5KOVC

Crystal structure of the human astrovirus 2 capsid protein spike in complex with a single chain variable fragment of an astrovirus neutralizing antibody at 3.24-a resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
245
structure length
223
Chain Sequence
DVQLKQSGPGLVQPSQSLSITCTVSGFSLIDYGVHWVRQSPGKGLEWLGVIWTGGSTDYNAAFISRLTISKDNSKSQVFFKMNSLQANDTGIYYCGRPYYGNVMDYWGQGTSVTVDIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTFPPTFGGGTKLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid polyprotein VP90
publication title Structure of a Human Astrovirus Capsid-Antibody Complex and Mechanistic Insights into Virus Neutralization.
pubmed doi rcsb
source organism Human astrovirus-2
total genus 45
structure length 223
sequence length 245
chains with identical sequence E, I, K, O, Q, U, W
ec nomenclature
pdb deposition date 2016-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kovC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kovC01
1N5AA 4CVXA 2NW3A 4KGLA 3ULUF 1OTTD 4ONFH 4HIEA 1I3RB 1YYMH 4G9FE 2IQAB 2V7NA 3MLRL 1NGZA 5IFHL 1UKSA 5JQHC 1AP2A 3SJVE 1KIPA 4PV9B 1PZ5B 4EI6B 5ICYB 3LKSA 3B3IA 1EHLH 1WFUA 3UTPD 3V0WH 3BKJL 5DMIH 2GJ6D 3V7AG 1HKLH 2VR4A 3MA9L 4ORGB 3QSKB 4L8DA 1FFOB 4YUEL 4AMKL 4NT6A 1G6RA 2VN4A 3JSSA 1NAML 5JPMB 2UYLB 4NHUB 3L3JB 1BQUA 2P8MB 4C56B 4F9LA 3QWRD 3CDCA 1IL1B 1IGCH 2ZUXA 3WKML 4WEBL 5I1LA 5DJAA 3KJ4C 1B0RB 2CRIA 4L1DA 5DUML 3I75A 3ULUC 3B2VH 1IAII 3QCVL 2A9NH 1CGXA 3D5OF 1WK0A 3AU1A 3Q1SH 1MHPH 4LSUL 3RHWF 3WLBB 2GAZA 3L7FB 3PDDA 4KTEH 2V2XB 4PLKC 5D1ZA 4G6KH 2AEQL 4XPBH 4NPYA 1NEZB 3OAUL 1A14L 2BNRB 3MOAL 1MCPL 4CVZA 4QRRD 1T1XA 2L4OA 3QUXA 3WIIL 4HH8A 1S5HB 2R2BA 5GGUB 3QULA 1BVKA 3K4DA 2VH5L 2LU7A 3FOMA 2EYRB 3IFNL 4N0UB 4TYUA 2ZNWA 4O4YH 5BV7H 5CWSB 1KGCD 4HWZA 3KXFD 3WFHB 1EDQA 2H2SC 3O6FC 5FAAA 1Y0LA 2KZ1B 3GK8H 2OZ4H 4YDJA 1I7TB 5MERA 2F54B 3DV4A 5I8CA 3G6JE 3S9DB 3V52H 3NIDF 3T0WA 5D1XC 1FORH 4NBZB 3WFCH 3KR3H 3HE7C 1FL5B 1U8HB 4Y16C 2XQBL 3MC0A 2W9EL 4JVUA 4X4ZA 3DUUA 4MYWB 1ZMYA 4HKZA 2OQJA 3IYLW 1CE6A 4EN3D 1D6EA 1IEBA 4IRJA 3NGBB 2CD0A 4TPRL 3V0WL 5DMIL 3K2MC 3G04A 5IMMA 2XFXA 1UEYA 2OSLA 5E8EB 1EEZA 4ZAKB 5D9SB 4NCDA 3QNXA 4BFIA 3DETC 5IBLC 2V2TB 3RY4A 2ZCKL 4Z0BH 5KSBE 4YHIB 4LSSH 1U3JA 3F5WB 2WLZA 4WUKH 4U0QB 5EBMB 4PS4H 4LF3B 5F1KC 3ZE1E 2X09A 1IGCL 1M6OB 2YC1A 1NEUA 4ZUSA 4LLWB 4A6YB 3MRRB 4P57A 4HIXH 2CLVB 3OJDB 1YNTA 5EU7E 3QUZA 2Y72A 3OSKA 5BVPH 3S34H 3K8MA 1MHPL 4MAUL 5FF6A 4XPTL 5E6IC 4O9HL 3O6FA 1GAFH 3L5JA 4J3UA 3TN0C 5IT2H 3AB0B 3P9LA 4PRPA 1KJ2B 4KJYA 2QHRL 2J4WL 3O45B 4TSCL 2ID5A 2KKQA 2BHUA 3ILPA 4GKOA 4X7EC 1NUNB 1DQJA 2A6KB 5EG6C 2XY2A 1AGEA 2UV3A 2F53A 3HE7A 4NWUH 3O3AB 2VDQH 5DMYA 4N90D 3B5TA 5IBTL 4WO4B 1ZANH 1YPZA 5I15L 4XAKD 4E0RA 3BPOC 1KPVB 2C1PA 5D7LA 4QWWC 3JV4B 5BRZE 2E9JA 3H7BB 2A0LC 4KKBC 3HRZA 5GS0H 5JIHA 3ARGA 1FBIL 1MAMH 4KAQH 2IQ9L 1U58A 1M05B 1R5VB 2APTA 2HWZH 3ROOA 4XWOC 4XHJC 3C2AL 2UWEB 1FLRL 4FQ1H 4KI5E 1WC7B 3VXMB 2NR6D 3OG4B 4YDIH 3QA3A 4JKWA 4GQ9H 4JDZA 5I8KL 3LD8C 3OR7B 4OSUH 3CLFH 5HVHB 3BRGC 5DGQA 1FZMB 4HWEH 5B8CC 1HIML 1UXWB 3RI5F 4C57C 4JRYE 1A1MB 4ELMA 3MRPA 2QTEA 3PWVA 3GDBA 1G9EA 3TN0D 2YKLH 4U1SA 2BSRA 4OIIL 1VCAA 4HIHB 5E8OA 5C0BA 3VWJB 3LN4A 4LLYA 4GAGL 4WUKL 3S35H 3OAZK 1GGCH 1TQCB 4PS4L 4Y89A 1QRKA 1RUKH 1G1CA 2A6IB 4KTDL 5ADPL 4W4OC 5E6IA 4UOW1 1DBBL 2XTJD 4KPHH 2LVCA 4HIXL 4JN1H 4PYHA 4ODTH 2DQJL 3CU1A 3CH1A 3F7VA 4AH2B 3QFJA 4LRIA 4RGNE 2UVFA 4NN7C 1ZE3C 1O7VA 3RVTC 1KTLB 2DM4A 1NFKA 3QI9B 2VL5A 3SJVB 5E9DD 4UILH 4PTUB 3I6LD 4P5KB 5DK0B 4MJ5A 1GAFL 3KHQA 4WU7B 3ZL4H 3G6DH 1I3GH 5GSRB 4WWKB 3RGHA 3M1BA 3ECBA 4UQ3B 4YHZL 4B41A 2D31A 4JANA 4MNQB 2HN7B 4XWOD 2RFXA 1JPFB 3GBML 3RQ3A 4K2UL 4ESKA 3VXNB 2P48B 4GRWB 3HI1B 3K4ZA 5E2VH 4E41B 4DTGH 5HHQA 5IJVB 4GQPH 3VXPA 3B9KB 4K55A 4N8CH 5TE6H 3G08A 1LO4L 5CSBA 5CINH 4OLUL 5GGRY 3WIFB 4X5WB 4NUJB 3O8XB 4Y4HA 5HHOE 1QUNA 4WW2B 1CT8A 5HHXL 5SWSD 3BIAX 1NAMA 2VSCA 2DQTH 5FDWB 1KPRA 2C3VB 5IB2A 2HVKB 4F7MB 5H37G 3LDBC 4OSUL 3CLFL 1WTGT 2JJTA 4PJHF 2VXSL 1EXUB 4EOWH 3H0TA 5A16B 1DN2A 4OFPA 4LVOC 4LCUA 5DVKA 3G6JB 4U2ZA 4WGWB 2R2EB 5IK3A 4IDJL 1KTDB 1YY9C 5MENA 3BGMA 4GAYA 3DV6A 3DURB 3IXAA 5FYJL 3MLUH 3FMGH 4MQ7B 1D5BA 4JHAL 3QDJD 1OP9A 1VFBA 2H8PB 3OKMB 5CFHA 5TFSL 2N56A 4UILL 3HG1A 3O4LD 2HT2D 4YHYC 4DW2H 2GJJA 2Q6WA 4WHCA 1QBAA 3N1QC 2A2QT 2Q3ZA 2QSQA 1HHIA 3BAEH 2DD8H 4N68A 5KSBB 1FLTX 5CJ8A 1M7DA 5T1KD 1G9MC 1W72H 2QADC 5C0CB 3DRQB 1JMXA 1KFAL 4PRPE 2DDQL 3MLTB 3IAQA 4P46C 3R8QA 4DVRL 5E2VL 4G6JH 1SYVA 3N85H 2C26A 1CLOL 3HCVA 5D7JA 5D7KD 2CDFB 4NNXA 4F7EA 3UTTA 4ISVA 5ISZD 4TUJA 2CJUL 4N8CL 3BQUC 4NQDD 4R7NA 4FXKA 4M9PA 1UM5H 4GLRI 1QSFD 1UJ3A 3ARPA 5C0JA 1DQMH 1YPZE 4MJ6B 3NPSC 1WIPA 1HDMA 1R5WB 1FGNH 4RFOL 1JGUH 1Q1JL 5D7LE 2X4TB 3L3HA 2KQNA 3VG9B 4QTHB 3BPCA 3HS0B 3TYGL 2COQA 4EDWH 4L3EB 4B7LA 5JDSB 4OD1H 1MAJA 4YBQC 5GZNC 4X8JA 2X4QB 1UXSB 1I4FA 4UT7L 3KPRB 1F90L 5E6ZA 5EBGA 3QHFH 5J12B 3HFMH 4JDTL 3QDMA 5J1AA 4I3RL 5L8KB 1X7QB 4LSVH 3HAEG 1M7IA 3GSXB 1U93B 4MD5A 5BRZB 5C07A 4KVCH 4LKXA 4P5TC 4ELME 1YN6A 4JG1L 1J0KA 