2OJ1A

Disulfide-linked dimer of azurin n42c/m64e double mutant
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKCVMGHNWVLSTAADMQGVVTDGEASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Inter- and intramolecular electron transfer in modified azurin dimers
pubmed rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 31
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2oj1A00
3X1FA 3EHBB 2XVBA 5I6NA 3WNJA 2WSDA 3S3CB 3NJIA 2CBPA 3ASNB 2R7EA 4BDVB 2GB2A 4JHUA 4EF3A 4DPBX 2YXWA 5B1KA 1NINA 3L45A 4RH4A 2YARA 1NWPA 2IH9A 3TA4D 1SJMA 2PPDA 1ZDQA 2IWEA 2XU9A 2XX1A 1NPJA 1RZQA 2CUAA 3N55A 1V10A 2UXVA 1FA4A 3GYRA 1J9QA 2YAPA 4DP2X 1E67A 5B1JA 3T9WA 2VM3A 3NP3A 4A2HA 4N4YB 4YVNA 4JHVA 2IDSA 4L0PB 4YSEA 2QT6A 3DTUB 1XB8A 3ZDWA 3FSWA 1BXVA 2XV0A 4W1TA 1B3IA 3FT0A 2CAKA 2QDVA 4CSZA 1AS7A 1W6WA 3FSVA 1A8ZA 2GI0A 1J9SA 1F56A 2J56A 3ABLB 1SFDA 1IBYA 1TU2A 3PXLA 4GYBA 3T6WA 4BWUA 1TKWA 3IE9A 3FSZA 3OMIB 4G70B 5B1BB 1AANA 2FQEA 3T6XA 1AZRA 2GC7C 3KW7A 2UX6A 2WO3B 1CUOA 3FS9A 3IN2A 2AFNA 1JZIA 5D4HA 2VSKB 1L9PA 4X4KA 4YSSA 2HX9A 1E5YA 2RACA 1XMEB 2XXFA 2UXGA 4YSOA 1E5ZA 1MZZA 1JERA 2EILB 2OJ1A 3DKHA 2VW6A 1PMYA 1WA0X 3TBCA 1ASQA 3SBPA 2IH8A 2FJSA 2HRGA 3QPKA 3AZUA 2PP7A 3NSCA 4HCIA 1WA1X 4KO5A 4AKOA 2EIJB 1AACA 4E9SA 2I7SA 1MG2C 3NSFA 5B7FA 1NIDA 1BXUA 1PZCA 2PPEA 2DV6A 1JOIA 1GW0A 1SFHA 2B3IA 1EZLA 1AG0A 2GIMA 3FQYA 2AZUA 3NSYA 1ET7A 3NJHA 1QLEB 5B7EA 1AR1B 3SBQA 2MRYA 5I6MA 1IBZA 4GY4A 1JZJA 4N8UA 5TK2A 2GHZA 1PNCA 1ID2A 1WA2X 1NWOA 2HXAA 1KDIA 1PF3A 4G7RB 2OCCB 2IDFA 3FU7B 2YAQA 3X1EA 2UXTA 3H4HA 2FTAA 3H4FA 1AZBA 1MG3C 3AG3B 3WIAA 1CURA 4P5RA 3X1NA 1ET5A 4DP5X 4HHWA 1KYAA 3ZIYA 7PAZA 1JXGA 3NP4A 2NRDA 3WI9A 1SDDA 5FC9A 3AG4B 1GSKA 4A66A 4KNUA 2VW7A 2GBAA 2YXVA 3T6VA 1E30A 4HCFA 4K9JA 1L9OA 2VM4A 5I6PA 5I5JA 1ADWA 1ZPUA 4KO7A 2PLTA 2FWLB 2GC4C 5I28A 4KO9A 1AZCA 2X87A 4G71B 1CYWA 5I5MA 1GYCA 1RCYA 1BQRA 2WO2B 1L9QA 3IN0A 1NTDA 2BP0B 2XXGA 2I7OA 2PPFA 1T5KA 4YSUA 3S8FB 1ET8A 4M3HA 7PCYA 2VW4A 3NJLA 5I6OA 4NB7A 1PZAA 1TEFA 4BDVA 5I26A 2IDUA 1V54B 3CDZA 5AZUA 1JZGA 2FT7A 4KOCA 2EINB 1SF5A 2ZONA 2CCWA 4E9VA 1X9UA 3BQVA 4KNSA 1A4AA 1WS8A 3NJNA 1CYXA 3H56A 4BXSV 2YAMA 1EHKB 3G5WA 4E9RA 1IKOP 4Q8BA 2YAFA 4HHGA 2EIMB 2FQFA 3WKQA 4CSPA 3FSAA 2IWKA 3DIVA 2XUWA 1GS7A 3FQ1A 4HCGA 1OCCB 1NICA 3OD3A 3S3BB 1OCZB 5A7EA 1KV7A 1NZRA 1OCOB 1E65A 1NDTA 2HX7A 1AAJA 1AS8A 1DZ0A 2P80D 1ZIBA 2EIKB 5AKRA 3PPSA 1JZFA 3TU6A 2Q5BA 2OV0A 4YVUA 4YSTA 3S3DB 2DYSB 3NJKA 2UX7A 1W6LA 1WS7A 2DWTA 4PAZA 4UF7C 2BP8B 1OV8A 3FPYA 4W9ZA 2W88A 2QPEB 1L9RA 4KNTA 3V9CA 1BYOA 4BK5C 3OMAB 3NJGA 1ILSA 1AZNA 4A2FA 6PAZA 1AQ8A 3V9EA 3FU8A 1NIEA 3RYMA 4UAHA 1ZDSA 3ASOB 1M56B 3AG1B 3ZBMA 3NJJA 1BQ5A 1ZIAA 2PP9A 4WTQA 3OMNB 1L9SA 1SNRA 4FAAB 2XV2A 1NIFA 2YAEA 3U25A 2PCYA 2FQGA 4F2EA 3QJUB 3EH3B 3WKPA 4AKQA 3WG7B 1BQKA 1NIAA 1J9TA 3IBOA 2IWFA 2JXMA 2YQBA 4YSRA 4E9XA 1JZEA 3ABGA 3IEAA 4AZUA 4DP9X 4YSCA 2AZAA 5B1JC 1JVOA 2BZCA 2HX8A 1YLBB 4DPAX 3JTBA 3QJTB 1CC3A 2FT8A 5PCYA 4YL4A 5LDUA 1KBWA 1WAEA 1MDAA 1QHQA 4M4RB 4YSPA 1J5DA 2FT6A 4A2GA 3D12B 1AS6A 2VN3A 3PLYA 3AY2A 4Q89A 3TASA 1N68A 4AKPA 3QJRB 3UGEA 4DP7X 1NIBA 1ILUA 1FFTB 3AW5A 5IY5B 3FU7A 3FYIB 4UANA 2PPCA 4KOBA 1SDDB 3C75A 3QQXA 2W8CA 4AX3A 1DYZA 2QDWA 2XWZA 2H3XC 4MFHA 1AOZA 2CALA 1OE2A 1ASPA 3EH4B 1PCSA 1PLAA 1GS6X 2R7EB 4G7QB 3PAVA 4PCYA 1GY2A 3T6ZA 3TBBA 5I5IA 1VLXA 1ZV2A 1XB3A 4KO6A 2IDQA 5PAZA 1ETJA 2DY2A 4DP1X 4HZ1A 2MTAA 5B1AB 1N70A 3X1BA 3UAEA 1NPNA 5TK4A 3ABMB 3EF4A 1KCBA 1I53A 4E9QA 3BVDB 4NERA 1RZPA 1GS8A 4TXVB 5F7BA 4QLWA 5B7MA 1A4CA 2PP8A 3UACA 3WNIA 3PAZA 3CDZB 4G72B 4DP0X 1PNDA 3NT0A 1FWXA 1XB6A 1AIZA 4YSDA 4DP6X 3FU9A 5B3SB 2BP0A 1QNIA 2XV3A 1J9RA 2PPAA 3SBRA 4YSAA 4QKTA 1JXDA 4JKNA 2Y69B 2A3TA 3NJFA 3PAUA 5I6LA 2H47C 2BW4A 3QJVB 1L9TA 1PLBA 2H5UA 2AVFA 2E86A 1SHXA 4GP8B 4AI7A 4YSQA 1KGYE 1PY0A 2BO0A 2GSMB 2TSAA 3GDCA 3OM3B 3FQ2A 1OOWA 2QPDB 3AG2B 3X1GA 2BWDA 3QJSB 3KW8A 2PCFA 4BWWA 4F7KA 1BXAA 1GY1A 4ZK8A 2YAHA 1PZBA 2XX0A 1W8EA 3ERXA 4HAKA 4A2DA 1UATA 1BYPA 1SHWA 3UADA 3HB3B 3HEIB 3X2QB 3CVDA 3OQRA 4HALA 1ASOA 2UXFA 1OE1A 1R1CA 1A65A 2XYBA 2VSMB 8PAZA 1A4BA 3FYEB 2BW5A 3NJMA 3QJQB 2J57A 2XLLA 4HIPA 2BZ7A 2FNWA 3PCYA 2Q9OA 1GR7A 3UAAA 5F7AA 2FQDA 4GP5B 1RKRA 1JXFA 2BP8A 1HAUA 4NAJA 2JFCA 4A2EA 2JKWA 5D4IA 1HAWA 4F2FA 4FA7B 1X9RA 2VMJA 2DYRB 5ANHA 2YAOA 2LLNA 5AFAA 5I6KA 1MZYA 1AG6A 2B08A 2ZWNA 4GXFA 5E9NA 5EHFA 4A68A 4G7SB 2I85A 2P80A 1SF3A 3ABKB 3N2JA 3JT2A 2IAAC 3GXUB 4GP4B 2HRHA 4E9YA 4DP4X 9PCYA 1V55B 3CVBA 2J5WA 2X88A 2AANA 4E9TA 1IC0A 4ENZA 3CVCA 1KDJA 1M57B 3ZX1A 1IUZA 2Y1AA 1KCWA 1J5CA 1OE3A 3MBWB 6PCYA 3CG8A 4E9WA 2IDTA 1PAZA 2CJ3A 3FPXA 1JZHA 2DWSA 3UABA 3MX0B 1PLCA 2BHFA 2TSBA 3S8GB 4P5SA 1BEXA 3CZUB 4DP8X 3NSDA 3T71A 4A67A 2ZOOA 2ZXWB 1AZUA 3EH5B 1KBVA 1OF0A 4WKXA 4BWTA 1OCRB 4BXVA 3SQRA 1M9WA 1JVLA 1HFUA 1URIA 1TEGA 2N0MA 4DPCX 1BAWA 2BWIA 2J55A 2HZHA 3NYKA 5D4JA 1A3ZA 2HLEB
chains in the Genus database with same CATH superfamily
