4XOAA

Crystal structure of a fimh*dsg complex from e.coli k12 in space group p1
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
279
structure length
279
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords FimG
publication title Catch-bond mechanism of the bacterial adhesin FimH.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 53
structure length 279
sequence length 279
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00419 Fimbrial Fimbrial protein
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4xoaA01
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4xoaA02
4J3OF 3BFQG 3ZL2A 3SQBB 4X50A 5CGBA 2JMRA 2WMPB 3ZPDA 3BFWA 4AUUA 2VCOA 5FS5A 5ABZA 2J2ZB 4CA4A 5IQMA 4AVHA 2W07B 1KLFB 4J3OH 4ATTA 1TR7A 3ZL1A 5FLUA 4AUJA 4XOBA 1UWFA 4AV5A 4J3OG 5AB1A 4AVKA 2JTYA 1PDKB 4X5RA 4BUQA 3ME0B 4AUYA 1ZE3H 5IQOA 4X5QA 4X5PA 3RFZA 5AALA 4AV0A 4AVIA 3MCYA 2XG4B 5F2FA 3JWNE 4XO8A 4XOCA 3BWUF 4XODA 3JWNH 1N0LB 4CSSA 5IQNA 4LOVA 1KIUB 4AVJA 3JWNG 4XOEA 2UY6B 5FWRA 5FX3A 4XO9A 5LNGA 4AV4A 5AAPA 4XOAA 2UY7B 5JQIB 4CSTA 1N12A 1QUNB 2XG5B 5F3FA 5LNEA
chains in the Genus database with same CATH superfamily
2YQBA 1Q72L 1LTXA 1LNUB 3TA3D 2AEIT 2OL3A 4K9JA 3UYOD 4U7KA 4AQ1B 1H9DA 2Z34A 2JMRA 3OMIB 4OGZA 2V7NB 5C6WH 2IH9A 4PJGB 4O00A 4OB5L 3VTTA 2K0RA 4ODHL 4NERA 2Y2WA 1QEXA 1U33A 2AAAA 4M6OH 3TX4A 4DAGH 4M43H 2WUCH 1FH2A 3ZOAA 4GMSL 3MV8A 3IDJA 4JZJA 4CBZA 2OJEB 1TZHA 5GPRA 3FTYA 7PAZA 1OXYA 5GHWL 3V6FA 3GJFB 3VRLF 3WSQL 2B9AA 4TS6A 4XPBH 2ZOWA 1J8HD 1QSEE 1MHCB 2L8AA 1OGTB 3BH8A 4EI5A 3EH4B 5TE4H 3CSPA 3NJXA 1IKFL 2OMUA 1CZ8H 3T6WA 5CCKL 1IFHH 2HG5B 3BC9A 3ROLB 5ECJE 3PUUA 3SO3C 1H3PL 4XWOC 2X4PB 1WT5A 3UJTL 4ZSOB 3TURA 1RP8A 1OPGL 4Y7MA 5EMYA 5BJTA 4WI5A 4P5SA 1GCFA 1ET7A 1RULL 2Y5EA 3R18A 3O4OB 2OL3H 4MWFB 3S36L 2JSFA 3WHE1 3MLZL 3BZEB 3BKCL 1EGJA 1UB6A 5C9JB 2BZDA 3TVMD 1YN6B 4EIGB 4LLUB 2ZTBA 3NP4A 2BO0A 1PEWA 4MSWA 1IAOB 4L4TA 3MCYA 2YJLA 1G7HA 3US0A 1ZVSA 2R51A 1IGYB 1JE6A 2VB5A 3DJZA 3BQUD 1P6WA 2YEZA 2YAMA 4XGZA 5F97E 4XOCA 3HPLA 3QG6A 