2OJ1A

Disulfide-linked dimer of azurin n42c/m64e double mutant
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKCVMGHNWVLSTAADMQGVVTDGEASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Inter- and intramolecular electron transfer in modified azurin dimers
pubmed rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 31
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2oj1A00
4ENZA 3FU7A 2YARA 4GXFA 2FNWA 2YAQA 5I6NA 1TEFA 2PP8A 3G5WA 2UX7A 2IWKA 1PF3A 2YQBA 4A2HA 1M57B 4DP4X 2CUAA 3FQYA 1HAUA 3NJNA 1ILSA 4HHGA 5I5IA 3T71A 3OMIB 3FSWA 2UXVA 2GB2A 2YXVA 4KNUA 2CJ3A 2QPDB 2PPDA 1L9TA 3NP3A 2PP9A 5F7BA 3ABGA 4KNSA 3QJQB 4YSSA 1ILUA 1AZRA 3QQXA 1NICA 1KV7A 1L9RA 5I6MA 3H56A 2X88A 4K9JA 4YVNA 1SDDB 1W6WA 3WIAA 4DP0X 4DP6X 2VM4A 2PPCA 2BWIA 5B1JC 1PCSA 1OCCB 4A2EA 2HX9A 3NJMA 3PLYA 3ERXA 3OMAB 2IDSA 4KOBA 1OV8A 2B08A 2XXGA 2XX1A 4FA7B 3NJGA 4RH4A 3T6ZA 3GXUB 4A2FA 1NZRA 2YAPA 1J9SA 3EH5B 4AI7A 2J57A 4PCYA 2AANA 3RYMA 2IDFA 3EHBB 3ZDWA 4BXVA 1BEXA 4CSPA 1AZUA 1J9QA 2FJSA 2QDVA 1NDTA 4UANA 1L9OA 2BZCA 5PAZA 3UAAA 1E5YA 2QPEB 3GDCA 1NIBA 5AZUA 1ET8A 1JOIA 1CUOA 2H5UA 2HZHA 2I7OA 4HALA 2ZWNA 1ASOA 2B3IA 4BWUA 3KW7A 4DP7X 1E65A 3C75A 1QHQA 3EH3B 2BP0B 1M9WA 1PAZA 1SNRA 3WI9A 5B7FA 1NIAA 2QT6A 2HLEB 3CVBA 3ZBMA 1ZDSA 2BHFA 2ZXWB 2DV6A 4NB7A 1BXUA 5I5MA 1OE3A 2MRYA 2JKWA 3AW5A 4YSPA 3FYEB 4GY4A 4KO6A 4UF7C 3U25A 4DP1X 2WO2B 2FT8A 3FPXA 2J56A 1HFUA 1WA2X 3OD3A 3PAUA 2IAAC 3SBRA 1KYAA 3QPKA 1MG2C 3TASA 2HRGA 1RZPA 1PNCA 4KOCA 2IDTA 2YXWA 4BK5C 5TK2A 4E9WA 1JXFA 2VN3A 4WTQA 1BQKA 1J5DA 1GYCA 4YSOA 1WS7A 2GIMA 4E9YA 1URIA 5D4JA 1A4AA 3FQ1A 3EH4B 4HAKA 3FU7B 1GS7A 4HCGA 4YSDA 1IC0A 1AS8A 3L45A 1AAJA 1KCBA 3BQVA 2IH8A 2YAEA 1AQ8A 3BVDB 3ASNB 1HAWA 2FQDA 3D12B 5TK4A 1JZIA 2FT6A 1BXAA 1FWXA 4BXSV 4JHVA 2HX8A 4GP8B 5I6OA 3T9WA 1SFDA 3QJVB 2DYRB 8PAZA 4GYBA 1A4CA 1IUZA 3JTBA 1GY2A 1EZLA 2BP8A 1JZHA 2YAMA 1DYZA 3X1GA 1BQRA 3CDZA 2BW4A 3SBQA 3FQ2A 1QLEB 2VMJA 3GYRA 5EHFA 2FTAA 1J9TA 3OQRA 2I85A 4A66A 4UAHA 1A4BA 4NERA 3S3DB 3CG8A 4A68A 2NRDA 2GBAA 2EIMB 1JVOA 4E9SA 1SJMA 4BDVA 3QJSB 2AFNA 4YSUA 1OE2A 1UATA 3WKPA 1DZ0A 3FSAA 1AZNA 3V9CA 2WSDA 4DP2X 1SHWA 3NSYA 2DYSB 3FU9A 1X9RA 4EF3A 2VSMB 4AKOA 3AG4B 1TU2A 1E30A 1SF5A 1T5KA 2BZ7A 1JZFA 4DPAX 1L9PA 2YAHA 3QJTB 2XVBA 3X1EA 1OCZB 1PLAA 3T6VA 9PCYA 1SHXA 2J5WA 1ZIBA 3IBOA 1XB8A 1JXGA 2GC7C 3MBWB 2IH9A 1OF0A 3TBBA 2PP7A 3NJLA 1GW0A 4M4RB 2OJ1A 2Q5BA 3NJFA 4YL4A 3WG7B 4A2DA 5I28A 3S3BB 4KO9A 5B1JA 4YSQA 5B7MA 4AZUA 1L9SA 5B1AB 3S3CB 1TKWA 4MFHA 5B7EA 1AOZA 1X9UA 1ADWA 1MDAA 3TA4D 4AX3A 4GP5B 3N55A 4A2GA 1RZQA 2FWLB 2TSAA 2UX6A 3NJJA 1AS6A 1OCRB 1FA4A 1YLBB 3X2QB 4ZK8A 2AZUA 1NINA 3S8GB 2WO3B 5A7EA 3WNJA 3FSVA 5E9NA 1IBYA 1CYXA 1AACA 5PCYA 1A65A 3N2JA 2JXMA 1ETJA 1I53A 3IN2A 4E9XA 4DP9X 1AIZA 4M3HA 1ET7A 2PPEA 4BWTA 2QDWA 6PCYA 5ANHA 5AFAA 2VM3A 2XLLA 7PCYA 2DY2A 1W6LA 1WA1X 2OCCB 2GHZA 1ASPA 1NIFA 3AG3B 1FFTB 3FSZA 5I5JA 4P5SA 3EF4A 2CCWA 2IDUA 4KNTA 2H3XC 3QJRB 2ZONA 2VW6A 1CC3A 2EILB 3PXLA 4G72B 1RKRA 4N8UA 2BP8B 2RACA 4HIPA 3WKQA 4G7QB 2EIKB 4G71B 3CDZB 4DPBX 1XB6A 2XYBA 1MZZA 5LDUA 1AANA 1WA0X 2GI0A 1ZIAA 3CVCA 3PPSA 4TXVB 1AR1B 2XUWA 3SBPA 2GC4C 2X87A 3JT2A 2J55A 3IN0A 1OCOB 3FU8A 4HHWA 1KDJA 4DP5X 2FT7A 5B1KA 2GSMB 2DWTA 5IY5B 1BQ5A 2VSKB 2W8CA 4BDVB 1AZBA 1NIEA 2PCYA 4YSRA 4PAZA 1GR7A 3ABLB 1E67A 5D4IA 3FPYA 3WNIA 2LLNA 1A8ZA 1M56B 3SQRA 1N68A 7PAZA 2IWFA 3IE9A 2VW7A 3CZUB 1SF3A 3NSCA 2UXGA 2FQEA 4F2FA 1ID2A 2DWSA 2XV3A 2Y69B 6PAZA 1PNDA 2IDQA 2N0MA 4YSTA 1KCWA 3ZIYA 2EIJB 1VLXA 4X4KA 1KGYE 4HCFA 2Q9OA 5B1BB 4A67A 1KDIA 3PCYA 4QLWA 1NIDA 4E9TA 4L0PB 2XWZA 2HRHA 1GS8A 3T6WA 5D4HA 3UADA 4G7SB 3ASOB 2E86A 2BW5A 1GY1A 1V10A 2FQFA 2UXFA 3H4HA 3X1BA 3S8FB 1QNIA 2VW4A 2P80A 1PZAA 3ABKB 2XV2A 1V55B 4HZ1A 4E9VA 4W1TA 3IEAA 2YAOA 2AZAA 4CSZA 2A3TA 5I6PA 5FC9A 5AKRA 2R7EB 3FYIB 2PPAA 1OOWA 2P80D 4Q8BA 3T6XA 1BAWA 1EHKB 1AG6A 1SFHA 4N4YB 5B3SB 1ASQA 4Q89A 1PLBA 4AKPA 1IBZA 3KW8A 4F2EA 2FQGA 1BYOA 3NSDA 3AG2B 3UGEA 2PPFA 3AG1B 2BWDA 2IWEA 4P5RA 3FS9A 1ET5A 1A3ZA 3NJKA 3V9EA 3QJUB 1XB3A 4E9QA 1KBVA 2JFCA 3X1NA 2EINB 4KO5A 5F7AA 2Y1AA 1AZCA 4W9ZA 3FT0A 3ABMB 2R7EA 3PAVA 5I26A 4DPCX 1SDDA 1MG3C 1V54B 2BO0A 4KO7A 3HB3B 4E9RA 4G7RB 1JVLA 1PZCA 1GS6X 1JERA 1B3IA 4JKNA 1L9QA 2CBPA 1NWPA 1E5ZA 4JHUA 3UABA 2PLTA 3CVDA 1NWOA 1BYPA 3AY2A 3AZUA 2PCFA 1CYWA 2XX0A 3DTUB 3OMNB 4YSEA 1J9RA 2I7SA 1PLCA 1JZEA 2H47C 3DIVA 4AKQA 1PY0A 3MX0B 1BXVA 3DKHA 4NAJA 3ZX1A 1W8EA 4GP4B 2CALA 2YAFA 1MZYA 1ZDQA 2MTAA 3TU6A 1PMYA 1CURA 2UXTA 3UACA 3NJHA 4YSAA 3H4FA 2BP0A 5I6LA 1WAEA 3PAZA 1JZGA 1KBWA 1TEGA 1XMEB 5I6KA 1N70A 2XXFA 4QKTA 1R1CA 3X1FA 1RCYA 1PZBA 1J5CA 4BWWA 3HEIB 1ZV2A 1JZJA 1NTDA 3TBCA 1IKOP 2ZOOA 1F56A 4FAAB 1JXDA 4YSCA 1AS7A 1NPNA 2W88A 2XU9A 4WKXA 4F7KA 1WS8A 3NP4A 1NPJA 1GSKA 2CAKA 4DP8X 4HCIA 4G70B 2HXAA 3NYKA 3UAEA 2XV0A 3NJIA 2TSBA 1AG0A 1ZPUA 2AVFA 3NT0A 2OV0A 1OE1A 4YVUA 3OM3B 2HX7A 3NSFA
chains in the Genus database with same CATH superfamily
