5KOVC

Crystal structure of the human astrovirus 2 capsid protein spike in complex with a single chain variable fragment of an astrovirus neutralizing antibody at 3.24-a resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
245
structure length
223
Chain Sequence
DVQLKQSGPGLVQPSQSLSITCTVSGFSLIDYGVHWVRQSPGKGLEWLGVIWTGGSTDYNAAFISRLTISKDNSKSQVFFKMNSLQANDTGIYYCGRPYYGNVMDYWGQGTSVTVDIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTFPPTFGGGTKLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Human Astrovirus Capsid-Antibody Complex and Mechanistic Insights into Virus Neutralization.
pubmed doi rcsb
source organism Human astrovirus-2
molecule tags Viral protein
molecule keywords Capsid polyprotein VP90
total genus 45
structure length 223
sequence length 245
chains with identical sequence E, I, K, O, Q, U, W
ec nomenclature
pdb deposition date 2016-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kovC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kovC01
4OKVB 1ZHBA 3TPUB 1DBAL 5C2UB 5EO0B 4LBEB 1FZOA 4OGZA 3TLRA 1CT8A 2NY2C 4NP4H 1V7MH 5F1IA 1HXMB 4YX2L 5EIIA 5E5MA 2XZCL 3TM6A 3WO4B 5C7XL 5E24E 1Q0YL 2VMFA 2Z35B 4ZFGH 1EMTL 3QEHB 1C5CL 3GSNB 4OTXL 3B2VL 5GZND 4GLRI 3TT1L 5C86A 3QG7L 2VTFA 3OKEB 3I2CH 2M26A 3N06B 4OZIE 3VXUA 2A73A 3IJHA 1BFOA 3CXHK 3MXVL 3GHEH 5F7EL 5FO8B 3IRPX 5C71A 4P9HC 3C60D 5HDQH 2ORBL 4R0LC 4HZLA 1AP2A 2GT9A 5D72H 3RUGF 3NCYP 1PY4A 4OZGF 4K8RC 3RX7A 5IQ7L 4CAGA 3PGFH 3BWUC 1MIML 1HH6A 3VXQA 3AS1A 4HJJL 5EOCH 1YNKL 1BBDH 2YRZA 2WWMD 2YD3A 5BOPA 5EG6C 1EEUA 3QG6A 4JPVH 4RAUB 5E08H 5HI4D 3EJZC 5F21B 4JQXA 1T1ZB 3RWCA 4HPOL 3VXRA 5F7EH 1NCBH 4POYA 4PJCF 3IFNH 4M5YH 4HS3A 3L3JA 3GMNB 1RPQA 2QQLH 3V52H 5FB8B 3UAJC 5E4EC 4J2XA 1HYRC 2R23B 4KK9D 4EUPH 4OD2A 5ADPL 1X5YA 5CWSA 4P46A 4Z7WB 4QGTA 5C0EB 3BDYL 3T77A 3OB0H 3BZ4B 3FT2B 2P1YA 3KPQB 3BPOB 4H0IA 5DI8A 3MLTB 3MJ7A 3FB8A 4OB5H 5MENA 1B0GB 5HGHB 3CUPB 5I1DB 4G6JL 5IMKB 3ZE2E 4YHML 4PB9L 9CGTA 3L3HB 4P46C 2FJFA 3MNVB 1FNGA 1AR1C 1VFMA 4ESKA 1QBLL 5AG9A 5F89A 1CDBA 1IC5L 4DTGL 2BMKB 4PYHA 1S9WB 2V9TA 1DQDL 3KJ4C 3HAEA 4RGOH 5E6ID 5LGHL 3V6BR 3PHQA 5CSBA 3DTXB 3V5KB 1OGTA 2ZOLB 2YPLD 4JM2C 5T3ZE 4H25B 4TSAH 3U6RA 1OTSD 3T0BA 2G9HB 3HMWH 3RWEA 3JWDC 5E8NB 5EOCJ 4KFZC 5FAAA 1MCBA 3MXVH 1N7ML 3QDJD 1YMHA 1RZJH 4ZSOA 2AJZB 4HFUL 2ATPA 1S5HB 4FQJL 4LCCC 3FONB 5E1AA 4G6AC 3ULUD 3IDUA 4XRCB 1KPUA 3TO2A 2E6PA 2QADC 1TQCC 3MV9E 3GMOB 3BP7B 4OCLC 5A3ID 1FIGL 2FX7H 5FO9A 4PLNC 2EYRA 3X11A 1MCWM 1ZT1B 4PG9A 1H8OA 2ZCLH 4Q0XL 3MR9A 3KPRE 1F6LL 4PJ5D 1QBLH 4E0RB 1VEMA 3VFMB 3SDCC 4L8CB 1XFPA 1IILE 5C09D 2X4QB 4MXWH 3HPLB 3HC3L 4OCSH 4AM0A 5I71C 4PJ8D 2EDXA 1A3LL 1QKZL 2DYPA 1S7VA 3RWIA 4FQ1L 1VHPA 1CBVH 3FHQA 4TUOA 1CLOL 2WV3A 1U3HC 2DIJA 5C0BB 1OM3L 1NJ9A 3FFDA 3HZMA 2BX5A 1CDCA 2XA3A 5CEZD 1UA6L 4YXKH 4D0DB 2EEBA 4G6FB 3O3EB 1VFAB 3SGEI 3BRGC 2VXUH 1N2RA 1ITCA 3JV6B 1F4YH 2CDFA 3DV6B 5DEGA 4YE4L 3EYFB 3QP3A 3ARSA 3DVFA 3LV3A 4OF0A 1IEAB 5ICXB 4PJ5E 2FBJL 3I3BA 4I13B 3FQRB 5HHQA 3IDIA 1X5FA 4JDVB 4JRXE 4OCWL 4QRQA 1U36A 2IANE 2FR4A 3SBWC 4Y2DA 2UYLA 4HXBH 4I18A 1U3ZA 4P57A 1BX2A 2JIXD 1FZJA 4FQXC 4JVWA 2D03L 4NJAH 4RGMC 2QSVA 4M62H 2HVKB 5I2IA 1MLCA 4K3DL 3MJ9A 5HGGS 4U6VH 5TPWL 3QFJA 3ALWA 1UT9A 2LAGB 2VZ3A 2ESVB 3BZEA 2CR6A 5FHAL 1ZEAH 5JLZB 5HPMB 1JF1A 4WEBL 4NN5C 4FXKB 1XAUA 3TN0B 2CKBB 4ERSH 5DZOA 4HG4J 1UXWB 4QXUH 3RQ3A 3D87B 4WFFD 4GRWH 1N59A 1NGQH 1X5ZA 2A74A 5TDPB 4HKZA 3RNQA 4JLRB 4Z7QE 5I15L 3FN3A 1N4XH 5JHDA 1YC8A 4K94L 5ABDE 2D0HA 2R0KL 4FQLH 4ZOBA 5D5MB 1T0NA 2PYFA 4JCMA 5ESVB 5DA0B 3V0VA 5BOZG 3Q1SL 4LIQE 1EAPA 2CDGA 1XH3A 3UO1H 4XXCC 2PR4H 4PJBE 3CFIC 1LNUB 4MJ5B 2R39A 2VE6B 1DBKH 2W07A 5I1AB 3FN9A 4JZJA 4L9DA 4WENB 4XGZB 2HA1A 3U2SA 1ZS8B 5ITBL 5EU5A 2ADJA 3OJ2C 4X0KA 5IMMB 1JIBA 4KROD 1B6DA 2WZPD 5D8JL 2BCKB 3X3GH 4DUXA 3VXUE 1JUFB 1AKJD 1MREH 1NMAH 3B3IA 5IVOA 1ZVSB 3ARGD 2CIIA 2EIEA 3ELAT 2VIRB 5TDOB 3CXHJ 3DWTA 3DRTA 4UOW1 1IC4H 3T8XA 5GIRA 3G5VB 3FHAA 3GM0A 1J8HB 5GISL 1E4JA 1F45A 4GRWB 4NHUB 3O2DA 4KTDH 1JP5A 1JBJA 4WHDA 3MUHL 5C08B 1FL3B 5KS9A 2GHWB 1EBAA 3D9AL 4OD1L 3N1GC 4IJ3C 3ZDXE 5C2BL 3KDMB 5DR5L 4P4KA 4WHYG 4OSUH 1K2DA 1AE6L 2GJ6E 1PKQB 3F6LA 1Q9KB 5A40E 4GAYA 3I50L 4GRLB 4U6VL 3BN3B 4WGVB 5F6HJ 4KVNL 4H0GA 2GSGA 3L7FB 4GKNA 2AXHA 3G6DH 3U0PB 4PP2B 3QIUC 3BYYA 3S88H 4WFEE 2R0LH 3KGRA 4Z18A 3EDFA 2F8OA 4UT9L 3VRLF 1ZLVH 4OZHB 2P5EE 4QHNB 3VFOB 3D25B 3KS0J 1F4YL 1YDPA 4H1LB 1FP5A 1F4HA 3Q6GL 4JY4B 2UZXB 3DNKA 4OLXL 3QJFB 3CDGA 3BPCB 2J4WH 3IJYA 3MNWB 4HAGA 4YGVB 4ALAL 4UQ3B 5IB3B 1R5WB 4UV4H 4GQ9H 1W2KT 4X7EC 4MJ4A 1RZ8A 5JOPD 4JFQB 1RZKL 1AY1L 3F7VB 4EKXA 4XHJC 2AABL 4DN3H 3BP4B 3GMLA 5T3ZD 1F2XK 4C56D 3D85B 1A6PA 1QG3A 1SM3L 2GI7A 1LEGB 1CTOA 4N8VG 4U33A 3O4LE 1YEGL 2Z8SA 4JFDD 3KPMB 2AXGA 5J6GA 3LEXA 3O2VH 1TCRB 4FFYL 4KKLC 4X6CB 3GSUB 5D70L 5AG8A 1BREA 4Y5XB 1PYWA 4KUZL 3ROOA 1ZHLB 4UDTB 3MRFA 1IJ9A 2AV7B 5D5MF 1ZHNA 3IXTA 1HDMA 1A5FL 3EYQC 1JI2A 2JJVA 3RZCB 1DQTA 4PJGA 4F33A 1XR8B 4PJ8A 5ID1A 3OKNB 3BZDA 5EOQL 3L6FA 5D7SH 4AYFA 4NT6B 1A9EA 3MPCA 2HKHH 4XPHH 4UV4L 4ZTOH 1KTLB 1JYWA 