1RK0A 5TH2B 5F70A 1JPSH 1T2XA 4YPGB 4LCWE 2HRLA 3C6LB 2LAGB 4LLDA 3UTTA 2Y25A 4ZMYA 3PWNA 4RMVA 5HTSA 4XI5D 3FRUB 3C5SB 1EAQA 3NN8B 1WFNA 4WHYH 3G3LA 3SIKA 4D8PB 4FJZA 1OP3H 3GXDA 1TNNA 4W9ZA 4RAUB 1ET5A 2A77L 3M17A 1T1ZA 4RISH 3LRSA 2BIMA 4LVNC 4J28A 1EXUB 4ZTOH 3PXHA 2DWTA 5FYJH 1MCSA 3LQAH 4IRSD 1D5IH 2XI9A 2R0ZH 4JFQB 4HLJA 3D87B 1JV2A 2VW7A 3BPCB 4IIQC 3BAWA 5DJ8B 1NBVL 2XBTA 3TN0C 3V0DA 2E9BA 4X5WB 1IQWH 1N5YH 3P0GB 4OLWL 1EGJH 4QTHA 4JPVH 1RUQH 2BWIA 2V3FA 3A0OA 3C5JA 3DETC 3GBMH 5IHLB 5EBLA 4ADIA 5JHDD 3MLWH 2WXIA 5J6HB 1GJUA 3DX4A 5DUBB 5AVXB 5DEJA 1RPUA 1JDCA 1IILE 2C9XA 2R39A 3PE9A 4B3VA 5ID0B 2CPCA 2A6DA 1CGUA 2B39A 3DX7A 5IROC 4N26A 2VN6A 9PCYA 4OBRA 5FA4A 1KEGH 2VRQA 4M3HA 4Z7AA 4ZUUA 1BPLB 4L9LC 5JW3L 5KAQG 3LKPB 4U1LA 3H3PL 4PSPA 4YWGH 3WSQH 3ZPDA 3VFGL 4NM4H 5IB3B 2CUMA 1FGNL 5B7MA 3FF7A 3TO2B 3C9NA 3EYFA 1GZPA 1FCGA 5I75B 2BOBB 1A7OH 1KEMH 2GSIA 3DUUA 4XXWA 1ECYA 5D6CB 2AJVH 5T3ZD 1A5FL 1L0QA 1AGBA 2O5YL 1WAAA 2GKIA 2NYYD 2BY2A 2HH0L 1FBIH 3QZPA 5F88B 2ENSA 3QYNA 2VDNB 1Z1WA 3S36H 2MFNA 2ZYSA 2IG2H 3MLZH 4CVWA 4YDIH 1J86A 4CUCA 1RFDL 4P2RA 1JZHA 3HFMH 2FUTA 4W9EC 1U8LB 1R3JA 3HC3H 5IT2H 2XQ0A 1HQ4B 4NC1E 4W1TA 3NSJA 4Y4HA 3SOTA 4DHLA 1QQDB 3EZJB 2FJUB 3VI3A 1GH7A 3ARFA 4I0PC 2D03L 3FQWA 3QZWB 3DJ9A 4LEEA 4RDQG 1OPOA 2GFBA 2COQA 2AMGA 3FF8A 1EQWA 3OGCB 4N9OB 5F6IB 5JOEA 3EHBD 5D7KD 4OGAC 2CUAA 5JXEA 1KOAA 3NIFB 5BV7B 1CICD 2ODHA 3CNKA 4UQEA 3CFKB 1HHHA 3L2LA 4UQ3A 5C08A 4HMCA 3S48A 3FSAA 5CEZL 4KK5C 4RGNB 2CM6A 2OZNA 3IU4H 2A6JB 3DV6A 3B9DA 2WC7A 4HJUA 4OLWH 3QORB 2Q3XA 4P9HH 2OCJA 4HCRL 5TDPA 1HOEA 1S9WB 2YO3A 1NMBL 3IJHA 3HG0A 3M8OH 3BJLA 4KOBA 5EZLA 4P2OC 1XCTA 3UO8B 1Q8MA 4XP9L 1BD2E 4GQ9L 5KSBF 3QUMH 1H8NA 5DJ6B 5HPMA 3UPCA 3V0FA 3QR1A 3S3CB 2W0KA 2Z7UA 1ZTXH 2Y1AA 2VR5A 4Z95L 3N1PC 4OTXL 4GOSA 4HVBA 4FFVD 1EXGA 2F58L 4I9WE 1FGNH 3QYCA 5F3FA 4JDZA 1JHLL 1UHVA 4ALAC 5D70L 2PXYA 1VDGA 3S3JA 3BDBA 1S46A 4OLUH 4X8JB 1LDSA 2A7BA 5KOVC 1I1FA 3FT1A 4Y5YC 2O5YH 2E56A 3NEXA 4B97A 4HYTB 4U1NA 2VWEE 4DJMA 3HKFA 5FYLH 3U82B 1KV3A 4LCIL 