2HT4D 1A1OB 4JRXE 5F0PB 1G9HA 1TEFA 2J8UF 2Z8VC 3BJ91 5F7DA 4NAQA 3CHXA 3N06B 1FAIH 4JFDD 4GUCA 3BVVA 3VFNB 3LKRA 3HVNA 4HCRA 5ADPH 1FFOB 1UWGH 3CQQA 2K6YA 4LSVH 1BD2A 4A63A 5H94A 4MA1C 3OG4B 1KCVH 1UEYA 2UXVA 4NUGL 1B3JA 1ETB1 3JWNH 3KJ4C 4OZHF 5D7JC 5FYJL 1UM6H 1AFVH 3CQPA 2BK8A 3RTQC 3VD1A 4JRLA 3UJTH 1ACYH 1JHLH 1UXSA 2A77L 2ZOTA 3ABGA 4AVHA 4U3SB 2VE6A 4NI6A 5E1IA 4S0SD 3TO4B 3CFIC 1ULVA 5I74C 3BQUA 4EMZA 5C2UB 3QZNA 4PTUA 1T04B 3MACL 4KFZC 1MCHA 5LO7A 3ZTNL 4X5WA 4X6DE 4HWUA 1YEFL 1AQMA 3QHFH 4PJ8D 3C9NB 1VFOA 3L1EA 4K9EC 1IGFL 1PYWA 2WWKT 3NJMA 5DJYB 1S7TA 3F3HA 2QR0B 2XXGA 3GLEA 4JDTH 4RGMB 1L3NA 3T6ZA 3O3BA 5D9SA 3FFDB 3OR7A 5DUPH 4PRNA 3QQ4A 3AS1A 5IB5A 1B88A 4ZMZA 1DBJL 1E0OB 2W94A 3BKCH 3GSNA 3UO1H 3A6CH 5BV7L 3HG2A 5DMYA 5E2UH 1R24B 4NQEA 4X8XA 5I1GL 3VSUA 3GDCA 3QEUA 4Y1TA 1AXTH 3ESUF 2HCZX 2JKRM 1CU4L 1MHCB 4ZOBA 5I6XC 3CFCH 5GSVB 2OMYB 4TVPH 4FQPA 2VITA 2A4CA 3K91A 4XH2A 5HVHC 2OR9H 3U36B 2ZSVB 4FYRA 5LCVA 3MBXH 1DTUA 1IBHA 3C6EA 2NQCA 2F53D 3B9KA 4Y5XB 5IKCA 5JXEC 1RHHB 5DSCB 3RIAF 2QV2A 4BFJA 3HKZA 2NDGA 4GY4A 3IDJA 4OSUL 1Q9LA 3HFMH 1QLEH 4PJ7E 1RUKL 4MB1A 2HKFH 4RAUB 2WP3O 3EYOB 5TK2A 3ZT6A 4UQCA 3GMNB 1BA9A 5K9QI 1CD9B 1HEZB 3R7QA 1G0DA 4B7LA 5GZOC 3QEGL 1VIWA 3CMGA 3NGBC 4ZPTB 3TBWA 5KBPA 2M26A 2ZCZA 5IQLA 4JDZA 2DQGH 5K9KB 1JHTA 3QXDB 3MRGB 4CC0A 2BNUB 5AB0A 1E4WL 3UTSE 2NXZC 4Q4IA 3BJLA 4ZNEE 1XCWA 4AQ1A 5FYJU 5FO7A 2HT2C 3CFKB 5I8EA 4GPVA 3VI3F 1PJWA 1P4LA 1AAJA 1DCEA 3KPLA 1GGBL 4U1HA 2EDXA 1UKSA 3BVDB 2CHWA 4B9FA 3HPJB 2VL5A 2WXLA 4N8VG 2BSSA 1N26A 2A9AA 1ACCA 1AIFB 1C16B 3PGCA 1UM4H 3LYRA 4D9QE 1SFDA 1OB1A 4KJYA 1JNLH 1AQKH 1LWHA 1FZMB 3FUNA 3GO1L 2XA8L 3QJVB 3N50A 4HEME 4TQEL 2IH1B 1GHFH 2K8MA 5BUPA 3MV8A 2EEBA 4DOHB 1E6JL 2BSTA 1O5DT 1I4FB 3X17A 3VFRB 1KULA 4PJHF 1EO8L 5I18H 1D5BB 3D52A 3EJPA 2J6EH 1DQKA 4ZT1A 4RISL 3ZTCC 3NEEA 2BC4A 4Y5VA 1JPSL 3V8OA 1NEUA 4PS4L 3MRKA 3ZT7A 4OFYA 2NY3D 3GUFA 3QDJA 3LIZL 4FD0A 1XD1A 3QDMB 5K39B 3T4AC 4PMFA 1OE2A 3WKPA 3IGKA 3WO4B 1L3WA 1WAAE 3IU4L 4R7XA 2UWEF 4AG4H 2DOCA 4UM8A 2X9XA 5JHDE 3UC2A 5FGSA 3ZDYE 2A73B 3MV7E 4ABWA 3MNZA 3O4LD 1J5HA 1S5IL 2ORBL 2EZ0C 4J2QA 1MW0A 4Q2ZA 5HHXH 3GINA 3X1EA 2KZBA 3D39B 4LP8A 3QSKB 4LKCB 4Q52A 1AE6L 2R2HB 3MXVL 2WYHA 3ROOA 4ZUTA 1HINH 5CEZL 1NM9A 1RZIA 1Q9KA 4MD4A 5I1HL 4D3CL 2XBZA 5K1VA 1KEML 1MJUL 4X98B 4OGZA 3PFUA 2KZWA 4PJFF 1IQWL 3NJLA 4APQA 1YSOA 3AABA 5ISZD 3DX6A 4FRWA 4L8SC 4PV9B 5AOMA 15C8L 5B1JA 2JXMB 3T2NL 5DWUH 4BH8A 4GRWE 3SDCA 1BSIA 1A9BB 2FBJL 1MFDH 4AJVA 5HI4D 1BAGA 3DTDA 5LGYA 2BOLA 3U4AA 1DFBH 3BVWA 1JK9B 1WIOA 3FUKA 1AS6A 2DDQH 4XMXA 3ZHLA 1IM3D 4X5XA 1YLBB 1N12A 2VDPB 3MBED 4DTGH 5MEND 2Y06L 3KS0H 4ACTA 5ILTH 4LQFH 4XP5H 4GEIA 4NYLB 3WSQH 2VLJD 3EHBC 4HW6A 1BXXA 5D8JL 3SDXF 2PO6B 5PCYA 2QVFB 4Q9CA 1ZVHA 3O2VH 1CL7L 4G9FA 1MVFA 3DVFA 2NY5L 2QGDA 3RGVC 1UB5A 1RZJL 2PPEA 5EC1A 2IFFL 2XPGA 4PGZA 3AU1A 2HFGL 1Z5YD 3NH7L 3SE3C 1ZKAA 2QELA 3FN9A 4Z3IA 5DEZA 4ZMLA 3T2OA 3QUKB 4YHYC 1QFUL 3Q2NA 5D5MA 3QRFM 2Y24A 1RLBA 4OLZH 1TZGL 3JWNC 2ZONA 5DI8B 1G84A 3CH8A 5DMGD 4NDMB 5KVDL 4LESA 3WHXA 1GGYA 1YY9D 3KXFD 4KZDH 1J88A 1XIWD 3BEWB 1FDLH 1MLCA 3WKQA 2DS4A 3V8CA 4DPBX 1MZZA 4M48H 5EUKA 3Q5OA 4L4TB 3ESVF 3E80A 4FTVE 4MSWA 4OFIA 4YE0A 1A6WH 4MD5B 2O6DA 2X87A 3ZL1A 4Z9KB 3KDPB 5LCVH 4WGKA 5IB2A 5I75C 1FYTD 4U1GC 1UZ6E 2EIEA 2GSMB 3ES6A 2VSKB 4JAMA 2E27L 1FFPB 4NOFA 3M45A 4RMVA 5EEXA 3S36H 3V6FA 3PQYB 2KLSA 5T1MB 3VJ6A 1GL4B 1B2WH 2YD9A 3H55A 1BQLL 4LMQI 5IROA 2ROXA 1M56B 2CLRA 3ZYOA 3GGWA 2XWJA 3QFGA 1YUHB 2OL3B 2VW7A 2CGRL 4MNQB 3UTTD 3HG1E 3G3LA 2OQJA 1ZS8B 3JXAA 3MTXA 4E0RA 5F96L 3QZLA 3GBDA 3NN8A 4NZTH 2RTTA 1KTDA 1VLXA 1F3JA 2JB6B 3F7VB 3AGVA 5T3XH 5E99L 1KG0B 4WIQA 2YBRA 3ZUNC 1G6RL 1QW8A 2HPOA 2WKGA 4FXGC 1Y07A 2X40A 2NR6D 3OLEA 4L0PB 2AMUA 3BIKB 2HH0L 1HT6A 3B5TA 3DXAD 4L1TA 4OIAA 3O2WH 4LIQL 1KC5L 1ZT7A 1A1NB 5IBTH 3H4HA 2EUZA 1I7ZB 3VWKB 1KJ2A 4GAFB 2IDCA 4JR9H 4RMQA 4UT9A 1K4CB 4JFEB 4J6RH 1A1OA 2ISDA 4OF5A 1SXZA 4Z3GA 5L9DL 2AJUH 2DI7A 2O5YH 4O02A 3MFFB 4Y5YB 1AD0A 1OCWL 2EC9U 1FFOA 4NLAA 4Q6KA 1DBAL 2Q3XA 3HZVA 1W80A 1Z7JA 1XGRB 5IOPB 1QYGL 3AITA 2R56H 4LT7A 1I8LA 1NSNL 2R2EB 4MCNA 4ODBD 5I23A 3X1NA 4PW3A 4U3SA 3WFBH 1HOCB 1RURH 2B9AA 3TO4A 1NCCH 4MJ4A 1KBPA 4EN2A 1WZAA 1T04A 3ZZ1A 1BLIA 3K2KA 4H8WH 4G2AA 3OPUA 3GPSA 4G6MH 4FQ2L 4NQUA 4CUCA 2C9AA 2MNWA 4BFGA 2VLRB 1C7TA 3WXWL 2DLFL 3AWFA 3C9NA 4K71C 5CIPB 5DLLA 4ZYKB 2R23B 5GGRB 2E56A 1ZE3C 2QR0A 5C0IB 3RX5A 1PKQB 4WO4C 3BFOA 1ZLEA 2ZUWA 3FFDA 1DJHA 3CVDA 1A6VL 5D1ZB 1AKPA 4H13C 2XX0A 1WQVT 4LBEB 1T5WB 2ICWI 1NL0L 4LAJH 2VAJA 1C5BL 2VRQA 5C1MB 1R24A 3GFUA 3DKHA 4YHOH 4JFZL 3ZTJG 4OQTA 1ZDQA 4XNXH 5D1XD 1MHCA 4PWGA 5E8OB 5GSVA 2OMYA 1U2CA 1GYAA 1NJ9B 3V7MA 1ZLSL 4JGUA 3U36A 2V3EA 1TYJA 2ZSVA 4WWKD 4J3XA 4DESA 2B7DT 1JZGA 2G9KA 1T22B 2L7JA 2QLYA 3CU7A 4JZJB 2BVYA 1WITA 4Y5XA 4XN8A 3AY4C 4HX1B 1RHHA 2LT9A 5DZPA 5DSCA 1EHAA 3P9LB 3QQDB 4K55A 5KVGE 2WXPA 3QUYD 2DL2A 3II3A 2VJ0A 2ZOOA 3ULUD 1U93B 1IC4L 1UKTA 1NMBH 5EOCL 1E5CA 1NPNA 2HRLA 2RB8A 3F2LA 3GRWA 1FIGH 3EYOA 4ONFL 4Q0XH 4RAUA 5ITFB 4AYMC 