1F97A

Soluble part of the junction adhesion molecule from mouse
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
212
structure length
207
Chain Sequence
KGSVYTAQSDVQVPENESIKLTCTYSGFSSPRVEWKFVQGSTTALVCYNSQITAPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEEGGQNYGEVSIHLTVLVPPSKPTISVPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGISMLTTRAFMNSSFTIDPKSGDLIFDPVTAFDSGEYYCQAQNGYGTAMRSEAAHMDAVELNVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords JUNCTION ADHESION MOLECULE
publication title X-ray structure of junctional adhesion molecule: structural basis for homophilic adhesion via a novel dimerization motif.
pubmed doi rcsb
source organism Mus musculus
total genus 49
structure length 207
sequence length 212
ec nomenclature
pdb deposition date 2000-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f97A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f97A01
4UQ2A 2DYPB 1JPST 3CVHB 2BVOB 4KKNA 2GJ6A 4JRXE 3BIKB 3U0WL 4PJXF 2Z93A 1PEWA 4R3SB 4Z5RB 3GRWL 1NCTA 4P4KD 3UPRB 2FLRT 5FOBA 3MUY1 4GAGL 5IW1A 3KJ6H 3QCVH 4OLZH 1FL5A 1MLBB 2EC9U 2LV4A 3CFKB 4X6FB 3U4BL 2VDPH 4FQHB 5E00B 3VJ6A 3PXJA 3INUH 1DBJL 2V5SA 1FL6B 5JW4N 3QRGL 4GRWE 4P46B 1QLRB 4P9HL 3RZCC 3ES6A 5HD8C 1VFAB 4OD2B 1MJ7H 3DVNB 2P5ED 3HKFA 2Q20A 4NUJA 2AJYH 3J8F7 3HUJA 4UTBL 3TN0D 3VXMA 3TBVA 1YUHB 2HJLA 1E4JA 4QRPA 1WCQA 1TCRA 5I8CA 4FFWC 4APQC 3OB0K 1IEAA 3CMOL 3O3DB 1GXEA 5T3XL 1NGZB 2DJSA 1J0HA 1H3PL 5FKAA 5I30L 5DS8B 3FTGB 1PZUB 2EDEA 1AC0A 3K80A 4OCWL 1YEFH 2Q3AA 3QPQD 5IROA 2DIBA 1A8JH 2GY7B 3B5GA 1ZLWH 3V4PL 3BZ4A 5FUZH 1QSEB 2HFGH 1WTLA 1KFAH 4EQ3A 5ABDE 4IRJD 5FDWB 1BD2D 5IJVB 3O6FA 3U79A 3ZYOA 2JCCA 3IU3A 5I9QC 1U8HB 2WIIA 4XP9L 2E7CA 1AR1D 4I0CC 1KIQB 1BBJB 3H7LA 4YIQA 3VW3H 4RMSA 1OTTD 4LPTA 1LGVA 1GGCL 3L3OA 5C6WH 1NFDF 5F7UA 3MGOB 2Q86B 3X11B 3FO0H 2DIJA 3RNKB 3V5KA 4HUUB 4F7MA 1VADB 2VQTA 3O6ML 1HOCA 1QSFA 1WCBB 2HTLD 1NH6A 1YECH 2A0LC 3MX0A 3EFFB 2P8MB 4N90D 1OHQA 5F7WC 1AY1H 5KZCD 3NN8A 4N8CH 2JJTA 1PZ5B 1CLOL 5JOEA 4GJTB 5DO2C 4KKLC 1G9NC 2ZG3A 3KLDA 1D5ZB 4M1GL 1H0DB 3QJHA 3AB0C 1EDQA 2FSEB 4LAQL 2BOBA 4KKAC 4NJ9L 4MNQE 5D5MA 3TNMA 5DZOA 3IFOA 1FZKA 3MLPA 4GG6E 4K9EH 4Y5XC 1Y6KR 5I1HL 1OD9A 5ALCH 1AJ7H 3T0DA 1Q9OA 3QSKB 5CCKL 1KNOA 4X6CF 1QKZH 3QQ4B 5INCA 4KZEL 4N0CC 3QXAB 3RWDA 1T3FA 1K85A 5IR1A 3VFOA 3MV01 1SEBB 5IF0A 2W59A 5MENE 4M7JH 2HWZL 2E9WA 4EVNB 5T33H 1S78D 5C0BE 1NBZA 4ZFFB 4M02A 5IBUG 3WFBL 4ODHL 1TCMA 3LN5A 5FV2A 4M43H 5GRZA 4Z7OF 5IG7A 3OGCB 3NFNB 4KJQD 4QEGA 1HK6A 1RJYB 5CSBA 3ZDZE 5I66B 1CD9B 3DVIA 1U8JA 1J0JA 1RJLB 3RVXC 1XGYH 3UYRL 4OCSL 3ZE1F 3HG1D 4LKCB 1FPTL 3PXHA 1CFTB 4HC1L 3UJIH 2VLJE 3KS0H 4WI2A 3OZ9L 2F8XC 3F5WB 5L8KB 3NIGF 1A3RH 1IBGH 1EJOL 4TVPE 1MEXH 4PLOB 4RMQA 2AEPL 2XZCL 2OR9H 3JUYA 4DKAA 2C3VA 1UG9A 5D71H 3H7BB 3BQUC 1BQLH 5HSFA 3P0VH 3OXRB 1LO5B 4UT9H 3QIUD 1FGNL 1A0QH 1EO5A 2VDML 1G6VK 4PJ8B 1XGPB 5DMGD 1I85A 5A2JH 2BVQB 3PWVB 3ECBB 3ARTA 3AS3A 2NR6C 2XFXA 4NRYA 2NYYD 4XNQA 4X8JB 3FB6A 5IEHA 4X4ME 4P3DA 1IC4H 3HAEA 5J56B 3FOLB 5CILL 1EVTC 3STLA 1OF2B 1VFBA 2X4UA 1JN6A 4HH8A 4NYLB 3UTZA 4X6DE 5CLWA 3MRCA 4XP6H 4DEPC 5F3BB 2J8UE 1DUYB 3U0WH 3CUPB 2X4SB 3BGFB 4UU9A 3GRWH 5E9DE 1PKQB 2GCYB 4PRPA 5C0AA 1JGLL 3TIDB 4X7TA 4Q7DA 5JDSA 5I1JH 4LPWA 1MCRA 4HS8L 5JXAL 1Z5LB 4Z7WE 3FQTB 3PWJA 3QRGH 3BPOC 4OGAC 4TNWK 5IB2B 1H8SA 4FXLA 4OFYA 2AV7B 4P9HH 4L9LB 4WO4A 1HHKB 3H42H 4DGYL 3PWPD 2IG2H 2FD6L 1C5BL 1TLKA 1WIUA 1S5IH 2VLKB 5IMMA 4CJ1A 4M8VA 1MRCL 4PJ7F 3BYTA 3L6FA 3VFPA 2V7HB 3EFDL 4UTBH 5HGHA 1F3JB 4O2EA 1AGEB 3QEUB 3TBYB 3R06B 1OW0C 2NX5E 4PJIB 4L4VA 3G6DL 1J11A 1TITA 4UDTA 2D0FA 5GJTH 3CMOH 4OV5A 5A3ID 4ORZC 3OQ3B 3HZVB 3EJYD 3VXRE 3KR3L 1UKTA 3D85A 4CNIA 2Y23A 4PLNC 4ZFGL 5JXEC 5I1AA 2GY5A 5IHZA 3MOBH 4EIGB 4HFWA 4NWTL 1OTSC 3MLXL 4PREB 2VXQH 4OSUL 4PRHD 4OF3A 4XHJD 1INEL 4RFNB 4AL8H 3HPLA 2VNCA 3E0GA 4X7EC 3V4PH 4OB5L 2BK8A 2H2PC 2OMBA 5D6CA 2XN9B 4F15C 3F12B 3WE6A 1YNTB 5EO1B 3IS1X 5GGTH 4XP9H 4RBPH 3VD3A 4BQ9A 4G6AD 3W81A 4HK0B 1EZVY 1CT8A 4LCWA 1KXQE 1UWXK 3MRMB 1GGCH 1NCCL 1MFAL 3RZCA 2NY6D 3OX8B 4GKSB 3KYMA 3VGBA 4EDWL 3A0OA 3BAEL 4YXKH 4IRZL 1YN6A 2XKNB 3O6MH 1MFDH 1TENA 4WWKD 2W9DL 4XCNB 4X9HA 1I1AA 4D9QD 3P40A 1WFOA 2VN7A 4APQA 2BSSB 3PHSA 4MA1B 5EBLA 1A7QH 4PR5B 3U30B 5MEOA 2DLGA 2H2SD 3L3DA 4QHNA 4PYGA 3BUTA 2RQ8A 1M71A 3MZGB 3DX8B 4LAQH 5KANG 4XCEA 1IVLA 3C6LD 4NJ9H 4L29A 1NLDH 2FJHA 4FNLL 5E7BA 3P0YL 2QQKH 5I1HH 2YS4A 5GISL 5DTFB 3TA3D 1C5CH 4J1UB 3T0EC 5CCKH 3NFSH 1RJCA 5CP3A 3SKJL 4XWGL 3CVIL 1MWAH 2ICWA 4JFOA 4XNYL 4OI8A 4KI5E 2HWZH 2ERJB 4Q9BA 1JK8B 3WFBH 4AT6A 4Z7QE 1CDYA 1F6AB 5GXBB 3D3VD 4P46D 4HGKC 5AG9A 3OJDB 3ZE0F 4OCLC 3O4LB 4YHIB 5E70A 3U0PA 5ESVA 4XPGL 3WFCL 1I3UA 2QR0A 4K71C 3BP4B 3UYRH 4OCSH 8FABA 2I26N 4XBPA 3QR2A 2A83A 3MACL 1FPTH 4HC1H 2ORBH 3M1BA 4QTIL 3ARSA 3OZ9H 1AXIB 5C0CD 1LE9A 4F37F 5D7LB 2QADC 3BZEA 4HKZB 5GRVL 3VXTA 5CP3H 2R15A 4WFED 2AEPH 1M05B 1T6WA 2XZCH 5K59E 1CQYA 1CXEA 1P4LB 4JO3L 5EZLA 5EDXA 1LNUA 4IMKA 4JFDE 2DQIH 3ZKXC 3OR7B 4I5BB 5BQ7B 3GIVB 1R3HB 5E8OA 1AKJB 1E4WH 5DVLA 1UXSB 3SKOB 