5KOVC

Crystal structure of the human astrovirus 2 capsid protein spike in complex with a single chain variable fragment of an astrovirus neutralizing antibody at 3.24-a resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
245
structure length
223
Chain Sequence
DVQLKQSGPGLVQPSQSLSITCTVSGFSLIDYGVHWVRQSPGKGLEWLGVIWTGGSTDYNAAFISRLTISKDNSKSQVFFKMNSLQANDTGIYYCGRPYYGNVMDYWGQGTSVTVDIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTFPPTFGGGTKLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid polyprotein VP90
publication title Structure of a Human Astrovirus Capsid-Antibody Complex and Mechanistic Insights into Virus Neutralization.
pubmed doi rcsb
source organism Human astrovirus-2
molecule tags Viral protein
total genus 45
structure length 223
sequence length 245
chains with identical sequence E, I, K, O, Q, U, W
ec nomenclature
pdb deposition date 2016-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kovC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kovC01
1KJVA 1S9VB 3E3QE 2B0SL 3MRIB 4NNYB 1G6RL 4FQPA 1FRGH 4P0DA 1VGEL 4I0PA 4DKFH 5LAXA 1UWXK 2CKNA 1F4WH 2FGZA 1AP2B 2YXFA 4U3XA 2AVGA 3UBXB 4EN3D 4YHML 2DQJH 5K33A 1HQRB 3RWHA 4KZEH 4Y1AB 4Z9KB 3T77B 4M5ZL 3VFWA 3MRMA 1C12B 1SMOA 2W9DL 4ZSOB 4X4YA 2YWZA 1A3RL 2ICWA 1QSFB 4M1GH 5EB9A 3VFGL 5HYSG 5JXAH 1M71B 3I6LD 4Y5YC 3T3ME 4DVBB 4M6NL 4F8TA 4DGVL 1XZ0A 5EU3B 3K8MA 4A2LA 2IG2L 1AD0A 2FX8H 1QA9B 2YA0A 2BY1A 4U31A 1SJVA 3MV8E 1MEXL 3UTTB 3IDJB 3NAAL 4J2XA 1I4FA 1C7SA 1JZ3A 1CFTA 4PJ8A 3ZTJG 4HUXA 1CXFA 5GZOC 4PRDB 3TCLB 3MLZH 5KSBF 1B4JL 2VXUL 4XCFH 5H2BA 4NM4L 2DAVA 1IAIH 5F1IB 3WN5A 2NTFB 1TZGH 4G8EA 4IM8A 4L4VE 4KTEH 4E41B 5E6IB 3MJ9A 4RAVB 4D0CB 4LSRL 4KK6C 4WFEE 2R9HD 1JNHB 5F88B 4G5ZL 4FFWC 4G8FA 4URTB 2P44B 5F7WC 1IVLA 2JJTC 3S3SA 4KHXL 1WZ1H 5HHMB 1A1MA 2XY1A 5HI3D 3K7UA 2NY5H 3KPLB 1WFOA 2NW2A 4YHPA 4D9QE 1BQSA 4R4NC 5FYJU 5HI5D 5HVFB 3CFCH 4IDLA 1QOKA 2PYEE 3MV7D 3STLA 2EXWC 1GXEA 2N7BA 3KYNA 1ZT7A 3FJTA 2Y5EA 3LIZL 4X80H 3ZKMD 3PUCA 4H5SB 4FXGA 1AC6A 1CDYA 5EBMB 1CIUA 3NOIA 1Q0YH 4HJGB 2AEWA 4P2OC 5E9DE 3QWOA 1J8HE 1XFPA 1UB5B 2O93L 4HQQH 2JCCF 5BS0A 5JXEA 1IGTA 4XNUL 2ZUUA 3C60A 5D6DC 1LK3L 4ZDHB 4L8CA 1S9YB 2X4UA 5D2LA 4AY0A 3NABL 4YBHA 2QADD 4XI5C 3MRRA 4X8JA 4JFOB 2ZUXA 4GKSA 3V4UL 4B5EA 2ZOLA 3JZ7A 4HS8L 4J6RH 1UJ3B 1DLHB 4J8RB 3WV0A 1OSPH 2P8LB 2MNUA 1VSCA 4P3DB 2V17L 3W9EB 4ODBD 4PUBL 3PDDA 4MYWB 2YZ8A 4ZXBC 1LO5B 4H8WH 4KXZH 3U0PB 1I8LA 1PKQE 1MFAL 4WO4C 3GB7B 3QCTL 1TJGL 4KKLD 2EICA 2Y07L 5L8LB 4C56D 3LS5H 5I1AA 1KBGH 1MUJA 3PNWA 1N64L 3DX6B 1BD2E 1SYVA 2F54D 2HTKC 3TBWA 3CZFA 1ZVYA 1S8DB 2ERJB 3G6AB 1XIWA 2UZIH 2WBJA 3D39B 1MOEA 3OR6A 2ATKA 4H0GA 5FCSH 2GK0B 3VXQA 5DJ0A 4KDVA 3WJJA 3TO2B 4HWZA 3O6MH 2CRIA 4YX2H 5DHYB 1R5IA 4TOYH 3RKPA 4FNLH 4XH2B 1TQCB 3QUZA 4AENA 5IMLA 3EO9L 4F57L 3ARVA 4PP1D 5I1GH 5CUSL 4EBQH 4UIKL 5C0RH 4M3KB 2BVUA 4NT6B 2JJUA 1ADQL 3MSPA 1G7JA 3AS1A 3NZ8B 3SKMB 1BX2A 3V6OE 1NGZA 1NGPL 5JIKA 2EKSA 3JTSA 4KVNL 1I3GH 5ESAB 2RGSA 1KTKE 3T4YA 4YDKH 1FO0H 3FQXB 3CSBA 3CFBB 5FV1L 3STBA 3LSOA 4HZLA 5JMRA 1DN0A 2VZTA 3NA4A 1T04B 5IK3B 3RWEB 3OX8B 2OR9L 1JN6B 2OTWB 4DUXA 3D85D 2NLJB 4QT5B 3QAZB 3DBXB 3EYVB 1TXKA 3VRLE 1FC2D 1I7ZA 1N0XH 1DFBL 5GGSA 4TPRH 1NCAH 1IEAA 3KPSA 1NEZB 3MLYL 4DEPB 4PJAE 5JR1L 1T7YA 2H9GA 1ZWIA 5I9QC 4HULB 4YHYC 1OF2A 4N0YL 3ROOB 2F9BT 4M1DH 1EGJA 5GRUH 4KKBC 3QYCA 3SDYL 1KN4L 4FQCH 5TE7H 3QBTB 3OKDA 4KROD 3ZSTA 5FGBA 2DJ4A 3BE1L 4XVJH 1MQ8A 1UVQB 3EFFA 1NAMB 4M5YL 2R2BB 3CFJA 4UT7L 1WEJH 1QVOB 2CUMA 4ZUUA 1W8NA 2DDQL 4NZRH 5T1MB 5IB1B 3QEGH 3NBNA 2HKFL 3B2VH 4MMXC 5JORB 5TH2B 1FL3A 4NUJB 3B6SB 3K80A 4OLWH 5D96C 1WCBA 3W0WD 1K8IA 4MQXC 2SEBA 2ARWA 2OP4H 3MV9E 3DHJA 2JELH 1BWWA 1CU4H 3WEXB 4WGWB 4P4RA 1YEGL 3H7BA 3VXNB 2DQDH 1B88A 1F3JA 2FB4H 1D6VL 1JGDA 2P1YA 4N90D 3BHBA 5IFAL 5GJTL 2ZSVB 3TWCL 1C08A 2YD4A 2CRMA 1B3JA 2ICCA 1YEHH 5IFHL 5F70A 2XYCA 1B90A 1EEZB 3AY4C 5DVNA 1XH3B 1T20A 4OLXL 1FORL 3I6KB 1NUDA 5HYJD 3X3FL 3GSQA 2IPUK 5FYKH 32C2B 2IGFH 1KSRA 4ZO6A 4Q6IA 3R1GH 4GXUM 3KLHD 2FX9L 5ICZB 4CMHC 5AWNH 2D7TH 1CFQB 2HT4C 2DQJL 5E8PB 4NKDA 5DR5H 3TZVA 4LHUA 4J1UB 1WZMA 1GZQB 2O61A 4AYFA 4MJIB 1SJEB 3AROA 2ZUYA 1M05B 1W0VA 3SN6N 4PY8J 2IAMB 2I27N 2OTUA 1QRNA 2CXGA 1IAOA 4QNPE 3F7PC 1OD9A 1KT2A 4P23C 1TVBA 4P4KA 2PW2A 1AY1H 5JXAL 1IGJB 4WW2A 4QHMB 3VXSD 5C3LD 5ESQA 4KGJA 4NDMB 4OZIA 4MNGB 4WV1B 4ZS7H 4XRCB 3ROLB 1TPXB 4HHAA 4O51B 3OR7A 4G8GE 4P3WA 2FX8L 2C3VB 3E6HA 4H26A 5J57B 4XB8A 1MRCL 4G6KH 1X3DA 1P7KB 4QRRD 5FYKD 3LS4L 4Q74A 2BRRH 2GT9A 4AH2B 3KPNA 5AYQA 3ZE0F 3MLZL 2WANA 1JGVH 1YPZF 1Z9MA 3KPQA 4XCFL 1DBAH 5J0BA 1A7QH 1IAIL 1U3HA 4I9WE 4JN2B 3GSVA 4HC1A 5ERWB 4AT6A 3BRFA 1F11A 2GAZB 2Y7QA 1BLNA 3SE3C 4NJAL 4KTEL 4UBDC 1KN2H 5L8JB 3G5XB 1ZSDB 1HCVA 1IAKA 5A16B 1NAKH 2CLRA 3PXJA 5K9OB 1AGFA 4RRPA 4WJ5A 3DUSB 4NSKA 4JFHE 3SY0A 3CFIC 4U1JB 3X11B 5D2NC 4G8IA 4MMZC 3VXMA 4X0KA 1WZ1L 4P2RD 2EIZA 1ZMYA 4MDJA 5CBAA 2DQEH 4PD4J 3TV3H 1SEQH 4HH9B 1OGAE 4DZBB 1T0MA 3QI9A 5BCAA 2VDPH 4MA7H 3CFCL 1TZHB 4F2MB 1ZA3A 3VGFA 4U4BA 2R1WA 4Z0BH 5JPNB 4CVZA 2A77H 5DK0B 