 3ARPA 4GG8B 3VFVB 4NZRL 5GRJH 2XY2A 2IG2H 4NO0B 4R90H 3VWJC 4IS6B 5IEHB 1MJUH 3PIQB 1DBBL 3L9RB 4YPGA 2ARJB 1ZLVH 1J87A 4BKLA 1ZEAH 1T0PB 4FXGA 3HCVB 3QDHA 3X11A 4GXVH 5E8DL 4NQDD 3HE6D 1KIPB 2GT9B 1MJUL 3SGKA 3HUJB 1IGTA 4AEEA 2DICA 1XIWC 5BV7C 1VESA 1Q94A 1ZEAL 4KVNH 1BZ9A 3OAUH 2BOCB 4HWEL 3L7FA 1YQVL 4YK4C 1IC4L 3SKJH 5JMOC 4NZUL 1DBJL 2X09A 1J0KA 3LKRB 4XAWH 1IL1A 3MGAA 3RX8A 3Q6GH 1MJJB 3MYJB 4XTRC 3TP4A 1SJXA 1HK6A 1I9RH 5IB2A 1ETZB 2AJ3B 3FO2B 4U4BA 5EC1B 2E7LC 3RQ3A 1NDMB 3WLBB 2D7TL 1EUUA 2DTSA 1AD9B 2ADGA 2DQIH 4OSUH 2IPKA 4FQHA 4QOKE 4ZXBA 4MHHI 1MOEA 5SWZA 4WJ5B 1JWMB 2CKBL 3QQ4B 4DGVH 4JFOB 4HPOH 3SDDC 4KKBC 5DR5H 3SE4A 1CR9L 3MRLA 4M1DL 4HW6A 2FGWH 4NGHL 5DJXA 4ZUTA 1ONQA 1MWAH 3V6ZB 4NM4H 2ZCLH 5DTFB 1BBJA 1PKQE 3HC0A 4NKDB 3QEUA 3ZTNH 4X98A 5D7IA 4XMLL 4X4YB 2ZSWB 4M1DH 1A21A 4QTIL 3A67H 3U4EA 3VRJB 4KAQL 1ZHLA 4DGYL 3MRQA 2BSSA 5F9AC 4RDQG 1J8HE 4Y2DC 4C4KO 4PJDB 4TOYH 3KPOA 4KJPC 5TE7L 5DUBA 1TPXB 3ZDYE 5I75C 1NBZB 5DD0L 4PG2C 5JW4M 4M8QB 2C7UA 4R0LB 1QBML 3O9WD 1WCBB 2CK0L 4RGNC 4Y4KB 1D5IL 3CFJB 4I3RH 4TOYL 1EO8H 3SDAA 5JHDD 2OZ4H 5C0AD 1A6ZA 5BV7L 4J8RB 1BOGA 2M1KA 3V4PH 5CP3A 1Q1JL 4KROB 2BDNL 2XWBA 4MXWL 4LLYA 3KPSE 4C59B 3AAZB 5IBUB 3QNYA 3QHZH 2VSCA 1II4E 1RPQA 3VXUD 4NUGL 1EA9C 1NBVL 4XZUA 1TMCB 3N9GL 5DO2D 5TF1L 1RAMA 5MERA 1J12A 3SDCA 2H1PL 4OZIA 1QRKA 1RZJL 4N0RA 1LO2H 3MXWL 2H41A 5B39A 3MACH 4K3EH 4MA7H 4BH7B 5HI5C 4TNWK 3NAAL 3RWDA 3VRLE 4CADB 2W38A 1H9VA 1IEBA 4Q6IB 3WLWC 3F6IA 5GSRA 5J56B 4B7LA 3WBDA 1AKJA 3CDFA 3I85A 3WFEL 2W0LA 1MY5A 4UILH 1TVBA 3GGWA 2XKNB 4RFOL 3S8WA 1YNTA 3QWRA 3K2UH 2EYSB 4RFNB 2DI7A 3UJJH 5JIPA 2CO7B 3VD3A 1EK3A 4PB9H 1SQ2N 1WCQA 4HF5L 2A9ML 1AY1H 4X4ZA 5JXAH 1HSAA 5DJ2B 5GZND 4I4WB 2A2QT 2IMNA 3VW3L 3LS4L 3PJSA 4KHTL 2I9TB 3TIDB 1FCGA 4WO4C 1P7KB 2J8UF 3MJ8B 5C09E 3BGAA 4U6YA 2AXFA 4QHKI 5EIIA 3OXSA 5F3HB 4OQTA 1HH6A 3MRGA 1KCSH 3X3GH 4WTXA 1PYWA 4JG1H 1N4XL 1JYXA 1U8MB 2DQHH 4RISH 4YGVB 2B5IB 5TDPA 3WFCL 1YQ2A 4OB5H 3DYPA 4XPAH 5CD3A 4XPGH 1N6UA 3CFDA 43C9A 1MRDH 2VLRE 4WO4B 3VXNB 1KB5H 5IT2L 2XY1A 3F12B 2G5BB 2XIDA 4LPCA 3V5KB 4K7PL 3MRDB 4OZFG 4LRNH 4JZOA 5DJ6B 5IBTL 2DJ4A 4KKLD 4HDIA 2EDYA 3H9SD 2PUQT 2YMXL 2VR5A 1BOYA 3CZJA 4OCXH 4R97C 5ABDE 3V5HA 3BKJH 3OKKB 1CG9B 2DM2A 2CMRH 1U8QA 2FB4H 2F19L 1GRWA 1R3LB 1MRCH 1UJTA 4W6YB 3B3IB 4JPKH 4I48B 4WFHE 3UTPD 4F7CA 3IF1A 2IG2L 5IQ9A 3BGFC 5IV2A 3QEQB 3VFWA 3G04B 1ZLVK 5ID1A 1DBBH 1TVHA 5T3XH 4OLXH 2DBJA 1D9KC 1P4IH 4W81A 3BO8A 1MFAL 3HI1B 3ZE2E 1AQDB 5GZOC 3HMXA 1G7LB 1H5BA 3BUTA 3EYVA 1QPXA 3FQTA 2NX5E 5ITFA 2HKHL 3MUGA 4JFFD 1YECL 1UT9A 4K23L 4QRQB 4XCEA 3IETB 2FO4B 4XGZA 1ZHKB 2ZOLB 1CICA 4Y8DC 3QEQD 1YYMH 3JVGC 4PY7A 3VU2A 4YGVA 5L2KB 5D9SA 1NSNL 3RDTD 3T0WA 3HE7B 4RWYH 4AIOA 2I24N 2HH0L 3CMOL 3CFIC 2HKHH 4LVHC 5C0CD 2ZUTA 2EDTA 2PCPA 3VXSE 3T8XA 2IBZY 2EDXA 4M02A 4YXHL 3V0AC 3IJSB 2ZJSL 3GBNL 3CK0H 2YRLA 2CJUH 3EO9L 1EFXD 3RWGA 3CSBA 4O2CB 1JPTH 3GDBA 2VZ1A 5CD5D 4ZO7A 2GUOA 4U6VL 2ZJSH 2Y23A 1VKXA 3PXJA 1WK0A 1BWWA 1F4WL 2DLTA 2VDRL 3FT2A 3GJFK 1NUFA 2X1PA 3VXME 1G6RA 1RURL 4KROD 3W9DB 2DLEA 1DE4A 3OJ2C 3O0RL 2VITB 1QSVA 2FJHB 3GMNA 1CK0L 3C5ZD 3HLAB 4LPTA 4Z7VA 1F4WH 2LABA 3ZDXE 4XCNA 4NQTA 2B2XL 2BC4A 2XI9A 5GS0H 3K3QA 3MLUL 1NJ9B 3QWQB 4YC2C 3IDMA 2CSPA 3WUZA 4U1HA 4QRUB 4IM8A 2X4NB 3C9NB 5AZ2H 5E2WL 4NQXA 2MOVA 3FN9A 3KPSD 1J10A 4OBRA 2VTFA 2MMXA 1TZGL 3EZ8A 1INDL 1DN0A 4ZPTB 5K9KA 5DQ9B 1W2KT 2ED8A 1CE6B 4OLEA 3BIKA 1YPZE 7FABL 3UTSB 5E9DA 3DO7A 32C2B 4G8EA 5BO1H 4HIEA 2X4UB 3VFOA 3BPNB 3I50H 1UH4A 4I3RL 1JF6A 3QDGA 1KV3A 4XC3H 2I5YL 5DVNA 4CRPA 5FDWA 1MNUH 4HEPG 4NZTH 5BV7H 2HJFB 3WMSA 1DBAL 1S9XA 3D3VE 4FHBD 5E0QA 2OQJB 5F7WC 5F88B 1EFXA 1RK1A 3B5GA 3B2VH 3OAZH 5CJXA 4NC1C 2E8YA 3PGCA 1MIEH 4GRLD 4B5EA 4GBXD 3QA3B 1Y6MR 2VNCA 3ALWA 4Y8AA 3FQRB 1Q9KB 4JFEE 4NCC2 5JW3L 3MRNB 3MX0A 4G5ZL 4XPFH 3GMQA 3T3MF 3B2VL 2F5AL 3SHSA 3SGEH 1S5IL 4Z8FH 4GBXC 5JW3H 3FFCB 1JTPA 2W0PA 3L7FB 2CK2A 2VDOH 1VERA 4YR6A 4OV6F 3HFML 2ILLA 4JZJC 4YFLI 1AGCB 1X6LA 4HX1B 4JJHA 3RUGF 1Z9MA 3FOLB 3NCJL 3ES6B 1A2YB 4N5UA 1XZ0A 3SOBH 1UQSB 3ARRA 3TV3H 3B5HA 4D9LH 3KYNA 4Y2DB 5F89B 5DD5H 5LAXB 1BM3L 3C87A 1YMMB 3AS1A 1C7TA 2QJDA 4I4WA 1S5HB 1UZ6F 3P9MB 4K9EL 4X6CE 4OM1L 5E2VH 2M8XA 3BUYB 3OF6D 1JF1A 4JN2A 3HN3A 2J8UB 1XF4B 1LE9A 2OTWA 3ZHKA 4HAFA 3H3BC 1UFUA 1YEFH 3ISWA 4PJIA 4LCIH 4GKZB 2G2RB 3QNXB 4LL9A 4ZUVA 3DSFL 2VAJA 1D6VL 1GOFA 2FEDC 2GJZA 4YBQC 5I1DB 5KVEH 2HYMA 3ARDD 3B8YA 1LO4L 1KJ2L 1U8LA 4TUJB 4V2CB 2UYLB 3V6OC 5J1AB 1HH9B 3QDGD 3D69B 5FUZL 3SKOB 2AK1L 1Q9KA 1YEFL 3BKML 5IK3A 2WNGA 4RCAA 3LEYH 2ERJB 4GS7B 