4UTAL 2FEDC 3D18B 1CLZL 3JTTA 3VXPA 4YHNA 3P11H 3Q1SH 4LLUB 4YDJA 1SQ2N 4Y4HB 2VDMH 4P5MB 1FO0H 5H35B 3FCTB 5F1NB 4MB5A 5T1MB 4I3GA 3MFFB 1MWAB 3DHJA 4K7PL 2KQNA 3T09A 2IANB 1WBXB 4L9LC 4W70A 1CL7L 3DX7A 4KAQL 4PRHE 1UGNA 1CDGA 4HK3N 5JO5A 1DDHB 4KMQA 1OF2B 4CADA 1GGIL 1IFHH 5DLMH 2LU3A 1DSFL 5D1QA 2HTKD 4WI7A 3RIAF 3T04D 4NQTA 5AYUL 4QHLA 2DL9A 2CGRL 4BELD 4ZDHA 4EI5B 4K3JL 5F7KC 1T3FB 5JMRA 1GH7A 5F7MC 2O5ZL 3F7YB 1HIMH 5DD5L 5JIHA 3CSGA 1NCDH 3IGAA 4ZFOA 5CKGA 3OHXA 5DJDA 2JIXA 4XCCH 5HHMB 3I6LD 4IMLA 2V9RA 1CFNB 2LTQC 1VFUA 4PGJA 3QAZB 1FVEA 4LRNL 4PJBA 4AT6A 4QRRE 4GKSA 3QEUA 4IOFD 1ZK9A 2F54E 3LQZB 2BNRE 1DQQA 3ULSB 4XPBL 1OHQA 2VAJA 3LRSA 3ARBB 1P84K 1UXSA 3EBAA 3VI4E 3VW3H 1NDMA 2D7MA 2DBLL 4DZ8A 5IV2B 5GRZA 1Q9OB 3H2WA 1J1XH 2EDKA 4FQ2H 2FATH 3OXSB 1BGXH 2HYMA 3T0AA 3SKMA 2J2ZA 2FB4L 1WIOA 3LSOA 5BS0D 1NBZA 3KPOA 2F5AL 2ENSA 4PBXA 3TH2T 2HFEB 5DRXB 4XNZC 4X4MA 5GZOC 2DLGA 1UH2A 5FUOL 4PJAB 4OIIL 3GI8L 4OZ4B 1NBQA 3VRJB 3O4OC 4MJ2A 1UA6H 5DZNA 3BDYH 4LPVA 4H20L 1T21B 5JPMB 5FYJU 2YD4A 4Y4KD 4EN3B 5K9JL 2ZOKB 3TCLA 2Q20A 1OTTD 3VXNB 5ANME 3T0ED 4KI5C 3FTGA 3TBTA 1QR1B 1SEQH 3S96A 3OJMB 1FFRA 2EDNA 2JCCB 4CMHC 2ATKA 4X6EA 1DQMH 2AK4B 5CIPB 4KXZI 4ONOA 4P2OA 1JWMB 1OAUH 1YEIH 5E7FA 3RWHB 1FPTH 3OJVC 3H3KA 4PJXA 5FV1L 1KLFA 5C0DA 1IAII 1R3IH 1B90A 2V5MA 4DEPB 2AP2A 1BLNB 3EOYG 1RUPH 5AEAA 3ARPA 1MHEB 4Z7WE 1NLBH 3SJVE 5SV3A 5KJRH 4O51B 3QXDB 3RWGB 4AH2A 1AQKL 5MEPB 3GJFK 4PR5B 3UJTL 4F8TA 2VLKB 3C09B 1XGQB 2JJUA 1TZHA 1LK2A 1FFPA 1WZ1H 2Z8RA 2X09A 4JJ5A 1A7RL 1I8IA 1HXMA 3DV4A 1IGCH 3RVTC 5IIEA 1UB5A 3QDJB 1P4BH 1A6UH 1JWSA 1E6OH 2VXVH 3OL2A 4YHYB 4M9OA 3L5WA 3A6CH 3DETD 3GSNA 4EUPA 1VADB 3EFFB 3MOQA 4OZFB 2P49B 2AXFB 4HGKC 4UZGA 2WW8A 2XN9D 1WCQA 4L3CA 2X10A 4KK6D 5IJKC 4MAYD 3EYVB 4QWWD 5TQ0L 2C3VB 1DL7H 1HI6A 3MTRA 1ZLUK 3UC0H 2PO6A 4LGSB 2JELL 1QHOA 5E9DA 2DKUA 2KPNA 1WCBB 3QUMH 3GNMH 4X99B 5DGQA 3E0GA 1LO5A 2Q6WA 3RKDD 1NMCC 4MA8H 4NDMB 1REIA 3CFDB 2I07A 3DO3A 1RUAL 1VGEH 2VDOH 2DJ4A 3W9EA 1C16B 3O4LA 3TIEB 3O81A 4QCIA 2FD6L 4O02L 2XACC 5B3JF 1NFDF 4U6YB 3K1KC 5K9JH 1RJYB 5BRZE 2OJZH 4YBQC 3LHPL 3ZKND 1JV5A 3KPRB 3CJJA 4WJ5A 2BY1A 1HYSD 5I19H 1KTRL 3FO9A 4HWBA 5DUPL 3CFJA 3WD5L 4APQA 3UJIL 3W9DA 3C6LC 1OSZB 3T2PA 1ZLSL 3LS5L 4I0PA 4JFYA 2R8SL 2Y06H 4JFEA 4Y4FA 1EFXD 3GGWB 5DZLA 5E7BA 1MCNA 3KWWA 1X44A 2BHZA 5JIIA 3D39B 1UYWL 2B0SL 2NX5E 3IDJA 4UAOB 5T1KD 4U1MA 5I74C 3WEXA 1D6VL 4RWYL 2BSTB 5CP7A 5CAYB 4NQEA 3ZT5A 5DRWB 1QZ1A 3TYGH 4JB9L 5FA3A 1M6OA 2DBJA 5IEHA 3VXOB 1D7FA 3EYOB 4EOWH 4I48B 5IFAL 1U8KA 4G6JH 2V5RA 3OKLA 3BRDA 3FB5A 1T7XA 4Y16A 5AYUH 1HKFA 1F8TH 2GJ6A 1KXTB 3WS6C 2FIRT 1CI5A 5D2LA 5DJXB 5D9SA 1Y6NR 3WFHA 4PY8I 4Q97A 2FX8H 3B5GA 2QQLL 4B50A 3ZKXB 1WUNT 5D1XC 4LCWE 5A2FA 3MA9H 3MLYH 4G8FB 4QHUA 2XWTA 2ICCA 4C83B 4NQXA 2H9GB 4LAJH 2R69H 4NBZB 4ZUVA 5DJ2A 2VDML 3RGHA 4L29B 1UACL 2Y23A 1OCWH 3GMOA 4IS6A 4V1DE 1OGAD 2EC9T 1S9XA 4GRMB 5FO9B 2VZVA 1MAKA 3MBEC 4XNYH 3HHRB 4TSCH 1AGBA 3S35H 2MQ3A 3FOMB 4LLYA 1U42A 1HN1A 3BGFB 4J3TA 3F5WA 1W0WA 2W9EL 4KK8C 1WT5C 4JREB 3T4YB 2XQBH 4HWEL 4YXLL 1Z9SA 1S7QA 4OGYH 5DFWH 3HG1E 1OQXA 1CE1H 3RTQC 3ZT7A 5F9WC 2MNUA 2OTWA 2X4PB 1UJ3A 4FZ8L 1GL4B 4TUOB 3WFEH 3GRWA 2N4IA 4IRZL 2P8LB 3NCEB 4WI8A 4HLZH 3QWRD 2P5EB 5IMLB 4YQXL 4WW1B 1GGYA 1JPSL 4MQSB 1U0QA 5FYLL 1A1NB 1D5XA 4D0BB 3ULVC 1XR9B 4NQUA 1N3NB 3B2UD 5D6CB 4HIHA 1H3WM 2ERJC 1NDGB 4LHUG 5KVDL 3T0WA 1B0GA 4PJEA 1BD2E 3C8HA 2IWGA 1I1AD 2V6HA 2X7LB 1ULVA 4YDKH 1H15A 5D6DA 3NIFF 4EVNB 1WLHA 4WY7H 1S7TB 2FR4B 3QXWA 3C5SB 1KCUH 1IL1B 2VABA 2BMKA 2PTTB 4O2EA 4S0SD 1F4AA 4U3CA 1IGIL 1UC6A 3EZ8A 5J89A 4G6KL 1BFTA 1LVEA 3ZL4H 3X12B 1QOKA 2J6EA 3MA9L 3MLYL 5FUZH 4TNVK 3WKNA 3MNZB 1AKJA 5GS0C 3C2AH 2Y1VA 1KCVL 2R2BA 2QKIA 4KVCH 4CBPA 5MI0B 2AJUH 2YOCA 1YNLL 1JZ5A 2GY7B 3IETB 4OLEA 1IT9H 1BFVH 1FZKA 4FG6C 4NOFA 4YIQB 3G5YB 4UV7H 2BZDA 4U0RB 3TO4A 1JZ3A 4X6DB 3WNNA 2MOVA 4YHPA 3GSQB 4X9HA 3IU4H 4HDIB 4XBPB 5DK0B 5EA0H 1ZLWK 1P7KA 3AXLB 1GVIA 3BN9C 1NGYB 5I66B 5IHBA 4LLMB 1CF8H 2OJEB 1CF8L 4NNXB 3UCRA 4DKAA 1FNEB 2EYRB 1I1AC 2QBWA 1I9EA 2O5ZH 4QRTB 6CGTA 4PJ7A 4TOYH 4GRLD 4XCFL 4OCRL 1N0XH 4U7KA 3BPLC 3VH8G 5JW3L 3QH3B 5BRZA 4E0RA 1AY1H 5IVNA 3PWPA 1I1YB 2F5BL 4Y5VA 4HUXA 4C56A 1CGYA 4G8EB 1MAMH 2BOCA 2H2PD 3AM8A 1ZHKB 4N0FB 5KANG 3PE9A 5CS7A 4QRUB 4AM0B 4P5TD 5F1KC 3FFCB 3BGFC 1ZOXA 1OCWL 4JKMA 4X6BB 1ZVSA 2EDFA 2EDDA 5IT2L 3KPRD 3QPQC 1AJ7H 3PV6A 3ILPB 3AMKA 5L6YL 3QUZB 1VACB 2FYYA 3B8YA 4HK0B 3WFCH 1QPXA 3WFCL 3HR5B 4WEUD 2P5WA 2AAVA 3KNBA 4JCLA 2EO9A 2Q3AA 3BSZL 3KPLB 1JGLL 3MREB 4IOSD 2Z93A 4LLDA 1KUMA 3FQUA 5IVZB 4WNQB 5ANMB 2Q8AH 3DV6A 1X4ZA 5LXGH 2YK1L 3HRPA 1RFDL 4PRDB 2IF7A 3O6FA 2FHBA 4LEOB 2JJSC 4PLOB 1RHFA 3BGMB 5D7SL 1ZSDA 2HRPL 4UUJB 1L6ZA 4H8WC 5ICZB 3IS1X 5DR5H 2YPLA 2VB5A 2YC1B 1DCLA 3BDXA 4XC1H 2ADFH 1MLCB 3IF1A 5J12B 5I17B 2OQJB 5F7DA 1D5ZA 3PWJA 3R4DA 4P3DB 1JGEB 3O2VL 3VH8B 5JLZA 5E2UH 5CD3B 1JF1B 4HFUH 3BKYL 4OGYL 5CJQL 1G6RA 1W0VB 5DC0A 2NX5A 1UXWA 1YQVL 1H5BA 1CR9L 2OSLA 5HHOB 4AMKH 2A77L 5F6IB 5D7KD 1RZ8B 4JLRA 4NRYA 5KJRL 5KVMC 2ARJA 4HT1L 3F7VA 3SE9L 1FFNA 