5D2LF

Crystal structure of tcr c7 in complex with hcmv nlv epitope presented by hla-a2
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
240
structure length
238
Chain Sequence
AGVSQSPSNKVTEKGKDVELRCDPISGHTALYWYRQRLGQGLEFLIYFQGNSAPDKSGLPSDRFSAERTGESVSTLTIQRTQQEDSAVYLCASSQTQLWETQYFGPGTRLLVLEKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Crystal structure of TCR C7 in complex with HCMV NLV epitope presented by HLA-A2
doi rcsb
source organism Homo sapiens
total genus 33
structure length 238
sequence length 240
chains with identical sequence J, L, P
ec nomenclature
pdb deposition date 2015-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d2lF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d2lF02
3MOAH 4R4BB 4QWWC 4X7TA 3DBXB 2YD5A 3Q6GL 2BVEA 4L5FL 1CLOH 1W0YT 4Y16B 5AYQA 4YE4H 2BCKB 5IW6A 1LEGA 4R2GB 4LCIH 4HG4J 3FT3B 4TVPH 3RWIA 3VWJD 3PGDB 1R3LA 3KJ6H 2DQHH 5J7CC 2SEBB 3O3EA 4YPGA 4PRDA 1F4WH 1QBLH 5DK3A 3QZWG 5E0QA 5HHQB 1KIQB 1KB5H 1JFQH 1Q9LA 5D1QC 4S1SH 1SHMA 3C6LD 4XNYH 5MENB 3KPRE 3NGBC 4P3CH 4P9MH 5ID0A 3NOIA 4GMSH 2YXMA 4FQ1H 1GZQB 3G6JF 3WIIH 4P57B 1BVKB 2VMFA 1Y6MR 1CCZA 4I3GA 4YUEL 3MRJA 4QRRE 5EU3B 1X5HA 1EX0A 2Z4QB 3O3BA 1NDGB 4R26H 5HHNA 4ZOEA 2DTML 1YNTA 1FP5A 1NCBH 2R15A 4G6JH 1F4AA 1QA9B 4H8WL 4YGVB 2MCG1 5FYLE 4U1LA 1IGFH 2LE9A 5L0QC 1J1OH 3UCRA 4HS8L 4K7PX 3B9KD 3SJVE 5CUSL 4HUWA 1RK1B 5BMFH 1X44A 1QD0A 3OPZH 1A7PH 1BEYL 4TVSa 4M93C 3KR3L 3MV8D 1YEFH 4WY7L 4Z7UE 2GIYA 4LK4A 4NQXB 4HXBH 4U1HA 5K59F 3QUYA 4N5UA 3WHXB 4FQPA 3TZVC 5EBMA 3U82B 1KJVA 4JPVH 3EJYD 2O5YH 2F74A 1ZVYA 2VR4A 4KK6C 5CEZD 5CJOL 2ED8A 1I1RA 3CCHA 1YDPB 4ONHB 5DJYA 4IS6A 5I2IA 4NKDB 2ED7A 4UNTA 4AEEA 4PRPD 3GHEL 5BXFA 1JK8B 1RZKH 4WHTA 1UM6L 4K8RD 5D7LE 4ELKB 1NFDB 1DUYA 4HGWA 3MA9L 4E41E 4KROC 4ERSH 1PEZA 3B5HA 2DTSA 2W1NA 3QO1A 5DEFB 2AI0L 4N5ED 3VG9C 3BAEL 2I9LA 2VXVH 1X5KA 5L2KE 4MA7L 1MAJA 4UV4H 1O0VA 3WLBA 2OL3H 3W81A 3FZUD 3QO0B 4JQXA 3VGAB 4P9HL 5L8KB 2X1OA 1FC2D 3MV8B 2X41A 2G5RA 5I16A 1YQ2A 4IRZL 3EYUH 1TITA 3MUHL 4X6CB 5E2UH 3QEQA 4H0IA 4BSWB 1A22B 4HBCL 1CXEA 4ZFGL 5E8OB 3DXAE 2D0HA 4Y19B 3R4DA 4M62H 1AFVH 3KG5A 4W4OC 4S1RH 4WFGE 4PGDB 1EERB 1SEBA 2GEEA 3AM8C 4M5ZH 5T3XL 5I1KL 3BP4B 4I18C 4OLWL 1GPOL 2ZPKL 4G8GB 1XGQB 3MCKA 2HN7A 4B7IA 3HR6A 5BW7A 1F3DH 5DRWA 1T6WA 2DS4A 4P5MB 4JFXB 5DFVC 1PYWB 2R2EB 5SX4H 1B0RA 4OZHE 4M7LL 4DQOL 4UNVA 2HJLA 4L9LA 1JE6A 3EJJX 3UTTB 2DWDB 3QUXC 4OD3H 3CH1A 5D1QA 3ARVA 3WD5L 5I74B 2H1PL 1GOGA 5E99L 2Y25A 2AERT 1VHPA 1XF3A 3BDXA 4M02A 1FE8L 1VA9A 2NY6D 2P5WE 3L3HA 4WTZA 3U48A 5B3JF 3EOBA 4NBXB 5FM5M 4Y8AA 1XGRB 1YUHB 3VGHA 3PDGA 1ZS8A 1U3ZA 1ZHKA 1H3PL 3L3OB 3QUMA 4R7NA 1GJIA 2VDQL 5IKCB 4FQQA 3AGVA 1SMOA 1TJIH 4P49A 1C5CH 1G0YR 1MJ8L 5EUKA 4GXVL 4D3CH 1DQLL 1T3FB 4F8QA 2R29L 3RU8H 5DLML 4BFEA 3A6CH 3KYNA 5K9JH 3ZL4L 3ESVF 5I17A 4WI5A 1QQDB 4HIJA 4O4YH 1NC2B 4GRWE 4GG6F 3LAFA 5F3HA 4G7VH 25C8L 5E8PA 5T3ZH 35C8H 3ULUD 1NGQH 4XP6L 1YC7A 1HHKA 3GO1H 5CP3H 4HIHA 2D7TH 1OLZA 2UV3A 5HI5D 2X9WA 2GKIA 4L8SC 3DSNA 3QXAB 2GJZB 4LASH 4P4KC 1LO5B 2I25N 5FA3B 4MXQC 1YN7B 5ITFB 1A6AB 1BIHA 4ISVB 3WN5C 2QKIB 3HI5L 3DTXB 3O41B 4XVJL 4UV7L 2HVKB 2EIDA 2P5EA 4QRQB 4JHBA 5GS3A 4JR9L 4ETYA 2VXSL 2HH0H 2C4XA 1JGDA 3TBSA 2VZSA 1ES0A 3HB3D 2BNRE 5ALCL 3E8UL 5LWYH 1UM5L 4Z78A 1Q9WA 2X2YA 5SWSE 1MHPH 5J11C 4M1CD 5T3XD 5AG9A 4JN1L 3GSRA 5HPMB 1IQWH 3ZT7A 1KN4H 3EO1B 3VXTB 2R0ZL 3RWCA 4M8QA 3W5MA 1IM3A 4O9HH 3K1DA 1T03H 1ZT1A 5BCAA 1RV6X 4OF6A 1R3KB 4BM7A 1NFIA 1GGIH 3OAYH 1GGUA 3ARGC 2NPLX 4LAQL 3NCJH 2E27H 2CPCA 4HAGA 3WCYA 1WV7T 4XHQA 1T0NB 1A9BA 3OG6B 2FIKB 3OJMB 3KNBA 2CKBB 1ZA3B 2OI9C 3T8XA 1UWXK 3N50A 4W4OA 5E8NA 2CIIA 3O2WH 4HMEA 4LSRH 3WYRA 1CLZL 4G3YL 3AM8A 4JG0H 3Q1SH 3V5KA 3IXTB 4RGOH 3O3EB 2A9NH 1FV1A 3VH8A 1D5IL 4ZQKB 5IESL 1I8IA 2FJHB 4FFYH 4F7MA 3ESUF 5FHBL 4U1MB 4NYLB 2GYSA 3QUYD 1MWAL 2M2DA 1CFNB 3OB0K 5DMYA 1N0XH 1IEAA 1NAML 4Q0XL 1FZJB 3LN9A 3UTSA 4MGXA 3EYVB 5FFLA 3JWNC 5FUCC 3RNKB 1P5VA 2VDRL 3MRJB 3SCMC 1Q9KA 1NGPH 3JWDC 1HKLL 5ENWB 2AJXL 2JB6A 2VQUA 3MODL 4PJHE 1P7QB 2VLKA 4JDVA 5CGTA 1QRNE 2LU3A 4G9FB 3LKSA 2HRPH 4KDTA 5I1AB 2R4RL 1RVFH 4PLJD 5DC4B 2Q76B 5DI8A 3BE1H 3NPZB 4JY4A 2AGJL 3MYJB 4RNRA 1MIMH 4PJIF 4UILH 3GHBH 1K2DB 1EAPB 1JPGA 2DDQH 3MNZB 5IT2L 3MLWH 5ACMA 4U7MA 4NN7C 1A0QL 4HUWB 5KTEH 4U6XB 1I8LC 1YECH 1YYML 2LV4A 3MRLA 4N1EA 4ZAKA 2WBWB 4ZS7H 1IVLA 4YNYB 3FRUA 4RQQA 2ED9A 2ADIA 3QEQD 1SM3L 1VEPA 3DYMA 1PJ9A 1OL0A 2OXHA 3NMEA 2Z92B 3HI6H 2V2WA 3ZTJG 3HFMH 3VXQA 3SQOH 4P5KA 3AREC 3NIDF 2AJUL 1U8LB 1X4ZA 4FQHA 5DQJA 1I1YA 3L1OL 1RPQA 3BIKA 4KI5E 3SQBA 4XXCC 4JFDB 1BAFH 4WHTB 4U1IA 4F15C 4LLYA 1QFWM 3AS2A 1VENA 4HGWB 2CGRH 4L8SA 2NLJA 3MRGA 5ELIA 4G6KL 3VXMB 1CICC 1G7QA 4DN4H 2ZUWA 4JFQA 3C2SA 3W9DA 5IHUL 3WN5A 3QO1B 4HLZG 1ITBB 2DQIH 2XY2A 3EOTL 3SO3B 4AYFA 1D3CA 4MXVF 2E3VA 1RUPH 1N5YL 3WLBB 2APWA 3RNQB 2W9EH 3LRHA 3Q3GA 4LCWA 5HI3C 2IFFL 2R69L 4I8DA 4NRXA 3U36A 3EFFB 4XCFH 1P4LA 5HYFA 5D1QD 3D6GA 1A2YB 4ZUTB 3PWVB 1PW3A 3OAYK 3QEQB 2VXTL 4CU8A 2VJXA 4LQFH 3I2CH 1BBDH 3R0MA 3RHWK 4R4FH 3WFHA 