1WITA 4RQQA 4CMHC 1GZQA 1BFSA 1G9EA 4QTHA 4P5KA 2NQCA 5L6YL 4JANA 4PJEB 3BP4A 4JRYD 4XPAL 4XPGL 3TA3D 4F7PB 1EXUB 2ESVD 4TVPL 4UQ2B 1FFPA 5IG7B 5IT2H 1RZIB 4JKWA 3PV7A 1I8KB 3ARXA 2FYYB 3RZWA 4LIQH 5EN2B 2DM7A 1ZV5A 5DHVB 5E95B 3TA3C 3GSXA 2BNRE 4XTRD 2QSQA 2XWBB 1U9KA 2YD3A 4HZAA 2E27H 3ZE1E 1FC1A 5F9DC 2XG5A 1SVZA 3D0LA 2GSIB 2BERA 3EYVB 1JPSL 2D7OA 2Y06L 2QQLH 1RZ8A 5D1ZB 3BKCH 2FNBA 3SKMB 1JHKH 4MJ4A 1OWRM 3SQOL 3FHQA 1A1NA 5EUKB 3B9AA 3RBSA 4L29A 4P3DA 3RVWC 4EI5B 5HY9B 3FQUB 1WIUA 1JGEA 1MQ8A 4L4VD 1QO3B 4D94A 4H8WH 4IIQC 1DL7L 1VACB 4PBVC 3TBSB 2VISB 4DW2L 5KSAB 4ZTPH 1N64L 2VXUH 5D7JA 2ICWB 2YXFA 4JJ5B 5KTEL 3O3DA 1ADQL 3BW9B 4KAQH 1RUKH 3ULUC 3L3HB 5A2LH 1VEOA 2DWDA 4OZHB 1SMAA 4UT9L 3CNKA 3T3PE 2BHZA 3RWIB 5DT1H 5E6IC 3VXMD 5EU6E 4L8SA 5D8JH 2GIYA 3EOAB 1EEYB 1Z0NA 2IJ0C 3O9WC 5DT1L 4LSUL 1KENH 4MQ7B 3PWNA 4R2GC 1JI2A 1JWMA 1BEYH 3DBXB 2CDGA 2EDRA 2BNQA 2LTQC 3ELAT 2QQQA 4QT5A 4MD5B 2DQCH 1JGVL 4TN9A 3EIFA 4YHLH 2EE3A 2R2EB 4JPIB 5DEFB 3T0VA 4NNYB 4M62H 1LDPL 4C58B 4XP4L 3IFOB 3PIQA 1CXLA 1F58L 3P4NA 1A9BA 4PJXF 2IPTL 5EOTB 4MXQD 1OWWA 4K2UL 3MLUH 4JGUA 1NUGA 3QCVL 3HR5B 2HFGH 3F7YA 3NAAH 3P0GB 4PG9B 5I8KL 4K3DH 4XP4H 2YA2A 4WV1B 4CDGC 3QXTA 4LNVA 4W6WB 3V79C 2R39A 5DJ6A 1I9EA 1OT1A 2OTUA 4HUXA 3UTQB 3BE1H 4PRHA 4Z0XA 3O2WH 2R1YB 1JBJA 1ZHNB 1T80A 1JFQL 4Y19B 1K9TA 5EPMB 5B8CA 1RQ5A 2FJGA 3O8XA 1GPOL 4WHTB 5MEOA 3VGEA 1BQLH 3STLB 5TPWL 4XPHL 1JPST 2A9MH 3L3DB 4XHQA 2EDKA 1JNLL 4XP9L 4LARL 4M7LT 1N8ZA 5HDQL 3PQYE 3VW3H 4H20H 3BO8B 4PS4H 5HDLA 1KG0A 3CFKB 2DQUL 2CIIA 4L4TB 2IC2A 2FEEL 4K3GA 1CTNA 1NFDB 2CD0A 2OL3H 4Z7NE 4OCSL 5GGUB 4HPYL 1DSFL 2MKWA 5M7QA 3WXVL 2HFFA 3IFPB 1S8DB 4P2RE 4PRBA 4DN4H 2UZIL 1A7RH 3OB0K 2FEEI 2VRAA 3HAEB 4K8RL 3QWOB 2OL3L 1W72L 3QJFA 4OIIH 4NQDA 2JCCB 5D7IE 5J1SC 4PJ7E 1UCBH 4DZBA 1YEHL 5LXGL 3GGWB 4PD4K 3OHXA 4F7MA 1C08B 5DUBB 1AO7A 3MV7E 1F13A 4UOJA 3MV9A 1YDPB 2AVGA 1FVEA 2XKUA 4OF7A 1NKOA 3SN6N 1ZE3C 5I2IB 4LGPB 3QNZB 4ETQB 3ULSA 2CMRL 2ZUYA 3B9KB 4QRRA 2A6DA 3GM0A 5EOCJ 3ZL4H 3O11B 3O9WA 1JTTA 3OKNB 3B5TA 1L0XA 3S7GA 5F93C 5B8CC 2UVEA 4Z7QE 2A0LD 3MODL 2FJHA 5C9JB 4FFZH 2DQJL 2AXFB 3T4AA 4HJJL 3MROB 3E6HA 5DD3L 2XPGB 4PRNB 2HT4D 2P8PB 4R8WL 4F7PA 1CDUA 5D2NB 5D70H 3WFDH 1ZK9A 5FK9B 3CVHA 4XP5L 1G1YA 3H3PH 1CL7H 1HWGB 2R8SH 2CDFB 3MBXH 4P59L 3HB3D 4U0QB 4C56E 5I1IL 3IVKB 4PGZA 1RD6A 3D1MC 3SDYH 4RRPA 3U0WH 1FVCA 4U1SA 1RVFH 3W81A 3MJ7A 3EO1A 1NFIB 1NFDE 2R69H 2Y5TB 4M48L 4FQQA 1CFNA 3CUPB 1JYNA 1GHFL 1BJMA 4EQ3A 4UTAL 3GRWH 4PJ5B 5SWZD 1W0WB 3SDXE 3T4YA 4YHPA 2GSIA 3EW3B 2QHLA 3QEGL 1D6EA 4RAUA 4YZFE 5TQ2H 2GITA 3LRSA 4UI2A 5C8JB 4ZTOH 1LMKA 3FZUD 4WEMB 3FB7B 5JW5B 3M1BB 3QDJB 2OR8A 5E1AA 1MJ7H 5HYSA 1EHAA 5IESH 5A43C 3VXUE 1HKLH 1G7IB 2YPLB 1QRNE 4P2QD 1G0DA 1WTGT 4AYFA 4NPYB 2V2XB 4HKXA 1MHEA 3NFNA 2JF1A 4KUCD 1NGZB 4OFIA 3DVGA 4JY5L 3ZYJA 2I9TA 4WWKB 4PREA 3U2SA 3L3KA 4HHAB 3C60D 4S0SD 1R5WB 4WI6A 4HCRL 2UUDH 2A1WL 5FYJL 2J88L 4UOW0 3VFUB 4F37F 4QRPD 4N0UA 3Q48A 1PSKH 5JHDA 4D0CA 4CW1B 4UT9H 4FRWA 4PJ7F 2BNRD 2DJSA 5LQBH 3WS6C 1V3MA 1OVZA 1U93A 4HIIA 1BD2B 2B0SH 2WP3O 2ZUQB 5E8OB 5HVGB 3PWVA 1CBVH 1DBMH 4MD5A 3SE9L 2EC8A 3INUL 2BSRA 1PD6A 5D7LE 5FO7B 6FABL 4KV5E 1X7QB 1XF4A 4X80H 4PV9A 2EDOA 4N8VB 4ELMA 3LEXB 5L2KE 1MNUL 3EYSH 4IHOA 4BM7A 3PP3K 1JCKA 1U8QB 2X70B 2FIKB 4OBSA 3EYOB 3NTCL 5ACMA 1S9YA 2IQ9H 5JXED 1IM9D 1KYOJ 3EYSL 3KPSB 4NBYB 5IJVA 4GMTH 3ZYOA 1UCTA 5EUOE 3DUUA 5I19H 2YPVH 3HR6A 2X4SA 5D1XB 3VI3E 43CAA 2VXVH 1I3GL 1YUHA 3N1PC 2VABA 5KS9B 2YPLE 5DR5L 1CLZH 4FQ1H 3U2SB 3UTZA 3ZT5A 4CVZB 1Q9WB 4O9HH 4R96B 1J1OH 4ZD3H 4K3DL 4MS8D 4PB0H 4I0CC 2Z4QA 2Z0BA 3FQTB 3QDMB 4LAQH 3UZEA 4X99B 3O3EA 4NQCA 5FYLH 5JHDB 4DGYH 4JFYA 1FZJA 1N0XH 3VRIB 3KXFE 4OJFL 4X5WA 1HN1A 1HI6B 3ZTNL 3FFCD 3D39B 1KULA 4G8GE 4H0IA 4M43H 1D5BB 3DX6A 4M61A 2NTFB 4FQCL 5L8KB 1TXKA 5CEZD 5MENA 3QIBA 3ARQA 3KPQA 1JNHB 4HGWA 5DI8A 2CK0H 1NC4D 5DJ8A 3LN9A 1K4CB 4OD3H 5DTFA 1YJDL 1HHHA 1RJYA 4JRXB 4GRLB 3CSPA 3OV6A 1S9YB 1IVLA 1ZVSA 3V0VA 4W6XB 3ZTJH 4FFYL 5TE4H 1PGRB 4RIRB 1OP5H 2FO1A 4X5LA 2ICWA 5HHQA 2ZCHL 4YR6B 5EIVA 4JFDD 3QAZC 3VDAA 4JHBA 4TSCL 5C71A 3GSNB 2BC4B 4MAYC 3GMLB 4LHQB 5ESAA 1YNKL 1DEDA 3CH8A 3IDUA 4URTB 4OAWA 3T3PF 4O2FB 1AGFA 1E4WH 5C0CE 2NY6B 2Y7QA 2MQ0A 2EC9U 1I1FA 4EBQL 4NO5B 5H35A 3ZE0E 5J6HB 1QNZH 4LEXH 4XXCC 3OKNA 1RZJH 2UWEB 4ZUSB 5DJAA 2A6JB 3T1WA 3QFJB 1YNKH 5ALCL 4HLJA 3IF1B 2RBLA 4K3EL 4MA7L 1BFVH 5JPMB 1NPUA 3DBXA 4JCMA 5F7UA 4S1DC 3RWHB 1EJOH 4FZEH 2MPAL 4PJCB 3RI5K 3DUSA 5GGQH 1IAIM 2XWTB 1GC1L 4BK4A 1LEKA 5IKCB 1KJ2A 1PG7W 3EGSA 3FFCE 3TA3A 5ADPL 4WW2F 2VN4A 