1XIWB 4PJHA 2E6QA 2MMXA 2VLJA 4PJ8B 3KPQA 4U33A 3HE6B 1JPTH 2NYYC 4P46D 5C0BE 2EDOA 4FQIH 1LO5B 4HS6A 5E2TH 3CZFB 2EO1A 4GW4A 1XF2A 2ADFH 2BNUB 8FABB 4HZLA 4TNVK 1J5OL 4Q2ZA 2AJ3A 4OBSA 3ABZA 1Q9KA 2BFVH 3FQRB 3PP4H 4DW2L 2NW3B 4ODWA 4HIEB 4JRYB 5HYSB 1YEFH 4X4YB 2OZ4A 1IRAY 2BSTB 4M7LL 1AP2B 1KB5L 4UOJA 3B3IB 1DJSA 1OGAD 3OF6D 5EIVA 1NMBL 3ELAT 3WHE1 3HZVB 2FBJL 4GSDL 4GBXC 4BH7A 3SKOA 3BP5A 5GRXG 4L8DB 2ENYA 1H3TA 1A7PH 3QNZA 5HBBA 3ZKMC 4LLMA 4G6JL 4F2MA 3N85L 5CCKH 1S9KC 3EZ8A 3RZCA 4HK3N 2YD4A 3K3QA 3K8KA 5EPMA 1MFAH 4RGNB 5KVGH 1A1NA 4WHTA 4OCXH 5IBUB 3GRWL 5FV2A 1RUAL 2DBLH 2R1WA 3KPLA 4BH8B 2YN3A 4JKMA 4FRWA 4JM4L 1J0YA 1JGUL 2QKIA 3GSWB 3DLQR 2QL1A 1RIUL 3KDMA 3VD7A 2DICA 5M94B 4EDWL 1YEDA 2X4PA 2P8PA 2JF1A 3EAKA 5AZ2L 2P5WA 3MLZL 4RGOH 3KLSA 4NPYB 4P5TA 5TF1H 5D5MB 1T1XB 3QUXB 1MNUL 3MLYH 3HFML 2R2BB 3QULB 1BVKB 5FYLH 3S37H 1H0DB 5CHNA 1YEIL 3C5ZD 4XVSH 3DTXA 4ZG1A 3IU3B 5TE4L 4EIGB 2CDGB 5DQDH 5MERB 5HHOB 1WBZB 3DV4B 1UWEH 3ZKMD 4NP4L 3VRJA 3FN3A 4G5ZH 4BA8A 5MENE 1S8DA 1DBMH 5LBSH 4DZ8B 1Q9LB 5FHAL 5JOEA 5DXWA 1VFAA 4GBXA 1JZ8A 4K3EL 2H3NA 1X5YA 3SGJC 3TJEH 3DUUB 35C8H 2PR4L 4HKZB 2OQJB 1CE6B 1NMAH 4CMHC 2CXKA 4NQTA 4IRJB 3RWIB 5KOMC 3BIBX 5DRNA 1IAIL 3HG1E 1MCQA 4X6FB 5DRZB 5IMMB 2XFXB 2LABA 4GMTL 1IC1A 2OSLB 3H7LA 3KYOA 3EOYG 5E4IA 5AUMA 4CN6A 4KZDL 4BFIB 1A7PL 4HV8A 5DLMH 5C92A 4HCRH 5CCKL 1FFNB 4BQBA 4F37F 4OZFH 4PV8A 3U4EA 4U1HB 4EXPX 3PABA 5K9KB 5C70A 4MQTB 4OUUA 3TZVD 4Q6YA 1CFTA 2P24A 3QJFA 1J7VR 1F5WA 1OW0A 4TULH 4ZUSB 1NC4B 5GRZA 1TTGA 2R39A 4LAJH 3BN9C 2WBJB 4R7DA 4YR6A 2H26A 4PRBA 4G7YH 5TQ2H 2Y4SA 1KCUL 3QUZB 4JFZL 1F6FB 1PAMA 1D9KC 2DYPD 3UTTE 3MRGB 2B20A 1WWBX 4NM4H 3OKEB 4NRZB 5DUPL 4LBEB 2BY2A 1I8IA 4IOFC 3ZTJH 3ARFA 5TF1L 4PRPB 5AYUL 1G0DA 3MLYL 3ILPB 1RQ5A 2R4SH 2X6MA 3S37L 4D0BB 5I1JH 5I8EB 5CGMA 2O61A 5EOTA 1AGEB 2HKFH 4H25A 4JKLA 4KK9C 3BW9A 5B4MD 3SGJA 1YPZB 2R23B 5DQDL 3SGEH 4E0RB 4ZFOB 3VJ6B 2J8OA 5GGRB 1EH9A 2ICWI 3RDTD 5C0AD 5D7LB 4HPYL 1EHNA 5C07E 3NH7L 4KROC 4GG8A 3FN9A 4HMEA 3U9UB 3PP3K 1MLCA 1T4KA 1DVFB 1ORQB 1QFHA 5EUKA 4PJHE 3QCUH 2VLJE 4Y4FA 1X44A 2HMID 4ZSOA 4HUUA 4X8XA 3ROOB 3CFKA 4HGWA 1RIHL 3BN9D 4QLRA 3S36H 3NIGF 1NUDA 5IQ7H 4G7VL 3NCJL 4JFDD 1D9KD 3ZYJA 3MFFB 4LGSB 4JDZB 3DRTB 3SEPA 2VB5A 4JDVB 4XI5C 1JFQH 4CU8A 4M03A 5IB5A 4IOFD 5I76A 3R8BB 4F9PC 3DVNB 4KRPD 1P7HL 5F6IC 1FE8L 4ZXBD 1K3IA 4KQ3H 4O00A 3C60D 5C0BB 3LN4B 3MGOA 1QSEE 4ZUUA 1KCRL 3NZHH 2Z35B 4WFGE 3D3VD 2NXYC 4OF5A 2A38A 1A3LH 4UIMA 1JZ3A 2D4FA 2RCSL 1RV6X 2JB6B 3CH1B 1XF1A 3LS5H 3T08A 2ZUVA 5FUZH 2VXVL 4UBDC 4MQXC 4R26H 3WS6C 4M5ZL 4F33A 3WXWL 1TZGH 4XVJH 4M1DH 3T0BA 1UVQA 4X6CB 1BD2A 3I3BA 2BC4A 4JFFD 2H2PD 4AEFA 2WIIA 3DGCR 1EVTC 4JO3L 5BW7C 3UC0H 2RFXB 5I0DA 4UUJB 2P5WE 4PD4J 1I1FA 1WWCA 4JPIA 4TUOA 1RZ7L 2HG5A 4O2EA 2HTKC 3TEUA 1XFPA 1MJJA 4XVUC 2OTUB 4K7FB 4F8QA 4XVTH 4QOKA 3VFOA 1F11A 1ZLUK 3VXPB 3SDAC 1DANU 3EO1A 2VRAA 3P30H 4APQD 3G08B 4QTIH 3LKQA 5F3BA 4XXDA 4ZMAT 3HI6H 2NXYD 3IETA 3PWPD 2BDNH 4C83A 4MAYC 3UZQA 5JXAH 2B1HL 1KPRB 4XXCC 5IB2B 3RGVC 1P6FA 1MELA 3DVIA 2VLLA 4YK4B 1TPXC 4WEUD 3T3PF 3GRWA 4XP1H 5JOPE 2DLGA 5DJXB 1YC8A 3GSVB 1EERB 1HWHB 3BGFB 2DF3A 4J3VA 3BRFA 1DR9A 4NO0D 5EU5A 1DUYA 1UZ6F 5D6DC 3OMZA 4JO1H 4LCUB 4EQ2A 3V6FB 2AXGA 1T1YB 4FABH 1C16B 3BGMB 4D9QE 3MRNA 3DV6B 1A3LL 3RWJA 3MUY1 4G6FD 4RMRA 3AMLA 4PRID 5HHNA 3ROLB 4U6XA 1D5BB 4YIQA 2XRAH 4DJMA 1TZIA 2HTKD 4DN3H 2FH6A 4HJJH 1T0NA 1U92A 4R26L 5B3NA 5BW7A 5I1CH 1N4XL 1P4IL 5E8DL 5KSUB 4OUOA 4WUUA 3HG1B 3GSUA 4XMKH 2J6EH 2X42A 1T5XA 3FOLB 2XICA 2ZCLH 3CAFA 4OF7A 2YRPA 2J5LC 3IJYA 5ESAB 1HSAA 2Q6WB 3RY6C 5T3XD 3QUMB 5I17A 1HHIB 4PJBF 5KSAC 1AY1L 1DLFH 3UC0L 4MAYD 3SDAA 2WBWB 3PE9A 3ILQC 1HSBA 5CP3H 4JM2B 3DI3B 4KQ4L 1YQ2A 3ZTNH 1OCWL 4XVTL 5EZJA 3W39A 5D7JB 1X9QA 4XC3L 3RGVA 1KCKA 3P30L 1B90A 2LQRA 1T0MA 2AV7A 1EFXA 3VFRB 2EIBA 2YR3A 1FPTH 3GM0A 5HDBE 4BQCA 5C0JB 3QXUA 1CLYH 3BMVA 1GZPB 2R1XB 3MGTB 1T21B 4DGYH 5D1QA 5JIIA 5JXAL 4MQSB 2EYSA 3O81A 4JRWA 3L3HB 4L8SC 3AC0A 4YHPA 2XOTA 4P5MA 1HH6B 1AGBA 2I9LA 4I13B 1JUFA 5IW6A 4ZSOE 1MJ7H 3BHBB 1IT9L 1VESA 2GK2A 1FVDB 1C1EH 3QPQC 3VXOA 4LHUG 4LP5A 3O9WA 5EZOH 1R5IA 3PWLA 1M7IB 3FRUA 1XF4A 4P2RA 2OTWA 5C07B 4N0FA 1LK2A 1WZ1H 2D0FA 3VWKC 1L7IH 1OM3L 2VDOH 3U82B 4X5XA 3QIBC 3M8OH 3F8UB 3ILQD 3QBTB 4XP5H 3KPQB 2XRAL 4NNPL 3A67H 4Z78B 1XAUA 3IF1B 4H0GA 4HS6B 3DVGA 1MCRA 5KSAA 1XF2B 1IQWH 2FATH 2Z4QA 2P42B 4WI2A 1DUZA 1BM3L 5I1CL 2XPGA 2XQYG 5D71H 4R96A 4X4XB 2PYFB 4NQUA 3D0VB 1Q9KB 1Q0XH 3HC4L 5KANI 4MA7L 3VE0A 1F2XK 4LQFH 3T0EC 2R0ZL 2XG5A 3MV7E 5CUSL 1ORSA 4LEXL 2QR0A 2H32B 5E4EB 4FQJH 2GK0B 1UEMA 4XCYA 1QSEB 2FJFA 5ETUA 3BFOA 2E7BA 5L7XL 4BH7B 1BD2E 3BP5B 2NY6D 2I07B 4GRMB 4QT5B 3QNZB 1YNLL 1WBYA 1ACYH 4URTB 3S96A 3IGAA 4NC1C 3RZCB 3EOBA 4JFEB 2E7MA 2XWBA 5C09A 5F1IB 1A6ZB 4ODVH 2ZUWA 5HGBA 2P5EA 3O2DL 5F7NC 4XNZC 5DUBA 5IWLA 4KK6C 3ARRA 2B5IB 3X11B 2EDFA 4J8RB 4QOKE 2AJSH 3O41A 2IFGA 4DGYL 5K9OA 3QIBD 3D69B 3KDMB 2WK2A 2PTTA 3RWFA 4NO3A 2X4PB 2YUWA 4Z7QF 3WJLA 2QQNH 3TBYA 4RFNC 3BH9B 2B2XL 2P5WB 4AIZA 1D3CA 3CVHB 3HZKA 4OLEA 3STZA 1MRFH 3QH3A 