3W11C 2ZZUT 4OCRH 4MQSB 1NGWB 4BA8A 1XF3A 1HYRC 3V95A 2HLFC 3OKKA 3BFOA 3AVEA 1Q0YL 3KPPB 4MQTB 1J87A 3MRCA 1CTOA 1WWAX 4MHHI 5FUZL 2CH8A 4HQQL 2CKBA 4UT6L 2VLME 4XWGH 1T22A 1J1XL 3SCMC 2VSDA 4N0CD 2WUBH 4NQXB 3V5KB 3MLRH 3B9KA 1S9WA 1CGXA 2Y6SC 4J6RL 2V5SA 3DARA 5JHDE 1OSPL 1NUFA 3KYOA 3PQYA 1QLRA 1ND0A 1NLDH 4JM4H 5JUEH 2HMID 1OL0A 3PL6B 4WFGE 5GPRA 2X05A 1D5BB 3QFJD 4RX4A 1LWRA 3MRDB 3A0OA 4NQEA 4JFDA 3NIFF 4OZHA 4J3VA 3QZWG 1FV1B 2MSPA 4YE4L 4BUGA 1XF4A 2ICEA 4GFTB 3MGOA 3FFCA 2FIKB 3IDXH 2YS4A 4JDZB 4XMLL 1XCTB 3ILQC 1TJHH 3GMRB 5T5FL 3O3BB 5EU6D 3MRGB 1AGEA 2UWEA 2X4OA 4Y2DD 3T3PF 1Z3GH 4PJXA 4YX2L 2R1YA 2CXKA 3D2UD 1TNMA 2C4FU 4TOYL 5EOCH 4FNLL 5AD0A 3UAJD 1NEUA 2EE3A 4N0RA 4JCMA 3ARGD 1NBZB 5I1GL 1ZLUK 4EBQL 5C0RL 4HWBA 5IW1A 2OI9C 1U92A 1B0GA 4M4RA 1ZVHA 2OQJB 3VXRB 1A1NA 1I3GL 3QWRD 3P4LA 1C5CL 3PHSA 4EI6A 4YDKL 5F1NA 1FO0L 5CJ5A 3N06B 2ORBH 3ZHLA 4B7IA 1N59B 2H3NA 4HJJH 5DD3H 4GKOA 4P9HC 4X7TA 2HH0H 1WAAF 2EXYC 2QLVB 4CU6A 2WLZA 3QIUD 4HIIB 1UWGH 5EU4B 2DKMA 3BH9A 2QSQA 4I18A 3VE0A 1IC7H 1N0XL 3NPSB 3WFDH 3DNKA 4TPRL 1Q9WA 1OTUC 3G6DH 2F58H 2P7TB 5J11B 2BP3A 4NKIL 2P5WB 1K2DA 3QSKB 1ZGLB 1R5WB 5GS0H 1RJZB 4TN9A 1A7PH 4DJMA 4WI8A 1RJYB 2KL6A 2B5IB 3Q3GB 3VWJD 3BEWA 5GRUL 4C54A 3FZUC 3EZ8A 4DCQA 3QXAB 4HWEL 1A6UH 4FQCL 3GJEB 4PLNC 3RGVC 4TNWF 5DMKA 1T83C 2HFEB 3C9NB 4MNQA 5JQ6H 3SDCD 3ARFD 1CDHA 4XWOC 2ZPKH 4MB5A 2YD6A 3CJJA 4KRPB 3FO0H 4E42B 4JQIL 3I6LE 3PV6B 1EUUA 4DVRH 1DBBH 1EO8L 1I9JH 5EA0H 3FTGB 3DUUB 2OXHA 2XACC 4K7FA 5GS2H 4IMLB 5HPMB 4S1DD 4NZRL 2ED8A 3QEGL 4M61A 3VFNB 4ZOEA 2CUIA 3B2VL 4QXGH 1AIFA 3VFVA 5ILTL 2ZJSH 4X9BA 2VL5B 4Y1AD 4NO0A 5CFHA 3BKJH 4ZS6C 2VOTA 5D1XB 5GS0D 2OP4L 1CU4L 5E7FA 5DUMH 2JJTA 5DYOA 1KLGA 4YXKL 1JV5A 1A6TB 2DQDL 3O2DA 3QXTA 3WLBA 4AM0B 2D31B 1XAUA 1MHHA 2FB4L 5EO0A 3SJVB 1A47A 5FOBA 5KVGH 3HAEB 4PV8A 3WUZA 1I9IH 4JDVB 4PPTA 2HKHH 4MS8D 4FQ1L 5AUMA 3PWNA 1KLUB 4PRAA 4X6CA 2BVOB 3UTTD 4YHIA 5GS2D 3PWPA 1MJJA 3QUKA 5FYKL 1RU9H 1IM3A 2IGFL 2BCKA 1LO0H 3IFLH 1D5IH 2OJEB 3R1GL 3SQOL 3T0EE 3C8KA 1AGCB 3PP3K 1JNJA 4YIQA 5AWNL 3O6LH 1MY7A 4NN6C 1JPGB 3I02A 3MV7E 1I3VA 1U2CA 1VFOA 4Z76A 4WENB 4KZDH 2CK0H 4E41D 5E6ID 1LK2B 3I50H 4LP5A 3A6CL 5D6DA 3VGHA 5HHQA 1AY1L 5HHXL 4GRLC 1VFBA 3ULVH 1VKXA 3PP4H 4ZS7L 2FGWH 2QQKL 5CLTA 2XXCB 3BEVA 5HHMD 3N1QC 4X9HA 5B3JE 1F4HA 5SX5H 2XQYG 1ROWA 4I0PB 5LAXB 4G6KL 5GZNC 3IAGC 2HJFB 1PX4A 3RWHB 1N2RA 5T1KA 3WDHA 5BVPH 3D1MC 5C1MB 3VFWB 3OJMB 3MRMB 5SX4H 4X4YB 1CDBA 1FFQA 5HJ3A 3PWJA 1NJ9A 2ICWB 1NFDE 3MLSL 4NCC2 5D1QC 3IU3B 2WZPD 1FZOB 4NO2B 1CICC 4NQSA 3C09B 2GYSA 1NAKL 3MXVH 4C56E 1N8ZA 3AM8C 1AD0B 3ULVD 1NCBH 3O2WL 2F54E 1I4FB 1IJ9A 2FJGA 3GI8H 9CGTA 2R39A 2DQEL 1CFTB 4PJ8B 1U8HA 4HUXB 3MX0A 3TV3L 1GRWA 4O02H 4QWWD 1XR8A 1CGVA 1HYSC 4YK4C 3BJLA 3DVGA 3WN5B 4UV7H 2APWA 5F96H 5BMFH 4G8EB 3CNKA 4L1DA 4ZYKA 4JDTH 1G9NC 4Q9RL 1HZHH 4F37F 1AQKH 3BPNB 2Q8AL 4DN4H 5IVXF 4J23A 1MCSA 1NBQA 3D39D 2XOTA 5TDOA 3UPRA 1MCRA 2G9HA 2X4QA 2NW2B 3DX9A 2R0LH 4Z7OE 2X89A 4F7TA 3MLRL 3QO1A 1H8OA 3S7GA 5IR1A 3STLB 5C0FB 1A21A 2LU7A 1MHEA 2ZUWA 4CVUA 5LG1A 4PLKD 3BD3A 5DVOA 1H15A 2Q20A 2JJVA 4JM4L 4NFDA 4NJ9L 4IOIB 2NY6C 1EJ6A 5DS8A 4FXGB 4ZG1A 3MLWH 2DWDA 5C0EA 2IF7A 4G42A 4ZFZA 3CAFA 3HS0B 3QWOB 4MNHA 2BNQA 4OZHF 3P9MA 4XCCH 2P48B 5BS0B 3MR9A 1IGIH 3UDWC 3C60B 4XNZC 1NAMH 4L8CB 3OAYK 3B9EA 4KI5C 5J06A 5B4MC 3E8UH 4Q97A 3MRRB 4X8JB 3WNPA 4HIHA 3RZCA 4GKSB 3WFEH 3QR2A 1FFPA 2ZOLB 4A2MA 4U1GC 5I75B 4E5XA 4ODWA 3RUGF 2UWEF 1U42A 3PF2A 1NGQH 1I8IA 3WO4C 3ARTA 5IGXH 4PJBE 2W91A 1G0XA 5L2KA 4B7LA 5KVEH 5T3XH 3WDIA 4FQ2H 3U9PL 4RMQA 2PO6C 4L9LC 5I1AB 1MUJB 2FSEA 2VDLL 3GRWA 4RQQA 1NCUA 3DGGA 3PNWB 1LDPL 3Q6GH 3W0WE 4WI4A 4KK8D 3RIAF 3TBWB 3CZFB 1XIWB 2WBJB 5C0BA 5GS3A 3AY4A 3OR6B 2ORBL 4PRIA 5DD3L 3VXQB 3S96A 5DJ0B 3ZYOA 4N90E 4HWZB 2WWKT 1D9KC 2OL3B 2HTLD 3QO0A 1R5IB 1UWGL 4PJDE 1YYLH 2XN9A 3QUZB 4YUEH 2ENYA 1IC7L 4AENB 5IMLB 1JI2A 3V79C 5GISH 4HDIA 1HEZB 2IQ9H 3G6DL 2F58L 5FM5M 5HYJE 1OP3K 4OQTA 1G7JB 4NCDA 1S7VB 5T3XD 1BIHA 1BX2B 1MFDL 1NGZB 3LPFA 1A7PL 3JTSB 3T4YB 2ITDA 5DC0A 2EO9A 3N85L 1EAJA 1LD9A 3JSSA 3LSOB 2XZQL 1CN4A 1DN0B 3SGEH 5DMGC 1BVLA 3RWCA 1MY5A 2K3TA 5DJAA 3NCYS 1T89C 1QHOA 3CSPA 3P9LA 1T7ZA 5BO1L 5DFWH 2ZPKL 4TSBH 3FO0L 3VXSE 1X4ZA 4DVRL 1I7ZB 5EA0L 4ZD3H 3HNVH 3G9VA 3H9YA 4R96A 5GGSB 1IEAB 4P48A 4U0RC 1WZLA 1RY7B 4QY8A 3KHQA 4KRLB 3B9DA 2H9GB 1ZWIB 1NPUA 1G9EA 2ITCB 1R5VA 1OF2B 4QXGL 5MERB 3UTSA 3SE3A 1GAFH 3QEHA 4JM2C 4QRRE 4TULH 5FYKE 2D7MA 3BKJL 4MJID 3IGAB 3Q0HA 2IAMD 1NMCC 4NUGH 3OKDB 1P4LA 5D2NA 5GXBB 3M07A 3EFFB 4R2GB 3U30B 5I71C 2YA1A 3B5HA 5EC2A 1C16B 4Z7VE 5KVGL 4ZUUB 1I9IL 4G3YL 3MRPA 1OP5K 2HKHL 5TQ2L 1LEKA 1EFQA 4OFVA 3RVTD 2QQLH 1FL3B 4P2RE 5SV3A 4C58B 3EYSH 4HK3N 1DUYB 1NBYA 1WCBB 3SGKC 3FB5A 1D5IL 1K8IB 4D9LH 2VWEC 4NN7C 4BSVA 3O6LL 5A43C 5L8KB 5H35A 3MRQA 4P4RB 1YMHA 3H7BB 1KNOA 5E8NA 5L0QC 2CK0L 1T1YA 5EOQH 4ZUVA 3BHBB 3KAAA 1P9MC 3WFHA 3VJ6A 1C08B 1T1XA 3QXUA 3LV3A 4BUHA 1XGUA 4HGWB 3ZO0A 4GQ9H 4PJIA 1TIUA 3MRLA 4KAQH 2NY2C 3SDDC 3PP4L 5T5NF 1K85A 4BZYA 1T20B 1AHWC 5B8CB 3VI4E 3GSQB 4PFEA 4UZGA 