3BPNC 4QKXB 2X40A 3WNKA 4HIIB 2BSSB 4JKWA 2CPCA 3BP4A 2VR9A 3B83A 5D7IF 2EEAA 2AXGB 2DRUA 4U0RC 3QI9D 1VGEL 5BW7C 2GJZB 4IHOA 32C2B 1FC2D 1M05B 3SY0B 3I02B 4FFWD 4MXQD 1VFBB 4BZ1H 1PG7X 4XXDB 5GGRA 4P49A 1AI1H 3DX8B 2CKNA 2VXUL 5IMMA 2Q76A 4E41E 1FG2B 4LSPH 2BRRL 2WUCL 2ADGB 5I6XC 5SV4A 1MFDL 3QFJE 4OQ1A 1IGTA 5KOVC 1IAKB 3KLDA 3VGEA 2RCSH 5SWSE 1V05A 4XAKD 4JG0L 3A6CL 4UNUA 3S34H 1W72L 2NY4B 3CZJA 3EDDA 4LHUB 2B39A 3FO1A 4I9WE 2VL4A 4MNGA 4LVOB 3RDTB 1G7QA 3WFEL 5KS9B 4NUJB 3IVKB 4EN3C 3DOSA 4D94A 3CZFB 4PJFB 3DX7B 4ODBD 4YHIB 3K81A 5F3BA 3DSFH 5JO5B 3MRRB 2VISA 3KYKL 1M4KA 1HHKA 2YD2A 5IBLD 1E4WL 4E41D 5JOEA 3ARQA 3V9FA 3FQXB 3V95A 4J3VA 4LNRA 5D8JH 4CU6A 5DQ9B 5DDHA 4R0LB 3MV7A 1F02I 5KBNC 5CINL 1U8HA 4MSWA 3TV3L 3L1OH 4JFFB 5EBMB 4F9PA 1BJ1J 5I1HH 1FPTL 1BHGA 4X5LA 5C0JB 3RIFF 2RIKA 5LWYL 4M7KH 1KLGB 3BJLA 1BD2D 4UDUB 2APBA 2E9IA 3C9NA 2PXYA 1SMOA 1CK0L 1WZKA 3G5ZA 3WIFA 3MNWA 3RZCC 5HVWA 4OGXL 4AL8L 4UQ3A 3M45A 4GG6F 5DHVB 3ULUC 4N68A 4XMKH 2MMXA 3GIZL 4ZO7A 4R2GD 3CFCL 4OV5B 5LBSL 4X5XA 1KIRA 4LVNB 5I1CL 1CVSC 4LDLB 2ITDA 5E8PB 3HS0A 3BRFA 3GMRB 1T7WA 2W0PA 3VXME 1WV7T 2PETA 2QQKL 4PJHF 4DVRH 1R24B 2ZNXA 3FB7A 1KJ2B 3MRBB 3C6SB 4IDLA 4NZRH 5EOCL 3SDCD 1VFOA 3JWOL 5D7LE 3V5HA 4WHYH 1CK0H 1NC2A 4X83A 1NBZB 12E8H 1T0MA 3F12A 1EO7A 1ZGLM 3IFPB 4F3FB 4NO3B 4GAGL 5B21A 1NEZB 4PRBA 3IFNL 4M5YL 4YK4B 3D18A 3JTTB 2FJGB 1D3CA 3A0OA 3DETC 3VGFA 4CW1A 1U3HD 4LSSL 1TZGL 3HC0A 5E56A 4I4WB 1G9ML 1EX0A 3FO2B 3VG9B 5C0CB 4YDLB 3JBG7 2GQHA 3NA9L 2DM3A 1YEJL 5KVEL 4PJFF 2YD1A 3HG1B 1N64L 5T1DH 1N5AA 1C7TA 2OL3H 4WFGD 1A0QH 4ODHH 4NQDA 4HJGB 5IB1B 3UTTE 4N8CH 2X42A 2XTJD 1A4JA 2PO6C 3LD8C 4MDJB 5DF0A 5IW3A 1SBSH 1WAAE 4RAVA 4X7SH 3P9MB 2UY6A 2VO5A 4D9LH 1JHKL 4PV8B 5T5NG 4YHZL 8FABA 5HHNB 3MLPA 3QEQE 3NACH 3WJLA 4I3RH 3S34L 1A4KA 4YBQD 3ME0A 4KKNA 5MEPA 3NCCB 2OCFD 4GSDL 5EORH 5FHBH 1OAZH 5F6IC 4A2LA 3IJHB 3HI6H 3JV0A 4N90D 3LDBB 4F7PA 1I7TB 3WL9A 4H26B 5FO8A 4OFIA 2EH7L 1H9VA 4J8RA 5DQJB 4G8IB 3UTQA 3RGVD 4HZLB 1TVBB 2F54A 2YPLE 3GRWH 1A1MB 1I8IB 2NY5L 1GCFA 1KYOJ 3OHXB 3DV4B 1S7WA 4RMTA 3MGOA 4JPIB 3QNZA 2Y7QA 5IIEB 5CZXD 4GW4B 2YPKB 4K55A 1H0DB 4ONGL 4HUKB 1O7SA 5IOPA 1A6ZA 4GKSB 2X9YA 3ARVA 3QEUB 4NJ9H 3HKFA 4XVJH 3PGFL 5DEFB 1CG9B 2KH2B 4OCYL 1GOGA 5CEYA 4HH9B 4ZFFB 1FYTD 4HT1H 3SE3C 2BVPA 1UXSB 1A7BA 5F1SA 4HPYL 4L4JA 4JGMA 1CGSL 3VXRB 1RIHH 3T0XA 3HCVA 2ZP0T 2HMIC 3VDBA 5EU4B 1P6AB 3V0WH 4WWKB 4U1HB 4GKZA 1KACB 4BH8A 4M03A 3NOIA 4MX7A 2A83A 1JGVH 3DSFL 4LOUD 2I07B 4G9FA 1AO7B 3KPOB 2E9BA 4G3YH 4QRRA 1LEKA 4LPYA 4OZIB 3FB8B 5AUMB 1UH3A 1DFBL 3KLSA 4XP1L 4JQVC 1Y18B 1MVFA 4KI5D 4Y4KB 1T2QL 4U1KB 5HYJD 2NXZC 3ZDYF 2JCCF 4WJ5B 6FABL 4EN3A 4FQHA 2NZ9D 3O2DL 3VD5A 3NBNA 3MRJB 4U4BA 5ISZA 5I18H 4JG0H 3FO9B 1DVFC 2GCYA 4QRPE 4U6XA 1OAYL 1KENH 3C5ZB 7FABH 5BW7A 3OKKB 4N5UA 1MFDH 1UWXK 5F8QC 4L8DB 3CVIL 3P4NA 5IR1B 5DLML 3O2WH 2V17H 3U9UB 4LDOB 3BIKA 4NRXA 2NY7H 1KC5L 3GKWL 5LG1A 3O6MH 5HGAB 2RHEA 2YPVH 2OTUA 2F5AH 2YRPA 3NIGE 3UTPE 2F8XC 1DANT 3ARED 2APTA 3FO0H 3HE6A 1E4WH 4XP9H 4PJXE 2PKDA 3PP4L 3RWGA 3K8LA 4MAYA 1R3JA 3KXFE 2UUDK 2FH8A 1KG0B 2O5XH 4TN9A 1UQSB 2DN7A 3BP7A 1AE6H 2NXYB 3AREA 2WWKO 1QLRA 2VDQL 4M6OL 4HS8H 3WFHB 1TPXC 1LK2B 4NKDB 2GT9B 1NCCL 1YA5A 2UWEE 1CS6A 3INUH 1DLFL 3LKQB 1KN4H 2MJWA 3QDGD 2EDBA 2XOTA 3S88L 2F58H 1A3QA 2HFFA 3O3UN 4OLVL 5D1XB 3QIBD 4I5BA 4IRSA 2NMSA 4OLZL 5IESH 1WZMA 1Q0YH 1QNZH 4Q6IA 3D0LB 4Y2OA 1QSZA 1Q94A 5F6HI 5LJYH 3QUYC 4FQCH 5L7XL 5H8DA 4P0DA 2C9AA 1G9NC 1F2QA 4HFWB 1PQZB 5IHUH 2HT2D 3O45A 1IT9L 3H6JA 5IW6A 3FOMA 4LLYB 4R8WH 1II4E 3D5OF 4GRWF 4KKAD 2W9DL 4KZEL 3K3QA 3MA7A 5BXFB 5GGQL 4HJ0C 4WUUE 2Y5TA 5GS0D 3T77B 3JV6A 5IF0A 1EA9C 5I9QB 4UQ2A 5DI8B 4YXKL 3ZDZE 1V3KA 3BIAX 3MJ7B 1T1XB 4KRPC 5BVPH 1JNLH 2A6DA 5DEZA 5K9OA 4MNQA 4FTVD 4OFDA 3BYTA 3B9VA 2E6QA 1NAML 1JV5B 2NZ9C 2VOTA 3KPRA 1NGZB 4TUJB 5HY9A 1TITA 5BO1L 2AKRA 4XVSL 5D7LD 3PUCA 4Z8FL 4P2RA 4PJIF 3MMEB 1ZANL 4NQSB 3ESUF 4IBLT 3O2WL 3DYOA 5BRZD 1VB9A 3VRLE 43CAA 4WV1C 5GXBB 3IDJB 3FZUC 4RGNC 1QP1A 4R97C 3TN0A 4JZJC 4BUHA 4J1UA 1YMHB 4S10A 1G6RL 4XZUB 3IS0X 1G7PB 4PS4H 1LP9E 2YD9A 1OP5H 5K9QI 1CU4H 1S5HA 5FO7A 2PTTA 5F71A 3WFBH 5A1AA 1KYOK 3IDXL 1I3UA 4JVUA 4HJ0D 5FKAB 2YK1H 4XRCA 2IALB 4JFOB 2MQ0A 1Z5LA 4D0CA 1JPGA 3SN6N 5EORL 2XTJC 4ODXA 3D0VB 1Z0MA 1JTTA 35C8L 4P5TA 3JUYA 15C8L 5DK3A 2GSIA 3C5JB 3N1MC 1F4WH 2J5LC 3RL1B 2EXYD 3GMQA 4MXVE 3EYUH 5CGTA 1SY6H 5BVJB 4KXZH 4XBEL 4P59L 3ARTA 4R90L 3SGKC 4G42B 2P46B 3CX2A 5DJ2B 4JFXB 2DWDB 2PYEA 4RZCA 4ZFZA 4G7YL 5E5UB 1OL0A 4FQPA 2Z92A 1A3LH 1QKZH 1BZ7A 3RVVC 1U3HA 3BJ91 4LCWD 2WP3O 3GJEB 4YHMH 4YE4H 1KCUL 4LCWA 3IDNA 5GJSH 2J8UB 2IQ9H 4EBQH 3SO5A 4PGCA 1A2YA 3WIIL 1DBBL 1NGQL 2VXTL 4LFHG 1JE6A 2Q7YB 5I75B 4PGZA 4TUKL 1ZV5A 3BD3A 5F1IB 5ISZE 1P4LA 4R7NA 2BNQE 4P4KB 1M71A 4WUKL 3RTQA 1LO3H 2OTWB 3SDDB 5B4MC 4JDVA 3V6OA 4ZTPL 2FYYB 3O3AB 1T83C 4PFEA 3KJ6H 2QR0B 2WBJA 4X9IA 5GGUA 2DMBA 5EU6E 4I2XE 4S1DD 2WBJD 5JOFA 4JDZB 1LK3L 5H2BA 1F3DH 3MJ9H 5ITFB 3OAZK 1D5XB 5JA9A 1NGXB 3PP4H 3D3VD 3HR6A 5IQ7H 1HHHA 1IKNC 4TNWK 3MCKB 5FCUL 3K4AA 3P73B 4YR6B 3DLQR 