4DO5A 2YN5A 1DE4B 3GMNA 4ELMF 1HEZA 1S2EA 2MQCA 4N2CA 3DX9B 3NP4A 4O5LL 4PJDB 2OMTB 3NCFB 4ZPTA 2GABA 3BN9C 3TV8A 4FOMA 4LSTH 3RTQB 4G8GB 4Q58C 3NT0A 4JFHD 4PHXA 2Z31D 3FUMA 3NACL 5K9KA 3QXDA 1NGWB 3MRGA 3T0EE 3C5XA 1ZCRA 2BNUA 1T20B 4JVPA 5KVEE 4NQDE 1OZTG 2YAQA 4CBZA 1NKOA 1UTDA 4AYEC 3CFKA 3QCVH 1UWYA 1Z9PA 2VT0A 2EACA 2W81C 2Q8BH 3GSUB 4UMGA 2NLJA 4NKIH 1KIRA 1RUQH 3T2QA 2EXWC 1CBVL 1AIFA 1C16A 3WGVB 2VGLM 2FO1A 1CT8B 2AITA 3UC0H 4WWID 4K8RL 4NZFA 1A6TB 1FGNH 1FZMA 2MOVA 2BJML 4YSSA 2IH1A 2XQ0A 1AZRA 4YDVB 3RHWK 3KPRE 5I82A 5CCGE 3H54A 5I6MA 1I4FA 5EO1B 2OR7A 3F7RA 3VFRA 2OK0H 2CE6A 1RULH 2FGZA 1GTNA 1D5BA 5E8DH 1WT5C 1WZ1H 2ADGB 3LRKA 3V7AG 4X9GA 1ZANH 1AGBB 1RUAH 2YLKA 1OCCB 32C2B 5I1IH 3SBWA 2IV9A 3TH2T 1EERB 5DYFA 3OMAB 4A1RA 2M8XA 2E47A 5DURB 3F84A 4QTFA 4YBHA 3UZEA 2XTJD 3ZKND 4BA0A 5K39A 5JIDA 3QDMA 1IZKA 4PY7B 2MPAL 4AI7A 5LLIC 2D7OA 4EN3C 2YWZA 2IPUG 5GGRY 4BXVA 4QJ3B 5ADOL 2QDVA 2BXZA 1QUNB 3ESMA 3MNWB 4UTAH 5IHLB 4I77L 1B9ZA 2A73A 3HC4L 2IALB 2DIJA 2YRLA 3NG5A 4LGSB 3LXUX 4HP5A 3RI5F 1MIEH 4JB9L 4ZBJA 3EDFA 4KUCD 2P5WB 3UTOA 3APDA 1MY7A 3QRGH 3QRLA 3W9DB 4IW4C 4CU8A 2IANB 1H9DA 4U6HB 1ECYA 3NGBB 4LKCA 4JN1H 5FYKL 2R2HA 5GRUH 3ZE2B 1VGEL 2E0PA 3RKPA 1DUYB 4LRIA 2Q8AL 4KMTL 3MI6A 3EZJB 4UQEA 4YSPA 3R4RA 3T4YB 2NXZB 1WTLA 4PV9A 3STBA 4NGHL 5SX4H 2O5ZH 3H3PH 4WEUD 5F6IC 5CJBA 3WNOA 1A9BA 3ABZA 2PR4H 3M6DA 1CWVA 4IS6B 2MQGA 2JB5L 3NEOA 3CHRA 1ZEAL 2ZPKL 3VTAA 1JK9A 4JDEB 4R7LA 1OP9A 5IFAH 3QQ9C 3HS9A 3RL1A 3UYOD 5BO0D 1K8IB 5FYJD 1NKRA 3Q8AA 4NYLA 2K70A 4WUUD 3GXFA 4GSXA 4L3EB 4MZIA 2PO6A 4FG4A 2C7FA 2I9TB 2CO4A 2A38A 3W38A 4XNUL 2VN5A 3BAJA 2BIPA 4KX9A 2OMVB 3VNZA 1WFIA 3TURA 1NGXB 1RP8A 4LLYB 4OGXH 2GHWB 3GSQA 1EFXD 4QHNB 2LVCA 3GTTA 3MLRH 2YMXL 2HLFD 2C9RA 3QUKA 5D7LB 4XC1L 4KBPA 3H7BB 1B4LA 3NTCH 5I6OA 4MCMA 5DZAA 1K8DB 2GKIA 3S5LB 2Y7NA 2BP5M 2DIBA 1DJSA 3JTBA 4NDMA 2OA9A 1UENA 3WNLA 1LDPH 1YEDA 5IESH 1F0LA 3BAEH 1MJ8H 3BEWA 2YAMA 5GZND 3BAYA 2FBOJ 5EZOH 3QZMA 4OQTH 3DJZA 4L4TA 3D0LB 4S1SL 3HZYB 3RJOA 2PTUA 2IPKB 3M1BB 3RVVD 4MD5A 4ZMQA 4XR8C 2EO1A 3O11B 4JN2B 2V37A 2NRDA 3ENEA 2F8VA 3L4XA 1N10A 3T0EC 1FFPA 3G5ZB 3BZEB 1I9RL 1IQDB 3PQYA 3QJHB 3OXRB 5T1MA 4C8XA 4BFIA 4YJZL 3VYNA 4X6DB 2ZSWA 4HFWB 5FYKU 3IDNB 1MREL 3PE9A 4TULL 4Y0GA 3O2DL 4AKOA 2EABA 3KGSA 5E2VH 1YUHA 2OL3A 1DO6A 4MNQA 1FGVL 2YPVL 2DEYX 1H8SA 5C0EB 2A6JB 1ZS8A 1OAXL 3KPQB 4PJIF 3MLXL 4HS3B 4XB8A 5I71C 5C7XL 4Z7QF 3LDBC 4PWJA 5I66B 3FT1A 2JB6A 1F90L 1ZTXH 1B2YA 3F7VA 1IKNC 4QOKE 2LAGB 5D71H 1MAML 1KG0A 2DN7A 2K6ZA 3OKMB 1VENA 3LZNA 3BP5B 2OJ1A 4TUOB 3WENA 1VCAA 3DRQB 1BX2B 1FZOB 3H0TB 3OSVA 4XHJD 3VFWB 1EV2E 2ZXGA 3ZQWA 4ZTOL 1X4YA 2O93L 2VLME 2C9VA 1A1NA 2OS7A 3SY0B 3VB8A 3D1MC 2N1KA 5E03A 3ARXA 4LPYA 3KLQA 4IRJC 1I7ZA 4CC4C 3VWKA 3CBKB 4EKXA 4N87A 3QG7L 1BWWA 1N5AB 4RAVB 4GKOA 5DJ2B 3KPPB 3PWPE 1K4CA 1IGIL 1NMCC 1MCDA 3EJJX 3DETC 1KLUB 3ZKXB 5TQ0L 4TNVK 2CRIA 4JFEA 1WUZA 2NNCA 5FEBA 3W39B 8CGTA 5ECGA 1X5ZA 3Q8EA 4I4WB 4JREC 3ZT5A 3EO9L 3FTVA 1HJBC 2O5XL 2VSDA 4XP4H 5J3HC 4ZX6A 2MJWA 3MFFA 4Y5YA 2NT0A 1BW8A 4LSSL 5D72H 3GKWL 2KDYA 2LABA 5C8JB 2QDWA 1XGRA 2YRZA 1H5BC 4KK9C 3ZQ9A 4A37A 5IOPA 1VPOL 2EDDA 1BVNP 3L1OH 3W2DH 3PP4L 4KX7A 5DZOA 2R2EA 4AEIH 1W8NA 3WS3B 1HOCA 1QRND 2IDUA 3LN5B 4KC3B 3UTSB 4Q9QH 4YDIL 4NJAL 3RBSA 4WI6A 5D1QE 4Q7DA 1MCPL 4POZD 3RWEB 2O1AA 5CCKL 2OBGA 4UZSA 1O0VA 1DQJB 1G4MA 1OAJA 2B1HH 5AG9A 1D5IH 1HDMB 2EIKB 3QXVA 1T03H 2XYBA 4Z7WE 3W1ZA 5CIPA 4S1QL 1C9SA 4TUJB 1YPZE 5HVHB 4ZYKA 4XNQB 2R23A 4GQ9L 5GGRA 3VXRB 1NC2B 2MH4A 3H2PA 4FNPA 3JUYA 5C0IA 1EJOH 1I9EA 1PKQA 1V3MA 2XN1A 3OJMB 5B8CC 4I18C 4HHWA 3RWDB 1KGWA 4C83B 5LNDA 5D1ZA 1JD9A 2AAAA 5B4MD 1UKQA 1T5WA 3CHPA 4LBEA 1TXKA 1LWRA 3W9EB 3QI9C 1EMTH 4FXGB 4FQXC 2WNGA 3DSFH 3I75B 2IMMA 3TEUA 2IWFA 4Z23A 4OKDA 1KCRH 1NJ9A 4NT6B 2VDQB 1A02N 5GS0C 1K3ZA 5TTRA 4TVUA 1LK3L 3LZPA 5C0BE 3HG5A 4MB4A 3HAEG 4HPYH 3S35L 3WE6B 2YA0A 1T22A 4JZJA 3B34A 2IBZY 4HX1A 2EIDA 2DTML 1NCBH 3P9LA 3QQDA 5JHDB 2XZAL 5LUMA 3HMXA 1XCQB 4YOKA 5AOJA 2ROYA 3B1TA 3AMKA 3MV7B 2VXQH 1DBKH 1U93A 2HRHA 5ITFA 4WWOA 4UZGA 4WW1B 1A4KA 4OCXL 1DE4A 2BW5A 4ODVH 4M1CC 3DX9A 3BFWA 4PJDA 5DA4A 2OMTA 1KLFB 2J88H 3ULVE 1YY8B 1FSKC 1UT9A 1SEQL 3BOVA 3RTQA 4G8GA 3R06B 4ISVB 2NY4B 1N7MH 3GEFA 1IT9H 1NAMH 3CBRA 3NQKA 4M6NH 4ZO6A 1T20A 1T21B 2EDYA 1OOWA 2VQ1B 1CZ8H 4TL4A 1BAWA 4GRWB 4ZMTA 2AI0L 4K5PA 3CMOH 1DSYA 4Q9BA 3IS0X 5EEZA 1PLBA 1F4HA 4K71B 4LVNC 5CU5A 4ZRGA 5EBMA 3GSUA 4U1LB 4H5SA 4K3JL 4HUXB 1XCTB 3LD8C 1J87A 4PRHD 2Y07H 4WO4B 4JBSA 2YGVA 2FO8A 2I32A 4ZS6D 1A6TA 4E9QA 1H3UA 2AK1L 3MOQA 1JCKA 4Y1SA 4YDVA 4P23C 3LV3B 1O6SB 4ODSL 3BKML 2ZD0A 5EO1A 4WVRA 4P5KB 3OKLB 3SEPA 2Y1YA 2WZPA 4KFMA 2ADGA 3NMEA 4MQTB 5GGVH 2W0KA 2XWEA 1ZA3B 2KZKA 3EYFB 3LOWA 3PABB 5DYOB 2OKMA 1AGBA 2AV7B 3D85B 4XBMA 3KLHC 3E2HC 32C2A 4HBCH 4TSBL 1GS6X 4F58L 1JNJA 3MOBL 3ARGD 3RX7A 5F72S 3KVQA 3HE7C 4XNMB 3ZE1F 4UYPA 3WIIL 4PY7A 2DD8H 2Z0BA 2FIKB 4HZLB 3AZUA 3RB7A 2J73A 5TQ2L 1NLBH 4YSEA 1QUNA 3VFOA 4PS8A 3MNWA 2ZF9A 3GIZL 3MX0B 2IALA 3MLUL 