4JHBA 3WGVB 3P11L 1CFNB 5E03A 3MJ7A 3MV9D 3ECBA 1FV1A 3OKMA 5JLZA 4L3ED 3JWOL 4HJSA 5C1MB 8FABA 5KTEH 2LV4A 1G7IB 3F3HA 3IJYB 5JIHA 5FA3A 2NTSP 3ULUC 2ZUWA 4U0QB 2ICES 3VWKB 4HJGA 5D2LB 4Z0BH 5HYJD 3P73A 4YHIA 4QYOB 2V7NA 3KYNB 4PJGA 1PIFA 3QGVA 3ILEA 4OZHB 1X5YA 2ZP8A 4JR9L 5HGDB 1WV7T 3O0RL 1WUZA 4PJBA 2CA4A 5AKVA 5GRZA 3MREA 3BIBX 3RGVA 1H15A 3APFA 3B5HA 1UM4L 4Y19D 4ZO7A 3Q6GL 4BWWA 1URIA 3HC2A 4G72B 5HYQA 4UM8B 1MCJA 1MPAL 1OGTA 1HYRC 1ZGLM 4LARL 3SQBA 1J0IA 1Z5YD 5BMFH 5KJ7E 2HVJB 2R27A 5CEZH 4YO0A 1T20A 1KTDA 4LL1A 1T4WA 1N0XH 1XGZA 4PJ8D 3N1QC 4UQAA 3NVQA 2VXVH 5J1AA 4WV1B 5LN4A 3LNHA 4UMGA 5DD1L 1EFXD 2I25N 4LMQI 3K2UH 4MWFA 5CBAA 2G30A 2BXZA 5F1SA 5E99H 3BZEA 5I1EH 4S1QH 1E4WL 1PPIA 3QI9C 1AKJB 3HKZA 3A67L 1JZDC 3NCMA 1IAOA 4OT1H 5CU5A 5KAQF 2Q3ZA 3IDGB 3QG7H 2ITFA 5JPNA 3X13B 3VWJC 4OTXH 4FNTA 3WIIH 1KUMA 2G2NA 5TH2A 3R4DA 2F58H 4PRIA 3ARZA 4YPGA 3H7BB 2QSCH 4ODVL 4DKTA 1CWVA 4LDCA 4NDMB 1JPFB 3B2UC 2DF3A 3Q9QA 5F7EL 4X9YA 2XWJB 1DANT 2WBKA 4R96B 3P4LA 1N8OE 5IR1A 5D7JD 2WOYA 4FYSA 4XVUC 3RX8A 1MFNA 1NCGA 1Q9WB 3S37L 5T33L 3P11H 5AKSA 1XIWB 4HKBB 4XPGL 4MCMA 3SDXE 3UL4A 2CKNA 4YVNA 3EO9L 3S34H 3RNKA 2CZNA 3JWOH 4OM0H 3ES6A 1QI5A 1NDGB 3K6OA 3NT0A 5F3HA 3EGSB 2VDNL 1ZA6A 3RTLA 2BNRA 3PGFL 3LXAA 3MOAL 4H88L 3U9UB 4XN2A 4GW1B 2V3EA 3WTUA 4NZTH 4FG6C 4NLAA 1M9SA 2ZOOA 4ZX5A 3U7AA 4UAOB 5J6HA 2J4WL 2FHCA 5DUBA 2F54D 2KDGA 2YJQA 4B96A 4ZMWA 1P7QB 4JY6A 5ID0A 3AJ7A 2A99A 5DO8A 3ZVVA 1UM5L 3A6BL 4RDQF 4F92B 1SDDA 4JR9H 3AZUA 3M1OA 3KPOA 4YZWA 3SD2A 1KYUA 2X42A 1J48A 3EDDA 4UNUA 3W81A 5HHMB 3Q6GH 5IB3A 5IF0A 1U8IA 2EYTB 3BP4B 3TO2A 3VYNA 3ZDYE 4LARH 1FE8L 3GJFK 5HDBB 1RIVH 1C5CL 3ESPA 5DVNA 5IP4A 2CHXA 2NY1C 1M71B 1KACB 5D6CA 4EN3D 1S7VA 5IJVB 2TRHA 5F88A 2OTWA 5DF0A 3UFIA 4A2GA 4FZ8L 2J3SA 3NK3A 3NFPB 2O6CA 5HHNB 5AFAA 3DVIA 3U30B 5B39B 1JGDA 2NYKA 1E4WH 2UVEA 5EG6C 3V8OA 3WEAA 2FLBT 2IWKA 2H0EA 3M6DA 2I69A 1X4YA 2BVEA 1Q0YL 1PD1A 4LVHC 3SKNB 5I5JA 5LGHL 5DUJA 1BXVA 2B5IC 5D7LA 3S3DB 3BAYA 2NR6A 1YJDH 2GTZB 4BA0A 3C08L 4ODVH 4QXUH 1D5BB 