1XGUA 4H8PA 2G60H 4OFQA 4CBPA 5BUPA 2IPTL 2AJVH 1KLGA 1LDPH 1LD9B 2MQ3A 5AOMA 4BDVB 1CT8B 1G7HB 1MCNA 5CR1A 3FO2A 1ZANL 5EIVA 1MIML 3VFGH 4FQIL 3MRDA 7TAAA 3H53A 3QG7H 3QFJA 3KR3L 2PXYD 2CQVA 2YPVH 4PCKA 2QQLH 5EWIH 1QPKA 4BCYA 3N55A 3AQZA 2HT4D 4U1JB 3TH4T 4X4YA 1LE9A 2DL9A 1OGAD 1MRFH 4YIQB 4DVRH 3GGWB 3KEDA 2ENJA 3AMKA 2LHAA 4ABVA 2Q2EB 2Q7YB 4F9PA 4F8LA 4PWGA 3B7TA 4ZI8A 1GOHA 1NCBH 2E46A 2WWKO 4KMLB 4WWKB 2X6UA 3O8XD 1TZIA 2DQFA 2IGLA 3KBFA 5LO7A 1XB8A 3HZVA 3DX7B 4EN3D 4XX5A 1Q4NX 3M17B 5C1MB 12E8L 1B3IA 5IBLD 3GBML 2AMUA 2CIKB 1NGQL 1OTUD 3MBEB 2B20A 5DFVC 5I1LA 1RP8A 5AG8A 1AQKL 3PPEA 1CXIA 4L3ED 3HG3A 1VGEH 1A8ZA 1ZA6A 4KMQA 5C0BA 1MREH 4KUCF 3RVXC 3CN4A 3D3VD 2J56A 3RWDB 1R5WA 1NAMB 2F5AL 3BO8B 4P48A 3L9RA 2Q76B 3S48A 4RAVB 1NL0H 1SGKA 2G5RA 1DUZA 2EIEA 15C8L 4N2IA 4WO4D 3TA3B 2N3JA 3S98A 3Q5YA 5IGXL 5MI0B 1HOCB 3Q8AA 1JZIA 4JL1A 3GUTA 2QFPA 4XWGH 1A02N 1TJGL 4LEXL 4X4KA 3VXUD 3CCHB 4LIQL 3NZHL 4HMDA 1XMEB 4KVNL 3FQUB 4HXBH 3GXTA 1JERA 2OI9B 3KPSD 3V0IA 1U4EA 3MUGA 4L1HA 5J1TC 4J8QA 5E8PB 2BY3A 5FUOL 4GEJA 1DQJB 1DQKA 3GK8L 1S2EA 5JDSB 1AXTH 1OALA 1WVZA 4FLQA 3QUML 3FAXA 1D6EB 3MV7A 5DQ9B 3RIAK 4AIZB 4XP6H 3O2DA 2ZWZA 2VSCA 5EBWB 4UTAL 1CDJA 2KZ1B 4KI5F 3I84A 4UB0L 1XTMA 3SBQA 4UQIM 1CFNA 4HUWA 1IGCH 2DOCA 2OMTB 3WXWL 5AKVA 4YHYC 1T1WB 3JTSB 1JI2A 2GIXA 2VGLM 4N8UA 4GRMB 2B2XH 4FXGB 5I74B 2HJFB 4LP5A 3PGFH 3ARZA 1NWOA 3KWTA 1OVZA 1XIWB 3C8HA 3L3IB 1JGEB 3O81A 4U0RB 5H35B 5F89B 5F9WB 1D5XB 4DCQB 1J48A 2F0CA 3O2DH 4G8FB 2BNQA 4MJHA 4A7UA 4KZEL 1U93B 3HZKB 4YXHL 5J9PB 3FL7A 4PRHA 4UQ3B 1AZBA 2ICCA 3T2NH 5DCCA 3KHQA 5DJAB 4ZYKB 2XHNA 1OGAE 5DK2A 1NFDA 2A9AA 4S1SL 3FU6A 3OJ2C 4JFYA 2CPUA 1CGXA 1RUMH 4FI7A 1FUNA 3MNDA 1N5YH 2FR4B 3QHFH 1DDHB 1CDGA 3DV4B 4FJ6A 5D2LB 1O6TA 3U2SB 3O41A 2HKAA 2R4RH 4YEEA 4Z0BH 3FUJA 5C09B 1E30A 3VD7A 2OA9A 1MCQA 1OM3L 4BZ2A 4YUEH 3RILA 1HNYA 4FS0A 3MUZ1 4R0LC 3IGKA 5BZWA 1FZMB 3S37L 3UG5A 4M48H 1OHQA 5I5JA 1ZGLB 4ODWB 5E4IA 1GTFA 2BS71 1FNLA 1PPIA 2WLZA 4FHBD 5DQDL 3D7PA 2X41A 4XGZA 3G3LA 4JHWL 1CB4A 1XSOA 4QHMA 5CAYB 2YD4A 4KUZH 5JQ6H 4L18A 1F13A 1S7WA 4AYFB 5KS9B 4L0ZA 1H15B 4X7EC 5JXAH 1BMZA 1QEWB 1T3FB 5DJDA 1UM4H 4KJWC 3N1QC 1T4KA 2PCPB 2J5LB 5SWZA 4FQXB 1DQIA 1QASA 4C54A 2WXJA 5I1HL 1BLNA 1L7TL 2V2WB 2BERA 2VH5H 3WN5A 4N8VG 1IAKA 1SF5A 4R4FL 1CICB 3QUZC 1MJ7H 3MFFA 5I6XC 1P4UA 4IRSD 4HZAA 1WS8A 2DQTH 4AEEA 3RGVA 2B5IB 2ITEA 3LZFL 4BXSV 2YAMA 4YPJA 4YAQA 3VXTB 2JK5B 4I48A 4HS3B 4N8PA 3UJJH 1AO7A 4PV9B 5GXBB 3QEHB 2XG4B 5D55A 5GGSA 2PYFA 3V4VA 1NOAA 3DARA 5CD3B 3RWFA 3WLWD 3ZKND 1RURH 1FYTA 2VIRB 4HWZB 1ZK9A 2Y23A 4KROB 4KK9D 2FHFA 4P2OB 4UDUB 5EF0A 1AAJA 5I8KL 1R6VA 4AE1A 1TOXA 2P80D 1X4YA 1ZIBA 3EO0A 1TQBB 2FBJH 4U33A 5I0YA 1G7MB 1UOVA 1YZZA 5C0CB 4YVUA 3ZLQC 4TRPL 2I60L 3RHWF 3APNA 4FG2A 3FTVA 2CKNA 3GKWH 3B2PA 5D7LE 1FG2A 1T1XB 3KPPB 5AQ0A 4UF7C 3BAKA 4XPGL 4N2NA 2KDYA 4CDGC 4I0KA 2Z8WC 5E6ZA 3UG3A 3AS0A 2P5WB 2N7SA 2X42A 3FHAA 3VNYA 1PX3A 5TQ0L 3VX0A 3PFUA 5HY9B 2JF1A 2OSYA 3BZDA 3IRZA 3O11B 1L3NA 3TCXA 2BCMA 4RA0C 2VT0A 2CDFB 4HCRL 3O0RH 2R2CA 3DYOA 5K39A 3NIFF 2LGNA 4X98A 3GB7A 1ZIAA 2PP9A 4WSKA 2RB8A 5F88A 5CM1A 1HEHC 3LH9A 2BLFA 1JGIA 1XGYL 3QR2A 1OP9A 3SDDC 4H25A 4NQDD 3RL2B 3IF1B 4LL1A 3UH8A 1RXLA 4AXWB 1HKLH 1WTGT 2PCYA 3KLHD 1TPXC 1QBAA 4H26A 4W9DC 2LAGB 4F2EA 3D5OF 3ZJAA 2EEXA 2A9BA 3HW7A 4GBXB 3SGJA 4N2BA 5C0DB 5IB1A 4UT6A 3V6OC 1WEJH 2FX8H 3ARDC 4ZTPH 4KKZA 3EGDA 2IFFH 3GMLB 2IQAB 4LRIC 4LP8A 2YZ8A 1PZ3A 3CUPB 4MA3A 4PJ8D 3KYAA 4K3EL 4OLZL 3NRPA 1VKXA 3N06B 3PUCA 5I15L 2FJFB 4LPYA 4YWGH 1LTXA 3MN8A 2DQGL 4DERA 1XR9A 4Y4KA 5JHBA 5T33L 4JANA 4P5KA 4JM2A 1EBAA 1ECZA 4KOBA 3HS0A 4OUOA 4HSAC 3VW3H 3HE6D 2AQ3A 4LPXA 2QDWA 4N6QA 4MLSA 2Y7SA 1BA9A 4YFEA 4WW2C 3COOA 1PCSA 4DAGH 3JV4B 3FUDA 4HK3N 3RX7A 4G6FD 5HGBA 3C2SA 4A7SA 2ZPKH 3HHSB 3NPSC 5IROA 3BW9B 3N44F 1U8CA 3GBNH 3IMUA 5TE6H 3VXNA 3L6FA 1QW8A 5JLZB 1HZHL 4JS7A 2YJQA 3EF4A 2E8YA 1CN4A 3TZVB 3HG2A 3RZCC 5E00A 1RUQL 2Y36H 5D1XC 4MJ5A 5FHAL 1ZLVH 5L4FA 3WXVL 3UCQA 2JIXD 1OP4A 5HXMA 3ILQD 4LCWE 1PAMA 4G72B 1YPZB 2GBTA 4QYAA 32C2B 1EEYB 1QRNB 1DBBH 1CU4L 2ODHA 5B22A 3VD4A 1M7DB 4PRDA 1KCRH 2XV3A 3GJFA 4OLWH 1CTNA 4EBQL 5C08D 3QUHA 4JKNA 5TDOB 1WBYB 1OB0A 1W0YT 1D2OA 4NC0B 1BF8A 3VVVA 2JB5H 5FOBB 5DD0H 2H47C 2NLJA 3OHMB 2R29H 1JNLL 4AWJC 2HJKA 3KJ4C 3CZFB 1B4LA 5EN3A 4H0IA 3LH2L 1ZANH 4GG6B 1MIMH 1OPOA 3DOHA 4AMKL 4ENEC 3QRGH 3LH8A 4LEEA 1C12A 1DQMH 5A2LH 3CFUA 4NQDE 2QPDB 4J23A 2A4CA 1CFSB 1NA8A 3MJ8B 2QADD 3BPCA 5DQJA 3L3DB 4CKVX 3RVWD 5FO7B 1O7DE 4NCC1 4P3DB 3ULVC 2YAHA 1PZBA 3ZKQD 2BY0A 2DTMH 3QZWA 5L0QB 2FECL 3UADA 4LHUA 3CSFA 4H8WC 4K7PY 3BN9D 4L4VE 2EDNA 2HG5A 4U2ZA 3N1PC 3L48A 1M3JA 3MZTA 4TUOA 4AZ8A 4PJ5D 2PWHA 1IJNA 3T1FA 4UTBL 1FIGL 3PHSA 4W6WB 2G75A 3AT8A 4LLMB 3MAWA 4HEME 4WHYH 4E68A 3EO9H 1GR7A 1BZ9A 1J1OL 2DMCA 5MERB 2Q1EA 3QE5A 4HGMA 4HKBB 3PWPD 1BQSA 3LMJL 1NUFA 1EHAA 1WAAA 4FGMA 5DJYB 1YA5A 1FORL 3TH3T 2F5AH 4IOFC 4Q74A 4YDIH 1JP5A 1RJCA 5GRZA 3DRQA 3GIVA 3SDAB 4P5TB 4PJ9C 3QCVL 4AYGA 4O02A 3M46A 4PJGF 5F0LB 5KYXB 2AANA 3NCEB 3QUMA 1UJ3B 4WIQA 