2YHGA 3HPJA 3I9GH 1OGAB 3SDAC 1FYTA 4H1LG 2HFGL 3QUZC 4JDTL 1NAKL 4LRIA 3NIFE 4NO0A 4LP4A 4ETQA 5HD8C 5I1IH 1BFOA 4HXAH 2X1PA 5EU7E 3STLA 4HQQH 1T1WB 2YWYA 4G42B 3QIBA 1IKFL 4GAGH 1ZT4B 1JPST 4GKSB 1T1XA 3F7VB 1A3RL 4CW1B 3MLZL 1E4KA 1JRHI 5K9KA 4I2XE 2VZ3A 3VFRA 5CCKH 1F00I 3HC0B 4X4ME 5C0CA 1FL5A 3FO0H 3OX8A 4JKPH 3ZYOA 3JV4A 2DQUH 3FAXA 4D9LL 2ICES 4KWUA 3CH1B 4D9RE 1RQ5A 1WT5A 3LDBB 2WBJA 5L8LB 4L3EE 1CT8B 1HYSD 1Q1JH 1INEL 1FNAA 1GHFL 3V6OE 3ALWA 4EUPH 1UVQA 1OCWL 5BZDA 4PLKD 2XQBH 2NY1B 1G7JB 3PWPE 4Y4FC 2EXYC 1UB6B 5LCVH 1MWAB 1HH6A 4FQIH 4XNQB 3V6ZA 4BYHA 2P5ED 1M4KA 1NAMB 3TFKD 1T20B 5EU6A 3SDYH 3MRMB 4JKKA 4PRHE 4RMUA 5EOCL 1JCKA 2F58L 2BSTB 5IFHL 3NH7H 3P40A 3DVNB 3OR6B 5EUKB 1WBXB 4I9WD 4YX2L 1R24A 2IH3B 1FZKA 2OMBA 4U1GB 3U4BL 4DAGL 3KYNB 3OJDB 4HUUA 4AIOA 3GNML 1BECA 1OHQA 2BY3A 1HXYA 4NZTL 4C4KT 2IH1A 3L5JA 4XVSL 3V6FB 1AH1A 2VXUH 1BX2A 4F80A 1I8LA 5B38B 5F3HB 1SJXA 5J1SC 1LP9A 3WFBH 4MHHI 3FHQA 3P2TA 1U2CA 4U0RC 2FB4H 4HPYL 2V7NA 4XPHH 2BVQA 4M48L 4PD4J 3IFPA 1R0AH 2AQ2A 4X9HA 1IQDB 2WV3A 1A9EA 3DI2B 3T4AA 1WLHA 2OCFD 5ISZE 2VXQL 5CSGA 4TSBL 4HS6B 3KPSB 4X6EA 1UJ3C 1TVBB 3KYMB 5D4QA 5TFSH 4LNRA 2FRGP 3BYYA 3QG6A 4Z7UF 5L6YL 5KS9A 2B7DT 5AZEL 4E0RA 2ADJA 5D7KD 1T2QH 4HV8B 4JFFA 3I6LE 3DX7A 1G7HB 1CFQA 4LGPB 1WFOA 3ROOA 5GXBB 2NY3C 3OKLB 3UAJC 3PG2A 2ZCLL 4Z7VB 1BFSA 2P8LA 4ONFH 1I8MA 4QNPE 4ZG1A 4MS8C 4H0GA 3LB6C 1R5WB 1LO2L 5DMJB 4OZ4A 2HJKB 5JR1H 4M8QB 2EKJA 3BP6B 3TA3C 3RAJH 3EYQD 2A6DB 1HINH 2A1WH 4LAJH 4DEPB 4V1DA 2KQNA 3UJIH 1A7BA 1P4BL 1QVOB 3NCYS 3SE4A 3MJ8B 1UCTA 5J8OA 3TO4C 1IEBA 3L7EB 4HD9A 3W9EA 4B50A 1T22B 3MRDB 5D93C 2VLKD 4PR5A 4PJXE 1AO7B 4GW5A 4UT9L 4YDIH 1CQKA 3MMEB 4P2CG 4QXWA 4KHTH 5E8NB 3S4SA 2BJML 3QUZA 3V0VA 2UZXB 4UB0L 3HAEA 2Y6SC 4J3SA 4JFEA 2R2BB 3MV7A 4ONGL 2JK5B 2QADB 2ZSWA 1KENH 3RZCC 1C08B 2DLGA 4ZAKD 4JKLA 4FABL 5FM8A 2AEWA 3C2AH 2OMNA 4K3DL 5JO5A 1U8MB 3E6HA 3S37X 1MCWW 2A6IB 1DQDL 1HH9A 3KPQB 2PR4H 1CI5A 1RJLB 1A4JA 4UTAL 3H6JA 2VDOL 3FQRA 3DJ9A 4RGMC 3WJJC 2XG5A 4IIQA 4LSSL 1XF2B 2OL3A 1XIWC 3CVHL 4K7PH 1S7WB 1OVZA 1DN2A 2R4SL 1R3IH 5GZOC 2JB6B 2DQGH 5A2KH 3P73B 3SKOB 2AQ1A 4BKLA 2ICEB 2VLKB 3HG1A 4TVPL 1JP5A 4PJ5B 4OZHF 3PGCB 4LRNH 5F6HI 3LKPA 4Y4FA 4HPOH 1WBYB 1V05A 5F7WC 5JPNA 5AAWA 1QBLL 1RI8A 3P30H 3FQWB 1A7RL 2IAMC 4HBQA 5KSBB 1WIPA 2HT4D 1WZ1L 2G2RB 4ZAKB 4LCWD 3TJHD 5J13B 2F53B 3CFEA 4P9ML 1X3DA 2ADIB 4LFHG 5KVFH 4CMHB 2X4NA 5CKAA 3OJVC 2XA3A 2EEBA 5DQ9A 1OAZH 4YHPA 3RGHA 2P4AB 1FC1A 4F7EB 2AJVL 5DK0A 3PF2A 4PGBA 4TRPL 5J89A 4Z8FL 3QXDA 3MOBL 1FYTD 2X7LA 3P4OA 3CLEH 3CSYB 4HKJA 1NKOA 1K8IA 1KPVA 3BIKB 1JGLH 3BXNA 4FTVB 3CSPA 5JIHA 3QQNA 3VXUB 5I30L 2NLJB 1S7QA 2YPLB 4RWYL 3ULVL 3QIBD 1G7QB 1J1OL 4QRPB 4GRWF 1MFDH 3B9EA 1UJ3A 3S35L 5CJXC 4YFLI 4JLRB 4KKLC 1KBGH 1RIVH 1YEFL 2ZZUT 4MVBC 5ANMA 3HZVB 2FZ3B 1R5IA 3MRBB 2VLRA 5C0CD 2XTJC 3IYLW 5JXAH 5LGJA 3CC5B 2NY7H 3INUL 2D0FA 1VFUA 4NQEB 4JPVL 4JZNA 2WBJD 4ODWA 2EO9A 1HEZA 2VZVA 3MO1B 3DO3A 1I4FA 2V2TA 2V2XA 1RZ8A 2GJJA 3VDBA 4YXKH 4PG2A 2QQLL 3WFHB 1RZKL 2NY0C 1JPFA 2V5TA 1NCCH 4U1NB 5C6TL 4XT1C 3DUHA 4OZIB 3CX2A 4WTXA 1AD0A 4NBYB 1T1ZB 4AIZB 3BKMH 5EU6D 3VDCA 5ERWA 3S36L 2YS4A 1A6ZB 3LPFA 3BGFB 3SGEH 5CP3A 4LLUB 4ZFZA 2P8PB 1XR9A 4NCDA 1OF2A 2W9DH 3ZTNH 3G9AB 4PRBA 3EUUA 4TVPD 5ID1A 3H7LA 5TDOB 1L7TH 4TN9A 2IQ9L 5IROC 4K23L 2CIKA 2VL5A 1LO4L 5C0CB 3TM6A 3OX8B 1DANT 3ARDC 5E2UL 3VGGA 1KJ2B 3OKYA 2GK0A 3L3GB 3P3YA 3HC4H 2WBJB 1L9NA 3LD8C 5TE4L 3MV8E 1N7ML 3O4LB 5ICYB 1VFMA 3PQYB 2YK1H 4PJEB 4M5ZL 1XIWA 3I02A 4N8VG 5CEZE 1I7ZB 4ZTPH 5E00B 5LBSH 4S0TD 5EC2A 5GRUL 3P0YL 5E2WH 5F9WC 4DTGH 4FQ2L 1MLBA 4P2OC 2X6MA 3RGVB 4JFFD 1M05A 2R2HB 4XGZA 4PRNA 3BT2H 4PRPE 3SGKC 3TVMB 4DKFH 4HDIB 4U31A 3CVHB 4XNZC 4G8GE 3VW3H 5JA8B 1FZOB 2EYTA 4TULL 2FJGA 2WINB 2QTEA 4XVTH 1A21A 2C4FT 1A7QH 1ZAGA 3ULVD 2PW1B 2R56H 3OBAA 4IRJC 3GM8A 2AKRA 1HOCA 5IBUB 3HR5A 4PJHF 5HI3D 1TZIB 3LZFH 3FB5A 5J3HD 1M1SA 2APFA 3DMMA 2ZUTA 3NBNA 1F11A 4Z76A 1TJHH 1J11A 3FJTA 4MNGB 4GS7B 3HPLB 3GJFB 2DD8L 2YKLH 4JQIH 4O51B 3W5NA 3D9AL 1YQVL 2BP3A 3DURB 5EB9A 5F7MC 2E9BA 2F15A 5FGBA 3QUZD 4J12A 4X6EB 5LKNA 2PTTB 5J56B 4JFED 2H6PB 3MV7D 4E42B 4F37F 5H35B 1ZLSH 3BWUC 3N1MC 1Z9LA 3RVVD 4HULB 2GITB 4PJ9C 4WV1B 3RU8L 3AFLA 5HVGB 2DMBA 2FO1A 4POZC 4NC1E 4UQ3A 3MXVH 3EOAB 5K9OB 3C8KB 4PY8J 5D5MA 5A43C 1I8MB 1GC1L 1VDGA 4PJBE 4OCRL 4G7VL 1CDCA 3LSOB 3EGSB 4KI5F 3WKMH 3QNXB 3IDIB 1G0DA 2H8PB 1K4CA 1KELL 1NGQL 4EVNB 5GS0L 2D7TL 5F89B 3D5OF 4OGXH 4XNUL 2A6JB 4QTHB 4LASL 2B1HH 4NO3A 3BZ4A 1P7KB 2FL5A 5EO0B 6FABH 4UAOC 3HLAB 1S7XB 4Y4FD 4YHZH 4L4VD 2HLFD 1TIUA 4P46C 2HH0L 3BDYL 2VITA 4R90L 4F57H 4MD0A 4PJ7B 4RMRA 3V0WL 3H9SA 2ZSWB 4P23A 3PNWB 4HKXB 1LD9A 1H3TA 1MHPL 3HMXH 3QI9C 4YDLC 1MOEA 2J88H 3LN4B 1KN4L 2FCBA 2OR7A 5C0EA 3M1BB 4KU1A 5FECA 4DJMA 3P0VH 1NMAH 1T03L 4P2QA 5CSZA 4YDKH 2ZKHL 3NIFF 3UEZA 1FNEA 5FO9A 3MRQB 3C5ZC 1A4JB 3SE9L 2I9TA 1CLYL 3UPRA 1KTKE 4IIQB 2O26U 4IEFB 1QFWI 4XH2A 1MF2L 1CE1L 5C08A 1LO0H 4WHYG 3MACL 1NMCC 1WZKA 2BDNL 5IMOB 2VYRE 1KCSL 1MCOL 2HKHL 2X89A 4R0LB 4ODXA 5DQDH 1UA6H 