32C2B 1O7SA 1K9TA 4R0LB 1KF9B 1OAUH 2M8XA 3N1FC 4FG6D 3WS3A 2H6PB 4JZOA 1UM6L 3VFGL 5IUSA 5E00B 4V2BA 1A3RH 3T3MF 5I16A 3O3DA 3DTXB 3GKZA 2LTQB 5IVZA 3B9DA 4KKCC 5DD0H 1KXVC 2VDOL 3M8OL 2HRPH 3K74B 1QO3A 3C8HA 3H3PH 1ZS8B 3NIGE 4OZ4A 4JR9L 4LCCC 4OZIF 3VRJB 1IQWL 1G0YR 2FATL 5CP7A 3TV3L 2JCCF 5D71L 2BY0A 4YGAB 3CSGA 1VFAB 3QDGB 5HHME 2RJMA 1PKQB 1OB1A 1D5MB 5DI8A 4XX1E 5L9DL 4JCMA 5EU6A 4LQFL 4KK6D 1IAOA 5HJ3B 2XQYK 5IW1B 1H3XA 4LCWE 3ARBC 1J1OL 4WUUE 1QLEH 3EFDH 1UM4H 1NUGA 3SCMD 1I8MA 3KYOB 3CFIC 3JTTA 3NACH 5GXBB 1YDPA 4KKLC 2FZ3A 3W5NA 3G5VA 4HV8B 4KJWC 2IBGA 4CW1B 5T3ZD 1U3ZA 4TNVF 2OYPA 2O5ZH 4XHQA 4R9HA 4AT6B 2AKRA 3U4EB 1T2QH 3P9MA 1NGQH 1Y6NR 1KTRL 3MRBB 4OUUB 3C09B 4PJ9C 4OZGA 1CFTB 2P24B 4P23D 2G5BB 2X4SA 1R0AH 1QLRB 4JHBA 4R7DB 4ZQKA 2H26B 4PRBB 4GKNB 3CXHK 3N50A 1MLBB 4FQPA 5F7LB 1U9KA 2QSCL 3FQWA 3QUYB 1T03H 4PP2A 1VA9A 3RVWD 4ZS7L 3VCLB 1I8IB 1NLBL 2EICA 3PIQB 3Q2CA 4FTVA 43C9B 4MCZA 4NZJA 3ARFB 4U0RC 1ZLUH 1G84A 4YPGB 5F97E 2NW2B 1KTKE 4QRSB 2CQVA 3D25B 4H5SA 1DL7L 3UPAA 1BFSA 1OAUL 1JRHI 3BD4A 1JF5A 4WTZA 4TTGA 2O61B 5EOTB 5DWUL 1J1PL 1VENA 4IIQC 2EIDA 1JL8A 1HQ4A 5DD0L 1ES0B 2VDML 5LXGL 1U3HC 3WYRA 2HRPL 1U8PB 1U8JB 1N64L 1WZLA 2YK1L 3FT2A 4MMZC 1OGTA 5E8NA 4KJWD 3ULVD 4H20H 5KAQG 3TT3H 4P2RE 3ARBA 1T89C 1G7IA 1T4KB 3JV0A 4NQEB 4NQXB 3T3PE 3VFPA 3RTQD 5EUKB 2IWGA 4MSWA 4JKKA 1MRCH 1YQVL 4Y4FB 4NBXB 4UNUA 4ZSOB 3UJTH 4HUUB 4MJIE 4JQIL 3HC0A 3FZUC 4XCCH 4M48L 5FYLE 1MVUA 4UU9B 4ZFFA 3H9SB 5J1TC 1LO3L 5DJDB 3ARDA 2FSEA 4OZIA 3IAGC 4YHLH 4OM0H 1HILB 4PJ9A 5FB8B 3HR5B 2EECA 3MRHB 1AGCA 3PJSA 4OD2A 5IB5B 4X7SL 5IJKC 3FFCD 5J4MA 1EIBA 2AERT 3VFVA 3OXSA 4ZUVB 4XP6H 1JNLL 2O5ZL 4MS8D 1XF3A 3NCMA 4I5BA 4POZC 1WSST 1TJIH 3MGOB 3QWQB 1U36A 4UIKH 5F8QC 4ETQA 4ZUUB 2BNQD 5EB9A 3SPVA 5L2KD 3TT1H 1Q9WA 2GW5A 3L5XL 4H26B 3LN5B 4RMSA 2RBLA 2N7AA 3DSFH 1NJ9A 3D18A 1U3HD 3EO9H 5EBWB 4NKIH 3OGOE 1FL6A 4Z6AT 1NFIA 3DYPA 5C09E 3MV7B 3HZYB 3FRPG 4ONOA 5EC2A 4HXBL 4KDTA 5E08L 1RHFA 5J6GA 3FB6A 5A43C 4EI5A 5INCB 5IKCA 1PFCA 2B4CL 2JTDA 1CXFA 4JFOA 1FV1B 4F3FB 3VFWA 5ITBL 4IIQA 4E5XA 1QP1A 1MHHA 5T1DL 1BD2B 2BC4B 1YUHA 1FO0L 1F8TH 1YJDH 4HBCH 2WIIB 3L95A 5AAMA 4RNRA 5HGAA 2L7JA 3IDYC 3HC3H 3GSRA 1I1FB 1T2XA 4WJ5B 4RISH 4TUOB 2DWDB 2VAAB 4ALAL 3RL1B 2J6EA 4F15B 1FGVH 1S3KH 1KC5H 2VDNL 4OGZA 5DMKA 4P4KD 3VFOB 1P7QA 1QBBA 1F11B 3RWEA 1A6TA 1A22B 3ALXA 3O6MH 1N3NA 5DFWH 4XXDB 5F44A 2VLRD 1W72B 4MXVF 3CXHJ 3VA6A 4AIOA 4G8GD 1GC1L 5CP3A 5EOCL 3IETB 1DE4B 2CLRB 2ZG3A 4ZNCD 1MCOL 4XCCL 5AG9A 4KY1H 5GGTH 4KV5F 4DOHE 4YH6A 4OM0L 3T04D 4UNTA 1RVFH 4I3SL 1QRND 1A2YA 2VXUH 3PL6B 4RDQG 1F3JA 3WIHL 1VGEH 5F9AC 1JYNA 1RZJL 5DS8B 5J13B 3RKDC 1C08B 2QSVA 4OV6F 4P2QB 5F1OB 3U1SH 5EU5B 8CGTA 5ESQA 2WINB 2B1AL 3IJSB 4UIKL 4JCLA 3MX0A 5TPWH 4NKMB 5DFVD 5HPMB 4Z7WF 1K2DA 5DDHA 1F97A 5FO8A 4WCYL 2R29H 3DSFL 5HHMB 3W9EA 5D93B 3V7MA 4YIQB 3BKML 3UPRB 3EO9L 3WFEH 1U95B 4NKIL 3W0WD 4MB3A 1IM9A 3I9GH 4OZGE 5EU3B 3OV6A 4PJ7B 4LCWB 1NMCB 4PB0H 4WUUB 3FONB 5LCVH 4G6MH 3GSNB 3RVUD 3KPPA 2VZ3A 1LO0L 4KVNL 3MBXL 1HSAB 5BOPA 4ZPVB 3T65A 4HBCL 1MRDH 1AIFB 2EYTA 1AKJB 5F7YC 3X3GL 1LEGB 3EOTH 4TOYL 3S98A 2P1YA 2OK0L 5HHPB 1P84K 4X6EA 2FGWH 4FTVE 1Q72H 5JW3H 4M6OH 1WTLA 2CO6B 4XAWH 1U8IA 1N6QH 2R4RH 1BBJA 3BO8B 4LARH 4NQSA 4P9HL 4HHAA 4QYOB 4FZEL 4FP8L 1MQKH 4OFKA 5T1LA 3ARYA 4HWBH 2MPAL 2YPVH 1A1OA 2AV7B 3F12B 5EZLA 4QHUB 3TGXA 1OVZA 3UEZA 5F9WC 3QIUD 2DQDL 1SM3H 3QEGH 1FZOA 1HZHL 4ZNEA 4UAOB 2JLLA 5JNYB 2E8YA 4JG0H 3OTTA 4NZTH 4ZO9A 5E1AA 2PXYC 1T7XA 4YHPB 1AGBB 3I2CH 2VXUL 5GISH 5IW6B 1OAQH 1LEKA 5C1MB 3BZ4A 1NBZA 3SGKC 1QR1A 4OCSL 3O3EA 4ETYA 3GGWA 3UAJC 5ANME 4L8BA 3U1SL 1H8NA 5C2UB 3O9WB 4GOSA 2PKDA 4XP9H 1R5IB 3D85B 3PWLB 4P2RB 1RJLA 3VFNA 1Y6MR 3TFKD 2H1PL 2NXZC 3DHJA 3PGFH 5D6CA 5CEZL 1CGSH 1KGCE 2R29L 3EYUL 4FQHA 3O11A 4U1JB 3P0VL 3OKDA 4FXGB 3VFTA 4IRZL 4ODXA 1P2CA 3WFEL 4CVUA 3DVGB 4MJIB 1IBGH 4KXZH 3MV9A 1R3IH 4D3CL 2DQEL 2Z4QB 5SWSA 3AAZA 2OP4H 2VABA 3SGDH 4R96B 3IXTA 2GCYB 5D8JL 1H3WM 4M6MH 3KLAA 2B4CC 2QEJA 4QHKI 1Y18A 3LAFA 3IDJA 1Y6KR 4M62L 5L88L 1J86A 2O93L 2Q86A 1RPQA 5I6XC 2HJKA 2QR0B 5BZWA 1F4WL 1KIRA 4G3YH 3QAZB 4N0RA 3BP4A 1K85A 2FJFB 5HGHA 5ETUB 3SE4C 3BZEA 2PXYD 4QCIA 1LK3L 2CKBH 5CEXA 3OXRA 2O5XH 4LARL 2H9GB 5JZ7C 1BF8A 3C6LC 1MQKL 4OJFH 4JE4B 4GXVH 5HGBB 1PDKA 5JR1L 1MCNA 4ZFGL 2ZOLA 1GC1C 3O4LA 5JHDD 1YMMD 1SM3L 3IVKB 3QEGL 1G7MB 4X7FC 1T7YA 4QXWA 2EDJA 4WEMB 3DX6A 4JY6A 3RWFB 4OZFB 4JG0L 5H2BB 5FECA 5B21A 4HIIA 4QY8A 3TBYB 3I2CL 4OM1L 1NEZG 1I7UB 4XNYH 1CG9B 3N0PB 3STZB 1RZJC 3OKLB 3LEYL 4K23L 5K9JL 4AEHH 4G9DA 5CBEA 4PRAB 5FKPA 7FABH 4XP9L 2Z92A 3P4MB 5EOQL 4JZOB 5HYJA 5E0QA 2OJZH 4L4VA 1R6VA 1MHCB 2AV1A 4FFWC 4G43B 5ISZA 2BJMH 4NKDB 3U36B 5JMRA 1F6AA 1GGTA 1K8DA 4JPVL 5HD8D 4LSTH 4E42A 3QIWB 1DQTA 1F4HA 4XAKE 3QEUA 2AJVH 1R3IL 1HHGB 1J12A 5GIRA 3OGCB 5CP7B 1H3UA 4PRHA 3C6LD 3VRIA 2Z31D 3MRMA 3SE4A 4LK4A 3EJYD 3MRJA 1HH9B 2IH1B 5IESL 1CF8L 1EGJH 1LD9A 1FFQA 1E4WL 5BXFB 5CLTA 1QHOA 1TVBA 4G3YL 1KV3A 1ZT4A 1QG3A 2Z8VC 1PSKH 2HA1A 4OLWH 3UJIL 4CNIB 1KCSH 4MXWH 1UB6A 3DROA 4P9HC 4YQXH 3KGRA 4U1GC 