1FCGA 5IB3B 4R84A 1THCA 4PJBB 1CQKA 4LIQH 4V2CB 2NZ9D 3QQ9D 3CZLA 2Q86A 4KVNH 4L8SA 4UTAA 5HGDA 2APWA 4KZDL 4NYLA 1MCIA 2OBGA 4BD4A 4A55A 4HFUL 3IDMA 4HJEA 2KMWA 2QR0A 4P2RA 3UYRH 2WKOA 3FT1A 4NZFA 5FUOH 3DNKA 4OAWA 4DP8X 4IHOB 1M7IB 1JPTH 5ADOL 3ZO0A 3ESOA 2UY6A 3VGBA 3RY4A 2WOBA 5C08E 4XNXH 2EDMA 2C34A 3HE7B 4M56A 5T5NG 3BD5A 4YK4B 5E9DA 3WXWH 4ZOBA 3NYKA 4U6YA 1KYOJ 5K9KB 4FNLH 4Y9CA 5GGRB 2ZOKB 1ZLVK 1ZHNB 4WK2B 3X1FA 2AXJA 2XQYG 3IJ9A 3OF6A 4QXVA 5I6NA 2F19L 2FO4B 4FYRA 3R18A 2CBPA 4Y2DA 4KZEH 1OW0A 3DBXB 4KKCC 1VZGA 4AGQA 4YXHH 4PGCA 3FB6A 4EF3A 3D2TA 4U1NB 2ZOUA 1FL5B 3B9KA 3VSVA 4YZWA 1QZ1A 2VE6B 3BUTA 3Q0HA 4N90D 3QIWB 1SJMA 4MAYC 1LEGB 2WQUA 3PP4L 5DD5L 2LQRA 4S1SH 3DRTB 1E7VA 2CUAA 5GIRB 2DZEA 2UVEA 2J21A 2NQ3A 3DGDA 4R26L 5AB2A 1IB5A 4ODHH 3RKDC 3O4OB 2DQUH 1KY7A 2DQDL 4PJ5E 5GHWL 3V52H 2WIIB 3KVQA 5IVXE 4S11A 3CSBA 1IAIM 1ZEAL 3LXCA 3MV8B 3WY4A 1IEBA 2ADGA 4JVPA 1INDH 2EABA 5KYNA 3WO4C 5DQDH 4QCIB 2CHZA 3FN0L 4IMLB 1VHPA 5F3HA 4JHWH 4XRCB 4RNRA 3PWPE 3CH8A 4QHPA 2X4SB 1GRWA 4W1TA 4DGVL 4CSZA 4JQXC 1X5KA 4RCAA 1GKOA 5D70L 4CVUA 4NQEB 3Q6FA 1WAPA 3S35H 3FSVA 2A1WL 1HEZB 4EXPX 4X9YA 2XKSA 4XTRC 1X6LA 2I9LA 3D85D 4QF1B 5I75C 2R1YA 2WZAA 2XPGB 4IJ3C 4POUB 5JMRA 3NIDF 1P4LA 1SFDA 3IS0X 4UV4L 1A0QL 5CZVH 3W9DA 5D7IB 2VWEE 3CNKA 4EIGB 1SJEB 3DX0A 5E51A 5AW7B 1OKEA 4UM8A 1F42A 3ALPA 4YHKL 5E6IA 2C4FT 3WS6A 3ARED 3GSXA 3P69A 4PJHF 3QH3B 3KPQA 1T20A 1CI3M 4G6JL 1CXFA 5CSGA 3P30L 4YSSA 5CS7A 5CN3A 2VABA 2Z4QA 1R17A 3HG1B 1KB9K 4YSOA 2QBWA 2H3KA 5I9QC 2G3ZA 2UYLB 2ZP0T 3DECA 5EU5B 1X5JA 2B4CH 3ARGC 4XMUA 2FJSA 3Q1EA 2HRGA 2SEBA 1EZSA 2PO6C 1C08B 1QMUA 2D8KA 1Q0YL 1JZ4A 4AM0A 3KJ6H 5KUMA 2CKBB 3QUYC 1H5BA 1M6OB 1S7RA 5FYKD 3UC0L 2FEDD 1A7NL 1SFHA 4N2GA 1RIUH 4BFKA 1DQQA 4LNRA 3VFVB 3DJRA 4DO5A 1NUDA 2NSQA 2XNAB 4XXWA 2VYRE 1I8KB 4DK3A 3K6NA 3OX8B 1YJDL 3V0HA 2VRQA 4JZJC 4XPGH 5EN2B 5C0FB 5EORL 1I3GH 4YHIB 1NOLA 2ZD0A 4NOBA 1ZA3B 5DWUH 1JZDC 5CCKL 3H9SA 4QMEA 5GISL 4BZ1A 5TQ0H 1VAHA 5TQ2H 4P2QE 5DLML 4ANKA 1I4FA 5HP5A 2R9HD 1N3NB 4HCRH 4N90E 4Q52A 1YG9A 4F1SA 2EE9A 2MSPA 4C55A 3VWJC 1N2RB 4HP5A 4ZNCD 2B7DT 1D5BA 4RRPA 5CR8A 5JYMA 1XGYH 3MCLL 3GQFA 3JWDH 3K2UL 3WIAA 1WGVA 4AIXA 5DRZA 2HP4A 1PKQA 4RAHA 4FZEH 5J5EA 4WDIA 2NRDA 4LKCA 1GZPA 3OKMA 1PZ5B 3ZL4L 1MH5A 5KSBA 3MO1B 1M1XB 1R24A 5ACZA 4L8DA 4B60A 4ZPVB 3LZRA 4BH7B 1KBGH 2CRMA 3OKYA 1BWMA 3U83A 3REWB 4P4RA 3RFZA 4C4KT 2ENPA 2X4NA 2X2IA 3NQKA 4K9EC 5HJDA 1Q9WB 5I73C 3HUJA 4OLZH 2X87A 4G3YL 4YHYB 4GIPD 5FYKH 2HLAA 3EKCA 4HOMA 3G9AB 2DQGH 5EUKB 2I7OA 1F0LA 2LTQB 3QZBA 1NJ9B 5EBLB 2AQSA 4FABL 2ZUSA 3QJFA 2WNXA 4JY4B 5HGHA 1B2WH 4N5UA 4BFFA 5FDWB 5I1DA 5D6CA 1TYEB 2VR5A 1FFPB 2XWEA 4WENB 4DOHB 3NZ8B 2WP3T 4AIOA 3BQVA 5JW4M 4XPAL 3RUGF 3LKOA 4RQQA 2YGNA 1BD2B 3NJNA 3VMPA 1CQYA 1DFBH 3OKEB 4PIRF 5IG7B 1W9XA 1UB5A 3NAAH 5H37A 1AJ7H 2FQFA 1MHCB 1C9SA 5JIDA 1WP6A 4GEIA 3CVIH 3AGVA 1NC2D 2HKFL 3QWNA 3GI9H 4XMWA 3REVA 3L3GA 4R0LB 1TMQA 1HXYB 3HLAA 1RUQH 1O0VA 2HTKD 5FHAH 2DJ4A 3UTTB 5DHVB 3WXVH 4PJCB 1UEYA 3SKOB 3ARRA 3IFOA 4GQQA 2VJ0A 1GGUA 1MFEL 2W65B 4G6MH 4Y19B 5K9JL 4U1GB 1YMHA 4KKNA 5ITBL 2R0LH 5GSRA 2Q5BA 1BF2A 1BVZA 1G6RH 2VR8A 3L4YA 2X53A 4HLZH 5BZZA 5GZNC 2QEJA 5F9AC 4HK3J 3MLZH 4L37A 1CWVA 2EDRA 3FPYA 1WBZA 1HCYA 4WJG3 1MELA 3IU4H 2RQEA 2X10A 4JMNA 2VDRH 3QUZB 2Z31A 5FGBC 4NZRL 1LP9A 3OG6B 3SJVA 5CZKA 4AMKH 5I6XB 3NDZE 3VI3E 1AQ8A 2XQ0A 1B0RB 1DCLA 1OK0A 2Q3ZA 5A43C 1SHSA 3OLIA 4UTBA 1O6VA 3IETB 2BSRB 3PUUA 3VFPA 2JE8A 3P4MA 3V0EA 1IC1A 3NG5A 1ACYL 2DDQH 4FAAB 1AGCB 2J7LA 2YGVA 3SPHA 1UJTA 5J7CC 1CDBA 4OJDH 2R1WB 4M7LT 2YMXH 3EH3B 2OSWA 3ULSA 4RGMC 2FJUB 3TF4A 3WUWB 1BQKA 1FVDB 1CGSL 2WTRA 4P06A 1LEIA 1BMGA 4PJFB 3K6FA 1OHZA 1WBXB 4NNPL 4QXWA 1AKJB 2YXMA 5JZ7D 3ABGA 2WXNA 3T3ME 5JO5A 4F9PC 1J1OH 1A3RL 3F62A 4NO5A 3MBXH 4G8IA 3QC5X 2CDEA 4ES8A 3QUXB 1K8IB 1MVYA 1WAEA 3MUHL 1BM3H 1NC4B 3S2AA 1FORH 2VQ4A 3HPJB 1N6QL 2NZIA 3QJRB 3PXJA 4ZSOB 1OY3B 5HI3C 1M42A 5SWQB 3BJ91 3QCVH 5KYYA 3A3YB 4QRSB 5IK3A 4XCFH 1AOZA 2Q10A 2VLLB 2NY5C 1JNNL 1ASPA 1XR8B 4YDVB 1U3NA 2CBOA 2CHXA 4UV7H 2XBZA 3LPFA 4OLXL 5C7ZA 2Z1KA 3SDDB 4IGBA 3VGAC 1TPXB 3WHXA 4XB3A 4S0TD 5DC2A 1IC4L 1R75A 3ZTCC 2ADIB 2H9GB 1A66A 1P2CA 4HU8A 3P4NA 4FP8H 3ZE0E 3MRLB 5DD6A 3WFCH 5DJ8A 1RZPA 1EO5A 5ADOH 2JH2A 3ARDB 4QLWA 5B7MA 3VNZA 4KY1H 1EO7A 1QLFA 4M6OL 1IKFL 5AVTB 1LNUB 4DKAA 2OMUB 4XCEB 2IALA 3NT0A 5AOIA 4NO3B 3TN0C 5FKAB 1RFDL 2MFNA 1RUKL 3NCJL 2Z92B 3VCLA 3F05A 1J9RA 3KWXA 3PDOA 4Y5VA 1NFIA 2A77L 4NZTH 4QKTA 2BCKB 5E08L 4JZNB 3PF2A 4KJQC 3VI4F 3JXAA 4MMXA 4LLYB 4M1GH 4XCYA 4OIIL 3BX7C 4E41A 2VMCA 5D2LF 2VDLH 2ICWB 3TGXA 4IK7A 3IXTA 4OT1L 5JORA 1CD1B 1V5JA 3V0FA 2K70A 4WW2B 3B2MA 2VN5A 4K7FB 3D2UD 1WISA 3HFML 3P4LA 4MKMA 4LCUA 3HJEA 1QX1A 5F71A 3HG0A 3OJVC 4M43L 2AQPA 3X1GA 3NPSB 3EYOA 3PP4H 3KPMA 2OK0L 4XAKD 5IVOA 3KW8A 1OZUA 3D39D 4PR5A 4ZK8A 2C26A 2GAZA 4L48A 1UATA 1WC7A 4MQTB 4OD2B 1QATA 3FTGA 2DQDH 5KS9F 5GHWH 3RZCB 2YPKA 5I2IB 5IVNA 3QYCA 5D1XB 2ATKB 1JK8B 1IBGH 2EH7L 2AJSH 4R4NC 1JNHB 1A4BA 1T7VA 4KH2A 