4EUPG 2X9YA 3O2WL 4LSRL 3RWJB 2RGSA 4ODUB 1K8DB 4UIKL 3Q1SL 1XCTB 4HJGA 4A6YH 3JXAA 1EXUB 1KT2B 4L4VB 3CX5J 5FIEA 5JPNB 2VLLB 4GAJH 3CXHJ 5C2UB 4JFPB 4P2OA 1CGVA 4FFYL 5FF6A 5IHZB 1ZVSB 2IQAA 2VLRD 5GRXG 4XPTH 4OZFG 5TH2B 3RWFB 3QG7H 2R1WA 4S1QL 4R8WL 4OGYH 2XN9B 4HUKB 2BVPA 1CXKA 4XRCA 1BZ9A 5EZIH 5GS1B 3V7AE 1G84A 4IRJA 3RDTB 4BQ8A 5T3XE 2GHWB 4U7SA 5DVNA 1UADC 4BH7B 2MPAL 3K8MA 1B9ZA 5KZCD 5MEQB 4I48A 1OM3L 1DTUA 2CDEB 4PB9L 3MRRB 4EDXB 3IDGA 1T7WA 4CL7A 5I1JL 3D25B 3BE1L 1LK2A 3OKMB 3QFJA 3AXLB 1AHWA 1S7QB 5HHPB 1TTUA 3BPLB 4NZUL 1FYHB 2IANA 5IGXL 3L3IA 2DDQL 5DJXB 1NGWB 2Y6SD 4G9FE 5BZWA 2E6PA 1JZ5A 1GGTA 3TH3T 4X0KB 1YECL 4KUZL 1LDPH 3SE3A 2P24A 3RKPA 4HUXB 2J8UB 1C5BL 5F72S 2HT3D 4PJ9A 2C3GA 5FYKL 3STZA 5LGJB 1ND0B 1T5XB 4WUKH 5ESVB 2HLAB 1D9KA 4PGCA 5F9JB 4IHOB 1BHGA 5JLZA 3F58H 4ODWB 2EKSB 3FTGB 3AB0C 1RZ8B 3HFML 5C9JA 2XXMB 3WLWC 1AI1H 5T1DL 4GUPA 3DSFL 2YPVH 1XIWD 1SVCP 2AJ3A 1P84J 1RHHB 4ODTH 1T66D 5D1ZA 5DS8A 4S1DD 5GZOD 3ZKXB 4W6WB 3CUPB 5JPMB 5FOJA 5T1LA 4DN4L 1H9VA 4QNPF 2R1XA 3GBNH 4U1JB 3GDBA 2IPTL 2VR5A 4JFDE 1I3UA 1NCWL 5SWQA 5J9PB 5IVOA 4Z7WA 3U2SA 1XF5B 4K7PY 2Y23A 3MRPA 5CEYA 3G6AB 2ZOLB 2V5SA 4H5SB 3QP3A 5I9QC 3GIZL 1I9JH 4ONOA 4YR6B 4PPTA 3CJJA 4LPXA 4AT6B 5DUMH 4QT5A 4XCFL 4LBEA 4M7KH 3QI9A 4PJXF 2G5BB 4NP4H 3NVQA 4HAFA 5IB2A 1TQBC 3OWEA 3DMMD 4ODVL 2R1YA 3QEGH 4PRIA 5BVJA 2YN3A 1CDGA 3VFUA 3IDXL 3VXRB 3GMPB 3GUTB 1BBDL 2WWKT 2DLEA 2Q6WA 2P48B 2ITCA 1DL7H 5INDB 3C5ZA 3T2NL 3D1MC 3QEQE 2QHLA 2UUDH 2C7UB 2Y06H 3B4NA 3WS6A 5I1LB 2FH8A 1N5AA 3B8YA 1D5XB 3IETA 5JNYB 5JW4N 2A73B 3T0XA 5IJVB 1DE4B 5TQ2L 2DBLH 1LNUB 2YEZA 2XNAB 5CJQH 1BQHB 5DJDA 4M61A 2BY2A 3K2UL 2FHBA 4ZUSA 1I1AC 5DWUH 2O93L 3BPCA 4RA0C 1MREL 3UTQA 2V9TA 5MHSD 5CP7B 4LEOB 3CXDL 2CDFA 1W0WB 1TJGL 2YWZA 2XTJD 5H2BA 1YPZB 5E8DH 3G6JA 4LVEA 3HR5B 2PYEB 1EJOL 5J1TC 1JPTH 2K7QA 5GSRA 5I0ZA 3GMQB 4RZCB 3FB5B 5IFAH 1Q1JL 4U6TA 2XWBA 3DMMB 3F62A 4ZDHB 2ICWA 5DD6B 2ZUUA 4OJFH 3SOBH 1ZHNB 1JWUA 2XQBL 4C55A 3VD9A 5FYKD 1XEDA 4DZBA 4OKDA 3C9NA 3DX9A 3FO2A 3Q2CA 4K71B 5LCVL 4GAFB 2PF6A 4FQIL 4MNQA 4WW2F 2DOCA 3BH9B 1X5YA 1C1EH 3MZTA 2VWEE 4NUJA 3BHBB 3SDYL 5FYJU 4MXWH 4M43L 3B5GA 3H9SD 3MPCA 3HZMB 4P23D 3U7WL 1MCNA 2CUHA 4WFFD 2FATH 4HWBH 2K3TA 1I3GL 4TSAH 4YQXH 1FGNL 2VKXA 4MA1C 5KG9B 2VXUL 2EDNA 3G5YB 4P2QD 3WJLC 1TETH 3AU1A 1X5ZA 1A6UH 3MLUH 2NX5B 3WFBL 4LU5H 2R8SL 1KLGA 3FAWA 1FAKT 1VCAA 4URTB 2AABL 4XPHL 3FB7A 1BLNA 4NM4H 4GLRH 5C08D 2WLZA 1R0AL 3VFTA 2CUMA 3TJEH 5F6IC 4FFVC 3BGMA 4J3VA 2FR4A 5H37G 1VERA 2X89D 2E9WA 2FECL 4NNXB 4ZFFA 5JTWA 3IAQA 2ZUSA 3MFFA 2FL5B 3OKKA 4IDJL 5CGYD 4WO4A 4Y4KA 3GB7A 1MFBH 2JJSC 2ZUXA 4XWOD 2AXGB 2AXHA 4JN2B 4ODHH 3VFVA 4RBPH 3UTZA 5ADPL 3U0PA 1U3HC 1U8IA 5I1HH 4OKVA 3NCFB 2B5IB 4P2OD 4HJJH 2PO6B 3DV4A 3H9SB 3JSSA 4JG1H 5TQ0H 3B5TA 3HUJB 2FSEA 4LSQH 1YEEL 4LLVB 2P5EE 1MCEA 5F1SA 5HGDA 4OAWA 1OTUC 1O7SA 2G75A 5D7JC 1FO0H 3T1WA 1E6OH 3U30C 4LSVL 3RAJL 1OSPL 4KRMB 4OD2B 3LKNB 4JO1H 4P2QB 1C8PA 4I9WE 1I7UA 4Z7VE 3OZ9H 3NA4A 4IRJD 1QBAA 4K55A 1QZ1A 1PZ5A 5C07A 3D87B 2W60B 4KDWA 1SJVA 3FRPG 2R2CA 4Q6IB 5DD1L 5C08B 1XGPB 4TUOB 4XAKD 4JPWH 5DJZA 3TBWA 1VFBA 3T3PE 4YDIL 1XGUA 1EEYB 1QBBA 5AAMA 3ARPA 2PXYA 4ODXB 3QFJD 4KHTL 1EO8L 3ZKMC 3FHAA 3X12A 1WUNT 2IAND 4MAYB 3SKNA 4HW6A 4QRSA 1AO7E 2EDLA 4CVXA 1DEEA 4HK3J 4WWKC 3ALPA 1ZK9A 4JRXB 3T65B 3WUWG 4ZO8A 2FBOJ 3MYZA 1MHEB 4PJ9D 4TSCH 2BZDA 5HHMD 3NCMA 15C8H 2P42B 3B2UD 1ZLVH 3MBEB 3C2AL 3MROA 1D9KD 2R23B 3QQ9C 5D7KE 4X6CF 4OLZH 1JHKL 4QHNB 3ZT5A 1DJSA 5I6XB 2X4OB 1BZ9B 1PD6A 4HWUA 4GRWH 5SWZA 1CGYA 5DD5H 5KAQG 3VXNA 4NKMA 4Z7QE 2NXYC 2D7QA 4TQEL 1KCRH 1R3IL 1N59A 1BMGA 4NKOA 1G9NL 5HHVH 2UWEB 5D1ZD 4Q7DA 1JWMA 5T1LD 1X7QA 4LRNL 4FXLA 3U46B 4PFEA 3JV0A 1HIMH 4XBGA 1EHLH 1KFAH 2EH8L 3CZFA 3HA0A 1PLGL 5CWSA 1JGUL 1P4IH 5DT1H 2VLKE 2CSPA 3P4MA 4L4TA 4HCRA 4NC0B 1JJUA 4BZ1L 4F8TA 3QQ3A 3TCLA 2FO4A 2EYSB 5FUOH 1C16A 4HHAA 3WDHA 1DFBH 4GG6A 3IJYA 3O3DB 1V3LA 3QI9D 5CINH 2H3NB 1L9MA 2JCCA 4LHQB 2VDPH 4HIIB 3MUGB 5DHYA 4PRID 1D9KB 1JF5A 1A4KB 1U95A 1OTSD 2WQ8A 4PLNC 5GPRA 2YBRB 4Y5VA 3IVKB 1KTDB 2F53E 5GJSH 3EIFA 4EOWL 2G60H 3C5ZD 2DQJH 2AK1L 3SDDB 3WL9B 5KJRH 5EN2A 1EEZA 1JGLL 1XF4A 3HS0A 3X3FH 2AJ3B 3BP7A 1HDMB 3IXAA 4X8JA 5GZNC 1IAKB 2PYFA 1OAQH 2W65A 1S78C 1U0QA 2YD6A 4O2CA 5EBLB 2R1XB 4LVNB 1GGBH 1WFTA 3O0RL 1CLCA 4FTVE 4XTRD 3F6IA 1RZGA 2Z8WC 1MPAH 2C9AA 1RZJL 2YPLE 3RX7A 1U3HA 5D1XA 4D0CB 1MHCA 2HFEA 1AGFA 5E08L 4ENEC 2IPUG 1U91A 4NM8L 2JTDA 1G7IA 1JZ7A 1MIEL 3AC0A 5EWIH 4QEGA 3QZWB 5IUSA 4YC2C 4X99A 5D7JA 1L6ZA 4OFIA 3BZFB 4GSDH 4PRIB 2ZG1A 3MJ9H 4KMTH 5E2VH 4LCWE 2ORBL 4YXKL 2FX8H 1B0GB 4NQEE 4FXGA 3QJFA 2Q6WB 3PWJA 5DFWH 2BOBA 3HI1A 4MNQD 1QG3A 4HK0A 4J6RH 1FDLL 4OLEA 1LK3H 1N5AB 3FFCA 1YN6B 5CZVL 4LHUG 5HVHB 3PHQA 2YEZB 5D71H 1F8TH 4B0MM 1FYTE 5DJDB 5FXCH 1KF9B 4ODSH 1F4YL 3MREA 1OWRM 2H9GA 1HZHL 3OF6D 2CMRL 3ZTNL 5EDXA 2AK4A 2D7PA 2RR3A 3F12B 5IBLC 3VDAA 2XA8H 3UTQB 3QCVL 1G7MB 1WJ3A 1ONQB 4WWKA 3MGTA 3T4YA 3GBMH 3PGFL 3DVFA 4FQJL 1CFBA 4LDEB 3C8DA 2EEDA 7CGTA 2ZUYA 3MV11 3Q6FB 2WP3T 3W11C 3HC4L 