4Z76A 4I3GA 2DOCA 2XI9A 2AXFB 3CSBA 4YDIL 1T1WA 2O26U 4QYOB 4LASL 2XWTB 4MD5A 5FGCE 2CJUL 4JKKA 2IWGA 5EBWB 4RX4A 2BFVL 2IAMD 1X7QA 3Q5TA 4WUUA 3QUZB 3KS0J 3ARFC 1A4KA 3RVTC 5GRVK 1G0DA 2A9NH 1G9NH 2ZJSL 5CKAA 4F33B 5T1KB 5IMKA 2VH5H 4MDIA 4V1DE 2NY3B 5DWUL 1WIPA 5MHSD 5DMJB 4WU5A 3ZL4H 5JLZA 1J8HE 3ETBF 3H9SD 5F1KC 2J12B 1JNLH 1EAJA 4OIAA 4R0LC 1P53A 2Z92A 3MODH 4HS8H 5JXAH 3U0TA 2I24N 3SE4C 4R7NB 2H6PA 5B22A 1F4XH 4ZDHA 2V7NB 3LCYA 1F90H 3VG0L 3ARDA 4XPAL 4DGYH 1BFVL 3PDDA 2FD6H 3OG4B 4BSWB 4PGBA 1FVDB 5HDQL 1TVBB 4DGVH 3TCLB 4PLKD 4MJ6A 3BH9A 2R23A 4TULL 4LBEB 2GIYA 5I19H 4AZ8A 5DLMH 4PG9B 4S1DC 3HMXL 3KR3H 5IB4B 2V2WA 3FKUS 1CGSL 5EU6E 1E4XL 3MO1A 5D7IF 4K07A 2CLZB 4NWTH 4M93C 3MLXH 3UP1A 2OTPA 4OSUH 2HJFB 3LQMA 1INEH 5D70L 4FFZL 2ESVB 5IBTH 4LVOB 3LB6C 4OB5H 3GO1L 1G1YA 4JAMB 2Y06L 3FAXA 3BOVA 5CGMA 3L3KB 1FNAA 4HXBH 4OQTL 4NBZB 1QTYT 4YHYB 2QSQA 5A16A 3VWJA 5IEKB 4FQPA 4JKLA 4LLWB 3WXVL 5E08L 3H9HA 3VH8G 3ARUA 2YD2A 3O81A 3X13B 5D7IB 1GOFA 5D4QA 1F6FB 3SN6N 1NCCH 1MFAH 5B38B 3WMSA 2W65A 4X6EB 1I7TA 2Z91A 3QNZB 3BAEH 3DARA 1N0XL 5J6HA 4IRZH 5DC4B 3ARGB 1XCTA 3FFCA 4FP8H 4S1QL 1OW0A 4NQVB 2EE3A 1CU4L 1P9MA 3TPUB 4OBRA 3C2SA 1IGML 1N6QH 3QFJA 4BK4A 5EO9B 2WMPA 1RVFH 3RWCB 1QRNB 5JO5A 1R5IB 1HXMA 2DICA 5F7HA 4GMTL 5KS9A 1A4JA 1N59B 4MJIE 2ZUQB 4F3FB 3FO9A 4ZUVA 2IALB 3P0YH 4G6FD 4PB0H 4H1LH 5GISH 3RGVC 3B2VH 3O3UN 3EO0B 3SKJH 4AJ0A 1TZGL 2BZDA 3CPLA 2ZCLL 1J0IA 4P2RA 4XNYH 5DJ6A 4IRSA 4ORGB 1MOEA 3HE7D 4XCYB 3AY4C 1Z9MA 4G8GD 3B6SB 4C56A 2BVTA 3DHJA 1X44A 4U1GC 2IF7A 3B9KA 3E3QE 5EZOH 4LEXL 5DZLA 5FF6A 5I71C 1A2YB 4OTXH 5DEZA 5IFJA 2F74A 4HUWB 5T1LB 1ZT7B 2GK0B 3WFCH 3LDBB 3CFJA 2KKQA 3GMPA 1RURH 3KYNB 4W81A 3GSNB 2ZUWA 4J3SA 1X3DA 1SYVA 4Y4FD 3MACH 4PJXE 1GYAA 2FIKA 5CD5D 4RMTA 5C9JB 4KQ4H 5DK3A 5GS0H 3PJSA 1IGYA 5BRZA 5GGSB 4BM7A 3BIAX 1RD6A 1UM5L 2BNUB 1U8NB 1KF9B 1CLYL 1G7HA 1W72L 4WI7A 1ZVYA 2NY0C 3O9WD 2IADA 1J88A 1NDMA 4U0RC 1KUMA 5EZIL 4NM4H 4WFGD 3T0EA 5ESAA 3HFMH 2EDOA 3ARED 1N5YH 3MLRH 3TO4B 1NEZB 3QCUL 4Z7UF 4QLRA 1VB9A 3FCTB 4J6RL 5FUCE 3CDGA 2NTSP 4JG0L 3NIFF 3RWHA 2XN9D 2WINB 3RDTB 1KIRB 4FQ2L 4E41E 4WTZG 5GIRA 2IANB 4ZODA 2FJGA 1JPSH 2BFVH 2P44B 5F88A 4UB0L 1MY5A 2C3GA 1KPVB 5DRXA 4G9DA 1MUJB 4DWHA 2ADGA 5L2JA 5SWQB 3EJZD 1FYTD 1QFWH 1P7QB 2CKBH 4Q6YA 43CAA 4J8RA 5J06A 2ICWJ 2R2HB 1F58H 4LKXB 1FGVL 4FFVD 1G0XA 2W60A 4JFYA 2PW2B 4F2MA 1NEZG 2D4DA 1KLUB 1I9IL 3KPPB 1MCPH 4MB4A 5DRNA 1WITA 4YHNA 1KCRL 2AJZA 3P73A 5HHXL 4KQ3H 3DRTB 1MHEB 4P5MA 3PABA 3D2UB 1IQWL 3VG0H 1ZT1A 4MD4B 5M94B 3H8NA 4YHKL 4M6NL 1BFVH 2UV3A 1JGEB 4K7PH 4HBQA 4NQDE 4OQTA 2EC8A 3NGBC 5I6XB 1ZA6B 1NFDE 2YSSB 1FAKT 5HDQH 3RU8L 3JTTA 3DX9A 3F7VA 4XB8A 5HVHB 3TF7C 3FHQA 2F54D 2ZOKB 4Y19D 1A6ZA 4MX7A 3GSQA 5FO7B 2XKSA 2MPAL 3HMXH 1CLZL 1CGSH 4WDIB 1E4XH 1LP9F 1K8DA 4EEEA 2MHAA 1EGJL 3DBXA 4NZUL 2P8LA 1ED3A 4PLJC 3C2AL 5D70H 4FFZH 5EIIB 1ND0B 5HVGB 4WU7B 4GW1B 2C5DC 1PDKA 1U3ZA 5IK3B 1G6RL 4AQOA 1VERA 3WD5L 1WFUA 3RKPA 4M9PA 2OYPA 4OQTH 3ELAT 4H8WL 3UBXB 5HHQB 1T80A 2F53E 1CD1B 3EBAA 5DYOB 4X6CE 4U7KA 1HN1A 4R0LA 3WXVH 4P2YA 2EXWC 4JRYA 1AE6H 3LQAL 1F6LL 4JR9H 1IC5L 5I8EA 2C26A 4ZUUA 3HI6H 1MHCA 5F1SA 2MFNA 3E8UH 5DJXA 2YPLB 3L3GA 2NW3A 4V2CB 3O8XD 4KK6C 2FYYA 4WFHE 2VQ1B 1N0XH 5I74C 3IJYB 1LEGB 3BGMA 1RU9L 3ME0A 4S1QH 2FECL 2HAZA 1KBGL 4PUBL 4OV6F 3MRHA 5HTSA 4Z7OE 1AKJD 3VFSB 1CU4H 4LQ1A 4UILL 4KK9C 3ALWA 1TQCB 5AWNL 5GS3A 1IAOA 1G7IB 5SX5K 1TZIA 3ZE1E 3DO3A 3VXSB 2EYSA 5BOZG 5EU4A 4NP4L 3NIGE 3VGEA 2V17L 1NLBH 1AIFB 2Q8AL 5JTWA 1KPUA 2FCBA 2EC9T 1FZOB 3BKMH 4N9GA 1NKOA 3LS4L 4C83B 4ODWB 3P11H 3MV7A 1BPVA 4PFEA 5E4IA 4JDTL 2AV1B 3TN0C 1TZGH 1HH6A 1IGFL 5JIIA 2ZCLH 1PKQE 4G9FA 5E8EA 1W72A 3IJHA 4JKWA 3FFDA 2HFEA 2DKSA 3AUVA 4OCRH 1M7IB 3DXAE 4Y4KB 4ODVL 3WIHH 4LEXH 3UTOA 1JWMB 4UQ3B 4XNXH 3QPQC 3K1DA 4MB3A 4JB9L 1KN2L 3MR9B 1IILE 4JRXA 4LVNC 4LDEB 2W0FA 5IV2A 4LVHB 5AZ2H 1G7JA 4CMMA 5ICXB 3HNTL 4MA7H 4HIIB 3MRNA 5ISZD 4GRMA 2Z31B 3W11D 4QRTB 5KVEH 4Q6IB 1UM5H 3D25B 4MAYD 3SY0B 4D9RE 4MWFA 1OTTC 2CUIA 1MAML 1W72H 2GITB 3F7YA 1P2CA 2I9TA 5EZIH 3RGVA 3OKNA 1KCSL 2DWEB 2XPGB 2W0PA 2AI0L 2YXMA 1UKSA 3G6JA 3DGCR 4GW4A 5DHXB 4F58L 1JGVH 2HTLC 1V3KA 3OHXB 4PJ7E 5KVDL 5DA4A 3AY4A 2DLEA 3OR6A 4U1JB 4X5LA 3FL7A 3SDDB 4U1HA 4UB0H 2G75A 5JOPD 3CC5B 4KUZH 3KLAB 2BC4B 3V0VA 3HZYB 4GW5B 1CL7I 3V6FB 4M6MH 3WLBA 3BJ91 3QH3B 1FGVH 3LEVL 3SDXA 4FN0A 3BKYL 5EN2A 1J10A 2E7HA 5FM5O 1HNFA 4W6YB 5DHVB 1U3HB 3ARBD 4XXDA 1I9IH 1AHWB 5EU7C 4K8RD 4PJFB 5E56A 4TNVF 1W0WA 4P0DA 1KCRH 5HHXH 1A3LL 1ZT4B 3BPLB 3RHWF 3O3EB 1S78C 1G6RA 2PTTA 1KB5L 3WHXB 4M6NH 4OCXL 4ZPVB 2EIDA 4U1SA 3SKMB 5B3JF 3FONA 4O02L 4MJ2A 4MD0A 1RZJC 4MJ5B 4NC1E 3VI4F 1KEGL 3CNKA 2NXZC 1VGKB 1UZ8A 1QQDB 1FVEB 4KJQC 2CXKA 2YD7A 1U92B 2P42B 1NFIB 2LU4A 1F02I 4KMTL 5CBEB 2MPAH 2WBJA 4BFGA 4OZFA 2NZ9D 5D2LB 3BW9B 4S0TD 3Q48A 5F7FA 3D69A 3NCMA 3CGTA 1EGJH 4HSQA 4NZUH 1JPFB 1I8MB 1J0KA 4MNQA 1MCQA 3QPXH 2Z9TA 4HF5H 2E7MA 1G6RH 5DJCA 3RA7H 4WWID 3ARPA 1MI5D 4MXVF 3KNBB 3QIUC 3WHE0 1MFCL 2G2RB 2NW2A 4QHKI 1D5BA 1YEDA 3MV9B 3OXSA 5DF0A 3VMOA 5MENA 5HI5D 