3KPOB 1QSED 2DLTA 1P7QA 3FN0H 1KB3A 4NKDB 1S5IL 3WJMB 5D70H 2FNWA 2J6WA 4TNWK 4F7EB 3B6SB 3CFEA 1T03L 2A1WH 4P9HH 3QNYB 1T5XA 1J5IA 2ZXQA 2MTPA 5ECGA 2LAAA 4FQCH 4MQ7B 3PV6A 4UYQA 2JLPA 5DHEA 2XXMB 2J2ZA 2VMJA 3KJ4B 5CGBA 4FHJA 3QQDB 1OSYA 2LLNA 3UXFA 3V6ZA 4B6ZA 5AFAA 1XH1A 4PVBA 1GYVA 4J3OG 3TV8A 1CR9H 2VXVH 5F7HA 4JPWL 1HYRC 1I7UA 4NZDA 1HWHB 4OZIA 1AD0A 1RZJH 4YHKH 3QWOA 5AVRB 3CLFH 4V2BA 3GIZL 5FKPB 4KMTL 3WNLA 5KS9A 1B3JA 1QO3A 1Y18B 4YLCA 4NUJB 2CJUL 3HTLX 2EXYC 3RWJA 4DUWA 1W72B 4MA8H 4ZMAT 3O3AA 1W2KT 4PBXA 2J71A 1QG3A 1CK0H 4G42A 3RGVC 4BE6A 2VDKH 3MX0B 2OULB 4BFIB 3LSOA 5IEHA 3BAEL 1Q0YH 4AV4A 2X6BA 1N12A 3BWSA 3CZUB 1JHKH 4EUPH 3V5KA 3ZKXC 4HLEA 3UC0H 2AXFA 2IPUK 3D34A 4QKXB 4Z76A 4OVVA 1RK7A 2Y0SA 3EOYG 2ZSVA 3BIBX 4UMGA 4X5XB 5E94B 5C0ND 3MOBL 1YECL 3WKYA 5EF3A 4AJ0A 4JUTA 1RU9L 4OIBA 3N04A 1DEEA 2I9TB 2DLHA 3GO1H 4GKSB 4WI0A 4PJIB 5GISH 2PW1B 3BKJL 1XF3A 4PJ9B 3DX6B 2XVBA 5DLMH 1OAQL 1OAYH 5FOJA 4IEFA 4E5XA 2O61B 1WD8A 1MW3A 3DXAD 1WWBX 4RBPH 1CFTA 2R7EA 1ICTA 1MFUA 1Z0NA 2XBTA 5G4MA 4NQUA 5D1QE 3D39E 4PRNA 3BUQA 4IHBA 3MCLH 1HSBA 5EEUA 3LCYA 2KLRA 1NEPA 3TBVA 3E0GA 2B0SL 5FAAA 4K2UL 4PJEA 3WS3B 1HXMA 3ZPDA 1FHGA 2XKUA 5H2BA 1FZOB 2DIEA 5B4MC 5TFSH 1D9KD 4RGNC 1QSEE 4DP2X 1EJOH 3E6HB 1I9IL 1J1PL 5I23A 4E2OA 2VM3A 1TZAA 1R3HA 4JKPL 4X6CE 4YVNA 2OPCA 3JZYA 4WFED 1J86A 4L5FE 1T7WA 3AT0A 5ISZB 1NCWL 1I3VA 2NDGA 3HN8A 2EDTA 4ZUVA 1FNHA 3FT0A 4G3YH 3FSOA 2ZX6A 3SGJC 2WV3A 4MLIA 3SY0B 3UDWA 4F5CA 4JO8A 2Q8AL 4R7NB 3V4PB 5BO1H 3BWZA 4OY9A 2F7OA 3OG4B 1S5HB 2EXWC 3EDEA 4MD4B 1AE6L 1N8ZB 5A2BA 4HKXB 1TKWA 2GUOA 3KLSA 5G5DA 3QWQB 1LWRA 3ZTJG 4Y4KC 5EIIA 2B1HL 3I9GH 4IM8A 3FS9A 3M1OA 4JM2C 3QFDB 5GS0L 4QRQA 4AG4H 3ECBA 2ZE0A 1TITA 3FT4A 3ZZQA 3RPKA 4RZKA 2CRZA 1JIBA 5AYUL 5EC1A 4F7TA 1OTTD 3Q48A 4XO8A 4Y4FA 1RMFL 4DFHA 1N4XH 1S8DA 2P42B 4DH2A 5C6PB 2OJ1A 3DMMA 3UMTA 4EN2A 4M8RA 1MVUB 2OLDA 1YAZA 3JT0A 3L4TA 3RKPA 5IW6B 3AZUA 5IROC 3QEUB 1X7QA 1K5NB 4XBEH 3WO4B 1I31A 3ML9A 1VFAB 5EPMA 4APQD 5BOZG 3JUZA 4DHLA 2YGPA 2WLIB 4NT6B 2QQKL 4Z95L 4KK6C 4Q14A 1BXUA 4GG6F 1A6AA 3MRKB 5EC2A 4K3JH 4AK2A 4TNGA 3WDIA 3KL3A 2AKRA 4PJXB 4I18A 3FQYA 3HAEG 3KGSA 2CJTA 5KVEE 3OR7A 3SCMD 2WLLA 1ET7A 2J8UB 3L3JA 4JRWA 4ZFOL 4OGXL 4PLJC 4P2CG 1RZGA 5I75B 1ZT4A 4YBQD 2X0UA 4IJ3B 3HI1B 4QXUL 5ICZA 4H5SB 3RTQA 4ABWA 1BJMA 1PY9A 1JS4A 2ZJSH 2PWGA 2XFGB 4KV5E 2VAAB 1J1XL 2OZ4A 2HXAA 5AB9A 5MENA 3V0DA 3TEWA 5H8DA 4UM9B 2B9BA 2R15A 3FU7B 2JSFA 4G1EB 1F2QA 2Z35B 3CVHB 1NANH 2V7NA 3D69A 4X7SL 4JDTH 2VITB 3PREA 4CGUB 2K9UA 3TT3H 5LCVL 4AW7A 2BIHA 1XDTT 1SUJA 4UQEA 1IAIL 1VB9A 5AL8A 5I9QB 3MREA 4FQJH 2Z7UA 1CL7I 5EZOL 4Z8FH 3ARGB 4WEMB 3ZL1A 1II4E 2BVQB 4NQCA 3EBHA 3VDBA 4RBPK 2HA1A 2HKHH 2F61A 3UX9B 4JY5H 3OXSA 1P7KA 1NLBL 1I8MB 3IJSA 4K9JA 3QUYB 1Z66A 4ABQA 3EH1A 1DBMH 2W0PA 4J6RL 4A39A 1KXTB 1M6UA 1WFMA 5E23A 5KYWB 2YLHA 4JFFD 5EU6B 2WC7A 3CZNA 2WZPA 2VLRE 4R6UA 4PJAA 4ZFFA 4G71B 4JZJB 3ILPA 4HQQL 4Z3EA 4PJBF 1FO0H 3PABA 3T0EE 5HDLA 1U33A 4KJYA 4IIZA 4YSUA 2NUPA 3ULUE 1N6QH 2C9VA 1GPOL 1ZPLA 2EDEA 5I6OA 4AE0A 4DEWA 1G9NL 2QGDA 5T1LD 1JHTA 3BSZA 5JIHA 2KQMA 2H8PB 3II3A 1TR7A 1M71A 5CINL 2DBLL 2YR3A 3B8SA 1MCJA 4CL7A 4KNSA 4POYA 4NN5C 1WIUA 2IDCA 4XN5A 5DYOA 3F12A 4OV6F 2R69L 2XACC 3EJYC 4HIHA 4Z78B 3U30C 2JKSA 3FCSB 4LFHD 1PU0A 3MV9B 4MDRA 1ZSHA 3JVFC 1CXLA 3K4AA 3BLPX 1F4YH 1IC4H 3PWUA 5DURB 5DYFA 2XWTB 1RHHA 4Y8DC 5IOKA 3G5XB 1MCHA 4WEUD 2BSTB 2J72A 4KZ0A 3FQ1A 4BSJA 1XGRB 2GITA 4L8SC 2XG5A 3MRNB 1OCCB 5GQBA 4W9JC 3K4DA 2BVPA 3P9MA 1E5CA 5HPMB 4M6OH 5ACMA 5SX4I 3VQ2C 3FO9B 2W07B 2PR4L 4A7QA 4R7VA 5I73B 5I1GH 1RFDH 3AXLA 3P2BA 5DJ2B 2XV6B 5KSAD 4ZUWB 1I1CA 5AKRA 5HGAB 1WT5A 3BVTA 4XNBA 5HYJB 4KITB 3KH4A 3P3TA 3T08A 5E08H 4F57L 3DIFB 2OMZA 4ZFZA 3FFCD 4PAZA 3PHAA 4B9YA 2WLHA 3F01A 2W88A 3RI5K 2W9EL 2COQA 4N9OB 5J1SC 4PTUA 2UY7B 3QW9A 3DUUA 3U7AA 4DT2A 1P4BH 3CDGB 4R97C 4EIZC 4U7MA 3VJ6B 3IGAA 5HHOB 1F02I 3U7YL 1ZDSA 2XWRA 4FULA 4OCMC 4CNIB 3T6QC 3BQUD 4QRTA 3MC0A 4J27A 3ABZA 4FG4A 4Y2DC 4XZ4A 3F65A 1OW0C 5E8DL 4UT7L 1BWWA 3MRRB 4HULB 5ES4B 1HHKA 3B9KC 3LRGA 1JE6A 2RBLA 3EXLA 2A6IA 1NAKH 5SWSD 5AVYB 3ZN6A 2E4TA 3VFUA 3K71A 4JFFE 2CHNA 4NENA 2VQUA 1J9TA 4FTVB 5LKNA 4J5VA 3TBWA 1DBAL 2XTJC 1QAWA 2R56L 2IXQB 1G1KA 1A1NB 5G2NA 4PJ7B 5AW3B 3JTBA 5EUOE 4K94L 3QCUL 2FK9A 4WNSA 1F1GA 3IM1A 3OSKA 4I2XB 3GF8A 3VDCA 4I0PA 2C9UA 2VN3A 3WMSA 1H6TA 5T8IA 4DP7X 4NQTA 3LHAA 4OCWL 1CO1A 1K4DA 5C0IA 5IY5B 1LEKB 4XVUD 1SDDB 3KH3A 2G9HA 3SQBA 4WKZA 3SSGA 1FP5A 2W9LA 4HA1A 5I76A 5I1EH 4KMTH 4JHZA 1KLGB 2GUYA 3EH4B 1MIEH 4MA1C 4WI3A 5CZRA 2WXFA 1H0DA 3FMGL 3F85A 2CJUH 2CO4A 2X89A 2NYYC 3FO2B 4MMZC 4NI3A 3MRDB 1H8OA 3JWOL 1C5CH 4KDTA 5IQ7L 2IDQA 1PYWA 4UDTA 3E9TA 5EU7C 4RGMB 1VADA 2NNFA 4PP2A 2XY1A 4KTGA 3WS6C 2C1PA 3V5DA 3RG1C 2WBKA 3BAEH 4MVBC 4IOSA 4RSYA 3BGMA 5DD1L 1MWOA 3QZNA 4NDMA 3ZZ1A 3BFWA 1LE9B 4K3GA 3BP6A 4MQXC 5F7BA 5AAMA 5KSVA 3HR5A 2YEZA 2BNUA 3CMOH 5DZLA 3VFNA 4DP0X 4ZX5A 2E6JA 2KI6A 1YECH 1TZIB 2DQFB 3BDYL 3I9AA 1GGBH 2HVKA 4ZMYA 2H2PC 3CLEH 4NAMA 