5CJOH 2NY3C 4NRYA 4PJHA 2FEDD 1Q9OA 2A83A 1MPAL 3VGAC 3QXWA 1EXUA 3KWWB 3TZVB 1CFVH 3U46B 5BVPL 1GL4B 2APXA 4R97B 2O61B 2GJ6D 4KJWC 1IAOB 1CF8H 1SJHA 1FFOA 1KT2B 4P4KB 5ANMA 2PW2B 1M4KA 3BUYA 3QFJE 4PJFF 5IQ9A 2YD8A 4OZIB 1C7TA 2VQTA 4TNWK 3SGDI 3MXVL 1C5BH 2P47B 2ZUQB 3OR7B 3NMEA 4NZJA 1NCBL 4HUKB 3IFPA 4I3GA 3E6HB 3DV6B 3MO1A 4PJ9C 1QD0A 3ZT5A 4MAUH 1AH1A 4QKXB 2Z0BA 4B0MM 4O02L 2GT9B 2DJUA 3CXHK 2GIYA 3KPNB 4JQVC 5EU6E 4UAOB 2BSED 3KPQB 4RBPH 4WTZG 3GSWA 4XTRD 4M7KL 4NYLA 4XP5L 1U3HB 4LHQB 2MWCA 2VE6A 3GSVB 4AT6B 2G75A 2Q7YB 2Y7QB 5BMFL 1BLNB 3UEZA 4P2QA 4JDTL 4LCWA 3SDAC 1B0WA 2XWTA 1HZHL 3ES6B 4OSUH 4U1KA 5IROC 2V9TA 2UYLA 2CLRB 1AGFB 4WJ5B 4NSKB 3SY0B 1A14L 4NP4L 4OF7A 3VXMB 4NBXB 2H8PA 1AFVL 4X0KB 5ICXB 4PGJA 2EIZB 1OAXH 4MDJB 1R6VA 5ETUA 3VXOA 3UYPA 2NR6D 3C5SB 3LEXB 1V3JA 3HN3A 5D72H 3RKDD 4KKCD 1T0MB 3QI9B 5EZIL 4EUPG 1KPUB 1TCRA 2VKWA 4U33A 3BT2H 5SWQA 4DOHB 3PP3H 3O81A 1ZA3B 3CH1B 5HGDA 3WJLC 2R1WB 1BEYH 3MOAL 4U1MA 4XVUC 4OZGF 2H2PC 4CVZB 5IB4B 4CDHA 5J6HA 1I1AC 5DMJB 2BVEA 3FFDB 3DRQA 3QUYC 1CFSA 1FQ9C 3L95A 4NN5C 3RGVA 1XF3B 3FRUA 1UZ6E 3MLWL 1T83A 1VHPA 2DQGH 3OKKB 3PXHA 4OGZA 3MRCB 1JYWA 2D9QB 3VXRD 2EC9U 3D18A 2CKBB 4XCCL 1T1WA 1T22B 4Y0GA 3OKMA 5MEOA 1TQBB 4HEPG 1RZIA 3B9KB 1FFRA 3S35H 5DMIH 25C8H 2PR4H 3WFEL 5B3NA 2A6JA 3JWOH 5JW4N 3KYOB 1ZHNA 2YXMA 1ND0B 1V7NH 2E6PA 1RIHH 1MCDA 2JIXA 4I2XB 4WRLA 5KVEL 5T3XL 2P5WD 3C5ZC 4FQ2L 4ZMAT 3ARBD 4NQEB 2EDKA 4JFDB 4WY7L 3UZQA 4S11A 1P4IL 3IVKA 1J8KA 1QBMH 1U41A 2DI9A 4ALAH 1GPOH 3ZYZA 4Y1AE 1BQHA 1XF4B 3Q6GL 2ICEB 3ARQA 3MGOB 5I1CH 5J1AA 3A6BL 4GXVH 4ZSOE 1YEJL 1MCNA 2ZNXA 4WU5A 2HA1A 4KRPD 1AGEB 2X4OB 4NHCL 2JB5H 4OIIH 1IC5L 4PJXB 4QRSA 1YYLL 1NFIA 4ODXA 4YUEL 4LVNC 4GBXA 5EPMA 3UTTE 4HGKC 2IQ9L 1YZZA 5IW1B 1JGEA 5DZNA 1UC6A 1U92B 5HD8C 5JW4M 4I1NB 1B0GB 2WAHA 5D1XD 1DEEA 3JUZA 1A1NB 1L7TL 4GRLA 2NCMA 4F37K 5KSVB 1UXWB 4UU9B 4YFLI 1WBZB 1DP0A 4LGPB 1U8NA 5F1NB 4EI6B 5KANG 4K7PX 3GDBA 1ZANH 5E2UH 2H3NB 4IRSC 3ME0A 4E41E 4X7TB 3SJVD 1F13A 5TE6H 4TSBL 4NKQB 5KG9B 4FFVD 3BH9B 4WHTB 1NCDH 1YYMH 4I18B 3VE0B 3RL2A 3F5WA 3HNVL 1JYNA 2DB8A 3GMOA 5EUOA 1Q9WB 4Y8AA 1L7IL 1L0QA 3M1BA 1K2DB 1RMFH 4K3DH 5D1QA 1GAFL 3MNVA 4QRTB 3BEWB 4ELMB 1VFUA 1CICA 3LH2H 3TA3A 1T0NA 3QA3A 1BZQK 4NUGL 3OAYH 5DMKB 4MNQB 5CP3A 2ZCHL 3GMPB 1AXIB 2P46B 3F12A 3ECBA 3QQ3B 3V5DA 5IOPA 4V2CB 4ZFGL 2NXZC 3FHAA 1U6AH 2O5XH 4M61B 2DQIH 2FWOB 3ULVE 2R2HB 3IRZA 3EOBA 2A73A 2QQLL 4I0PD 4W4NA 1AIFB 5HDLA 3ZKND 4K3EH 3O9WB 1FGNH 2DKUA 5AZ2H 2CR3A 2WW8A 4NO0B 3GBLA 2VJXA 2HT3D 3MJ9H 2VNCA 1H3WM 2X1OA 3ARDC 3MROA 2YEZB 3DSNA 3AAZA 3WYRA 1KLGB 1DN2A 1JV5B 1UB6A 3WLBB 4XHQA 1MHHB 5EO0B 1RZGA 5EOQL 3RIAK 1S9KC 4S1QH 4XZUA 5FOBB 5MI0C 1HNFA 4KAQL 4PV8B 2UY6A 2MQCA 3D5OF 4EI5C 5AUMB 3PWNB 2BFVH 3MRJA 4PRAB 1GC1C 4X6CB 3B2UC 4YHIB 4FA8A 1FNAA 3D39E 1P6AB 1CK0H 1OP3H 1JHLH 4F7EB 1MJJB 3QUKB 4PJ8D 4LSPH 4WTWA 2BCKB 5CJOL 3OJ2C 4DKAA 1HKLH 1MIMH 3H3PH 1EA9C 4JZJC 3C8KB 3AREA 3WFZA 4YIQB 5HHVL 4NQCA 1CFVL 3I02B 3CSYB 4IOFD 5C07A 3L7FA 4Z76B 1MI5A 4NC1C 1CF8L 5DHXB 3UDWA 5E4EC 4HPOL 2UVEA 3JTTA 4C55A 5HHQB 1VFBB 1AI1H 1P7QA 4RGNC 4XT1C 1VKXB 2E9JA 4F3FA 3LKRA 4ZNEA 1CL7H 5IB2B 3VFSB 3VMPA 2EDEA 4OD2A 3BEVB 3L5WB 4H25A 4X5LA 3VFRA 4GW4A 4P3CH 1N6UA 2EH7L 3T04D 2VIRB 1QPPA 4N0FA 1N2RB 5T1KB 4L9LA 4XHJC 4J3SA 4PLOB 5HJ3B 3PWJB 1NJ9B 5DJ2A 3B3IA 4JO4H 4CW1B 2AKRA 1UM6H 3HMXA 3FQNA 4G7VL 5ADPH 1X5AA 1FGVH 4NQSB 2IMMA 4YEFA 4DKDC 5IT2H 4TVPH 4Z0XA 3Q1SH 2WWMD 5BS0D 1NEZG 5JXED 5EIQA 3C60D 4EXPX 5FA3A 3WUWA 3AMLA 2FJGB 4IJ3B 4LSUL 1OAXL 4MDIA 4PJCA 4PB0H 1GGCH 4LMQE 1U8HB 4YHZL 1NL0L 1PSKL 2DN7A 1XR8B 3BT2L 3QH3A 3HZYB 5HVHC 3AMKA 1XF5A 3S37H 4F7PA 3FN0H 2XA8H 1IAIM 3IKKA 1Z5LA 1A02N 3ZKSD 3VW3L 1UCBH 3ZYJA 4LLUA 5DJCA 4YEEA 1PG7H 2DQGL 1YEKL 1T89A 5T3XE 4DQOL 5AG8A 1M6OA 3OL2A 3LB6C 1XIWD 2WBJD 3G6JB 4TVPD 2WP3O 4ERSH 2G9HB 2X4QB 3UXFA 3DX9B 4DUVA 2ESVA 3BN9D 4M7LH 3O4OC 3MBXH 3S35L 5DMIL 5I9QB 5SWSA 3QO1B 5IR1B 1MHEB 3P0VH 1P4BH 4OFPA 3QUZD 4O4YH 5D93B 3EYQC 1V7NL 4XNMA 1FVEA 4P46C 5F9JA 5DS8B 4K23H 4LPUA 5BRZA 5HVWA 1EPFA 1KACB 4CN6A 5C0EB 4PS4L 1RZJL 2FJHA 4G42B 6FABH 1TDQA 4PJ7A 3OPZH 2WINA 4JFFA 4MNHB 3MA7A 2BNQB 1B0RA 1QBML 1L0YA 3P9MB 1GPOL 4P2CG 2B1HH 5K9QI 4PJEF 4FZEH 1K9TA 3WL9A 4MJIE 5C8JA 4O00A 5GS1C 1A7RH 1HSBA 2DMBA 5DJ8A 4PP2A 2NY0C 2X4NB 4HIHB 3RZCB 1E6JL 2QR0A 4YC2C 1GCFA 4E5XB 2AXJA 1Z0MA 4ODWB 3BO8B 1LVEA 3MRBA 4JJHA 2JB5L 1F3DJ 3WIHA 1I8IB 2HN7A 4L8BB 3KPSD 5L2KB 4HV8A 5D7JB 3RWJA 3OG4B 2P43B 2FSEB 1A7BA 4RQQB 3DGGB 1QSEB 2JKXA 4FQXB 1G9MH 4KDTC 5C09B 3U83A 4BH7A 5CBEA 5E2UL 1AHWA 1LO2H 1HHKA 4PRIB 4R2GD 3S96B 5F8QC 3L1OH 3RVXC 4M7JH 1FL6B 2R1XB 5TE6L 1GIGL 5CKGA 3QO0B 4Z7UA 4M4PA 5DUPL 5BV7C 2LE9A 1FIGH 2XN9B 1NCDL 3OXRB 1YEIH 4RA3A 4HDIB 2E27H 4JR9L 4MAYC 1WBXA 1BJ8A 4ONGL 2X44D 1J0IA 1RMFL 3BKYH 2D9CA 4K3DL 1OWRM 3K2UL 3UX9B 2QQQA 2YSSA 3LH2L 4LQFL 2DI7A 3PWUA 4JRYA 3I6GA 5C0GA 2MJWA 3BPLC 1A6WH 2GJ6E 4HKJA 2IANA 4JY4A 1BVLB 2AJUL 3RWCB 2Q1EA 3PGCA 5DJAB 5CILH 2DLEA 3MZGB 3LQAC 3RBSA 2VXTH 3ESVF 3P9LB 3GMMA 4GUPA 1MJ7H 2E5EA 4PJ9A 3QG7H 4KVCL 4QYOA 2PTTA 4R96B 