5F3FA 5K5YA 4FJ6A 3ULUF 5I8KH 2L7UA 3QXAB 2X4QB 4AW4A 2MTAA 3QCUL 3LEYL 2P5WA 4GIAA 4OZGF 3W9DA 5FF6B 1QI3A 1FO0H 2IANA 2VMEA 4FQIH 3UACA 2P5PA 4ZFOB 2DBLH 1QUPA 2RJMA 4XAWH 5LAXB 3ZYZA 2IPUK 5JTWA 4PCSA 1DUYA 1MKFA 2QHRL 3QZPA 5IHBA 4YLQT 1G9ML 3JSSA 1ZV2A 1NLDL 5CP3H 4TLTA 1CLZH 4YSCA 1IKOP 1GGUA 4KWUA 2V9UA 3HG1B 1QSVA 3OWEA 1ACZA 3CN0A 3Q43A 5C0CD 1A47A 1GCYA 5ITBL 3HAEH 2ZYSA 4IS6A 4RQQB 1F86A 2OSYA 1EHLH 1U8NB 1NPJA 4OB5L 4AJ0A 2W65B 2CR6A 4JDEA 2VZ3A 2I60L 3KYAA 1E8YA 4G70B 2QSVA 1A3RH 3VRLF 3LZQA 2J8UE 3PDOB 5LB1A 3DJSA 4S10A 5E4EC 3WS6C 4ZJ9A 1K8IA 3SKNB 1KN2L 1W16A 5E5LA 2YARA 2DI8A 4L3EA 5GGUB 3IAQA 4PJXF 2PP8A 3TX4A 4Z7OE 2X4OB 4WJG3 4Q97A 3IDXL 1PF3A 3FF8A 3BIBX 2OMVA 4OZHE 5E6YA 2YGPA 1QPKA 4XXCC 2ZCKH 1NGXA 4LLYA 4CA4A 4QHNA 4R5XA 5C2BH 2ARJB 5D7LA 5AZ2L 1ZLDA 2CJ3A 3H7BA 4XWOD 5FM4A 2OJZL 1L9TA 1Y6MR 1K8DA 1ROWA 3TZVD 3S5LA 3KBEA 2KKQA 2CG9X 4PYHA 1JNHB 3QJXA 5HI5D 4GSDL 4DFIA 3WEOA 3H56A 4IRSD 4Y19D 1C1EL 3PGFL 1SVZA 4NWUH 3TH4T 1HWHB 3D0LA 4ZZFA 3HZYA 2IPKA 3M1BA 5IP4A 3II1A 4V1DD 3VFUB 4KUCF 1OLZA 3ULVC 4A2EA 5HY9B 1AXIB 1J0ZA 2XN9E 2XQBL 1NCUA 3O11A 4JN2A 5BS0E 3DX8B 2XX1A 3BMVA 5F1KC 4FA7B 4FQHB 3G5ZA 3BO8B 3BZEA 1OTSC 1XF4B 3K8LA 4QHLA 1IQDA 2J57A 3QJHA 1MHPL 3OXRA 4X6DA 4HFWA 1I75A 4L8SA 1J9QA 3IDNA 1TVHB 2WOBA 4O4YL 3C6LC 2VQTA 3B2MA 3SE9H 4KNQA 3RY5A 1YC8A 1U36A 1NIBA 1SUHA 1MCWW 1U2HA 3SGEI 3BDBA 3MKGA 4NJ9H 5C0EA 1HXKA 2A6JA 1J8HE 3BXNB 3KPQA 4JFSA 4HS3A 4TPRL 1B0GB 3FRPG 2ZJSL 3K7UA 5I66A 1KLGB 2APXA 3EH3B 2AEWA 5FYLD 3T65B 1SNRA 2HFTA 3LS5H 4YDMA 4MXWL 3ZBMA 5BVJB 2Y7QB 1KEGH 1BXUA 3OKMA 1HZHH 1F3RB 2CHXA 3BP5A 3RNKB 4TUOA 3DRQA 2YOAA 1BX2A 1TZHB 3H0TA 4FG6D 3VFWA 2EYTB 2VCOA 4IJTA 5CBEB 5CR8A 3RGVA 3WHE1 2YPLE 1KCSH 5E5RB 1RZPA 2WB7A 4IGBD 1E2VA 1WBXB 3D08A 2ZXDA 3ARSA 1JXFA 1N5AA 4HS8H 1R19A 3CFDB 3GTNA 5DJ2A 3KPPA 4NQCD 4YE4L 4PRIE 3FDWA 1KLUA 5D4JA 4XMLH 3VI3E 2GTQA 3A4DA 3W39A 4HAKA 3LH9A 1F5WA 2P28B 5ICXB 3U1SL 3AREB 4P4KD 5F1SA 3DPBB 1JGUL 4ABUA 4DIXA 3K4DA 4L48A 1IC0A 3TYFB 4PP2B 5F8QC 3GI9H 5T5FH 1XL4A 5C8JA 3D4GA 5IHUL 3LQAH 4IOFC 3O4OC 2AJYH 3KBHE 3OHMB 5E4IA 4ZX3A 1QWNA 4FLQA 4K9EL 3VXUD 5HGDB 3VGFA 4GG6E 1T1XB 4CAGA 4URKA 2GY5A 3WS3A 3T0EB 1E4XH 5J6GB 4PJHE 3LN5A 2DQCH 4GT7A 2EO9A 3UTSA 1UT2A 3UBXI 2ILLA 4GYBA 3BCDA 3DGCR 5DEFB 3TV3L 3GSWB 3RWEA 1PU0A 1DQJA 4K2UL 4KUZH 1L4IA 1HDMA 4LEOA 1QRKA 3FQ2A 5IK3B 5C6WH 4KPHH 4NNPL 2R0LH 2VMJA 2C7UB 3LEXB 4LSQH 4M61B 4TUJA 4XNQA 3S37X 1J9TA 3VXRA 1NC2A 4A66A 3UG4A 2VC2H 1J5IA 5CS7A 5FFOA 3CX5K 3KPSE 2RH0A 1TETL 3E8VA 1NC4D 3OSKA 4PJ5B 3D69B 5DD5L 1FUNA 3KPRB 3GMLB 3RWDA 4C83A 3QJSB 3CFUA 4C56D 4UILL 5EIIG 1M7IB 3W9EA 3NSYA 2DYSB 5DVMA 4FXGA 1EDQA 2DICA 4XO8A 1TJIH 4ZX5A 4EF3A 3I75A 4Q56A 4HUWB 4PGEB 1MWAH 1JWMB 4NT6A 1CF8H 3PHOB 4G8EB 3GHBH 4WFGD 4KK6D 4KRPC 3X3FL 5DC9B 1OCZB 1XSOA 4XTRD 3U79A 5SV3A 1N3NB 2E7DA 5BXFB 1LO5A 1NMCB 4AXWB 1M4KA 1KBKA 4LSUL 5E6RB 3PHSA 5AVWB 4C4KO 5JHDA 3L54A 1XCQA 4KY1H 4DKTA 2PF6A 3WY2A 1M2OA 2PP7A 4A7TA 3MV7A 3U6RB 3NA9L 3P9MB 1UACL 1I3VA 4CVZB 3GZQA 1TCRB 4N2GA 2FATH 1HHJB 4WW1A 1YA5A 4XNDA 1SXNA 3TA4D 1KLFA 3H9ZA 1RZQA 1YY8A 3TIEB 1JL8A 3R06A 1JTTA 4ISVA 3N85L 5BNXD 3L4WA 2IIJA 4G6AC 4JO8A 5CZXC 4G82A 1T21A 1VB9A 2AXJA 3QZWB 5ESAB 5C92A 2VQ1A 3P30L 4FXKC 1SXAA 2H26B 4LOUC 1A65A 3BAKA 4KRMB 3EW3B 3M07A 3QBTB 4LVHB 2VDRL 4P04A 3RJDA 3L81A 4U1LA 4HUXA 4XPAL 1XCTA 4H8VA 1MFEL 3KBPA 1EIBA 3T77A 3EJYC 3AXHA 4DSYA 3U0WL 4WO4A 5B8CB 4BFOA 3QGVA 1B4JL 4HMCA 2EVJA 4KZEL 3VGHA 1JGLH 5DJXB 5E1HB 3LV3A 1O6SA 1YEWA 4DQOL 2APTA 3MYJB 1XGQB 3D33A 4P5KA 3VU2A 1ZWIB 3OKLA 5IVOA 3BYTA 2ZYHA 1ZA3A 3EYFA 3BDYL 2YA2A 1NDGB 3PABA 4PS7A 2VJ8A 3HR5A 5DYOA 1CXIA 2AV7A 4HT1H 4BQ9A 4YXLL 3D85A 5CO1A 4CBPA 4F7MB 2E46A 4KHTL 3FNKA 4LPVA 4YHMH 1KPUB 3VO0A 1V3KA 3LZRA 4XNMA 3G6JE 5TH2A 3HR6A 5HYIA 1OCOB 4NKOB 5DT1L 3Q5TA 3ZTDC 2FT7A 2OAAA 2DWTA 2FIKA 4HZLA 1AZBA 3V6OE 4UT6L 4PBDA 4IDJL 4YSRA 3I50L 5GS3A 2Q2LA 4OJFL 4HLEA 3MX0A 4FTVA 4EI5D 4L1SA 1E2WA 2WWMD 2X4QA 3O6ML 3QXAA 4IKLA 7PAZA 4OZFB 4PJ9D 3RVUD 2G9HB 5DFAA 4TNWF 5FF6A 3HA0A 4I5BB 2VDNB 4H0GA 4Z3EA 4ZFOA 4NPJA 4NM4H 2WZAA 2ICWJ 4YIQB 2OMBA 3D50A 5LAXA 3P4NB 4OAWB 1CJYA 2JELH 3CN1A 4Y2NA 1KTBA 5D70L 2B39A 2R9HC 3KWVA 4ZAKD 3IFNH 1T0OA 3NDYE 4DKFL 4W6YB 5D4QA 1WD8A 3HMWH 2YD7A 3HG1A 5AKVA 2AV1B 4OUUB 1IVLA 2WO4A 1TYEB 2QQNL 4LVNB 5KG9B 2J5LC 1PFCA 4F8PA 4U4BA 1U8NA 2E6JA 3GZPA 1WF5A 1DQLH 2W65A 3RFRA 4AIZB 5MI0C 3L3DB 1FAIL 4QOKB 3FO1A 4AL8H 2WXJA 3C5ZC 4H0IA 3PDOA 3JVGC 3HNTH 1AY1H 1UWGL 1W72B 2ZG1A 4MMXB 2HTLD 3QCTH 4NOBA 4LSVL 1HYSD 3SKNA 1KCVL 4PJAB 5E7FA 3TIDB 5GGUA 1ZT4B 2PCXA 4JFXB 1AFVL 2X4OA 3WJJC 1WT5A 1GTFA 2EXSA 4YHLL 3UJTL 1ACYL 5BQ7B 3MUHL 4I87A 1F4YL 2G2RB 5KSBE 3GXTA 3QIBC 3PWPB 2PXYB 2ARJA 4NIKB 4DGWC 5FO9B 5IJVB 5HHME 3QHFL 3ARDC 5AW5B 1KBVA 5A6LA 4BJLA 4EIGB 4JKWA 2Y1AA 2I24N 4WLCA 5IEHB 4R4BB 1TTFA 1JNHA 3ABMB 1M3IA 4JDTL 2GUYA 1VHPA 5MP6H 2LFEA 4PG9B 1SXCA 5DUPL 2G30A 1QSFD 2WLKA 3CZNA 3VRJB 1FZJB 1HHHB 1J86A 5EIQA 2VDQH 1P2CB 1LHZA 3VFUA 1B0WA 4R4NC 