1IC5H 3OPZL 3U9UA 2F9BT 2W1NA 4LARL 1JZ3A 5F72S 2NYYC 1QLEH 1IKFL 3L5WB 3D0VA 1MVFA 1OGTA 4MSWA 4HIHA 3WIFA 2VYRE 3DETD 1RZGB 1FFQA 1RU9H 1T0MA 2ARJA 1KBGH 1OGAB 1ORSB 2UWEF 4G80A 1UYWL 1QPPA 4UILH 3ZE0E 2R1WB 3MJGX 3UAJD 1H3GA 2VKWA 5IOPA 5C0BD 5H35B 4LAJH 3OKMB 1F13A 4XCFL 1FIEA 3NZ8B 2R0KH 2X4QA 2Y5EA 4AG4L 3LKSB 2V17H 5FHBL 3KPRB 4ODUA 1BZQK 4KTEL 4F7TB 3QUMB 1KJ2L 5DUMH 3LS4H 4QXUH 1DDHA 4JG1L 5ILTL 5BS0A 2CGRH 4R4ND 3IKCA 4NQUA 2QQNH 2V2XB 4MVBC 2DWDB 3G9VA 2VLJD 3FRUB 1RIHH 2HP4A 4U6HB 1DQQB 4ZUTA 5CUSH 3BN9D 5DRWB 5TH2B 3GHBH 5CINL 1FNEB 1PY4A 2GHWB 5A3IC 4EUPB 4RAUA 3EJYC 3GSUB 4U1NA 5JHDB 4OFDA 3BWAA 3MLUL 4X4MA 4QHUB 4FQXB 3HC4L 1S5HA 5DT1H 1JVKA 1J87A 4JB9H 1KN2H 2Q8BH 4Y88A 1R3IL 5FOJA 3GKWH 4XHJC 2I07A 2J8UA 2DQEL 1G9MC 4I18C 1IAIH 5E9DA 4YK4B 3TV3L 2VE6B 3HNTH 1CVRA 1NDGB 3DUSB 3A67L 1UH3A 1D6EB 3TO2B 2VXUH 2IPKA 1NCAL 3KPMB 4K3JH 1HSAA 4G6AC 3I6KA 5D7JC 4L3ED 5DMKB 4Z7WA 5TFSL 1XF2B 1MVUA 4EUPG 1D9KC 2BOCA 2NY6C 3CSGA 3WJJC 1KCSH 2P5EA 3MQIA 1J5OL 1NQBA 4FTVE 5CJ5A 2BP3A 3V9FA 2AI0H 1ZTXL 4WWKC 4D9LH 4F58H 2ESVE 3TN0A 1T22B 4AQ1B 2NX5A 3QIWD 1KB5A 5KVDH 4O2CA 5I1KL 1OPGL 3U46A 1T21B 5TQ2L 1IEHA 3PP4L 4OT1H 4Y1AE 1QZ1A 5SWZB 4WHYG 3K8LA 2H2SC 4WENB 2X4OB 1TTFA 2DL2A 2QV2A 2BMKB 2AABL 5LKNA 4N8VB 5D7IE 3GB7A 1R3KA 3C6LC 2B2XL 4QHMA 1BJ1H 2HJKB 1QA9B 5F7LB 4KRPD 3IXAB 3MUJA 1SBSL 1EAPA 3LEVH 2WNGA 3TA3C 5BO1L 3GI9H 3BKYH 1GRWA 2PO6B 3EGSA 4NQEB 1MCLA 2UVEA 4ISVB 3CFCL 1FVCA 3VXRD 4WI3A 5DSCB 4ZMAT 4Z0BH 2DMKA 4MNGA 3U4EA 4L3AA 1CFQB 1QRNE 3UTQB 4JHAL 2X40A 2PW1B 1F2XK 3VXSD 1HHJB 1Q38A 2ED7A 3IJSA 4OCXH 4O02H 1RZ7L 2H45A 3BPNC 3FB8A 1PSKL 2A74A 2IH3B 2XNAB 1KB9J 4JE4B 4XMPL 2E6JA 2X4PA 4P46C 1QBBA 4N8VG 3BPCA 2EIBA 4C58B 1RQ5A 4PP1D 1EJ6A 3KYKL 3SBWC 5E2VL 4XVSL 5F9DC 3TP4A 4BH8A 1R0AL 3TWCH 5FAAA 1UM6L 2FRGP 4CW1A 1R5VB 5IWLA 4KMTH 2SEBA 1WF5A 2EEDA 1G9ML 1YJDC 2BY0A 4M00A 4U6TA 5IVXF 4RAVB 2P1YA 1NCWL 1BFSA 3O4OB 3HS0A 4LLUB 2FATH 1FIGL 1TJIL 1NJ9B 1OAUH 2XG4A 1R5WA 2PTUA 4LSQH 3GMQB 4QY8A 5ID1A 3W82A 4NT6B 1CBVL 1B0RA 4QNPF 5EC2A 1UA6L 1MFCH 3RTQD 3WFEL 1OSZB 4KHXH 2PYEB 4FQCL 4Y5YB 4NBXB 1KJ2A 2JKXA 3OPZH 5DEFA 2AEWA 5MERB 3ULUD 3ZKSD 2D4FA 1ES0B 1A7RH 3KXFE 2OM5A 2IAMC 4FZ8H 4NOBA 3S4SA 2ZOLA 4IOSD 5K9QI 1KENH 3UJTL 1P69B 4U6XA 5BVPL 5ITBH 4BUHA 3IETB 1DQLL 4K3EL 3CZFA 3QG7L 5IJKC 5F70A 1CGYA 1AH1A 3K8KA 2A6JA 3OJ2C 3CVHL 5SWSE 2C3XA 2DKUA 1KXTB 3F6LA 3FQRB 4HMDA 4NWUH 3W0WB 2Z4QB 2R1XA 2IANE 3LKOB 3K7UA 3UZQA 1YMMB 5EPMB 1BZ7A 2ADIB 4KTEH 3VFRA 4JQXC 5ACLA 5ILTH 1U36A 1I9EA 4YHPA 3X14B 3PDOB 4X9IA 2EZ0D 2IQ9L 4PYHA 3MRKB 4RQQA 5B39A 4PLKC 4R8WH 3WO3B 3OAUH 4KHTL 5F71A 5KVGH 1RZJH 1AFVL 5GZOD 1P84K 1UZ6F 3QXTA 4Z7UE 2UZIL 3QUYA 3OKYA 5DJAA 1U3HD 3G5VA 3NIFE 1HHHB 2XWJA 3BYYA 3VGHA 3DLQR 1AGDA 3MFFA 4HDIA 3S97C 3GMMA 2NY2B 4H26B 5ESQB 4GAJL 5C0GA 1IJ9A 4L1HA 2EDLA 4GKNA 1Q1JH 1SBBA 1U93A 3RL2A 2PUQT 4P5KA 5CJXC 3TBSA 3EKCA 2C7UA 3QHZH 1INQA 3QO0A 4MQSB 1QSZA 4NCC1 3WFDL 4XRCA 3SE9H 1H15B 1IE5A 4U6YA 5TFSH 4YH6A 1U8LB 5FCSH 2KQMA 4P4RA 1FC2D 1NCNA 4V1DD 5ID0A 1IM9B 3BE1L 4GUPB 2CIKA 1NBYB 3I2CL 4E0RA 1FLTX 1ZTXH 1YYLL 4NQXB 5H37H 3UC0L 4NPYA 2BVYA 1J8HD 4QGYA 5EFIB 2ZUTA 1MFEL 5DMYA 3W9DB 5I1KH 4KY1L 1OPGH 1L9NA 1MH5A 2BSED 4YQXL 3QDHA 4PJ8C 5D1ZA 5IHUH 1OARL 3B8YA 4AEHH 1RI8A 1A1MB 3OKDA 3MBXL 3TPKA 3EZJB 4CU6A 1DANT 1EK3A 3HN3A 1X5KA 5LVEA 3BVNB 1T04B 3MUGA 5IIEB 3V6OC 1LP9E 3HI5H 3HUJF 2ADJB 2B2XH 4QXTA 2YPLE 2H3NB 3M8OL 4JKPL 1CZ8L 1KIPA 2P5WB 1SBSH 4XXCA 4U1IB 1U8OB 4I9WE 4P9ML 4I3SL 3CFCH 3RPIB 2FBJL 4G5ZH 3BGFC 1ITCA 2C4XA 1P6FA 5EU6D 3BEVA 3L5HA 3AU1B 5D7JA 1RZ8A 3HE7C 1UVQB 4JHAH 4AH2A 3DSFL 1D9KA 1DCLA 4QRRE 5JIKA 1U41A 1T89C 1RZ7H 4HH9A 2IJ0C 4I77L 1T1YB 4XPBL 3QIBB 3LN4B 3KDMA 4XMPH 3KPRD 4OFPA 5TDOB 4LEOB 4L9LC 1OLLA 2Q7YB 5A1AA 4OLEA 4JHZA 5EOCL 3N85H 5HPOA 5INDA 2HH0L 1TJGH 2JTDA 1BJ1J 1KG0A 2QBWA 2ZCHH 4Y4FC 4QRQB 1G9MH 4HZLA 3MLSL 5CD5C 1ADQH 5DK0B 5LQBL 4P2OA 1NCWH 1SJHA 1I8KB 1S9YA 1VACA 5KAQF 1LO4H 5J9PB 3GI8L 1FIGH 3DMMB 3C6LA 1TMCB 5JHDD 1G7PA 3MLZL 4JANA 3C8HA 3O9WC 4LLMA 4OZGA 4XAKD 1RHHA 5GS2D 3PV6B 5CD3B 5DGRA 3VWKD 5J13C 2DYPA 3CVHA 2BVOA 1BIIB 3CCHB 1DLHB 1UA6H 5FYLE 3WFEH 3MGAA 2AJXL 4RFNC 3BIKA 5I15L 3IU4L 3IFPB 4Z5RA 1JYWA 3EJJX 4X80H 3UPRA 2F15A 3UTSE 4KKCD 3O3BB 4G6MH 4XVTL 4ZXBB 2OJZL 5F6HI 5D5MF 1MLBA 4RGND 3CFKA 4X6FA 4FQHA 5E00A 5LBSH 1FL6A 2QHRL 1CICD 1IGCL 4P46A 1EO8L 1QLRA 4GH7B 4XX1E 3EJZC 3KPQB 4M5YL 4OAWB 3VE0B 1VFAA 4OD2A 3SBWA 3DVNA 4LF3B 3BMVA 1URLA 5EIQA 1GAFH 1DQLH 3O6KL 3QG7H 3OWEA 4FFVC 3SGDI 1YUHA 4K94C 3HE6D 4UZGA 5C6TL 4LP5A 4MA1C 4TOYH 3GBMH 4NUGH 3O3DA 2QSCH 4EDXB 1NGZA 3EZ8A 1IC7L 3C8DA 1C1EL 5DS8A 4F9LC 3FTGA 5CEZE 3QEQD 2Y72A 1ULVA 4LPCA 1A5FL 2VABB 3EOAB 2E9JA 4NO3B 4OJFL 4Z78A 2IQ9H 3PWLB 4DW2H 1QOKA 1JUFB 4KHTH 4DVBB 4G3YL 1NAKL 1MPAH 4PTTB 4WFFE 1QSEA 5FYJL 2PO6D 4NQED 2UZIH 5GS1B 4QOKB 5IJVA 4RGOL 3QDMB 5TF1L 3WKML 1S9WB 1U8HA 5IFHL 5F9JB 3K4DA 1U6AL 2VLRB 4QRUB 1KIQA 2ERJC 1BBJA 2HTKD 1YJDH 3L5XL 4JFEE 1I3RB 3QQ3B 2X4TA 4KK5D 1YEJL 1EFXB 3MGOA 3LKRB 2Q86A 1ERNA 1UJ3B 3X11A 4X9FA 4GAJH 