4JQVA 3BP7A 1U6AL 2E6JA 2NX5A 2DQIL 1NCNA 2ZCLH 1OTTC 1DQML 1R5VB 1R3LA 4JFYB 1WQVT 4OGYL 2N4IA 2R0WH 4K3EL 1FGNL 3QEHB 3R8QA 4UIMA 5AZ2L 1KTDA 2EDDA 3TZVD 5D7IA 4HC1H 4WI9A 5IROA 4V1DA 3VXUA 1TITA 2V2TA 4ZOBA 2H32A 3MJ9L 1P4LB 3H2WA 4N8VG 4S1SH 3X14A 4G9FA 4P4KD 4KTYA 1NC2A 4S1QL 4BH8A 3D87B 4XMKH 5EC2B 1P5VA 1V8HA 3JBG7 3MRPB 4LDLB 1LEKB 3MUJA 4NZUH 4PV9A 2BFVL 3WJLA 2Z35A 4MLIA 1UA6H 5IMOA 3VWKA 4U1LB 4L5FH 4RCAA 1CK0L 1JHLL 2DD8H 1I1AA 3D9AL 1NBYB 3FB5B 3TH2T 1MIML 3H3PL 4Z7WA 2XT1B 4BSVB 2ZUTA 1QBLH 4LLDA 2EDLA 3ISWA 3UYOD 43C9B 3O6KH 1U3HD 1MCQA 3TVMA 5CSZA 3U2SA 5H35B 1YMHB 2GSGA 1KNOB 5E8NB 1NANH 1UACL 1T1YB 4K94L 4ZUVB 3QPQD 4XBEH 3L3GA 3VJ6B 1T1XB 3LV3B 2CKBH 4PJIB 3MRLB 4V2BA 2D3VA 1BFOA 4LKXA 4KI5F 2VRAA 4UOW0 3VXMD 3IDGA 3VXRE 4JHZA 3RDTC 4QRPA 1WFUA 4Y4KA 3LHPH 3CX5K 5I6XC 3QI9D 4NRYB 3N0PB 2V7HA 1J05A 1UWEL 4P3CL 4PJHB 1Q9OB 2FJFA 2AK4E 2A83B 5EBGA 4MJ2A 5DTFA 5IF0A 3C5ZA 1EXUB 1Q8MA 3DYOA 3OGCA 5JNYA 4C59B 2IBGA 2Z93A 1CS6A 4L3EA 4ODHH 1FFOB 2FZ3A 5ANMB 2DBLH 3BUYB 3WXVH 5IQ9B 2P5WE 3BGMA 1DL7H 3F7RA 5TDNB 3DO7A 4LIQH 4TVPL 3Q1SL 3DVIA 4IRJC 4BK4A 4W68A 3LCYA 2YWYA 3HTLX 3MO1B 2IFFL 1XGQB 3QXVA 3DI2B 5F7EH 1GGCL 2OL3L 1F45A 3B9KD 5DXWA 1E4WH 2QEJA 1ONQA 2OLDA 2J4WH 1GYAA 1MCCA 1K4DA 3U4BL 3GSWB 4L4VB 5F72S 4NYLB 4Y4FC 2BVPA 2VE6B 4HWBH 2G75B 1E4XI 2XA8L 4RX4D 5DZOA 4F33B 1IGML 4P2QB 2GJJA 2PF6A 2XWTB 1J0KA 1PLGH 4NQED 4PGEB 4U1KB 4JFDD 1UCBL 4OF5A 2I24N 4IRSA 5KBNC 3F6IA 3OZ9H 1LEGB 1IEHA 2VLRE 3FFCD 5EUKA 2B7DT 4FN0A 5KAQF 4JO3H 2OS7A 5ETUB 3VXOB 3V6OC 3BXNB 2BSTA 5D7KD 3BGFB 1UGNA 4M00A 4XP9L 5SWZA 2QKIA 3WKNA 1OTSC 5SWQB 1OM3H 4M7LL 3SJVE 3SDXA 4LCCC 2PCPA 4OKVA 3A67H 3P0VL 1P4BL 2WM0A 4O4YL 5J6HB 1CIDA 1SVZA 3BIKA 4NO3A 3DRQB 1CFSB 3L95B 4JM2F 2EYRA 4LVEA 4K23L 5E9DB 3FRUB 4GW1A 2E7MA 1T2QH 6FABL 3OPZL 1Y6KR 1F6FB 1ZHKA 3EW3B 4RMWA 1NGXA 5IHLB 3O6FC 1T1WB 1A6VH 2B1HL 3OKMB 4XAWH 3X13B 3DIFA 4PRPA 5MEOB 5INCA 4Y4HC 2GEEA 3PHOA 1QFWI 2C5DC 1RZIB 4JVWA 4Q9BA 4LAQH 5C0ND 5I16A 1EEYA 3L5XL 2A6JB 4P59H 4JZNA 2EYSA 5HHOA 2C3WA 5FDYA 4OKDA 1Q72L 2BJML 3O8XA 2VABA 1OQOA 2APVA 2JIXB 4BJLA 5D7LE 5L88L 3HA0A 3ARDA 3QHFH 3UC0H 1MQKH 3T1FA 2HJKA 2CSPA 1S7RA 1BQHB 3L3JA 1DQLH 3TFKD 3O2DH 5J1AB 1G9ML 1N6QH 1G7IA 3EOYG 3QCVH 4MCZA 4MNQD 4WI7A 4AEEA 4EI5A 3LRSA 4EDWL 4WU5B 2NYYD 3TYGL 1LO2L 1N5AA 1A4KA 4CMMA 4DK6A 1E6OH 5FGCB 3L1OL 1V3KA 3O4LA 4M7JL 5E4IA 5DMYA 2X7LB 3JWNC 3O41A 3WLWC 4Y5XC 2PTVA 3HC0A 3DETC 4JZJA 4QRSB 3TJHD 3C6LC 1FIGL 2EDTA 1U91A 1NC4A 1YEIL 2IFGA 4GBXB 2H6PA 3GJFA 2E27L 5DRNA 4BQ6A 1R3IH 1JGEB 4OZ4A 3B43A 4G6MH 2J5LC 4KK6D 4NO0D 4HWUA 3BKYL 5I1EH 3DROB 4LNVA 3WD5H 1DEEB 2X70A 4YBQD 3I9GH 3W39A 2X10A 1U8OA 4GRLB 3KVQA 1WT5C 1U8NB 3PGFL 5GGVL 3SBWC 1A6WL 4HMEA 2VZSA 4EOWH 1SYSA 5EBWA 5CILL 4R4ND 2KKQA 1MJ7L 1E0OB 2C4FT 3CLEH 5DI8A 4YHOH 5E5UB 5FO9A 5A3IC 4XMPL 4PJAB 3RL2B 3F5WB 3FL7A 1H3GA 5EUOB 3PWPD 4POYA 3MACH 3M1BB 2ZCLL 1YA5A 5C08A 3IDNA 5GGRY 1OW0C 2R0WL 5D1QB 4PR5A 1EERB 3MNVB 1CICB 3C08H 3TA3B 3LKNA 1FSKC 1T0NB 2AJ3A 4F9PC 3NGBC 3QA3B 2E7LC 2EKJA 4TYUA 5I19H 4HCRA 2XZAH 2ATPA 4ZTPH 4S1SL 3F12B 3V5DB 5EIVA 5IOPB 1IZKA 4XMKL 1D6EA 2R4RH 2XPGA 5CD5D 4J7RA 3HE7C 1X5IA 2H2SD 3HC4L 4NZUL 5BS0E 4MB3A 3UTQA 3EOBB 4YK4B 1UA6L 2A73B 5D2LE 2BXYA 3WNNA 2DD8L 1F42A 4FQJH 5T1KD 2VMFA 3GBMH 2NNAA 3AU1A 4K3JH 3WS3A 2APBA 1FDLH 4Z7WF 1CQYA 5HGAB 2W65A 1CD0A 3MROB 4PRHA 3AAZB 3VFUA 2HTKD 3V8OA 3GI9L 1ZHLA 1N3NA 1RZGB 3VDBA 4XZUB 1OARH 3QJHA 3HE6C 3GHBH 1IZJA 2CKBL 5GGVY 3VH8A 4PLJC 3MRJB 1YEDA 2IBZY 3AXLA 4DUWA 1CI5A 5JPMA 5I15H 4Y19A 4TVPE 1ERNA 4KK5C 3LHPL 3KDMB 3WHXA 4PD4K 4P5TC 2NY6B 3CDYA 3AREB 3FT2A 3T3PE 2NW3A 1UYWH 3PABA 5CZKA 4NQCB 2PXYA 2MKLC 3SOBH 3T0XA 3L7FB 4RFNC 3RY4A 4ODHL 3JTTB 2V2XA 1FZKA 2Y5TA 3WXVL 5GS1A 2ID5A 1P7QB 4G7YL 5AAWA 1FZJA 4S0TD 2WK2A 3FAXA 1PG7W 2OR8A 4H25B 1CQKA 3VFRB 4GW4B 5F7EL 1I3RA 3MRNB 4HT1H 5CCKH 1IMHC 1E4WL 5F9WB 4N0FB 1J0ZA 1R3KA 2XQBH 2AXGA 2J4WL 1CD9B 4MD5A 1H3XA 1DBMH 3OQ3B 1FBIH 2YK1H 4F7MB 5J9PA 5DJ2B 3B3IB 3LEYL 1JPSL 1P6FA 3LZFH 4RDQF 3GRWH 4KDTA 3KPSE 4J4PC 2VXQL 2XG4A 4EJ1C 2XNAA 4U1IA 3FQNB 5KSAA 1CVRA 2HVKA 1PLGL 3NH7H 3MCG1 1DR9A 5F1OB 4RWYH 4CVWA 2BNQD 3JWDC 4Z0XB 3U9UB 3MA9H 3U82B 1HINH 1ZE3C 5GRVK 1K3ZA 1HHGA 5FA3B 3F58L 3WUWB 5IEKA 4H1LA 1OWWA 4HX1A 2ZNWA 4PYGA 4PJCB 5TE4L 3RZCD 1MCPH 3PIQA 1KG0A 4MAYA 5FHBL 1MRDL 3BIAX 3QH3B 1OM3L 4ZFOA 1XF5B 5FOJA 1NMAL 1X5LA 4WWKC 3SDXF 3C2AL 3MUZ1 3R06A 5DURB 5JA8B 4F7PB 3A67L 2WV3A 4OQTH 5L2KD 1F8TH 1OQXA 1LO4L 1Z5LB 4FQLL 3U0WH 2QQNL 3T2OA 1RUAH 4JHAL 4UT9H 3ARSA 4LLUB 5DJCB 3W2DH 1QSED 1T2QL 3S36X 3P40A 4U7KA 1M6OB 4OF0A 5C09D 3EFDH 5LQBH 1G7PA 4X6BB 3PV7A 4XAWL 1BIIA 4PRID 3C2SA 5F6IC 2O26U 5FF6A 1CE6A 3ZYIA 1GGYA 1DDHB 4JQXC 4LAQL 1NSNH 4GSDH 2VAAA 1FNLA 2E8ZA 4XC3L 4JANA 2EH8H 2XN9D 2HT4D 4Z5RB 4XNMB 1FVEB 5F9JB 1NUGA 3EO0A 5GGTA 4GKNA 3FOLB 1NMCB 4PJGF 5BRZB 3MZTA 4RFOL 1DQDH 3UC0L 3ZE2E 4PJ7B 2WINB 4JFFB 5B38A 3MA7B 2VITA 5I71B 1B0RB 1CR9L 1OD7A 3MRKA 3D48R 3HI6H 1BM3H 3FO9A 1DQLL 4FZ8H 3OJDA 2KZWA 1N6QL 5C8JB 5MHSD 5BW7C 3KYMA 1HSBB 1QRNE 5DJ8B 4PP2B 4JPWH 2QR0B 