4G8GB 3FRUA 3B83A 4Z6AT 2H3NA 3L5JA 4P23A 5B39G 1VEMA 2BVPA 4NNXB 1AQKL 2V5RA 4AEFA 4F57L 2NW3A 5BW7A 1MFBH 4NZRH 1NGPH 5CWSA 3WFDL 4J1UB 4X6DE 2YBRA 4KTEH 4XNMA 3MRMA 3RL2A 3Q5YA 4YJZL 5EZIH 5CP7A 4HKZA 4YHPB 5F9JA 4YHYC 4I0PB 3WV0A 1KCSL 5EO1B 3X3GL 5CCKH 1ZT1B 1NGPL 5IFJB 4WI9A 1RVFL 2Z31C 3LS4H 5IF0B 1MCWW 5EO0B 3C5JB 1NUNB 2W0FB 5D7KE 4JFPA 3O6KH 2BHYA 4OV5A 3O41A 1P2CA 3RGVB 4RMQA 4HWEH 4JGMA 1OM3H 4KZDL 5CGTA 1IAKB 5CILL 4F7TA 5GISL 1KB5B 4LVNC 4K71B 3FRPA 4X7FC 1LWRA 1N3NB 2C5DC 4FS0A 2Z92A 2YEZB 3ARWA 1QR1B 2CUIA 4JFFE 5EO9A 1MF2H 3BYTA 4R2GD 4QRPE 2F19H 5C08E 3MCLL 4LLMA 2P8LB 5MERB 4P9HC 5IKCA 1U8IA 5FV2A 1A7OH 1CL7I 4QCIA 4P5TC 3C9NA 3ULVL 2DD8L 4G7YL 4JB9L 1X5KA 2XZZA 1F4YL 4NQXB 5D6CA 5LGJB 4X0KB 5MEPB 1F58H 4TTGA 1FAIL 1BIHA 1H5BC 1IEBB 4HIIB 5DVOA 4YXKL 2FL5B 5GGTA 2P7TB 1KIPA 2NY3C 4BUGA 3V7AE 1Q9LA 3B9KC 3RWIA 1CICC 1XAUA 3TNMB 1RMFH 3RUGE 1F4AA 5F1IB 3NZHL 2EH7L 1I7RA 1FZMA 3QDMD 1DBML 1F42A 1FE8H 1FVDA 1H3UA 3O41B 5FXCH 5HDBE 2C3VB 5TE7H 4I9WD 3DXAA 4XX1G 5DHVA 4MA8L 5EC1A 5F7DB 3T0EC 4BFIB 4XPTH 2CJUL 1R3KB 3EO9H 4XPHH 3A6CH 3GBMH 4ONFH 5IIEA 3MROA 1D5XA 2FDBP 2YD4A 1QR1A 3D3VB 4P2QA 4HXAL 4Y2OA 2MFNA 1AIFB 2WBWB 4KK8D 2BOBB 1ERNA 4HS6A 2Z4QB 1CICB 4HFWB 2PN5A 4P3CL 2XZCH 2BK8A 2IBBA 3MV8D 4GW4A 1AGCA 5CEXA 2DM3A 5HGBA 4MHHG 1YY9D 3DETC 5LBSL 4XBPA 1KCVL 4JFYB 4I2XE 4WFGD 5C07D 5LVEA 4QHNB 3MNZA 1OAXH 1JPFB 4NWTL 3RRQA 3TESA 1S7QB 2M2DA 1E0OB 5E8NB 4DN4L 1J0HA 2ZKHL 4HUWB 2CH8A 1FHGA 2W9LA 4MYWB 1RK0B 3AREA 1VHPA 4TUOB 4C55A 5I9QC 4V1DD 3L3HA 1PEWA 3SDDA 5B21A 3L9RA 4LCWB 4YPGB 3QCUH 5LXGH 3WIFA 4PJIB 1DQQB 1OQXA 1SJHA 5HD8C 1F4HA 2GHWB 4KXZI 3ZE1F 2XYCA 1J8KA 1K2DB 2GY7B 3G6AA 2BCKB 3ARBA 1IGTB 3WUWB 5DQDL 1CLYL 1IBGL 5IHZB 3SDAB 4UIMA 3GNMH 4HMEA 5GHWH 5IM7A 3BPLC 4JFXA 4J3TA 1GOGA 3OKDA 4Q9BA 4O5LL 3HMWH 2AKRB 3ESVF 3UJJL 4MNQE 4PJ8B 2ZSVB 3MNVB 5KSBE 4OFYD 4P46A 2NYYC 2HRPL 2HN7A 5TE4L 3CH1B 3T2NL 4OCYH 4MA3B 2APXA 3H8NA 2OJZH 3P77A 4NO2A 5F1NB 3PABB 5ITFB 4PTTA 4BSVA 2WAHA 3MMEB 3D0VA 2AEQH 4YBLC 4YDKH 2FYYA 3PL6B 1EAPB 3GEWB 2EDNA 1IAIH 5E7BA 4Y1AE 3DMMC 4F37K 4JG1L 1A0QH 4G42A 1P6AB 4V1DA 5CZXC 3ROOB 3RNQB 4G5ZH 4DGIH 2VDOL 1G6RL 4PJCA 3QT2A 4LP4A 4G8FA 1TJGH 4JVPA 5CEZL 5DJCB 1RIUL 2GK2A 5E6IB 2A0LC 3FQWA 5SWSA 4TYUA 5ERWA 4JG0H 3WIFB 4R97B 4X5XB 1DQML 5E4IA 1QLFA 3SDXF 2VL5A 3VFRA 2FHFA 4UMGA 5IBTH 4WTWA 5E94A 5CEZH 3OX8B 3IFLH 4PUBL 3QO0B 4EEEA 4TNWF 3CXHJ 3R1GL 1EZVY 2GJJA 1BPVA 2XN9B 4GKSB 3MV7B 5ISZB 3AS2A 1EEZA 3AS3A 4PJDA 5HHOA 3RZCC 3TV3L 5IGXH 1R6VA 5DWUL 3HNTH 4OLYH 3L1OH 2VDPL 2D9CA 2BNQD 4N8CH 4UQ3B 1GGIH 3RY4A 4JQVC 2J4WH 3TN0B 5T3XD 3IDMB 4HJGA 1NCAL 1KJVB 3UDWA 2Z91B 5CLWA 5DJYB 5DRZB 4KK5C 5IW6B 1EEYA 25C8H 1RUML 4LSRH 3T3ME 1FO0L 2QR0B 1KEML 3LV3B 4LCCA 1QG3A 5CBAB 3NIGF 1N3NA 4N9GA 1KXVC 1KCKA 3O2VH 2VL4A 2ADIA 3D39D 3TLRA 1RZGB 3V8CA 1OM3L 4JFQA 3FB7A 5JW5A 1B2WH 3Q0HA 4XRCB 3WSQL 4XB8A 1PG7X 4UT7L 4FQ2L 2OI9B 3OAZK 1T7XA 2PR4L 4GRWE 2X4TB 1XFPA 4X80L 2LU7A 2EH8H 3J8F7 1EHXA 4OIBA 3MV9E 3TBTA 1EEUA 2G75A 3C60C 4UT7H 1BWMA 3O9WB 5EZJB 3D6GA 4KTDH 4F7CB 4LAJH 3VRJA 4HZLA 3VJ6A 2AJYL 1JNNH 2PW1B 2D0FA 5AD0B 1KLUA 3M8OH 1X5AA 1CD1B 5C6WH 2V2TA 5CP3H 1W0YT 1YEKL 1J0JA 1IILE 2KH2B 4BK5A 3OB8A 3WFHA 4YHZL 5DRZA 4MD0B 1A2YA 5IB5A 4N1HB 5F1KC 4Y5XA 4PY7B 4ISVB 5IOPB 1VFAB 3WS3B 4KKCD 2C1PA 3BP7B 5LGHH 5E2WH 3D2UD 1TLKA 2CR3A 3QUKB 2GJ6A 3PDOA 3LIZH 3VG0H 4GRWB 3VCLA 2VWEE 1N64H 1U8MA 3T04D 4YHYB 1FQ9C 4KUZH 2IQAB 4UDTB 1RY7B 2VDLL 4MNGB 1RUKL 3LCYA 2YWZA 5ESQB 2Z35B 4HC1A 1C5DA 3BVNA 2IAMC 3H9HB 1G7JB 3MXVL 1B0GB 1H3GA 5HDBF 3VH8A 4GH7B 3N1FC 2YA0A 1FYTE 4K7PX 3BIAX 4UUJB 5INDA 5MEQB 1NMBL 3NFPB 5T1KA 3VE0B 2EIDA 5EU7C 5JO5A 1OGAB 2WK2A 3QFDB 3PNWB 1FN4A 4N90E 3TO4B 1OAXL 2JJSA 2UVFA 1NBYB 4Y5XC 3UTSD 3X14B 5EU5A 5D7LB 6CGTA 1TDQA 3I6LE 4M00A 5F7MC 1MLBA 2X2YA 4FQLL 3FB8A 1A02N 3WO4C 3QEQA 5FO8A 2CLRA 4NJAL 5BZDA 3QCUL 2V7HB 5CLTA 4MCYA 3WD5L 4F7TB 5SWZB 2FD6L 4G7VL 4HIJB 1KTRL 5E8OA 3GSNL 2IH1B 1BFVL 3CSGA 3KJ6H 3K74B 3PWJA 2OK0L 4U1IA 1EJOL 4Y4HA 3JWDH 4M1CC 3ZKSD 3QHTC 4R9HA 4NKOB 5D7LD 4HBCL 1DUYB 1ZTXL 5CUSH 1D5MA 3GSVA 4KK6C 3TWCH 1I7TA 2LAAA 1LNUA 2JB5L 3TO4D 3W2DH 5I1JL 4NRYA 4ZG1A 4ONHA 4RAHA 5I0DA 3EDEA 4ZS7H 5DLMH 5E9DE 2EZ0D 2EXYC 4WFEE 1WFOA 4F3FA 5IFHL 4ODWA 3IJHA 1QSEE 2R2HA 4Z0XB 4PJFE 1T1WB 2H32H 3H7LA 1N59A 2XFXA 4M6OL 4NKMA 4WWKC 1NBYA 1VPOH 3T08A 1HSBB 4OGYH 4EJ1C 2EZ0C 3J7HA 5IHLB 3MCKA 1JN6B 1VENA 3SE3A 5HVHB 2AXJA 4JM4L 4K8RH 1JRHH 3P30H 4QXGH 2C4FT 5DRWA 2QBWA 5FYKE 3DV6A 4RFEA 5DRXA 4X5WB 1MCCA 4ZQKA 3WKNA 5GRXG 1HHGB 3H9SE 5C6TH 1A7RL 1MRCL 