4LGPB 4ZO6A 4HBCH 3RNKA 4HUUA 1VADA 1JYXA 4LHQB 3PDGA 4F57L 1RV6X 1WCBA 4E41D 2VKXA 2GQHA 2EO1A 4FQIL 5EIVA 3EFFA 3MRLB 2P8MA 1B6UA 3WFDH 2HLFD 1HQ4B 5I1IL 1PZ5A 3GMOB 3O2DA 4LCCB 1QP1A 1ZV5A 1V3MA 3VFTB 4DOHB 3N0PB 1D5ZA 1H0DA 2CK2A 1DL7H 2FSEA 5I17B 5B3JE 2AK1L 3I84A 3UC0H 3MRBB 3RL1B 3VI4E 5I8OL 5J7CC 5IT2H 1TTGA 4NNPH 4PJ5B 4X7SL 1MFEH 1MIML 4KY1H 2AEQH 3QQ4A 4PJEF 2Z8VC 5E6ID 2AJUL 4K23L 3QXAA 2VQUA 3MV9E 1SEBA 5C8JB 4TUKL 4YX2L 4FQJL 4NQDD 3L3IB 2X70B 4EVNA 4JPVL 1YNLL 3RY5A 3WYRA 3O2WL 4ZFFA 4C55A 1HINL 4RMVA 4M4RA 1JGDB 4K3GA 5HGGS 5TGBB 3ZZ1A 1F4HA 3OGCA 3NFNA 3OAYK 1TPXB 1RJYA 5CJXA 3C09B 5I66A 1GSMA 4MXVE 3I9GL 4PJEB 1RJLA 1F97A 3LD8B 4F80A 5D96C 3P9MB 3RAJL 4H5SB 1KCVL 4LKCA 1CFTA 4TVSa 3ARZA 3F5WA 3DSFH 2OP4H 1I4FB 3WSQL 4B5EA 4YWGH 4I77H 2ICCA 2PNDA 3V8CA 1K4DA 1WWWX 1YMMD 2CRYA 1F45A 5EOCH 3IGAA 1CR9L 2HH0H 3BZFB 3HNSH 3H2WA 3WJLC 3OXRA 1AQKL 1LO5A 5I1DB 2YKLL 1OAKL 4PV8B 2UWEE 4PJ8A 4QO1A 1XGPA 4OLUH 1HYSD 1N6VA 3MLSH 1K3ZA 3LVEA 3ZTJG 5LQBH 2BVQA 4NSKB 3PWVA 3ECBA 4WFHD 4NN6C 4LSVL 3W11C 1Y6NR 4WW1B 4ZUSB 3SHSA 1ZLSL 3V6OA 4MAYC 3WNLA 5F3HB 3WNPA 5FCUH 4JEGB 3CMGA 1GIGL 3EYVB 1OF2A 3E2HB 4ELKB 4NO0D 3NCFB 4HJGB 4O51B 4JY6B 2ZKHH 5F3BA 1DUYA 3IU4H 3CUPA 4NZDA 2X4SA 1PKQA 2D31B 2GCYA 5CGYC 4ZQKB 4LP4A 5FK9B 2GUOB 1NUDA 3TIDA 4YHYC 2OJZH 1SY6H 1Q72L 3MROB 1MWAB 5E8PB 3HMWH 2MQCA 1CF8L 1Z5LA 3FQTA 4OD3H 5IB2A 3ARXA 2AV7A 4L9LA 1HHKA 4M5YH 3S3PA 4MDJB 4UUJB 2VLKA 2YZ8A 4R4BB 3O6KH 3NCYP 1I8LA 2V7HA 4JO2L 1CI5A 1F3JA 4ALAL 1AGEA 3QEUA 3TBYA 3R06A 4YXHL 2Y5TA 5C6TH 1MCKA 5GGVL 3ARBC 4HUMB 2VERN 4PJIA 1MCCA 5DRZB 3HR5B 3DXAD 3I3DA 4K8RC 4MCYB 1SEQL 2X9WA 3HZVA 4TNWF 5D7SL 1QUNA 5SWZE 5GGUB 3CX2A 5GJSH 1IC7H 1C1EH 3G6AB 2IBBA 1A1OB 3QUXD 5GZND 4OJFH 4PREA 2ZUQC 2CKNA 1C12B 5IB5B 1WEJL 3F6IA 3CLEL 3QG6B 2BX5A 4G3YH 2J7LA 1MLCB 1WBZB 1F3DJ 1NAKH 1CN4A 2OJEB 3VD4A 2BHZA 1SJEB 3F12A 3FN0L 1P84J 1YNTA 1LDSA 5EO1A 5C86A 5C09B 1JF5A 4RGOH 3AS0A 3EDJA 3SDCB 5IFHH 1UB5B 2NZ9C 1SVCP 1RAMA 1DQDL 4FMFA 4HK0A 2UYLB 3K81A 1M1SA 1JNJA 2O5YL 4YC2B 3MRMA 3ZKND 4FZEL 2D3VA 3OX8A 4GKSA 5T3ZD 1IKNA 2XKNA 4F57H 5A2FA 4WI9A 4XCNA 4FQIH 3WNNA 3AB0B 3GUTB 4LCYB 2BSSA 2B5IC 4PR5A 1NSNH 2D0GA 5FGRA 2DTML 5HI5C 1RK1B 4K7PX 1BFTA 4Y5XB 2AGJL 2BRRL 4OF7A 4F9LA 4EBQL 2CPCA 3B2UD 4LCUB 3NA9L 3DX8A 3OAYH 3DETC 2AK1H 4U33A 4GRLD 1GZQB 2ZG2A 4ZAKD 5I8OH 4JN1L 2OCFD 4X7SH 5DTFA 5MEQA 4J1UA 3T65B 2YD6A 2AJUH 5JPNB 4CN1A 3UAJC 2H8PB 1UCBH 4HKBB 3J7HA 2JELL 2CRIA 3RDTC 4K94H 4DGIL 2AKRB 5IVXE 4JPVH 3UXFA 1JK8A 1YNLH 4O2FB 1BX2B 2I60H 3FB5B 1Q9KB 1HINH 4Y16B 1F6AA 4L4TB 4WEBH 1GHFH 4LSUH 2NY7L 3OJDA 4YHIA 3O4LA 5IBLD 2BNQB 2XRAL 3FO2A 5E4EB 2XTJE 5C08D 5IQ9B 3I9GH 3BP4A 3IAQA 3BIBX 4QNPE 5GHWH 3BN9C 1BOYA 1KCVH 1JBJA 3KPLB 4HMCA 1PX3A 3BQUB 1XR8B 3L3JB 3VRJB 5D7LA 1RULL 3WSQH 3HB3D 4HKZA 4WVRA 1LE5B 2AK4D 2OTWB 1M05A 1P4LA 5T5FL 3SJVD 3O45B 3N9GL 3OR7A 1L7TL 4I5BA 1CR9H 1CGVA 1R3HA 3GIVA 5I6XC 3UTTB 1AKJA 4U7SA 2QQQA 1E6OL 4ENED 2YKLH 1OAKH 3C5ZB 1UXSA 3RWJB 3SKOA 1BF8A 5HVHC 2BNRB 5TE6L 3PL6B 4XMLH 2AXFA 3TZVD 5IQ7L 4OLWL 4QOKD 4QYOA 1FZMB 1ZLSH 4DEPB 1QLFB 2XWTA 5E2JA 5SV3A 3GSNL 5EBWA 3C60D 5HHOE 2VLRD 4H88L 4OCYL 3QUZA 3K2UH 1NUGA 4NHUB 3UPCA 5E95B 1OVZA 3Q5OA 1QO3B 3RIFF 4J2XA 3PWNB 4F33A 1EFXD 5T1KA 3BP5B 4LSSL 2OZ4L 2DLFL 3H0TB 1NUNB 5FYKD 3PQYB 4H1LB 1NBQA 5EOCJ 1VSCA 5DC9B 4BZYA 1Q72H 1UZ6E 4EZMA 4W4OA 1XF4B 1PD6A 3MV11 2W9EL 4WV1B 5D6DC 4TQEL 2JIXB 5L2KD 3FRPA 4R7NA 2V7NA 1AD9A 2QQLH 4JFQB 1QNZH 1MQKH 4Y4HB 2VZ3A 3BKCL 3QWRA 3S6CA 3UO1L 4BSWA 3L1OL 1TVBA 3TCLA 2WBKA 2X9YA 4ALAH 1BZ9B 1NGWB 4LLYB 4YXHH 4AEIH 2EYTB 5EORH 3U7WH 4LBEA 1TQCC 3F7QA 1S7QA 4PG9A 4R26L 4JFXB 4F9PC 4CADB 3ARVA 5IB4A 3BGAA 4JHWH 1KELL 5L7XH 2CLZA 4F15B 2GJ6E 2AERT 2HJFA 4X4ZA 3UJJL 3CLEH 2ESVA 5CSZB 4PP1C 4JAMA 4LNVA 4Y89A 3JVGC 5HYQB 3MA7B 3FN0H 3L3KA 4WEUD 1VPOL 5LAXB 4NKDB 4EXKA 3RJDA 1D6VH 5IEKA 1XGRB 1BJ8A 1X5JA 2YR3A 4JFHE 4F7PB 4LLWA 4DN4L 4CDGC 4HQQL 5J0BA 3V5DB 3GSRB 1FNHA 4WHTB 5FECA 4LOUD 3X13A 5D7IA 4FTVD 3ALXA 5B38A 4FZEH 1NGXB 1DBKL 2VWEC 5HYJB 1RIUH 4X6EA 4GKZA 3HUJE 3QNZA 4FQ1H 3VXME 1EBPA 3ARGA 2F19H 5ICZA 1MELA 2NZIA 3PP3K 4XPTL 5F7DB 3VRIB 1AGBA 2CKBB 3T09A 1LD9B 2NY1B 3TPUA 3UDWA 5HYSG 3H3BC 1E28B 3MRJB 4LVHC 5EO9A 3V4UL 2DTMH 3D0LB 3RWCA 1QRNA 1HILB 2AGJH 3LRGA 1Z3GL 3ULUC 1R5IA 3HLAB 2Z31C 4HUXB 1CDIA 4JN2B 3NA9H 2UY6A 1N59A 3F7PC 2DQGH 4F3FA 4CJ0A 2ICEB 1M4KA 2IALA 1MNUL 2PXYD 2FDBP 2F5AL 4U1KB 5TE4L 3WDHA 3DV4B 1KTLB 3EO0A 1F00I 3O0RH 4GKOA 5DQJB 4HK3J 1YMHB 4IHOB 2YRPA 4JO1L 1FJ1B 4ORGA 1Q9LB 4S10A 4MA8L 4XCYA 4ZS6D 1S7SB 3B6SA 4K71B 1YY8B 4MA3B 3D39B 4K8RH 1RIVL 3SDDC 1LEKB 1QSFE 2NY7H 1A2YA 4JO4L 2J88L 1MCBA 3LRHA 2EZ0C 1KTKE 4HUWA 5C0IB 3R8BB 1OWWA 5T1LA 1ZT7A 1UACH 2GK0A 5AD0B 5EBMB 4OUUB 3KYNA 4HXAL 3R8QA 3GSNA 5GZOC 1ZS8B 3MV8B 5C9JA 4WW2B 1U3HC 2ZZUT 1PG7L 3CLFH 2EH8H 1RULH 1AHWC 1BGXH 3KXFA 5ACZB 5J1AB 4LSDA 2OZ4A 2UZXB 1NC2D 1K8IB 2XTLA 5D5ME 5GGSA 2BNUA 1U8NA 5T5FH 4NQTA 3N9GH 3FQXB 4WGWB 3BSZL 2Y07H 3VFMB 2YUXA 3LV3B 3JV6B 2VLLB 4BZ1H 5DVNA 3TYGL 3O6LL 1DVFB 5C2UB 3TO4A 3QO1B 