2BSRA 3NH7H 4LCYA 3RWDB 4KXCA 4KWUA 4LSQL 4XCCH 2WLIA 3FMGH 5ESQA 3P3TA 4AC4A 5KVGL 2XACC 2F8VA 1CLZL 3F7KA 3W11C 3AM8C 4OIAA 4PB0H 1P1ZB 4TUKH 4XHJC 2BSTA 2NY2D 4O2CA 4LLYA 3OHXA 1JYXA 3PQYE 4B5EA 1GIGH 1V7NL 4HJ0C 3G6AA 2BVYA 3O6KL 4ANVA 4OF7A 3CVBA 1MHPH 3RTQC 3EO9H 1VGKA 2PCFA 3NCJL 1IE5A 5IEHB 4W93A 2OYKA 1E5YA 3L81A 1DVZA 5FEBA 4Y1TA 2VKXA 2C9AA 4QCIB 5DDHB 4BGLA 3QISA 4UMSA 2W60A 4KKZA 4WFFD 3PGFH 1ERNA 5DD0L 1T21A 2ZOKB 3UJJL 2MSPA 3MRFB 5DHYB 4FFWC 1ICTA 5IMMA 4N0YL 5K33A 4ZW8A 4NIKB 3V0GA 2ZKMX 1S2EA 3S98A 2VISB 1KGJA 3DROB 3IPFA 3TZVA 4M5SA 1FSKC 5C0CD 4Z7NE 1OP4A 4UM9B 2FJFB 1Q9KA 3RIFK 2GI7A 3A6BH 1NCWL 5CGBA 3VCLB 1T89C 4WI7A 3VXRE 1MCEA 3OKLA 4JZOB 3BSZL 1G7LA 3UTSB 3Q5TA 1A47A 2VCOA 4XN4A 4NQUA 5DO2C 5IREA 4WY7H 5DEFB 4O02A 5HDRA 1ZPUA 4YH6A 4M93B 3MLVL 4F8TA 3B9KC 2EDMA 3NSFA 4OCNC 4QR7A 5FKPB 2ARWA 3VYPA 4NO2B 4NENB 2CO6B 3ZDZE 1QFWI 1MCOH 2RMNA 1T83C 5FO2A 4FFYL 4KVNL 3UTTE 4AW7A 3V79C 3QCTL 1XGYH 3PP4H 1W72B 4HIIA 1UA7A 2LVEA 1L7IL 3EZ8A 5ITFB 3KYOB 1LO4L 32C2A 4DKFH 4IYKA 1TJGL 2X2JA 2CO7A 3NJVA 4PGCA 1H3WM 4YVUA 4D3CL 1JNJA 2OQJA 1NFDA 3S3SA 3KNBB 3RZCB 5C6TL 3G7TA 2EVGA 5K9KA 1G6VK 4N87A 4DP1X 3LKOB 4QI3A 3VWKA 3S8WA 4NSKB 3WEMA 3K6FA 1IT9H 4TRPH 2FO1A 1SBBA 4W4OC 2UZIH 2YXFA 3CQFA 4CKVX 1PD6A 2PW1B 3WUWG 1AY1H 4DKAA 3U9WA 4MHHG 1R24A 4ZS7H 2AQRA 2UXTA 4O02H 2GITB 5EUOB 5B7EA 3WLWC 3MNVB 3HOGA 5FYKL 2R29A 5AZEL 1B0GB 1VEPA 5DUPL 4WIQA 2EO9A 5I6NA 2O1AA 4EKJA 1FRGH 2OTPA 5HGAA 4PP1D 3G5ZB 3MLSH 3MR9A 1SXBA 1N59B 3BDYH 1MVYA 5KBKA 2HVJA 3KLAA 5HHVH 4BHUA 1LWHA 4UBDD 1BFVH 3MRKB 2ZOUA 3UTQA 4ZYKB 3UJJH 5HVWA 3H53A 4PWIA 3FU9A 3ZT7A 3D3VE 4N0YH 4YHKL 3CFUA 4F2FA 1TTAA 5LGYA 1JUFB 1MW2A 3BP6B 2YUXA 3PL6D 4MA1B 1WZLA 3PAUA 5IVXB 4GAJL 1YMHB 4F9PA 1TFHA 1UZ8B 1KIPB 2EDRA 3IDGA 1CICB 4UNVA 1DQDL 1AZVA 2XWXA 2PTUA 3P3YA 5GS1C 2XVLA 4E9WA 3D2UB 3X13A 3HE7A 1IIKA 2IANA 4G42A 2KT6A 3JVGC 3AT0A 4NPKA 1AXSA 5SWSA 4DZ8A 2R29H 3MLVH 2YD7A 5HVHB 1A6WH 4J6RL 4G6AD 3H6AA 3GMLB 1CDCA 1FLRL 1FH5H 1DVFB 3INUH 3V6OC 2DTMH 4TM9A 3ZSTA 1CDBA 2OV0A 