1OAQH 1XCQA 4YDJB 4FTVD 4HBQA 1W72H 1A4KA 4JPKL 2H6PB 1PJ9A 5DA4A 1JYWA 1MJJA 3HI6L 3KPPB 3EOBB 2NR6D 1S8DA 4LOUD 5CSBA 2DQEL 1I9IL 1L4IA 4WW1B 4HIXL 3R0NA 4WFFD 4N0YL 1AKJD 1AD9A 2ADGB 1J0YA 3L5WB 4P5TD 5KVGL 3V0VB 2O5YL 4ENED 3S97C 3H9SB 4DVRH 2PO6A 3U4BL 1IGML 1CDGA 3LB6C 3PWUA 4LU5H 4KHXL 3MJGX 2BFVL 3QI9C 1DEEA 1HZHL 5LCVH 4FFZL 1A7QL 2OK0H 2QSCL 1U8HB 2E3VA 4Z5RB 4HUVA 1LD9B 5JA8B 4K94H 4HCRA 4PGEB 5AG8A 2D7QA 5FB8B 4N5EC 5B8CB 2FJGB 5D2LE 3WSQH 2R69L 4FA8A 5DEZA 3QI9D 2I07A 5GXBB 2X7LA 4DQOH 5CGMA 4P46C 4QRSA 1HINH 1I8MB 4PJXE 2VITA 3P4OA 3BPCB 2A77H 3EZJB 3OKDB 4XMKH 3IB4A 3UTTE 5TQ2L 3BHBA 5EA0H 1OAYH 5DEGB 4KY1L 5FYKD 1OARL 3TIDA 1BF8A 3FFDA 4HLZG 4HX1A 2YZ1A 4CVZA 1MI5D 3LKRA 3P9LB 4JREB 2XA8H 1QSFE 3FMGL 4MQSB 3UYOD 1MRFH 3VXOA 3RWEA 5ADOH 5GGUA 5KZCD 1FLRL 1TVDA 4LVHB 5EU6D 3OGCB 4LMQE 3TF7C 3R8QA 3B9DA 5EUKA 5HYIA 4PRAA 2AQ3A 1ZT4B 32C2A 4JZOB 3TZVC 3U6RB 4M62L 4G42B 1BX2A 1F3DH 3S35L 3MSPA 4R90L 4WDIB 2BVTA 4WO4A 3U7YH 5FGCB 2W9DL 5J4MA 5HHOD 4ZYKB 3BPOB 4NKQB 5DD6B 3SKUD 1JNHA 4HGWB 5DI8B 5HYSB 2BSTA 3KLHC 3CCHB 1UWEH 4FXKA 3KPRB 1KC5H 2L7UA 2ZPKL 5TGBB 3VXRE 3G08A 2IGFL 3CSYB 1G7JA 1GH7A 3QDJE 5INCA 4YUEL 4AENA 1R5VA 3NCYS 2AQ2A 3VH8B 5D72L 1BBJB 3HC0B 4KVNL 2ZCKH 4LEOB 1RUQH 3SE9H 4LLUA 4XI5C 5CJQL 7CGTA 4WGVB 4MQXD 2CDEA 1VFBA 1S7XA 4LSTL 1EXUA 2J12B 2ZCKL 2XICA 3WKML 3QQ3B 4YX2H 1I9JL 3RTQB 2B4CL 5AZEL 4JPVL 1OSZA 3ARGB 1OTTD 4MJIA 4XPFL 3X3FH 5EU6A 4JLRA 2NX5D 2OMBA 1JNLH 2P5WD 5FO8B 4L8CA 4XCFL 3L7EA 4NDMB 3WL9B 5DD1H 4H20L 4WUUE 1X5HA 3P4NB 1TCRB 3HRPA 1S7QA 1GGTA 4PJ8D 5E8NA 4G3YL 3C09B 3H6JA 4JFZH 4PJGF 2R0ZL 4HUWA 3VXPB 5E8PA 2VLRA 4AQ1B 2PF6A 3MOAL 5F1SA 3AS0A 1CLZL 1FZOA 1A6AB 4ELMB 1EGJH 2Z31B 4WEBH 3U7AA 2YPVL 4DGIL 1FG2B 1SJVA 1EO5A 2CKBB 4HMDA 2JJVA 3T0EA 3VFNA 4MZ2A 3NIGE 2L4OA 5I1EL 5HGHB 4F9PC 2GI7A 5DC0A 1C1EH 5IJVB 4BZ2L 4HK0B 2C3GA 4FG6D 5HHMD 3BDYL 5KG9A 3UYRL 1R0AH 4G6KL 4FXGB 1GZPA 4OIAA 3TYFA 2BVOA 2PTVA 4LSVH 3OR7A 4M43L 3DRTA 4EDXB 2VXSL 4RFNC 4OZHF 3DXAE 2VQUA 5DZOA 3UTZB 4QRUA 3VGBA 1UM6L 2UUDK 3RVVD 4I77L 3FO9A 1R3LA 3RL1A 4U0RC 3AU1B 1T89A 2F54A 3V4PL 2CIIB 3FO2A 4X6CF 1QEWB 4JN1L 2EYSA 2Y4SA 4XP6L 5C0AA 3WNOA 4MXWH 3EDKA 1LEGA 1IEHA 1A64A 1NCAH 1BJ1H 4DWHA 4HKBA 5IBLD 3P2TA 4MSWB 1KTLA 2DIAA 5DUMH 3STZA 4PTUB 3VXTA 4WEUD 4Y5VA 4PFEA 5DRXB 2WSKA 5K9KB 1JPFA 1QFPA 2P8MA 4JN1H 4XP6H 3GIZH 4QEGA 2Y6SD 5CSZA 4FFYH 4D9RD 3PHSA 5KANI 2NLJA 1N0LA 5FO7A 2Q87A 5C08B 5JOFB 4S1QH 1DQLH 2BSED 4L5FL 4LSSH 1U3JA 3ARVA 2J5LC 3PV6B 3V6ZA 4WV1C 1PYWB 5EDXA 4HV8A 4OTXH 4EUPH 5LKNA 1FGVL 2OR7A 3GK8L 4Z7QF 3I2CL 3QEUB 2NY5L 3W9EA 1N7ML 4ZODA 2QADC 2OSLB 3QG6A 1DQLL 4YWGH 2FH8A 4RMVA 1KF9B 3RTQC 3ARBB 4P2RA 2QSTA 1M05B 1P53A 1P84K 5FKPA 1V7NL 1CGTA 3WO3B 2MPAH 1NGQH 3VD5A 3GB7B 2BRRH 5IHUH 4Y4FB 5KSBF 3LMJL 4R0LC 4ORGA 4QXUH 5CINH 2HT3C 5IB1B 1BQUA 3PGDA 3TPUB 3E6HB 4Y4KA 1CT8A 5HI4C 1AGFB 3CDYA 2CR6A 1NMAH 5I73B 5GJSL 1CG9A 2PNDA 3QISA 5HGDB 2YRPA 5F97E 1F11A 3SBWC 3W5NA 2WUBL 5AUMA 2I07B 3IVKA 4I48A 1SEBB 5FA4B 4KXZH 3PWNB 3L3OB 2C1OA 3QDGE 4Q9QL 1C8PA 1U8KB 4FTVE 2HJKB 4Y1AA 3TZVB 2G5RA 5IW1B 3W0WB 1EFQA 3LDBC 2EKSB 3S34L 4Z7WA 3D3VA 1G7LA 4HXBL 1M71B 2ZUWA 3L95A 4RISL 3FRUB 4NBZB 5LG1A 3ZDXF 3UYPA 3SO3B 2B0SL 1WFTA 1FSKC 1H15B 1HHHB 1L0QA 1P7QA 1IC4H 5GISH 5JXEA 3KGRA 4PRDA 4Z7UE 3THMH 4TUKH 5CS7A 1B0WA 4GSDH 4OKDA 3UC0L 5D9SB 3HPJA 1GZQB 1PKQA 1NCBL 4JANB 3S5LG 2R23A 3SCMD 1EEZB 4CJ0A 4MXVE 5J06A 1AHWC 3UMTA 2XKNA 3UC0H 5FOJA 1DLHB 4PRHB 1J8HA 3IT8D 3NVQA 4YK4B 3G6JA 5JLZA 1KCRH 5C1MB 4TTDC 3EYUL 5J0BA 3VA6A 2DLGA 3EBAA 3PWPB 1HSAB 3FT2B 2W65A 1L6ZA 4P9HL 1ITBB 4D2NA 4L8SC 1FFRA 4NJAH 5I76A 2CLZA 4P23C 3L6FA 2DKSA 3RVTD 2ADIB 2NXYC 2ZCLL 4NQED 1MELA 4LLMB 2P8LA 1HEZB 4TNVF 3T1FB 3MRFA 5FKAB 3RDTB 3BD3A 3O6FC 3UEZA 2L0DA 2BJML 4GQ9L 2OTPA 3QJHB 4ESKA 4WHYH 3HG1A 4IHOB 5JPNB 3RAJH 3CFDB 5I1LA 4OM0H 5JDSA 1MFCH 1VCAA 4ODVL 1CGUA 3GBNH 3ZYZA 3FQUA 3MJ6A 5IP4A 3FOMB 4X9IA 4KH2A 4J3SA 4OD3L 3EFFB 3MLTA 5IQ7L 3ORJA 3L5IA 4L8SB 2WIIA 4HT1L 5I1DA 1XGPB 3O45B 5LJYH 4D9RE 4APQD 2D2OA 1JV5B 4MCYB 4HT1H 1H3WM 3CDGB 4WTZG 1TNNA 3ULUL 1SYSA 2DIBA 3CVIL 2FJFB 2DOCA 5CZVL 1KPUB 5HVWA 4KI5C 4WWKA 1IT9H 1NDMA 4HFUH 4TSAL 4OUOA 3G5ZA 4P2QB 1FLTX 5JMRA 5KSVA 1ACYH 5AZ2L 5CIPH 1MPAH 2DN7A 4ZDHB 1FFPB 4FFVC 5IG7A 1YZZA 4QT5B 2APTA 3DURA 5A2FA 1R5IB 1HXMB 4P2OB 4BQBA 3MOBL 1KT2A 3GSUA 4G6JH 3TN0A 2V17H 2YD2A 3K46A 4Q9RH 4HWBL 2VXSH 2NY2B 5KOVC 5I30H 4X8JA 5J11B 3O4LE 3RWDB 3HG1D 3GJFA 5DK2B 2A9NH 4I77H 4XCEB 2D7MA 2JIXB 4NQCE 2NR6C 1T03L 3KLAA 4HWBH 5T5FL 5D1XD 1NLBH 3TM6A 1CFSB 3FJTA 4AMKH 2YA1A 