1HH6B 1QYGL 1U8IA 2ZCKL 5C9JB 3VE0B 1NMBH 1IC7L 1MCPL 1KB5B 1L9NA 2BY2A 1HH9A 5I8EB 3TT3L 1IL1A 2VABB 1MFAL 1AIFA 3RWCB 2UWEB 2D9CA 3KJ4B 1KIPB 1DLHB 3EHBC 4PJEE 5D5MA 3BXNA 5LQBH 1CXKA 4F2MA 1KEGH 1U58B 5CD3A 3GK8H 2H8PA 5CZVH 1MCOH 3GJFB 1CE6A 1HSAA 2P8PA 1PYWB 4NO2B 4CU8A 4EN3D 4UBDD 3VFGL 4N5EC 1ZS8A 3IXTB 2MCPH 4S1DC 3TJHC 3E1F1 5B3JE 3HZKA 4KTEL 3D69A 3RZCA 4YIQA 2E27L 1KCRH 4JM2A 1WBYB 4NKIH 2XT1B 4C57C 4JKLA 4XBPA 5FGBC 3KPSE 4C4KO 3PF2A 2OJEA 3VXPB 5A16A 4U3XA 2X41A 3WDHA 3OKDB 1DVFB 4LSUH 1UM5L 4PJ7B 2UVEA 4X5WA 1KEGL 1OGTB 4Y4HA 1WIPA 5C07E 1M05A 3VFWB 3OZ9L 4NHUA 1W72A 3DXAB 3RBGA 3TNNB 5DO2D 2DIBA 3RWEB 4OCWH 4MD4A 1X5KA 1MFEL 4HV8B 2ADGA 5E5RB 1HK6A 4HMEA 5HHOD 1G1CA 5HI3C 1SY6A 1C12B 4EDWL 4YDIL 2QSTA 4X98A 3WDIA 5HYSB 1KPUB 3QUZA 3TO2B 1MCCA 4FA8A 4BSJA 2B1HL 2X1QA 4UMGA 3MQIA 4C56E 5IVXF 3F6IA 1A8JH 5ILTL 2VJXA 4NQED 4HS6A 5DJ0A 4D2NA 5SWQB 4LAQH 4Q7DA 3SE9H 1U92A 1ND0B 1OAUL 3BN9D 1UZ6E 2QADB 4FTVA 3SDAD 1BZ9A 1ERNA 1TJGL 1JK8B 1BJ1H 4YHIA 1FFOA 4KC3B 4LEOA 4AEFA 5FM5M 3PXJA 3WN5B 5INDB 1TJHL 4JB9H 3FQXA 4LP5A 3I2CL 3HLAB 3TBVA 1S7VB 1PG7W 4PRHD 5FDWB 5KANI 4R0LA 3V7MA 3HI1B 3E6FB 2J8UF 1FGVL 3V52L 5IMOB 2R0WH 5BMFH 1J8KA 1BVKB 4AEEA 1YEJH 3QIWD 4PS4L 4MVBD 4FFVC 1MJ7H 2AK1H 1EEZB 3C9NB 3BFOA 4OLYL 1G7LB 4U3HA 3G5ZB 1HCFX 4LLVB 2CDFB 5DEGB 1BJMA 5JW4Q 1SVCP 1H5BB 2I26N 3EGSB 1BGXL 4QOKE 5KSAD 3P4LA 5AAMA 4IIQA 2BSRA 4P59H 1EXUA 3U83A 4QNPE 2NY1C 3S5LB 4HULB 2QSCL 3MLWL 2XTJB 4JY5L 3HS0B 4LPWA 4HH8A 1MJUH 3IXAB 1BZQK 2HVKA 4WU5B 1QFHA 4D9QE 4NN7C 4OGAD 3FB7B 3HE7B 5TGBB 4P5MA 2ESVA 4N0UE 3SY0A 3UYRH 5BVPL 4U1GC 1URLA 3NCYS 4NCC2 4KHXH 2VN7A 3FQNA 1HHIB 3RWFB 1T03H 4PB9H 2EE6A 1MPAL 1WFOA 5EWIH 3RTQD 1E6JH 1WBXA 1YJDC 5DMIH 1AD9A 3B8SA 4WV1A 5GGSB 3QULB 5KSBA 3WUWG 2NXYC 3PL6A 4MXVF 4PRNA 4FFVD 4U2YA 5TDPA 2F54D 1FNSH 3K2UL 4HBCH 1H3PL 1P7QB 5C0CA 2YBRB 3TA3A 1QSVA 1U8LB 5I73B 2FECI 4LLWA 1KIUA 3THMH 3TT3H 3NCJL 3VJ6A 3SKNA 4HIXH 4Z8FH 1IAOA 5JW4R 5FKPA 1JVKA 4XVUC 2HT4D 5CZKA 4PGEA 5B4MD 3KPSB 8CGTA 5KSVA 1HHGB 3LS4H 1L7IL 5TF1L 5IKCB 2GTWB 4ORGB 2FZ3A 5GS1A 2XKUA 4UAOC 1JUFA 4MA1B 4L8SB 3BW9A 1IGML 5CEXB 1UWEH 3QPXH 2DQUL 5EZOH 3DUSA 3IJSA 3L3IB 5T3XE 5TDOA 3EYSH 1QR4A 2APVA 4OJFH 4FQQB 5KS9F 4QOKB 3UBXA 2FGWH 3REWA 2BXZA 4BYHA 3RUGA 1QBBA 3UTQB 3P77A 3WE6A 1MY7A 3S37X 4WUKH 3QHFL 4UB0L 4JRXD 1N5YL 2AJVL 3QFDA 2F53E 1B2WL 2X1XR 2VAAB 1NCDL 5E2JA 2OMNA 1QLFA 1FL5B 1ODAA 4GRLA 5KN5B 5I30H 1DQLL 4FZEL 5E2VH 3U36A 5EOTA 1CG9A 4GKNB 1JGUL 4N9OB 1AFVL 5I74B 5CILH 3F7QA 3DVGB 4NZJA 1HYSC 4GRLC 1L0QA 3I85A 4APQB 4WHTA 1IARB 3RKPA 3SJVB 2LABA 3ALPA 3P2TA 2LVEA 4QHNA 4ZOAA 4MX7B 1YDPB 4H1LA 2YA1A 2VZ1A 3FTGB 1R5IA 3MZTA 4BKLB 1RUKL 4XH2B 1YEHL 4NGHL 2NTFB 5D7IA 3VFRA 3S96B 1G9EA 3UZQA 2IH1B 1QSFA 4DKFH 1LDSA 1IGIH 4U6TA 1BAFL 3BO8B 1CD1B 4S11A 2JF1A 3AMLA 4ZPVA 4PRBB 3LPFA 5IB3A 3DURB 2FJGA 2PCPA 4A6YB 3X3FL 4KROC 4HIXL 4JFQA 3QQ4A 4DQOL 1LDPL 2A38A 1G7IB 3A67H 3ET9F 1MCRA 4JAMA 5IEHB 2BJML 3PWPD 3TN0C 1MHCB 5ISZB 2GCYB 4U6XB 3VXRD 3FB5B 4M3KB 4PRPD 5I1LA 1TMCB 1WC7B 3KPMA 1X5LA 3QDGE 5J6GB 3NIGF 4XMLH 3SKJL 4OT1L 3R0MA 2B4CH 4Y5XA 1YYML 3KR3L 5I18L 4EIZC 4XVUD 4ZSOE 2HT3D 1N26A 1HDMB 1MCLA 2IAMB 3AM8C 3DMMB 4K8RH 5EFIB 4F7EB 1GZPB 2C7UB 4P23D 1UM6L 4F7CB 1KXQE 1EGJH 3GKZA 4YO0A 4K7FB 3ROLA 2XWTB 5DFVD 4WI3A 4X6CE 1BM3L 4MMXC 3U7YH 4ZXBD 2FO4B 3GSXB 3LOWA 4OZFA 1NCUA 5DRZB 4Y19D 1KCSL 3S7GA 3OPZL 3VGDA 4AIZA 2IFFL 4XNMA 4GRMA 3EJZD 2WUBL 2EIZA 3CFEB 3MBEA 1HI6B 3ILQD 3U48A 3UMTA 3KPNB 5JHLL 4RFNC 2V7HB 2ZPKL 2HVJA 1J0JA 5C3LD 3QYCA 1K3IA 2XG5A 5DTFA 3FT4B 3MV01 2IANA 1F13A 4RDQF 1CFQA 3UTSD 5M7QA 1MFNA 4LARL 2R2HB 2VDNL 3QNXB 1ADQL 2E7BA 1FCGA 4O4YH 4IOIA 1A6ZB 4K3EL 4NOBA 4QCIB 3GSRB 2VRAA 4FABL 1FL6B 1PSKH 2J5LB 1Q94B 1OSPH 3L5HA 4CMMA 1OTUC 3A6BL 4KKCD 4XCFH 5FYJD 5C9KA 1C1EH 2EDTA 3CU1A 4PGDA 1E4XI 2VH5H 3CC5B 4Y19E 3ZYZA 1EGJA 1DANU 1NAMA 5J1AA 2H32B 4LHQB 1YEHH 4MLSA 3W9DB 1B2WH 3S4SG 1S9VB 1FNSL 4PRHB 1J1OL 2E9WA 3MJ8B 1N6UA 2R56L 3B2UC 2EXYC 1LEIA 5DJDB 1KFAH 4CDHA 3ZO0A 2J6EL 1NLDH 4MNQB 1I8LA 5J0BA 1JGUH 3MC0A 1Y18A 4Z77A 1KCVH 3HZVA 1JZ6A 3TYFA 3SDDD 4U1KA 2OZ4H 5IJVB 1NFDA 4DK3A 3TBSB 2JB5L 4V2CB 4F80A 3OKLB 2RFXA 1X6NA 3OKKA 1MREL 3N85L 1VESA 4Z7QF 5DVKA 1FJ1A 3MXWH 2EDQA 1A7QH 2FDBP 2EE3A 1V7NL 3X12A 1SYVB 4L8DA 5F7WC 4Y2DD 4O2FA 1FLRL 1ZLSH 1MQKH 5I71B 4JREC 1DN2A 3TZVC 1J18A 4PJCE 1RI8A 5SX5H 1I8KB 2BFVH 2P5WE 4QTIL 1ES0A 3HE6B 1DTUA 4JRYA 2Z31A 1RZJL 3MV8D 3TO4B 4WU7A 4PJ7F 2DLIA 1YY8B 3DBXA 1Z5LB 4D0CB 3LS4L 1UKSA 1SJEA 6FABH 1FZMA 1A6WH 4QXWA 5EWIL 2J1KA 1BD2A 5A2LH 1NQBA 1MRDL 1TETL 1UKQA 2G2RA 1JYNA 1HXYA 3CLEH 5C6TH 3W0WA 3FOLB 3SDDC 3HUJA 1ZGLB 1ZT4B 3M17A 2DJUA 2LU7A 3G04B 4X6EB 3I75B 3QH3A 4HIJB 1OT1A 3GMMA 2CUHA 4DZBB 2BDNH 4Y5VB 2AGJH 1A14H 1H3PH 4OZHE 3T0EA 4PJHE 4JQIL 3GB7A 5HJ3B 5BQ7B 3CVHB 4Q9BA 1QA9B 1O0VA 1TNMA 1IVLA 4JN2B 4WFED 5EZLA 4KJYB 3B9KD 4YBHA 4GS7C 4X6BA 4HG4K 4KDTA 5DQDL 4QF1B 4DUVA 4KH2A 4F9PC 2P5ED 5I8KL 4NQVB 1B0WA 3L3GB 3AS2A 4HFWA 2F74B 3PWUB 4JRXB 4KK9C 2WAHA 3CX5K 3CVHL 1WZ1L 3SGJA 3UAJD 1FFPB 1FC1A 4D0BA 3BE1L 1IEHA 