1C08A 2MQGA 4NI6A 4H8WC 5EBGA 1XB8A 4ZUWA 1WAPA 1O6SA 1E8XA 4AYEC 2GK0A 1QD0A 1Q9WA 5LGJA 3QNYA 2J2ZB 1W9XA 3DGCR 2BMKB 4HKBA 2WO3B 4LHUA 1TJGH 1VZIA 2JI1A 3BUIA 4NUMA 1AS6A 1WD8A 1AP2B 2PO6A 4NZ8A 3EKCA 4QXGH 2HX7A 2XN9B 3ZN6A 1I82A 1KTJA 2NQ3A 5E5MB 2R23B 4LQFL 4F33A 3UAAA 4U1GB 2MCPL 3ZX1A 1U21A 3Q8EA 5EZIH 2VERN 5C08E 5SWZA 2HT2D 1JGVH 4Q0XL 3BD5A 3MRCB 3U9PH 3VXUA 2R56L 4Y9BA 2GIYA 3KVQA 2XYBA 1MVUB 3FO9A 1HVXA 4P4KC 1TLKA 5B38B 1AH1A 1B0RB 5AD0B 1KCRL 5I73B 1UXSB 2DY2A 5AZEH 3MV9B 1RHFA 3CFDB 4Y2NA 3VJ6B 1SF3A 2VH5H 4WSKA 1DJSA 4C47A 1PY9A 3S36X 3DYPA 5D7IE 3JSSA 1JYNA 2JFCA 3B8SA 3TA3A 1PX3A 1VADA 5D8JL 3P0VH 4LCUA 3U7YL 3O81A 4XWOD 3UAJD 4M5TA 1M71A 4ZX3A 2XJLA 5EIVA 2JKJA 1I7UB 5EU3B 1BDYA 5C07E 4YGVA 3CFBB 3BN9C 5IJVA 1J8SA 3VH8B 5A16B 1U3HC 3C60C 4GH7B 2OX5B 5AAMA 1R3HA 5AOLA 2FWSA 1I31A 3FCTB 3WL9B 1U8MB 2FGZA 4YHOL 5HPOA 3LZPA 4K8RH 2PCPA 4JFZL 4P57B 4GSXA 2I07B 2YMTA 5CEZE 3EYSL 3POHA 4MCNA 1XGTB 1J8HA 2R2HA 3MJWA 1YNKL 3GMQB 1DQDH 2A9NL 4KUCD 5DJYB 1AHWA 4JDEB 2EDTA 1LWJA 1GYVA 2XFXA 4C4KT 1E5AA 4PRDB 3AAZA 4NKOB 2WZPD 1CXHA 1RZ7L 4LU5H 3WNKA 5IG7A 2I26N 2ZYIA 1BEXA 3I02B 1V05A 3G04B 4KMTH 1MAML 3S5YA 4BFOA 5MENB 4XPFL 4A68A 4F7CA 1YYMH 4PJGE 2E4FA 4LHQB 1J1PL 3KBFA 1I1AD 4JM0A 2WJ5A 4JUSA 2WCSA 3TVMA 1R1CA 2AJXL 3OJ2C 1KB5A 4BZ1L 4HS3B 4C4KO 2CJ3A 1FL6B 3NRFA 3BQUA 5AWNL 2WXGA 1W72L 4NAMA 1F90L 5I76A 5IEHA 1HZKA 1NGXB 4WO0A 3DLQR 3W3BA 3V95A 4Y9EA 1EAJA 3DETD 4GKZA 3RVVC 5I30L 2A3TA 4KJPC 3RILA 4WW1B 1C12A 5DHYA 3BKJH 5DU7A 4HIEA 3DROA 3QJHB 3O6ML 1NA8A 5IROD 3DI2B 4NN6B 4ZSOE 5D7JB 2VYRE 1A7PH 2P8LB 4PJAF 1UG9A 5CINL 4MMXC 2X10A 4IRSA 2HWZL 1FO0A 1IBBA 3UZVA 3O2VL 2VXTH 2R1YB 4OZIB 1WITA 4A6YH 1BQHG 1A4KB 1KBGH 2CDEB 2G75B 2OMXA 4N0UB 4NO3B 4AITA 4Y4FC 3VD7A 1NM4A 2P3YA 3BPOC 3D4CA 2EE6A 3IEAA 5FKPA 3S4SG 2GTQA 3WFDL 1JNHA 3VM5A 4NENA 5GJTL 1I85A 1KB5H 2CO6A 3MUY1 4MBOA 4ZTPH 4FA6A 3RWHB 3VXQA 5JHDA 5LUMA 2OAAA 4N8CL 2Y7QB 2BHYA 2MOQA 2XTJD 3IJ9A 3K7UA 3KYKL 5KG9B 1E65A 5IM7B 1W72A 4JEGB 3SGDH 4GW4A 1UZ6E 4DP4X 5DEGB 3T8XB 5BZDB 