3A6CL 3UO1L 5AENA 1RU9H 1J1XH 4K3EL 5HY9A 2VZ1A 3BSGA 3PU7A 4JM2C 1ERNA 2ZYIA 3DX8A 2DWYA 2GIXA 1KB9K 2D9QB 3PWLB 3GUTB 1AXTL 1NWPA 5EZIH 2JTYA 3BO8A 2E76C 5A3IC 3CFCL 5D1QB 1SJHB 4TVPL 4FMFA 2OR9L 3INUH 1G1KA 4NKDB 4LK4A 5EU4B 2E6QA 5EN3A 3MBXL 4M1GH 4Z7WB 1S9YB 1PY0A 1RV6X 5GRZA 5JDSB 3C60D 1MQKL 5TF1H 3CZJA 3BXNA 5A6MA 2CJTA 4XVTH 3HFML 1QLEL 1B0GA 4DO6A 1VERA 2EEFA 3T3MF 3MR9B 3T1WA 1KLGA 2F7QA 3T65A 2HKFL 3VXMD 4QF1B 5LBGA 1WAEA 4WTZG 2HTKC 5BVJA 1S6NA 4WEBH 1KY6A 2Y7QA 3DX1A 1KYOJ 2Y7OA 2C3GA 3FT2B 3X1FA 4B0MB 1PZBA 4JFDE 3RNKA 2ETWA 4IU2B 1TZHA 2E4FA 4AYGA 4A2LA 2OZ4A 2EYTA 4ELME 1XEDA 1F56A 5CBEA 1KY7A 2Z92B 1BQHG 5TE4L 3GI8H 1MELA 2YRBA 5C0BB 4YEFA 1WBXA 4UI2A 1UB6B 4UOW0 3CFDA 1F02I 3EOAB 3B2PA 3HUJE 1UCTA 3QT2A 4EBQL 1NUDA 2BNQE 4V2BA 3V6OC 3C09C 1QWHA 3I85A 2HX7A 4KXDA 1OP5H 5ICXA 2VO5A 4CVWA 3EFOB 1I8MB 1UM4L 3DPBA 4QYAA 3RZCB 4YL9A 1AQKL 4HXBL 3SD5A 2FX8H 2YQBA 3TYFA 4PP2A 3RL2B 1XTLA 1TQBC 2X10A 4HHGA 4MYWB 1JN6B 4POYA 4XE5B 4U6VH 3ATDA 3EJRA 2L4OA 4QDGA 5HGDA 5I18L 3G6AB 1T1XA 4C47A 1EK3A 1PZDA 2A9CA 2DZEA 2FSEB 4HAGA 4HWZB 4LHUD 5JW3H 3UDWC 3T0EA 1MF2H 3D2UB 1C5DB 1H0DA 1MIMH 3B4NA 4YC2B 2GK2A 2PYEE 3QJQB 4XO4A 3IE4A 5DEFA 3GSWA 3KD4A 1SHMA 1L9RA 4X6CF 3L6FB 5E8PB 3CSPA 4K9JA 3TBTB 2AQ3A 4MB5A 4CU7A 3CNKA 5IK3A 1YAZA 3RBGA 2C7UA 3B37A 2ENQA 4AG4L 4UDUB 3FUJA 4PSPA 1MFVA 4R7VA 2F53E 3PLYA 5GJSH 5ABAA 1KPVB 4G1EB 4PJ5A 3D69A 3E6FB 2VH5H 1IKNA 3KPRA 3GMLA 3GXUB 4GJTB 3SYPA 4A2FA 5E6ID 5HHXL 3AT8A 2VKWA 3X13B 1M7IA 3VXSB 1ODUA 5IWLC 3JT0A 3K1KC 2ADIB 1HINL 3TCXA 4RGND 4MA8H 3UZQB 4HUWA 4K3GA 4PGEA 3OPZH 2YLHA 1JWMA 4NBXB 4IOSD 2N4IA 2WBXA 3PHOA 4GNKB 1Q0YL 5DJ6B 4HALA 4CKVX 2HKAA 4G8EA 2EE0A 1JSYA 3ZKMC 3ECQA 4QR7A 1IC7H 1ESOA 3DJTA 2YR3A 1K9TA 3EYQD 5DWUL 1ZPLA 1N3NA 5BXFA 2KC0A 3N43B 4AXWA 1MFDL 3IMWA 2ATAA 3BVXA 2QT6A 3F58L 4U3XA 3SKUD 3NOIA 1UA6H 1RH8A 2DV6A 2BHYA 2F68X 3SDYH 4LF3B 5DF0A 2OW7A 5AB2A 5ANME 1DFBL 2IJ0C 2DDQL 4NXKA 3U6RA 4LHJB 3P9MA 3WAJA 4CVZA 1HS6A 3DI2B 4BUQA 1TCRA 4PQXA 4R97C 2CUHA 4DTGL 1HHJA 4RRPM 4OGQC 5ILTL 4LQFL 4DQAA 4JFVA 3L4CA 2X4SB 3CZLA 4R2GD 4WV1C 3WSQL 3O4OB 5JLZB 2YZ8A 3O2VL 5KOVC 3G9AB 3TIEA 5CLXA 3RWIB 4M7LH 4CADB 3BRDA 4B9GA 3QUMB 4KAQH 4JFTA 1UH2A 3W81A 4FP8H 4WEMB 5E9DD 3FCGA 4GRLD 1IX2A 3NFPB 3QZWA 3EH4B 5ESAA 3HCVB 2P5ED 4U4IA 2HVJB 4H8QA 2O6EA 3QJFB 4P9MH 1GS7A 4HCGA 3US1A 4PPTA 3MUZ1 4NNXB 3BUTA 4G7YH 4OLZL 4Y4HD 1IKFH 1L7IH 4ZW8A 4QTIH 4N1EA 5E1QA 4KZDL 2ZE0A 3VG9B 2NY7H 1FDLL 3MJGX 5B8CA 2HT4C 4MWFB 2LHAA 1GKEA 3JVFC 1IAMA 3MCYA 4M48L 4PIRF 1A8JH 2HX8A 4GP8B 4L0ZA 4ZI8A 5HVWA 2ZUSA 5DJXA 1A6WL 3ZTEA 1I85C 3OZ9H 2YEZB 3SCMC 4Z7OB 3MKKA 1XGQA 3QI9A 1ZWIA 3O4LE 3VGAC 2JIXD 1LQSR 2J43A 1NDGA 4TQHA 4ZXBC 5FLUA 4R4FL 4F93B 3N1MC 3GYRA 5CXPA 4F7MA 4DUWA 1B2WL 3WYRA 1NCAH 1KPUA 2YQ3A 5BOZG 3B2VL 4I1PA 4JRYD 4IKIA 3HFFA 1SXBA 4MB3A 4RMUA 4I3GA 2W60B 1R5WB 1OAUL 1XL6A 1KJVB 3V9CA 5BRZE 1BQSA 3NZSA 4NZTL 4OLWL 2EDKA 4PJIE 2WY3B 4KZ0A 1E3FA 1XR9B 4OZFA 5T3XL 4Z7QE 2XN9B 3RWFB 2G9HA 1S3KH 4I5BA 5BS0B 5GGTA 4U1JB 4BZ1H 5T1LD 2C9UA 4LLUB 4YIQA 5MENE 1N9PA 3OAZH 3P4NA 4OAWA 4B50A 3O2WL 1QBMH 4AGQA 1ADQA 3Q8BA 5IBTL 1FLTX 2BSRA 5EULV 1TSRA 2IH9A 2CR3A 2H1XA 2RQEA 5B21A 2ZOWA 4RX4D 3SDDC 4KI5E 4JR9L 3IFLL 1ZA6B 2AV1A 1WCQA 4OUUA 4FG0A 2PABA 5KBLA 1TENA 3KLKA 1J8HB 3OLGA 2OSLB 2OULB 2HG5B 4J6RL 5KG9A 4KJPD 3RI5K 5BO1H 1MCQA 4AIZA 2AJUL 2B4CC 2O5YL 3L3DA 3OB8A 4QOKA 4B9CA 5K59F 2P8PB 3DURB 2ITCB 2CK0H 4CL7A 1G9EA 4MMXA 3KXFE 3H6AA 4P23A 2AZUA 1OP5K 1WGOA 3TIDA 5TE7H 2R56L 2O6FA 5AVXB 2GUOB 3EJCA 1ZT4A 3CZGA 4JFXA 3ECWA 4I8DA 3VTTA 5A43C 3HE6D 4N2DA 4AC4A 3MRDA 2WUCH 5BQ7A 2C4FT 3FQUB 1RURL 3WFBL 3WUWB 1FNLA 4FNUA 1P0SE 2G2RA 4H8WL 3P3RA 4G6ML 4KKRA 4HK3N 3PWPA 2PXYA 1QFHA 5FO9A 5IJVA 4PRIB 1LE5A 1L6XA 1I8IB 3N42F 1WSST 1WA1X 4E41D 2GHZA 1ASPA 1DEEB 2VN6A 3FUFA 5F7NC 3NZUA 4KHXL 4R4BA 5GGVY 3ZSTA 5IEHA 4I0KA 2ZOUA 2OSWA 3HHMA 2D0FA 4G72B 1A66A 4PG9A 3UTTE 4HHAB 1DANT 3MJ9A 4M9PA 1OZUA 4GLRI 4GQRA 3VRJA 1FZJA 3R8BB 5J1SC 1INQB 1P2CA 4XPTH 4L1HA 2UUDH 4DERA 4GG6B 1BZOA 1PIGA 2XUWA 4OFVA 3PWLA 1CPUA 5IG7B 3GUTA 2Y2YA 4XNXL 3M86A 3GQFA 3B2UD 5D1QA 1D6EB 1SJHA 3K6FA 1XF3B 4OF0A 2NYYD 1OQOA 5AYUH 5DD0H 4UQIM 4ZFZB 1FQ9C 5A2AA 4M56A 4NKDA 2VUYA 5EU4A 3LNEA 4NCC1 1FCCA 4M00A 4Z7WA 2LLNA 1S9YA 1L9MA 4NQVB 1NBZB 4MMZB 5IBUG 1YPZA 3KGUA 2J1XA 4BGDA 2X4UB 3OF6A 5JDSA 5LHDA 5E2WH 3N91A 5KSAC 2AK4E 4M8UA 3OBAA 4YFDB 3MR9A 5IM7B 1CFVH 4YSTA 4ONOA 2G3MA 4QF1A 3W0WE 1FIGL 4Q0XL 1GC1C 2BNRB 3HC3L 3WS6A 2YRPA 3WFDH 5I1JL 3FT2A 2B16A 3Q9QA 5D55A 3AM8A 4ZMXA 4J3WA 2OMZA 1MCSA 4MZ3A 4IU2A 4OI8A 2MKLC 3LPOA 3QUXB 3D5OF 5JUEL 1BOYA 1UWEL 4LSTL 2Z92A 2Z8RA 4KV5F 4YH6A 2Y5QA 3ARBD 1H15B 2Y1VA 2WQAA 1IM9A 1TKWB 4XXCA 5C0BA 1DVXA 2E86A 3WJMB 2UXFA 2YSSB 4GW1B 5HBBA 3QIBB 4GAGL 1I1CA 4IBYA 3ULUH 1WK0A 1A22B 1UB6A 2VW4A 4QRUB 3OKOB 3EOAA 5AVRB 1MUJB 3ARDB 1HIML 2QKIB 4JGJA 3CSYB 1T80A 3EGSB 3F01A 3U83A 5EU5B 1G43A 4NKIL 5D2LE 4RZCB 3OAUH 3OGOE 4ZW7A 3EGXB 1KF9B 5HI4C 3FYIB 1RUQL 3EFOA 1I8MA 1C5CL 5JIMA 