3WUWB 1QOKA 5T3XH 1PGRB 4PR5A 4XC1L 4OJFL 4L8CA 1CVRA 4OZGB 2Q7YB 3LV3A 25C8L 1AC6A 3IKCA 4Y19D 4LFHD 4RMWA 3WIHA 5HYEA 3QQ3B 1C12B 1S5IL 3R1GH 5JXEA 4A2MA 1T3FB 5EIIA 5T5FH 3QJHA 4MNHA 4PJXF 2X1PA 3V6OE 4JY5L 5F93C 1BQHB 2XV6B 4BZ1L 2JJSC 4PP2B 2HFTA 3NCCB 4J1UA 3P77A 5E9DE 4KHTH 4XNYL 2GJ6B 4MCZB 1XGTB 3I6LE 1BGXL 2WWMC 4ZNEE 5I66A 4WI8A 5EFIA 2DJSA 2HH0H 4O2CA 1SEQL 1QR4A 2WP3T 4Y1AA 4LLAA 1BQSA 1MREH 3OKNA 3ZHKA 4GRLC 3KPTA 5D2NC 4I4WB 5IVXA 4MXVE 1BIIA 1HQ4B 2V17L 3BWAA 1GGUA 4X7TB 4N8VA 1R3LB 3LCYA 5TDNB 3FT2B 3OJMB 5E8NB 2EDLA 4X4MA 1WCBB 2XN9D 4C55A 5KN5B 2FYYB 1G7IB 4Z7VF 2EH7H 3MRQB 4LCYB 4M61B 4QRTB 2NY2C 3MV8D 4WFEE 2XZAL 3MOBH 1EGJL 2DMBA 1A5FH 1BREA 4CDGC 3MV9E 3F62A 3B43A 4GS7C 5ANMB 5SWSE 1KUMA 4QRRB 2W9LA 2CIKA 3LQZA 3PHQA 1JPSH 2M1KA 3NZ8A 3SQBA 1QQDA 1SJHB 3PJSB 4OD2B 4Y4KA 3C5ZA 5E5MB 3UTSD 1VHPA 3KXFB 1DP0A 2WWMD 4I5BB 4PY7A 4PGEA 4G6AC 4JPKL 4GKSA 5T33H 3MLWH 1GOGA 1Q9WB 3AREC 5FKAA 1B88A 4PJEB 5IEHB 4GRLD 4PBVC 2Y06H 5J8OA 1GYAA 5IHUH 2DRUA 1G7JA 1DDHB 1NJ9B 2VXQH 3LZFL 2EDXA 3V6ZA 4P9MH 1FL6B 1NFIB 2Y6SD 3CK0H 3E1F1 4I77L 3SO3C 3FB6B 4EN3B 5IKCB 2YD9A 3LEXB 4LLVB 3JBG7 3RVXD 3O4LE 3BUTA 2IBZY 5DT1H 3O2WL 1KENH 1MHHB 3FB8A 1RUMH 1RZIB 1HOCB 4AL8H 1KJMB 2NY2D 2R0LL 2FEEL 2HH0L 3IDIA 3CFCH 3L95B 1LP9F 5DMGC 1IC5L 1ZLVK 4RNRB 4YX2H 4KKNA 1OT2A 1CN4A 4NM8H 3GSRB 3QWOB 1U8LA 3CFEA 4DVBB 1T2JA 4M6NL 3EDDA 5MI0B 5A2IH 2WBKA 3BYYA 1BVZA 4BYHA 1T6WA 2Y5TA 4R4FL 5ELIA 5DMKB 1J0ZA 3T4YA 5IV2A 3VXTA 1NGWA 5CD5C 2V5YA 3SDDC 1OTUC 5ICZB 3MA7B 4L4VE 4NQCA 4PJAF 2ZSWA 4MD4A 1N3NB 2DYPA 3HUJF 1VACB 3AM8A 5ISZE 1GHFL 1VB9A 2W07A 1ZVYA 5JQ6L 4G6AD 4M7LT 1JZ2A 3BVNB 2EH7L 1JWUA 1QA9B 2CLZB 5ERWA 5F7FA 2YD8A 1QSFE 5J3HC 3S5LA 1MY7A 2ZG2A 3VD4A 3GMPA 1MFBH 1FYTA 1IAKB 2HT3C 2R0WH 1G7HA 2DJUA 1JPSL 1MCIA 5BQ7A 3TNMA 3KYKH 3L3GA 2AI0H 3TBVB 1A2YB 2IALB 5F7DB 3V4UL 1C5DA 4EUPG 1WBXB 5ESQB 2ZOKA 4R4BA 3ZKND 1FZJB 5IGXH 3IDXH 5DD6B 3U6RA 3H9HA 1CICC 3GMRA 5ID0A 3MLWL 3GJFH 4Q9BA 5C0AA 3PDOA 1NFDF 4LHUA 1OAXL 4WHYH 3SKJH 5HSFA 5FO8B 2EZ0D 1NGPL 1MFDL 2GY7B 4U1IA 4HS3B 4KUZH 1O0VA 2DLFH 4TN9A 5ITFA 3ZDZE 1NBYA 5T3ZH 2BVPA 1U8OA 5L2JA 3BWUC 3QRGH 3KJ6H 2ZUSA 3ZKSD 2FX7H 3CK0L 3JTSB 2HFGH 2RR3A 3T77A 1N26A 3TPKA 5KVFH 3LQMA 3HTLX 4JFDA 4ZOBA 3S37X 1LNUB 3P2TA 1KENL 3SY0B 3F7YA 3NN8B 4WTXA 3IFLH 4AL8L 3T65B 2ICEA 5J3HD 4PB9H 3W11C 2X4OA 3CFCL 3PWNA 4D0CA 4XBGB 3SDDA 2EC9T 4AENB 3U2SA 1FHGA 4NM8L 1OGAE 4X6DF 5CZVH 2HT3D 1A21A 5EBLB 5F70A 3MJGX 4X0KB 5D72H 5HI3C 2Z93A 3U46B 3CFJA 3ZDXF 4MA1B 2QQKL 2FO4B 3MZGB 4FQCH 4Y88A 4PJDF 5J6HA 3MYJB 4Y1AE 3U30C 2XTJB 2X7LA 5E5RB 1B0GA 2ARJB 1NCWL 1CXLA 5DYOA 1MCDA 5IVXE 2P7TA 4ZUWB 4HKBA 4PJGF 1CICD 4HUXA 3CGTA 4FFVC 1ZA3A 3SDCC 2A6JA 2GJZB 5E9DB 3WEXA 4FN0A 4NCC1 5J7CC 2CKBA 2DWEB 1FZOB 5DJ2A 5MHSD 4Z7UF 3LB6D 3ES6A 1U6AH 1MJUH 1M7XA 4JFFA 4TSAL 1ZLWK 3ULVH 2YZ1A 5FO7A 2X4NA 3C5JB 4PJAA 2ITCB 3TA3A 2I9TA 3BZ4B 1NBZB 5DC9B 1QR1B 2XWJA 3VMNA 3CSYA 5B3JE 4NSKA 3LEVH 3BUYB 3O3EB 2X40A 5INDA 2VUYA 4OI7A 4YBLC 4M1CC 4S0TD 5IGXL 3LD8B 4PG9A 5D96B 2DKUA 3MBEC 1FZKA 3P4LA 3TO4C 4YFLI 3MO1A 4YHKH 3W11D 3RWGA 4MX7A 3EHBC 5J89A 1FAIH 3VFNB 1RIVL 5KAQF 1B6DA 3HPLA 1I9RH 2XA8H 4XNXH 4BZ2L 1ZEAL 2OL3B 5DJ0A 1EBAA 3Q6FA 3OKDB 3VFTB 5A2FA 1P2CB 1CFNA 5TF0A 2VERN 3GBNH 2X9WA 3S7GA 4M5YL 3SBWC 5SWSB 3PWPA 3AAZB 4HJ0D 4HGKC 1RUPH 2YD5A 2FL5B 3TIEA 4Z76A 3RX7A 1QVOA 1Y18B 1NFDA 3AVEA 4FFVD 3QR2A 1RURH 4AEIH 4PB9L 4BFBD 2HJKB 4NO0A 3FT4A 1ACZA 2AXFA 3L5HA 3CFBA 1O5DT 3VXSA 2NPLX 2NY0D 2DM2A 2VZTA 5D72L 2R56L 1EA9C 4QCIB 4F57H 1FIGH 3PUCA 5F9JB 3MXWL 2E6PA 4LSRH 4FQCL 3IAPA 1QYGL 5KZCD 5EDXA 3GI9L 4J23A 2FR4A 1Q94A 4JJHA 1EGJA 3BE1H 1KEGL 2VZVA 4PRIA 3WV0A 4PGDA 1P5VA 1HXMB 3QDJB 4ZDHB 2Y07H 3TO4D 2G2RB 1WF5A 5SX4I 3VDCA 4N5UA 2BSSA 2EDNA 1DBJH 4MB4A 3O4LB 4DUWA 5FFLA 2VDKH 2NX5D 1KCVH 4NQCE 4GG6F 1K6QH 3DX6B 4JY6B 4RFEA 5CSZB 2ADGA 2FBOJ 3RX5A 1H5BB 1I1AA 5EUOF 4F7PB 3OZ9H 1EZVX 1IKFH 1C5BL 2D03H 4OLVL 3CSBA 5T1KB 4PJGA 3QCTL 3FN0H 5F96L 4OIBA 3UJJH 4AYFA 2NLJA 1R3JB 4G9DB 1UZ8A 1JWMA 3E8UL 1MCCA 2NCMA 1T1ZA 5FKPB 2V5RA 2VITB 4CKVX 5DO2D 1FAIL 1IZJA 1XCQB 4L9LA 1BX2A 5C3LD 1FNGB 2AS5M 1CE1L 5ISZB 1H3PL 3C5SB 4XNXL 5FUCE 1ZGLP 4NQDB 4DAGH 1BWWA 4TQEL 1QSFB 1K3ZA 5E95B 3QEQD 3MJ8B 1QFUH 1I7ZA 2Y23A 3RAJL 1PYWB 5HYIA 5GIRB 5C0AE 1RUPL 1N0XL 5C9JB 3AS0A 2VLMD 4M93C 1F2QA 3VRIB 4F7CA 2MHAB 1QD0A 4AG4L 1MHEB 5BJTB 2ADJB 3INUL 4S1QL 4F58H 3RNKA 1CWVA 1BHGA 1PLGH 3DXAD 1MWAH 4Q9CA 1CFSB 1F4XH 4N9GA 1BVLA 2PW2A 1TVBB 4JY4B 4YHYB 2PYEA 1ZT4B 5C0NC 2FWOA 2OMBA 4JFDE 3GIVA 4K71C 1OPGL 4BFEA 3W2DH 3FO9A 4F57L 3G5XA 2D7TL 5CAYB 1NGYA 1R3HA 1J1XH 4A6YH 1YEKH 1CL7I 5HGDA 4MA8L 1SBSL 1K5NA 3DX7B 4PR5B 4P46B 4NYLA 2D9CA 2Y07L 1AQKH 2XZCH 3BPNC 4DEPC 2IPUG 3U4BL 1T7ZA 3LV3B 5I1DA 3D3VE 1F13A 1A7RH 3BI9X 2BRRH 1A7NH 5SX5K 1JNJA 3HNVH 4JRXA 3RWCA 3V8CA 4DZBA 2VDKL 4MNHB 4QNPF 1K6QL 5I19H 3NPSB 1SJXA 1P1ZA 3LY6A 5LGJA 1RMFH 4JREB 1ZHKA 5FYKU 1OGAB 3BDYH 3FRPA 1RJZA 1INQA 1MIEH 3DO7A 4FFZL 1ETZA 2ADIA 3UJJL 5ACZB 4HH9A 3MRLA 2HTLC 4U7KA 1G0XA 5FYKD 1RU9L 4JFFE 4O2CB 1QSVA 4NHCL 4ODHL 1NCTA 