2DAVA 4MA7H 4JFZH 1I9JL 4BK4A 4FL4B 5J7CC 2Y7OA 3AT8A 3LKQA 1HH9B 1OV8A 5F9WC 1SHSA 5EU4B 3LKOA 3ZKXB 2KZWA 4TLUA 3QWOB 4A04A 4MCZB 4I0PD 5D1QC 4UILH 4L2LA 3BZ4B 4LSRL 1FO0H 4I3GA 2PW1A 2QQLH 1ZV2A 1F3RB 1R0AH 1RP9A 1MAMH 1OCWL 4AYBA 7CGTA 4YEEA 3TFKC 1PY0A 4JY4B 1LD9A 5T1LD 1OCRB 5EUOA 1J1PH 1N7ML 3ROOB 4OGAD 4NNPL 4ONFL 2EIZB 4E9VA 4WF7A 3L3OA 2AJXH 3ALXA 2CBMA 3L54A 1IC0A 1CFMA 3G5ZA 5DD5H 1PFCA 4X0KB 1W72H 2FECI 2LU5A 2E9WA 4J3WA 1T2JA 2EDOA 2XV3A 2FX7L 2DKUA 4NRXB 4NQXA 5F1IB 5J56B 2H2PC 15C8L 4OLEA 3U46B 3IE9A 1PKQB 3WHXA 1II4E 3EOTH 3RJOA 4P2OD 3HCVB 5AW5B 1FFNB 4F5CA 3GXFA 1ESOA 2DKMA 3WXWL 1ILSA 2Z31C 3BP6A 4XB7A 3L1FA 4ICWA 2GTWA 4IK6A 2PWEA 3DX6B 3BUDA 3MI6A 5CINH 3WE6A 4TSAH 5D7SH 1KIPA 3BFWA 4LP5A 4YN3A 1AGDA 5T3ZH 1CICA 2YBGA 2E27L 3I6LD 2Y7MA 3O2VH 4PJEA 4X2UA 4DP6X 3LS4L 2B08A 1WFJA 1YHPA 5DMIL 3WN5B 4PWHA 4P04A 4Y4KC 3TBVB 3RI5F 1M05A 3MJ6A 4X6BA 2CDFA 2NY5L 4LAJH 1KFAL 2AAVA 3WIFA 1IC7H 3VFPB 4PWKA 5E2WL 3CH8A 2JJSA 4AJVA 3KYKH 4W68A 3NCCB 3T3MF 1Y18A 4KC3B 4YFDB 1IFRA 4KITB 2NY7L 1BM3H 1RL1A 4GIAA 4Z76A 3TEXA 1WFMA 3IETB 1SEBB 1YPZF 5CEYA 3WFEL 1A64A 3N42B 1CE6A 4QY8B 3ULUD 5L2KB 4HP5A 2HSIA 4U6XB 1MSPA 4L18A 3JTTA 3CVCA 2V37A 1PNCA 1JTOA 4RGNE 1IBZA 4PJHF 4HWZA 1JFQL 2E7HA 2HUHA 4ZXBC 4EUPG 3SDCC 2VLLB 1B0RA 1IAKB 2NXYB 4YE0A 2YGNA 2QR0A 4N4YB 1OCWH 3CZSA 2XXMB 5C0NC 2AV1B 4Y5XC 5K59F 5B1CA 6FABH 1O6TA 4LK4A 5I1GL 3MV9A 3OKDB 2H0PA 4QRQB 3CN0A 4GAGL 2Z8VC 4U2YA 4L3EA 4I3RH 3B2VH 5F71A 2WWKT 4C83A 3N91A 4QRSB 2VDPB 4X99B 1X7QA 2APSA 2D7OA 3BWUC 4XHQA 1ZLVH 3L7EB 1VFAA 3UGXA 5HYJA 3CFCL 3B3IA 1NCAL 2Y3AA 3O6LL 4IK7A 1XEUA 1AFVH 4P59H 5DRNB 3X1FA 5KVGE 5FM4A 2JTDA 2AXGB 3UTZA 3VH8A 5A16A 4L4JA 1B9KA 4KJQC 3FUFA 3MUGA 1OAQH 2WWKO 1U8MA 3KPNA 3WXWH 5FKAB 5EF0A 1DFXA 1RMFH 3WLBB 1JERA 4UQIM 4JANB 4Z78A 2I07A 4HZLA 4Y19A 3H9HB 4QJ3B 4P46C 4R84A 1L0XA 2LVCA 2D31A 2XCMC 3VWJD 1XGTA 2XG5B 5CMAB 3L1OL 3NDZE 2DQTL 1EJOL 4FDWA 4HH8A 4NQQA 2E3VA 4JDEA 4NXSA 5IB4A 5LVEA 5DS2A 3R06B 1DJGA 4P0DA 1NFDE 5TD4A 4WEUD 3UDWA 2CRZA 1EXHA 3EO1B 