1NEZA 3T2QA 2QL1A 4KJPC 1JTTA 3FCTA 1A6WL 5TE6H 4HZAA 3ARFB 5CJOL 2PKDA 1GZPB 2WINA 5DFVD 3RDTA 1LK3H 1KIRA 5DUPL 2IANA 1FYHB 3SDCD 2AVGA 1OWRM 3QDME 3GSNH 2KQNA 3JTSB 1FRGL 1TNMA 1BBDL 4OCYH 1JHKH 1KPVA 1OQXA 1MUJA 5EH1A 3V5HB 5SWQA 3ULUL 3F65A 7FABH 1PQZB 4LSSH 1P7QA 3TVMD 2DLFH 3QDAA 5T1MB 5KN5B 1A6VL 2J3SA 2FR4B 2HMID 4LKXA 1DN0B 5C07B 1F42A 1MCIA 3BUYB 2PW2A 1KLUA 2HKHH 3KPPA 2W9EH 3UPAA 4M1CD 4GMSH 4TQEH 1ODAA 3DRTA 1BFOB 1MHEA 3D2UA 4PJDF 3QP3A 4MD4A 5HYEA 1JGEA 2VDKH 4JFFE 2PTVA 3LS5L 1ZA3B 3KYOB 3BKCH 1ZA6A 1ZHLB 3RP1A 3UO1H 4PRIB 2YSSA 1KEMH 3L1OH 5MI0B 5CEZL 1GGIL 1CE6B 4WJ5B 4EXPX 5J11B 5EUOB 1JMXA 4NKMB 5FHAL 4M93B 2ZOKA 2DQDH 1KGCE 1YNKL 1AO7D 5TJWK 5FO7A 1R24B 4R26H 3SDAD 3VFGL 2O5ZH 3IDIB 1OAXL 4WDIA 3BDYH 1KJMB 4PJDB 1MFBL 4KVNL 1EHLL 3IFNL 3UJJH 5EIIA 2A73B 1ND0A 3MXVL 4PRPE 2V2TB 4WU7A 5IK3A 3MXWL 4DAGL 3UBXA 5MP6H 4MNHB 4X8XA 5HHQA 1CD1A 5DYOA 3KYAA 4PJEE 1O0VA 4DN4H 2Y36H 5GGVY 1MIEL 4HQQH 4U3HA 5D6DA 2YUZA 1YPZB 2Z35B 3CK0L 3G6JF 3NZHL 4I1NB 2YPLA 4ZTOL 5FDYA 2EDJA 1DBKH 4ELMF 2R8SL 2VQ1A 4FQXC 3VXUB 3VWKC 1X5YA 1U91A 1LEGA 4L4VE 3HNVH 4XPTH 1A7PL 3UTTD 1FAIL 3VFSA 1CXFA 4KDVA 2XQYG 4YK4C 2Y9RT 4YEEA 3SGJC 3C5ZD 5I16B 4KKCC 2VSCA 1XIWD 4X4XB 1G7IA 3OB8A 3BFOA 1T83C 4P2QB 1S3KL 4RGNC 4F8QA 5M7QA 1FBIL 3SDXF 4QHLB 4ELMB 4I9WD 1QFOA 4ACPA 2DJUA 1FZOA 1U58B 1QFUL 1MNUH 4C83A 4ODWA 3T2PA 3JVGA 2X1XR 4GBXB 4QTHB 2WIMA 2AV1A 4LCIL 4TNVK 3PQYD 3TBWB 4XGZB 4U1GB 5DR5H 3QDJB 5KG9B 3RHWK 4OFIA 4LCWE 3IDMB 5I71B 5JA8B 4JO1H 1JI1A 1SQ2N 4MA8H 1RHFA 2A38A 4NQCB 2VIRB 1RIVH 5FKPB 4AM0B 1M7IA 4Y4KA 2RGSA 4JLRB 1JWMA 1S7UB 3OJVC 4JO4H 4UQ3A 3BXNB 2J88H 3KJ4B 4K2UL 2UZYB 4BQ8A 3RVUD 3MR9A 4Y4HD 4FQLL 1A6UL 4W6XB 4DCQB 4YGVB 4Y2DB 4HXAH 4YO0B 3EOBB 3C9NB 4JQVC 2PO6C 5ICXA 2CDGB 3QUML 4HIIA 2X89D 1FG2B 4ODTL 3QZWB 1PG7H 4D0DB 2VLME 2Z31A 12E8H 2E3VA 5HJ3B 4K7FB 1KLGB 1CFBA 4QRTA 4Q6IA 1S9KC 3P30L 1L0QA 3B5TA 3D25A 2JJVA 3SY0A 3EO1B 1YEGL 2DQTL 2GITA 5TPWL 5D9SB 5FYLD 4KK5C 1RUML 2X5PA 4M8QA 1MCWW 5IFAH 3TYGH 3O6LH 3UTSD 1F8TL 3GM0A 4HMEA 4GXVH 2DWEA 2XPGA 4XPFL 4Y5VB 1UEYA 3OHXA 1A6WH 1Q0XL 5CJOH 1GL4B 2X42A 4ZFZB 4JZNB 2HLFC 3DUHA 4J4PD 4U1JA 3EDEA 5D7KE 3CSPA 4PJGB 1WISA 3SDDA 1CE1L 3QZWG 1LK2B 2W0KA 4IS6B 3W2DH 2DN7A 2BC4A 1UM4L 3KLAA 3ULUH 3OL2A 3HZYA 2FEDD 3WIIL 4GW5A 4K3DL 5HYJD 3V6FA 1U42A 1A6VH 1I3GL 1U8KB 3QH3A 3NPZB 3LKQB 3MBED 3ROLB 1PLGH 5E6IC 3NGBB 5DHVA 4YDLB 1U3HA 1AHWA 4Y5YC 4BK5A 4PJFA 4LHUG 1CGWA 1ZT4A 3ZE2F 1QSVA 3O3EA 3DHMA 4IM8A 3VI3F 3WHXA 1EO7A 4NZTL 4ZPVA 4LU5H 1QFWM 2XYCA 3SKMA 4NCC2 2XKUA 4K55A 5CSGA 5KSAD 1OM3L 2YD9A 4ZFOB 4MJ5A 2KZWA 3JWDC 4NRZB 3F7RA 1GGIH 3IS0X 1VGKA 1BAFH 1FVEA 3LEXB 1QQDA 1JYVA 1P1ZB 5GGSY 1NFIA 1YNKH 4I0KA 2I27N 1I7UB 4KTDL 1J1XL 5CBEA 3VFGH 3OKLB 4JFED 4WUUE 3K4AA 1FO0H 5D2LA 3BW9A 3WNKA 3MLYL 1X6LA 1DN2A 5IGXH 3JV4B 1MFBH 1WAAA 4QWWD 5DHVH 1JPFA 4B0MM 1D5IL 1I8MA 1YN7B 4S1SH 4LNRB 1EHLH 2EICA 4NCDA 3MXVH 1J1OL 4U3XA 5C0ND 4DAGH 2ADFH 2D9CA 3KNBA 1M7DB 2BNQE 2G2RA 2V5TA 5IHLB 3MV9A 5KSVB 1I9RL 5I74B 1NGPL 4JPIB 5LCVL 3SGDH 4YUEL 1GH7A 1NCDL 5EZJB 3QAZB 1MIEH 1AQDB 4KPHH 2DJ4A 5C7XH 3MV8D 2A6IB 2Y7QB 3NZHH 1U95B 3CJJA 4ZTOH 1QYGL 3L5WA 4P4KB 2HLAB 4YLQT 2BSTB 5JW4Q 3P4MB 2HFFB 1RZGA 1X9QA 2IC2A 4R96B 2NLJB 2NY2C 3ULVC 1A7PH 1OGAA 3LPGA 4BELD 1ORSA 5J1TC 4ZSOB 5DJYB 1AR2A 1N5AB 4C4KO 4Z77B 1T03L 1JF1B 1DVFD 3S3JA 1VHPA 1IZKA 2LVCA 3TJHD 5C0FB 1DQML 3V52L 1S3KH 3SKNB 5H35A 3OKMA 4X99B 2ZUUA 4FG6C 2G5BB 3NZ8A 3LKSA 2HRPH 3KPRA 4YBQD 2QEJA 1QBLL 4F7TA 3QUMA 4XZUB 5CHNB 3EDKA 3VG9B 5TE7H 1PFCA 1P7HL 5EUKB 1CGTA 2O5XL 2FX7L 1JMZA 3NCYS 4DFHA 2VAAB 2V2XA 3V8OA 2DWDA 4ZS7L 1A6AB 2OK0H 3LMJL 4U6HA 3T0BA 1DQQA 3JWDL 5BMFL 5DRWA 5TH2A 4CUCA 1DFBL 2WWKO 1SM3H 3ALPA 1FNEA 4LVNB 4EUPA 3JSSA 3GSUA 3MTRA 2BY3A 5EOQH 5JHDA 2GJZB 3FFCE 4QHUA 3IFLL 4FQXA 3UCRA 2PF6A 4P57B 1ORQB 2P8PB 4IRJB 4K2UH 5GZNC 1BD2B 3O11B 1MF2H 1OCWL 2FNBA 3WS3A 4ZNEA 4JM4L 4PRID 2BY1A 1NGQL 4RRPA 1FN4B 3SGJA 1B2WL 4YHLL 1OB1B 2VE6A 3DUSA 1NDGA 1DUZB 3QA3B 5HHPB 2C1PB 3P9LB 1GOHA 1D6EA 2FBOJ 3TO2A 5J1SC 3KPMA 1YEEL 2GTZB 5HI3D 4YHMH 3P30H 5DMKA 1KSRA 1EMTL 1YEGH 2UY7A 3GMLB 1XF2A 5TPWH 1RUMH 5F9WC 3ZKNC 4EUPH 3MRGA 3MOAL 2EIZB 4X7FC 4MMZC 4HPOL 1T22A 5GS2H 4UI2A 2XQBH 1Q0XH 1GVIA 1GJIA 3ESVF 3R1GL 4F7MB 4PRNB 2M1KA 1H3UA 1T21A 4C56E 3ULVL 4HWUA 5SWZA 1CE1H 1T4KB 2D9QB 3DJ9A 2X4OA 3C08L 5DJ0B 2I25N 1HSBB 3B2UC 1A14H 4WHYH 2BMKA 3K46A 4PY8J 1UC6A 4OKVB 4N8VA 3WIIH 3VXQB 1ONQB 4K3DH 2HJKA 4MS8D 3WO4B 1KPRB 4GAFB 5I75B 1HKFA 1QA9A 1YZZA 1I3GH 3IXAA 3QCVL 1WZLA 1C16B 3TH2T 4OLZL 2PO6A 4X9GA 2XA8H 4NQEA 1CXKA 1I75A 4ISVA 1OTUC 5FV1L 4K9EC 5BRZE 5DSCA 3INUL 1G7QB 4EJ1C 1CFQA 4ZXBC 1XGTB 2DLHA 3UTQA 4URTB 2PW1A 2CR3A 4NZTH 3PG2A 1HHJA 3T0EE 4BKLB 4JM2D 2AJYL 3MRFB 2JJSC 2IH3A 2XNAA 1MY7A 3HG1B 5CBAB 5GPRA 3WUWB 3TJEH 1ZANH 1A21A 3LEYH 5IBLC 4Q74A 1Q0YH 1DP0A 4GBXD 4HG4J 3RQ3A 1R5VA 1EXUB 4PJ9D 1JNHB 4KTDH 4HKJB 2R0WL 4RAVA 3OF6D 3HB3C 3QIUB 4LLUA 2ZUSA 1D5IH 1CXHA 5E2UL 1NJ9A 3D39E 1J1OH 1QBML 3SCMB 2D0HA 2HFGL 1KFAL 2NY4D 3LPFA 3KPSD 1H3XA 3GMQA 4NT6A 5I1EL 4AIOA 