4K3HA 4GG6A 4PJAE 3EYVA 2HVJB 3MOQA 3L3IB 5EUOA 1TENA 5IVXB 1N5YL 3A6OA 5C0ND 4LPWA 4ENEC 4ERSH 4DAGL 3MR9A 4XRCB 1EJOL 2PCPB 1TJGL 1Z0MA 4U6YB 1QFUL 1QFWL 5BS0D 3UBXI 3BSZH 2FIKB 3VXUD 2X41A 2BHYA 1TVDA 2CR3A 5HGGS 4LDLB 1SEBA 4G8EA 3KLDA 4KDWA 3TVMD 1YYLL 3T8XB 1PLGL 4YHNA 1QZ1A 3E2HB 1ZT1B 3C6SA 3PWPE 1X5KA 1YMHA 3D1MC 1AO7D 1SJVA 3DX8B 1SBBA 3LQZB 4CBPA 4KMTL 1NFDE 1GGBL 2ARWA 2CK0H 3W2DL 5IQ9A 1IJ9A 3ZT5A 3C5ZB 1WIOA 1UH3A 2CMRH 4AIXA 3P11H 5FHBH 5CEYB 1F00I 4UI2A 1J1XL 3HLAB 1YEKL 3MPCA 2V6HA 2EE2A 2MWCA 1S7QB 1FVEB 4OCYL 4PY7B 4PGEB 5FGBC 3VXSE 4YHML 4HF5L 2ZCHL 5FKAB 4IOSD 2V2WA 5DJZA 5IP4A 4V1DD 1A7RL 4CMMA 1LWRA 4I0PC 5EO1B 4GKZA 1C8PA 1RK0A 4NQVA 4YDLC 3QO1A 4MNGA 4PRIE 1KJ2L 1U91A 4K07A 2YBRB 4JFXA 4RGMC 5I19L 2IPUK 2NNAA 1E0OB 1YECH 4KKAD 3RZWA 2CIIA 1AD0B 1MOEA 3FQNB 4JB9H 4CRPA 3GJFA 4N8PA 2PO6D 4XCEA 1S9WB 4Y2DA 2EDDA 4KTYA 2NY1D 4GRWH 2YXMA 3SOBL 2BVUA 3V7AE 3NCYS 5T3XE 3LMJL 1CCZA 2EDYA 2VR9A 3HKFA 2Z8WC 4YWGL 4OFYA 1CZ8L 1TZHA 4PJGE 2R2CA 2YXFA 3CFEB 3BZFA 3MJ7B 4OAWA 4WI6A 3LIZH 3TZVB 1JHTA 4ERSL 5FDYA 3MUHL 4P23A 1ZLWH 1I85A 3UXFA 1CXHA 2VWEE 5I74B 4OCWH 2FX8H 4WIQA 4YZFF 4LRNL 4AQ1B 1EO8L 4MB5A 1S9YA 3DI2B 5DEFB 5LQBL 2DYPB 1AD9A 5DVMA 4UT9L 3SDXB 4NZRL 5DQ9A 1FRGH 1YN7B 5ERWB 1U41A 4EBQL 5I75B 5AZEH 4ODSL 4LVHC 2ITDA 5HY9B 3BIKA 1KB9J 5JW4R 1KIQB 2W0LA 2NY3D 1YEJL 2LVEA 5L0QC 3I6GB 3TNMB 5BQ7B 2GI7A 1BBDL 1INDL 5FK9B 4I0PA 4M3JA 4WFHD 4LPUA 3X3FH 1XEDA 2BOCB 3NFNA 4QF1B 5LAXA 4NO5A 2XNAA 3RWHB 2ZPKL 4LIQH 2PYEE 1RHHA 4NJ9L 3U6RB 3UO1L 3PNWA 5H35B 4S1SL 1Z9LA 3RDTB 5ID0B 3LKRA 1CFBA 2EH8L 5C0AB 3PDOB 1JYVA 4H8WH 2VZ1A 4X7CC 4Y5XB 1GRWA 4U1IB 1CLZL 3OKYA 3PGCB 4U4BA 2VC2H 1JI2A 4MD0A 5ITFB 1F3DJ 1NBYB 1AGDB 5L2JB 1KEMH 5F89B 2YPLD 1T5WB 2I60H 1YECL 1TTFA 1MFEH 3OPZH 5CGTA 3GMOB 2F5BH 3RA7H 3JXAA 3MCLL 4JFDB 1D9KB 5HVWA 4JRXE 5L6YH 3PQYD 3MNZA 3EOAA 4H88L 5C6PB 2ICEB 3TLRA 2X4OB 3PWNB 3FFCA 2EEDA 4KRPB 2Q8BL 1I3RA 1ND0B 2MSPA 4GMSH 3MNWB 4ZXBB 2DIJA 1UCBH 5E94A 5GGVH 3U2SB 3C60B 4IS6A 4EI6A 5ICYA 1PZ5A 4FQXD 1HYSD 4NRYA 2BNQA 3CFJB 3D3VB 1SQ2N 2MJWA 4HK3J 2X4UA 2R9HD 4Z8FH 4OCWL 4Z5RB 4ORGA 2VN7A 1FFOA 3GNML 4PJCF 1TCRB 1BAFH 1FFPB 5JPMA 3SE3A 5I1KL 3VD5A 5KS9A 2UYLA 2HJFB 4D0DA 4HKBB 3NGBC 3OBAA 3L3JA 4NHUA 5C8JA 1VDGA 4PLJC 1RULH 2P8MA 3WSQH 4C56A 1IL1A 3UTZB 4ZAKC 5F7UA 1NC2D 1G9NL 1SJEB 3H42L 4HUWB 3HB3D 2WUBL 1B0RA 4JO4L 5I1IH 3DMMD 4JKPH 4JFFB 3MLVH 1CVSC 4JFHD 1AR1D 5I18H 1DEEA 2IAMD 3MACL 3CSYB 4UMGA 1KB5B 2V2XA 5I8OL 4HDIB 1YEGH 5GRWA 4PG9B 1KJ3H 2BNRA 1H9VA 4HIJA 1YEHH 2OLDA 2DAVA 4BJLA 5AD0B 2DQIH 5IMKB 3CX5J 4P4KA 1S5HA 1DFBL 5GGUA 1C7SA 4WU5B 2AK1H 2EYRA 4H8WL 2ZJSL 1LDPL 4APQB 2CSPA 3Q5TA 2VLRA 2VC2L 3NABH 3WFHA 4Z7OE 1CK0L 2NXYB 3AB0C 1DBKH 2BY1A 4PFEA 4YDVB 1KACB 2UWEF 4HAGA 3PWPB 2I60L 1I7TA 2F54A 4K3GA 1XGRB 4HMDA 3QZWB 5DD1H 2XIDA 2ICCA 2DQCL 3O0RH 4Z76B 1KG0B 5GGQH 4LCIH 5GRJH 4K8RH 2ZUQB 4MNGE 5IFAH 1QRNA 1NSNH 1RZ8B 1U8HA 4S1DC 1FJ1A 1GZQA 4WO4C 1ZOXA 1E4XL 2DKMA 4NO0B 3STLA 3FT4B 5C0DB 1I8LA 1URLA 2R1YB 3MNVB 5SX5H 4WNQB 4HAFA 4Y2OA 4JFYB 1TXKA 1U42A 3GSOB 4JLRA 4ZTPL 15C8L 5E8EA 3DUHA 2ZUYA 4IRSD 1Q94B 4OZHA 3TJHD 2W38A 4U2YA 5T3ZE 4QNPE 4G6FB 4PRIB 4PGDB 5EORL 1MWAA 4B0MM 2JIXD 4XPFL 2V2TA 3W0WA 4YO0A 3V6BR 3IT8D 3K2UH 3F5WA 1YC7A 4POUB 2BSSB 1CIUA 1NKRA 5F8RC 4QHLA 4XP4L 1M6OA 3VI4E 4MLIA 1X4XA 3K46A 3PGDB 4XBEL 4A6YA 3LH2L 3GMNB 5I1IL 4UQ2A 1CD0A 3CIQA 4JKPL 2CLVA 3OJDA 4R6UA 5KVEL 3IRZA 1KBGL 4MAYB 5IF0B 1TQCC 2R15A 3O6LH 5DD5L 1UJTA 3JV6A 5GJTH 1F3DH 2RB8A 4GRWF 3MYZA 2VYRE 1KJ3L 1JE6A 5J11C 4QRQB 4HFWA 1JTTA 3O45A 5FO9B 1U2CA 5F9DC 3DO3A 1BX2B 1OT1A 4R3SB 3U0PA 3PXHA 1KULA 2A6KA 2GQHA 1NLDL 3UZVB 3O3AA 4WW2F 1DBKL 4WWKC 3VMPA 4WO4A 3ULVE 1MH5B 4P59H 3MRCB 2NY4C 1KPVA 1U8KB 3RUGB 5CJOL 1B2WH 1LEIB 4NGHH 3AFLA 4S0SD 3JV4A 3O0RL 3WFDH 2VDRH 5GRJL 4K8RL 2XYCA 3LHPH 5K33A 3AY4A 4PGJA 1GXEA 1WISA 1HI6A 1M05A 1R5VA 1BVLB 2PW2B 2R2HB 5B39B 4JGJA 2J3SA 2J5LB 3KPSD 2FWOB 3G6JF 3VGAC 3B9KC 5CJQH 3GIVB 1WC7A 3KYAA 3E3QE 3G5XB 1DZBA 4XPAL 4OIAA 3WN5B 3OR7A 3MCKA 3FFCE 3O8XC 4RWYH 2F8XC 5HGDB 2EDQA 1PY4A 4WW2C 1P7KB 4KHXL 1IMHC 5IOPA 4HW6A 4RAUB 1FNLA 3VWJA 2BNQE 1VKXB 3VFUB 4G9FD 3LKPB 4HGMA 1ED3A 2ED9A 4JZNB 3RWCB 4XNQA 3G5YB 4G42A 5F1NB 5TH2A 1JF1A 3F6LA 1G9NC 1TETL 2IF7A 3M45A 2MFNA 2Y25A 5KS9E 2F5AH 5I1GL 4TVPD 3GI8H 4OCLC 4AH2A 1JHKL 5JPNB 4W6YB 5KSBF 5LGJB 4ZYKB 4C56E 2EXYC 1ADQL 3VGDA 1KTLA 5JOFB 2NY4D 3QI9A 5KTEL 3GMMB 3N9GH 1RJZB 1INQB 2SEBA 4L8SB 3DO7B 4PJBB 5AEAA 2ADIB 3V9FA 4W6XB 4H0IA 4PTUA 1KELH 5DK0A 4XGZB 2NY6B 3LQAH 3KLHD 2OR9H 4WU7A 4D94A 4YZFE 3ZDYF 5GSRA 4WWKA 4LU5H 2N1KA 4WV1C 4UQ3A 3MLSH 4AEEA 4DCQA 5C0IA 4MNQA 1HQRB 2N4IA 3DX9B 4LDOB 4ODUB 4P3DB 4M3KB 3UYOD 1JPFA 2N7BA 1XR8B 3CVIL 5E2WH 3FQXB 3VDAA 2Y9RT 2BNRE 3VXNA 5IROC 3HI1A 4E41A 3HMWL 4P59L 4XB7A 3QIBB 5E2JA 4LKCB 3BX7C 4YFLF 2VLRE 1IC7H 1X5FA 4G8GE 1UGNA 1U0QA 3WIFA 4X5WA 4NUJA 3O8XA 4FXLA 4OBRA 2F54E 4WW2A 1RZKH 1WIUA 4OGYL 3K0WA 1FDLH 4OF8A 4OTXL 4P99A 3B2UC 4HKJA 4YNYB 5EU7C 4ZO6A 2C3VA 3CLEL 2HVKA 2CK2A 1I9JH 1IGMH 1QRNE 1I8KA 2EXYD 1H15B 2EC8A 1IGFH 