1WFNA 4XWGH 3X11A 1UWGH 4G43A 2VLJB 1J8KA 3NFPA 2H26A 5ECJE 3K8KA 3HMXA 5C0CE 3DV6A 4HCRL 4YDJA 3IDJB 1FFPA 1KPRA 2YK1L 3ET9F 4JFYA 4WEMB 4K2UH 4R97B 3WLWD 4YHYB 5J6GA 4WO4D 4Y4KD 2FBJH 3A6BH 2QR0A 1CL7I 3QJHB 4MD5A 3O4LE 3SY0B 5C8JB 1IKNA 3ARFB 2X4PB 2DLHA 5F7DA 3PWUB 4HT1H 4PJIA 4Z5RB 2YC1B 3MGOB 2D2OA 4JGMA 3BKYH 4KAQL 4JO3L 3NCCB 1W0VA 4YDVA 5EU6E 4K7FB 5E5UB 1K4DA 3TYGH 4KTEL 2X70A 2Z8SA 3X3GH 1F5WA 4A6YA 3LZFL 3HNTH 4XMKL 4XP5L 1WCBB 1KLGB 2RHEA 3MLVH 5C07D 1TJHL 1GGCH 4TVPE 2VN4A 4YO0A 2LU4A 3RTQA 1DBJH 2FEDD 4J7RA 4NSKA 2EE6A 3R06A 3BGMB 1LP9E 1P2CB 4JQIL 2FR4B 1UGNA 3KPPB 5DRZA 3U0WH 2PXYD 4WU5B 4R7DA 2EXWD 4HF5L 1UQSA 1JZ2A 4Y4KB 3GMRA 3GMOB 5A16A 3TBYB 1MVUA 4MNGE 4R9HA 3QDMB 4WGWB 1RUQL 3P9LA 4MLSA 5TF1H 5I1CH 4DKDC 1SJHA 3SPVB 3TN0B 4MB5A 5JQ6L 3MXVL 4PGJA 4YEFA 5D96C 4JHWL 2M8XA 4UOW1 2YA2A 1YEGH 3BEWB 2G75B 1NEZG 1UXWA 4JFFE 4JEGB 2XTLA 3OGOE 1DANU 1MRFH 3O2VH 4M93B 5SWZD 4JJ5B 43C9B 3WS3B 2AEIT 4CJ1A 2VIRA 3RY6C 4KQ4L 1H0DA 2DB8A 3ULSB 1J87A 1NDMA 1UM4L 1JNLH 3ULVE 4PTUB 4LLQB 5C0IB 1BOYA 1EEQA 5FO8B 4G8FA 4I13B 5DJZB 1GXEA 6FABL 1FL3A 3CVIL 3BKJH 1IAIM 3V7MA 3WFEH 3X12B 4KDVA 4ZPTB 2FWOA 4L4TD 3BRFA 5AUMB 4CVXB 1J88A 5EZJA 4FP8H 5IIEA 4KROB 2CLRB 4NQTA 2HWZL 5DJ6A 4AZ8A 2BFVL 4F9LC 5KSVB 2ATPB 4JFEE 3DRQB 2C4FU 1BP3B 3UZVB 5FV1L 5I1DA 1RHFA 4RMTA 2NNAB 1GIGH 3F7YB 5FO7A 4EIGB 4G7YH 1QUNA 3GIVA 1KXTB 1NEZA 4GKNB 5ADOH 1X4YA 4LMQE 3ISWA 4AEHL 5BOZG 2NW3B 1NMBH 1JNHA 3G04A 1LO0L 5FHAH 3G5XB 3K74B 5HJ3A 3SDXB 2JE8A 4EQ2A 1EFXA 1XFPA 1FLRL 1S9VA 5J4MA 2EDHA 4FFVD 4WW1A 1JWMB 1F6FB 2QQKL 4JAMB 4NNYB 5F1NB 1VGKB 3T0WA 2OP4H 2CLZA 2UVEA 2EDTA 3EO9H 3UZQA 2VZ1A 4PS4H 3QFDB 3DVIA 4JM4H 5EOCJ 3QB7C 1HN1A 1YY9C 3IFLL 4GAJL 5DURB 1AP2A 4I18B 4XNXH 1FRGL 1XR8B 1DQQB 1JHTA 4BH8A 4TUJA 1ZGLB 5D1XD 1NCAH 4FXKA 4RAUB 4XPTL 1AGEB 3QQ3B 4UQ2A 2H2SC 2FO4B 4L4VE 3QG7L 3UPAA 2Q20A 5C6PB 3VFSA 5L9DH 3BQUC 3OB8A 4KK5D 5D6DC 2A0LD 1OTUD 5D7JD 2XY1A 5KSUA 5GGUB 4CVZB 5CBAB 4J1UA 2OX5A 1GSMA 2O5ZL 1CFSA 2ESVA 5JOFA 4HS3A 4YBQD 4NWTH 1IC5H 3QUXB 4LSTH 3ARBB 5HYQA 3LRSB 3RWHB 3HS0B 4U6HB 5HYJB 3FFCD 5I76A 3ZT6A 4X8JB 2WIMA 1ZEAH 2BC4A 3O8XC 4Z7UA 1A1OB 2BVOA 1D5MB 2GUOA 3I3BA 4JE4B 5HGBB 4KJWD 1MFEH 4OD1H 3SKUD 2F8VA 1IMHC 2AK4D 1G9MH 1MQKL 1VADA 2IBZY 4NN5C 5HY9B 5I15L 2HMID 3UJTL 1CDBA 4R4NC 3V4VH 2FJFA 4PTTB 1QEWA 1IARB 4ZO6A 2EC9T 1IGIL 5MERA 5KOMC 3QCTH 5SV3A 4YHOL 3EDDA 4PJGB 2J8UE 4X99B 2RIKA 2DQCL 3ARRA 3FQNA 2VLRE 3CDCA 4AMKH 4HWBA 1AI1L 2OJZL 1DSFH 4JFOA 2YXFA 3VE0B 4GRLB 3O3AA 4MX7B 1IGTB 2NXYD 1G6RH 3IKCA 5L2KA 4KY1H 1YNLH 2ZG2A 4GG8B 4WJ5B 4UDUB 4Y0GA 4OBSA 1JZ8A 2RCSH 1LE9B 4M9OA 1A14H 5KANI 4JGUA 2X4RB 4P4KB 1CGSH 1U8QA 3BSZL 1LILA 5KW9L 5FDYA 3L5IA 4QXUH 1IGYB 2H9GB 4Z7VF 5J12C 1CYGA 3WXVL 1UZ8A 3CMOL 2ZSVB 4OLUH 1JWSA 1I9JL 1CDUA 4RGND 3PWNB 3QEHB 5HDOA 1RMFH 3LEXB 2A74A 4NQDB 2V9QA 3T3PF 3O2DH 4GFTB 3IGAA 5J11B 3EFDL 2AV7B 4M1DL 5DGRA 5DHVH 4JB9H 3RTQD 5FGSA 2IADB 3PXJA 4X6DA 5FV2A 4P5TA 3OJ2C 4MWFB 2Y06L 3VMOA 1KXVC 2VKWA 1FO0A 2HP4A 3ARGB 3SN6N 3VXOA 5EOTB 1T2JA 1FN4B 2DBLL 2B8OT 1G7PA 2MKLC 2VQ1B 1OAUH 4QOKA 5GZND 3DARA 1ORSA 5DWUL 3BIBX 1BJ1J 5HVWA 3VD3A 4QHKI 5JORB 1PZUB 4AM0B 5LXGL 4ELMB 1MJ7L 3TBVA 2VAJA 1AXIB 3UBXI 4Z7QF 1K4DB 3P77B 1EAJA 4L1HA 1E4WH 3QWQB 3GZKA 1S7SB 3N85L 3CFKA 1G6VK 3ORJA 4OV5B 4OF0A 1FNGA 4X6BA 2FHCA 5D6DA 3SOBL 3FN0L 5I71C 4YO0B 3RTQB 4QXTB 4PGEA 3WIHA 3C60A 3WKNA 1EK3A 4CNIB 2DMCA 2D03H 1JRHL 1C1EL 5GRVK 2NY2D 3SCMB 3OAUL 4N8CH 1DVFB 5I73B 3LMJL 4O2EB 1C5DB 2YD9A 3U6RA 5DF0A 3P9LB 4H1LB 4KKAC 4ORZC 4G8IA 3O8XA 4Z18A 4XP1L 2Z31C 4LLMA 4MZ2A 5F7NC 3KPMB 1HSAA 4KI5C 3L3DA 3PL6C 1U93B 4UDTA 2B0SH 4DZ8A 1V3MA 2HG5B 3IU4H 1BIIB 3KJ4B 3MLUL 4NN7B 4OIIH 3K4DA 4KKBD 3UDWA 1ZWIB 2JIXD 1KULA 1IBGL 2NCMA 3QRFM 3LV3A 1J86A 4NM4L 5D5ME 4XB8A 1G7LA 4CGTA 1EFXD 2NX5E 1XH3B 2W9LA 2RFXA 5KANG 3HZYB 4HWNA 5JXEC 3JVGA 3TNNA 2EDOA 3WO4B 3RUGA 1T04A 1WF5A 3QNYA 1HXMB 5T5FH 1AGBA 3B9VA 1S7TA 4XCCH 3REWB 3AREB 1E27A 2NY2B 3C5SA 1JI2A 3MRFA 1DBAH 3L7FB 2GSGB 5FYKE 3RJQB 2N7AA 4YFDB 2XG4A 5CEZH 4HJJL 2Q86A 5IR1B 2W0PA 4JG1L 3AY4A 5TQ0L 3OKOA 5IIEB 1WWWX 3E6FB 3G6DH 4F2MA 4ZD3H 5DVKA 4IRSC 1E4JA 2OQJA 3MXWH 1INDL 1FO0L 5IFJA 3AAZB 5EU7C 2E7LC 1RK0B 4U1SB 4MYWB 3H9SE 2GY7B 4XCYA 5IVZA 3L3JB 2FEEI 4RFEB 2D7MA 1BWWA 4WFFE 3ETBF 1RFDL 2ESVD 2JIXB 3LPWA 2NXZC 2NTSP 3HE7A 3TGXA 4X4XA 4P2QE 3Q6GH 4L5FH 5JA9A 4OZIF 3VRIA 4CAGA 3V0AC 2W0KA 4WW1B 2KH2B 4NIKB 5GJTL 1F3DJ 3EYOB 4Z9KB 5C08E 3SDAB 5HHXH 1N2RB 4UUJA 2WZPD 1C12A 2GW5A 3V6OC 4L8BB 4KH2A 2O61B 5DC9B 5EO1B 1JHTB 1EO7A 3I75B 4IMLB 2YUVA 2YD2A 3WIHL 3DUSB 2F54D 5DJCB 1GH7A 2XICA 5H94B 1HHJA 1YEKL 1CG9A 3C6SB 2DJ4A 4JRXE 3U7AA 3T0EA 3DIFB 4MJ4A 4OCWH 4ZOCA 1AD9A 3E2HB 4J3UA 4YUEH 5DD5L 1D6EA 1RULL 4GW4B 4O5LL 2XQYK 5B8CB 4F7PA 3LQZB 1Y6KR 4ZFOA 1GCFA 1NGZA 1KEML 4JPIA 4JZJC 2DN7A 1RSFA 1BVZA 1BBJA 4F3FA 5IJKC 4UIMB 2DTMH 2A38A 4H8WH 5GRZA 2HJFA 2XXCB 2VN7A 5I76B 5EZOL 1PKQB 1KXQE 4QKXB 3RKDC 5FA4B 5C0NC 1ETZA 1FNSH 2UWEE 3DROB 1QFPA 4HS8H 2GUOB 4J3TA 4XAKE 5CUSH 2PN5A 3HMWL 4AH2A 4ZYKB 1EHXA 