4OFDA 4LHUG 4KFZC 1RK0A 4PBVC 4ACPA 4OZIE 3MRBB 4FP8L 5EORL 5EZJA 4NN7B 2N56A 5E8OA 1IC1A 4UNTA 2FH6A 5DGQA 4HV8B 4R3SA 2R9HC 1RURH 3RWJB 5J1TC 1LP9F 3L5IA 1R3IL 4UBDD 4WCYH 2F53A 4G6ML 5HSFA 5I1EL 4ZPVA 3KS0J 3DO3A 4B41A 2R56L 4JRWA 1A6ZA 3QUXB 2NY2B 4BH7B 5C6WH 1WWBX 3OG6B 4XC1H 2C3HA 5HI3C 3RVUC 3V52H 3RDTA 1RK1A 4K7PL 1R0AH 3MCLH 4LARL 4LU5H 4JLRA 4Z7UB 2FHFA 3ZKXC 4YHOL 4M9PA 4HKXA 4XP4H 1Z9LA 4G43A 4OCNC 3ZKMC 3VXME 2NTSP 1FVCA 4OD3H 4XCNB 1WBXB 4U3CA 1DLFL 3MACL 1HHJA 4RRPG 1UEMA 4YFEA 1OT1A 5AAMA 4DOHE 2IH1A 2HLFD 2R29L 1ULVA 2YSSB 3PWUB 4JRYB 3I6GB 5C0GB 2IANB 1ZK9A 4FFYL 1TLKA 3PGCB 5I19L 2XZAL 3HG1A 5D5MB 4LCUA 1ACYH 2E9BA 4RMRA 3CVIL 2DLGA 5I73C 3SE4C 2AERT 2F5BH 3U7AA 1DQQA 4QYOB 4PTUA 2CDEA 2PTTB 2GI7A 4HW6A 3BP7B 4KQ3H 1ZLVK 3IF1B 4OGXL 1D7FA 3MYJA 2NX5B 5IJKA 3CXHJ 4Y4FA 3WFBH 1R3LB 5CMAA 1QLFA 4KKLC 3IFOB 2IWGA 3KXFA 2UV3A 1P2CA 4UIMB 5D7IB 4FQJL 3QEQA 5HY9A 3DMMA 4V1DB 2MHAA 2H32B 4LLQA 2XFXA 1BFTA 1SEBA 4P9HH 4G9FB 4GRWB 2FCBA 2YC1A 5MENA 1NC2B 5AZEL 4BH8B 4D0BB 3ILQD 1OARL 2FX7H 4QHUA 3GHBL 3V6OA 1HCFX 4NQEE 3AB0B 4JFDE 3OHXA 4OZHE 1MCWW 4K7PY 3QCUH 1BWMA 2Z35B 2LTQB 4LCCA 3FOMA 5IMOB 3FFCE 3VWKB 3T0EB 5I15L 4LIQE 1PX3A 1F3RB 3I75A 1I1AB 5FFLA 4YQXH 2EYTA 4WGVB 5J7CC 5D7KE 3SKJH 3F8UB 4LLDB 4Z7NE 2UWEE 1UYWL 5DA0B 5FCUH 2VZUA 4PJXE 5CSZB 3BKMH 3TVMB 3U2SB 5DK3A 7FABH 4OGAC 3KLAB 4P2QD 1ZAGA 3O6FA 2ZCKH 5DD1H 3TGXA 3L3GB 5IVZA 4NPYA 3HRPA 1IM9A 4Y4HA 1JRHL 1BFOB 2HT2C 1RHFA 3MLXH 1VFAB 2BHZA 2P42B 3ILPA 4OZFA 3L3IA 3BYYA 3IDGB 1I1RA 3KPOA 4QRPB 2AV7A 4Y4KB 4AZ8A 3EJZD 2QADB 1U8MA 4I3SH 4PGBA 2V7HB 1J05B 1RSFA 1NKOA 4ETYA 1ZEAH 2FJFB 1A1OA 4GO6B 4DW2L 2GY7B 5IF0B 1AGDA 4YZFF 3C5ZB 4BFEA 3WIFA 2M1KA 5E56A 4N8CH 2XQBL 2MFNA 4YR6A 1IARB 4KROC 1DBML 4NM8H 4RIRA 5CSBA 3MRFB 1EZVX 2YK1L 2Z93B 2FZ3B 3GRWL 5E9DD 1SBSH 2R4SH 4I4WB 2QHRL 4OCSH 1RUML 4YBLC 3D6GA 5CJ8A 3NH7L 4XWOD 3V6BR 3D0LA 3DXAA 2W0PA 3U7YL 3DO7B 1TVHA 4RWYL 1G6RA 1URLA 3MA9L 1HINL 5I74C 1N5YL 3CFKB 4Y5XA 3PWVA 5E8DH 3BDYL 4DGIH 5IFJB 2P5EA 4MNQE 3L3DB 4OLVH 4LVNB 4M9OA 1MCPL 4XVTL 1ONQB 1QLEH 4W4OA 5TF0A 2FATL 4HG4K 1SY6A 1A8JH 5J89A 1K4DB 1W2KT 5IBTH 3ARXA 4UQ2A 3BRDA 2BVPB 5HYQA 1EH9A 2CRZA 1F8TL 2JIXD 2W0FA 2CD0A 3ZDZF 2CIKA 4ZQKA 4XVSL 2CLVA 3KYKH 3U0WL 4FG6C 1RUAL 3SBWA 4M62H 4UT9L 4IRSB 2HFFA 2VDNH 3E2HB 4J3WA 1HWHB 4ZAKC 3MNWA 3EFDL 5LQBL 2V2WB 5J12C 1EHLH 5E99H 4D2NA 1HILA 2EDHA 4ZUWB 2BSTB 3U4AA 4CRPA 3HMWL 5SWZB 2QKIB 5CEYB 1LEIB 1NSNL 3RWFA 3B9AA 1D5MB 4GSDL 3T3MF 2PCPB 4OKVB 4N68A 1OW0A 4YHKH 1YDPB 1FG9C 1KIRA 4OCWL 1ZA6A 3BIKB 4NO3B 2K1MA 4GBXD 4X6CE 1ZGLM 2EYRB 1JIBA 3PWPE 2E7LA 1GGTA 2FHBA 5HBBA 4GW1B 1DQDL 3QDMA 3HNTL 3CDCA 5HGHA 4GRLD 5C2UB 5CP3H 1NGXB 4PY7A 2W0KA 3IT8D 4MZ3A 4QRQA 3QJFB 4X5WB 2Q8BH 4N5UA 4FZ8L 1MFCH 3FMGH 3P4MA 3A6OA 3HE7A 3DIFB 4PRPB 3OKYA 3U1SH 5INCB 2QV2A 2I07B 4MJ6A 5I16B 4JPWL 5MEPA 5GZND 4JZNB 2EYSB 2YD1A 1WF5A 5HHOB 1JWSA 1MCLA 5C2BH 3O8XB 2VABB 1G9NH 3ARDB 4EKXA 1QKZH 5T5NG 2EC9T 4YDJA 5D1QD 1WISA 3EJYD 3T1FB 1V3MA 2HJKB 1S7RB 4WCYL 2HFGH 4W81A 1CICD 3U4EA 3TA3D 3HE6A 2EECA 3LN5A 3L3JB 5MI0B 4NNXA 4Z8FH 3RPIB 2F15A 1G7IB 3LN9A 4EI5B 2O5ZH 5EZOH 3P30L 3V52L 1N5AB 1A4KB 1RUQH 3O4LB 3O41B 4O2FA 2FO4A 4Q9QH 4DAGH 4HUUB 5DD5H 4P5TA 4NFBA 35C8L 2FIRT 4Z78A 1U91B 5HYJB 1NC4B 5DJYB 1HYSD 1QG3A 5LVEA 2H6PB 3GJFB 4OD3L 4WVRA 3QQNA 4JKMA 5KSBA 5EU5B 4OZ4B 1KC5H 3W82A 1F6AB 1I7RA 3QNXA 4X6DA 1FFNA 2J8OA 3VG9C 4NGHH 2PNDA 3W39B 1UCTA 1U8OB 2F19H 4ORZC 5GGQH 4CADA 5IHBA 4MQ7B 4MGXA 4QF1A 4N0CC 3RIFF 3QQ4A 3F6LA 5EBWB 4I3RH 1GGUA 4ODSL 5MEQA 3TBSA 3U6RA 5DI8B 1KJ3L 4E0RB 3QP3A 1VEOA 3IFNH 1KELH 1RULH 4NNPH 12E8H 2GTWB 3NCJH 1JMXA 4LOUC 4HKZA 3H6JA 4RISH 5IVOA 4LSSL 3V7MA 5C08B 4XGZA 3K4AA 1RZKH 2NY6D 3ARED 4J4PA 1MCOH 4PR5B 3UYRH 1E4JA 4NQCD 1G7LA 3Q6FA 4QXUL 2ARJQ 4RGMB 3QIWB 4NZDA 5C07D 3HMXH 3P9WB 1MI5D 2BRQA 5KVFH 2AABH 4NOFA 5B4MD 4XPBH 2JCCA 1P7QD 1R3JA 1D6EB 2FX7L 3VFTB 2XPGB 3QNYA 5I76A 4Y5VC 1KULA 1MAMH 4JO2H 5C7XH 2BNQE 1WICA 5HVHB 3UAJC 4WWKA 3ARGC 3QCUL 3P77A 3UTQB 1JZ4A 3C8HA 1KCVL 3P73A 2C1OA 2BSRA 4DFIA 3RY5A 4YQXL 3G04B 3T09A 4UTAH 3SKJL 2NNAB 3AU1B 3WS3B 1TZIA 4BSJA 2W65B 5FCUL 4PRHB 3VRLF 3QFDA 3WSQH 3VFUB 2P8PB 2BMKA 2H1PH 5L2KE 1BAFH 5A1AA 4XPGL 1ZHLB 1N3NB 4ODVL 2ZCKL 3G5YB 2R8SL 3WS6C 4H0HB 3QJHB 1ZTXH 3MUHL 4IMKA 1W72A 1X6LA 2CIIA 3MYZA 4OM0H 2P45B 5F7KC 4DN3L 3MLXL 1YY9C 2DLFL 1UADC 1QSEE 1K3IA 1YEDB 3AXLB 3GZKA 3TN0C 5C0AB 1CZ8H 2V5TA 1K4CA 4YXHH 3EAKA 5E2JA 5C0BE 4Y19B 4GLRI 2I60H 1I7UA 2GFBA 4WW1A 2R0KH 3WHXB 4NHUB 4PRIE 4RMVA 2VTFA 4KRMB 5DO2D 3EYUH 3FT2B 2NW3B 3HUJB 5L2JA 3INUL 2C1PA 3PABB 3SO3C 5DURD 5DHVA 2PXYB 4YH6A 4POZC 1B2WH 2YZ1A 2XN9E 1WIOA 2Y23A 5I1DA 2V2XB 1FZKB 5DMGD 2Y5TB 4FQIH 4OCSL 5BW7A 2W60A 5GRZA 1AXTH 2VLMD 3BESR 1FZJB 3HI5H 4BZ1H 4QLRA 4YC2B 1QO3A 1UKSA 1I8KA 4W6XB 3TPUB 2AEPH 2AXFA 1LO3H 4MWFA 4DGIL 5MHSE 1I3RB 1G7HB 1MHPH 4FQQA 3NZHL 3AS2A 1I1YA 5SWSD 1QLEL 4HBCH 2G5RA 1R3KB 2AXGB 3GMQA 4Q58C 1RAMA 1A7OH 4DTGL 1Y18A 5FM5O 5IBTL 4FXKA 5J9PB 4F15C 5BRZD 4ZO8A 5CJXA 2XNAB 4U1IB 2X6MA 4YDIL 5KSAB 3P4NA 4EUPB 4JFFD 4NQDA 5F7NC 3UTSE 