5CINH 1RUQH 5A43C 2I60L 3QRGH 4LLDB 1QO3B 1G0DA 4XWGL 3UJIH 3F8UB 3C6LD 1JWSB 3TCXA 1JGDB 2HKFL 1XIWD 3JWOC 4YDVB 1KEMH 4CVXB 1MVUA 5DMKB 5J13B 3N85H 3CSBA 1VADA 4G9DA 1N8ZA 3LZFH 5CJOL 5HPOA 4I0PC 1NGPH 4OZHF 4OKDA 5LGKA 1CDYA 5ICZA 5E4EB 1OAZL 4L3CB 2DBLH 4APQC 4O2CB 3HNSH 2WANA 3CFKB 3MRHB 4HBQA 4NQSA 4QLRA 3ZMRA 4NYLB 2CXGA 3VI3F 2PO6B 2R4RH 4NM4H 2XKSA 1NGXA 3CFBB 2HJKA 4CRPA 4JM2D 3O11A 5EC2A 4P2QA 4X99A 3GNML 3B9KC 4NNYA 2RR3A 3WIHH 4ISVB 3QUKB 4M62L 1SBSL 5KG9A 1P2CB 4JHZA 2DTML 5J06A 1JZ7A 1V3LA 2R2BB 3TBYA 4Z7NF 2ADIB 1K4CB 4F15B 5E2UL 3TNMB 5ADOH 3BVNB 3JV4B 4Z0BH 2LV4A 1I7UA 1KJVB 3Q3GB 1BIIA 4NC1C 3ZSSA 3SJVD 1CICC 2YA0A 4NUGL 1FNAA 2YEZB 3CMGA 5JZ7D 1EUUA 4U1SB 3RL2A 1DE4B 2IALA 4B53A 3NZ8A 4JN1H 5A3IC 4O5LL 3IAQA 4Y4HC 3ZTNL 1PKOA 4WFFE 2FB4H 2R4RL 3DYMA 4NM4L 2EYSA 1KJ2L 2QTEA 3FB6B 4URTB 2IFGA 4P23C 1RFDH 4U1JB 2UY7A 5BRZB 2DICA 5BVJA 2J8UE 2FEDD 3MOAL 5CGMA 3MOAH 2BSTA 3F65A 1RUAH 4NQEB 4JFXA 1OP3H 3UDWA 4YNYA 4I48A 2VLJE 3QUML 1IAKA 3V4PH 4LSRL 2UUDH 1G7MA 1GGBH 4ZPTB 5LAXA 1Y6KR 1YMME 5DD0H 5SWZE 1IGYA 2KKQA 4X8JB 1EGJL 2NNAA 4JE4B 2ESVD 2J8OA 3NVQA 2HKHL 3PHSA 3T0DA 4ONFH 1DBJH 1T1YB 1D5MB 2IGFH 1KB5L 5SWSB 3BEWB 5T1KA 3SGEH 4NZDA 4PJFA 5D7JC 4DFHA 4LSVL 3RTQB 2EDRA 3RPIB 1XF2B 2L4OA 3SDDA 3TH3T 4E42A 1BQHB 2G5BB 4X98B 5HYSA 3DROB 4RBPH 1QSFE 4KMTL 4L29A 4NZUH 3O3AA 3LQAH 1INDH 5IB5A 2QR0A 2WBJB 3UYPA 3BZFA 1EZVX 5D7LB 3X3FH 3NFPB 2BNQD 4D9RE 3NZHL 2AJ3A 4HS6B 5DJ0B 3K0WA 2XN9B 5SWQA 5EBMA 3H8NA 1MI5D 4DGYH 5K59F 3RVWD 1YNLH 3MXWL 1JGEA 1KLGA 2HH0L 5C0ND 1HHHB 1I8MA 3GSNL 2AJXH 3WNMA 5KVFL 4AENB 5HYJA 5I73C 3V6OC 5DJZB 1K8IA 4I8DA 4GO6B 4LMQE 3P11L 3OF6D 2NPLX 1E27A 2NZIA 4RMSA 3BUYB 2NY6B 2MCG1 3HLAA 3TBVB 4QTIH 2X4PA 3MRDA 3UBXI 5DHVA 2NY2D 5GS0L 2A9NL 3E6FA 1I9RL 5EZJB 4GBXD 3N50A 5TE4H 3W0WE 2ZUYA 5IHUL 2X9XA 4OIAA 2R56H 3RNKA 4UT7H 1UCBL 4AJ0A 2C3GA 3AC0A 4NQCD 4H20H 3KAAA 2XWBA 1ZMYA 1FAIH 1N3NA 3H9SE 1RK1B 3IDMA 3GI8H 5GZOD 3WIIH 1L0XA 5D71L 4ENEC 5GGRB 1KIQB 4OLVH 4JRYE 4JM2F 1CQYA 1D6EA 1V3MA 2AGJL 3ZKMD 4GRWE 4N8PA 4NO3A 3MROB 4HLJA 2X4OA 2XIDA 1I1FB 4AZ8A 3M8OL 2W92A 2FATL 4R26L 1DSFH 3CU7A 3AVEA 3HC0B 5C1MB 1ZANH 3ULVF 4NKMA 3QEGH 1EBPA 4P5TC 2ZCHH 1YJDL 3PDOB 1RJZB 5TGBA 1T66C 2FIKB 5L88H 3UTSE 1ZWIB 5GRXG 3BKJH 4HJGA 3TWCL 3EO9L 5ESAB 5C70A 2O61B 1TVHA 4NRZB 5T3XL 3BKYH 3V8OA 3TVMC 4L9LA 2MKLC 2G75B 2Z8VC 2YUZA 4FABH 3QUXD 1A1OA 4GS7B 2C4FU 3B9KB 4P3WA 3K4DA 3G5YA 4M1DL 1DN0A 4ELKA 1FAKT 5TE7L 8FABB 5I1IL 2IH3A 4FNLH 5ACLA 2DAVA 1A21A 4K71B 3UXFA 5EB9A 2B20A 4KUCF 4U7SA 1RHHB 4CL7A 2V5YA 5FM5O 1OGAB 2D7PA 1ND0A 5I15H 4Q9RH 4OF6A 2HN7B 5C0FB 5AWNH 5E2TL 5HYIA 4FQCL 2DQIL 1KCSH 1DFBH 2GYSA 5ENWA 3NTCL 4PRPA 4F37K 3P0YH 1DP0A 3GIVA 2DQCL 4GW4A 4UV7L 3S35X 1VA9A 4MVBC 1KFAL 1H0DA 3CCHA 4K9EL 1K6QH 2XRAL 2X4UA 4U1IA 3FAXA 1EHNA 3K1DA 3X3GL 3E3QE 4X4XA 2DOCA 3VFVB 2YXFA 3QQ9D 4S1RH 3UBXB 3OR6B 1KCLA 2BVPB 5I8CB 5DMYA 2FLBT 2DTSA 1XIWB 2VL5A 4ONHA 4WUUB 4OCYH 4Y4KC 3CSYB 3RHWK 1G6VK 4N90E 3EDJA 4KKLD 1MY5A 1CLZH 2DD8H 3IDYC 5TE7H 5HDLA 4NQEE 5ELIA 5ANMA 5D93B 4P2QE 5IGXL 5D7JB 4LOUC 2XWJB 2R29L 4A2MA 4Z7VF 1I9IL 2R8SH 3GI9L 5C0GA 3IFPA 4F3FA 4JY6B 1RUMH 4JFDE 5TJWK 2NY7L 2D9QB 3U36B 3D3VB 2QHRL 1K6QL 3N1PC 4KU1A 1GHFH 5L2KA 4MHHI 3W2DH 1T6VN 3SDXB 4WU5A 1OT2A 4CN6A 4G8GD 1T4KB 3NTCH 3IU4L 1X5IA 4PY8J 4EQ2A 1KF9B 1UFUA 5C6PB 5TF0A 3QQ3A 1D9KB 1Q38A 1CFTA 1J86A 5E8EB 3HZYB 5KZCD 3HB3C 1HSBA 4V1DB 5DD6A 3ZYOA 1BVZA 4ODTL 4Z7OF 3HAEG 5KSBF 3BWAA 1A4JB 1YUHB 4MDJA 5ACMA 3RJQB 4QWWC 5DD0L 3ORJA 4YK4C 4Y16D 5DHXB 4RAVB 3UX9B 1UM6H 5HGAA 3H9YA 4Y5YA 4I77L 2DWEA 4WTXA 5JUEH 4HKXB 4LVEA 4Q9RL 2ARJB 4XP4H 3VFPA 1J87A 1MHCA 2BSSA 3V4VL 2FWOA 4M43L 5HGDA 4MAYB 2W65A 5EZIL 5JIPA 5I1LB 5FF6A 3HE6D 3P4OA 1WZLA 2E9JA 2W0FB 5D1XD 3TWCH 1UZ8A 3MV8B 1QLRB 3VD3A 5DQJA 2BJMH 1VFBA 4MAYC 1C5DA 1FORH 5HTSA 3SCMB 3WLWC 3ZKNC 2K9UA 4ZD3L 3KPSA 4XP5L 5CBAA 2YS4A 1E4XL 2I24N 4FP8L 4N0YH 1H3XA 3RBSA 1CGXA 1BWWA 1KENL 3TBWA 2OS7A 3MOBL 5JXAH 1NAKL 4OLUH 1UJ3C 3ARBD 4BFGA 3GSNH 5AZEH 4X9BA 4DKDC 3HB3D 3T3PF 3MV11 3O0RL 4P9MH 2CO7B 2ZCHL 1S7XB 1B4JH 4NN6C 5CEYB 5LGHH 5E2WL 3LQAC 5I75C 2ARWA 3RUGE 3TA3D 4JO2L 5MP6H 1AQDA 3FO1B 4NPYA 1R3IL 3WE6B 3MUGA 1HQ4A 1KGCD 1IM3B 3GSWA 3QISA 1HEZB 4D8PA 5EU7C 1BVLB 1XGRB 1RMFL 4WWKA 3SOBH 4MAUL 1AGDA 2BERA 2JK5A 5MERA 3O41B 4UT7L 2UZYB 4U49A 1LO4H 2C1PA 3GFUA 3H7BB 5KN5A 5D2NA 3GSRA 3TGXA 3SGJC 1FAIL 2FSEA 3DX6A 2DQGL 1YEDB 2UZIL 5DDHB 5CJ8A 1OAKH 4XVJL 4N1EA 1NCWH 4PJ9A 3KG5A 4JFFA 1KELH 3VA2C 3AY4A 4KHXL 4POUB 3T3PE 2OK0H 3CH1A 3N1QC 2R0ZH 3IAGC 5EO1A 1IQWL 3P0VL 4P2RB 1MCPH 3BP6A 5C3TA 1YNTB 4TSAL 2BVEA 3ARBC 2BNRD 3KXFA 1TZGH 4J7RA 3E6HB 2VLJB 5B38G 1K4DB 3V0WL 3ULVE 3C08L 2IPUK 1KGCE 3K8KA 4FRWA 1MFEH 3WJLC 3MLWH 2QSCH 1OARL 3PWVA 2DL2A 2XV6B 5EBWB 3UJJL 1F6AA 5B38A 2F53D 2IMNA 4OD3H 1J88A 2VUYA 3AS3A 1RZIB 3LH2H 4OUUB 4ZUUB 1PLGH 2VXQH 1CLOH 4HF5L 4NQCB 3QQ4B 3QWOB 3QIUB 3MRKA 4NSKA 3MV7D 4I0CC 1ETZB 2VDOL 4NBYB 1BECA 4KRLB 3E3QC 5IBUG 5K9QG 4RA3A 1JHKH 1WTGT 1ITBB 1IAIL 1U9KA 5K9KA 1R24A 4NKIL 3P3YA 5FM8A 4H0HB 1IKFL 1KCRL 1M7IA 2P24B 