5T3ZH 2HRPH 4LLQA 3EFFA 4WV1A 1IQDB 4NUJB 5DUML 5ACZB 5DMIH 3ULVC 5CJXC 3RHWF 5A2IH 3Q1SH 1E6OH 35C8H 3VGDA 4PYHA 4EN3A 3U30B 3MJ9L 3DV4A 3S37X 4YBHA 5DMGC 4FQXC 5EZIL 2E6QA 4GLRI 2Q7NA 1F8TL 1WSST 1IAIL 3CFEA 4RNRA 4P2RB 2X4SB 2FRGP 4Y5VC 2X1OA 1IC5H 1Q94B 5J6HA 5FM4A 5IK3B 1CU4L 3EYFB 3HCVA 5I18H 3P4MA 4Q2ZB 5SWZE 1CTOA 1S9WA 4ZFZA 1JL8A 5ACLA 2WIMA 3V7AG 2BNRB 4NZJA 4YWGL 3L3DA 4JRXD 1HCFX 4JG0L 5EULV 4L9LB 3WHE1 4NO2B 4JO2H 1CICD 4NYLA 1JGDA 3GMOB 1K5NA 2VC2L 4X7CC 1UJ3C 4OD2A 4WI7A 3VRIA 2HAZA 3EYQD 5AUMB 3LSOB 4PJHE 5B39B 1SM3L 4LFHG 1AHWB 3NIDE 2DWEB 4D0DA 1T83C 1TCRA 4YHKL 1IM3A 3SPVB 2EDBA 1S7VB 1T3FB 5F9OL 2NY4B 5DWUH 5E8PB 1F6AB 4CVXB 2OS7A 1N5AB 3GO1L 1U2HA 4K8RD 5FIEA 2J3SA 3K8KA 3QWOA 3G5VA 2BY0A 2JCCA 4YGAB 4F3FB 3TBWB 5I6XC 2OQJA 5E2TL 5F88A 5T1KD 1QSEB 5E5MA 4X9FA 3C6LD 3HKFA 3IDYC 4BA8A 3FN3A 4KZEL 3HI5L 4K8RC 4LCCC 1MFAH 3SE3C 3MCKB 1UWEL 4EQ2A 4U1JA 1BIIA 3NA9L 1YNTB 1T7ZA 4U0RB 1KN2H 1QPPA 3RIFK 1MCRA 4ZUTB 3DETD 3MA9H 3OKOB 1IJ9A 3Q6FB 4C56D 4RFEB 1QLEL 2X44D 1RZ7H 1RUQL 2VR9A 3KPRD 4I1NB 2GY5A 2RJMA 4P5MA 3U7WL 2YOCA 5JO5B 3ILQC 3QXVA 4HH8A 3RI5F 2H2SD 2PYFA 4NYLB 4NP4L 1F6FB 3GKWH 3D25A 4QY8A 3MRGB 3U30C 3LVEA 3VFMB 3CVHL 4NQVA 1KJ3H 5D1QA 2R2BA 4FQQB 1ZT4A 3O3UN 3U6RA 3BPOC 4DZ8A 1J86A 3GKWL 5BXFB 1DTUA 5C09A 3C2SA 4DTGH 4YQXL 4JFZL 1FFOB 1NEUA 1H8SA 3OKLA 5K33A 5FHBL 4QRPB 3VMOA 2QADB 3O0RH 4MNQD 4ZPVB 5I15H 5JR1H 4JRXE 1CS6A 4G8FB 4XB7A 4UINH 5J12C 4N0CD 1CK0H 4MAUH 3RVUC 5C2BH 4H8WL 4NN5C 5F1IA 2IAND 4TQEH 2I27N 1I7RB 2LAGB 3MRKB 3WJJC 1U8LB 1PBYA 5KAQF 4NFBA 4YHZH 1RZFL 1XGQA 2HFTA 3JV4A 5F9JB 3FOMA 2X7LB 2PW1A 1NDGA 1X5ZA 3JTSA 4LLVB 5AD0A 2NY4C 1YMHA 3K81A 1F3RB 2PYEB 4IRSD 2NY0B 4O2EB 3U36B 4KKBD 5D7SL 3I3DA 1B6UA 4U1HB 2P43B 5EU7E 2X4QA 2ITCB 2Q8AH 3RUGA 4BH8B 3ILPA 4NKMB 3VXMB 4XAKE 3LKNA 4TVPE 3IDIA 4R3SA 5B22A 3RVVC 2R0KH 2EO9A 2E9JA 3PGFH 3WE6B 2QSVA 1P4BL 1IAMA 1VSCA 5FHAL 1T04A 1OAUL 5C0GB 1CDYA 3LKQB 4Y88A 2FJFA 3ROLB 1U92B 2OZ4L 1L7IH 2Q86A 5B4MC 3WNLA 1X7QA 4WJ5A 4NN6B 1DP0A 2HJFA 2X4RB 4LVEA 1A4KB 2DS4A 3DTXB 1NEZG 4OZFH 4NQSA 1L7TH 3MOQA 4ODUA 1XF2A 3N9GH 2Q7YB 3ARTA 4X7EC 1Y6NR 4YNYA 5B4MD 3GSWA 2ITDB 4P9MH 1MPAL 3MJ7B 1NAML 2JIXA 2F53D 2NY5H 1MAJA 2P7TA 2AAVA 1FYTD 4KMTH 2IMMA 5B38G 4NRXB 3U4EB 2HKFL 3LQAL 4ZNEA 3K2UL 3MRMB 4LLVA 3AFLA 2B20A 4F7MB 3PF2A 5GS0C 1MLBB 4F57H 4WHDA 2EDDA 1HIMH 4GW1A 3WFEH 2D31A 1FJ1A 4KTEL 1JP5A 4KVCH 5KJRL 3JV5A 4CVWA 4RBPK 5BS0E 3JWDL 1HILA 3HNTL 4OLWL 3PP4L 4PTTB 4Z7VE 1UENA 4B41A 3AREC 5CUSL 2DB8A 5IMMA 1NGWB 3MJ9H 4ZUWA 4QGYA 1AI1L 4OLUH 4GKNA 3IAPA 3MRJA 3TVMA 5FUZH 5F70A 3VWJB 3RJQB 4P3WA 3UXFA 2GYSA 3IYLW 5JXAL 4YAQB 2XXCB 4WU7A 1VDGA 4NNYA 4KK9C 4ELME 4Z9KB 1NC2D 5JZ7C 1CXHA 4KHTH 1S7SB 4TSBH 1ZLSH 1BJ1J 1QYGL 1MRDL 4F58L 5SX5K 4N0UB 2IQAA 1K6QL 4Z0BL 4CW1A 4D0CB 1CFTB 2YUXA 1OTSD 3S36H 2CGRH 5GZNC 4Z7NF 1ROWA 2FBJL 4JM2A 1QVOB 5JZ7D 1EHLH 5IVZA 2V9RA 3WNPA 3QUMH 3ZLQC 1WBXB 2BVOB 4QOKA 3V5DA 4KKCC 3QUXD 1ITCA 1F4YH 1W0VA 4ZFOB 1K4DB 1OTSC 1X5FA 4PRIE 1Y6KR 4PGDB 5FYJE 2EE6A 3V8OA 3LKPB 2KQNA 5IWLC 5BVPH 4ZUUA 1T66C 5D1ZD 3WUWA 2GCYB 2HLAA 3OPZL 2ARJQ 3WIHA 4NFDA 2YUVA 5FUOH 3MODH 3GIVB 2IAMD 1YPZA 5CKGA 2VO5A 4JDZB 1RMFL 4BJLA 1NL0L 4PJ8A 3WDHA 2P8MB 5CJOH 4KKLC 5KVGH 3LPGA 1RJZB 3KWWB 4P23D 4WU7B 1Z9SA 2AV1B 2X9WA 3QDMA 1ZMYA 4CMMB 1R3JA 3I6KA 4LU5L 1RZKL 1CLCA 2UZXB 3CGTA 5GRYA 3MNWB 4YE4H 1K3ZA 2EYRB 4WFFE 5JORB 3IXTB 3S3JA 4NM8H 1PKQB 4X6CA 1MCWM 2XNAA 1UVQB 4XMKL 4KUZL 4OM0L 1BBDH 2XZCL 4UOW1 1OAZH 5EBLB 3P0YH 3MUY1 4PJIE 2DQTL 3F6LA 5GSVB 4OZHA 1MCFA 1OTUC 4PP1D 2CQVA 2XZAH 1K3IA 3BP4B 5FM5O 3R06B 4FXLA 2E7LA 4D3CL 3DJ9A 1IAKA 4NO0D 2R1WB 2O5ZL 3NABL 1RIVH 1WC7B 1Q0XL 3PDDA 5I15L 3TO4C 3QPXH 1MRFL 2UWEF 1V7MH 5FA3A 2H9GA 3DLQR 3CVIH 1F3JB 4IOFD 2YZ8A 3KS0J 4WU5A 5E6YA 4IDJL 4PY8J 3QUKA 4MMXC 2QQNL 3FO9B 1AE6L 1IBGH 1CLYH 4R96A 2HVKA 1JGDB 5F8QC 5E5RB 1DVFA 2X1XR 2A6IB 3GMOA 4PRPB 2X6MA 1BP3B 5F9WB 3MO1A 1W8OA 2JB6B 4CGTA 1BZ7B 4N9GB 1S5HA 2QQNH 3GHEL 1G9MH 2JE8A 5DYOB 3WHXA 1WT5A 3PWLA 1BFOB 2CLVA 4L3EB 1NCCL 5DMKB 1IM3B 3I9GH 2BVUA 5GRUL 3KYNB 5LAXA 3QG7L 1XGRA 1F6AA 4M8VA 4GQPH 4XNUH 3PGFL 2R0KL 5EFIB 4CVXA 2IALA 1UYWH 2GJ6E 1YN6B 5BO1L 2AEQL 4JHAH 4NO0A 5DMIL 1JV5A 2Y36H 1WUNT 4M5YH 5D6DA 3LRSB 1T0NB 5I16A 2V6HA 2CXGA 1LD9A 5AZEH 1GJIA 4AY0A 2R0ZH 4XXCA 4ELKB 1T1XB 4WRLA 5EZJA 2VXVL 2VUYA 1FZKB 3U83A 4LKXB 1HH9A 2OL3B 3HLAA 2ZUVA 4B7IA 3QZWB 4Z7VB 3PE9A 5ILTL 5ICYA 4GKOA 4Q7DA 1NGXA 2XRAL 1IGYA 4X8XA 2AXGA 3QUXB 1HQ4A 1I1AA 5D5ME 1WVZA 3B9VA 1WAAA 4EUPA 2KPNA 5CGYD 1MCQA 4O51B 4RMRA 4WFED 1DLFL 4PREB 1MUJB 5FYLL 