1R17A 4NKOA 4PJ8A 1OIOA 1FAIL 1CFTB 3ZDXB 4MYPA 1EDYA 1G9MC 1NLBL 4N2FA 5GGRB 3O3AA 5D9SA 5D2LE 3G04A 5B1AB 1EHNA 1EFXA 3AC0A 3BXNB 1J0HA 4LSVH 4OCXH 4HKZA 3DWTA 5E2WH 3FYIB 4XBEH 1KPUB 4K7FB 3EH1A 3FUJA 2WN3A 1YCSA 4OZHE 3EDKA 3HBQA 2OMYB 1BCIA 3MFFB 4IMLA 4UU9B 4YSRA 5GSVB 2A2QT 2VO5A 4WU7B 2XN0A 5IBUG 1QNIA 2QSQA 4R5XA 3S2AA 3JZ7A 3LS5L 4XO5A 3FFDA 3WUWA 3OX8A 5HBBA 2Y5TA 4PCTA 1TMCB 1HEZA 3KHOA 5A40E 2BHZA 1OCOB 5CWSA 4OZ4B 1YUHB 2MTPA 2IF7A 2JCWA 3HRZC 5I8EA 1D7CA 3CV5A 4N2NA 1JFQH 2VIRA 1NWPA 3REWB 2CGZA 4XT1C 2QKIC 5D7JA 4R4BA 2ZUSA 5IBLD 1M6UA 1XQ4A 2HTKC 5I24A 3DMMC 3UP1A 5I6XB 4X5QA 1J11A 3ABGA 3EO0B 1NANH 1HX0A 2R0KH 3MQIA 4OZIA 2EDHA 3L9YA 4N0UA 1A4KA 5CR8A 4NO3A 5K93A 5CJXA 3V52L 3K71B 4K3DL 4PGBA 1K8IA 2NY1D 2CK0L 2H41A 4JFFD 1UVQB 4WHTA 5F7AA 3UOAB 1BZQK 3BAEH 4NQEB 4E42A 2Y07L 1HIMH 4R7XA 4CGUB 2EDBA 3K72B 4G8AC 1U8HA 2Y7QA 1NBYB 2F54A 3FS9A 5FYKE 3RA7L 4KO7A 1J88A 4Z7VA 4AEFA 2ITDB 4ONHA 3MXVH 1CFBA 1RV6X 3CIQA 2X0WA 3T8XA 4QHNB 5HYIA 5BZDA 4KTYA 4YHML 4L8CA 1L9SA 1P84K 3CU7A 3LEVL 5DR5H 3UIZA 3WS6C 2PR4H 3IJSB 4N86A 2DQIH 2FO4A 3QXWA 4I8DA 2SEBB 1L7TL 1NGYA 4WO4D 1FNGA 1KBBA 5GJSL 3AQZA 2DQTH 1CXIA 2AGJL 4JM4H 4KOCA 1J8RA 3NZSA 3SPVA 3SO3B 3QEHB 2DQGH 1WFTA 2CR6A 3SY0B 1BZ8A 5HHXL 1G7JB 3N40F 5IJBC 2AJZB 2EVIA 3BZ4A 4FKEA 1FAIH 3S5LG 1NPUA 4EN3A 5DUML 5B4MC 3GKWH 3MLTA 2GUOB 2C8NA 4FQJH 4MX7A 3VRIB 5FW8A 4JY4A 3O2DA 3STBA 3LPOA 5EIIA 2CD0A 2EIZA 5HDLA 1TXKA 4Z23A 1PNDA 3EF4A 1VGEL 3RTQD 3IE4A 1NCCH 2O5ZH 4YSDA 3H42L 4X6DA 3FUDA 1EH9A 4I13B 1NOLA 1WWAX 2K3HA 4KXBA 5HHME 1SOQA 2Q8AH 4FFWD 3UX9B 3MRLB 1AQHA 2XLLA 5HDBE 1Z9LA 2J1KA 3TH4T 3MROA 4KO9A 4WFGD 2AW2A 3O0LA 2O30A 4BINA 4LVNB 1GZHA 1E3FA 1JI2A 5C0DA 2OXGA 3ALWA 5JR1H 2ZUYA 3IGAB 3NJLA 3WEXA 3OKKB 3MXWL 5IB5A 2EICA 2F5AH 4IIQB 5GISL 1OAKL 2VR8A 4J3OD 2WP3O 1YEGL 3TN0B 2ZX6A 2RQ8A 2PUQT 4JKKA 2AKRB 3JV6A 3B9KD 4JKPL 4BEIA 2YZ1A 4JHUA 3O2DH 2CCVA 3FH5A 1EHKB 4DEPC 2WZ6A 3L9BA 2VR7A 4JO1H 4PJXF 5F7MC 5IGXL 1BECA 5I6MA 2EABA 1DQIA 2VDPL 1MCNA 3RA7H 3CC5B 3ABZA 2DYPB 5GS2D 5C0CA 