3WXVL 2MQ3A 3UC0L 3RZCA 4LCUB 2XJLA 2YD5A 3APMA 2F5BH 1TFPA 3RL2A 5B3SB 1ASQA 4FHBD 3CVHB 4PRPD 5EF1A 3IWVA 2WCGA 4M4PA 2XPZA 1JN6A 3NCBB 9CGTA 4GAAA 3MU3A 5IZ7A 2OK0L 4XWGH 5AALA 4ZMAT 4JM2B 5E8DL 1ET5A 1WZ1L 2DQJH 3DK0A 3G6AA 3V9EA 5JXAH 1CMOA 1HEJC 2FSEA 3MGOB 4HWZA 4MS8D 1NUNB 1ZANL 1R47A 4XN4A 1WO2A 3D2UA 3IXAB 5I1IL 4FFWC 3QIUD 1IL1B 1NCHA 4KI5C 5I8OL 3B5GA 4YMPA 2OYKA 1FBIH 3L6FA 5E8PA 3LMJL 3TBTA 4JQIH 4YNYB 3CFJB 4E9RA 3UFIA 1TQCC 3DUUB 5EOCJ 4UDUA 5GGTH 4WWPA 1JDAA 4OIIH 4LL9A 4UTAL 2DWEB 2YGNA 1D7DA 1KPVA 1OP4A 3ATFA 4G1EA 1MIEL 1VZGA 1XIWC 5IQ9B 3E6FA 1E90A 1OT1A 4TLUA 4WFFD 4XE0A 2HRPH 5HD8D 3QRGL 3U2JA 3X13A 3S2CA 4BZ2A 5KTEL 1BYPA 1S78D 1CYWA 5F1OB 5FV1L 2KPWA 5MHSE 4OZGE 5FLVA 2ADIA 3K4ZA 3UZQA 3ARTA 4XMUA 1EAOA 4XO3A 1RD6A 3KPNB 4NAJA 3ZX1A 1CDUA 3FAXA 4J39A 4YLBA 1UEMA 5DJ6A 4GO6B 1DQTA 3G6JB 3A0OA 3L5IA 3A6OA 1LWJA 1EFQA 2O5ZL 3OAZK 3E9TA 3P2TA 5I1AB 1D7BA 4XMKH 3UAJC 1W72H 2NX5B 1E8WA 3HB3D 2VMDA 2PR4L 3K80A 3PAZA 1XMEB 3B6SB 2Y36H 5CILH 5BZWB 2NCEA 4UBDD 1C12B 1WC7B 2ADYA 1S7SB 4J3SA 4AH2B 2EO7A 3ZOAA 3E1ZA 2E8ZA 3U4BH 4TL5A 5IFAL 1TOXA 1MFMA 3BRFA 1IAOB 3PP3H 4JM0A 5MEOB 2X0WA 1TQBB 3BUDA 1DLHB 1PIFA 1R3IL 4W4NA 2X4SA 4PCKA 3VRLE 1NFAA 2NW2B 5JLZA 1YEIH 4HIEB 2WCSA 5C7ZA 2XIIA 2EVIA 1WS8A 1CQYA 4CADA 1TJXA 5CJQH 4WI0B 1QR4A 3QUMA 2NR6C 2G5UA 5AKSA 4B60A 3CCHB 4PJXE 2AVFA 1MEXH 2ZCLH 3F00A 4OGXL 1ACXA 5D7KD 3NIFF 3NFPA 2WXOA 3HCVA 3MLRL 2JF1A 4FFYH 2HVJA 1OGAE 4A6YL 3QJFA 2YUZA 4J3OD 3BT2H 5I6NA 3NTCL 3BUPA 3MJ9H 2UX7A 4NNXA 3L9EA 4WHCA 2Z7UA 3MRFB 4BQ6A 2R0KH 1M57B 1RZGB 3X12A 1D3CA 3N44F 3X14B 4HSAC 1LDPL 4N28A 5HYJB 3S97C 1U9KA 3BAEL 5DO2D 5B38B 1MJ8L 5IBLC 5EZOL 4MWFA 3T0VA 2UVEA 4WU7B 3FSWA 4HD5A 2CJSA 4YHPB 2QPDB 1CB4A 4QLRA 4UNTA 1XF1A 3FTSA 3MVSA 4KKLC 2YEZA 4ZUWB 2H2PD 1QLFB 3AROA 5K1NA 1OKEA 3JWOC 1CGVA 3U4EB 2EEAA 1TEYA 5B22A 1CXEA 4LCYB 5KSBB 2UUDK 5GIRB 3D4YA 1S8DB 5HHMB 2ZUVA 5F7UA 3GBMH 2N59A 3JWDH 4L3CA 1F00I 2MCMA 3SODB 5E2VL 1I1AD 1Z3GH 1A6AB 1MLBB 4R83A 2YC1B 2XFXB 1R5WA 2YAPA 4IK7A 1J9SA 4JO3H 1KJVA 5CCHE 4DZBB 5AL8A 4ZMOA 3CXFA 1AR2A 2Q6WB 1S7XB 1TMQA 1P5UC 1ZTXL 1YYCA 5KZCB 4R97B 4WGWB 4XMPL 4CC1A 5D71L 1XR9A 3K6IA 2W9DH 5F7HA 2XN9A 3RWFA 1ET8A 4WV1B 3GLZA 1CUOA 5BS0A 3PHQB 4U1JA 3RURA 1F1AA 2K45A 4LLUA 3RVTD 4MCZB 4FMVA 1SYVB 3ZMRA 1WH0A 2D4FA 3IJEA 2WKOA 1N5YH 5H37G 5FYJE 2ZXEB 4WUUE 1WISA 2Y1ZA 5DGRA 4AW7A 5M7QA 4NB7A 4KKZA 5D1XC 3ML8A 3IETB 2MRYA 2JKWA 2APSA 4X9YA 2WQUA 4RFEB 1ZA6A 2X3CA 5E9AA 4X6FB 2WO2B 4R84A 4Z7VF 2DYPA 2FT8A 3FPXA 4IDLA 1J8HA 2OSLA 1UHVA 1WA2X 2HG5A 2R29A 4KQ0A 1JWUB 2V33A 5FCUH 3VDCA 1SVBA 1OSEA 2DH3A 4MDJB 1S46A 3RY6A 5JHAA 4GO9A 3H9YA 3D34A 2J1ZA 2P24B 3QUYC 3BAXA 2P8PA 5GGSB 5D72L 1WS7A 2ITCA 2YMOA 1G5GA 4UQAA 3ULAB 2FUQA 4P5TB 1URIA 4UOJA 1TFHA 3SCMB 4ELMB 2GUOA 1TZAA 5CLZA 2MCAA 3L1OL 3W2DL 4DKDC 1B4RA 4AEIL 2YPLA 2NDFA 2ZQKA 2OSXA 3H9HB 3KL0A 4P46C 1P5VB 3LNHA 4PVNA 4ZXBB 2W0LA 4Q9QL 3EBAA 1RZ8B 3DO4A 3U30B 5IGXH 2BOBB 1CVSC 5ALBH 2Z31C 5CJ8A 3WKNA 2YAEA 4YGAB 3HUJB 2V0AA 2WSKA 2B1HL 4PRIA 1D5IL 1I8IA 2BNQB 3DSNB 1T03L 4D7BA 5LBSH 1DEEA 4NM8H 4UIKH 3ZO0A 3NCYS 3AS0A 4BZ2H 5JR1H 1QZ1A 2K7QA 3CXHJ 3RDJA 2WQVA 4N2MA 1EJOL 4GXVH 5AYQA 5CM1A 1CO1A 2DMHA 2X0UA 5T3ZD 3WEXA 4HHAA 3B5HA 4Y2DD 3T3PE 4XNYH 3VFMB 3DDFA 3M7FB 3P54A 4HWEH 3UG5A 1INQA 5I73C 3SKOB 3W37A 2H0JA 4JHAH 3ZDZF 4GG6A 4H88H 1EMTL 3C87A 3G04A 3DMMD 3DSFL 2IFGA 4PJHA 5IG7A 2FJFB 5DRXB 1BF2A 3NABH 2PYEB 1D6EA 4IBTA 1KCRL 1SJMA 3U7YH 1U8QB 4ZFZA 1UADC 1KGUA 5SX5H 5F88B 1CFTB 1N8ZB 3VYOA 4HPYL 1UASA 3SDDB 1BD2D 5KW9H 3TPKA 4NQVA 1NBZA 3MC0A 3IF1B 4HUVB 2X4UA 1NCBL 2XTJC 3PWUB 3WUWG 5IT2H 4JHWH 2NZIA 1KIQA 1CK0H 1JZFA 2A9BA 2VXQL 1DBKL 5IM7A 3BQUD 3QUMH 3THMH 3VWJB 1SHXA 3X11B 1AHMA 4ODVL 4G6KH 2C1OB 3L3HB 2J88L 3SGDH 3TBBA 3QUXA 3WJJA 1CGSL 2LQRA 1FJ1B 4L1BA 5HHOB 4OJCA 3FH8A 2C9PA 1IT9L 1NAML 3VXNB 1H15A 2OTUB 4M6NL 1TKWA 4MFHA 5KYYB 1IBGH 3WJMA 2YSSA 4GW1A 3QYMA 1CZ8L 3DYMA 3QIBA 3VD5A 4QRUA 3IMUA 2QQLH 3OKOA 1MUJA 1NCWH 4MXQD 4HLZG 3ARDA 4K7PX 2JH2A 3NJJA 2QKIA 1BVKB 4I88A 1E6OH 5EU6E 2IOMA 3CSYA 3EGSA 3SD2A 5BZDB 1FA4A 5ANMB 3LKOB 4RZCA 4LRNH 3X2QB 1NINA 2IGLA 4A7GF 2Y07L 5FCSH 1RVFH 1T6WA 5HVGB 3A5VA 1HL8A 4LCUA 3U82B 5GGSY 2ZWKA 4QRQB 1AACA 2W1NA 1S7UB 3VCLB 4RGOH 2LOEA 3CVHA 4E9XA 4OVVA 4NPYB 3VYPA 5J0BA 3L9YA 4JM2A 2RCSH 4L3AA 5GGVL 3H53A 4Z76B 3MGOA 2F8IA 1DVFC 2J1WA 5EA0H 4WF7A 1F13A 5CEZE 3TF7C 3IXAA 1FC2D 2P8MA 4KJWD 3CXDL 4HBCL 1IL1A 2FHCA 1YZZA 2FL5B 2IPTH 5HPMB 4ODWB 1IMHC 3SYAA 4NO0A 4YNYA 2JQZA 3CFJA 1WGVA 3DUUA 1NEZG 3FT3B 3ARRA 5KSAB 2AQTA 3FUEA 1R46A 5I2IB 5JO5B 4EQ2A 2FYYB 2DWEA 5T3XD 5HHNA 4DGIH 5I8KL 5IQ9A 4IRZA 2R69A 1KDJA 2DQHH 4QAWA 3PUCA 1FO0L 4I2XE 4FQIL 4FQ1H 3NIGF 2AERT 1CDCA 2DBLL 2E7HA 2XACC 2DQ6A 4OLXL 4WTWA 3S4SB 3WJLC 1KTLB 3RVVC 4NZRH 4JG0H 4XAWL 1G7HB 3OKDB 3BN3B 1NBVL 3RUGF 3KPNA 3KHQA 2R29H 2H32B 3PFQA 3T0AA 2VRAA 1KACB 4EO5A 2P9RA 3G6JA 3FO2B 1OP3H 1OAYL 4U7KA 4MBRA 1CLZL 5AW8B 3FOLB 5I1AA 3MV8D 4R7DB 5CZKA 5BZZA 5L4FA 4RRPG 3V6OA 4ZDHB 3IXTB 