4RCAA 5F88A 2Y5EA 1P1ZA 4PBXA 1U8PB 4WEBL 4P4RA 3S96B 3L5WB 2J4WL 5FUOL 2X5PA 3I85A 5C3LD 2IANE 4J8RA 1EO5A 1QEWB 2F54B 4OGAC 1M7DA 4NHUA 1LP9F 2JB5L 4FNLL 3PL6A 4UOW0 5E1AB 3EKCA 5CJOH 1BGXL 1Y18B 4EN3C 2ZNXA 1Y0LA 4EI5C 3X14A 5HHME 4P5TD 4P2RB 2DQJL 3S5LG 4WU7A 3NPSB 1I8KB 2F5AL 1Q94B 4NPYB 3THML 1UM6H 5FM4A 1SBBA 2XWTB 3X3FL 3O3AB 5IW1A 3MA9H 2I07B 1KJMB 4APQD 4QOKD 4KJPD 4DGYL 4KRPC 5CIPB 5MEOA 3FN3A 4XZUA 1GGBL 2AI0H 3FT4B 1T89C 1F90L 5A2LH 1FNLA 3LQAL 2CKBH 4KJQC 4P9HH 2X4QB 1HHHA 5BRZB 4NO5B 4OSUL 1RZFL 4IRZH 3ULVF 2I26N 4Z7WE 1DN0A 4IRSA 2NY3B 2ITDB 3S35X 4B41A 4ZFGH 2QV2A 4TTDD 1MJJB 3UMTA 3KYOA 4G9DA 3O11A 4FZEH 4IOSD 4J3OC 5E2VL 1KNOA 5F7YC 3PHOB 3C60D 3DRTA 2YSSA 5HBBA 3HE6A 3BO8A 4P5TB 3TA3B 2X9XA 4MDJA 3QDGB 4HJ0D 5HYSA 1JN6B 2BSSA 1FSKB 4PRIE 5IBTL 5I1KH 2D4DA 2HTKD 3OV6A 3VXOB 2ZPKH 1PSKL 1FAIL 3IJSA 3TO4B 3KPLA 3U4EA 3MUJA 4KFZC 5D71L 4L8DA 4APQB 5JUEH 2RJMA 4QOKB 5D93B 2IPKA 4MJ2A 5IB5B 2IPUK 3OKEB 4DQOH 4L3EA 1FG2A 3VXPB 4P0DA 4RMVA 4ZFOL 1CBVL 3V6OA 2DIBA 3H7BB 3MUY1 4KXZI 1P5UA 3RZCB 4ZPVA 3S36X 1ACZA 4PJDB 4YZFE 2X05A 3RVXC 1JUFA 3WD5H 2CXKA 1MRCL 2H1PH 1JGEB 3D0LB 1UWGL 5E6IA 4S2SA 5D2LA 1AR2A 4R2GC 4CVWA 1FE8H 3D2UB 1FNGB 5I18H 4WW2C 4Y4HA 3N9GL 5A2IH 4PRHA 1TQCB 3FB6A 4NDMA 1IAII 3IKKA 4LF3B 5B39G 3UO1L 2UY6A 2NYYD 1NL0L 4XCEB 3A6BL 3T2PA 4U6YA 3MV9A 1H3PH 1QFHA 1SYSA 2DMKA 2VDQH 4ZUUA 3H0TA 1UZ6E 2GTWB 5HYEA 2VISA 5KVGH 3OHXA 1FJ1A 3BOVA 5CSBA 3CDGB 1DQLH 3BJ91 2R29H 2J6EL 3JTSA 1J0KA 2XZZA 4MNQE 5IOPA 4LPTA 5GGSY 3VXSA 3H9HA 1VACB 1VPOH 2DM4A 2Y7QA 3ZL4H 3NABL 3GI8L 5EC1B 3BZEA 1LWRA 2W0LA 1HSAB 5FKAB 1CD1A 4FRWA 25C8H 4DZ8B 1H3UA 4KMQA 1J0YA 1KG0A 1YNKL 1B4JH 1MH5B 3HNTL 4PY7B 5BO1L 5ISZA 5EUOA 3H3KA 4MCZA 1LE5B 4AJ0A 2WBKA 2NY4D 2CRYA 1ODAA 2VC2L 3HE7D 3OTTA 3G9VA 2VABA 3W0WB 3OSKA 1RJYA 3GSVB 5FKPA 1DUZA 4NQVA 3Q5YA 3VWJC 1T7ZA 1AQDB 4X98A 2RFXB 3U0WL 3PIQA 3F65A 3LEYL 1N4XL 3QNYB 4XVJH 4UV7H 1AGBB 4F9PC 5I1CL 2EIZA 5F44A 2YRZA 4JM2B 3MRKB 2IALA 3TIEB 3DX6B 3E8UH 4N8VB 4U3XA 3JWOL 1UM5H 3C6LC 3DHMA 3IFOA 3EYSL 1N8ZA 5CBEB 2J8UF 4JN1H 5IQ9A 3VG0L 1ZLUH 2A77L 4MJ5B 5F8QC 4OZGB 1YEIL 2OJEA 3T0ED 3EO0A 5CILH 3O2VL 3D0VA 1IGJB 3U0TA 4X4YB 2J12B 1ED3B 1OPGH 4X8XA 5INCB 4D0DB 4LAQH 1T2XA 5K33A 4WFEE 5GGTL 3HE7B 4GBXA 4I5BB 1JV5B 1K3ZA 4DCQA 4EDWH 4PREA 4EEEA 1H5BA 3B9KC 5C07E 4F33A 2BNQB 1CLZH 4Z6AT 4G3YH 3WFEL 1SJEA 2EYRB 3VGAC 4G6FD 3LHPL 3FT2A 4D9QD 4NOBA 5GGSA 1C12B 4MAUL 3KDMA 4XBPA 1D5IH 4NFBA 5IESH 4MJ6A 5L2JA 4MMXC 4UOJA 4OLYL 4EQ3A 5FHBH 2IF7A 1G6RA 4HWZB 2OSLA 2EDWA 4NKIH 1MWAH 3EJYC 4M9PA 3TNMA 3PL6D 2BOCA 4JVUA 4BK5A 4Q9CA 2Y9RT 2W0FB 1NAMH 5EZLB 5BQ7A 1RJZA 4QHMA 5ADOL 5TF0A 2VDRH 1NMBL 4R4BA 3DBXA 4K8RC 5E6YA 1HKLH 2G9HB 4UI2A 1U42A 4Y16A 5ETUB 1NGZB 3VA6A 2MJWA 1IAOB 3FT3A 3RQ3A 3PGDA 1AC6A 2C1OB 5DYOB 5MI0B 3CZJA 2R4RH 4GH7B 3O2DA 4N5EC 3ZMRA 3EO9L 3FQTA 3SDXE 2AGJH 2SEBA 4GW1B 1TTGA 2WUCH 3VFOB 1F4XH 1MCJA 1TNNA 3FZUC 1B90A 3RHWF 4XNXL 5LG1A 5IT2H 1NFKA 1A0QH 5HDLA 1KIQA 1NCAL 1YYMH 5JW3L 1QFWL 2AEPH 2FH6A 3P4NB 4TUKH 3T09A 1U8JA 5I74C 5MENA 5L9DL 4XBEL 1GZQA 1Q38A 1SM3H 4I77H 4IRSD 1BVLB 4L4TE 5C09B 4HFUL 4DW2H 4NHUB 4P57A 1BVKA 4MQSB 4N0FA 4PJAB 5EU3A 4S10A 1OW0C 2Z4QA 3BPOB 1MFAL 3HE6D 3ZZ1A 1IC5L 2AJUH 4NC1C 1NDGA 4XNMB 3SDCB 3L1OH 4RAHA 2JCCE 4NQCB 1Z5LA 1W8OA 2WAHA 3L6FB 3ILPB 1QA9A 1S9XB 4YGVA 2XKNB 1R6VA 1EJ6A 5EU5B 4GAYB 1EUUA 5GRVL 4G6KH 3NCYP 5DD0L 3ARUA 1MAKA 5IHUH 5CZXC 3KVQA 2HTLD 1RK1A 3EOTH 3UTPD 5KVMC 5GS2D 4H8WC 1G9ML 1X4XA 4L3ED 1N5YH 3BISA 2FGWL 2WWMD 4YWGH 4NQXA 3WV0A 5D5MF 3V4VL 3WHXA 1NGXB 4OCXH 2IFFH 2R69H 3FOMB 4ODBD 2BXZA 3CLFH 5E6ID 3RFZC 1E6JH 2Q3ZA 3A67L 1YDPA 5FK9B 2NY6C 4AMKL 1AXTL 4Y4HD 4OFKA 4OZFB 1FCCA 4PRHD 4QHLB 1JK8A 4BUHA 2HFGH 3HE6B 1I85C 4JDTH 4ELKA 1NFDA 1NAKH 3MV9D 1G6RL 4TNWK 3MZGB 2P46B 2BSSB 4KY1L 3L95B 5CD3A 1AY1H 1OAYL 2W59A 2K1MA 1DQTA 4WI8A 1D6VH 5IMKB 3JV6A 1HCFX 5DEFA 3BN9C 3H8NA 2C3HA 2Y07L 1CGSL 3C8HA 2ZJSL 1EA9C 5HHOB 3VXSD 3HTLX 3PDOB 4UAOB 3DYPA 1A3RH 2ICWJ 4U6VH 3MLZH 3QO0A 1F6AA 3OAZH 4OLUL 2ADGB 3MV8A 5TPWL 1XMWA 4P46B 3VA2C 3LQMA 3MRCB 1RMFL 1FLTX 4X6CA 5BVPH 5ISZD 2GCYA 4BSWA 4D9LH 3B9DA 4I0CC 5E8OA 5FCUH 2AK4E 4P9HC 4Y19A 5HI5C 3WBDA 4AEIH 2R9HD 1INEH 1GHFH 4PGDA 1XCQA 1HSBB 1OCWH 3DWTA 4LSUL 2MCPL 2Q87A 2R39A 5JW4M 1NQBA 3R0NA 3BP4A 4H20L 1BZQK 4G8GA 1XGQA 5F93C 5CGMA 1CD8A 1RAMA 1OAUL 5JOEA 4XP4L 3HB3C 4P5MA 4JFXA 5EOCH 5IFHH 5JHDB 3WUZA 4YX2H 2VISB 2XACC 4B53A 2NTFB 3U4BH 4DAGH 3PJSB 5IOPB 4JO4L 3GNMH 4L3CB 3PWLB 5HDQL 4NZTH 1GL4B 3NTCL 4XVSH 3UTTA 2D31B 4KJQD 1WICA 2EC9U 3QH3A 4YXLL 2D4FA 1SYVA 4MCZB 4M4PA 4HPYH 4M48H 2XT1B 4FMFA 4GBXD 2VABB 3CIQA 4RGNE 2UWEF 4NQVB 1XGRA 3RBGA 1YUHA 2VXQH 3IDUA 4TSBH 5K9QG 4FQXB 3L3OA 5ICXB 2R0LH 5IKCA 4N8CL 1YA5A 4XCNA 5L6YH 1OTTC 3LVEA 3S97C 4YHLL 5AZEH 4JDZB 1T3FA 3PXHA 4G80A 1QLFA 1RUKL 4LARH 3RVTC 3IFOB 2ZCLH 1QQDA 5T5NG 3W39B 1NC2A 4C4KO 5GRYA 1KEGL 1LO2H 3CMGA 3DGCR 4FQCL 4NO2A 3DUUB 3FONB 4OIIL 4RMQA 2DKSA 4D0BB 2DL9A 1T4KB 5C92A 1Q0YH 3U0TB 1CZ8L 5DJ0B 5I8OL 1QSED 1P4BH 2WANA 5E9DB 3G08B 4Y16D 2DQFB 