5ALCH 2VDNL 2VB5A 5CIPA 3KPRB 5D71H 1H5BC 2A0LD 4JFZL 1CLOH 4H1LB 4R8WH 4HX1B 2W9EH 2X9WA 4NRXA 5A40E 1UKTA 5FKPA 5E99L 5D2NE 3HHRB 5A2FA 3PIQB 1KG0B 4MD0A 3H0TA 4MAYB 3EDKA 4CAGA 4ZFOB 2JE8A 3OB0H 3GKWL 1KCKA 4GAJH 5IV2A 3R06B 1EMTL 4MXQC 3IDIA 15C8H 1KF9B 4W6WB 1DVFA 4HPYH 5E6IC 1T03H 1W0YT 1MCEA 2ZKHL 3BPLB 4R90H 4TSAH 1S5IH 5CJBA 1CG9B 1HH9A 2CDGA 5BQ7A 2MTPA 3HI1A 4LFHD 1DSFL 1BFVH 3QUXD 3SE4A 2NY2D 2BOCA 1G7PB 1LE5A 3K1DA 4LGSB 3CK0H 1BOYA 1PEZA 3ARFB 4A6YA 4UINH 3U1SL 1CE6B 2XA3A 4XCYA 1N7MH 5B39A 5HDBE 2VXSL 4PJIE 4JANB 4UTBH 4HUVA 1CFNA 1SBBA 2LAGB 1H0DA 5C2BL 3VG0H 4OFKA 4GG6A 3BN3B 3MLTB 3EO0B 2RCSL 4GKNB 4KJWD 4K71C 3B8SA 3GEWB 4Z7QF 5LXGH 1QKZL 2C9AA 3FT4A 4OD1H 4PJHE 2H32H 5B38B 2VITB 4Q0XH 2D7QA 2HFGL 3MRKB 1XGYH 2DICA 3FO9B 4GRWH 4JRYD 4U2ZA 1T3FA 4Z8FL 3QRFM 3MOQA 4BFGA 3OJDB 2IAND 4XNYH 5IQ7H 3KYMB 5JOFA 2O5ZL 3Q5YA 1KCSH 2VLKA 5EZOL 5ITBL 1I1FA 4QWWC 5ANME 1UJ3C 4PJ9D 2Q86B 1U8IA 3BP5B 4GQPH 1RK0B 1RUQL 4JFQA 2YD5A 4DAGL 2J8UB 3UJIL 2OJZH 2NX5D 4R7NA 4F9LC 4Y88A 3ETBF 1IGYA 4R3SB 2VZOA 1YPZA 1Z2KA 5I0DA 1KPRA 2HJLB 1DQJA 4CUCA 1LILA 2F53B 5T33L 2J8HA 4ZPVB 4V1DD 4LDOB 2KH2B 5I1IH 2RAMA 4X6DF 2ERJC 1A6ZB 2F19L 3BAEH 2DQCH 2LFGA 2UUDH 1ZHBA 4G9FD 3HZVA 4XPTH 3RDTB 3KNBA 1NC2D 3CGTA 4P2QE 2DM7A 4LCWE 1UXSA 4I3RL 4X6FB 4HLZH 5LCVL 1FPTL 5DVMA 4L4TB 5HYFA 2MCG1 4CVXA 3GMNA 1IFHH 1TQCC 4HKXB 3IFNL 4M02A 4PLKC 2VXVH 4IIQC 3SGDH 2X4SA 3CX5J 1FJ1A 4HUMB 2JJWA 3VWKD 1FVCB 2H2PD 5FUCC 3T0ED 5FGSA 3NCJL 3S5LA 2O5YH 1I1AD 4RISL 5F7HA 3RX8A 1HHJB 3RTQB 1RZKL 3O3EA 4LBEA 5BZDA 3E6FA 1KB9K 2ADJA 4JFPA 1T1ZA 3RJDA 3TVMD 1HHIA 1HXYA 5CJQH 3RWGA 1KFAH 1FAIL 5CZVL 4MHHG 5D1ZA 5KVFL 3HG1B 4LCUB 5ESVA 1J11A 4JFEA 1ES0A 3ARWA 1X7QA 3WXWH 2CDEB 5JDSB 2BSSA 3FB6A 4YNYA 1MAML 2CQVA 3MYJB 2V6HA 4QRPD 4Y4KD 4KJPD 5CMAB 5LGHH 1QLFB 1PQZA 3HB3D 3C5ZD 5CZXD 3TIEA 1MRFH 1P2CB 2IPKB 3QEQB 3MUGB 3GBNH 4AG4L 5IMMA 3DMMB 1P1ZA 2UZYB 1EIBA 1KCUH 4KK8C 4UTAL 2FEEI 1PDKA 2EEAA 1GSMA 2MHAB 5ECJE 4LLQB 1JTOA 2XFXB 4L3ED 3WSQL 2GJZA 4ZAKA 1SEBB 4N9GA 5FK9A 2YC1B 1BAFL 5JW5A 3V6FA 5MENB 1FN4A 4M8VA 5FV2A 5FECA 1K5NB 4QHUB 1PZUB 3LDBB 2YOCA 1S7QA 1GZPA 4HF5H 4PRBA 4OM0L 3T0DA 1ZLWH 5INDB 2L0DA 4HFUL 5JLZB 2X9XA 4LCCB 3IS0X 4MLSA 4YXHL 5HYEA 3H3BC 3I75B 5E94A 5E00A 5DRXA 1INDL 1VADA 3B83A 2EYTB 1ZT1A 2ED9A 2R69H 4OAWB 4P9MH 1BQHG 5FGCE 5ITFA 3V8CA 2BZDA 2J3SA 2W1NA 3CDGA 4FTVA 1DEDA 4Z6AT 4WUUA 2W9LA 3KJ4C 3O6FB 1FL5A 4XPFL 2MKWA 3VD7A 1HIML 2OSLB 5F7UA 4QXWA 4GOSA 5IMKB 4S0SD 4NPYB 4IRSD 3WNLA 2B1AL 2GTZA 3MOBH 1HHHA 3ILPB 3RIFK 1A3LL 1AXTL 5FM8A 3L3IB 2JF1A 4PGDA 3OJVC 4BZ1L 1HSAA 5FXCH 1J0JA 1K8DA 4HJ0C 1U0QA 3KPOB 1RHHA 4JG0H 5FHAH 3VU2A 1WAAA 2AV7B 2AEPL 1ORQA 1U8MB 5EU7C 1LO3L 5EFIB 2QSCH 4PGBB 5SWZD 3K2MC 5C6PB 2A6KA 1A1OB 1MHPL 1YQVH 2BXZA 1AGDB 4K9EL 3WIFB 1BQUA 1XMWA 4HBCL 1P84K 1IQDA 1X6NA 1PFCA 5DVLA 5E08H 2IAMC 4RIRB 1F97A 4QHLA 1BVKA 3TYFA 5H37H 3MNZA 5EUOE 1MCFA 1T5XA 3QDAA 3IAPA 2JK5A 2XZZA 4WV1C 1MJUH 4OLUH 2NQCA 5DFVD 3DXAB 4AIZB 2F8XC 3GFUA 3EKCA 1TVHB 5ALCL 4NKMB 1U2HA 2B2XH 2HAZA 1ACZA 3JVGC 1CLOL 3RVTC 4R8WL 4PRPD 1WTLA 5FAAA 3PWVB 3GHEH 2P5EB 4M43H 1MFEL 4XBGB 3RVVC 4GXUN 4GKZA 4X4MA 1TETL 4LVHB 4EZMA 3NFNA 5I1KH 5HHOD 2FD6H 3GJFH 4FXLA 4GAJL 1CBVH 3TIDA 1K6QL 3O8XD 4UQ2B 15C8L 2W0FB 5DQ9A 1BHGA 1SHMA 2CIKB 2WNGA 3ARDD 1ORSB 3DECA 3K4ZA 2WSKA 4HPYL 4U6VL 5ACMA 2YN5A 1T03L 2XKSA 2CLVB 4F58L 1YECL 4OV5A 1BMGA 3QIBB 4TSAL 1S5IL 4JY6B 4JHWL 1V7MH 2HFFB 3FB7A 1CE1L 4TQEH 5C0JA 3I2CH 3S36L 4EI5D 1A0QL 3CK0L 3EYOA 1HILB 2YA2A 4UINL 1NFDF 3BQUA 2Z91B 3O4LD 1JGUH 4Y2OA 3VXTA 4U1NA 1AD9A 2HLAA 4RZCA 2YPKA 2GCYB 2WP3T 1KIRB 1ZA6B 1NC4D 5C3TA 3VG0L 3CFDA 4GG6F 1FRGL 4DKFL 1F4WL 5DWUH 3QDMB 5LXGL 3MJ6A 4KZEL 4RA0C 3JV5A 3ARRA 5HGHB 3FRPA 5HVGB 2FNBA 2YPLA 4HCRH 4RGND 1GVIA 3OKOA 2KQNA 4NQCE 1XGYL 4QRQB 3THMH 2W59A 4Y5VA 3P4MB 4M1GL 5C07E 1YN6A 5AYUH 3T08A 5IQ7L 3E0GA 5CKAA 1MI5E 4MJ6B 4Q2ZA 1KCSL 1SJXA 3ARGA 4MVBC 5E70A 5MEPB 5HXMA 3T8XA 5DJXA 2N7AA 1JWSB 5KS9A 4WTXA 4ZNEE 1ZV5A 1CD1A 2WQRA 1H3TA 2FRGP 2OJZL 3PL6C 4XHJD 4K8RC 4HLJA 4WHDA 3FQUA 5C08D 2E6QA 3RP1A 4YDJB 4Z7OF 1U95B 3WS6A 3LN5B 4NNXB 3QIWD 1J5OH 2DL9A 4IDJH 5I1IL 2OK0H 5EZLA 3NIGE 3FB8B 1TZGL 3PE9A 3BAEL 2DQCL 1PD6A 5F3HA 3O3AB 2BC4A 3NVQA 3TN0A 1ITBB 4KKCC 4R6UA 4XPTL 2NMSA 1RUKH 3TC9A 4PBXA 3RU8H 4DKEH 4O2FB 1Q9LB 1F4AA 1IFHL 3EOAA 3N1PC 4Z78B 4HIJA 3OGOE 1GGBH 5DD6A 3U7WH 2NY5L 5IW6B 4I13B 4GH7B 2YBRB 5KSBB 4PJCE 4RFNB 4U6YA 1X5GA 4ETQA 5CEXA 3EUUA 4X99B 5I8CA 3QNXB 2DYPB 1FFNB 5BOPA 4CJ1A 3WUWG 1DTUA 3VFPB 2GJ6B 2VERN 2B4CC 4PRHD 4CADB 1KCRH 1IT9H 4X80L 1A6AA 1T2XA 5EULV 3QQ4B 3UZEA 3D3VA 4PJBF 5IVXA 1JE6A 3MRIA 3NACH 3V0WH 1OCWH 5MEQB 3TBSB 2ZG2A 3UBXA 4LCIH 3NPSC 1A22B 4PG9A 1W8OA 5C0AD 5HGBA 5F9OH 5F9AC 1NBVH 3S35X 1UWXH 4Y19D 4HKZB 5EO9B 5J11C 5DRWA 4ZSOA 4N8VB 3KHOA 1QSFA 4XNXH 4XPHH 4LSTH 2WIIA 4GS7C 2ESVE 4RGOH 1FE8H 1MRFL 1F4YH 4DVBA 4OI9A 1WWWX 1G7LB 5SWSE 4PB9H 3GBNL 1CT8B 2PXYD 1KCUL 5EU3A 4R4BA 4H8WL 4I48A 4PJDF 2IQAA 3UP1A 3MBEA 1NMBH 1A9EA 1H5BA 4EUPH 4CNIA 3IDYB 4LP4A 4HH8A 5BRZE 3DV4A 3LS5L 1KBGL 2JCCB 4TRPH 