4ENEC 4NGHH 1E27B 3BKJL 3WUWG 5MEPB 5T3ZL 5I76B 1OSZA 1I9RH 2PYEA 3VW3L 4Y5YA 4YUEH 5LGHL 1K4CB 5GS1C 3TZVC 5MERA 4IIQA 2D7TL 1ES0A 2A2QT 5JR1L 4DVRH 1Y0LB 3C60C 4Z18A 4P5TA 2J2ZA 3ET9F 4QT5B 1YECL 4BUGA 2OQJB 3NTCH 1JJUA 3RI5K 5CEYB 2EEAA 3FB6B 5GRYA 4P3DB 1ZLWK 3HAEB 1KJVB 4KDTC 1T03H 2VDQL 1J12A 3NCJH 3MRCB 4KJWC 1BQHA 2QJDA 1DQMH 4UOW1 4W6WB 4KWUA 1U8QB 3PWPB 4LHUD 3V52H 4S2SB 3QDGD 3W0WA 2Z4QA 2CUMA 4BA8A 5H8DA 2VITB 1UGNA 4K9EL 5H2BB 3CU1A 3GNML 3LKOA 3S5LB 4XCCL 2VZ1A 1YMMA 3CD4A 4LPYA 5ALCL 5EPMA 2ADIA 1QBLH 1QKZL 1T7XA 2XTJD 2O5XH 1IZJA 3PDOA 4TN9A 3MRKA 4N5UA 4ZS7H 5GRWA 3LMJH 5DURB 4UMGA 3JWDH 3QULB 5T33L 3BX7C 1HCVA 3HAEG 1FFNB 1A6PA 1DFBH 4PRHB 2YMXH 4O4YL 1HHHA 4I18B 3TIEA 4M43L 4C59B 1PVHA 5HHOA 2OMNA 4HWBH 2OX5A 4OLXH 3IFLH 2L7UA 1MREH 1Z9SA 1AD0B 4M4PA 1CTNA 1OCWH 2P43B 1UENA 5ESQA 5JDJA 4U49A 1NGQH 3UJIL 2XWBA 1A3RL 1N26A 1IBGL 1TPXC 4Q0XH 4PJAB 4PJBB 3C09C 2EYRB 1T66D 1YEKL 3S34L 3DTXA 4OZGF 3D9AL 3DRQB 3GGWB 4XNZB 1H15A 5TQ0L 4WWKB 3WE6B 5CKGA 1EMTH 4LOUC 1WT5A 1U8LA 4YE4H 3P0VL 3MV7E 4UTAH 4KROB 2L7JA 4JY5H 1TNNA 3PNWB 5DMIL 3QXDB 4PJDE 1A0QL 1IM9A 1HDMB 4GUPA 5EU3B 1NBYA 3AROA 1IAIM 5CEXB 1H8OA 2DM2A 4G9FE 3QXUA 1XCQB 4NQXA 1T7WA 5DUBB 5L6YL 5EFIA 3R1GH 3W9DA 5CIPB 5FYKL 2DTSA 3BD3A 3REWA 2H1PH 3KWWB 1A1MA 2HT4D 4GS7C 2AXJA 3C08H 4PP2B 4M3KB 1HWGB 3TA3B 1JNNL 1HIML 4I2XB 4UV7H 4XP6L 4UNVA 3BVNA 1T04A 5IIEA 3Q3GB 2ADJA 2H3NA 4QHNB 2HG5B 4J7RA 2IGFL 2H32H 4LLDA 3V0WH 2P5WA 1OT1A 2DRUA 3VXUE 5I0DA 3AMLA 3E2HC 4U1IA 1U8OA 1IARB 3I6LD 1QFHA 4ODSL 5BZDB 5I1JL 1PYWB 3BPNB 3FB7B 1WWBX 1A3QA 4LSTL 4NC0B 3P4NA 3D3VB 2DB8A 1XFPA 1P5VA 3AU1A 2GJ6D 3H42L 1EUUA 1UVQA 2IG2L 4ZS6C 3B83A 3HC3H 4GQ9H 3OG6B 1S5IL 5C71A 3LSOB 4M9OA 3CFBB 1T1YA 3G6JE 3LN4A 3QIBA 2HVKB 2EDFA 1V7NL 5TDOA 4ELME 4LEOA 2Q7YA 2AQ2A 5C0CB 5HGDA 4PBXA 5GJTL 2BSRB 4JJ5B 3VMNA 5BVJB 5GGRB 1NANH 4TSAH 1I3VA 4Z7VB 4QRQA 3MOBL 3QDJE 4FS0A 2R0WH 5DK0A 5KTEH 1I8KA 2VXQL 2DQCL 5F97E 3SQOL 5J9PA 3T0WA 3VXMD 1F3RB 3MNWB 4AL8L 3DMMA 3IDYB 1A22B 4QRPD 5E2UH 1VEMA 1QBMH 3SDXE 3EHBC 5CD3A 3PV6A 4NNXB 3VXNB 5I1EH 1JPTL 5GGTL 5F7EL 1BIIA 3CCHA 1DSFL 1DLHA 3B9DA 3BKJH 5IM7B 1INDH 3PGDB 4KXZI 5T3ZH 2IAMB 3FMGL 3I75B 3IFPA 5LGHH 5DFVC 3O3BA 2NMSA 1OAYL 2Z8SA 4HWEL 1I1FB 4ZXBA 3TT3H 1H8NA 3HI1B 1I1RA 2CIIB 3SDCC 2D7TH 4BJLA 5JR1H 1A9BB 2LTQC 4YXKL 1MFDL 4KVCL 4YC2C 4CN6A 3O6FD 4ETQB 3KPQA 4ZPTB 3H9SB 4OAWA 4U31A 3TVMC 1F11B 2DMCA 2PR4L 1YEHH 1A7QL 4LF3A 1I8IB 2VDQH 2A1WH 5IBUB 3K74B 2DMBA 2HMIC 2X4NB 3AXLB 4HCRL 4GXUN 1C5DB 4RBPK 3OKEB 3FO1B 3F58H 1NLDL 1QSFD 4M1CC 1VESA 4EDXA 4TTDD 3GNMH 2QQKL 4XCCH 2MCPH 2ZUXA 1O7SA 2VR4A 2DI8A 1C5CL 5L9DL 5CZXC 5E5MB 3TT1L 3EOAA 2VABA 4KRNA 4CMHC 3NFSL 4NO3A 3FJTA 2FEEI 4LIQL 1I7RB 1MWAL 4JY4B 1JUFA 4WNQB 3ROOB 5I8KL 4DVBA 1JGUH 3TC9A 2VXTH 4PTTA 3BP7B 5GS1A 4GOSA 4Y8DC 4CDHA 4QOKA 5IB1B 3V0AC 3SDAC 4O4YH 3QDMA 1S9WA 4N0UB 5F9JA 2APBA 2VLRA 4QRUA 3V95A 1FDLH 1I3RA 3QQ3A 1PX4A 1H3VA 1ZLUH 1EFXA 3S96B 1UJ3A 4Y16C 1D3CA 4KDTA 5EO0B 5IKCB 2ORBL 3ZYIA 2EE2A 1WZ1L 4ZUWA 3LOWA 3TNNB 1BM3H 5E4EC 3ORJA 1YEKH 3S34H 3GSWB 3MRLA 5HI4D 3D9AH 3GRWA 3HZKB 3OGOE 2K3TA 5TQ0H 1HQ4A 1T7YA 3S8WA 2DQIL 4M03A 3GMOA 3U1SL 4LCCA 5BS0E 5DXWA 1E4WL 2AP2A 3VFTA 3ZE2E 4JFFA 3QJFB 5DMIH 3VI3E 1AP2B 4DQOH 5I17A 4TRPL 3V7AE 2OTUB 4RWYH 8CGTA 3RPKA 3SCMD 3MRBA 3RL1A 5L6YH 1BWWA 4PJ5A 2N4IA 3C5ZC 5ECJE 1XCTB 5IMOB 2NQCA 5FYKH 2E5EA 4G6FB 1UWGL 3PL6C 2R1YB 3H3PH 1HHIB 4MJ4A 2QKIB 1MQ8A 2A9NL 1G9NL 1JNNH 1HIMH 3L3IA 2X70A 5GQBA 2VH5L 5EA0H 3DUUB 4KUCD 2IGFH 4H0IA 4HJJL 4PJIF 5J6GB 4JFZL 1JGDA 3HE7B 3ZL4L 5HPMB 1KGCD 4AK1A 4GQPH 4G6JL 4G8GB 4ODSH 1JNLL 3MODL 2E7BA 4NDMB 4ZSOE 1F4WL 4LSTH 3DSNA 4PJEA 4IDLA 1F4XL 4PJHB 1F90L 4MHHG 3SGEH 4H5SA 1CFNB 5T3XD 1M6OB 5T5NF 5GGTA 1TFHA 5HBBA 4P2RB 2P5EE 3U7YH 3OJMB 1I4FA 4WI4A 4PRPD 5C0AD 4DGVL 4WV1C 4HIXL 4Y4FB 3VDAA 2PYFB 1V7NH 5HDLA 3RRQA 2CLVB 1JI2A 4Y4HC 1MHHB 1TJHH 2UUDK 5I19L 3BZFA 3B9KB 5DLML 4BFIA 5FF6B 5TDNB 4OFYD 5I1DA 4PV8A 4WO4D 3WNOA 4LPUA 5DURD 3O9WB 3X3FL 5E94B 3VD7A 4NSKA 5J13B 3GMPB 3EYQD 3N1FC 2DQCH 3SQOH 3ZTJH 4WW1A 4ZUSA 3AREB 5IBTL 5LJYH 6CGTA 4L4VD 3IRZA 3PE9A 4HCRA 3SQBA 5GS0C 4KKBD 3EYVA 3ZHKA 4HXBL 4OF8A 2BJMH 4ELKA 1JPTH 2Y6SD 3D85D 5F7EH 4X4YB 1DSFH 4HJGA 4O51A 3C8KB 4DZ8B 4HIEB 4JY6A 3FMGH 4L5FH 4MNGE 5GGQL 4YHZL 2WP3O 3R0MA 2D31A 1BVKB 1FYTB 3K3QA 4ZQKA 1OAYH 3ZT5A 5CP7B 4HWEH 5FO9B 5FK9A 1TTUA 2GUOA 3DECA 4HLJA 3MROA 3L9RB 1MWAA 3E6HB 4M62L 5E8PA 3RWHB 4KVCH 4LHJB 4FP8L 5GIRB 2D7PA 3M17B 3QQ9D 2B20A 2FEDC 4KROD 2IPTL 4U1MB 4MDJA 4UUJA 1FNLA 2PR4H 1N6QL 4N90E 4IMLB 4OD1H 4LCWD 1RVFL 2CDFB 3NABL 4R4BA 1VGEL 4D0CB 3MBEC 5I1GH 1XR9B 4HCRH 1S9VB 3RZCD 2YUVA 2NY1C 3TBTB 5DRZA 1GPOH 3HR5A 5CZVL 4MCYA 2VMFA 3E6FB 5JORB 4JFYB 5GGUA 4PB0L 4HC1A 1NEUA 2HT2D 1I1AD 4F2MB 2F54B 4G8IB 2EH7H 4FFWD 4Y19B 4APQD 3B2VL 2YD8A 3Q2CA 5L9DH 3TT1H 3G6AA 1JHTB 1A1OA 2G9HB 4LFHG 5C0EB 5DFTA 1XZ0B 4LIQH 3ARYA 5IB5A 5EU7E 5I8KH 1GGBL 3QG6A 1MLCA 1WBZA 2ZNWA 3B43A 5AEAA 2OJEA 1B0WA 2D03L 2WWMC 2VR5A 1RZKC 1SJEA 3F7VB 1JZ4A 4D2NA 5C09A 2APVA 3SDCA 5EZOL 1UB5A 4WUKL 