3TBSA 3GKWL 2DQUL 1BFVL 4HUMB 3S8WA 2EDKA 1L7TH 4YAQA 1M71B 5DJZB 3VG9C 5ID1B 1VEOA 4KI5F 2B0SH 3SKMA 1BIHA 1KTDA 5HI5C 4OZHE 4W68A 3BESR 2XI9A 1DQLL 3QO1B 1U91B 4JZJA 3DURA 4JFXB 3W0WE 2F5AL 4MQ7A 2NNAB 1JGLL 4OLZL 3X13B 5J12C 1TVHB 2CIIB 2ZG1A 4GUPA 1JGDB 3MUGB 3QQ9C 3GJFB 4XCEB 3OKMA 3H9YA 1DBAL 1KXTB 4GFTB 3SCMB 5ECJE 3I6KA 3RX8A 4NWTL 1KELL 4FHBD 1JRHH 2AJZB 4OLYL 3RRQA 1S7RB 3ZT7A 1XIWC 4R90H 4ZFOL 3WO4B 4PJ8C 3HE6C 3NA9H 5IROA 5L8JB 2D4DA 3MLSL 3S88L 2HLFC 3C08H 4MLSA 4KI5C 4KJPC 3QPXH 4P23B 5C0CA 5F7EH 4EVNA 3DRQA 1NL0L 4X9FA 3MLTA 5CILL 5KW9L 4K3JL 3VGHA 5DHXB 2HYMA 1S9YB 3HI5L 1CD1B 4DGIH 4MWFB 4LLDB 2X5PA 4LCCB 5AWNL 2ITDB 4K8RC 4N0CC 5HTSA 5D5MF 5DZLA 3H2WA 1F4YH 4NDMA 4MJ6A 1RZKL 4R2GD 1CGTA 3Q3GB 5E6YA 1R5WA 4P2OD 2X4TA 2B7DT 5GRUH 5DSCB 4RGNC 3A6BL 3B5GA 3L5IA 2V5MA 4L3EA 3GB7B 4WI4A 5JDSA 3K7UA 3QQ9D 5LAXB 1IGFL 1HNFA 2XNAB 5LJYH 2FHFA 1AJ7L 1UXSA 1X5XA 4ZTOH 1MCFA 3KPRA 4RIRB 4UTAH 1CGWA 2L7UA 1J8HD 3NOIA 4OFDA 4P3CL 4X6BB 4PJIB 3A0OA 2XN9A 3GSXA 5D1ZC 1A6WH 2HKHL 3RTQB 4KJPD 1Q8MA 4O2FB 4XX1G 5DEGB 5CJ5A 3B4NA 3V4PH 3LPGA 1ZGLM 4IJ3B 4YGVA 2HRLA 3QUMH 4YE4L 3QUXC 3HE6A 1BFOA 3ISWA 1LO5A 3S4SB 2Q87A 1JHLH 3CZFA 2UZXB 1JMZA 2BNUA 4TTDD 2WW8A 4O51A 1DQDH 2ZUTA 3FQRA 3FFCB 4R90L 1S7TB 2BVQA 4K94H 4FFYL 4U0RB 4JRYA 5ADOH 1A6UH 5HYSA 5E94B 4X4YA 3D39D 2BSTA 4IS6B 3C08L 4PGZA 5I73B 4FQLL 4NRYB 2BNQB 5L2KB 3THMH 2BY3A 1HYRC 2HJLA 2IPTH 3HZVA 2X4UB 3ARVA 3L6FA 3BKYH 2J8UB 4OLXH 1V7ML 2ZKHH 4L4JA 5FYKH 2YUXA 4MNQE 3GHBH 1U3HB 5KS9B 4IRJC 4D0DB 1ZWIB 5C8JB 4KFZC 3ORJA 1Z3GH 2VE6B 4PGBB 3SKNA 5D1ZD 4GRWE 3RJDA 1YMME 4E41E 1JZ5A 2VDLL 4K9EL 5GGVY 1WEJH 4BH8A 4HBQA 1P6AB 3MCG1 3GSWA 1DEEB 4TSBL 2FB4L 1OARL 4K7PY 4Y7MA 1OY3B 3IDMA 4H1LH 5I71B 6CGTA 1YPZF 4ZTOL 5D5MA 5DD3H 4ZD3L 4HIJB 5GJSL 5IG7B 3QUZC 4P4KB 1BEYH 4HPOL 2VTFA 1MQ8A 1H0DA 1ADQA 5LKNA 3PWJA 2VLRB 1MF2H 3R06A 5C2BH 5DR5H 1CDHA 2Q8AH 1QBLH 4G8GB 5D7IA 3IU3A 5D70H 2CDGA 4XPHH 5KJRH 3ZKXB 1JNNH 5HHOA 1WBZA 3WO3B 2QQQA 2E7LA 4IMLA 2H32H 2DLHA 2X1QA 1GIGH 4DZ8A 3E0GA 1Q9LA 2A1WH 1QRNB 5HHVH 1WVZA 4ELMF 1FJ1B 1D5XA 4I2XE 4LIQE 1GZQB 5TDPB 4ONFL 3BJ91 3CMOH 1YYML 4K94L 3STLB 1NBVH 1AXTH 3OAYK 3HAEB 4XWGH 12E8H 1DEDA 3WHXA 3ULUD 3RWIA 1EHLL 1FCCA 3BP7B 3WFBH 1CTNA 3I85A 2W0FB 4X6FA 1QEWA 4JLRB 5DRZA 3ARGC 4NKQB 1EEUA 1DVFC 1HKLL 4PRDB 3U79A 5IB1A 4OZHB 4OGAC 1DTUA 4PLKD 1EAJA 4OI9A 1MWAB 1A4JB 3WNPA 3GUTB 2MNUA 3W0WB 1KLFA 2RIKA 1FFNA 4YO0B 2A83A 4U1HA 4UOW0 5K9KA 5C0CE 1Z3GL 4JO2H 2YS4A 4QHLB 1BZ9A 3R4DA 4Y19E 2J12B 2IFFH 3CVHH 3D0LB 1NC4A 4Q58C 3BYTA 5F71A 2WBJA 3ZDYE 4GO6B 4UQ2B 3O6FD 2H2SD 4J3XA 3B2VL 4J3SA 1RZKC 2D3VA 5JIKA 1FG2B 4EKXA 2A9NL 3MRGA 3Q1SL 2IADB 3OKEA 4NRZA 1LMKA 4KTEL 4LBEA 4QXUH 3GMQB 1W2KT 3JV6B 4G6KL 5D1XD 4XPBL 3O2VH 3I02B 2UY6A 2F53D 3HE7D 4Z95H 4HFWB 4UINH 4Y16D 4LRIC 1IARB 1WQVT 2IH3B 3JWDH 5J9PA 1F45A 4L3EE 5GPRA 2VNCA 3ZTJG 4D0BA 3U0PB 5I8EA 1MFNA 4O4YL 5BV7L 4H0HB 1WT5A 3HHRB 3J7HA 2A77H 5C2BL 4NFDA 2K9UA 1QBLL 4P4RB 2ORBH 1E4KA 3KPRE 3LN9A 3ARGD 3QIUB 5C6TH 3GK8L 4XPHL 2OZ4L 2R23A 4OGAD 4ZFOA 1JNNL 4LPTA 3VJ6A 5GGRA 2OJEB 3NCBB 4OF0A 3DETD 2XN9E 2P44B 3V52L 1L0XA 1FORL 5IBLD 3KPMA 3WFCL 1KN2H 2Y5EA 3KR3L 3U9UA 4ZO8A 1NBQA 2A1WL 5EC1A 1QKZH 1DVFA 1ORQA 3MV8E 4G8IB 2VR5A 3FQUB 2NTSP 1HI6B 3TPUB 3CMOL 4KJQC 1LE9B 1NBVL 5D2LB 4PBXA 1T80A 4XWGL 2LV4A 4WY7H 3HMXH 2EDBA 2W92A 3WFBL 4PJ5D 5LWYH 1CDBA 3MFFA 3DRTA 3MCKB 4JDVA 2IGFH 1OSPH 4Y4HC 2OX5A 5MEOA 3LPWA 1YEEH 5E6ID 4Z7WB 5IOPB 3DVNA 5DC4B 1ZHNA 4Z0BL 4LSSL 3QFJD 4A2LA 4I48B 1ED3B 1H3VA 2FCBA 2A73B 2B39A 4JO2L 1QFPA 2Z35A 1JPST 1X5AA 1E27B 4XNQB 4G42B 2JJTC 3FO2A 3CVHL 5TH2B 1JF1B 3BGFC 1A6VH 4K9EC 3V5KB 2JB6A 3QXAA 4D9RD 5BVPL 3S34L 1AI1H 4F8TA 2JB5H 4Y5YB 2ESVD 2SEBB 4R8WH 4JM2F 3JWOH 4QWWD 4ELKB 5IHBA 2PXYB 4KKBD 2A0LD 4UT6H 5CKAA 2AW2A 2ATPB 5IT2L 2GT9B 4WTZG 4X6CA 1JWSB 5C0IB 4DCQB 4KJQD 1GPOH 4XHJD 2XZQH 4UUJA 3WJJA 2A77L 1RY7B 4NWUL 5D5ME 2ORBL 5CD3A 2VDQL 2DMCA 4J3WA 5JHDB 3H6JA 1YMMB 1ZANL 4AM0B 4Y4HD 2OTUA 4K7FA 1AFVH 3VW3H 4XZUA 3DYMA 3T2PA 2G5RA 2OR7A 5A2KH 5GS0L 5LGHH 5FUOH 2P8LB 3U9PH 5D7IE 4JM2C 5C71A 1MAML 4KAQL 4ZS6C 2ICWB 2J1KA 2NMSA 1ODAA 2APXA 2HWZL 4XNUH 5F6HJ 4FQ1L 4HKJB 5D7JC 4YDIL 3QUKA 1FO0B 3V0AC 1OD7A 4GQ9L 3TO2B 5A2JH 5LWYL 1I8KB 1A4KA 1ZHLA 3RVTD 1UJ3C 2WP3O 3GHEH 4HWEL 3TBSB 1LQSR 1JGEA 5DJXA 5MEND 6FABH 1RZGA 3GSVA 4OCRH 2YKLL 3QEQA 5KVDH 4YAQB 2OXHA 3TBTB 3V6FA 3VFMB 3S35L 1GGCL 3AS3A 3D2UD 3C6LB 3SKMB 1T1YA 1C7TA 4B7IA 1RUKL 2EKSA 1C16A 1L6ZA 1NQBA 2Z31B 4JFQA 5IFJB 5ESVB 5K9QG 4JZJB 2DLIA 4KPHL 4JN1L 3QXDB 4M7JH 4ODTL 1TIUA 3ROLA 5E99H 1BECA 1GJIA 4I2XB 1ZXQA 3RVVC 4QXGH 1PVHA 2X89A 4GUPB 4ZOAA 3QRFM 2G60H 4IDLA 3JVGA 3I6KB 5KSUA 5H94A 9CGTA 5DHVH 2A74B 5K9QI 2DLTA 4UT6L 1BF2A 3ZL4L 3U48A 3FOLA 3G6DL 1I3GL 4OKVB 5ESAA 3CFDA 3BEWB 1JPGB 2UUDH 3WHE0 3QUMA 1XGPB 3KYNA 5CMAB 2VZOA 5K59E 2IAND 3FCTB 3UTTD 5BV7C 3SE8H 4FQQA 4EVNB 3SHSA 1F02I 2DJ4A 4N5EC 4JM2A 4Y19B 4Q0XH 3F7PC 3TCLA 4NUGH 2WZPD 4DTGL 1AHWA 5IHZB 4HUKB 3VW3L 4Q9QH 5DZOA 1UB5B 5E4EC 1S7XB 2DTSA 4DKEH 5TE6L 5LG1A 4WFFE 5CINL 2DIAA 4TRPH 3VFRA 2GFBB 