4LASH 4JREB 1R3JB 1B6UA 4NIKB 4H1LH 4PJ7E 4LF3B 4PRDA 2C7UA 4CDGC 4JFFE 4HF5L 5I76B 3QEUA 3ZMRA 2UZIL 2DMCA 4WWKB 3P77B 5F1IA 4QXTA 1Q94A 3TT1H 3P73B 5HDOA 2BSRB 1T4KA 3IETA 3NFPA 3RUGA 2P8MA 4YWGH 2R69L 3F7VA 1RZJC 2XY2A 2Y36H 5DEFA 3O6ML 5F88A 5D1XC 4U7MA 3UROR 4R9HA 4CN4A 1TZIB 4Y89A 3QFDB 1J12A 2VWEE 4HSQA 3D25A 2VISA 4YO0A 1OY3B 3BWAA 3LQAH 5KSAD 3KPLA 1JF6A 2M2DA 1W72B 4WNQA 3SKUD 4FFVC 1NQBA 3MOBL 3KPRD 3WBDA 3RVXD 1K4CB 1J9CT 2W0LA 1TFHA 5DD0H 2AK4B 3ZHDA 1I7UB 2GFBB 4WW1B 1ZXQA 3E1F1 4JCLA 4MAYD 1PYWB 4AL8H 2FO1A 2NY1B 5L2JB 5EBMA 4KJYA 1OGTA 2AK1H 1EVUA 2C1PB 4LFHG 4E9LA 2Q87A 5GGTH 5DHVB 4Z7UE 1PKOA 4Z7VF 3CH8A 1NCAL 3CMOH 4FFZH 5CP7A 1FNEA 1Y6NR 1RZFH 1S78D 5D4QA 1XEDA 3IDUA 2BERA 4BQCA 1I9RH 4NC2B 5I1DB 2Z8WC 1S9YA 3ARBB 2W60B 4M1DL 1MJUL 4Y5YA 3GMLA 4K2UH 2EEBA 3DWTA 2BVQA 3ALXA 1T0PB 4GMSH 1UJ3A 1Z0NA 2Y1VA 2BNRA 1I8KB 2A6DA 2B2XL 5TE7L 4P3DA 5TDPB 5LGKA 2D2OA 1U3JA 2C26A 4XVJL 4KH2A 4RNRA 4JRYE 2AXFB 1CDGA 2OMNA 3M17A 1MCKA 4GRMA 3TBTA 4KUCD 4MWFB 2IANE 4M93C 1T5WA 4F9LA 4FQQB 5D5ME 2XTJC 1OTTD 1WEJL 3MLVH 3GSNA 1RV6X 5C9JA 3GMQB 2FD6L 1Y18B 4LCYA 1CBVL 3DX6A 1CDJA 4LSVH 4OI8A 4OCLC 3Q48A 4OLWL 2NX5E 5CHNA 3VI4F 1AO7A 3P4NB 3C09C 4I5BA 4NQDB 3S88H 2VLRB 1V7ML 5CIPB 2JELL 1Q0XH 4TQEL 1FC1A 1M7DA 5D7IE 4V1DE 5DHYA 3VXUE 3ZKXB 4NRXB 1YY8B 4PJ8C 1QEWA 4IIQA 5FKPB 1F6LL 4MSWB 4G9FE 5C0DA 2KDGA 4GRWE 4MD0B 1YEHL 3F62A 5ISZA 3NZ8A 1YEEH 5DDHA 1JGUL 1BZ9A 3SKMA 5K9KB 3HZMA 4G9DB 5ESAA 1DVFB 3MCKA 3ELAT 4Y8DC 4OTXH 3BPNC 4HXBH 5DWUL 3RWEA 3QHZH 3MODH 1X44A 2CO6B 2D7TL 2F53D 4P5MA 3RFZC 1HH9B 1WC7B 4UDTA 4X7FC 5DR5L 2CDGB 5BQ7B 4P2OA 2V9RA 3HI1B 3J8F7 4HCRL 2BOCB 3EYVA 1LE5B 4MZ2A 3THML 1G1YA 5J8OA 1CGSH 1MREH 3VGEA 4A6YB 3RDTD 5FGRA 5AYUL 2VKXA 2H26A 2VLJA 5B39B 3BPCA 2IBBA 1JWUA 1XT5A 4XCEA 4L4TD 3HLAA 2NPLX 4MX7A 1CD8A 1FG2A 1DANU 1FLRH 3HPLA 1H0DB 5D7LB 2XKNA 5KSUA 1YNKH 1KJVB 2DM3A 5KS9F 1QNZH 3RGHA 4ZXBA 1OLZA 4QRPE 1AQDA 3FCTA 4WO4A 3RTQD 4K94C 2BRRL 3L3HA 5IB3A 2DI8A 1JGVL 2PN5A 4HLZG 5JXEC 5HPOA 1MELA 1DBAL 1T3FB 1A7QL 1J5OL 2OK0L 5LKNA 4PJFA 1J86A 2AS5M 4KY1H 5IB1A 1TTUA 2VLLA 3HG1D 2VLKB 1KN2L 3BWUC 4L3EE 5TH2A 1I1FB 4NUJA 5I75C 1XZ0B 1U8IB 4CL7A 1RUKL 1UZ6F 3ALPA 4DKEL 4JFQB 1F3DH 4R7NB 1I8LC 3C6SA 4NQVA 1GGBL 1J7VR 1QPXA 4Y4FD 2XTLA 1C8PA 1SEQL 1IGYB 4MCYA 4XPAH 1WIUA 1YPZB 5DC9B 5ELIA 3KXFD 1KPRB 2VDPL 1DQJB 4MA7L 3S37X 3EHBC 5ADOH 5JDJA 2ZSVA 3QEQD 3WFCH 2Z31C 3DMMD 4KRNA 5H2BB 4Z0BL 2VSCA 3LKSA 3RAJH 1KJ2A 2A77L 1CXHA 2V5RA 5DJZA 5DQDH 4OCRL 1IT9L 1ZHBB 1PG7X 2CMRH 3HZVB 2EZ0D 4DK3A 3AGVA 5MEND 4NOBA 3BN9C 4OZFH 3WHE0 4G8FB 5IBLD 2FBJH 4NQTA 1PY9A 3V0WL 5L6YH 1OCWL 5KJRH 1AGBA 4ODTH 4CVXB 3GMNB 3NFSH 1FNSH 2J6EA 3LQMA 3QUZC 4LCIL 2DQFA 2X4SB 4XWGL 1A1MB 1X4YA 1FJ1B 4J1UA 4NBZB 4YHPB 3EDDA 4G6AD 5F9OL 3ULUH 1X5YA 2WUBL 3FO2A 4Z77A 2X40A 4XPHL 1FZMA 4OZGA 5SWZE 1LNUA 3MRHA 3O3EB 4LBEB 5BZDB 4QHMA 2ADJB 1HXMA 4RGOL 1FE8L 3SDXE 1FAKT 4JFPB 1NLDL 3KYNB 4MNGA 5M94B 1T1ZB 1ZT7B 2DLHA 4PB9L 1HHIB 1HXYB 3RWGB 5JUEL 4APQC 4L3CA 2OZ4A 3O6FD 1E4KC 3MJGX 5D1ZB 5I74B 4MA1B 2C3VA 1E4XH 1KV3A 1G6RH 5ESVB 2AJSH 3STZA 4D0DA 3W5NA 4JFEB 1ES0B 1X7QB 2HWZH 4AH2A 1IGTB 5JZ7C 2BSSB 3FB6B 4YNYB 3UO1H 4TNVF 2X4UB 5D2LB 4LDEB 2W9DH 1T7XA 3IDXL 1WFNA 3IXAA 2ZUSA 1TJHL 1SY6H 4HG4J 3TT1L 4PRPE 5F7DA 1PQZB 2GAZA 2GSIA 3ULUD 3TIEB 3IB4A 1I7TA 2X1PA 5JOPD 4YWGL 1HNGA 1Z3GL 3G5XA 2Y36L 5IMMB 3D69A 4IBLT 3L7EA 5HHOE 5EOCL 5K9OA 2IG2H 5FGBC 3DUSA 4I0KA 2AJVH 2GJZB 4N9GB 5FK9B 3NAAH 4R2GC 3U30C 5JW5B 3K8KA 3SHSA 3V6FB 1FN4B 5FECB 1UZ8A 3REWA 3DXAD 4DZBA 1S7QB 1GZPB 4U6XA 4PRBB 1SYVB 1JGLH 3AUVA 3MJ7A 2VXUH 2QSVA 1H3PH 4U05A 1OAYH 3V9FA 5IEHA 2ATKB 3KGRA 3DETD 5JPNA 2P5ED 5H37G 4HJJL 5DD0L 5E94B 5E00B 2HH0L 5DK2A 3FQWA 5DRXB 1OLLA 4LPWA 1NGWA 1DCLA 5J56B 4G5ZH 1QFWH 3GSRA 4AL8L 1BF8A 5ITFB 3G5VA 3O4LE 1EEUA 4LEXH 2VZ1A 5GGTL 3CDGB 4FTVB 3WFDL 3ZTNH 4FFZL 4WUUB 4HK0A 1G9MC 2I5YH 2D7OA 4X9IA 5M95B 2VDMH 1FL5B 1RZFL 1UEYA 1JZ2A 2F8OA 3ULVF 1I9RL 3QIBD 5GS0L 3L3KA 1EO5A 4QTHA 4P23A 3O45A 2EKSB 4LRNH 2ED7A 2GTZB 3UTZA 1HHHB 4NC1E 4NQXA 4D8PA 3SPVA 4K2UL 4PGDB 4XXCC 3T2NH 5F3BA 1A6UL 1K8DB 5DA4A 2YMXH 5B8CC 4HZLB 1E27A 1KTLA 1RHHB 5A3ID 4RGNE 5JQ6L 1CXIA 3PL6A 1D5BA 4KMLB 1HK6A 3FT3A 5CGYD 3TZVC 3AS3A 1DBBL 1I9JL 1IQDB 4R97C 1FV1A 3KPSB 2Y72A 2XV6B 4QHLB 1BVKB 3TYFB 3MNZB 4LSVL 1T2JA 4P4KC 2FIKA 3ESUF 1VEPA 4K55A 1T5XB 4LLWA 3S98A 4JDZA 1XCTA 4JKPH 3QDMD 2JK5B 3HR5A 4QOKA 4KV5E 4OFYD 2ZJSL 2HRPH 5C08E 2RB8A 3I3BA 3O3BA 3MRGA 2EDOA 2ZUQC 1CXKA 4OM1H 4WHCA 2V17H 1IBGH 2W38A 4PUBH 1MCHA 5F8RC 4I8DA 5DUML 4RMUA 3HZKA 1MFAH 3FKUS 4LKCA 4WFHD 3CFJB 3DGCR 5GSRA 2Y07H 2YKLH 3NFNB 3OAUH 5CLWA 4WU7A 1CXEA 5EWIH 3OSKA 3TIDB 1U3HC 3FAWA 3R0MA 2OQJA 3VG9B 2E9IA 3FN9A 2ZWLT 1ZLUH 1GOFA 1TNNA 1J0HA 3ARUA 1RD6A 3OKEA 1RU9L 5C71A 3VFMA 1LO0L 1N59A 2YD3A 3IFLL 1OAKH 4PTTA 2VDQH 2SEBB 3MODL 1S3KH 3FQRA 3FB7B 1JK8A 3NCCB 1UH2A 5DEZA 3V0AC 4QTIH 1YMMA 4KZDL 1F3JB 4PRHE 1JGDB 1MREL 3EO9H 3EYOB 3I50L 5CUSH 3QI9C 3SCMA 1CVSC 1VB9A 3BQUB 4ZTOH 4KMTH 3ULVL 3SKOA 1AE6H 2P5WA 4KK5D 1JNLH 3VXTB 2RR3A 2HLAB 4RZCB 4ENEC 3HRZA 