3B6SA 4MXVF 5BRZB 3DJRA 1KCLA 1BIIB 5BZWA 5CD3B 1C12A 2XWCA 1EHLL 1UUSA 1S7SA 4FE9A 5FB8B 4ZD3H 4AH2A 5KVDE 1EXGA 4GBXB 4MVBC 4PJIB 1G9NC 3S37H 1A3RL 2OP4H 4Z7QB 2APBA 1KYFA 1IAOA 3JYCA 2Z7ZA 2C3HA 5MEOA 1GS8A 2FH6A 4OFYD 1IZJA 1DLHA 3W5NA 3UADA 3QDJD 3NUKA 4M7LT 4XRCA 2NW2A 5DQDH 2NQ3A 3P0VL 2WLLB 4HIEA 2DMBA 3KZ8A 4KKAD 3X1BA 1FLRH 3L9BA 1A21A 1ZTMA 2P80A 4WI0A 2XV2A 1A5FL 5L4IA 3T2LA 3RFZC 2DQIH 4V33A 3CCHA 5J11C 2H0FA 5KYNA 4U31A 3V6ZB 2ZCKL 3MJ7B 3CSGA 4NS0A 4WQOA 3Q3GB 4IYKA 5C2BL 3NFNB 4PGCB 4PLJC 4QHPA 4PCTA 2G3XA 4HUKB 1EX0A 2V2TB 3QWRA 1CFBA 1I8AA 4W6WB 4Z3JA 3MRFA 2X6UA 4N2IA 1N6UA 5EPMA 4AKPA 5CUSL 1TQCB 1PG7L 3IRCA 3X14A 2FQGA 3IDMB 4TUKH 1QPXA 4W70A 3UGEA 4L9DA 5B38A 1PD0A 2R39A 1BBJB 4I3SH 4ODUB 4OUOA 1XCXA 5JYLA 1A3ZA 3NJKA 4APQD 1YAIA 2GBVA 4WSJA 4YHPA 4HMEA 5EUOF 4NKMB 4RESB 2HSIA 4ZUWA 5IWLA 3SDCD 1QLFA 4AIXA 1MXGA 3BIAX 4DW2H 3ESPA 1O6VA 3U4EA 4OM1H 4LCYA 2VRKA 4TQ8A 5KSBA 5GIRA 1S8DA 2CBQA 2AJSH 3HNVH 4LIQE 4HFUH 3HJ0A 3DC0A 4ESKA 2WXGA 3SE9L 3R0MA 4POZC 2WC7A 5C08D 1QD0A 2CGYA 1A6AA 1MLBA 2OM5A 4MLSA 2XFXA 4JHUA 4KVPA 2DIEA 3QC5X 4G9FD 5EBWB 2FWOB 2VQ4A 5SX5K 4XAKE 4DZBA 1Q1PA 1J7VR 4X0NA 5C71A 3ZHNA 4DUXA 2F18A 1S7XA 2CO6B 4N1CA 3BW9B 4RNRB 1BQUA 5A2CA 2XICA 3T3ME 1HZHL 4Z7UE 4WV1A 3PHQA 4PI0A 2OTPA 1NOLA 2PWHA 4MCZA 1SDAB 1SYVA 5B4MC 3GBEA 5EF2A 1MCNA 1WAPA 1KCKA 4W4OA 1NGQH 3LRMA 1KCSL 1A7BA 3TTYA 1MNUH 4X0KB 3IETA 1J8RA 2ADJB 1GAFH 3HNSH 3LTVA 2X6CA 4HS8L 4RFEA 1MCIA 2HT3D 1WICA 2ICCA 1NTDA 4X6FA 2GI7A 5L8KB 4G11A 2AK4B 4UNIA 1URLA 1Q0XH 2D7NA 1JWUA 4XMLL 2N7SA 1WPCA 4MDJA 3V4PH 3VD0A 2NY0B 3W0WB 4FDWA 1UQSB 2P24A 4B95C 5GGSA 3GI9L 1CGXA 1IBDA 2WD0A 5T5FL 4JFDA 5IROD 2VDKH 1AG0A 1ZPUA 3LQAL 1I85A 4P5TA 4PP1C 4Y19E 5J13B 1Q1JH 2AJYL 4HF5H 3SCMA 4ELMA 1XGPB 4FQLH 4PG2C 2NY1C 4HUMB 3DV6B 1X7SA 4ENZA 4QHMA 2NY5C 1E4XL 3H9HA 4R6UA 1RZJC 1P84J 1P5VA 2DQCL 4FFVC 4N9GB 4ZXBA 5BVPH 5I0WA 3TFKD 1RZ8A 4A2HA 4FI7A 2BOBA 2WLMA 4HV8B 2DF3A 2HB0A 4WHDA 1N0XH 2BCKA 3HUJA 3T71A 1JS4A 4KUZL 4LEXH 1RK1B 2BNQA 3APFA 3DSNA 3BLPX 4XOEA 2HUEA 4KPHL 5D2LB 2R0LL 4X6CE 4LSQL 2CD0A 1CDBA 4Q6YA 2VC2L 4ZX4A 1JPFB 1P5UB 1NOAA 2Z7YA 1Z66A 4TMPA 4UUJB 3VFMA 3LS4H 3WIAA 4DP0X 3GSXB 4HS6B 2NTFB 4R5VA 3SKOA 4HG4K 3NIDE 4YHKL 5HPOA 1KB5A 1TJIL 1NCTA 3PDDA 5FV2A 4KOBA 2FJFA 2HMID 5DRXA 4LHQB 2PYEA 1MWAL 4GSQA 5M95B 4RH4A 1KGCD 1CF8L 3LSOB 2J3SA 1IC5H 2FEDD 3GHBL 3HG0A 5J06A 5F88A 1N8ZA 3RVXD 3SDDA 4P2OC 2FJSA 3ARGC 4KRNA 3GHEH 2ESVB 1NDTA 2JKSA 3UG3A 3IF1A 4HUVA 2BZCA 2WINB 1DVSA 4NN6B 4Y9CA 1IJNA 3PWUA 1B0RB 4KY1L 3UPCA 4BEIA 3TNMB 4J23A 1DCLA 1OP3K 2X05A 2DI9A 1OHQA 4OKVB 3UH8A 1AGDB 1J5OH 4N2KA 1ASOA 4HOWA 5TDOB 1I82A 4JKLA 3GEWB 3TO4D 4BZYA 4D8OA 3SYQA 1XH1A 4DP7X 3M17B 3NFSH 4ZTPL 3VWJA 2FATL 3X11A 2BP0B 2HLEB 1YN7B 4FFZA 5FGBA 1YEJH 2C1OA 4OZGB 3L3HA 3TN0C 1E8XA 2OX5B 5DS8B 2Y5TB 1T83A 3BLBA 4ZMWA 5HHOA 1FJ1A 4ZFGH 4PY8I 4XBEL 3VRIB 4P46B 4W9HC 3VXNA 2OTUA 3LIUA 2ICWB 1AGCB 1QSZA 2NNAB 3L4TA 3VXUE 1DJWA 4B97A 1FPTL 2WXFA 2Z31B 2DW5A 2GJRA 3CBJB 4OTXL 2CKBB 4JPKH 4L05A 2BVUA 4AVJA 5BZXA 1BVKA 5BZDA 1DBBH 4JL1A 5SWZE 5ANMA 2X9WA 2Q86B 3LKOA 1Q9WB 4RMWA 2ODHA 4YO0B 5C9JB 3O0LA 5D7SH 3MRBB 3SB3A 2WQSA 1MCOL 4C4UA 1GVIA 4QRQA 2Z1KA 1WD9A 3Q1EA 1SM3H 1JGLL 3VCLA 1Q8MA 4PTTB 1WWWX 4LFHD 2VB5A 4NPYA 1OAZH 3GT6A 4OQ1A 1C08B 1YEEL 4Z76A 5BO1L 3BKJH 4RMTA 5FYKE 1L5GB 3LKQB 1A7PH 1KV3A 5AYTA 3EH2A 3M88A 2W92A 2EICA 1RSFA 2H6UA 4LU5L 5HYQB 4YZWA 1OGAB 4H8PA 5JPMC 3OAWA 2BIHA 2FR4B 1FVEB 2FL5A 2HVKB 4QTHB 3VD4A 3DGGB 4ODWA 1RUPH 1Z1WA 4MQXD 4HJTA 4Y88A 3DDGA 4G7VH 3K81A 4XWOC 3FT3A 1E2ZA 3GZOA 5KSAA 1NCIA 3S34H 4U0QB 5I2IA 4G80A 2IAMB 2K78A 5JO5A 2FYYA 4LLAA 3OQRA 2KPNA 1KUMA 4OZ4B 5HI5C 3CFEB 3S3DB 4IRSC 3TJHD 2VKXA 3K46A 12E8H 4CN1A 1DJYA 2AGJH 1KTLA 1DVZA 1J10A 1G7HA 3IJHA 3OKDA 2FEEL 4F9LC 1NQBA 4M8QB 2MCPH 2B59A 2F19H 2JELL 3D9AH 2ZAIA 3KR3H 2H32A 5KYUB 4KX8A 3PXJA 2HFEB 3IFNL 4JG1H 3H42H 4HKZB 4Y4KB 3FO2A 5DVOA 1A4JB 3SOBH 1B4TA 3FOLA 3QJTB 2XVBA 4W93A 4B9JA 2VXSH 3HMWL 4YQXL 4X4YB 4R7DA 3GS4A 3RPIB 4NFDA 4QRPE 3B43A 4ZDHA 3IXTA 2RALA 3RHWF 5BRZA 4F24A 1BIIA 5CD3A 3MBWB 5ID0B 1Z0NA 2YBGA 3H9SB 1DQLL 4JCWA 4GBXA 4PJIA 5J6HB 4AL8L 3QNXA 1OW0C 1A25A 3HNTL 4JFFB 4TTDC 3RQ3A 4A7UA 1LILA 3QCTL 2AXFA 4IOIB 5CWSB 2WLLA 3QDMD 3UJJH 3WELA 3KM1A 1DO5A 3CJJA 5DUMH 1CE1L 5EWIH 3L17A 4XC3H 3V0IA 1NFDF 3F7PC 4KGLA 1DVFB 1BDYA 4TRPH 1NCJA 4MAUL 3MJ7A 4FEMA 3V6ZA 5J1TC 4OCRH 3Q3GA 4FADA 2XIBA 1Z2KA 2FBRA 4UCFA 3NFNA 4PGCA 2Q76B 2MKWA 4MHHG 4FA8A 2V2TA 3NCXA 3S4SG 3ILQD 5C09B 3B2DC 2WOYA 3D39D 5JOPD 3DVIA 4HC1H 2XZCH 2CHNA 1O9ZA 4LHUG 2X6BA 4U1IB 1KBBA 3IDMA 4M3HA 3WMPA 1ZHNB 1BBJA 4ODUA 1VEPA 5MP6L 1X9LA 4JO2H 3KXFA 2VM3A 3O9WC 1DJGA 3LNDA 2H6OA 4P4KC 5L0QC 3AG3B 5IR1B 4NKMA 5KYWB 2B3RA 4NP9A 1J1XL 4HIIB 4M5SA 2QZQA 5BV7B 3MODH 3QJRB 2ZG2A 1H6FA 3FBKA 1UZ8B 4PWHA 5ACZB 1BZ9B 2O5NA 3R0NA 3TWYA 5L6YH 1DQIA 4LAQH 5EZIL 4M5YH 2ATPB 2FJGB 3UJIL 5LG6A 2IGFH 4EKJA 3INUL 1INDH 4MZRA 4KITB 1AANA 4Q9RH 2QTVA 4KXZI 1ZIAA 4OY9A 2P1YA 5DHVH 5J6SA 4X6EB 