1YY9D 4ZOEA 4NDMB 4QKXB 1GZPA 2R1XA 3IFPA 3MGTA 1T21A 4RMTA 2LFGA 3RZCC 2CUIA 4XNUL 3VI3E 3I3DA 2DQTL 3L7EA 5BVJA 3RVVD 3QDMD 5TJWK 1HH6A 2I25N 5C07D 6FABL 2B5IC 2AQ1A 1I1YB 2E27H 4EOWL 3BHBA 3GIZH 2VLJD 1FVDA 1QLFB 4MDJB 1TFHA 2MKWA 2XN9B 3REVA 1G7PB 3T0DA 3GSNH 3OAYH 3NAAH 1K4CA 5JIPA 3TVMA 1LO2H 5GHWH 2BHZA 2QADD 1WCQA 1X5GA 2Z0BA 3MV8B 4H1LA 1UH2A 3MLUL 4L4TD 4YGVB 1ZVSB 3FMGL 4N5ED 1BFOB 4R0LC 4X9BA 2ILLA 4QXGL 1DSFH 4Z78A 3IF1A 3PG2A 5MP6H 4JPWH 1MCEA 5FOBB 2G60L 5AYQA 3S97C 4O51B 5EIQA 4X4XA 2LTQC 1QBMH 2PYFA 2JJVA 3D0VA 3BQUD 2XACC 3UTSB 2IG2H 2WSKA 2BVQB 2R8SH 3BAEL 4TVPH 2DD8L 2YMXH 2H32A 2GK0A 4L29B 4Y5VB 1QSEA 5E2UH 1W72L 2HJLB 4J6RH 5MEQA 1SY6H 4O58H 1ZA6B 4X6CE 3L6FB 4GRLB 5D2NB 2BSED 2I07A 4GRMA 4QT5A 4YBQD 5GZND 1EV2E 5CZXC 3ZHLA 1IE5A 1EEYB 2FJHB 5GS1B 1S7WB 1ZV5A 4JFEA 4Q9QL 2D0GA 2YPKB 5I2IB 3GJEA 5DFTA 4PJXB 4J2XA 5F1IA 1A6ZA 2V9RA 5JA9A 5GS0C 5DURD 1UM5L 3SKNB 1JCKA 5J0BA 1DQML 3ESUF 1P4BH 2KPNA 5IIEA 4BQ9A 4P5TD 3X11A 2FX9H 3EBAA 1FGNL 3F6IA 4J8RA 5EN2B 5SV3A 2NY2B 3HPJA 5JDJA 3ZSSA 4JJ5B 3D69A 2NYYD 1XZ0B 3C09C 3WXVH 3IDMB 5JHLH 3Q6GH 1OW0C 3BH9A 4OD1L 1T22B 3T2NH 4XT1C 2VAJA 4DKDC 5HDBF 5SWQA 3CVHA 1VPOH 32C2A 3QHFL 5EH1A 5F1SA 4R0LA 2XKUA 2CPCA 2A9MH 3QUYC 2H6PA 4OD3H 4KZEH 1ZTXH 4LSVL 5CSGA 2VQ1A 5E00A 3GSNL 1A0QH 3NAAL 3PWJB 3R06B 4KVCL 1VFUA 4D8PB 4TNWK 1OP5K 3ARFC 5D7IB 3OX8B 1FNAA 3QEQE 4GBXD 1MVFA 3H3BC 1OLZA 1JPTL 4FQIL 1ZS8A 4IMLB 5E2TL 1F4AA 3VXQA 5CZXD 2ADFL 2D7OA 4RAVB 1S9XB 4KGJA 4HXAH 3QDGA 1NCAH 4KUCF 2BFVL 4AY0A 1D5XB 3PP4L 1PKQA 4HS8H 4K3DH 1D5MA 1XGYH 4QO1A 1YEFL 3QG7H 1ULVA 4NN5B 5HJ3A 3WHXB 4C4KT 5IW1A 3L3OB 1QEWB 4Y8DC 5E2UL 2NY7H 4J6RL 5IW3A 5IB1B 1ZT7B 4Y4FC 1PW3A 2E6JA 4PD4K 2IC2A 4CW1A 4RMUA 2M26A 4AT6A 4EZMA 1MFAL 2A83B 3CPLA 5IHLB 4DN4H 5KVGL 3EFFB 3MRBA 4OCXL 3G9AB 3HMXA 3FHQA 1BZ9B 4UV4H 2DBLL 1TDQA 1PX4A 4ONHA 2HP4A 4Q97A 5C0RH 2G5BA 3MRFB 5FYJU 2DTMH 1QLRA 2E3VA 1WFNA 3PQYA 5CJXA 1Q9OB 4GKNA 2FX9L 1IAIM 5K93A 1MLBA 2PTUA 3BT2H 3MRIB 5FYJD 3QUYA 2X1WL 3V0VA 2LAGB 5EZIH 1ZHBB 3VCLA 1LP9B 2W9DH 3Q6GL 5DJ8B 2YWYA 4RGOL 3PIQA 4HULB 43C9A 1FNSH 4S10A 4YPGA 2X10A 2NW2A 3AMKA 4QRSA 5FYKE 4QXTB 3D25A 1MCHA 1HXYB 2YA0A 5J9PB 4TVSa 5FYLL 1CYGA 1PEZA 1FP5A 5IB4B 4XVSL 4MZ2A 1RFDH 2VISB 1ES0A 4N1CA 2DBJA 4YC2B 4PY8I 3IS0X 1U8PA 1U8JA 5BS0E 3CDYA 4XNMB 1UWEL 1UWXH 1UQSB 4G5ZL 3KPMB 4DUXA 1IGIH 1DBML 4IMKA 1M4KA 5LBSL 5EC1B 2MKLC 4MXQC 4NJAH 4NQEA 4NQXA 3BXNB 3HNSH 3QQNA 2IAMA 4F15C 5CZKA 3CDFA 3TJEL 4K3DL 1XGYL 35C8L 4XMPH 3M17B 1RD6A 1NMAL 1AO7E 3QG7L 4BUHA 2FNBA 3EJZC 4XCFH 4UU9A 3H9SA 5DJDA 3DBXA 2QHLA 4HQQH 1HILA 5HI4C 5FB8A 2AABH 3HR5A 3MRHA 4DQOH 1G7LA 5ALBH 4LLUB 5MEOB 2VDPH 4LQ1A 5DLML 4HCRL 4ZUVA 1ZHNB 4YXLH 5SX4H 2GITB 4PJ7F 1NDGB 2DB8A 3BP6B 2ZP0T 1T6VN 4V1DE 4UV4L 4H26A 3FO2B 4TULL 3LN5A 2WWKT 5J13C 2VLKD 5H8DA 4G7YL 5TQ2L 4KK9D 3QXAB 4JFEE 3BT2L 5EBWA 3ET9F 4WW1B 3S3PA 4EQ3A 4NM4L 3MV7A 3HZYA 2Y7QB 4F80A 2NY0B 4PG2A 2WMPA 3FB7B 5INCA 4KROD 1FV1A 1BZ7B 4F3FA 1FNSL 2GKIA 5D93C 1FN4B 1J9CT 1TMCB 5EULV 5KZCB 2F58H 2F19H 1D5IH 4J4PC 4U1NB 4L5FH 4R4NC 2R4SL 5I1JL 1IEAB 4PJDB 1W8OA 4PRNB 2CUMA 2MCPH 4QOKD 3EJZD 2W1NA 4N8VG 3TO4B 4GAFB 4WJ5A 2HKFL 1RZFH 5CD3B 2DWDA 2VAAA 3RL1A 2IMNA 4XI5D 4LSQH 3ZYOA 1KOAA 2NX5B 3FQTB 1RJCA 4XZUB 3KHOA 3PWUA 3G6AA 3RU8H 1W72A 3O3UN 3QCUL 4PGCB 3KVQA 3KG5A 2F8VA 4UB0H 1TJHH 3GSQB 1DE4A 2CLRA 4M4PA 4LNRB 3S36L 4Z9KB 3ARUA 3QUKB 5IQ7L 1FH5H 1A4KB 1ZHLB 4HQQL 3QDGE 4UBDD 2AJXH 3KNBB 3MGAA 4MQXD 3KYMB 2AABL 1CL7H 1PKQE 4JGUA 3U7YH 3PL6A 1JFQL 4WFHE 4DQOL 1JK8A 1JGEB 5ALBL 5DS8A 2XKNA 1RZGB 5JW4M 1C08A 2XWTB 4P2QA 2F74A 5D1QC 1U8MB 3QEQB 4YXLL 1V3JA 2EE9A 4KQ3L 2WINA 5TQ0H 3BEVB 2P45B 3IJSA 5JMOC 1AGFB 3ULUH 4XPGH 3LKOB 3NZHL 4HLZH 4NKMA 4Q9RH 2EKSB 5HPMA 4U6HB 5F7WC 1HHKA 4JFQB 1RUQH 1OF2A 2EC9U 2VXTH 3LS5L 2ATKB 3DXAB 5FUZL 3UPRA 3ZZ1A 3OL2A 2YPLE 1W0WB 1U95A 3O9WC 4HFUH 4J4PA 5IMOB 4XVUD 5DQJB 2Q20A 4GAJH 5EU3A 1D6VH 4PJ7A 1CFQB 4LCWA 5ACMA 1JGVH 1KYOJ 3SDAD 5H94B 1TZGL 3FONA 3ZYZA 3GSNA 3PQYE 4LPVA 4XVJL 4YXHH 4M1DL 1HHHA 3Q48A 3CFDB 4ZPVA 1YA5A 1MUJB 3W9DB 1AIFA 1AKJA 4QHMA 1LEGA 3KYNB 3K1KC 5JUEH 5EA0H 5HHPA 2HLAB 2GUOB 4FQQB 3RGVD 5IMLA 3MODH 2RQ8A 4E9LA 3LS4H 5JO5B 3P3YA 1EFXD 1N8ZA 3T4AA 3TCLB 4BZYA 2Y36H 3AXLB 3BO8A 2BERA 2C4FT 1AHWB 4QYOA 5BMFH 3LRSB 3SQOH 3EDFA 5D1QD 3QAZC 3S5LG 3MXVH 5MEPA 2EIZB 4QTIL 3BDXA 4RBPK 3F12A 4W81A 4QHUA 4IHOB 3HI6L 1KNOB 3RU8L 3WUZA 5C6WH 1SY6A 3IFPB 1TJHL 5DJCB 2BDNL 3WD5H 3KPNA 4N0YH 3L7EB 1OP5H 1OP3H 5BVJB 5JNYA 2CRYA 1CD8A 5HXMA 4JFHE 4I18B 1CDJA 2ED8A 2EXWC 4NQEE 4HC1H 1JV5B 1C5CH 1IFHH 4XP1L 5IWLC 4ZFZB 2QBWA 3T2OA 4RMVA 3MJ6A 4U3XA 3H9SE 2W65A 5JTWA 2MQCA 3V8OA 5BS0B 4FMKA 4JO1L 5HVGB 2ENSA 3D85A 3WJLC 4XPGL 5KSAD 3REVB 2X70A 5FYLD 3H3KA 4FABL 5I1HH 1T83A 1ZSDA 1K4CB 3TVMB 2G9HA 4U1JA 4H1LB 2VXTL 5EWIH 4M02A 4FXGA 4DN3L 1Z5LA 4HJJL 4LDEB 4MJIA 4M1GH 4OCMC 1AO7B 3WMSA 3RBSA 1JGVL 2BRQA 1UA6H 1UH4A 4XMKL 2GCYA 5BO1H 2J6EL 4YHOH 3U0TA 3BGAA 3QXVA 2ZCLL 3TH2T 5C7XH 4OGXH 4OB5H 3QIWC 3MFGB 2NZ9C 5DRWB 1DLFL 2DQHH 4OZGF 3D87B 1MEXH 2UZIH 3VGFA 3BH8B 3PDGA 4PREA 