4X6FA 1H5BC 4WWPA 3V6BR 4AV5A 5ECJE 1OAQH 1NEZA 5HHMD 1YO4A 3S4SB 1OAUL 2ITCA 3VH8G 1JD9A 4ZW3A 2EH8L 4OCLC 1ZA6B 4XXWC 5C0BB 1YMMD 3KS0H 4P49A 5ETUA 3QDJE 4GLRI 4M1CD 2WN3A 1UT2A 4PS7A 1R5WB 1EJ8A 2FB4L 2G5UA 5D7KD 2CGYA 3DETD 2OS7A 1HNFA 4PN6A 3PP3K 3VGAB 3L9RB 4XVTL 2BM3A 4O2FA 1DUZB 2JI2A 4K2UH 2W60A 5LBSL 5E2WL 2DKUA 2VNCA 4KY2A 5DO8A 5SWSE 2K8MA 5HD8C 5JXED 1JBJA 4EKJA 1MI5E 1H6EA 5IVZB 3EF7A 4A2DA 5I66A 2Z8VC 3GUTB 1H8SA 4N5ED 1HHHA 4L4JA 5C0AD 2XDHA 4KHXL 2OYKA 4OF0A 4ZUUA 4X6DF 1SHMA 2G30A 4ZS7H 3TN0B 1AKPA 2XWJA 5CP3A 4WHDA 1NCWH 1V3KA 4Y4HC 3EFFA 3ZGIA 1ZMYA 1ZS2A 2EADA 4PG9A 2Y07L 3I50L 5IKCA 3QHZL 4NO0A 3R0MA 5BV7C 3TT1L 1TCRA 3MV7B 4G43B 4R83A 1T1YA 5DZJA 1CFMA 3D3VB 3DTXA 2CH8A 4JGJA 4XN7A 3UBXG 3UTSD 5CF3A 2MKLC 2Z7ZA 1VEOA 3ARBD 3RFZC 1CFNB 2IAND 4HUWB 2AV1A 3DPBB 4NP4L 3B2DC 1AE6H 4WO4A 2ATAA 2FSEB 2QZ5A 2A0LC 1CBVL 2DLGA 3WGUB 2F53A 2BFVH 3IMTA 4PJCF 2B9AA 4W9CC 4DP4X 2GBVA 4HUNB 4F93B 4HGWB 1CDUA 3SKJH 1UOWA 4J12A 4ENZA 1CE6A 1MHHA 3D08A 5L6YH 1UA6L 1YCSA 1IUZA 3KPSB 1KB5L 3VTAA 5L88L 1KCWA 1ZWIA 1J5CA 4ZW7A 4NO2A 1HCFX 5I17B 1S3RA 1FNAA 4ODXB 1U3HA 4FQ1L 5DK2B 1NFDB 4H1LH 4ZMOA 4L4TB 4JFYB 4R90H 5T1DL 4PY8J 4D0DA 1H9VA 1UEMA 5F9JA 4I8DA 3N1MC 4CVZA 1Y7VA 3O41B 2QQKH 4N6RB 5MEPA 4FFWD 5A6IA 5IFAH 4BWTA 3BUYA 3QDGD 4B95C 4M6ML 4KI5E 5BZWB 5EBMA 4BXVA 4G8EA 1D3CA 5AENA 4WY7L 4P57A 5ELIA 3VACA 1EX0A 2OKMA 5D7LA 2QGEA 2Z9TA 4NOFA 5HHME 4A2LA 3BKML 3S8WA 2IPKA 4XGZB 3EOTL 3PNWA 1FL6A 4CJ0A 1YMME 2WQVA 4O58H 2D3NA 1URZA 4PP1C 4LLVA 4OI8A 4WVRA 2VLKD 5D7KE 4TQPA 5DJDB 4TS6A 5E95B 5GRWA 4DSYA 1T4KB 1MOEA 5AAWA 5DZOA 2WJ7A 5SWZB 1N18A 1S7SA 1ZVHA 1A7QL 1BLNB 2EYSA 4U1IA 1U8MB 4DZ8A 2AP2A 3BKYL 3U9UA 5L4MA 5DMGD 3ZE2F 5LCVH 1S78D 3CXFA 2IG2L 2Z31C 3V8OA 1ZDQA 2V6HA 3ATEA 5E7FA 5LNEA 3RVVC 4YGVA 3MFFB 4Z7OF 1NGPH 5EZOH 1RV6X 1V10A 4JKLA 3SE3A 4JRXE 1AH1A 3EH2A 4XC1L 4I48B 4KXAA 3E6FB 1AO7B 4IBWA 1NLBH 4GAYA 4OCYL 5GGSB 3ZKXB 2PYFB 5HYSG 2CR3A 3V4VB 3NP3A 1KCSL 1NCAH 5D1ZI 2ARJB 4UIMA 3BP4A 1KJVB 1XH2A 1FYTB 3VD3A 1JPGB 4PGBA 4Z7UF 3JUYA 3DURA 4P23D 1J8HD 4QRPE 1D6VL 4TQ8A 4ONFL 4V1DA 1Z1WA 3UTSE 4HQQH 4AL8L 2R69A 1B6DA 2IANE 5IFHH 3EO0B 2A9DA 2A9NH 1ZAGA 4N0CD 4GI9A 4H8VA 2CK0L 2OW6A 3EDFA 5D7EA 2N01B 4FYQA 3FQNB 1CTMA 1CGVA 1HILA 4IRSA 3FZUD 4ZFGL 1T2JA 1BX2B 1DN2A 3GRWL 2R1XA 1B4JL 5DRWA 5LN4A 5IW3A 2KH2B 4GSXA 1FJ1A 2R69H 4KVPA 2Y4SA 5E8EA 2X1QA 2AFNA 3DVFA 2Z64C 1G84A 1RUAH 2D3LA 5K39B 1DHKA 1TYJA 4E9LA 1X7TA 3MKGA 3GB7B 1IBBA 2AJYH 2VMEA 3A4DA 4RGNB 4BFJA 5F88B 3NQIA 1OT4A 3G7TA 2CLZB 2VLJD 3DKHA 2I5YL 4M5ZL 4H25B 3BIKA 3W0WD 1MAKA 4J3OF 3NEEA 2YPLD 3GI8L 4LCWA 2EIJB 5CWSA 2WKGA 4MNHA 2Y5QA 4FG0A 4ZRGA 4YHPB 3QEQA 2O6CA 4MJJA 1DE4B 1JOIA 1XL6A 2ENQA 2G3NA 3BZFB 3ZDYB 5IHBA 1HH6A 5IB1B 4P5MA 3FUEA 4HK0A 4OCXL 4F57H 2WXQA 3OZ9H 4JO4L 3HZMB 3EGDB 2EO7A 2LW3A 2CMRL 4FZ8L 2VLKE 1QBBA 4OD1H 4MA3B 1IZKA 3S2CA 2W9EH 1VKXB 5HI5D 5TK2A 3J8F7 3GHBH 2CO6A 4Y5VC 5CLTA 3B5HA 4MCYA 1KDIA 4WWOA 3D52A 4P5KB 2X5PA 2DLIA 4FG6C 2YD8A 5F96H 3AQDA 4LSDA 1FSKC 1E8XA 1G7LA 2XIDA 2R8SL 1CZ8H 3PL6A 2D9QB 3MBWA 4XMKL 3VFWA 5DMKA 5IMMA 1IJ9A 4WQOA 4WZ9A 4DK5A 3WAJA 4GUQA 2HUHA 1X6NA 4WFHD 4LCCA 3JWNC 4LCYA 3VUAA 3LS4L 3ZIYA 4JFEA 3NK4A 3E7JA 4L4VA 3G6JB 4QOKA 1KACB 1LL1A 2YXVA 4G6AC 3L6FB 4NNXA 3TVMD 1S9YA 1QLEH 4N2OA 4DUVA 1DBAH 4PB0H 1Q9LA 2C9AA 1J8HE 1HIMH 4PJ8A 4U2YA 3KBEA 5GRYA 4HEMA 3LXUX 4PLKC 1TSHA 2X4RA 4MJ5B 3BXNB 4LSPH 4RETB 3AS1A 4K94H 4KO9A 2DYPA 1A5FL 1AY1H 3UOAB 2PTTA 3IAPA 3QCUH 4HS6A 3FW6A 1GYCA 1QVOB 1RJZA 3SDCD 4PRDB 3L4ZA 1YEEL 1HINH 4M93B 3ZR6A 1R3KA 4AMXA 4BGDA 4JREC 3VQMA 1UYWL 4JHBA 3B37A 1A21A 1DDTA 4ETQA 4XNDA 4G9FD 5AZUA 4Z7IA 2BIOA 2EINB 4MBOA 1L9NA 1PQZA 3WO3B 4K3DL 4E9VA 3CQFA 2NY3C 1KYUA 4NBZB 3X17A 4M9PA 1AI1H 1KFGA 4DVBA 1JNJA 1MQKH 3JWOH 3ZE1E 2VLJE 4B0MM 5IQ7H 1C12B 3WKQA 2JB6B 2O93L 3BPCB 3L7EA 3ZTDC 5EBGA 3WIFB 3H9HA 2YPLE 4UQ2B 4PMFA 1E8YA 1BREA 2OSXA 4PJIF 1KGXA 3QZWB 3ARFD 1HL5A 2J1YA 1RZ8A 4LHUB 1IV8A 3WDJA 5DJ6A 5JOEA 5LGKA 3S3BB 2VDML 1YJDC 3H6AA 4JFQA 3Q43A 5EDSA 2HG5B 3KNBA 4UIKL 1MQ8A 5C08A 2V2TB 1NDTA 2FNBA 3BDYH 5ITFA 3VMOA 1EFXB 2EIKB 4XI5D 1MCBA 3UIZA 3BUPA 3KYNA 4TSCH 3ISWA 1M1SA 2G2RA 2ED9A 2X4UA 1VRSA 5LBSA 1OARL 4LGSB 2UX7A 3QUKA 1BZ9B 1CF1A 1O7VA 2J1ZA 1JGLL 4EOWH 3B9AA 3ZHDA 3IK2A 3WFBL 4XBGA 3SPIA 4HISA 4NN5B 1KGCD 2F08A 5FYKU 3OHXA 1EEQA 3QIBA 3DRQB 3GIVB 1B6UA 3U30B 1SOSA 1UZ6F 3N91A 4YX2H 1U2HA 4GAJL 1OEZW 3QUMB 4S1QL 1G0DA 4X0KA 4XCCL 1MCRA 5FO2A 1Z3RA 4PJ5A 4L8SB 3A6BH 5HGDB 2Q86B 1U8QB 2HLFD 5IVXA 4NYLB 4ZMNA 4WHYG 3IDMB 4JR9L 5DJCA 1LHZA 3PFQA 3WFHA 4DGIL 2AQ2A 3SPJA 1ZLDA 4A7GF 4LPTA 4E9XA 3GC3A 1AP2B 2Y07H 3PWPA 3QHZH 3TNNA 3U7WH 1JVOA 1LK3H 3TT1H 2UY6B 3QJTB 1C5BL 4HWNA 2O5ZL 3VD2A 4HC1L 2JQAA 4JGUA 2C7UA 1CFVL 1MDAA 4HWBH 3LXBA 3GSUB 1IGYA 4G9FE 1Z7JA 3ASWA 4Q89A 1N68A 4ZPTA 5F0JB 4F7PA 2B39A 5E9DB 2GG1A 2I27N 3FHQA 4RGOH 1CBVH 3QT2A 1KCUH 4IBTA 4UANA 4U6YB 1ZHKA 4R97B 3UTQA 4FQLL 1ZHBA 5F0PB 4F58L 1COBA 3TH2T 1MNNA 3UDWC 4UQCA 3RAJH 5DHXB 4QHKI 4PJGE 3RBSA 