4G7VL 1ZHBB 1IQDA 3TPUA 3UTSA 3C5JA 4MNQE 1KTKE 1FZOB 3D3VE 2APXA 1JN6B 3I6KA 1XGYL 4F7EA 3F12B 2FBJH 4JO1L 5EU3A 4HWZA 5SWZD 1B6UA 4ZYKA 4WU7B 4NWUH 3V4UL 5DRZA 3DI2B 4I4WA 2AVGA 5DVMA 2Q7NA 2YWZA 4PIRF 5D2NE 4O58H 5FYJL 4KI1A 4QXTA 3MFGB 4AG4H 1HNGA 3EO0A 3W0WB 4PRPE 1CBVL 4ODSL 4C58B 5SX4I 1GGTA 2B1HH 3KYNB 4AMKL 5HI4C 3PNWB 3WDJA 1XGUA 4PD4K 3P9MA 4CVWA 3VXQB 3STBA 3NIDF 5IHZA 1SJXA 3EHBD 5K93A 1U8QB 4ENED 1Q9WA 4X4ZA 5E8OB 1TZIB 2RGSA 3QJHB 4TUJA 4Y8AA 4O5LH 4ZUSB 4F7TA 3L3JB 5I16A 1BOGA 2YUWA 3PWNB 3NH7L 2GTZA 5H2BB 4PRHA 1TVBA 1CZ8L 1YPZB 2FX9L 4RISH 4P46B 1AO7E 1A1MA 3MV9B 2AJSL 1QO3A 4XI5C 3OWEA 3VG0H 3P0GB 4JFPB 3SGKA 3VXMB 4YR6A 1JGDA 2CK0L 4ZAKB 5IBTH 4FN0A 2OL3B 5FGRA 3VE0A 5JMOC 1S7UB 3NACL 4XZUA 2X1OA 1FNFA 1KB5A 4UIMA 5DEFA 2R4SH 3OGCA 5E2WH 3SKUD 1HH9B 5I8EA 3G5XA 4DK6A 4OM1H 4IDJL 5I1JH 3PGDA 4O2CA 1A6WL 2R15A 3STLB 4JO3L 4JFOA 3FQTA 4IRJD 4TULL 1IEBB 1JNNL 5SX4H 2C3HA 3DTXA 3CDFA 1NGPL 3E8UH 4HUVA 3OJDB 1MCSA 4GFTB 4HXAL 4OM0H 1OARH 4GKZB 4NN6B 4O2FB 4BH8B 1KPVB 1YZZA 3OAUH 4LCCB 3BISA 4LHJB 3AAZA 5EBLB 3MLUH 4NWUL 1QFUL 4M1CD 1CE6B 4N8VA 3V4UH 4YJZL 3RL1A 1AO7D 5D2NC 4OZIA 2XZQH 3BVNA 2GJ6D 4ZSOB 3VXRE 3UP1A 2FH6A 4KY1L 2ATPB 3R0NA 3JVGC 2Z31C 4MB3A 3D69B 2DI9A 2WINB 4ZXBB 1NCWL 1U8OA 1RZGA 1PX4A 2DWDA 2PYEB 4RZCB 3OKOA 4XC3L 2F15A 1WWCA 2DQTH 1MEXL 3G08B 3IDXH 1AD0B 5DJ8A 2VDLL 4ACPA 2X4TB 3EKCA 5IESL 5MENE 3BEVA 4JO2H 2H26B 2FJHA 4KV5E 2D7NA 2IQ9L 3RI5K 5DD1H 3VFWA 1YEFL 2RB8A 4PJ8C 1ZT4A 3G04A 5D1QD 3RVUD 5IR1A 2V7NB 1ORSB 3E2HB 1F42A 3LH2L 4PTTA 3BD4A 3LN4A 3HTLX 2AQ3A 4F8QA 5I1CH 1Z9MA 5GISH 3CVHA 1H5BC 1NKOA 4KJYA 3PHOB 3RJDA 5EC1A 1KSRA 4MCZA 2LFGA 4PJHA 3BQUA 3WNLA 2W38A 4GBXC 1WITA 2YD7A 3DGGA 3VXMD 4CN4A 4Z76A 3NAAH 5HHXL 3U4EB 2XXCB 4X8JA 3V6FA 4P2QD 4K2UL 2PTUA 4XCYB 4RNRA 3WXWL 5ITFA 3C60A 3QUYA 5B22A 1U8NB 5C92A 1FE8H 3SDAC 5FXCH 1UB6B 3PJSB 1S78D 1XZ0B 1BFSA 5KSAB 5GGVY 3MCKA 1JK8A 2VZSA 3CX5J 4YX2H 2RAMA 2E7CA 3IDIB 4XPHL 4LKCA 1CGTA 3S9DB 2VKXA 1J05A 4W6XB 1EHLH 1BMGA 3IFLL 4M8VA 1NCNA 2QSQA 2UYLB 2WQRA 4JQIH 4P57B 1YN6A 2A77H 3F7RA 5C2BH 5F9OH 3BZFB 1RMFH 3HI1A 3CFKA 4NFDA 3ZTJG 4NYLA 1PQZA 2XZAH 5D1ZB 3OR7B 5IW6B 2K1MA 4P3CH 3O11B 4RSVA 5EA0L 3MA7B 5BXFA 5HYJB 4ZS6C 1EEZA 1ZVYA 3GJFA 2CKBA 5FA4A 5DURD 3ZDYE 3O6KH 3U79A 5FCSH 4UQ2B 3JV4A 3QNYB 4PJXF 2A6DB 2I9LA 2VWEC 1BIIB 4NC1E 1L7TL 2YRLA 3VFTA 4E41A 1YYMH 2R2CA 2VLLA 3KR3H 3LKRB 4JG1L 1QFWL 1YEKL 1NGZA 4JDTL 5AZ2L 3UTTA 4LPCA 2DDQH 5BZDA 4AK1A 1MJJA 2BP3A 3GI9H 3MMEA 3UZVB 3V0VB 3ULVH 1DVFA 1BQUA 4FFZL 1JPTL 3QCUH 4X5WB 2XWBB 4M43H 1P7HL 4X7CC 5C8JB 2VE6A 4U1JA 3UTOA 2YPVL 3EJJX 2CRMA 3MJGX 3U2SB 3EO9H 3S4SA 5EU5B 4X7FC 3WFDL 5JDSA 2EIDA 4YHLH 4KKBD 1AD9B 1GGCL 4LP4A 3PL6B 3DHMA 3EW3B 2ZPKH 2X4OB 4L4VE 1WAAA 3S98A 4XC3H 2ZKHL 4TTDD 1LHZA 2MWCA 2VIRA 1T7VA 4YAQA 3GJFH 4MS8D 5LAXB 3IFOB 1UZ6F 4MD5A 3MV8E 2V5SA 1IGYB 1I9RH 2F5BH 2VDPH 4P5TB 4JKKA 4P9HL 5HYQB 1EEYA 2PTVA 2O5YL 3VJ6B 2VC2L 1N0XL 1BJ8A 4TVSa 3CLFH 2V2XA 2CXKA 3QUMA 4U31A 5BS0E 3QIBC 5FUZL 3E8UL 3Q5YA 4PGEB 1YMMD 3C8KB 5IG7B 4DCQB 5T33H 5T1DL 3U0WL 3QCVL 3VU2A 4M7LT 1MAJA 5JNYB 1WSST 4BFIB 4LCYA 2Q8BL 2Z92B 3L95B 3CMOL 3T0VA 1BFVL 5IQ9B 2R4SL 4PP2A 5HHXH 2AW2A 3S35L 3QSKB 3ARUA 4G9FE 4BSWB 4EUPG 5BS0B 4EXKA 4OF7A 4OZHA 3T0EE 4O00A 5KVDH 4PJFE 3PQYB 5CEZL 5C07D 2ICWJ 4W4OA 2VLME 4Y1AB 2BHUA 5E95B 5ENWB 4AEHH 4K94H 3JWOH 1JNNH 1FYTA 5L88L 1AC6A 2IGFL 2GK2A 4GMSL 5I0DA 4JPKH 4MXWL 3PABB 5HGBB 5GS1C 4KRMB 5F88B 1J10A 3HFML 1T5WA 2D31A 4QRSA 2DQJL 1PD6A 4GMTH 5I1KL 4M5ZL 5LBSH 1BPVA 4YUEL 4Q9QH 5JOFB 4QEGA 1EJOH 3O9WC 4GG6A 1LO2L 3JUZA 1SMAA 1DBML 1PAMA 2DQHH 3ARFD 1MCQA 3H9SA 3QA3A 4FFWC 4ZO9A 1Q0XH 3QXTA 4EQ3A 1G7JB 3OKMA 2JJWA 1U93B 3ZLQC 1E28A 1DEEB 4M6ML 3LKSB 1A6UL 2NTFA 3VFRB 1HHIA 5MHSE 4Z78A 4OI8A 3QHZH 1GPOL 3NFSH 1MIEH 3WN5C 1EO8L 2NLJA 4CUCA 4M6NH 3QIBB 5KSBB 1A7OL 4EXPX 1JFQL 4U0QB 1P1ZB 3DPBA 1KTLA 4XVTL 4OM0L 5BV7B 3VXSA 1PDKA 5MI0C 3LB6D 4WVRA 1MJ8H 5IW1A 1JGVL 1I85A 2B2XL 2EDYA 2VDRL 5J4MA 4LSSH 2F53A 2HG5B 3QIWC 4PRAB 4WTWA 3FCTA 2E8ZA 5E94B 4G6AD 4PJDE 1QUNA 4LASL 3SKNB 2P8PB 2GAZA 1F58H 3QBTB 1IAOB 5SWSD 1QFWI 4YPGB 43C9A 2ZUWA 3D39D 2IAMA 1CT8B 2FD6H 2QEJA 1XT5A 2A2QT 4IEFB 5MEOB 1DN0B 4ELKB 5IKCA 4F7CA 5IBLC 2NY1B 5LKNA 1JNJA 4K7FA 3RI5F 5I8OL 4CGTA 1WFUA 5CEXA 1S3KH 3QEHA 1T22B 1R0AH 3GSXA 4WGWB 3CGTA 5A16B 2R1XB 3OKEA 4ONFL 4XBGA 1NC4B 5FF6B 2VQ1A 3MRGA 2DLTA 4AIZB 1T7ZA 3R8BB 2A6KA 4LSVH 3C60C 3JSSA 5FEBA 3P77B 5F8RC 4EI6B 1B9ZA 3UYRL 3C08H 5FUOH 4OBRA 1U8MB 4PJBF 2RJMA 4PV9A 4TVPD 2NY5C 4AEIH 3QFDB 1OLZA 2EE2A 3LQMA 3MLUL 3GMPA 1KT2B 1MJUL 1RU9H 3RZCD 4F58L 5JZ7C 4KJWC 2DQFB 4WO4B 5J6HA 2OJZL 3V0AC 1FL6A 1K5NA 5CBEA 5EOTB 5L0QB 3QG6B 4RAUA 3ULSA 3VD4A 4Y4FC 3FQWB 4P4RA 2C4XA 1T83A 4OF8A 3SDCB 2IMMA 3L5XL 1UM5H 1R5VB 5GGTL 4IDJH 4WUUA 3QWQB 1IM3A 1JMZA 3GSWB 1KEML 2VITB 3DO7A 1BVLA 2E8YA 2Y6SC 4XPFL 1I3RA 5GSVB 1YECH 3MGTA 3LSOB 4Z7VE 4OQTH 5DA4A 1FFOB 4NNPL 2OR8A 1LEIB 4OTXH 3WLBB 3N1FC 4HEME 4DAGH 1RU9L 1SVZA 4XNQB 2NR6D 1T0PB 4LRIA 4OZFG 4UBDC 4ZPVB 4RISL 5CLWA 2VWEE 3OZ9H 2AQ2A 3HZVB 1FNGB 5HHMD 5DMIL 