1IFHL 5FA3A 1YN7A 5ITFA 1A6AA 1FFRA 4PLJC 1XZ0A 4UT9H 1S5IL 4ISVA 3LRGA 5L88H 3DTXA 3O41A 4ACPA 3SO3C 2PTVA 5ICZB 3FMGL 5F7EL 2HVKA 3B3IB 4QRQA 4UB0H 4BFIB 1A6WH 1KJ2H 1EUTA 1SY6H 3LH2L 1ZLWK 1N0LA 4ONGH 4AK1A 3CU1A 3KDMB 4Z7WF 4XBPB 3O4OC 3VWKA 4CDHA 5HPMA 4G5ZL 5MEND 1HK6A 3EO1A 4FABH 4K94L 3MXWL 4HGMA 4K3DH 4LCCB 2X4SB 3Q5OA 3WO3B 2E9JA 1RIUL 3IS0X 1DQDH 1TVHB 2IMNA 4UTAH 1MJUH 1UKQA 2VDOH 5I9QB 4LSSH 1T0NA 3T1FB 1NKRA 3M8OH 3CVHH 2FIKA 5EULV 4TPRH 1ZA6A 1QSEB 1ZHBB 4D94A 2CKBA 1ZA3A 4WI6A 1Q9OB 2R4SH 1RUAL 2QSVA 4D8PB 3HRPA 5BW7C 4LCUA 2L7JA 4CDGC 4HC1L 1FZMB 4LQ1A 4PG9B 1ZHLA 5C0DB 4EXKA 3BPNB 1RJCA 3IXTA 5HHXL 4PB0L 1Z0NA 4IBLT 5E8EB 3FQTB 2IJ0C 3ZDYE 4EZMA 1LEKB 1URLA 4N90D 3VRJB 4L9LC 4ZQKA 4YZFF 1BJ1H 5T1MB 2FJHA 1A7RH 5TE6L 3KYKL 1S8DB 4U1MA 4NYLA 4OCYL 1WQVT 5IMMB 3GJFH 1WZ1H 1UEYA 1U8JB 3MRHB 1CFNA 3LS4L 1I1AB 4LVHB 1FZJA 1ERNA 2VWEC 4KKCC 1OOAA 4OCWL 4S11A 3KLAB 3EYVA 4YGAB 2AJVH 4GKOA 3RNKA 4CVUA 4N0FB 4TRPH 2ZCKH 3O9WB 1D5BB 4X9IA 4Z8FH 2IG2L 1EGJL 3MOBH 5ENWA 4Y5YB 1UZ6F 1P7QA 5IK3B 2J2ZA 3MC0A 1PBYA 5I8CB 1Z5LB 4G9FA 3BFOA 2QHRH 5I1AA 2Q76A 3D3VB 2ILLA 2BRRL 2QQQA 3CDYA 5I30H 2ATKB 4U1GC 2ESVE 3MYJA 4RWYH 3ULVH 4Y1AB 2B39A 4NJ9L 1FNSL 1EAPA 1K2DA 4CN4A 3KS0J 5FB8B 3MNZA 3U83A 3S35H 2VL4A 3FB8B 4GXUN 4U6XA 2P49B 2Y36L 4YNYA 1PKQE 3VD5A 2VDLH 4NRZB 2J8HA 5IB1B 3INUH 4L8CB 1HYSC 2VH5L 4Y19D 3WUWB 5J6HB 4U49A 4WI2A 3HAEH 2Z92A 3KLHD 4Y8DC 4PLKC 1U8NB 1QFOA 4ZUVB 4MA1B 1CXLA 1T21B 1NBQA 1U8LA 3EZJB 2F54E 1PG7W 5D8JH 2QQLH 4K3EL 5CJBA 4JFDA 5C6TH 4G8GD 2MWCA 3PABB 1IZJA 3TFKC 3MNVB 3WSQL 5CD3B 3VXMA 4P2RE 3S36H 3MQIA 4NFCA 3JV6B 4NQUA 5FUZL 2CRIA 4KVNL 1J0JA 2BSRB 5F1IA 32C2B 3RNQA 1QSFA 3H3BC 2CKBL 3UTTD 3GSWA 1F6AB 4DN3H 4DEPC 2DM2A 2IQ9H 2YRPA 3EFFA 5KBNC 1FVDB 5DMIH 2F5BH 1MHHB 5HGHB 4K23H 1A2YA 1LO4H 1WZLA 4ZUTA 3PWVA 5DEZA 2GCYB 1JTTA 1BPVA 3QBTB 2UYLB 4WTZG 1E4XH 1YZZA 1V3KA 2ZOKB 3K4AA 5TE4H 4FZEL 1N7MH 5HGAB 4OTXL 1T5WA 1KCUL 1OGAA 1ZTXL 1XCQB 1FORL 4YBHA 3U30B 3UTOA 1J1XH 1MCRA 1QPPA 2MHAB 3V52L 1UWXH 2QADC 4PV8B 2E7HA 2R0WL 4J3WA 5FYJL 1T1WA 5KVDL 5GRUH 3P0YH 4BFGA 5GIRA 4G42A 1JF1A 4X6DE 4FQ2H 2AJYL 1J5OL 1EEUA 2GJ6B 5JUEL 2EECA 2F8OA 1ZT4A 4MD4A 5SV4A 2L0DA 5GSVB 4GKSA 1T0MB 3F7VA 4CW1A 4LPUA 4POYA 3ARXA 5CZXD 4LGRB 3GJFK 1NC2D 4TULH 4G8EA 1NBZB 4DK3A 2I60L 3HC0A 4QOKE 3EYQC 3ES6B 3R1GL 1FH5L 3KLDA 4LLWB 3CFJA 3D39B 3OB0H 2P7TB 5E5MB 2P8MB 4XAWL 2AQ3A 3QH3B 2C3WA 1CT8A 1V3JA 1J05B 3EZ8A 1SYVB 2CD0A 5I18L 1A7NH 3V79C 4MCYB 1MNUL 3SDXF 1G7JA 4KDTC 4PJDE 5JIIA 1YC8A 1UB6A 2DD8H 1IJ9A 1MWAA 4JJHA 3OQ3B 3D9AH 1YQVH 4OLXH 4XNQA 4K3JL 1NAMA 5C1MB 2R0KL 1T20A 5DUPH 3MRMA 4KXZH 2BSTA 3NIGE 4XCNB 4ZAKC 3DVNA 3OR6A 5KVGL 1WBXA 1H15A 2OR8A 1JPSL 2IH3A 2M26A 5EBWB 3BN9D 3VWKD 2BVUA 3OJDA 4G80B 1QLFB 2GFBB 4CMHC 1VPOL 2YN5A 4LHUB 3T0AA 3V6FA 3QHTC 1GC1H 5B38A 4OCRH 1S3KH 3U9PL 2Y72A 3H2WA 2JCCF 1B4JL 4NO2B 4X5XB 1WCQA 1KELH 5C6WH 1F2XK 5GS0H 3GSXB 5C0AB 3JV5A 1IGCH 1TNMA 3G5VB 5I1GH 1IQDA 3PUCA 4XNUH 1DP0A 2AEQH 1VESA 4HS6A 3I3DA 3KPSA 1XZ0B 3EYFB 4Y89A 1TVBA 3SGDI 3KYMA 1X5JA 4YHNB 2J7LA 2CLVB 1CDYA 3VH8G 5IG7B 3P0GB 4Z0XB 3QXTA 4HV8A 3MRNB 1DBKL 3BDYH 4P3DB 4R90H 1T1YA 1XGYL 1G7HA 2HT4C 3V0WH 3TJHC 3RUGE 3OKLA 1MFNA 4Z7VA 4MSWB 4O02L 4KTDH 3VWKB 5D9SB 3ME0A 1Z0MA 9CGTA 1ITCA 2LTQB 1R5WA 5FYJD 2HJKA 3NA9L 2YZ1A 4KTYA 3BP6A 4JRYA 2A6DA 5CILL 1BM3L 2ZKHH 4HSQA 3ZYZA 4MJIB 1OPGL 3GMLB 1QVOA 3SE9H 2UVFA 3MJ8A 1CLYH 4LRIC 1AIFA 3QIUB 4WUUA 3A6OA 3L7EA 3QIWD 1T22A 1MF2H 1CE1H 1P7QD 3MRDA 4QHUB 1ZA6B 3RI5K 1NCNA 2BDNH 1AO7A 3MACH 2GSIB 4G9FD 1KCSH 1MCOH 2HKHH 4LCUB 3MMEA 3QIBC 4EDWL 4X9BA 3GK8L 2IFGA 2QL1A 4C83A 1OGTB 1FFNB 2I27N 3TO2B 1ZHLB 2R2BA 4UIKH 4K07A 2JK5A 1E4KC 2OTPA 5IM7B 1F3JB 5AG8A 1Y6NR 1C08A 3RWDB 3QPQD 4HKZB 3GJEB 4NN6C 1OTTD 2Y4SA 2HRLA 4DOHB 1K85A 3V5HB 1WT5C 3RVTD 4NKIL 2WBJC 3NZHL 1U8MA 3GM0A 4S1QH 2A6IA 2H32B 3KPQA 4R8WH 3T2OA 1VEMA 1RJLA 1ZMYA 4F7TB 1XF2A 2IBGA 1S7WA 1HI6B 1FFQA 2MPAH 3SBWA 4DFHA 2ARJQ 4JFDD 2E7MA 4M1GH 4RISL 2YA0A 5DTFB 1OM3H 4UT6L 4XVUD 3QIWB 4PB9H 4Q97A 3TT3L 3P73A 3T0EE 3SKOA 2ICEA 5KSAA 2FYYB 1YJDL 1X9QA 1N6QL 3VXMD 4PJ5A 3PGCA 3TVMC 5I1JH 4AQOA 1WBYA 4LEXL 5CHNB 4NZUH 3DVGB 2WUCL 5IGXH 1F4XL 3FQWA 4OV6F 2DQEL 5KSBA 1QSFD 4W6XB 5C0JB 1KB9K 3IDMA 4KUZH 4ELMF 2G2RA 2AEPL 4TUKL 5IV2B 1ORQB 1I1FA 1C5BH 2F53A 1DR9A 3TLRA 5FYKH 3HC3L 4D9QE 4I77L 4DW2L 5IHLB 4F7EA 5E94B 5DJAB 1A8JH 5TJWK 1F97A 2EIEA 1KJ3L 1OGAD 4HFWB 1UB5B 5IW3A 4PBWD 1OQXA 2EDRA 5T1DH 3CSYA 3UYRL 3DSFH 3RWGB 5IWLA 2FNBA 1MAML 3MA7A 4FTVA 3ABZA 1WFUA 3LKRB 2YPKB 3NFNB 3VXUA 4WV1C 3SJVB 2YPLA 3VFPB 3B9AA 4QRPA 4HWEL 4NQCE 1C7SA 2IPTH 2WIIB 5GGVL 4BQ6A 1QR1B 1NCWH 5GGRB 4JLRA 4IJ3B 1DBML 4J2XA 1ZOXA 4NHCL 3HZVA 5F1IB 3ULVC 2FZ3A 1QSFB 3MCG1 3MRBA 1S9YB 4YWGL 5TDPB 1MCLA 3CC5A 3GIZH 3GSWB 2VZTA 4OCXL 4LMQI 2YMXL 4UTBL 4NQEA 4ZS6D 3UBXA 5F7KC 5J3HC 3CLFL 3SE4C 1QRKA 3MO1A 1ZANL 4NCC2 4ODVH 1E6JL 2LVCA 5D96B 2BMKA 4KKCD 3VRLE 2OS7A 3IDXH 1BJ8A 2NY1D 2A9ML 1VFAB 4E41B 1T5WB 3T2NH 4U1NA 4QGTA 3QA3B 3HNSL 1KIUA 1MCIA 2KZWA 4OZIA 1P9MA 1WAAA 1DBBH 