5FDYA 2LT9A 4GRLC 3UTPD 5D7JC 1NBYB 4G7QB 4PCYA 1P5UA 2JCCE 4D7PA 2NSMA 4PGCB 3TBBA 1GC1L 5HHXH 1KB5H 3BH8A 3B9KB 4WHTA 3ZT5A 3RVUC 5JQHC 5L88H 5PAZA 2FATL 1TVDA 4FQ1H 2PETA 2YD1A 1KJ2H 4JQIL 4N2LA 2NXZD 1JDAA 3P0VH 3UAEA 5T1DH 1NCGA 3ABMB 2MPVA 3HB3C 1WLHA 1O5DT 1CG9A 2XTJB 3CN3A 3R0NA 4MWFA 5E5LA 5F7LB 4Y4FC 2ITFA 3P4OA 3CDZB 2LU5A 3DMMC 3H42H 3MRJA 1IEBB 1SXCA 3T09A 3TFKD 3IVKB 4N26A 3FU9A 4NPJA 4TUKH 3O6KH 3B5TA 3GKZA 2QJDA 5F3HB 1PD1A 1DJXA 4XOCA 4EVNA 5KVFL 1B2YA 4QRUA 4RNRB 4JJ5A 3FT9A 2OTUA 1ADQA 1LO4L 2COVD 2V3DA 1XXDC 3GSNH 3P0YL 4MJIE 4I18C 5BRZD 1I8IB 4P2QA 1Q1JH 3GZQA 4F37K 1E4XI 1P6WA 5ENWA 3F7VA 3UJTL 5JHDE 2R1YB 3V0WL 5IB2B 1HSAB 4CAGA 4MA1B 3V4UH 3I6LD 1KG0A 3BKYH 5FV1L 3RTQC 3S34L 3V95A 5JNYA 3IRCA 2GSMB 4MMZB 2VO8A 2WM0A 4QUOA 3S96A 3W9DB 1FC1A 1J0KA 2EKSB 3ATAA 4JZOA 4UM8B 2QPUA 3JV6A 1Y0LA 3HC0A 5IMKB 2YA1A 1DVQA 1GY1A 3MA7B 1JWSB 4ODTH 5HI4D 3MRHA 2XX0A 2CO1A 4HXAL 4P46A 4W6XB 3LEVL 2YS4A 1T20B 3KPQB 1H19A 1BQLL 5DMYA 1EXGA 2Z4QB 4NZ8A 2KPWA 4LBAA 3KBHE 1X5GA 4TQEH 2EVHA 2OR9L 2PTVA 3LPWA 1FL3A 4O00A 4UOZA 4WF7A 3ISYA 2SEBB 4PRID 3W38A 2WCPA 3GRWA 2CRIA 2DWEB 2DB8A 3O3BA 2VRKA 4X9IA 1D6VH 2BVEA 3VXSD 4AM0B 1Z6JT 1P1ZB 3M1BB 1H5BB 3D85B 2JQZA 4GP5B 4HWEL 5D2NC 3D18A 1BVNP 1DQQB 1MPAL 4LNRB 5FXCH 3SE8L 4A2EA 2BVOB 3S3PA 3NIDE 1QBMH 1MCPH 3QI9D 1J05A 1KZYA 4MB4A 5I6KA 4OZFH 5J8OA 2A99A 1H3VA 3AREA 1TXKA 1SBSH 3UTPE 4F8OA 3H9SB 1B4JH 2GK2A 1YDPB 3AMLA 3JT2A 5EOTA 1SMAA 3OAUH 3BSHA 4OIAA 3GXUB 1I4FB 2HRHA 3MACL 4JRLA 1U30A 4UOW1 4E9YA 3MJ7A 4PJHE 5DVNA 4ZTOL 2J5WA 1PBYA 3OWEA 1A9BA 4MD5B 3H0TA 4TUUA 3ZIMA 2WXIA 1QUNA 3CFCL 1D5BB 1MRDL 3MNZB 3SYOA 3TEUA 1QKZH 4M5ZH 5D1ZD 4IOIA 4U49A 5DRZB 3FPXA 3GI8H 4MKTA 4WDIB 4Y4HB 3RLSA 3W11D 3CZSA 4LKCB 2OXGA 3OKMB 5I30L 3AACA 2GEQA 2XQBH 3RIAF 5KSBB 1R24B 2O6DA 3OJDA 5ACZB 4OFKA 1AOHA 1LMIA 4OCXH 4J3XA 3WEOA 4ZO9A 3AAZA 1QFWI 4JO4H 1INQA 2CMRH 5LG1A 4TLUA 5BRZE 3RFZB 3F7RA 1GJIA 3HUJB 4ANXA 2WXKA 2X6CA 4WHCA 3TJEL 1T2QL 5INDA 4W93A 3I6LE 1U42A 1I1YA 1WT5C 4GSUA 1ZLSL 4OM1H 1UM5L 3VI3A 5HHQA 1F41A 3B3BA 3M8OL 3QJFB 4W9HC 1MFNA 5HGHB 5LDSA 4WWKD 4UTCA 3RRQA 5C0RL 5I1DB 5D6CB 1PVHA 1WCQA 3CQPA 4N20A 2PPDA 3QISA 3H2WA 5D6DA 3BDBA 2B77A 1NPJA 1UD5A 2RA1A 3LKOB 4RQQB 3SGEI 4JFZL 4IBLT 4DJMA 2GHWB 3MBED 4IDJL 5EEWA 2AXHA 5MEOA 1CDYA 5C3LD 3CGTA 1UB5B 3M07A 3ZHKA 4X2UA 2CG9X 3T04D 4OZGE 3UEZA 2HMID 3DI2B 4PRIE 1JV5B 5IBUG 3ZQXA 3T9WA 3TL5A 4A2HA 3REVB 3L3GB 3HLAB 4G8GB 1G9MC 1BZQK 2BOCA 4R3SB 4WWNA 3FKUS 2A6DA 3CHRA 4YQXL 2QDVA 5I0WA 2ZF9A 3TA3D 4N2DA 4E36A 5D8JL 4NCDA 3FF7A 1IT9H 1E28B 1YEHL 1YMHB 5GSRB 4IBYA 4I77L 5FR3A 1UYWH 3A6CL 3K6SA 1BDYA 2Q7NA 2CJSA 3UMNA 4L37B 2ZZUT 1XH0A 4PVNA 4K3DH 1JVKA 3RUGE 4I0PC 5B1BB 3II1A 2Z31B 3SJVB 1LP9B 5GSVA 5E0QA 1NMCC 2VN7A 4MD0B 4FQQA 5GRJL 2WCSA 4OB5L 5EU4A 1LLAA 3SYPA 3ULUL 1JYWA 5DJZA 4NAQA 3C08L 1E7UA 3IDGA 4TM9A 3VFPB 3EOAA 3EYUH 2DW5A 4OZ4B 2WD0A 4Y7OC 2VDMH 1OF2A 3Q8FA 2P8MA 3ULSB 4HLZG 4ZW6A 4UIKH 4CDHA 2VDQL 2WVTA 3UO1L 1K6QL 5CCGE 3FH8A 1TTAA 2DJUA 3IFLH 2DLFL 2W1NA 5CCHE 4OJCA 1A7OL 5KJ4A 1NAMH 1T7YA 3KPLA 2Y3NA 5AAMC 5JO5B 3L1FA 4WGWB 4X83A 5FA4A 4G8IB 3BAJA 3F6JA 2NX5E 2X44D 4ZO7A 1EEUA 1LO0L 4HOZA 3U9WA 4TVPE 2LVCA 3WFBH 1K9TA 1T0NA 4LCIL 4UBDD 5C09D 1ERNA 4L2YA 1ZVSA 4OGZA 3C60A 3QORA 1AVAA 4RA3A 3R4DA 2MCAA 1XSIA 3LB6C 4TSAL 3BGAA 4DIXA 5IK3B 3I3BA 3ZU8A 2BIIA 3KLAA 4S1QH 4YL9A 3WJLA 1EZVY 4XCCH 1YEGH 1CLYH 3LNDA 1BGXL 4Y2OA 2XY2A 4N1HB 5AW1B 3BE1H 3WHXB 1BOGA 1MWAL 4DGIH 4GQ9L 1KCLA 3BFQG 1P2CB 4FQXD 3GJEA 5DEGA 3P4NB 4KJPD 3SDYL 1B0IA 1KMGA 5DJ8B 1BG9A 5KVDH 3BC9A 1CICD 3QPQD 5I28A 4HC1H 1OTUC 4UILL 5F8QC 3DK2A 5C07A 2J1WA 2J3SA 3VCLB 1D2PA 2PPFA 4YR6B 3PDOB 4M3HA 1YVLA 3KPRE 4XR8C 1OIOA 2MHAB 4JQIA 1Y6MR 4FQLH 5F93C 4F58H 5GS0C 1D5MA 4XCYB 4HJJL 2CA3A 2DLEA 3T77B 1QSVA 4E41B 1BCIA 4EJ1C 3SOTA 1FSKB 2Y9RT 1G94A 2VJ8A 5GGTL 2O6EA 1X9UA 2WTPA 4ZXBA 4X0NA 7FABL 4UUJA 5E8NA 4NGHL 3G9VA 4KROD 4P2OD 5KBLA 4IBVA 4R9HA 2FLRT 2RGSA 4LCUB 4NM4L 1KN4H 3IWVA 4D3CH 2P8PB 3EYOB 3KPMB 2AMGA 4F92B 1U8NB 2LFEA 4PR5B 4DKFH 3KCWA 2VXSL 3DIVA 3LHPL 1LXMA 2GAZB 4P4KA 2X4TA 2YPKB 3OKDA 2P5EB 4J28A 2VXUH 4OZHA 3U36A 2H32A 4DZBA 1U3HC 2L3BA 2KC0A 1PG7X 5TDNB 4U4IA 4CN6A 2AQNA 2EICA 4C83A 1U8OA 5KVFH 1SN5A 4KK8D 3K81A 1A6TB 2CLRA 2AJZA 4MSWA 3QDMA 3CFEB 2VN4A 5D2LE 1T5XB 4J3WA 4Z5RA 4X5PA 2AV7A 4KTDH 4RDBA 3PV6B 5KN5A 4UMSA 4FN0A 2HT3D 3W39B 4LSSL 1J12A 3V0WH 3VG9C 4Y2NA 3S7GA 4LMQI 4CW1B 1ILSA 3L5IA 4F1ZA 3K80A 4QR7A 2ZUTA 5CP7A 2NY3B 4FD0A 5CLWA 5D1QA 3D39A 5DR5L 3FU8A 4GBXD 4HEPA 2WTOA 3RURA 4ELMF 1AD0B 1BQ5A 3QWOB 3V8CA 1O6SA 3RWGA 2BINA 5AAWC 2VDNL 5KS9E 3Q1SH 1QO3B 2CO7A 4OLEA 1UFUA 3U25A 3UBGA 3OPZL 5IMLA 4XMZA 3FB7B 5AKTA 4PPTA 3EJRA 3UO8B 3ECUA 1R3IL 3QJUB 4X5WA 3RWJB 4ZQTA 2ZXEB 2VZUA 3O3AB 3L1OL 3O3UN 4G42B 3IKCA 2ATPB 1I9JH 3QP3A 3SKOA 3SE3C 5IEHB 1EAJA 1SM3H 4P99A 2X9ZA 2JQMA 4LSQL 1Q1PA 2BHYA 3V5KB 4TVSa 3FF8A 1J5HA 2AXFB 2HH0L 1G9NC 2D0FA 1MPAH 3X12A 4YL4A 4Z76B 3HBPA 4FTDA 1UXSA 1DVXA 3ZUCA 4A2GA 2X1XR 1AS6A 3D12B 