5GRJL 4O5LL 2JJUA 1MAKA 2HFTA 2UYLA 4OTXL 2Q7NA 4QWWC 43C9B 3I02B 1MCHA 1U3YA 1RURL 5DJ8B 4WY7H 5DD5L 3ZKMD 3QISA 3O2VL 1NCBL 1HNGA 5C0NC 4XBEL 5K93A 3VFNB 3AGVA 1WZ1H 3PHQB 3QB7C 4KQ4L 2W07A 5GS0L 3AM8C 3O8XB 1KTDB 4J12A 3GUTA 3W5MA 4LCYA 1CDBA 2AS5M 4Z0XB 3RUGF 1GCFA 1RK1A 4Y5XA 3U1SH 4WW2C 1ACYL 3RKDD 2ED9A 4NM4L 3NACH 5CJQL 3RIFK 1JYNA 4LCUA 2DKMA 1T20B 3HFML 1QACA 1N5YL 3MLRL 4O9HL 4TRPH 4KKLD 5KSUB 3X12B 1GZQA 3H3KA 1EEQA 5DI8B 2LE9A 3DVFA 5ADOL 4X7DC 3T65A 1DVFC 4KKAD 1JZ7A 5ANMB 5JPNA 1JPSL 3VGAB 1S7TB 2H8PA 3U82B 3MRHB 5E5UB 1UWGH 1LO0H 4HKBA 4P2CG 3RUGB 1QFWL 1CLCA 5SX4H 1P5UA 2AKRA 2CKBL 4N0CD 2D2OA 1LO2L 1Z0MA 4O2FA 4EN3B 1BX2A 3V6ZB 2UUDH 4NHCL 5FGBC 4YBQC 3FB5A 2DLIA 1F58L 4HJJH 4Y16A 5D96B 4L4TA 1MJUL 4JFZH 3EAKA 4NZJA 4EOWH 4G8EB 4G6JH 1R3LB 1Z6JT 2BNQA 4RX4D 1MCPL 5JMRA 3GHEH 4D3CH 4WUUD 1F4WH 1N4XL 3BESR 5IQ9A 1K6QH 4KQ3L 3KLHD 2BVPB 4RFEB 2A6KB 2J6EL 2Q3ZA 3KPLA 2NPLX 4K7PL 3PWPE 3BQUA 1XR8A 3L3JA 3VRJA 4A6YB 3TYFB 3RVXD 1RZKL 2ITDB 2YRLA 1BP3B 1HEZB 4HIXH 4QKXB 2OTWA 5IB3B 3U4AA 3O45A 4LLAA 3SO5A 1JRHL 1VFOA 5ISZB 3VH8B 1WBXB 4NZRH 4NN6B 2MCG1 1NGYA 1NBVH 1BEYH 4MAYB 5F7NC 3ARDD 3MRPB 5MI0C 5J11C 3EYOB 3RWJA 5HY9B 1TXKA 2BNRA 3X3FH 1OAQL 4G42B 3PL6A 1CS6A 5IV2B 4XHQA 5HI3C 1FZMA 5I73B 4AMKH 5BV7C 4G6KH 3C6SB 4GRMB 1A7OH 1X4YA 4YHOH 3KPTA 4PS4L 4ZG1A 4NHUA 2JLLA 4YEFA 1U9KA 4PRDB 5E2WL 1QO3A 2WV3A 3PWNA 3BP5A 1CTOA 2B4CC 3H0TA 1P2CB 4YHZH 5GGQH 3PQYA 1AE6L 4JR9L 1P4IL 4H1LA 4RDQF 2MOVA 3HI6L 5DQ9A 4PIRF 3E8UL 1QPXA 1TETL 1JF6A 4OGYH 1XF4A 3DIFB 4M62H 3MGTB 5E0QA 5HHME 3T8XB 1T2JA 2JB5L 2R4SH 4WV1A 3MJ9L 5JNYB 2JIXA 1TIUA 3NH7H 3VWJD 3D48R 3ARBB 2IPTH 5JUEH 1BHGA 2ICWI 4MS8C 2K7PA 1SHMA 3QNXB 1S7WB 4OGAD 3NABH 5JQHC 1VGEH 2XICA 5JXEA 1PG7X 2K7QA 1BZ9A 1NGWA 3PGFL 4LLYA 3HHRB 1EIBA 2EYTA 3WLBB 1NLBL 5CZVH 3BKML 4I48B 4JFXA 4OZGE 3G5XB 4CADA 5BZWB 3P11L 4XXDB 4NO5B 1N8ZB 2GAZB 5K9OB 4I4WA 4JM2C 3QFJD 4I2XE 5L8JB 2DM3A 3N50A 4KFZC 2B0SL 2DQFB 1GGBH 3GJEB 4GLRI 3L7EB 5CSZA 5F1NB 4H20L 5HYQA 2D03H 3MA7A 1XF1A 3OV6A 4GBXC 3MJ7A 4OCRL 4NKDA 5J57B 2IH1B 15C8L 2V6HA 2P46B 4LL9A 2H2PD 1XGRA 4WUKH 3WIHL 4F7PA 5GRJH 1DQJB 4O5LH 2CLRB 4NRXB 4XNXL 3MMEB 4IOFC 1MI5B 5KBNC 3V5DA 3GSRA 2FZ3B 4WHTA 2EO9A 4OZFB 1QR1A 4P2RD 2IBZX 1NGXA 5DD5H 5AZ2L 1H3WM 4IRSD 2B5IB 5B4MC 2NY4C 4MA7L 3O2VH 1NCBH 4XBEH 3KJ4C 3GKZA 2VL5B 4C56D 5FYLH 5F7DA 3D18B 2CKBA 3VRIA 4GG6B 2WUBH 1LD9A 3B9KD 4A2LA 5KVEL 3G5YB 4Y2DC 2R2BB 3MRJA 1FZJB 2B4CL 2BXYA 3D0LA 3FHAA 3N06B 1HILA 1ZVSB 1ACYH 3QHFL 3HLAA 1RFDH 3OXSB 5CJQH 4HUXA 4JN2A 2RFXA 3C87A 4O9HH 1JGVL 2YD1A 2J6EA 3DO7B 2ICEA 2OL3B 5C0BB 1S7XB 1QSEE 4OZFG 1FL3B 4ZNCD 5ADOH 1B9ZA 4U1KA 1CVSC 1GC1C 1U2HA 4Y5VC 3DV4A 1KTLA 4KUZL 5DQJA 4HS3B 3T1FB 4CU7A 3WXWH 3T0ED 1Q8MA 4IHOA 1FJ1A 3B9EA 1Q9LA 1LO2H 4M6ML 5HHNB 1S7SA 2VB5A 4NHCH 2VLJB 3HMXA 4ZO8A 1YY8A 4MA3A 3D39A 3KHOA 4LFHD 5HYIA 1MJUH 1LEKA 4DKFH 5MHSE 1L6ZA 5C0IA 5AD0A 1N4XH 1RUAL 4OUUA 1T0NB 1DDHB 3L3HB 4QCIB 2J6EH 4ZYKB 3ILQD 3BEWB 3U9PH 3K4ZA 2VZUA 4J3OC 4FABL 4Q9RH 1ZS8A 4YDLC 1KB9K 4MQ7B 4WW2A 3P2TA 1QR4A 1AGFB 1RZKH 5J1AA 5ACZA 5EC1B 3FQXA 1JRHH 3VFMA 2QADD 4OLVL 3LV3A 3JV6A 2F58H 2VLLA 4L4JA 1CDGA 3TGXA 2E8YA 5D2NC 4L3EB 1DVFA 4BFBD 4X6DB 3HRZB 3QO1A 1A7NL 2OXHA 4PV9B 3D6GA 1OAQH 3ARFA 5C0JB 1GZPA 2UVFA 4MHHI 2EIEA 4RNRB 4JDVA 5K9QG 4PBWD 3QPXL 4HF5L 2XACC 3JTSA 1O5DT 3QIWB 3RA7L 1VEPA 3IDGB 4N0UE 3V7AG 4PS4H 3DROB 4KAQL 5E2WH 3V5HA 3HR6A 4Z7WB 3BD4A 1PQZA 2VSDA 5T1MA 4NO2B 4DKDC 5KN5A 4B7IA 3HA0A 5HXMA 3SE4A 1P4IH 2DQUL 2MSPA 2FR4A 4JZJC 1DN0A 1YDPB 5C07A 1ZGLB 3MREB 2AJSL 1QLEL 3MUZ1 1TETH 5KSBF 3VFVB 4PGCB 1E6JH 3NFPB 4KRPB 5J89A 2DQJH 2N1KA 1A1NB 2HT4C 2JB5H 3QAZC 1NL0H 3IXTB 4HUNB 3MJ9H 1IT9L 2DQHH 3WN5C 1BFOA 2WP3T 1CQKA 3VXRB 4HD9A 5FIEA 3GK8L 4P4KC 1ZA3A 3KYOA 4MGXA 1ZHLA 4JRYD 3GMNB 5I1LB 2HT3D 3CH8A 4PRIA 4PTUB 3WIHA 1CDCA 2RR3A 4DK3A 2QSTA 4I0PB 1Y18B 1CE6A 4WJ5A 3GIZL 3LRSB 3PGFH 5EUOA 4NKMA 1T5WB 3V6OE 2R0KL 1EEZB 5KSBB 1R24A 4KGJA 5DUML 3P77B 4QXUL 2CGRL 3IDIA 5AZEH 5A2IH 1KJMA 3N1MC 1FNGB 2QQNL 4PJDA 4TUOB 4S1DD 4EN3D 2NTFB 2B0SH 1ZKAA 1RIHL 1WTGT 2MQ0A 2A73A 3MYJB 5CUSL 4ZOCA 2V2TA 1FNSH 1YQVH 4PGEB 3VG9C 3ULUF 4H20H 3GHBL 2BVEA 4MNHA 15C8H 2BHYA 2R4RH 3BP6B 1H5BB 2R2EB 4ZFOL 3MV7D 4YFEA 3BZDA 5LWYL 5DT1L 5F6IC 3IF1B 2Q8BL 5FYJE 1VKXB 3GKWL 4I8DA 3RTQB 3S35H 1YPZA 3PUCA 2Z35A 2VLKE 4OBSA 4RFOL 1IAIL 3HPJB 4G9FD 5KVMC 3W39B 3G9AB 3VXUA 3TLRA 5BV7H 4WCYL 4ZOAA 4IRJC 3F8UB 3EOYG 2VXUL 4PJIE 3BDXA 4K3JL 3RBGA 1AR1C 1D5XB 4Y2OA 3SPVB 4PY7B 4UNTA 5B8CB 2F8VA 2B4CH 1EPFA 5IROC 4X4XA 4JRXD 4LLVB 4LLQB 4CVZB 3PHOB 4MYWB 4Z9KB 3QHFH 4P2QA 4WFGE 1J1PH 4IDJH 4UDUB 1E4XI 2CO7B 2HRLA 4D9LL 4QHLA 4N1EA 4JQIL 4ELMA 4P59L 4XNMB 4ONFL 4OM0L 3VD5A 2FO4B 3O41B 1U58A 2JE8A 2XN9E 5EU5B 4PJFF 4OF5A 4YZFF 4GBXA 4OT1L 4QTHA 4RA0C 3TBWA 4XGZA 4TSBH 3QDJA 3QWQB 5KG9A 1R6VA 3IDMA 1NUFA 3OF6A 3U7AA 3RJQB 4RA3A 4NQCA 4TTDC 5FM4A 2VIRA 1YC8A 3ZKQD 3DPBA 1FO0B 5FKPA 3FT3B 4AM0A 3GI9L 4JLRA 1S7UA 2AJVL 1EGJA 3KPOB 1X5AA 3BXNA 4G43B 1I7ZB 3N1GC 1N2RB 4Z0BL 3WO4C 3HZMB 5I75C 4XT1C 4JFDB 5D2LF 5EOTB 