3CFBB 3PE9A 1T1ZA 1AY1L 4AIZA 4QXGH 5TQ2H 3GMMB 1A6ZA 1X6NA 3RVVC 4JO2H 1D6VL 5GIRB 1JF1B 1RZKC 4LLUA 1PQZB 2P8PA 2Q7NA 3K2UH 4QF1B 1JZ4A 4MD4B 4Y2DB 3RY4A 2ARJB 4RAVB 4U6VL 5DR5L 1SBSH 4N9GB 1MREH 4R3SB 4G8EB 5TDOA 4NJAH 2PETA 4UNUA 1M6OA 1T6VN 3CXDH 1T7VA 3DXAB 3H42H 1TJGH 4IIQC 1MI5B 5BVPL 1KJ2A 3CFJB 1SY6A 3UTPE 2DYPB 1NBYB 3L3GA 1EJOH 5FCUL 3FQUB 1KYOK 2CRMA 4AEIL 3O4LA 5SX4I 4CMMB 4YHKH 3KPNB 2DQTL 5ICYA 1CGWA 2WWKO 3RIFK 1NGYB 1GZPA 3PQYA 1Z6JT 2KUTA 3KPSD 4PJEA 3ZDYF 1NC4D 5MP6L 3NZ8B 4MZ3A 1FIGL 3GSUB 4CADB 1I7ZA 2HLFC 5E00A 2D9CA 5D2LE 2EC8A 3B6SB 5DMKB 3RGVA 3EDEA 1AJ7H 1U8OB 2R2HA 4OZHB 2XPGB 3CFIC 1VKXB 3BH8B 2WQRA 3TVMA 4M43H 4HDIA 1W72B 3CVHA 5I8EB 2DBJA 2JJTC 1H15B 3U7WH 2DJUA 1FZOA 3MV9E 4U7KA 3E3QE 2WINA 1UC6A 1I3GH 2VO5A 4PRAB 1FGNH 4OT1L 1TLKA 3I6GB 2PW1A 4JRYD 5JHDE 1TZIA 2CDGA 3VXSE 2R8SH 2P5WB 4XMLH 4WUUD 5F6HJ 2AABH 2AJSL 2W07A 4MNGA 4GKZB 3HPLA 3GJFA 1AO7D 4H25B 3S4SG 2BHYA 4O51A 3EDKA 1EDQA 3QQ4B 3DURA 3HAEG 2CXGA 5EUOE 3BPLC 5B3NA 4EBQL 1UCBL 4IDJH 1NC4B 5ESAB 1U8KB 1IC4H 2PTTA 1A3LH 2EE3A 4HK3N 2R0LL 2GT9B 2H6PA 4DKAA 4E42A 5H35A 5F96H 3EHBD 2QADD 4F58L 5HVFB 5ADPH 1OP3K 4ZSOB 2WUBL 2F9BT 2GITA 4WV1A 1T1YB 5BJTB 5MEPB 4LARL 3EOAA 5K9OA 3C8KA 1YEEH 2X42A 3EDFA 5DRXB 1TZGH 5F8RC 3GEWB 1JIBA 3LSOA 3EGSA 2FX9H 4POUB 4LSVH 1OSPH 3QNXA 3IDIA 1IL1B 4IOIB 2H8PA 4JRYB 5C7XH 4PG2C 4EVNA 4NN5B 1B4RA 1UH2A 3LKQB 1Q0YL 4QTIL 1GC1C 2V17L 5F89A 1LEIB 2A6JA 1KLFA 4WUUB 1AIFB 5DJ2A 3ZKXC 5LGHL 5JDSB 3OG4B 4QTHA 4ESKA 5AYUL 5DD1H 4ZODA 5KSAD 4AG4L 1P7KA 2X1QA 5C0GB 5EO0A 4PJ5D 3HLAA 1S7XA 5GS0C 5L88L 4U1KA 1LQSR 5CZKA 4WCYL 4C83B 2VSCA 1A6WL 4RDQG 1EO8H 1KJ2L 5B4MD 2XI9A 1SY6L 5SWSB 4ZXBA 3V6BR 1I7RB 3M17B 2DJSA 2N56A 4PJ7A 2DQDH 5L7XH 3FCTA 3PNWA 5DHXB 4HKXA 2AJZB 1ZGLP 2HT3C 1NLDL 2F53D 3LN4A 3F7PC 3M1BA 3VFGH 4BFBD 5FOBA 1CK0L 4PBVC 1DLHB 1WEJL 4HKBB 1JHKH 3MRQA 4H26B 1MJUL 4KJYB 5I66B 3UC0H 5DO2D 2VB5A 3M8OL 1GOFA 4L3AA 4TPRL 2DF3A 4X6DF 1T66C 5IMOA 4TQEH 4S1DC 4FTVD 3VFNB 1G9NH 4FOMA 4R0LA 3VXUD 1FGVL 5KSAB 4ZTOL 2CR3A 2YPLD 4HX1B 3RWJA 4ODUA 4QRPD 2E7CA 1K8DA 2XZQL 1QSEE 1XCTA 1FBIL 1EXUA 1KT2A 4Z95L 1Z9OA 3KLSA 4L4VA 2EH8H 3NAAL 1PLGH 1VGEH 2VLLA 1R3HB 1JGUH 2IBZX 4LLDB 2FEEL 3MLSL 3PV6B 4JFPA 3OGCB 3EW3B 4Z77B 5IHZA 1ZVSA 1UH3A 4BZ1H 1KLUB 3IDMB 2Y5TA 1EIBA 5TH2A 2JJTA 3RWFA 1I1FB 3PDDA 4NQED 1EBAA 3QEUA 3RPKA 3DMMC 3MLTB 2BVTA 4PJDF 3EOYG 2DICA 2XN9A 4JREB 4OCSL 5GS1A 3RDTA 4PJHB 1FVCA 4BH7A 2ZCKL 3CAFA 5MENE 5MEQA 4EOWH 2HAZA 5CJ5A 2CDEA 5FGBC 4XC1H 2AK1H 2HT2C 3NIGF 4C56A 3MRRA 1OSZB 4UU9B 3NCBB 4EDXA 2XKSA 3MA7B 2DLFL 4I0PB 5F97E 2QHRL 3DX8B 3D25A 5DDHB 5LJYH 3OKMA 3VFMB 3AXLA 3ZKQD 2NMSA 5HHPA 4NZRL 2MQ3A 5DJXA 1NGWA 1H8OA 3U79A 3O0RH 4MB3A 1JYWA 3K46A 2Q8BL 1S9KC 3D3VE 4X0KA 4YK4B 4LVOC 4TTGA 3EDJA 4HUXA 1RZJH 2J8UA 2VDLL 3ARZA 5E08H 1ND0A 1T5XA 4NM8H 4IOFD 1QHOA 2HLAA 5ESVA 4AENB 2ERJC 1MIEH 3UBXB 5F9JA 3U7YL 4IHOA 3P4LA 4N90E 4J4PD 3LIZL 3O4LD 4WHDA 2EKSA 2EIBA 3FTGA 4L1DA 5T33H 3I50H 2BMKB 3TBTB 4AY0A 2ORBH 5D8JL 3PQYD 1RUML 3WFDL 3QYCA 1Z9MA 1MCPL 1RHHA 5C3TA 4GMTL 3RUGF 1FDLH 3CUPA 5JPMA 2B5IC 1U6AL 2HFTA 1NEUA 5DZOA 3RGVD 1U58B 4WIQA 5CZVH 3ROLB 4P23C 4U1JA 1LO3L 3TVMD 4UBDC 2VDNL 1WC7B 5TDNB 4U0QB 4X5WB 4JM2F 2VAAB 5J9PA 1NFDE 1F4YH 2XWJB 4X6FB 4KC3B 1XF5A 2NR6C 3G6AA 1HZHH 2ADFL 2CMRH 2ZOLA 4H5SA 1AXSB 1I9IH 4YR6A 3U4AA 4DN3L 2V9RA 3QCVH 1U9KA 2C3VA 4AT6A 1M6OB 5DMIL 2A83B 2F5BL 3PGFH 4FQJH 4BA8A 1W2KT 2WNGA 3SKMB 2G5BA 5T1KB 4XPFL 1U8HB 4M7ZB 3QPXL 1NLBH 1E4XL 3VXRA 4OIAA 3GMPA 4XPAH 3GUTA 2L4OA 2EE9A 3I84A 4U3HA 5INDA 5SX5H 1YY8B 4HCRH 1DEDA 1J1XL 1TZHB 4X6CE 5CGYC 3O6KL 1GZPB 4NNPL 2C7UA 2V6HA 5I1LA 1KCVL 1SVZA 4XWOC 1D5XA 4Y19E 5JNYA 1X6LA 5D2NB 2A73A 4JFZH 5IJVA 5F9OH 1DE4A 4LCYB 4PJ8D 1R3JB 1LNUA 2XNAA 3V5DB 1BQHA 3G5ZB 1HYRC 3S88L 4X80L 1PY9A 4I2XB 4P59H 2Z91B 3K4ZA 3TP4A 5C0RL 4YFLF 4KAQH 4JO3H 1Z2KA 3D18B 1X5FA 1QFUL 5CP7A 4LEOA 4YEEA 1W0WA 1DDHB 2ZCHL 2AXJA 3RL1B 4KTEH 5C0FB 4FHBD 1YPZA 2PYEA 3IU3B 2WP3O 2CDGB 5ALBL 3GMQA 4RZCA 4XMKH 4XP5H 3CK0H 2Q8AL 4ZDHA 5DRNB 3PWPB 5DD6A 3ZSSA 3C5JB 1ZHNA 3UTTE 1OQOA 1A7NL 3QXUA 2VUOA 4PJCA 5IMLA 3X13B 3NFSL 1O5DT 1Q8MA 3ZYIA 4N0CC 3V8OA 1AHWC 4OLXL 1GYAA 1QLRB 3TT1L 3BH9A 4HF5H 1L0QA 3BHBA 5DUPL 4LL9A 4PJ8B 4ZXBD 1N6VA 1RUQH 3KS0H 3SE3C 3HZMA 4JZJB 2OK0L 2ZP0T 1KN2L 4K9EL 3B2UC 5JQ6H 3HN3A 3D85B 1D9KC 2JLLA 4Y88A 5IB3A 4JHWH 5KG9A 4EXPX 3D69B 3G5YA 1IAIL 1S3KL 3MR9A 2FHFA 2NX5A 4FQLL 3RA7L 3MLPA 3SDDC 4N8PA 5E2JA 1AGCB 3B8SA 2B2XL 4PJAF 2Z35B 1A02N 2PCPB 1IGCL 5I1GL 3FO1B 5D1ZC 3A0OA 4KQ4H 1CE6B 5DJ2B 1UM4H 2AEQL 3MUZ1 4N0YL 3S9DB 3MX0A 4X7EC 5KVEH 4NNXA 5E5RB 5C0AE 4EN3B 4U1KB 3CVIH 4EI5B 2AXGA 4JANB 4JN2A 3DGGA 5HI4D 2WK2A 4ZXBB 5B39B 2B1AH 1RZ7H 3MOQA 5C86A 2PO6A 3V4PH 3FCTB 1RD6A 1U2HA 3HUJA 2DWEB 4KTDL 2NY5L 2HWZH 4LLVA 3T08A 2BFVH 3VRLF 5D7IB 4KRPB 3CFDB 5D6CB 5FOBB 1OTSC 1QO3B 2XN9D 3BX7C 4PYGA 1ADQA 4OD2A 1PG7H 3LKNA 4MQ7B 1QBML 1BOGB 2FX7H 1OP5K 1W8NA 3QAZC 3RDTD 4XP9L 5D70L 2BXYA 5IB4B 1A7OH 5E7BA 1D5ZB 3BEVB 4PJXB 5EFIB 4AEHH 3WS6C 2W60A 4C59B 5SX5K 3REVB 