4PGEB 3WN6A 4D2NA 2FWOA 4AQ1A 2B3RA 1RPUA 3JYCA 4JB9L 1FFTB 1DEEB 2R59A 5BJTB 4Y9GA 1JXJA 2ZICA 4Z77A 4PFEA 1QWNA 3TZVD 2E75C 3IFNH 3N9GL 3B1UA 3LX9A 3L3KA 4IEFB 4E5XB 2E76C 4X50A 1AXIB 5DMIL 5A7BA 1PIFA 4YGAB 1CFTB 1YN6B 3DPDA 2R7EB 2WVVA 4HEPG 5CBAB 3OR6A 5C0CE 5JW3L 4NRZA 5IOPA 1BFVL 4EUPG 3ZSTA 3SE4A 2WBXA 2HN7A 5CEYB 1CPUA 4IRJA 3TBVB 2JMRA 2P5WE 2AERT 1XD0A 4PJEB 1ZHLA 1HXMB 4J39A 4ECNA 1IAOA 3HZ3A 4NNYA 3GT6A 3WNIA 1QUPA 2TRHA 1FWXA 1GMIA 5H94B 2NZ1A 4U1SB 2WB1A 1L6XA 4URTB 3GLAA 5ABAA 1F4AA 1XGTA 3MXWL 2VRAA 3TBSA 4C4KO 4FE9A 3TO4C 3TJEH 1T2QH 1OPGL 1BQUA 2PTUA 1E4XH 4ZDHA 4H13C 1BZOA 2Z7WA 5DA0B 1A4KB 1PLBA 2AVFA 2D7OA 2GK0A 3G6JF 4XNUL 4FXKA 4GRLB 3ZT7A 2YOCA 5D7JB 4OJEH 4ANWA 4LL9A 4R5VA 3I02A 4O5LL 5C0RH 4UINL 4ZMWA 2WOYA 2TSAA 2O26U 2GT9A 2GUOB 3BT2L 3Q44A 4J4PA 4L3FA 5G5DB 2WP3O 3LD8C 4EIBA 4HPHA 2HTLD 4W68A 4MBRA 5EIIB 1FFOA 1JN6A 1IFHL 2NR6C 2E9BA 4IDJH 4LK4A 3ERXA 2KZKA 3FT4B 1SQMA 3HB3B 3VFMB 3HEIB 3PL6C 4LGRB 5EC1B 3X2QB 5DFTA 5LXGL 2WKLA 1CE1L 1N10A 4Y4FB 2EO9A 5E2TH 4UQBA 1S8DB 2ZWLT 1TNNA 3DMMB 4K94C 4U3XA 4LCCC 1W0VA 2X1OA 1FPTL 2BW5A 3S3JA 1K5WA 3SDAD 5TF1L 2F18A 2VLRA 4P5TD 4LSTL 4YFLF 2XLLA 2XN2A 4YHZL 4BK4A 4HUUA 1PLGL 5EPMB 2X9YA 2I32A 3FOLA 2ZCHH 1X5AA 5D8JH 2ZTBA 1DVFA 4KK5C 5JW4N 3T0EA 5EC2B 2ICWI 4PWIA 4XNYH 1YEHH 5GRVL 2AKRB 1T04A 4I18B 2FWSA 4JM4L 4F15C 1I9RL 3OR7B 4I77H 2WLLB 2AK1H 4OI9A 1U8LA 1NGXB 2BZDA 4FA7B 3ZYJA 1RZGB 3N0PB 1KEGL 1AG6A 1CFQA 1ZT4B 4JFPA 4FEMA 1WZKA 1A8JH 1ITCA 1VFBA 3RTQB 4JRFA 1SF3A 5C3TA 1E6JL 2PUQT 3N2JA 3WEBA 2ZCKL 4XMLL 3FB8A 1QRNE 5GRJH 2GW5A 5I8OL 4OB5H 3EJUA 4ICWA 4U1HA 4HKJA 5IJBC 2V7NB 3D69B 3HE7D 3EGSB 1W8OA 2K0RA 4HW6A 1CGYA 4MTMA 4X4ZA 5DUBA 3CK0L 3MPCA 1L7IH 1ROCA 5D96C 4G2AA 5CEZD 3MLXL 4UWQB 5DD3H 4C47A 3NH7L 2BHFA 3EBGA 4NQCB 3IDUA 3I75A 4D9RE 4GG6E 2AXWA 3NSDA 3SCMA 3OXSB 1MAML 4NRXA 1PSKH 5I18H 2NTFA 3APCA 5FO9A 3EOBA 4UCFA 2DLFH 5DA4A 1A7OH 3UEQA 4A04A 4Q9RH 5D2NB 2AXGA 2OFQA 2X9XA 3QIWD 1KPUB 3AUWB 4PJAB 5MP6H 4DQAA 4ZFFB 3ILPB 2KT6A 3ECQA 3BWAA 3PABB 3FB5A 3JQOB 5L2KD 4QRBA 4KJYB 2NUPB 4LCIH 1GOFA 5GGVH 5GS2D 2BS8A 2CE6A 4XP9L 1OLLA 1MWAA 2G4EA 3CFDB 1R3JB 3MV8D 5CJOL 3VFSB 1DJHA 1JHTB 2V37A 1E5AA 2CUHA 2P49B 4RH4A 3S9DB 3L4CA 4EDWL 5DDHA 2B1OA 4ODSL 5FB8A 4WV1A 5DYOB 3F12B 3CFJA 3OHXC 3QIBC 3CZJA 4G6KH 1RIVH 4HIHB 4NFDA 4NQED 4HIXH 4AIEA 2HVBA 2YC1A 4ZFQA 4JFFA 1XCWA 3PWUB 1INEH 3DOSA 3MRFB 3ROLA 5A40E 3E1F1 1RHHB 1W16A 4NBYB 1ZD6A 3GS4A 2QVFB 4RFEA 4ADGA 2QT6A 5CEZH 1MEXH 2BNRE 2GITB 2XG5B 4QRFA 3VAEA 2C4FU 1M2OA 2BVPB 3P9MB 5GGTA 3LQAH 2XBDA 4G11A 4TPRL 4PJBE 5FV2A 4OBSA 4RWYL 4G9DB 4MNQE 2FYYA 1Q94A 2NMSA 3NIGB 4D9QD 1IL1A 1XEUA 3IDYC 3QULB 5JDJA 5F44A 1FVCA 4ZTEA 5T1LB 3W5NA 3HG1D 5BUAA 2CLVB 1TENA 5DTFB 2OMZB 2VQTA 3PWJA 4OM0H 4HJJH 4C59B 1T89C 4YDLC 4B53A 3MJ9L 1DUYA 5IHWA 3BVXA 1PZUB 4GYBA 2XWBB 3HOGA 1SXSA 2AAAA 1S3KL 4XB8A 4J1UA 1G1YA 5ESQB 7FABH 2ZOLA 4G70B 5AW5B 1GCFA 3T6XA 4PTUB 4GSDL 3VWKA 3DUUB 1CUOA 5KVMC 2VWEC 3IGAB 2E9IA 5DFVD 3BGFC 3MLPA 3DV6A 4P3CL 5CEZE 1RZKH 3SPVB 3ZRSA 4FFZH 4QRTB 1BJ1H 4LOUC 2VXSH 5KAQG 3LHPH 1P5UC 2VW6A 4PRBA 3MLRL 2NY6C 1WA0X 3CN2A 3QZLA 3RVXD 3TBCA 1AGDA 5DVKA 5AW9B 5E4EC 1HHKB 2ZXAA 4S1RL 1HHJB 2A6IB 5F9OL 3NABL 2NW3A 5JIIA 4NENB 5B7FA 3FT3B 2LU7A 3TBWB 2EAEA 2ESVB 3NSYA 1UURA 3GMMB 1RZ7L 5J11C 5L2KE 1QBLL 1SN2A 2VMFA 4PLNC 2RJMA 5E4AA 3MRQA 4FXTA 5B21A 3ZZLA 1JPST 4HIJA 2XN9A 4U6HA 5H4YA 3QDJA 1PNCA 3R1GH 4I0PB 4I1NB 5JHLL 5CJXA 3VFOA 4G7RB 4OCRL 1NMCB 1K4DB 2JJSC 4QWWC 1CS6A 3D9AL 2Y06L 2LVEA 3C87A 4ZW8A 4WKZB 3A4EA 4LFHG 1X4XA 3HNTL 4GMTL 3WSQL 5SWSA 5FYJD 1FFRA 1MI5A 2D03L 1H0DB 3X1NA 1KLUA 1G5GA 5ICYA 1G1CA 3K46A 2L0DA 1KYAA 4QRRB 3K7UA 1JXGA 2NYZA 5L8KB 2BRRL 1ZTXL 5FC9A 3AG4B 2MJWA 5DHDA 1PYWB 4HLJA 4ZO6A 5HHVL 3SKMA 3GZOA 3L1OH 1VADB 2X1WL 4PP2B 3K2IA 4AL8C 2C1PB 2ZWKA 4P46C 1EAQA 1XF1A 4LSQH 2AABH 4NDMB 4QHLA 3ZDXF 3BP6B 4N0UE 3K2KA 4D9QE 5HJ3B 5KSVB 1P84J 3APMA 3OB8A 3HR5B 5GRXG 3U1SL 2YEZB 1M53A 2BNUB 3VFNB 1CYWA 1BD2D 3L4VA 3HG1E 1TG8A 4KBPA 4LLUA 5IW1A 1BBJB 4RMTA 1NTDA 4NQSA 5IBTH 5IT2L 1PG7L 5J56B 4WFGD 1IGIL 5K9OA 1I8LA 1MHEA 4JO3L 1ROWA 2WLMA 3O45A 1NEZB 4XP4L 2ZUUA 2VUKA 3KWVA 3EYSH 2ITCB 3GHEL 4CN1A 3UTTD 2ZYHA 2EYTA 4RZCB 1TQWA 5ETUB 5JUEL 2D0HA 2WWNA 3UL4A 3INUH 5JIQA 2O5XL 4JO1L 4C56A 3GSQA 3KD4A 4LAQH 4XMXA 4Y19D 3EYQC 1JGVH 1MCWM 4O2FB 4YLQT 1QA9B 1Y1DA 4MYWB 2W60B 2DQHL 3HC2A 3IB4A 1Q9KA 3QUGA 4KJWD 3LZNA 4NIKB 1XBRA 3GMNA 5FYJH 1YEIH 5I66B 4NQVA 4M1DL 2EDOA 2V5SA 4OUUA 2Q8BH 4ALAL 1HHHB 3NRFA 5GGVY 4XP1L 5DI8A 5GS3A 5J57B 1MAJA 3KZ8A 3QUZD 4OLYH 4ZUUB 1EHLL 1NZRA 1E65A 5LAXA 1S6NA 5CJQH 3WFZA 3IU3A 3BAXA 4AY0A 2XWJB 2AC0A 3LKRB 3OLDA 2DL2A 5IKCB 1YMMA 4YXLL 1OPGH 4DKTA 5LWYL 3L95A 3ARQA 2O72A 1EBPA 1RZFL 1TCRB 3EYFB 3SD5A 5CEXB 2BWQA 3DTXB 1I7RA 3RQ3A 4XNUH 1AZVA 4F7CB 4XWOC 1FZKA 1ZJAA 3IJ7A 5B3NA 2R9HC 3AVEA 5JXEA 5K1JA 3GPSA 4B27A 4J2XA 2ZNWA 2F53B 2WXPA 3NEXA 5GGRY 2OYMA 1AKJD 3JVGC 3TONA 1LILA 4HV8A 1USZA 5BRPA 1IFHH 2VCOA 2FIKA 5DHVH 1SNRA 3BVUA 5C0AB 4GQPH 