2DBLH 1RUAH 4DCQA 4YGVA 4UIMB 4Y2DA 5C0RL 4YO0A 2WQRA 4YHPB 3EOBA 3C9NA 1WAAF 2CDGA 4U7MA 4FABH 1FG2A 2A6DB 3QZWA 5FFLA 1ETZA 4D0DA 5HJ3A 4K7FA 1KLGA 4CU8A 5CS7A 1EX0A 3EO1A 1RK0B 2IMMA 3STZB 4HHAB 4TYUA 5D9SA 5FGCB 3TWCL 4Y19E 4OLVH 1WBYB 5ITFB 3FQWB 5E8NB 3RX8A 1IAKB 4TSCL 1A7NH 2NY0D 1RZFH 3KG5A 1DZBA 4V1DB 3IDNB 5D1QB 4KMLB 5C9KA 2FATL 2RIKA 1K2DB 4JZNA 3MOQA 1OAUL 1NAMH 5E2TH 1RUKL 4LSQL 4PJGA 1J8HB 4K7PY 6FABH 5DD0L 1LK2A 3AC0A 5F9AC 4IS6A 1TZHB 3O4LE 4KAQH 1NPUA 2WBJD 5DMGC 3GEWB 4N0FB 4Y0GA 4KHXL 4P4RB 1RPQA 1V3LA 3SCMC 1WUNT 1QFPA 4S1RH 2DQUH 1U8KA 3ULSB 2ZG1A 3LKQA 3RIAK 1GGTA 2AJSH 4MNQD 3ROLA 1A7RL 4IOIB 5D7LE 3VFUB 2EKSB 4FZ8L 1GC1H 5FA3B 1KENL 5ERWB 1IT9H 3MRRB 1W0VB 3MNVB 1I85C 4H25B 1OP3K 3P9WB 5ITBL 4BQCA 3GK8H 3IDJB 5EU6B 1ZE3C 4FXGB 5MEND 3UYOD 5CZKA 3OKOB 4YBLC 4ZFOA 2BVUA 3T3MF 4XVJL 4NRZA 4HPYH 3GIZH 5ICYB 4NWUL 1P1ZA 4M5ZH 1N64H 1RUQL 5ETUB 1S9XB 4PB9H 3TM6A 1I7UA 3OKLA 1ZWIA 4HKXB 1T1ZB 1JFQH 3RUGE 3FQUB 4G7YH 1KOAA 3JV4A 3Q6FB 4R8WL 1V7MH 2FJFB 1YN7A 3OAUL 4LNRA 5KVGL 1RZJL 4KRLB 4AIZB 4TVPD 4KRMB 3BHBB 1YC7A 2OLDA 4YPGB 3DOSA 1IL1B 4PLJD 4NNYB 3Q6GL 1M7DA 4WO4C 1LEIB 4V2BA 5KSVA 5BS0D 5LWYH 4JPIA 3VWKB 5EZJA 3WNMA 1AQDA 2A6IA 4QXWA 2VN4A 2Y7QA 1IAMA 1U95A 2WM0A 4RFOH 5I1CH 1MRFL 4P4KA 4LPVA 5JW5B 1Q1JL 2HLAA 3QNYB 2BSTA 2EXWD 4H0GA 1OAZH 4KKBC 4WCYH 5FM8A 3P4MA 2HFFA 1B3JA 3QHZL 2XZQL 4MJIB 4Z6AT 4R96A 2NLJA 4RGNB 1MCSA 4ZSOA 5DJYA 1N5AA 4LLMB 3SE9L 1RHHB 4Z77A 1JF1A 5AAMA 1CICB 5E7FA 3WKNA 3IVKB 2BCKB 2F5BL 3RWFB 5C0FA 3SKNA 5E9DD 2VDRL 2WSKA 5F96L 4DZBB 4X99A 3GBNH 4KK9D 4ZOEA 3V6BR 4XNZC 2G5BA 4JVUA 3T77B 2XZAH 4JQIH 4P59H 3HE6B 3QQ9C 4ONFH 4OM0H 4KROC 5C0DA 4XZUA 5CHNA 5JQ6L 2R29H 1ZHBA 5EUKA 4ETYA 2ATPB 5IHUL 2VAAA 3B3IB 4OI9A 4AEHL 1TQBC 1ZAGA 1A6AA 4WEMB 1AI1H 2VDNH 1L0XA 4BH7B 5JOPE 3QEQB 3RFZC 5AUMB 1F4YL 2N56A 3HI5L 4RMUA 2RCSL 3O3AB 1E4KC 4PJXB 4R6UA 1X5XA 4W4NA 1HKLH 2NX5D 2JK5B 4PRAB 3CIQA 2HT2C 1I1AC 2GJZA 1FORL 1MCJA 1CGXA 3DX6B 2AJVH 4P57A 5CWSB 1ORQA 2R69L 2P8PA 3QEHB 4G5ZL 4IRJA 1BD2A 2MKLC 4X98B 1ZGLM 3O11A 3VFWB 2IQAB 3SDYH 5C0RH 3C5JB 2FECI 4J3XA 4I0PD 1FN4A 4Z78B 4JZOB 1OB1A 1DUZA 3QA3A 5HHPA 2C1PA 3P9LA 2WANA 2GTZA 2Q76B 2ZPKL 2VOTA 3N85L 4BZ2H 1WVZA 4E41B 3GMLA 1N3NB 2CD0A 1OQOA 3C5SB 1TJGL 5I0ZA 1ZHNB 2ZCHL 1JPGB 5TDPB 3ZKMC 2YA1A 2EIZA 1CD8A 4TSCH 1ADQL 2X4TB 1D5MB 5I18L 3V79C 1LO4L 3DURB 2CRZA 4P48A 4UINH 3JXAA 3RX5A 1OLZA 4PRNA 2KL6A 2VAJA 1OP3H 4L8CB 2YWYA 1UEMA 1RUKH 1UCTA 4HAGA 1T4KA 5DJ0A 3RKDC 2RAMA 5DD0H 5IP4A 1EEYB 1HSBA 2C3HA 3HCVB 1MI5E 3IDXH 1CFVL 5E6IB 4N68A 4OKVA 3IDYC 1FFOB 4FFYH 1ONQA 3VXQA 4X80L 5I2IB 1KPRA 2YA0A 2NNAB 4NQDB 4G6ML 3BJLA 2DL9A 1VDGA 1C16A 1NFDB 4IMKC 1IAII 4Q97A 1W8OA 5LBSL 5EWIH 1T6VN 2IPUK 4LMQE 1G7QA 5JPMB 3T1WA 2PETA 1XGTA 4POZD 1PY9A 1IC1A 4BKLA 1GAFL 3T0XA 1S8DB 3MRFA 1AXTH 4KI5D 1DBAL 3HG1A 4FOMA 5CBAA 4XVJH 4YFLF 3QBTB 3T04D 3WUWA 3D87B 2ED8A 2ENYA 4TOYL 3GBML 2R2CA 4NUGL 2EDXA 2FGWH 1RUQH 2QSCL 5H94B 3KLHC 3TESA 2NXZD 1HZHL 1EXUA 5F8RC 1JNHA 1OT2A 4HKJA 2OI9C 3MRQB 2F53B 5EB9A 5F9OH 1EA9C 3PV7A 4ODBD 3ULVF 4X6CB 1ZLVK 2CMRH 1KULA 3QIUA 3VXOB 4DW2L 1U8MB 2E7LC 2DDQL 1MPAL 5GRUH 4X5WB 5JW3L 3NPSB 3SCMA 3GMRB 3QI9B 4ZD3L 3MLWH 1K4DB 4LSPH 4OI7A 3Q6GH 3ARDC 1E27A 4JFDD 5MEPA 3IGAB 5I76A 3QQNA 2X1WL 1YJDL 5TF0A 4ZTPH 4NO0B 1K4CA 4MAUL 1FV1B 9CGTA 2LFGA 2LAGB 2CSPA 5LGJB 2B1AL 4HBCL 1MRFH 1Y0LA 2KBGA 5D1XB 3QUYD 4YDVB 4QT5A 1T2QH 2OQJA 2XZQH 1X5GA 5F89B 5AYUL 3ZDXF 5CEYA 4ONHB 3THML 1KJVA 2H32B 4E42B 1KN4L 4L3EE 1MJ8H 3B9AA 4XP1L 3T4YB 2F5BH 3D1MC 1U8QA 3PWPA 1MCWM 5D1QD 3OB0H 1DL7L 2VDRH 3DV6B 3GSXB 3LHPL 5F96H 4S2SA 2HKFL 1Z9LA 2VITA 4QGTA 4GAGH 5H2BA 3S5LA 3VWJC 5IT2L 4NNPL 3DGGB 3U4BH 3RI5F 5JQ6H 3DXAB 2AEQL 4HLZG 5HGAB 3FN3A 1DBJH 4R2GD 4F7CB 1JZ6A 1HH9B 1L0YA 1K5NB 1RMFL 3QULA 1F4YH 3QUXB 3CX5K 1FFNA 2RCSH 1EHNA 5J3HD 4PRHA 4MVBD 3VD9A 3P4OB 4N1HB 3HAEH 4B53A 1NCUA 1FSKB 4I18A 2Y5TB 5FYJU 1P9MC 4DUWA 1ADQA 5IVZB 1FORH 4G8FB 2YPVL 4DTGL 2MMXA 5T3XH 1AD0A 2R69H 5D1ZD 1H3PH 2MWCA 5I30H 3DYPA 3I6GB 1SJXA 5JA9A 4OCWH 3MCLL 3ISWA 3NCCB 4J23A 3BMWA 2EDDA 3VXSE 5F9WB 2OP4L 3OTTA 4PJAA 4YWGL 4PJBA 2EYRA 1UKQA 3WJJA 4PJ7B 4RWHA 3FQNB 3LKNB 3DRQA 2ZPKH 4FMKA 5KSBE 3GGWA 2KDGA 1JWUB 1UH4A 4WWKA 3BH8B 1DEDA 1KV3A 1HHGA 1J86A 3HNSL 1ZK9A 3PNWA 5BJTB 3QXDA 4IRSC 2R0ZL 5D7JD 1HDMA 32C2B 5EU3A 4OLUL 5GSRB 4JVPA 5CEXA 5HDOA 1J0ZA 1D9KD 1XCQA 2JB6A 5I18H 5DUBA 4FQQB 3B9KC 4PGDB 5HHMD 5CIPA 1E4KA 1CGUA 5FCUL 4GRLB 2VWEE 4M7ZB 4ZAKB 5T5NG 3KWWA 5BXFB 2VZSA 4PP2A 5DJ2B 1Q94B 3TA3A 1N7ML 4I2XA 3OBAA 4OZ4B 1CFVH 1T0PB 1U8IB 2QTEA 3AREC 2ATKB 3Q3GA 2ZKHL 3SGKC 1CLOH 2WBWB 3H9ZA 4R3SA 1IQDB 1WLHA 3GZKA 3WEXB 2LABA 2HG5A 4P2OD 4L8BB 4WRLA 5DVOA 4M1GH 3DVGB 1P6AB 4MJID 3U36B 1SY6L 3ULUE 1U8PB 4YJZL 3VA6A 5DK2B 5BZDA 1PYWA 3HMWL 1ZLVH 3FB7A 3DYOA 2VXSL 4KV5F 4OD3L 2DYPD 5J12B 3D3VA 5MEQB 1T7ZA 2YC1B 3A6BL 5JOFB 4KZEH 5C08B 1XF3B 5FXCH 5CIPH 3LSOA 3CFBA 1DBAH 4Q9QL 2HVKA 5DZNA 4CL7A 2Z0BA 5AG8A 5C0CA 4ODHH 2AK4B 2BSRA 3P4LA 4JJ5A 5BVJA 5GGRA 1J18A 4CVXB 3SJVB 1HZHH 3ILQC 5GJSL 1DEEB 4TUJB 4Z7VA 4NBYB