3TBSA 1LP9F 2CDEA 4NZRL 4LLQA 5I8OH 4GAJL 2W60B 3GBMH 5ADOL 3SPVA 3Q6FB 3ZHDA 4FQJH 1WC7A 5EH1A 3QDHA 4Z7VB 3WS3B 3BPNB 4JFDA 1IKFH 4XMPL 5DD6B 2HLFC 2ZOLA 3IYLW 2JCCA 4MQ7A 5H37G 4Y5YC 4TVPH 2AK4A 2Q8AL 3CDCA 1VERA 3ULUH 1OAQH 4JZOA 1IBGL 3LZFL 5CJOH 5B38B 3CLEL 4Z5RA 5E8NA 5E08L 1A6AB 1U8JB 4KRNA 4D9LL 3BAEH 3H9SD 5I1EH 2HP4A 4Y5YB 2ENYA 3SO3B 1ES0B 3HNSL 4NFBA 3S5LA 4X7TB 3ROLB 1MHEA 4G7YH 3BDBA 3DX9B 2DI7A 4O51A 4WIQA 5L2KD 2X5PA 3FRPG 1ROWA 1KB9K 2BNQA 2C26A 1FSKB 4J4PC 2W0FA 1UZ8B 3MV8A 1QHPA 3VG9C 3NPSB 4AEIL 4M61B 3QEQD 1HXYB 2D7TH 1JTOA 2V7HA 4NBXB 4BH7A 4PG9B 3NABL 3DYPA 2X4NA 4GT7A 4KQ4H 3MSPA 4X80H 3KLAB 1JFQH 4EEEA 1A5FH 2YKLH 1ACYH 2EKJA 1QRND 1RZJC 4PRNB 4ZS6D 1RVFL 5BJTB 5L2JB 4DOHE 1FH5L 4XAWH 1GYAA 1AGEA 4QT5B 4KRPD 4WW2B 1DBBH 4HGWA 5IM7A 2ZWLT 4DW2L 5GRYA 3HFMH 3K46A 1T1ZA 3L3OB 4AQ1B 3SE8H 3KYMB 1G9NL 1IKNA 4L3EE 3CC5A 3ARFB 3ES6B 3FT3A 5C08E 4B0MM 4GXVH 3QI9B 3HUJE 3NCBB 1A9BB 5E9DB 2Z4QB 3SHSA 2DQJH 4RFOL 2JK5B 1DL7L 3DVNA 5MERB 4OD2B 1FV1B 5GZNC 5C0EA 4DN4H 5E4IA 3O4LB 3TIEA 4UTBL 2CIKB 4R96A 4XNZB 3VGGA 2FZ3B 5GS1B 3MLTA 4M93B 3C09C 3CUPA 4PUBL 4XCNB 4YDVA 4CNIA 1HHJB 5DMKA 1EVTC 1NAKH 4OLUL 1J0IA 5HHQB 2Z31D 5I1GH 1E6OL 3TYFB 4YEFA 4QRQB 1N8ZB 1IGFH 2CKBH 3ARGB 1TZIA 3QJHA 3WSQH 4FQQA 3H0TB 2V5TA 4RMVA 1MQKL 5IJVA 1IC7H 2VLRD 4ZUSA 5F89B 4PJCA 4M7KL 3PGCA 3REWB 5I2IB 1MFAH 5JPNA 5C0BD 1FJ1B 1K4DA 1T89A 4OAWB 2VXSH 1ZGLP 4FQ2L 1CDIA 2PYED 2XPGB 5K59E 3VXMA 4CVZB 4ISVA 3CSPA 5KG9B 4OSUL 5DHYB 3TVMA 1F3DJ 2DKSA 3A6OA 4MZ2A 4KMLB 2B2XH 4IOFC 3CXDL 1FVDA 4NN5B 4WI4A 5DRWA 2PW1A 4BK4A 3AREC 5JXEA 3G5XB 3RWJA 1J8HD 3G6JA 3VWKB 1JPFA 3LCYA 3DBXB 3DVGA 1MELA 4OGAC 1B4JL 4DJMA 4P9HH 5CFHA 3P4MA 1PY9A 3OJDA 4JEGB 3QDME 2PYFB 2P42B 2O93L 1BD2B 1LD9B 2C3XA 1TIUA 3SKOB 2GJJA 3I6KB 2C3WA 5C0BE 1RSFA 4MJ5A 3U0TA 1P53A 2F19H 4YFDB 2CGRH 5E6IA 1YJDH 1JPTH 3QCUL 3G6AB 4PGBB 2IPTL 4JKPL 1GHFL 2IPKA 1IM9A 1QRKA 1A7PH 3QUYD 4LQFL 1WGOA 2DYPB 4IS6B 5KAQF 3A67L 4R4ND 2EIBA 1L0YA 5M95B 3ARGC 4QXTB 5F70A 3VDCA 3EO0B 4GUPB 1NJ9B 5EU6B 2LTQB 3I9GH 2XRAH 3K80A 3MJ9L 2N1KA 3QDMD 3GUTA 2V7NA 1PZ5A 1EJ6A 3MZGB 1QNZL 4GG6E 1T1YA 2IQAB 1B3JA 1F11B 2F9BT 3LVEA 1OWWA 5IHZB 1CLYH 4QHKI 4RMUA 5H94A 3QO0B 1RZKH 2ICEA 1LO3L 1Q9WB 5SWZA 4H88L 1FVCA 4W4OC 3SE3A 4I18B 3RWDA 1XCTA 2DF3A 5AD0A 1BQSA 4KJPD 1ZXQA 3CFEA 3MBEB 1VENA 4KPHH 1AP2B 3QFJB 4KQ3H 4WO4D 5D6CA 1GZQA 3PG2A 5JXEC 3WFZA 3VFOA 1LDPH 3P9LA 4LDEB 4JFPA 1JZ4A 3BHBB 4JY4A 3W39B 2X7LA 5DJZA 4K3EH 4PTUB 1K4CA 1KN4L 1MLBA 1S7TA 3D85D 1KJVA 3BUYA 4XB7A 3WXVL 5D4QA 1NCTA 4G43B 1N59B 2ZKHH 4KK6C 5J9PA 3Q0HA 5GGSY 3FQTB 2ED8A 1IEBA 5D1ZA 5C6WH 1FFQA 1WBZB 4HS3B 5GPRA 2IBBA 4HXAH 5J1AB 4BZ2L 3B9EA 1O7VA 5DD3H 2IFFH 3RKDC 3QEQB 3O8XA 2LU4A 3ZE1F 3RGVB 3MJ8A 5EBLA 4Z7WA 3GSUA 1ADQA 1EDQA 4K23L 3IU3A 2EC9U 4OUOA 5DS8B 4G8GB 1RULH 4F37F 1EERB 4UU9B 4KTYA 4YBLB 1S5IL 3IETA 1T20B 5HYSG 3I3DA 5IMKA 4L3AA 2BOBB 2AEIT 4FHBD 5EULV 1A3RH 1R3HB 2DQTL 1MHHA 3HN3A 1T89C 4I3RL 5KW9H 2ARJQ 4OLZH 3S36X 1PKQE 3HI5L 4HMCA 5JDJA 2W59A 4NC0B 5JR1L 2WWKT 2HJFA 1RIHL 4KWUA 4KQ4L 5D7KE 4X7SL 5C09A 3U1SL 3U7WL 2E5EA 3CK0L 4U1LA 3MODH 1WVZA 1J8HA 2GW5A 5GGTA 1JHLL 3KPSD 3ARXA 3U6RB 1I1YA 4LBEA 4UIKL 4M7LH 5C08A 4YEEA 3B6SB 5JDSB 3D48R 1UYWH 4BJLA 1TVHB 5J56B 3TESA 5DYOB 3K7UA 2E7HA 3LKPB 4L9LB 2M1KA 1BBJA 3WHXB 1XF2A 1Q9KA 3B9KA 1MJ7L 4JFEE 2H3NB 2FL5A 1U2HA 4E42B 2NQCA 4PJHB 3ILPA 1X5AA 3PWLB 1AXTL 2XG4A 5GGTH 4JR9H 5DRNB 4ODSH 1FZMB 1FGVH 2A9MH 4K7PY 4Z7UB 4ZDHB 3ULUL 3ZE2F 2XTLA 5EO9B 1RK0B 2G2RB 4TSCL 1JWUA 1YN7B 4WO4C 5B8CA 3QUYB 5CKAA 4XX1E 5CILL 3LN5A 3EDKA 1ZGLA 1F6FB 1XZ0A 3JZ7A 4AENA 3L3DB 5DD1L 2CKBL 2DM7A 1K8IB 1KC5H 4NO0A 2R0KH 3CDGB 5J13C 4TVPL 3IRZA 1T04B 3OG4B 3IJYB 4HKJB 5BQ7A 2A6JB 3KPTA 4ETYA 2JTDA 3GO1H 4YGVA 2WWMC 2H1PH 3RY6A 1FVEB 2WIMA 4HEPG 3AY4C 2YC1A 1KOAA 5CMAB 5ETUB 4U1GB 3QHFH 4NQVA 3G6JF 1N6QL 4RFOH 4X4XB 1N64H 2OQJA 5F7DB 1GGBL 3PWJB 5FECA 3TC9A 4P3DA 2Z0BA 2NX5D 2R23A 3V4PL 1OD9A 2VDQH 1VFAA 2XTJE 3VRIB 4FQXA 3IDMB 4RGNE 2P48B 1GOFA 2DQUH 5EZOL 5DJYA 3S36L 1QLEH 4KZDL 4XPGL 2AV7A 3B4NA 2Y5EA 4IIQC 3LV3B 3L5XH 3AGVA 1IEAA 5HHOA 3WJJC 2XQBL 4ZUTB 3R1GL 4M93C 3R1GH 4G9DB 4JO3H 3DSNA 5ID1B 1S78C 3EOBB 1DEDA 1A9EB 2D31B 1INEH 1BX2B 4YGAB 5I1EL 5HDBF 1EIBA 2HFGH 2R9HC 4YBLC 2OLDA 4X6DE 3D1MC 2OTPA 1JZ8A 3QDGA 1H3VA 2BSED 4TRPH 7CGTA 3CFBA 4NZUL 1JCKA 4QRPB 3GRWL 3V6ZA 5EC2B 1XF5A 1QFWM 3HZYA 5I76B 3UTZA 3LKSA 4XPTL 1YQ2A 2X6MA 1NEUA 3TNMA 2X9WA 4KKAC 4Z9KB 1Z3GH 4LU5L 4XHJD 1JWMA 1WISA 4ZMAT 4X4YA 3RVVD 1W72H 5IVXB 4NUGH 4K3JH 3N0PB 2HLAA 5CD5C 1DE4A 4OV6F 3KLHD 1OAQL 4PPTA 3V8CA 3ZYJA 1CIUA 1FBIH 3GBNH 3QXVA 3MCLH 5EBGA 1TJHH 4GXUM 1EEYB 4TRPL 3EFDL 4LAQL 2EC8A 1VKXB 4YFLI 1HE7A 1BQLL 1RULL 1XGQA 4JY5H 4QGYA 1TJGH 2Y6SD 3UPCA 4XMKL 1HILB 2OM5A 4NM8L 3FAWA 5CZVL 3IGAB 3NA9H 5DT1L 4PBVC 1HHKB 4WTZG 5IG7A 2IAMC 4LSQH 2BCKA 3HPLA 5I6XB 2CLZA 1GGUA 4BFIA 4XPGH 4CDGC 3V5DB 3RDTD 1R3LB 4WTZA 4U1IB 4GW5A 4PJDB 4R7DB 4M6NL 4XPBH 3MUY1 1T80A 3QIWA 4JPWH 2AEPH 3ARBA 3LKNA 1DVFD 2C3VA 2HFGL 4D0DA 4ONHB 1Q9OA 3O3EA 2HLFD 2X44D 2GIYA 4Z7NE 1N2RB 1FRGL 2PW2A 