3TBYB 1HHKB 1P2CB 4BQ6A 5C92A 2MJWA 5FCUL 4G9FE 4EOWL 3QJHA 4YFLF 4Y5XB 1HILB 1MCEA 2ICEA 3WDIA 4NKOA 3LH2L 3GI8H 4NO5A 1KBGH 4N5ED 3DO7B 4LCIL 4JDTL 4FP8L 4LRIC 5DRNA 2DLIA 5DMKA 3SOBL 3PHQB 5T1LA 3MNZB 1V3LA 4Y5YA 4PJHF 2V9QA 3H2WA 4BELD 4U2ZA 25C8L 1CGVA 4K9EH 3LN5B 1JPGB 1IQWL 5T33H 3NH7L 1KEMH 2X41A 3SCMB 5D6CB 3QNZA 4ETQA 3CLFL 5HY9A 5DD3H 5L6YH 5DSCA 2R1YA 1I7ZB 3Q5TA 4NKDA 3S4SB 4R8WH 3TN0C 3RY6A 4CU6A 5DK0A 1J05B 5CAYB 4OZGB 4J3OC 1MJ8H 1X5LA 4U3CA 2R23B 5C7XL 3DV6B 3D85A 4K94L 4K7FB 4P2QE 4JKLA 1EO7A 3RPKA 5DDHB 3QQ3A 4DOHE 2BOCA 4EUPB 4GAGH 3RTQA 1A5FH 5TE6L 1Y0LB 5HPOA 1RJLB 4HWBA 1DVFC 4R3SB 2VQ1B 3RU8H 5HTSA 3WFHB 3WE6A 1E28B 2V2WB 1U8JA 3F58L 5JIKA 5JDJA 4Y2DA 5F89A 2OXGA 3MYJA 3E3QE 4H88H 3NN8A 4BSVB 5EOQL 3O4LA 1NMCC 1DN0B 1WTLA 1N7MH 2Y07H 2MCPL 2F58L 1XF5B 5CINL 5C0BE 4XBGA 4WI4A 1KIRA 1XGUA 2ED9A 4YQXH 1MH5B 3MLVH 4OZIE 2GITB 4PRHE 2ENSA 3S36X 2E27L 1JI1A 4YBLB 1E4XH 1R3JB 2BRRL 5CJOL 1CGYA 4OZFA 1N6QH 4MZ3A 3MLVL 1A3LL 1K4CA 4PP2B 1RJYB 3IXAB 1AGEA 2A38A 4RNRB 3TVMC 1T7WA 1URLA 1XR8A 3OAUL 3MRIA 5ALBL 3KYMA 3QCTL 2WUBH 1RZFH 5CEYB 4M03A 3SDDB 3D85B 3RWGB 4XVTH 1WV7T 4ZFOL 3HZKA 4Y4HD 4DW2H 5LQBL 4RRPG 2ATPA 4MJ5A 2NY4D 2LV4A 5KTEH 1PKOA 2XPGA 2BY2A 1JHTB 4HUUB 1BJ8A 3EJZC 4JM2F 4KZDH 2XQBL 3LZFL 1FIGH 2X89A 3LKOB 4EDWH 4M93C 3FOLA 2NY7H 4FN0A 2Z8VC 2IANB 1DN2A 3LSOA 4I5BA 5K9JH 1U8KA 4V1DE 3DVNA 3SE8L 1A9EA 1MVUA 3U9UB 1XF5A 1YEGL 4MX7B 2HN7B 1L7IL 3CPLA 3K2MC 3KPMA 4FZ8H 1D5XB 4ZDHA 3DRQA 2F8VA 4G8GA 4C56A 3ARYA 1HXYA 1XIWB 1QD0A 4QNPE 5BV7B 1T5WB 1FAIH 4LIQE 5DQ9A 2YD1A 4OZIB 3L5WA 1BZ7A 2XACC 5IEKB 3N85H 4HWZA 3JWDC 3CLEH 3QEHA 2VISA 5KSAA 1PLGL 5D7JB 4M93B 1X3DA 3VD4A 1A1OB 5IVZB 4G80A 1JZ7A 2CIKA 2E7BA 3GJFH 3G6DH 4RQQB 3T2QA 1MHEB 1RJCA 2HFGL 3OJMB 1RK0A 5EO0A 2Y1VA 3C5JA 1FPTH 4ONGL 3UROR 4FQPA 1UACL 4AM0B 3VXQB 4EVNB 2F74A 4PGDA 2VLLB 4J6RL 4ETYA 1ZT1A 4GRMA 2ESVE 3VFPA 5KSBB 2I9LB 2VQTA 4MXQC 1E4KA 3DX7B 3TT1H 4BZ1H 5F7FA 2J2ZA 1LE5B 2RR3A 5GS0D 4R4FH 3HZMB 3VFUA 4AK1A 3GUTA 4DKAA 1ZLWK 2EDQA 4ONGH 4N0FA 1AR2A 2J7LA 5E70A 3BP7A 4ODTH 2Y5EA 3IS1X 1S7WB 3MV8A 5ITBL 2KL6A 5L88L 1U8PA 1U95A 5E9DD 1Q0YH 4HPYH 1BQLL 1C12B 1OAKH 2FATL 5DURD 5F96H 3SDXA 5C70A 5JQ6L 1A7PH 4WCYL 1BD2A 3WIHH 1CD0A 2NX5A 1QBLL 1PZ5B 3O4LD 3BH8A 4K9EC 4ZXBC 3MRLB 3DRQB 3L95B 5D2NE 3U1SL 4TSBL 3LEXA 2ZNXA 4TPRH 1L0YA 3MA7A 4JDVA 3SE4C 2XTJD 4M6ML 4WY7H 1KJMA 3UX9B 3ARFB 4YFDB 4L5FH 4LSSL 4ZXBD 1I1YA 4L29B 1INQA 4P3DB 5L9DL 1W0WA 1XGQB 2N7AA 1QO3A 3JV4B 3T4YB 5J13C 2CRYA 3FN0L 1Y18B 5E1HB 3TNMA 4LQFH 2QKIA 1LEIB 4AH2A 4RFOH 2V17L 4PJEF 1Q9LB 5ESAB 1TZIA 3VMNA 1KEGL 4JO1L 4KQ4H 2FHBA 4Q6YA 5INCB 3JTTA 3QUXC 4YHMH 5F6IC 4PGJA 3E1F1 1KXQE 3MRPA 1UKSA 4ODHL 1BREA 2V7HA 3O8XB 3HTLX 3MOBH 4WHTA 5MEOB 5C07B 5A3ID 4LPUA 4KHXH 2ZUXA 1T66D 1QFWM 4NWUH 5D1ZC 5BVJA 5T3ZL 2CDEB 4CBPA 3RZCA 1MI5B 1A22B 1I3RA 4EI6A 1OY3B 2HVJB 1AQKH 3U0WL 2OJZL 3OF6A 3ARFD 2V7NA 1OT2A 1LEKB 4AMKL 3TIEB 4JFFA 5K9QI 5IVNA 4BQ9A 3QIBB 3MLSH 2F8XC 4JKPH 2QLVB 2JIXD 2PTTB 1XMWA 1SHMA 5EC2A 2R0WL 4BUHA 3VXUB 3UPRA 1DUYA 2FHCA 1A9BB 3UAJC 2H32A 4R4NC 5E24E 4HXBH 3VXSD 1FZOB 4GMSH 3REVB 5KS9F 4ERSH 2HT4C 3KNBB 3HZYB 1JGLL 1RZ8B 2APVA 2EC9T 3P0YL 4UTBH 3S98A 1RU9L 2FX9L 2QL1A 4Y4FA 4GMSL 2Y07L 1B6DA 2GK0B 1EFXB 1RK1B 3S96A 1CXIA 1GL4B 1U8OA 2XZAL 3BISA 3GIVA 3NIFE 3ZYIA 1HDMB 3R1GH 2X1QA 4RSVA 3QIUB 3LEVL 4UTBL 5AWNH 2V5SA 1R3IL 3OR7B 5MHSD 2MCG1 1FO0B 1OL0A 3EJJX 4WUKL 5IESL 1J1XH 4OCRL 1MIMH 4RGOL 3X11B 2D4FA 4G7YH 4JB9H 4P4RA 5T5NF 4ZFGH 3RZCB 5IM7B 2DWDB 1I3RB 4EI6B 4MWFA 2VKXA 3U4AA 4MJ5B 5IMKA 4WUKH 1C7SA 3EUUA 3IDJA 1OSPH 1CZ8L 1YYML 1RFDH 4GXVL 3IXTA 5E8DH 3CZFB 5J13B 1NSNH 3MLXH 2PO6D 2X4PA 1TETH 1EJ6A 5D7JC 4APQC 1DFBL 1BOGB 3WKMH 1NEZA 1S3KL 5IB2B 1ETZA 3CUPA 2B1HL 5EWIL 5F9WC 3VXPA 3NA9H 5AAMA 3RA7H 1U8NB 3I6GB 4XH2A 2OM5A 4XZUB 4NN7C 4KI5D 4HH9B 3QG7H 3ZTJG 1BAFH 4FFWD 1QA9B 2PXYD 1KN4H 4KDWA 1E6JH 4LP5A 4FFVD 2VDRH 1NFKA 1T6VN 1S9XB 4TULL 4PGCA 1QLRA 3H42L 3UJTH 1U8HA 4Z5RA 1JZ4A 4X6DA 4KTDL 1M05A 4X7TB 4UZGA 3VI4F 4DTGL 5DJ0B 2NZIA 1MHPH 2AK4B 4U2YA 3VWKA 3QIBC 5GGTL 1LP9B 1EZVX 3DX8A 4JE4B 1NQBA 4MJ2A 4OSUL 2RQ8A 2Z92B 1DQTA 1YEKH 4NWTH 1N0XL 2JLLA 4L9LA 3FFCA 4X4MA 4LGRB 4G6KH 4DGVL 4UQ3A 5K9OB 2I9LA 3G6JE 1AP2A 3QIBD 1X5YA 1GAFH 4LASL 3T65B 3FQNA 4PB0L 1E28A 4UNVA 3QULA 1ES0A 5A2JH 2AJVL 4OFKA 3RKDD 1AHWA 2UWEE 1B0RB 1E27B 3H9YA 5DFWH 4R26H 1NGWA 1ULVA 4XRCA 2O93L 4ZPVA 4LLYB 4WW2A 3R8BB 4PJBB 1WEJL 1U3YA 2IPUK 4XVUD 3FT4B 4P4KD 2A9NL 1Z3GL 5HYQB 3RKDC 4KU1A 2NY1D 3IKCB 1G0XA 3KPNB 5IVXB 4PJIF 2J8OA 1WEJH 2FSEA 1U91B 1FZKA 3CLFH 