3UPRB 3UAJA 1AYOA 4QRRE 2PO6D 3TNNB 2X4TB 5TF1L 5CBAB 5EBWA 3GMRB 2GAZB 2FWOA 2GW5A 2VR7A 2XV6B 4XVTL 3T3PB 1GR7A 2CO6A 4QNPF 2OYLA 4Y16C 3BW9A 3CN4A 4RNRA 4WEBL 4BFBD 3B8YA 3QZOA 1XHHA 4UTBA 2ZIDA 2F8OA 3MJ6A 4HJ0D 1ID2A 2NSQA 3RP1A 4ADGA 1AR1C 1P53A 3GI8L 3Q06A 4TM9A 3TH3T 1KGYE 3Q0HA 1EO5A 4X0KA 1HILB 2Q9OA 3CLFH 2ADJA 3FCTB 4L4TD 3L8QA 1D2PA 2Z65C 4S0TD 2H9GB 5ID1B 1QFOA 4AVIA 3B9DA 2FLMA 1MRFL 3MFGB 1ECZA 3BT0A 3LVTA 4XTRC 2AK4A 4XP1H 3TBVB 2J7LA 3G7TA 2LVEA 3QIWC 4HGWB 3D3VE 2BMKB 4L4VE 3W0WA 3T8VA 3PQYD 1UQSA 3GJFH 4J7RA 3TFBA 4NP4H 1PZAA 2FX8L 5BOJA 3ORJA 3ARFB 2ZWSA 3MLVH 1LYQA 5AG8A 4R5TA 5MEQB 5DHXB 1H6EA 1XGPA 3VAEA 2XSKA 4MNQD 4U6VL 2R7EB 3DV6A 2PN5A 3EGDB 3NZ8B 4FC3E 5JW3L 4DVBB 4MJIE 2X53A 1T2XA 2EYSB 4N9GA 3RB5A 2ZOKB 2GY7B 1EXHA 4AQEB 1EA9C 4HV8A 4UQ3B 5A6IA 5DGQA 1OAKH 1RK1A 5EU6B 4DK3A 4TF4A 4WNQB 1LP9B 5D2LA 1OSZB 5FHBH 5EZJB 3FB6B 3TA3C 4FXTA 2ZZUT 3IMSA 5F7AA 4N2NA 5GJSL 1DJIA 3PUUA 4AQ8C 4XHQA 1JPFA 1P5UA 4UUJA 2VH5L 3DIDA 4EI0A 2BO0A 3VWKD 3GSXA 5DJAB 4KO7A 4IBSA 1X5XA 4NN5B 2O26U 4H26A 2AQSA 4XOBA 5SV4A 5D5MF 1HN1A 1JV2B 3SJVE 4JFED 1KB3A 1JERA 1TVDA 4MA8L 4CVUA 1FP5A 1B0IA 5KYXB 3N9GH 5DEGB 4IIQB 3QHTC 4J4PA 2OPCA 4TNVF 3UCRA 1DN2A 2ZOLB 5FPIA 3LSOA 2WWKO 1IC7L 2GBUA 1CBJA 2XETA 4ZQTA 5JHLA 2QMJA 4H4NA 2ESVA 1BZ7B 2EUXA 1KTCA 1BXVA 1BMGA 1UA6L 1B0RA 1UM5H 3O45B 2CXKA 3SDYL 3TNMA 2OMWB 3LRSB 3BGAA 4OKVA 1PD1A 1WWCA 5TDOA 2JKNA 2NXYC 5F2FA 5BW7C 3M17A 2BP0A 2XZQH 4MQSB 5SWQB 3S35X 2BIIA 1YN7A 4EI5C 4OZGA 2VLRD 2HP4A 2OX5A 4PJ9C 5DS8A 2Y5TA 5DTFB 3ALWA 3PYCA 2NY1B 3RVUC 1EHNA 1U6AH 4M7LL 4XZUB 5D96C 2NY6C 4K94H 3VRIA 4KAQL 5F89B 4YDLC 5CLTA 3FOMB 4P46A 3RKDD 3U9UB 4FP8L 1T0NA 2ICWA 1AGCA 4Y9GA 1T6BX 2NNAA 4OLUH 4BHUI 3OV6A 2Z31A 1ZGLP 1A7RH 2WCPA 2CKBA 4P9ML 5D1ZD 4ZO9A 2TAAA 1GSKA 2X89A 2VUKA 3BYYA 4G7YL 1IKFL 1L7IL 4QTIL 2Q86A 1Q9WA 4P3CH 4YO0A 5C9JA 3AAZB 4X7FC 2NY7L 3MRBA 4JANB 5J9PB 5F7EH 1P7QB 2ZWLT 2I5YH 2XVGA 1DN0B 3UOAB 2ZXAA 1W0YT 3G5WA 4ZNCD 1ED3B 1FH5H 2EC9T 2ARJQ 3OZ9L 3P40A 4HKBB 4Z18A 5E6ZA 1CDGA 1C08A 1RIUH 2P7TB 4ONGH 1IGTB 1L5GA 3LKQA 3R8QA 2H8PB 5D9SB 2VN7A 5HYQA 2FR4A 1OGAA 3TEYA 1NCAL 2PP9A 4KNSA 1FVEA 2EDEA 3ZQXA 5L8LB 2O61B 1L0XA 2HVKA 1J0YA 1R34A 3I6LD 3DGGA 3QQXA 4QTHA 3WV0A 4P2OB 4IJ3C 4X5LA 3F65A 4NLHA 4BCYA 4AIEA 4NQEB 2JCCB 4PJEE 3CPLB 1X5FA 3RTQD 4G8GD 2IAMA 2IEPA 1A9EB 4OZ4A 4I0PC 2MWCA 3DX7A 1S3KL 2NSMA 1IIKA 1G6RB 3B9KB 4BZ1L 2JQMA 3TN0B 4ODXB 4AM0B 4BFKA 1RZFH 2VN4A 3COOA 3ETBJ 3RYMA 3P0YH 3LJ3A 1NEPA 4M8QA 3ZSSA 1NGPH 4WI3A 3RDTC 5K9JH 3ARVA 5KYUA 3O0RH 2HFEA 4HKZA 4WI4A 4DVRH 1KXVC 3FO0H 5AZUA 3K5RA 3ZK0A 2D8KA 1A4JA 2J6WA 3OL2A 1Y1UA 1TNMA 1SHSA 1X5MA 4X4YA 3MRHB 4L8DB 5LQBH 2YGQA 5E9DE 3RPIA 3C75A 2Q2EB 4ENEC 1KJ3H 3W11C 3BH9B 2WZPD 5FA3B 1GXEA 3LHAA 3MBWA 3RNQB 5ID0A 3UTPE 3H9SA 5LDSA 3NCMA 3C60C 4AITA 3M8OH 3OR6B 5J6HA 4OD1H 4QHKI 3T3MB 1L0YA 3E8UH 4Z7UB 2YMTA 5INDB 2ED8A 5DURD 4X4ZA 2P8LB 1DJXA 3SBRA 5TE7L 3N41B 1U3HC 3GJFK 3V4VH 1L0QA 2VL5B 3KHOA 4M3JA 5CKGA 2VXUH 1DVFA 2WUCL 2W38A 2IBBA 4WTQA 4DEPB 2WW8A 1OB1B 5HP5A 2Q76A 4ZMNA 2V5SA 1HVXA 4LVEA 2P5WD 2QQQA 3O3DB 1XZ0B 2IAND 1EFXA 4XB3A 4JG5A 5C09A 3U7AA 4CDHA 1KYDA 4Z3TA 2WXHA 2ITFA 1NUGA 5DMKB 5IB1A 4U1IA 3SPIA 5F9OH 3LX9A 4K23H 1ZHNA 1JDCA 4B96A 1K6QH 3D4CA 1JTPA 2NXZD 1BXAA 5IMKA 1A64A 4BXSV 1VGKB 5C0DB 5KYWA 4XPTL 3ZE0E 1JF1B 1T89A 4HIIA 1SY6H 1JMZA 3T9WA 4J2XA 3IBEA 1OO2A 1EDHA 1NCGA 3CDYA 1UZ8A 4KROC 3K0YA 1BZ9A 1IUZA 5ACZA 3N5AA 3WOVA 2ATPA 3SPCA 4UM8B 2FJGA 3PGDB 5I9QB 1G7MB 1AVAA 1BM7A 3DJ9A 5AYUL 5DD0L 3GIVB 2NQDA 2WXMA 4PJCF 5GISH 2JJTC 5D93B 4X6EA 4DAGH 1IAIM 3UPRA 4L3ED 4XI5D 3TNNA 2X4TA 2DJMA 3G6DH 5E2WL 5CBAA 2EIMB 3GMRA 5IQNA 2GAZA 3CZKA 5IJKC 2G5BB 2OYPA 2A9NH 1CFVL 2X5PA 1U8CB 5FGRA 2BY0A 1RK0B 4LCIL 3FU9A 4UM9B 3NIDB 1MCLA 1UWFA 1YYLH 4FNTA 3WFDL 5D7LD 1EEQA 1DLFH 4XXDB 3BMWA 4NO2B 2MEJB 5DCCA 5E6IC 3ME0B 1FVDB 4MX7B 2CKBH 3W5MA 2DLHA 1UD5A 25C8H 1RJCA 4S0HA 5KAQG 3EJSA 4RGNC 4XPBH 2V7HB 1TO4A 1HILA 3FCTA 3RIFK 3ULUL 5A2LH 2H9GA 1S7VB 5J89A 5ID1A 2EZ0D 4ATWA 3IM1A 1XBRA 2Q5BA 1YMHB 3QJZA 3TBVA 2CPCA 2FD6H 2EIZB 4HGWA 4N8CL 2CCLA 4IM8A 2EEXA 3FL7A 3T0WA 2BMKA 3OAUL 1KFAH 1NOFA 4GS7C 2BVTA 1N6QH 2WIIB 3SGJA 4AX3A 2PNDA 4NWTH 1OM9A 4J3OG 4NQXB 2CO3A 3N55A 4A2GA 3O9WB 5C0AE 5L0QB 2OMUB 2XY1A 1ZK9A 3P1VA 5MEQA 4XP6H 3LY6A 1KTKE 2JCWA 5C0GB 3EGDA 3NZ8A 3ZHFA 4R2GC 5JXAL 4R90H 5CGYC 5BOPA 3NCYP 2QHLA 4DVBA 1HCVA 2XIDA 5CJOH 5A1AA 4YPGB 2ZOKA 3ISWA 1MFUA 5DWPA 1ODAA 1ETJA 3QFJE 4XN5A 4AQEA 2WN3A 4E9LA 4UQ3A 2LFGA 3J7HA 4PW4A 4BKSC 4J8RB 1FBIL 5L4JA 5EU6A 1CQKA 4GRLC 5LAPA 5SWZB 3LIZA 4JQIL 4WNQA 6FABH 1MI5E 3D87B 1OSZA 2QFRA 1OAQL 1W6LA 4Z1PA 5EZJA 2J8OA 2NSXA 2MSPA 3FB6A 4K7FB 4Y4HC 3DVGB 4D94A 4P2RB 1YEGH 4EOWH 4HJJH 1H8LA 2BERA 4Y16B 2FRGP 4I89A 3PXLA 3A67H 5AVZB 2HRPL 3FCSB 1LO0H 5DJAA 5HDBE 4URTB 4G71B 3MYZA 2CJUH 2COQA 1SOQA 1A7OH 2COVD 5DD3L 1PZ5A 1XTMA 4AV0A 1JV2A 2VXVH 3K6NA 3V4LA 2Z91A 5KYXA 1R6VA 5DEGA 4IIQA 1AR1B 3ZMNA 4B5EA 1WFOA 4X7SH 3KCWA 3FQRB 1CXKA 2X2JA 1D5RA 2ZOLA