4IBLT 1VERA 1LILA 3BKCH 3CNKA 4V1DB 5C09D 5MEQB 2WQ8A 3FO0H 2P5ED 3VD3A 1OAZH 5DJYA 3ZTNL 1FVCB 1KLGB 3P4NB 3HR6A 3SGDI 2H9GA 1V3KA 3LKNB 4K3JH 5ILTH 2KZWA 4N1HB 3ZE0E 3MXVL 3GJEB 3QPQD 3MLRH 4LLQB 5IFHH 3MROB 3L5WB 2PO6B 1FPTL 4GW5A 3C8KB 1CLYL 3BKJH 4ZUTB 3VWKD 5IIEB 1SMOA 3ULSB 3IVKA 1G7MA 2NY1B 3HPJB 4HCRA 5IR1B 4N0YL 3LPFA 4OZFA 4YUEH 1QFOA 4AMKH 5ICXB 5H2BA 3RNQB 4YJZL 1NAMH 4OCNC 1C5CL 3IKKA 3UP1A 1CXEA 1I7UA 1UYWH 2OL3H 5SWQB 1CG9A 3ZE2E 1MJ7L 4X98B 3OKLA 3QEHA 4MCYB 4PJFA 1WAAF 4OV5A 1N2RA 1C1EL 3WKMH 1OTTC 4CL7A 4PRAA 5EZOL 3P4MA 3T0ED 2VQ1B 2YD6A 5E70A 1WZ1L 1AQDA 3NVQA 1AXSA 1MHCA 4G43A 1NAKH 3P0GB 3QCVH 1L7IL 2MOVA 4LSUH 4NKDA 4P2QE 4XP5L 3U36A 4U1KB 5I9QB 1W0VB 4RRPG 3A67L 3QZWG 3QIWA 4GXUN 2AEQH 2NY3B 3VXQB 5EU6D 3X14A 1CIDA 1HHGA 1J18A 3OAUH 1A14H 3OGCA 3MOAH 1MCPH 4RGMB 3ETBF 3FFDA 3WIIH 4YHOL 4G8FB 1NCCH 1HH9A 2IH1A 1Q0XL 3B8YA 3HNTH 5BXFA 4PJ7E 4FQJL 1MEXL 1D5ZA 3C87A 4PJEF 4HK0B 1ITCA 4LPCA 2VUOA 4CNIA 5L8LB 4MJ4A 1CBVH 3MREB 1KSRA 1PJ9A 4QRUA 2DS4A 3V5HB 1ACYL 2C1OA 3QQ4A 3BD3A 3WUWA 3B9VA 1H8OA 5E5UB 4S2SB 3ARDC 3CPLB 2YPLB 2XQBH 5E8PA 2W9EH 1NANI 2FIRT 4ODVL 2Q7YA 5J57B 3E6HB 4ONHB 1A02N 2MCG1 3WNLA 2H41A 3PQYB 4TPRH 1XF5A 4FTVD 3QQ3A 1C12A 4KKCD 5I0ZA 2AJSL 1T3FA 4LVHB 4TVPE 1BQHA 2DIBA 3OB0H 1GGYA 3V0VB 3D39A 4WRLA 2QQNL 3EO0B 5L0QB 2ZCKH 4FQXB 1UYWL 2OL3L 2GJ6A 1XGTA 3K4AA 3WDIA 2BP3A 1KXQE 4U49A 1MRFL 4GW1B 3B83A 1FC1A 5CBAB 1JN6B 1VADB 3QDAA 1PQZA 4KDTC 4EN3C 4Z0XB 4EI5C 2DN7A 1A3RL 3ARBD 4I4WA 1NAKL 2IPKB 2KH2B 3QWRA 3NIFE 4MAUH 4X7TA 3H3PL 4PLNC 4KKLD 1NC2B 1R3LA 5TDNA 4XPTH 2YOCA 5CS7A 3OWEA 1WAAA 4O9HH 2VJXA 2Z9TA 3DMMB 1WCBA 4JFPA 3B9AA 5KN5A 4TSCH 2QHRH 2J4WH 4XBPA 3ARDD 2FYYA 2KDGA 4LCYA 2C7UB 3MRQA 4M61A 4QRTA 2IAMB 4DK6A 1HEZB 4PJ9D 1NCCL 2FEEI 3VFSB 4LSDA 5B39G 4BFGA 5MI0C 1V3MA 2OR8A 3L9RB 1G9MH 1JVKA 2HFFB 4R97C 3HNTL 5ANMA 4TNWF 1OQOA 3UCRA 4QRRA 1JZ7A 3DBXB 2JK5B 1QLEL 3EFDL 5IBTH 1UM4L 5I15H 3NACL 1SJHA 1G7LB 5D4QA 1CBVL 5KSVA 5E5MA 1U8QB 1J05B 1F6LL 3X12B 3KXFA 3G5ZA 4BKLB 1MCBA 1MPAH 4W70A 1FBIH 2D9QB 1T2QL 2GEEA 2IQ9H 3QHZH 4TUKH 1NGQL 1L0YA 1X5HA 1CDUA 4PJEA 3C2AH 1FLRH 3LSOB 4EI5D 1R0AL 5IEHA 4QRPD 5T5NG 2DI7A 5I8KH 1DDHA 1CQYA 1HIMH 3Q5OA 4NN6B 1T03L 1EO5A 2CRZA 1KPUB 3A6CH 4EN3A 3VD9A 4OIIH 3LEXA 3MV11 4LLVA 3CH8A 4C54A 4GAGH 4QGTA 3FAXA 1RZIA 1HOCA 4IRSB 1KJMA 2FRGP 4RBPH 5C0GA 4KTDH 5ADPH 1DBBH 2JIXB 1P7QD 3FZUD 4W4NA 2DQJH 4HUNB 2NR6C 4RX4D 4B53A 4PJCB 3QWOA 4LP4A 4OI8A 2ERJB 5DHVB 4DVBA 4PJFE 3P4OB 4X7DC 3KWWB 4HKXA 1EFQA 4H20L 3NTCH 1CR9H 3TT3L 5ICZA 3MA7A 2PTVA 4POZD 3PWUB 4X99A 1VACA 4ONGH 4YHZH 3BVNA 1YZZA 3G6AB 1QA9A 2CLZA 1MRCL 4MA1C 3UBXA 2GYSA 5D1XA 3UJTL 1G9ML 2PW1A 3BPLB 2XTJC 4X83A 1U2HA 3GBMH 1I7RA 2W0PA 1FFRA 1B9ZA 4K2UH 3V6OC 2AVGA 3OHXB 1IAKA 4Y16A 4QGYA 3GBLA 5FOJA 3QO0B 4YHLL 4G80B 3TBVA 1XGQB 2IALA 1JK8B 4F7TA 3V5DB 5F7DA 2XKNB 1CDYA 4JGMA 2APWA 4HJGB 3VGEA 3RPIA 2F74B 1LO4H 4XP6L 3U7WH 1WBXA 1BOGB 1FZJA 1J8HE 2W0KA 4OLUH 1MPAL 1TJIL 4TUKL 3DECA 3QHZL 4P49A 5DD6A 1OSZB 3ZO0A 1IM9D 3TT1L 5HHXH 1JNHA 1HHKB 4HC1A 1IM3B 1OF2B 2P46B 3U7AA 4JQVC 2ICES 3L1OH 3NFSH 4HS3A 3UX9B 5D96C 4WHYG 2VXSH 3KPSB 3JTSA 3A6CL 5I1AB 2JKXA 3QG6B 4U31A 4J7RA 4PJ5A 1ZAGA 1JYWA 1HHHB 1LNUA 2V7HB 3SY0A 3MRKB 3EYOA 3NN8A 4IDJH 1ZGLA 1F8TL 5A3IC 1YJDL 4I0CC 5ACLA 3MMEA 4QHMB 4M7ZC 3D39E 4XBGA 3TN0A 4WDIA 1G7QB 5FYJH 4AENA 3CZJA 3UTPE 2OI9B 3HC3L 5J11B 5T1LD 4JEGB 4JHAH 1HHJB 2GJ6E 3WNMA 5EBLA 5IMLB 4X0KA 4G9FB 4RISL 4YXKH 1N8ZB 3T4AB 3U46A 1FGVL 1S3KL 2W60A 1KC5L 2FO4A 5TFSH 3MYJA 3RKDD 1A9BB 3NTCL 1CR9L 2ARJA 4LNVA 3V6OA 2I26N 4LVEA 3O6ML 5MEPB 1P69B 4ONGL 2BVOB 2X2YA 4ZUWA 3KS0J 2NY4B 3FTGA 2ESVA 2GJZA 5E9DA 2DWEA 1WAAE 1JZ6A 3KPNB 1KFAH 1V8HA 2DDQH 4KY1L 1IGJA 5GGTL 4DVRH 2ZSVB 3C5JA 1RVFL 3BZDA 4L3CB 4P3WA 2ITCA 2XG4A 1VGEL 1CLOH 1ONQA 3IDUA 3VGAB 4QEGA 3BUYA 4JQVA 3CDGA 2CJUH 2HT2C 4YFEA 2BVTA 2W65B 3U7WL 4QRRE 2GHWB 5DZNA 4WFED 4WHDA 5A3ID 5B8CA 1XMWA 1H5BC 3OKOB 1TQBB 5TPWL 3MV9D 2X70B 3VGBA 4UTBH 1LE5B 1ZSDB 4RFOH 1Q1JH 2IBBA 5KVMC 2G9HB 3KXFE 5ENWA 3L1OL 2OL3A 3NFSL 3MTRA 3TYGH 2AXHA 3S4SG 5SV4A 1Z5LB 2K3TA 2VOTA 3I9GL 4CADA 4W4OA 4PJEE 4UT7H 1F90H 5TGBB 4PB0L 4EUPB 5LCVL 4G6ML 3DNKA 2FL5A 4JDTH 3U0TB 4I3RH 5DHYA 1XR9A 5JLZB 3GJFK 3RBGA 4RZCB 1MRDL 2UZYB 3ZDZF 4WTWA 1DLHA 3EOTL 5DVLA 3CC5B 3REWA 4JG1H 3ULUE 4BSWA 4PREB 1BZQK 2FGWL 4LHQB 1Q72L 4WV1B 5JW3L 4M6OL 4OQTH 3D2UA 4XAWL 4YXKL 3IS1X 4DKAA 1MCLA 5DJYB 5F9JA 2VMFA 1N6QL 2R4RL 2P4AB 3QDHA 1J5OH 1TNMA 5KG9B 3UAJD 1AR2A 1KLUB 1BLNA 4HWBL 1HXMA 3E6FA 2YPVL 3QDJA 4ZDHA 2G2RA 4M7LH 1KB5H 4NCC2 4GW5B 1VGKB 2NXZD 1NMBH 2YA2A 4UDUB 2FBJH 4GSDH 2DQFB 2FJGB 1FSKB 2G75B 5CSZA 4NZTL 1H5BA 5IVXF 4KDVA 5HYJD 5GISL 4F7PA 1OAQL 1W0YT 2IANA 4L4VD 5T1KA 2F9BT 3S35X 3QEHB 1WV7T 5JXEC 1MAKA 2F53E 4PJFB 1R3JA 3GRWH 1GGIH 4OV5B 3TWCH 1N2RB 1RUAH 2VITA 4WGVB 3TP4A 2BMKB 4NC0B 3B9EA 4UTBL 5B38A 4JM4H 1XCQA 4JREC 1AQDB 3RL2A 3PGFL 1FNGA 1AXSB 4PRHD 2QSTA 1CGSL 1RIUH 5JW5B 3C5SA 1HINH 5IVNA 4NQDA 5B3JF 1NH6A 4KMQA 3DGGB 1QSFA 4N90E 2OS7A 3MJ8A 3MSPA 5AZ2H 3MLZH 1IBGL 3X14B 4R2GB 1PYWA 4Q6IB 1R24B