5KZCB 4A6YA 1NMBH 5IMLA 1A14L 3OR6B 1FL5B 1R5VB 3D9AH 3NIDF 4HKZB 2Z93A 3C5ZA 1J1PL 2M26A 3F12A 4YDIH 4TPRL 3KDMA 3DO3A 2DQFB 5D2LF 1NC4B 3O6ML 4O51A 3MREB 4XNZC 4N8PA 4ZFFA 1EAJA 1YDPA 4PJDE 1NJ9A 4HZLB 4POZD 2X1WL 3MACL 1YEJH 2DL9A 1A0QL 1CU4H 5KS9E 3GSRA 3EOAA 5FFLA 1A5FL 3OAYK 3WNNA 3MXWH 5IHBA 2JB6A 3MV01 3F58H 4JVWA 3GM8A 1QNZL 4FQHB 1NAMB 2V5MA 3MLZL 1KTDB 1QTYT 1JZ5A 1FFOA 1SBSH 3NFSL 3OKLB 3CIQA 4JFDA 2D03H 4TNVK 3ILQD 1H3VA 5SWQB 4GT7A 4NUJA 5ACZA 1HNGA 1LO4H 1KYOK 4X9HA 5I71B 5KG9B 3NFSH 3SKMA 3KYOA 3LEYL 5GIRA 2FIKA 1GGIL 2H32B 5ADPH 2BVEA 1IC7H 2FL5A 3HE7A 4R7DA 3SGJC 5BJTB 3G6JF 4DFIA 2A74B 4HF5H 5T1KB 3VE0A 5L8LB 4CUCA 1DANU 2DKUA 3PQYD 3CJJA 4UUJA 5C8JA 1N4XH 1NCTA 5HBBA 1R3HB 2AKRA 1UADC 1CQKA 3SQBA 3S4SG 2EDEA 2RAMA 5KW9L 3RGVC 2VLLA 1AXTH 2V2WA 1NCBH 1XIWD 4LCYB 1ORSB 1WT5C 4U33A 1WZLA 1KOAA 1KPUA 3OWEA 3QIWB 1WC7A 5IBUG 1M7XA 1P9MC 4K7PH 5CJ5A 4X83A 3BT2L 1KPVB 1CFQA 3QNYB 1YJDC 2NY7L 5E08H 4S2SB 3BOVA 1FORH 1NAMA 2Z31D 4UV7H 1INEL 4JZNB 3SE8H 1IM9A 4IRSC 3TVMD 1MREL 5DEGA 4M7ZB 2D7TH 4NOFA 4NO3A 4QLRA 4RGNE 4G8IA 1QR4A 2DQIL 4ZUVB 4FZ8L 4P2RD 3LS5H 1DQJB 2SEBB 4NN6C 5DEFA 3MC0A 1KPRA 2KZWA 4UDUB 2X05A 4JM2B 3OKYA 1DL7H 3ZHLA 4LDEB 4RMSA 2IF7A 4XGZB 1CR9H 1A7OL 5HGBB 5MI0B 3V4UL 5A1AA 4ZOCA 5F8RC 3UP1A 1ADQH 5FUOL 2WUCH 3QDGB 4MNQA 5E00B 3OKOA 3Q6FA 4EIZC 4OGXL 5E6ID 3MV7A 5T3XL 3RAJL 2L7JA 4L3CA 5ICXA 1YEDA 2ZOKA 3MRRB 2V2TB 3V4VL 1MCOH 2F54E 4S1RH 1SJEA 1JIBA 5LGHL 2NY6C 3AC0A 3A6BL 4RAVB 3QRGH 2R15A 1BAFL 3WYRA 4I3GA 4BZ1L 4KJPD 4G6AC 2I60L 2ORBH 43CAB 2YPKA 2FZ3A 1UM4L 3KJ4B 1TTGA 1SEBA 3QZWA 3BZ4A 3V2AR 5FUCC 2GSGB 1JK8B 5L88H 2H6PA 5J11C 1KNOA 2HWZL 5JQ6H 3IDXH 5DC4B 3ARGC 4UDTA 5K9OA 4OD2B 3NOIA 1XGYH 3NCCB 3ULVE 5HGAA 4B50A 1ZLWH 1A4JA 4MXVF 4X8JB 5IVXE 3BN9C 1AC0A 4LPXA 4RGNB 5EBMB 1TITA 2LVCA 3QIUC 1T20B 4X98B 3TH4T 2RCSL 3V52H 3ZKXC 3P9MA 1IAOB 3T0ED 1KCUL 1GYAA 1XEDA 4Z7UF 4PJGE 1HYRC 3PHQA 1KCVH 1DEEB 4GBXB 4IDJH 5I1AB 4G8EB 3BN9D 3DX9B 5HI5D 1W0VB 4ZFOA 1N2RA 5F72S 3AVEA 5HYQA 5HHPA 2OXHA 4JCLA 5DJCA 3GJEB 1YY9C 2NY1B 5KVMC 1U0QA 3LKSB 3DV4B 2J6EA 4BYHA 3L3IB 1BHGA 5ESVB 4MJID 3SGKC 5DK0B 1JGUH 3SJVE 5I17A 1WWWX 1JF5A 3TWCL 1A1MB 4PJEE 2AGJL 4Z18A 2XN9A 4GKSA 3KG5A 4QKXB 1OCWL 4M7KH 5KSAC 3C6SB 5C9JA 3B6SA 1AY1L 5CBEB 3L5XH 4ZS7L 2MQ3A 1BVZA 1P84J 2EDWA 1EUTA 2IEPA 1QHOA 3O6FB 2HLFC 1XF1A 1UYWL 5I1LB 1ZHKA 2YN5A 1OCWH 2ZOLA 5IFHH 5FK9A 1FNGB 5JDSB 3RJDA 5SX4I 1CXKA 4Z7UA 2HJLA 2NXYB 4OUUB 5KSAD 2QV2A 2XQYK 2DBLL 4HQQL 3VFGH 1LP9F 3GSXB 2ITDA 1E4KC 4QHLA 4H1LG 1BX2B 1UQSA 5BQ7B 5HHXL 4HUMB 3HC3H 2FX8H 5ECJE 3KS0H 1UGNA 3EO1B 5DMYA 2F5AH 1JUFB 2EYTA 2R2HB 4PJAE 4QXGL 3DI2B 2CGRL 3GHBH 2WM0A 5C08A 5JOFA 2XRAH 4LLWB 5IEHA 5E5MB 1G6RH 1KTKE 3BEWA 3MCG1 5DD6A 1XCTB 1UKQA 2OJEB 3TCLB 4P49A 1LGVA 2YMXH 2AJSL 3ULUE 2WWKO 3G9AB 1IGIH 3U46B 5I75B 5DO2C 2UYLA 4JFXB 2G75B 4H1LB 1I1CA 4AG4H 1TFHA 3ZDZF 4ZNEE 2F5BL 2FX7H 4P2YA 1P7KA 1IC7L 5D96C 2YXMA 4PG2A 2F53B 2PTTA 4JKMA 1F97A 2OR9L 3MV7D 4OKVA 3ARDA 3W0WE 2NXZC 3WLWD 1A3RL 1I75A 3GSUB 2KKQA 4HFWA 3O2DA 3QIWA 1D6VH 4M48H 2VB5A 5GZOD 3NACH 1WIOA 4AL8H 1JZ3A 2CLVB 1RUMH 1M7DA 3DHMA 2QTEA 1F2QA 3Q6GL 2NY2C 3DX6B 4M61B 1GGCH 1MCIA 2P47B 4Y1AB 3TZVA 1YEIL 1S78D 3CMOH 1MJ8L 1Z5LB 1XT5A 5C0IA 3BP5A 2KQMA 5FEBA 4YXHH 3OQ3B 5EA0L 1YNLL 5EOTA 1JMXA 2PXYC 1OAZL 2F8OA 2NY2D 1FL6A 1BVLB 5EOQH 5L2JB 1S7UB 5FYKL 4WO4D 5TE6H 5J6GA 1C5DB 3GMQB 3V0WL 1WLHA 2AI0H 5JR1L 2EECA 3S35X 1ZA6A 3RU8L 3P4OB 3VXRD 5C08D 3QQ9C 3G04A 4U6VH 5C0ND 3UPAA 4UNUA 2LU4A 5L7XL 1TJIL 2CIKB 2VLJE 1OP5K 3MR9B 4UIKH 3VMPA 3NMEA 1RURH 3QI9A 1AFVL 4UV4L 1OGAE 4BZYA 3P9LA 3NCEB 4U3HA 4KI5E 2PXYB 3CFJA 4JY6B 1OPGH 3IU3B 2DWEA 4D0DB 2ICCA 2ICEB 2K7QA 4Z95H 4KMQA 4Q9QH 1IFHH 1TTUA 3SKNA 4JZJA 1UEYA 1HHIB 1G9NL 1I3VA 3IJYB 4HD9A 1S7WA 1MCPH 1NLDL 3MRHA 3QRGL 1U8PB 2MKLC 3QP3A 5IB4B 4E41A 1QSEA 2WWMD 1P7HL 4OZIF 4R26L 1IFHL 4LHUG 5TFSL 1HI6A 3C8KB 1HQRA 2ORBL 1KB9K 4ZSOA 3P11L 3VG9B 3KLSA 5JXEC 1MCPL 1NLDH 3SGDH 2GFBB 3OKEB 3G5XB 5D93B 4ODUB 1PEZA 3HE6A 2Q7YA 3T0EE 3RIFF 3QO1A 3UJIH 4Y7MA 2NY1C 4DEPC 3HAEA 2FCBA 3V6OA 1I3GH 2VZSA 3E6FA 3UO1H 1INQB 5CP7B 4XBEH 5TH2A 5IMOB 3HR5A 4N1CA 3BZFA 4MS8C 3DI3B 4LCWA 4B0MM 1HOCB 2H26A 5BRZE 4HHAA 5KSUB 4ZUUB 2MSPA 4Q6IC 1ZGLA 4K2UH 1SVCP 3PL6D 5JW4R 2VLJB 5D1QB 1N59B 2VR4A 2VLKB 1CVSC 1VADA 2XFXB 4GW1B 3QZWG 3GSNH 1ES0B 5C0RH 3BFOA 2CKBH 5DJYA 4PRPA 1ZHBA 3FKUS 1UJ3A 3JWOC 3MO1B 2J8HA 5C6PB 5JTWA 3WFBL 3NCJH 3N85L 1WQVT 4ALAL 1YY8B 2IPKB 1ZGLM 2BSRB 3MRBB 4MCZB 1MVFA 3CH1A 4NM4L 3AY4A 4KQ3L 5CBEA 1QSFA 2E7HA 2R0LL 1RHFA 4NO3B 3DURB 3JWOL 4H5SB 