1NGPH 2FGWL 2MPAH 2YPKB 5JW3H 4KVNH 2AGJH 1FLRL 3Q3GA 1BJ1J 1YNKL 5C0AE 4IHOA 3GJEA 3S34H 4Q6IB 4Y19E 3UMTA 1AJ7H 2DRUA 2OR9H 3VH8G 2DYPD 4NKDB 3JWDH 4LHUB 4IEFB 2V7NA 3HUJE 1JPST 2YPLB 2OXGA 1W0VB 2Y06H 5EN2A 2OTUB 1QBBA 4K3HA 3OKOB 1WZKA 5T1LA 1QRNB 3H9HA 1DFBH 4IMLA 2EDQA 3QRGH 4Y5VB 2LU4A 5FYKU 4HFWA 1YN6B 1TVBB 4KY1L 4DGYH 3QQ9D 4CU8A 4MXVE 4WW2B 4Q2ZB 5ESQB 4NO5A 3T8XB 5DJXB 5IHUH 3CPLA 4HHAB 5GIRA 4X6EA 1CDIA 3TBYA 1CD1B 4CBPA 1CYGA 1AR2A 1KN4H 4H26B 3GI8L 1L9NA 1F00I 4XPAL 1VACA 4J4PD 4LLAA 1HH6A 2CLZA 2RHEA 3VRIA 2IMNA 4UT7H 5ADOL 3WFCL 3HAEA 4UV7L 3LKQA 1F11B 5DQDL 5F96L 4TUOA 3RAJL 3WE6A 1KB5A 2HKFH 1BQLH 1W72H 2BC4B 2CMRL 5IIEA 1AQKL 2Y9RT 2EC8A 1IAKB 3AS0A 4DN4L 4WHYH 2KZ1B 2FBJL 5L6YL 5KJRL 4ODTL 4G8IB 4HIJB 3KPRE 5HDQH 3MLUH 5IP4A 4WWKD 5CBAB 5DD6B 2R0LL 3ULUL 1YEGH 1O7SA 5CINH 5BXFA 4U6YB 1D6VH 5CEXB 1LE9A 5DHVH 4AK1A 5I8CB 3QUMA 3P3YA 2I25N 3S3JA 5IESH 5IFHH 5HI4C 3LPGA 4H1LG 4QHKJ 1FORH 1A6AB 5I0ZA 5FYJE 2AJZA 3D3VB 1EJOH 3VFOA 5IVXB 3ZHKA 1E4XL 3K3QA 5C0NC 3T0AA 2AJSL 2HJFA 2FX9H 1G7QA 5ACZA 1A64A 4I18C 1IGCH 2Z4QA 2HWZL 4PG9B 1IGIL 1TTFA 5HGBB 3UO1L 3LD8B 1NAML 1HI6A 2YD9A 4S2SA 4YDLB 2AK4D 3VDAA 5DRWB 2NZ9D 3E8UL 1V3LA 1SY6L 1S9WB 4F15B 2WIIB 2NY1D 2VQUA 3IU3A 1FZOA 1NGYA 3PQYB 4NO2A 1QLRB 4PGCA 5I1HH 1REIA 4N0UA 3TFKC 5T3ZE 1NGQL 2GW5A 5IGXL 2IALA 4R4BB 1X5ZA 4I48B 4FQHA 2IQAB 3MBEB 1A9EB 1H5BB 2AJVL 4CNIB 2NYYC 1JF5A 5K9QG 5CIPH 1MRCH 3DV4B 4OZHB 1I1CA 4M6MH 3LS4H 3TBVA 4PJEA 2C7UB 3QEUB 3TJHC 1JGLL 3FFCB 3H9SA 3BI9X 2BHYA 1H3PL 1JF1A 1OAYL 4QXTB 1Q94B 4X7SH 4LQ1A 3O9WC 4NJAH 1T4KB 3NFPB 3IETB 3RUGB 5B38G 2P8MB 2UWEB 2L7UA 3F7VB 4QGTA 5DEFB 2BK8A 4LL9A 4YBQC 1AKJA 1QFWL 2R1YB 4ZUSA 3ZDYE 4C83A 2DF3A 2EDYA 5AD0B 3QPXH 4LEXL 2J8UE 5GISL 3D25B 3ZTNL 2I5YL 2VISB 2VDML 4GMTH 3BZFA 4YO0B 3BWAB 3S4SA 3ULSA 4M1CC 3RVUD 4NQDD 2VLRD 1S7UA 3H8NA 4WNQB 3ZE1E 4LK4A 4JAMA 4IS6A 4LRNL 2F53E 3N50A 4NKOA 1INQA 4A6YH 3T2NL 5KOVC 1IC4H 5C0FA 2YMXL 3SE8H 4JO1H 4LNRA 4J3TA 1XR9A 3PWLA 4IOIA 1N26A 1AR1D 3TH4T 4BQ9A 1IL1A 4K71B 4KJQC 4KJYB 1OGTB 5H94A 2LABA 3HS0A 1Z9SA 4L4TE 4ZD3L 1ZGLP 2GUOA 1V5JA 5CP7B 5FUZH 1FNEB 1DVFD 4UT6H 1J1XH 3VDCA 1U3ZA 1EHXA 1WVZA 3VA6A 2BX5A 4JKPL 2HRPL 4Y5YB 3GMLB 1M7IA 4TULL 2BVQB 5F7MC 4DCQB 5CD5C 2BNRB 2A6DB 3X17A 1VENA 3AM8A 4OM1L 3ZT7A 2H2SC 1IBGL 4RNRB 3M17B 2GK2A 4GRMB 5E8EA 3TBTB 1T5WB 3HG1E 4TNVK 1JRHI 5JA9A 2G5BA 3GSNB 2YKLL 3MC0A 4K7FB 3OAUL 5C9JB 4YE4H 5D7LD 4LCYB 4QHKI 5EWIL 5KZCB 1YQ2A 1P7HL 2Z31A 1FHGA 3VFVB 2APTA 5CHNB 4XMLH 1FYHB 3EYSL 1AO7B 4PIRF 1EDQA 4I5BB 5T5FH 1OAKL 4KPHH 4KGLA 2VDQL 4D9LL 3KXFE 1S3KL 4OUUA 2VDOH 1ITCA 3QEQE 1M7DB 2AQ1A 2Q7NA 4QTIL 2OL3A 4IJ3C 1PZ5A 5DYOB 1VFMA 2A1WH 1QEWB 4IIQB 2VLKD 4LLYA 5C0DB 1HEZA 2DWEA 5MENE 5J13C 4GQ9L 3ZT6A 4ZTOL 4KMTL 5C70A 4TTDC 3BGAA 5ISZB 1AE6L 1S7VA 5DDHB 1BZ9B 1CGWA 1JNLL 5JW3L 2MPAL 3VD9A 3HZMB 2AGJL 3PWPB 1C5CH 3MCKB 1IM3B 1H9VA 5ALBH 1XF2A 4OGAD 3S34L 4APQA 1KB9J 4NQUA 1NCWH 2A38A 2EEDA 1AJ7L 5F97E 1E4KA 4P5MB 1HE7A 1QSZA 5F6HJ 1MNUH 1S7XA 4UDTB 4LVOC 3JWDL 5A2JH 4P2OB 3FN3A 2Y06L 4ODUA 2HT2D 2E7HA 1D3CA 2A74A 5I1LA 3QRGL 1MF2H 4DGYL 4J3XA 2H26B 2VLJB 4NKIH 3QDGA 3BPCB 5SX5K 1AC0A 2ITCA 2MQ3A 2VH5H 1JWUB 4X7EC 4XCEB 5K59E 3HLAB 4MX7B 1FG2B 5MERA 5IHUL 1C5BL 5D93C 3HPLB 4RFEA 2D0HA 2XKNB 5KSUB 4HWEH 1II4E 3IGAA 3MLPA 4ZXBB 1T66D 1S9XA 2X5PA 1AQDB 3FCTB 4MAUL 4WO4B 1T7VA 4HS3A 4LRIC 1BVZA 4OZFG 3L3HB 5IB3B 2PO6A 4PRNA 3EYFA 3ET9F 3JXAA 3ULUE 4JQIH 4BQBA 5JOPE 3JUYA 1C16A 2R2EA 1EO8H 1UQSA 1X5KA 5JIHA 4PJFB 4QGYA 1YNTA 2FHCA 2IPUG 2VLLB 5D1ZD 3PGDA 3ZL4H 1BQLL 1W72L 3RZCC 5GGRA 5KTEH 4OSUL 4C4KO 3VGDA 2D7NA 5C0CA 4JFED 1N8ZB 1OP5H 4U7SA 5ILTH 2YHGA 1DUYA 4WI2A 2ILLA 4O58H 3DXAE 3IDMA 1D9KA 3DURA 1VEMA 3C6SB 4NQVB 1BBDH 5HDQL 3BZDA 3MLUL 5E6YA 3JV6A 4KK9D 4MCYB 5D7JC 2LQRA 5D72L 4ONHA 4JE4B 2P5EE 4M7ZC 5CINL 4YXKH 5E5RB 3KJ4B 4YHNA 4FG6D 1RIUH 5IESL 4HGWA 4FQXC 1BEYL 3DVGB 3MV01 2F8VA 3LKSB 3KS0H 4G6FB 3QISA 1KJ2B 4FQ1H 2B39A 2P49B 4O5LH 5DJZB 4ZYKB 1JWMA 1QP1A 4ZAKD 4XXCA 1ZLSH 1EVTC 5B8CA 3T2PA 3GUTA 1EJOL 1RZ8A 4HAFA 5F7FA 5H8DA 1BPVA 3SQOH 3QNZA 1AGBB 4OF3A 5JHLH 1OVZA 5I18H 1IGCL 2DQFB 3KWWA 5TDOB 3UPRB 3U46A 2XI9A 4P2YA 1RZ7H 5E2TH 3T0VA 4U6TA 4L8DA 3FO2B 5HTSA 4Z77B 2CJUH 4KKNA 4F7TB 3A6CH 1P84J 1X9QA 25C8L 2PR4L 1FZMB 4OZGB 1LNUB 3MRHB 3JWOL 4YHYB 4TSCH 5HHXH 1HXMB 5DC4B 3NCFB 4XB7A 5I1HL 3AC0A 4JM2A 4FTVD 1H15B 3RVWC 4WUUD 2QQKH 4L3CB 1RIHL 1EGJH 3TNMA 1KXTB 2DWDB 3FO1A 4O2CA 5IHZA 4GG8A 4ZFZB 3DV6A 1JYXA 3STZB 4D0DB 4M6ML 2YUVA 4ALAL 3QDME 3MR9B 4OUOA 5I1CL 1CTNA 1KLFA 5FB8A 4GXVL 4X4ZA 3ZDXE 5T1DH 3IXAB 4X7SL 5BVJA 5F7DB 1FFPB 2Q7YA 3MLSH 2GSIB 1XCQA 4X5XA 5F6HI 1I7TB 5E0QA 2UY7A 4WFHE 3ES6A 4OIIL 5D96B 2A9MH 2CUHA 3D69B 3SGKA 3L7EB 2EDRA 1OOAA 3QPXL 4QHNA 3O2WH 2DQTH 4XXDA 5ICXA 3Q5TA 4Z7QE 4GMTL 1UZ8B 3REWB 3C5SA 3LEXA 4PYHA 4HWNA 1P9MA 4U6XB 1KPUA 3BP6A 3CH1A 3MJ7B 4L8SC 5C0BB 1HDMA 4A6YL 3SDDA 5IEHB 1IC4L 4IRZH 1ZANL 5IB4A 4JO1L 3SE8L 2GHWB 3FFDA 4ZODA 5DK2B 3FQWB 4Q9RH 3MV11 3QULA 1PJ9A 4WEUD 1YC8A 1BBJA 3IRPX 3GSRB 2Q8AH 5JW4R 3CD4A 3G5VB 4CMHB 1YYML 4EDXA 3WHE1 4HK0B