3DO7B 4Q6IA 4C56D 1XGPA 4GQPH 1VSCA 4TUOA 4XPGL 4ZO9A 1FLRH 5E1HB 5IVNA 5E56A 1EEYA 2QQKH 2FLBT 3GSNA 3WXWH 4HLZH 2B20A 2GK2A 1LGVA 4MLIA 1UYWL 2BHZA 1CR9L 4OQTH 4MAYA 1TVDA 4XTRC 5I1EH 3MLRH 3GMNB 4GQ9L 4KZDL 4JRXA 3IFLH 3T65A 1S7UA 1FRGH 2KPNA 4BSVB 1MHEA 3ARTA 4I3RL 2QLVB 3MBEA 5D7SL 2Y5TB 1Q72L 5DZLA 3EJZD 1IE5A 2R23A 5IVXB 3QEUB 1T80A 1GGYA 4W70A 4QHNA 1MY5A 4DOHE 2X4OA 1RURL 1UH4A 2AP2A 3IRZA 4MQXD 4YHYC 3H9ZA 4H1LH 4R97C 5D2LF 5IEHB 4M6NH 1FVCB 1N3NA 2O5ZH 1YMMA 4DVRL 3IDNB 5FYJE 2CRZA 4M1GL 3ARFC 4YBLC 4KZEL 5JZ7D 2UWEA 3ZLQC 2GAZB 4LSPL 3QNZB 4C56B 3TCXA 4LOUD 2MFNA 5EPMB 5ESQB 1WIOA 4MA8L 3U46A 3B2VL 5GS0D 4WW2B 4XXDB 1G9NC 1HCVA 2EICA 3O6FD 4MA3B 1T7XA 5DHVB 4DGVH 1MQKH 1S7RB 5I15H 5I75C 1TCRB 3MCLL 2EYSA 3HRZB 3UJTH 2D9QB 4OCNC 2HFFB 3O3DA 1HHIB 3WNOA 4Y5XB 5LGKA 4LKCB 2H3NA 1MCBA 3HCVB 4HIIA 3MUGA 1IGIH 3O6LH 1A4KA 2Y1VA 5EUOF 4DK6A 5EO9B 3HZKB 4YHOH 3VXRD 3WEXB 1I75A 2YBRA 1YYLL 5EORL 3IVKA 1KTDA 2DQCH 4OM0L 4OM1L 4RRPA 2CK0L 3SDDA 3WL9A 2OJZH 4ALAL 4WO4C 4Y4KC 3KWWB 5LAXB 2NZ9D 5EU4B 3WHE0 1KIPA 1HDMA 1T83C 4MDIB 2CO7B 3LKOB 4QRUB 1IAKA 3F5WA 1QACA 3TN0C 1ADQL 5EBLA 3K81A 3STBA 4NQSB 3VWJB 3U9UA 3WNKA 1M7XA 1PKOA 4ZOAA 3BSZH 4Z0BL 5KW9H 3JUZA 3O6FB 4MNHA 4D0CA 4KVCL 1AGDB 3VXME 3B83A 3WXVH 3CMOH 2V7HB 2WSKA 2C3VB 2PYED 2YD7A 3DOSA 3ZHDA 3GSNL 3QZWA 1RZJC 3C6LB 1IT9L 3BZFA 1MCCA 3SGEI 5CMAB 1DCLA 1QSFE 3GGWB 3EFDH 3JTTB 5I0DA 2FEDC 3IT8D 4M1DH 5FGCB 3BW9B 4Z7OE 1B0GA 5DJ8A 2PXYC 2EXWC 1FFOB 4M5YH 5FEBA 1DBBL 4N0UB 2HT2D 3H3PL 4PUBH 1JI1A 4QXGL 4HZLB 1YN6A 5C2BL 4KKNA 4JO2L 1OGAE 4YPJA 3GSOB 2APTA 2DLTA 3FO9B 3F12A 1ACYL 3ULUL 1MLCB 1SBSL 3BUYB 1H3VA 5LXGH 3B9KB 4NJAL 4ORGA 1MJ7H 1G7MA 1ONQA 1A6TB 3VCLB 4I4WB 3H42L 2NX5D 2OTWA 5CEXA 3QHZL 5BV7B 1P69B 3Q6FA 3WFCL 3MLXH 2ZG3A 3N85H 4WDIB 1KGCD 2VLJA 1E0OB 4QY8B 5GRJL 3IFNL 4YHKL 2NQCA 5TGBB 4IMKC 2BVYA 3FN0H 1LMKA 2A6KB 1MI5E 3IDJA 5IMLB 4PJCB 4KK9C 1FIEA 1CIUA 4CKVX 1T0PB 1QSZA 4KRNA 3M07A 5HDBE 3QJHA 3SY0A 5DK2B 1JRHH 5C8JA 5IEKB 1YMHB 3ARFA 2X4PA 4PRPB 5C71A 4NUGL 5CAYB 1V7ML 3PWUA 1EMTL 3OAUH 1AJ7L 2EZ0D 4Z5RA 3LMJH 2YC1A 3MGOA 1JNNH 2WMPA 2B4CL 1II4E 2PO6D 3JBG7 4W81A 2UZIL 5EIIB 1R5VB 4KHXL 4UBDD 1RZIB 1J10A 4XP1H 1IAMA 3OF6A 1F6LL 1UXSB 3P11L 4K7FA 3IDYB 2NR6D 4BK4A 4EI6B 4HUNB 5IB3B 1UEMA 3C09B 1PFCA 4WFHD 4Y5VC 3MR9B 4AIXA 3NACL 1MUJB 2GQHA 1WCBA 4PJFB 3ARBC 4XMLL 5CIPH 1IBGH 3IJHB 5C9KA 1RY7B 4L29A 3VMPA 4O2FB 1P2CA 1U3JA 3KPPA 4JY6B 4WU5A 3CPLA 2X4TB 4YLQT 1IC4L 2BY0A 1A3LL 1KPUB 3GMOA 3TBYA 4YAQB 4MAYD 3QDMA 4RIRB 5F96L 3WE6B 1T83A 4JZOB 2Q3AA 4AEFA 3DGGB 1XGTB 2FGZA 3O45B 5D1XC 4JRXD 4RFOL 3SPVA 3TN0A 4EKXA 3KPSE 2QSCH 1E28B 4PJBB 1KC5L 3L5HA 2LQRA 3MBED 1I9EA 1BZ7B 3MBXH 1WBZB 3BEWA 4KK5C 1TZGL 4ZSOE 5J0BA 2A0LC 1M71B 1INDH 4JGJA 1HHGB 2FX9L 3BMVA 2O5XL 3ZE0E 5C7XL 2LVEA 2HVJB 1HE7A 4JJ5A 4XX1E 43C9A 1U92A 3WS3A 4GRLC 4YBQC 4ZOBA 1RFDH 3RIAK 1I7TB 1YMMD 2JELL 3ULSA 1QHPA 2J5LB 3TZVA 5IF0B 4PTUA 4LLQA 3T0VA 5C0IA 4JRYE 5FO8A 5GHWL 4HIXL 1NFDF 2NY6B 1MCWM 5KAQF 3OKDA 2PKDA 3GSNB 4WUUE 4OUOA 4N0CD 2F8XC 5A1AA 5GJTH 2PW2B 4KJWC 2OYPA 2EDYA 1MELA 4ZPTA 1L0XA 1S7VB 2HMIC 5AUMA 2DQDL 5DD3L 3TH2T 5L7XL 3F7QA 3DPBA 4E5XB 2CLRA 1S7UB 5KSVA 3ZE1E 2ATPA 1MCFA 3WIHH 3VFGL 1ULVA 4XMPL 3OXSB 3DRQA 3ZSTA 4YHIB 4HLJA 1OARL 2NNAA 3PHSA 2VUYA 4HIEA 1YEKH 3F7YA 1RU9L 3GKWL 3UYPA 4M6AA 2H2PD 5DUBA 4LP5A 4JCLA 3AUVA 3RVWD 2IEPA 4GKNA 1NCDL 4M3KB 3UC0L 4DUXA 4OUUA 2NW3A 3OL2A 3OR7B 3SDDD 1S5HB 1RULH 3SE8H 4O5LH 2VE6B 4RWHA 3G5XA 1N3NB 4NFDA 3SDXA 5JMOC 1YMMB 1IKNC 2ENYA 1OAKL 1KEMH 4WEUD 4X9FA 2KZ1B 1J7VR 4JAMA 4FG6D 4NNYA 4X7TB 4IMKA 5F1NA 4BJLA 4DKEL 1VGKA 1EHNA 1J0ZA 2V5RA 5IW6B 1LEGB 4OQ1A 5EZOH 3RWIB 3QFDA 7FABL 1R3LB 1VGEL 3V4UL 1DQML 4I18A 1XR8A 1DQQA 3ALXA 3HMWH 1ZGLA 4YPGB 4PJ5E 4PRDB 4RAUA 4RGNC 4WEBH 1AGEA 2C3XA 2DIJA 1GRWA 2J4WH 3JZ7A 3SKJL 1Q9LB 3DETD 4ZNEE 4BELD 1DLFL 5KSBE 4FNLH 2JB5H 5ID0B 3RTQC 5GGUA 4CVZA 5JOPD 1CWVA 3QUML 1BGXH 5CBAA 5DFTA 5CD5D 3QUXA 4XC1L 1UACL 5F3BA 3ARBA 2F5AH 2OZ4H 1DVFC 5I73C 1GOHA 3THMH 3LRSA 3RWHA 3TESA 3O3BB 4U6HA 1KIPB 3CSGA 5HYJA 5HHNB 3AROA 3F5WB 3MSPA 1H3GA 1YNTB 2J1KA 1A1OA 1D5MA 4DGYH 4QO1A 4GXUM 4U1LB 5HGBA 4NGHL 2MQ0A 3U9UB 2BK8A 4TOYL 4U2YA 5HY9A 3VXUE 4ZMAT 1F90H 5AZ2L 3KJ4C 4MNHB 2Z0BA 4NOFA 3LQAH 4QRPE 4DUWA 4PTTA 4OSUH 3GI9H 1QYGH 1RZFH 4U1HB 1BF8A 3QUYB 2VLJD 1TPXB 4PJGA 5EBMB 1GAFH 5T33L 3I50L 1KJVB 2F74B 2NW2A 4KK8D 3WO4C 3CCHB 5DJYB 4JHZA 3VE0A 5DJ8B 4GRLA 4IS6B 5I2IB 1Z3GL 1CF8H 4MX7A 1IGTA 4NT6A 4NWUL 1QKZH 2NY2C 4XC3L 4GG8A 3ARFD 4WJ5A 4UDUA 5IBTH 5BXFB 4QWWD 1HWHB 1LE9A 1PSKH 1FAIH 1DUYB 1ZKAA 4AL8L 2X4RA 3QR2A 4P4KA 4G6ML 2N1KA 2AV1A 4OZIE 1WAAE 1IGYA 2I9LB 2ZSVA 1KV3A 1H8NA 1I9IL 1PX4A 1AQKL 2Z8RA 4ORGB 3PWNA 3QEHA 1CBVH 3FKUS 4M7LT 4KKBC 2N4IA 3V9FA 3EAKA 4GO6B 2OTWB 5CEXB 3LEXA 3RVUC 1QPXA 4NQDA 5I16B 3O4OB 1KACB 1NLBL 1MRCH 2AV7A 5ABDE 4XPAL 2IADA 4W68A 4OF3A 3N9GH 4MWFA 3UO1H 3ARGA 1FHGA 1NL0H 2ZUQC 3D48R 5EOTA 4JFZL 1SEBB 4WVRA 5F9OL 1FN4A 3IAPA 1K5NA 3QDMD 4FFZL 1S9WA 2VQ1A 1MFCL 3PQYE 2XZCL 3MCKB 1YEHL 2HN7B 3TN0D 4PJEE