4HK3J 1MFCL 5T1MA 2AGJH 1EV2E 1KJ2B 2P42B 4HS3A 2AJUH 4G9DA 4U1LB 3GJFB 5DK2A 4GO6B 1KIQB 4JO3H 2FATH 4W4NA 1IQWH 4JJ5A 3IFPA 5T33L 3MRIB 3TBWA 1HWHB 2AK1H 1FYTB 3HA0A 4LARH 3VFGL 3V5HB 3TBVA 3LKNB 4U1GC 3VXRA 1YEDB 4LSPH 2OI9C 1RIHH 4WCYH 4WFHD 2C7UB 4HLZH 4KK6D 4R0LA 3VFSB 5ICZB 4LEXL 4HUNB 2UZIH 5KW9H 4OIIL 3S5LB 1A6TB 3OGOE 4L8BB 3RGVD 3MV8B 3GRWA 2CLZB 2VZ3A 2GEEA 5TF1H 5FB8A 4MQ7A 1CQYA 2OCFD 3PWPA 3VG9C 4GAGL 4JO4H 3GK8H 4M7ZC 1CGXA 3D3VD 1YN7B 3IDGA 1JRHL 4XVSH 4PV8A 4YH6A 2VLRB 1JF1B 4JN2B 5DRNB 1GC1H 3V6FB 4MWFB 1AIFA 1JWUB 4WWKD 3KWWA 4M7LL 5FKAA 5H2BA 1OAQL 3DUHA 3WNKA 3OGCA 5HHNA 1CI5A 3KR3H 4YDLB 1TIUA 2ZNWA 1YMME 2Y06H 1QFHA 5LCVL 4U1LA 4HKJB 4CNIA 4M7LH 1EDQA 4D9QE 1KIQA 1I9IH 2B7DT 1IKNC 1OQOA 4LRIA 1M7DB 3PWVB 4KDTC 4HIXH 1UWGH 4P57B 1U8NA 5DUPH 4GBXA 3U48A 5GSVA 1UB5A 4P59H 4NM8L 4BFGA 2Q6WA 4CAGA 1MCBA 3BSZL 1IARB 2AEWA 4LOUC 4YIQB 5AYUH 3MBEA 1IGJB 2VUOA 5C0CB 3RVXC 3SY0A 2P48B 3QWRD 5I8OH 3TJEH 3LKSA 2R1WA 4NC2B 4WI3A 4L8BA 4DUXA 4NQEA 1TPXC 5EOCL 3SDYL 5ANMA 4GOSA 4PTUA 4KKAD 2YUWA 3LB6D 4R6UA 4AEHL 1FIGL 3TJEL 4FABH 3THML 5SV4A 4YBQD 2O5ZH 1MAML 4BFIA 4O02L 2A77L 3C8HA 1Q0XH 4QWWD 5JHLH 2WINA 1CDBA 4XHJC 5HHMB 1BEYL 2Q76A 4OT1H 3GMRB 4NHUA 4MB5A 4L1DA 2JK5B 4JFDE 1XGYL 2B2XH 2P24B 3GO1H 3W5MA 3QEQE 4MB3A 1J1XL 4OCRH 2NY3D 3HG1E 1D5MB 2ARWA 3WLBA 3I84A 1JMZA 3B9KD 5TQ0L 4OD1L 5GJTL 4QNPF 4PP2A 5T1DL 1E27A 4PLKD 4F15B 4WWID 1IQDA 1KELL 4LHUD 4GW5A 3CXDL 4IIQB 5HVHC 1OB1A 1SBBA 3QIUD 5EO1A 2WLYA 1ZANH 5J8OA 5SWSE 5IFJA 4Q74A 2UY6A 4APQA 5E4EC 1CXFA 3QIWC 4YHIA 3U7YL 4YHOL 3T0BA 3MRPB 4AZ8A 5C0EA 1FV1A 3BQUD 3K4ZA 3BE1L 1I9JH 4UAOC 2B1HH 1ZVSB 3ARGD 5EWIH 1DBAH 2P5ED 2VERN 2XTJC 3P9WB 3TPKA 1TZHB 1S9WB 4ZFZB 3CFCL 3ALXA 3GBLA 1MCNA 3O6LH 2YEZA 4UIMB 1FN4B 3TO4A 1KCLA 4QXTA 1TENA 5AYQA 1CDIA 3AU1A 1ZWIA 1B88A 5ENWB 2F53A 1PQZA 3GSOB 1PVHA 2EYRA 5J1TC 1MUJA 5LBSH 1IRAY 4I3SH 4IMKC 2IH3A 5ILTH 4IMLA 1WZKA 3FAWA 4Y5VB 5KANG 1A6ZB 1H0DB 1T5WA 3QFJA 1N5AA 1J5OL 1LEGB 5A3IC 4XI5D 2IQ9L 3AMLA 2Y5TA 3I6GA 4X99A 3C5SA 1N5YL 4N90D 1KTLB 1RHHB 5SX5H 1C1EL 1OGAD 2BZDA 1WISA 1TCMA 3WN5C 3PWJB 1QFUH 4G3YH 5CEZE 3I6LD 1IAII 4OFPA 4PRIA 2FX8L 2UV3A 4G6ML 4PJFB 3MOAH 3D48R 5K59E 2BSTB 3LN5A 4QYOA 4F8TA 2P5EA 1J9CT 5SWSD 1UCBL 1J1OL 4PLOB 4BH7A 1AGEB 4S11A 4P23B 4PJ9C 5AEAA 2BVPB 1FBIH 3VWKB 4NT6B 4G6JL 5BZWB 4EXKA 5FGRA 1TZHA 4BZ2H 3BN3B 3EHBD 1T89C 4FTVA 3UYRH 5I76B 5JUEL 2FX7L 3QI9B 3ARGA 4KI1A 4CJ1A 1NGYA 4OV5B 3F7VB 4KWUA 3TJHC 4AIZA 5C7XH 3ARSA 4NHCL 4QO1A 5HGDA 4O2FA 1DQDH 2VAAB 5C0BB 3HAEG 3PJSB 2BRQA 3CPLB 2VLJD 4X6EB 4PJXA 4S2SA 3NACL 3WUWG 1W72A 2GJ6B 3PDOB 2COQA 5KN5B 5IB4A 4LLWA 4KPHH 3FAXA 1XGUB 3ZT6A 3UTSE 1RZGA 4QGTA 3JWNC 1GOHA 2GAZB 2EE9A 5H2BB 4H88L 1YN6A 1P7QB 3BP6B 4G9FB 1DQJA 5ALCH 2H8PA 4PUBH 2HKFH 3WHE0 2Z8RA 3Q3GA 3TNNB 2WP3T 4K3JH 2QQLL 3SGEI 4LSQL 1NKRA 1IGCH 2D4DA 3MLZH 2Q3AA 5D7JD 1IEAA 1T22B 3IU4H 3BPNC 1HHJB 3BH9B 3NPZB 5MP6L 2VDPH 1F00I 4ZFFB 3NFPA 1EMTH 1FYHB 4YDVA 1RUPH 2OMNA 5HYSG 2BNUB 2BSSB 5CZKA 3RDTC 3OKMA 5AWNL 4LSQH 4QRTA 3QQ9D 2XT1B 3NCFB 2AXGB 1FNLA 2DDQH 1S7XB 4XCYA 3DX7A 4YIQA 5CIPA 1AFVH 4UV4H 1EMTL 2AXHA 4TVPD 4P0DA 1R24A 2EXWD 4HCRH 4U1SB 5D7IF 4YXLH 2IBZX 4KRPD 3SDCC 2BNQB 3AAZA 4DKDC 3ZKXB 2G60L 3DGCR 4MLSA 2HRLA 4LSUH 2EH8L 4LKCA 2NY0C 1S3KH 4PJFF 2FWOB 5JNYA 4MJIE 3W9EB 1WZ1H 2GTZB 3OZ9L 4JRXA 4O00A 2VE6A 4I18B 2FSEB 4HWUA 2JCCF 2YN3A 1M6OA 5HYEA 2C4FU 1A47A 4QHNA 2KUTA 1TQCC 1T83A 2XNAB 1O7SA 1VFMA 1T20A 3ALPA 2JJWA 2APWA 2B1AL 4K7FA 4PJGB 5GSRB 4AT6A 2AJXL 1J88A 4ZYKA 4BSJA 1UXWB 2DD8H 3JTTB 4Y1AD 4OI7A 3RX5A 3CLEL 3OPZH 4NGHH 3K0WA 2B8OT 4JRYA 4UV7L 1SEQL 3IU3A 2P5WA 2AJXH 4LPVA 5GS1A 1D9KD 2AJ3A 5DVMA 2WWMC 3CXDH 4O4YH 1A6WL 2E9IA 4XWGL 3AGVA 2BCKA 4XX1E 4TRPH 3CZFA 1KGCE 5IMMB 4OGZA 4U7MA 1ED3A 4XAKD 4KRLB 3A0OA 4GKNB 5JPMA 4V2BA 4E41B 4LPWA 3LIZL 2IAMA 4LAQL 1YECH 1DBKH 1GSMA 3SQOH 5ELIA 4GG6F 4GJTB 4WU5B 1NANI 3ZO0A 3G5XA 1JWUA 1OOAA 5DJXB 4OGXH 3QO1B 1G7MB 3OXRB 3VFTA 1GCFA 1IKNA 3EOTH 4IS6A 4PJHA 4Q58C 3EYOA 2A6IA 4KKNA 3F7RA 4PGCB 3K8LA 4B53A 5CEXB 4LDLB 1LNUB 1Z3GH 5EORH 4Q97A 1NDGB 3JTSB 1A6AA 1WFUA 1ZA6B 4I3SL 5IROA 2PYEA 2JELH 1NCUA 1UG9A 3D2UB 5DHYB 2PW2A 1XR9A 4K3HA 1G7HA 5I8EB 2H1PH 4JHZA 1FIEA 1CD9B 4AH2B 2B5IC 3RWCB 2VLJA 4LF3B 4JQIL 4X6FA 2VXQL 4D0BA 4NUGH 1J0ZA 1QLFB 3TPUA 2HWZH 3VFRB 4GAYA 3CFEB 4P3CH 2C9AA 1U3HA 4RZCA 5IR1A 5IUSA 5L0QB 1KB5A 1GC1C 4EDXA 5ISZE 3ZZ1A 4MAYD 1PX4A 1YEJL 3ROLA 4PYGA 2FEDD 1E4WL 4U1KA 3T4AB 3CC5B 4M1CD 1G84A 2JCCE 1HEZA 4JAMB 4MQTB 4XCCL 3W11D 4U6XB 1FAKT 1HXYB 4XPBH 3RIAK 3QXAA 1J0IA 3KPQB 1UC6A 4H0HB