2Y2WA 4JRXA 3LNEA 1CE6B 1MHHB 1ZKAA 1OQXA 2G5BA 5A2FA 5B8CA 4R2GC 1KCVL 2P26A 2VC2L 4X6DE 1NC4D 4PUBH 1ZWIB 4NO2B 5D6DC 4ZFOB 4AQOA 1U3HB 3GXPA 3P0GB 3WY1A 4BUHA 5TF1H 4DOHE 3MOAL 3BESR 4LSTH 3MRGB 2W9DL 3IXAA 4ADIA 4TNWF 4WU7A 3R4RA 1AFVL 1CTOA 4D0DB 4QRPA 2F68X 4LMQE 5INCA 3SO5A 3MLSL 3CXDH 1J8RA 4EPSA 3ARBA 1FNFA 3AS2A 5IP4A 1CC3A 1KXVA 3BUYB 4MXWL 3SDDD 4N86A 5LDUA 5EBMB 5F7DA 4G8EB 4LPCA 1U8KA 1E4WL 3WEAA 4XN1A 3AY2A 2OR7A 5D7LB 3VG9B 4LVEA 5TH2A 3X3FL 2DD8L 3AW5A 3PNWB 1FL6B 1WE5A 2PYEB 3NN8B 5F2FA 4PJCE 1IGFL 1RP9A 2DIJA 4K23H 5FA3A 4Q7DA 3WENA 3Q3GA 4ZMPA 4LLVB 4M6AA 1NLDL 2BX5A 4PYGA 4JMXA 3CFKA 3D48R 3R06B 3ARDD 4ORGA 2ROXA 2X2HA 3IYLW 3VFTA 4PGDA 4Y19E 4H1LG 1KYOK 1S7SB 3UAJA 1F6AA 1I7ZA 3HMWL 3S5LG 3TBTA 2EYSB 4U1IB 4UZGA 1V7ML 4DZ8B 3HS8A 4NKIL 1XQ4A 2ZOTA 1JUFB 3CDYA 2MTAA 2HCZX 5AVVB 5D72L 3MLXH 3MJWA 4UOW0 1T6WA 3HVDA 3T0BA 1HI6A 4NERA 4XP5H 4AT6A 1GS8A 4X4XA 4DN3L 4LKXB 3VA2C 1DP0A 5KBNC 2AJXL 4GAYB 3BJLA 4BEIA 2BSBA 3H85A 2EDFA 4OKVA 1XB6A 4DGYL 35C8H 4QXTA 2W38A 1YNLH 4FKEA 4O9HL 3BP4B 3MLYL 5BW7A 2BP0A 2OCJA 2Y3AA 4PGBB 4N0YL 4PW9A 3DURB 4L9DA 3TC9A 4YHNA 5J6HA 1JF6A 3LKQA 4V1DB 5B38G 1THAA 3US1A 1JSYA 4F91B 4PSPA 1G4MA 1OTSC 3PAUA 3WU1A 1KYFA 2VDOL 4I4WA 2VXQL 4PJFE 3RZCD 3NBNA 2A74A 2XT1B 5E70A 3NPZB 4M5SA 5D1XD 5CJOH 5KOVC 4NBXB 5J12C 3ZE2E 1SRDA 1UGNA 1HILB 3MR9A 5J0BA 5E1GA 4BH8A 2XPYA 2R1XB 2EDBA 4ODSH 5DRWB 1MCDA 3UERA 3FCUB 1RLBA 3NA9L 2DEYX 3HS9A 5A6MA 5E8EB 5ACLA 4M9OA 1ETZB 3C60C 3QORC 3Q2LA 1NGYA 4IU2A 4ZSOE 4R8WL 4IJTA 1KTCA 3ZMNA 3WJLC 1F8TL 2WUCL 4GB9A 1J8HA 4P23A 2C3GA 3BIKB 4BKSC 1KB9J 2N0KA 2BPBA 3LQZA 3VO0A 1E6OH 4ENED 2FEJA 1F45A 2WQSA 4TPRH 2BSDA 1ES0A 4LCWB 5CWSB 3C9NA 2J88H 3TO4B 1MN4A 3QEQB 5EOCJ 3L3OA 4OV5A 1F6LL 5FFOA 3ULVD 5T5FL 1S9VA 3VX1A 4TYUA 1D5ZB 4P5MB 4HK0B 1HAWA 1T83A 4LDOB 2YAOA 4X8JB 3HG4A 3VRIB 3MJ9H 3V6OE 3CU1A 2D0GA 2J44A 1GC1C 1S3KH 4Q0XH 4XN8A 2DQJH 3P77B 3ABKB 4WUUA 1NUGA 2CO6B 2IAAC 2OXHA 3EZJB 5CIPA 4MCYB 5GRVK 5AYQA 3MZGB 4HAFA 1KFAH 3GRGA 1OAJA 3TYFA 2VLJA 4ERSH 3EBIA 2X9WA 3LN5A 3ZX1A 2G4GA 3FTSA 2D7TL 5FYLD 3KDPB 3UGXA 1T66C 4GKNB 4JKKA 1OE3A 3PL6B 3MBWB 2YPLA 4ZXBC 3VFWB 5DMKB 1ZXKA 1DSFL 3GBDA 3MLRH 5IB5A 5GZOA 3HA0A 1QHPA 2EECA 2AHIA 4LCCB 4S1RH 5F70A 1W8NA 4IOFD 3UABA 1PLCA 1WO2A 5F9OH 3VGFA 1A14H 4JFEB 4IIQA 4PJ9D 2IEPA 3NFPA 1CI5A 2UZIL 4L4VB 2GYSA 1FNGB 4QOKB 4O51B 5JHLA 1JI1A 1S9YB 1FGVL 1Q9LB 1T0MA 1U0QA 4P4KC 1RI8A 2A9ML 5I1KL 3PNRB 2XXCB 4F15B 1QBLH 1TEGA 2X4RB 4Q9QL 2DYPB 4NN6B 1NMBL 2PTTB 4WI2A 1J87A 3HZYA 3QIUC 5D1XE 4UT9H 4PBWD 3BUIA 3VXMA 2WSDA 1IVTA 4X5LA 1YEWA 3ME0A 2Y7QB 1UKTA 4OCRH 3GEFA 3CX2A 3D9AH 1XGZA 4GT7A 1MF2L 1W72H 1VPOL 1KTKE 4H8WH 1PDKB 4X6CF 3WYRA 5CLZA 5A2CA 1K2DA 3HNTH 4JY6A 1FRGH 4GMTH 4YS4A 1XWVA 1NWPA 2IH9A 1ZV5A 4TOYL 3VYPA 1BQHB 5ISZD 2APSA 5TF0A 5D1QC 3B7SA 5D96B 2DH3A 2ZCLL 3MROA 3TVMA 4DGWC 4PIBA 4TVPL 2ROYA 4GIAA 5B39G 4LT7A 2DMGA 2VKXA 5HHVH 1DN0B 4ZZKA 5FYLH 3L7EB 2EDXA 3C8KB 1E67A 1WZMA 2L7EA 2XYCA 3Q5OA 3U4BH 2X4OA 4OJFH 1F18A 4JHVA 4M5YL 1RULL 4KKCD 2JTDA 1X9QA 1RZ8B 2GTZA 5DJ6B 4AENB 3VQ1C 5TE7L 3ULVE 1QFPA 2E7DA 4TSBL 4MAYD 3OKLA 3KNBB 5DGQA 1MCSA 3QYMA 2VERA 2LE9A 1SYVB 4CSSA 2NPLX 2I07B 5ITFB 3DSNA 2ZKHL 4G9FA 1SYSA 3AXHA 1MLBA 5IHZA 3RKDD 3ML8A 3KYNB 4L9LB 2W81C 1IGIH 2E27H 3U9PH 2G2RB 2GJZA 2X4UB 3O4LB 4Y1AA 3QUKB 1C7SA 2BSED 4J8RA 3T0DA 1IBYA 1TF4A 4PJGA 4TLTA 1A7RL 3IFPA 5ALCH 3DX9A 4AQ1C 5JUEH 1LGVA 3GXIA 1UB6A 4LDCA 4LF3A 4L1BA 2O5XH 2EDKA 1M7UA 5C97A 5GS1A 4JO1H 4XBGB 5TE4H 3KXFA 1EH9A 1LDSA 2AEQL 3E1ZA 3IDIA 3IN2A 3OHXB 3QIBB 4NM8L 4HIQA 1PTZA 1YEDA 3ARFA 3FRPA 3J07A 3ARSA 1UOKA 4XTRD 4BSWB 5JHAA 4PJIE 3SQOH 2IBZX 3FOMA 4JGMA 2DTSA 1Z5LA 3SN6N 1ASQA 4NWTL 4X7FC 4X0KB 5EG6C 4PRPB 2MCG1 5IZ7A 3MRPA 4XP1H 1MXGA 1IBDA 4Q9CA 3T1WA 3SPCA 5IM7A 3SE4C 5IF0A 1R9FA 3V2AR 4PBDA 2AAVA 2I7SA 4IRJC 43CAA 2C3XA 1NBVL 3V4PH 4HSQA 4UM9D 3WFHB 1M2VA 1X4ZA 2PPEA 4YDKL 4YEFA 5IESL 3BWUF 3IDYB 2EKJA 1A6WL 1Z3GL 3HFFA 3TNNB 3WNKA 4HDIA 3AS3A 1OGSA 3RI5F 2AGJL 1ORSA 4MJIA 3THML 5IFJA 2AK4A 2ARJQ 2JJWA 1QP1A 2C7UB 1F4WH 3NJVA 3ARGD 1G7IA 3PWLA 5JHDA 1IGYB 1KB5B 4W9GC 2PO6D 4F7PB 4N0FA 4GQRA 3OVUB 3OWRA 2HVJB 2WYHA 1UZ6E 1VCAA 2V5RA 2ZX7A 3FC8A 3NACL 1ZHKB 3K1DA 3QUYD 3UTQB 3BGFB 2QVKA 4JJHA 3H4FA 5EU6D 4KDVA 2VSDA 4ODBD 4AW4A 1P5UB 2X6VA 1TJXA 2NY6B 4DP5X 1OK8A 1RLWA 3GS7A 5KTEL 5E4EB 1O75A 1IFGA 4MNGE 2GTQA 2OMWB 3FRPG 4J4PC 1GSKA 3MXVH 2K4WA 3N40P 2ORBH 3VTTA 3C6LC 1G9EA 3NCBB 2JKJA 1G1OA 2OJEA 4A6YL 1RSFA 3MNWA 3PS6A 3BZEA 2GEEA 2MOQA 1V27A 3VWJD 1HJBC 3FCGA 1KBBA 1IM3A 2FD6L 1YYLH 2FHCA 1UADC 3P4OB 3F64A 3MRJB 1UXWA 2Z7YA 4HJGA 1PJ9A 2R2HA 1URLA 4KRPC 5B3JF 1BQRA 1DLFL 5L2JA 3MV9D 3GSRA 4OTXL 2R2BA 2ZG1A 3EADA 3S8FB 2P48B 1H6UA 2DD8H 4EVNB 2OAAA 1LJMA 4QRUB 5AZEH 3LV3A 3NJLA 4JJ5B 4WW1A 3UJIH 1IGFH 3QCTL 1DVFC 2OTUB 5I26A 3KLDA 3T0EC 1U8HB 2WWMC 4KHTH 4EDXA 3ULUC 3WBDA 3DGGB 4P2QB 2ZWSA 4WI9A 2AQQA 4FFYL 4Y5YA 4PJHA 5ENWB 3F7VB 1R47A 2E0PA 2KQNA 1I75A 1CCZA 4H0LC 4PJXE 3F00A 1ZLWH 5JPNA 4G7YL 4MB1A 4QT5A