3OXSA 1ZLWH 1TQBC 3QDMA 4ZODA 1LO5B 2H1PL 3WCYA 5KOMC 1V3JA 4I0KA 2OR7A 3NA4A 3U7WH 5ICYB 3AS0A 3WIHL 1PKQA 5DRXA 3ZHLA 1XF1A 3LD8B 3I84A 3DROA 2K7PA 1AC0A 2GSGB 5KS9E 5C0AE 1RZ7L 2BXYA 3GMRA 3TJEH 1NLDL 3NFPA 3SDXA 1T21A 5JPMA 4PLJC 1R5VA 2AJ3B 4QTHB 1U8PB 2LVCA 2XN9A 1RZKC 2ZOKA 4MA7H 2EICA 4P23A 1MF2L 3LEYL 1J1XL 4J4PD 3C6SA 1UWGH 1NSNH 4I0PB 4N0YL 1E28B 5ID0A 3E6HA 3O6LL 4P9ML 1JGLH 4JFEB 4Y4FB 3PWVB 5HVGB 2VQUA 4HWUA 4E9LA 1CICD 5DJCB 4ETQA 5DUMH 4PJGF 5C0DB 1I9IH 2YA2A 3KVQA 4MDIB 3GHBH 4OUUA 3QG7H 5EZJA 1V7NH 5FA3B 3S3PA 3V79C 3FO2A 2HJLB 1XCQB 4IM8A 1G7HA 2HTLD 1U8KB 4OD3L 3BKCH 1FYTE 4LQFH 5ERWB 3RHWF 3UYOD 4PRAA 1RIVH 1UKTA 1XH3B 3WS3A 2YR3A 2HT2C 5IB1A 3S6CA 1G6RH 2C5DC 1DBMH 43C9B 3U9PL 5GRUH 3QHTC 3BPOC 1OLLA 3LIZL 3OTTA 2EDLA 4MJIA 3TP4A 4Z5RB 2C4FT 4J3XA 1YMMB 1PBYA 1OAXL 4JHWH 4PJGB 4F33B 4OLWL 3WKMH 4NT6A 4G8FA 4QHUB 3RZWA 1C08B 1EO8H 1IFHL 3KYOA 1I1FA 4EUPB 1K85A 1A4KB 1WEJH 5D1ZC 3BSZH 1TXKA 2K7QA 4H5SA 1KPRB 1WTLA 4HAFA 4YHKH 4AEHL 4N9GA 1C1EL 2OI9C 1AQDB 1ZWIA 1LO2H 4JFFE 5D6DC 4D8PB 3LAFA 3MFFA 2R1YA 2BNRA 3KXFD 3ZHKA 2O61A 4K3GA 4NRZA 4TQEL 4O4YL 2Q6WB 1RAMA 4MLIA 1AI1L 3GMPB 3SQBA 5FYLD 2IG2H 1J1PH 2C1PB 5CCKL 4M1DH 4LARH 3BGAA 1CWVA 1U91A 1PG7H 4OF3A 5D2NB 3ZTJH 3UEZA 4R4BA 3IDYB 1U95B 4JG1H 1NMCB 2W0KA 1A7QL 2ZUUA 3WYRA 5C0IA 2NY0D 1DQJB 1RJLA 5BO1H 1YEDA 1UCTA 4S2SA 4BSVA 1RJYA 3QXAA 3L3OA 4RIRB 2RBLA 4HHAA 2ZUVA 2XICA 1C8PA 4PJ9B 3HCVB 2BRQA 4NQCE 4YH6A 5GJTL 2NY6D 1BOGB 3RVTD 2Z4QA 3BP6B 3WNOA 2AJVH 3RVXD 4BQ8A 4H88H 3HA0A 2M2DA 4PRIE 3MODL 4ZFOB 4HIHB 2OR9L 3KWWB 2XZAL 4LRNH 2J12B 2GK0B 1J8HE 3TFKD 5JTWA 1CFNA 3LPGA 3V4VH 4ZAKA 1JF5A 4HMDA 1T2XA 1GAFH 3LMJL 4AT6B 1S7UA 4ZUUA 1I4FA 4RMRA 5I0ZA 2Y07H 3EYOA 4M7JH 4PJCB 4H1LG 4YDLC 2W60A 3TN0D 5I8CA 1RZFH 5DMJB 1LEGA 5HDOA 4WCYL 3TA3C 1XIWA 2VL5B 2O5YH 4Z7VA 1RQ5A 1F90H 1EPFA 3ZT6A 4MQ7B 1IM9D 2AK4E 3MRFB 1NUGA 2BVYA 3EYQD 2KQMA 2XWJA 4WY7L 5DHYA 5F3HA 3MLSH 2OXHA 5E6YA 2A9NH 2OTUB 3DARA 5GS0H 2JE8A 1QFUH 3OXRB 1FZKB 3AB0C 2AI0H 4NFCA 4YHPB 4K9EH 4K7PX 3MRQB 3TPKA 1KBGH 4M8QA 3G08A 5CUSH 3REVB 2X4TA 2YZ1A 2R0LL 5F1NA 3BEVB 3SKOA 4V1DA 3O3BA 2DYPD 1KB9J 1OAXH 3P30H 4IMKC 4Q6IC 4OKVA 1NH6A 4EI5C 2Y07L 4P4KC 4P2OB 4K8RL 1ORSA 5J7CC 3ZE0E 2AK4D 1OGAE 1QFWH 1YEKH 5AZ2H 3RWHA 3K8MA 2AQ1A 4HX1B 1AR2A 3G9VA 5DK2B 4HKXA 5L8JB 4QRUA 1FRGH 5D1QB 2D4DA 2F58L 1CFVH 2Q3ZA 2H2SC 2FWOB 3BQUB 3PV6B 3SQOH 3MLZL 4L8BB 3MRNB 2WP3T 5B39G 4PR5A 2MQCA 4F7TB 5I16B 4KVCL 3QI9A 4DQOH 4IRZH 5FK9B 5H37H 4DN3L 3BQUC 2GTZB 1TZHB 1TPXB 2B1AL 3MO1A 3SE4A 3SCMA 2CJUL 4ZOEA 4OLYH 4N0CD 1XR9A 2XI9A 5IF0B 3CXDH 4ZNEA 2H6PB 3LPWA 4LMQI 5FGCE 1T1XA 4NGHH 3BOVA 1HHJA 3L5WB 1AGCA 1NSNL 2J4WL 4FNLL 3BAEL 3T3ME 1TNNA 4S1SH 5T1LA 1F97A 5HYFA 3BGMA 3SO3C 3EAKA 1MCJA 4YFEA 4L4TE 3LKOA 2CLRA 2IPTH 2YPLB 1CDJA 3NCFB 2AKRB 4JKPH 5T3ZL 2ZUQC 1H8NA 5IV2A 4PLKC 3OR7A 1G9NH 4ZG1A 1PEZA 1GZQB 1X5GA 5FYJE 3SKMB 1WCBA 4LSTL 2R69L 2FX9H 2SEBB 3G6DL 43CAB 1PEWA 1MH5A 4LCCA 1KCKA 3LQAL 4NDMA 4CVZA 5CEZE 2NY5H 3W39A 2ILLA 2QJDA 2ITCA 3H3BC 4NQDE 1R3KB 3HRZA 1YEEL 1E6JL 5D2LE 1D5IL 5ISZD 3VG0L 4N8CL 7FABL 1FNLA 1HCVA 2NX5B 1RJCA 2HFTA 3ULUF 2FSEB 3OBAA 3DX6B 2XYCA 4L4TB 3Q5TA 1LILA 4OZ4A 3VRJA 5CSGA 4MA7L 3G6JB 4TSBH 3VFTB 1MNUH 5BV7H 1U8OB 2DTMH 5D93C 1FIGH 4P2YA 4Q9CA 1BOYA 3CH1B 4I9WD 3P4MB 4ODXB 4OJFL 4J3UA 1CXEA 5EO1B 5CHNA 1SYSB 3LDBC 1HNFA 3SBWA 4MMZC 3T0EC 5EPMA 1K8DB 3BMVA 2FNBA 5FGBA 3LHPH 3WS6A 4Q74A 3I02A 5CIPA 3D39A 1D6VH 4Y16C 1KV3A 5C0CD 3UJJH 1F6AB 1X4XA 2B0SH 4G8EA 4OZIF 5L0QC 1ZHKA 4N0FA 4ZQKB 4P2RE 1IM9B 1GC1C 1M6OB 4KY1H 4NWTH 4Y1AE 3BI9X 4NHCH 3PQYE 4MCZB 3QXDA 4KMTH 3JWDL 4HIEA 5ESQB 2R0ZL 5FGCB 4Q0XH 5C09B 1JRHI 5CIPH 3ARYA 4U1LB 5D9SB 1OAYH 2B5IC 1M7IB 2P24A 2P5WB 3KNBB 1AXIB 4LHUA 5C7XH 3QHZL 4U6HB 4XCYA 2Q7YA 3QUXC 2YMXH 12E8L 4GSDH 4XB8A 5FHBL 3VI4F 2ZUSA 1U8NA 3QQNA 1UB6A 1F11A 1QACA 2HTKC 3CNKA 4L8CA 1WWAX 5ACZA 2I9TA 2H9GA 3C8KA 3ZE1E 2FL5B 3U82B 4LKCB 4M1GH 5SWZB 5CJ5A 2AXFA 5HYJE 5JNYA 4NHCL 4J6RH 3L95A 5GGUB 1JTPA 3I6GA 3MRIA 2YWYA 1SEBB 5IP4A 5GRUL 4JDZA 4MSWB 4ODHL 3HG1D 5I17A 5B8CB 2GKIA 1AQKH 1QYGH 3FRPA 1AXTH 3FFDB 3HZMB 3EOAA 4R4NC 3KYNA 3P73A 3KPPA 2I60H 3CFDA 3QRGL 1JNHA 5IJKA 4M02A 1AXSB 1QLEL 1C16A 5C9JA 4KZDH 1TJIH 3MRPA 4HUWA 1TJIL 2A6JA 1MLBB 3R8QA 5L9DH 5BZWA 3T2OA 4M7LL 3DMMC 4Y1AD 2VDRH 1UJ3B 4QRPD 5I1HL 3PABA 3FQRA 2XQYK 4E41B 4JO1H 2EH8L 5IB4A 5F88A 4OV5A 5JQHC 1XEDA 2NY3B 1UH4A 3WHE1 4FXGB 4L4VA 5FECB 2P5EA 5IMLA 4W6YB 3O8XB 1YPZA 3RGVA 1YY9D 1LWRA 2GJZA 4DEPC 4A6YL 3IU3B 4UINH 4XWOC 2OXGA 4G6MH 4DWHA 1Y0LA 5JORB 3CFCH 3S4SB 5C6TL 4FXKA 2Q76B 4GAJH 1H15B 1OY3B 2NTSP 2OL3A 4ZUTA 5HHVH 3TIDA 5F9WB 2BOBA 5HHVL 5FUCC 2NLJB 3OGCB 1R3HA 1BBDL 4WWKC 1VPOH 4HJJH 3B5TA 5MP6L 4YC2B 3E2HC 3VXSB 3MOBH 2LQRA 4PY7A 3OKDA 3PDGA 3QCTH 5IFHL 3T2NH 2RCSL 1ZLVK 4G7VH 1WJ3A 3VGAB 3IFOA 1SY6L 4ELMB 3O0RH 4ZFOL 1T0NB 4OQTL 4BQBA 2KL6A 1AKJB 3IDGA 4XNXH 1MJ8L 1EAPB 2CDGB 3RDTA 1KULA 2P45B 4MD4B 2EH8H 4PJAE 4YLQT 1A47A 2CJUH 2QKIB 2VZUA 3IVKA 1LNUA 1M7XA 4HUUB 3KHQA 2GFBB 3UZEA 4BUGA 1J0HA 5D96B 4MNGE 1A7RH 2A6IB 4RMWA 1GSMA 3MACH