5D2NA 2K6YA 4HIQA 4KRPC 4L9LB 2R0WL 1BFOA 1YAZA 1YY8B 2ATPB 4XVOA 2XXGA 5FLVA 3GUTB 1AO7D 2VDMH 3BE1H 3LEVH 4PJHA 4HUWA 4P8QA 2YPKA 2WV3A 4AEEA 4K7PY 1OM9A 4QY8A 4Q97A 1GA2A 2DLTA 1NDTA 2FEEI 4M6NL 5GJSH 2OSWA 1HDMA 4ZI8A 1N0LB 3FULA 2A0LC 4HX1B 5E6ZA 5T5NG 4UINH 3SCMD 2YAEA 1LO2H 1UXWA 3FQRB 2EYSB 2I85A 2VR6A 3KBPA 5ADPL 5DUMH 5LNDA 3LH8A 1VERA 1U8OB 2HFEB 3K2IA 4FF9A 4MD4B 4PFEA 3WLWD 1F41A 4H0HB 4N8PA 4QUOA 2DM4A 2AV1A 5T1JA 4XC3L 5JA8B 2R2BB 2VSKB 4HC1A 1IE4A 4ZNEE 2XV2A 2EIKB 2VAAB 1CPUA 5K39A 5ERWA 2QV4A 4WSJA 2J1YA 4HHAA 3L4YA 4YFEA 3GRWA 4X99A 2DQFB 5ICYA 1XV8A 3FFCD 4QOKD 2BFVH 1F58H 3PHQA 5DYFA 3L7EA 3UTSE 4NPYA 2ILLA 4I0PB 3WY2A 1XXDC 2YQ2A 3OV6A 3X3FL 1S9XB 1F56A 3KEDA 4X80L 2FBJH 1X6LA 3BLBA 4ZFZA 1TEFA 1KPRB 5CGTA 5FKAA 2FWLB 2IPTH 2BOCB 4HSCX 2FX9L 3KYMB 3BAJA 4LCVA 5CS7A 4N2DA 3WLBA 3ZYOA 1I3RA 5JW4M 1FNEB 3GK8H 5F7UA 3H9HA 4A67A 1EV2E 1G5GA 2JJTC 1MFBH 3MXWH 4AC2A 4IU2B 3ULAB 1DBAH 4LEXL 4TUJA 2YKLL 3A22A 4Q56A 4PGDB 4JKPH 3IT8D 4NWTH 4AQZA 4H44C 3EO1A 4HC1H 4OLYH 4B95C 1CFTA 1AI1L 2ZP0T 3AMLA 4URKA 1EHLL 1Y6NR 2VQ4A 4ZPVB 4ZMPA 1BLNA 4XOBA 3UC0L 1SEQH 3ARGC 5FGBC 5IGXH 1S8DA 4HD9A 1LEKB 3GRWH 1JWSA 2YMXL 3PL6A 4OIIL 4FTVD 4E9QA 1FZJB 4XN7A 3MFFA 2R0WH 4UZSA 5GSVA 2CLRB 1NDMB 4WU7A 2VZSA 5EUOE 1JP5A 3BWZA 4XP6H 1T22A 2WXMA 4QRTA 1AYRA 5HXMA 3TYGL 3EJCA 4NM8H 3ESNA 1MG2C 1RK1A 3GO1H 1H9VA 1ZIBA 4UTCA 5IK3B 4L0ZA 1SZNA 5L9DL 1EUUA 1H5BC 2RD0A 2ZPKL 2O5XH 1UCBL 4KJWD 3WELA 2C9QA 3QZWG 4WJKB 1XF3A 2VN5A 4P4KD 4Y5YB 4QGYA 3TNMB 3E2HC 2AABH 4AZUA 5JMRA 3GPEA 5IHZB 4FXKC 5AW6B 3KWUA 2O6FA 1OSZB 2AJ3A 2CLZB 2DZEA 4U6HB 3EO0A 5MERB 2AEQL 1W8EA 2KZBA 1IBYA 4LEBA 3HNTH 2FLMA 2OA9A 2A9AA 4P5MB 5IVXE 3JVFC 2MPAH 1A7BA 5D7KE 5DC4B 4H8VA 3JTSA 3PWUA 4P5KA 3BN9D 3RLSA 4GFTB 3MUHL 4UOW0 1U3HD 5IW1B 3K72A 2OJZH 4AV4A 4NQDD 1WEJL 4N1CA 4ELMF 4MNGB 5AAPA 4QRPA 4CN1A 1YY9C 1CFVH 2W94A 1BWMA 2ITDA 3RE0A 5FECB 1XR8B 3GSXB 2HN7A 4YLQT 2MH4A 4F7TA 1A3RH 1AZRA 2H3NA 1LMIA 4B9ZA 4AGPA 2BVTA 1FZMA 5DVLA 1GY1A 3L3JA 2BIPA 4JHAL 2CBOA 5DVOA 1EZUA 4YC2B 2YPLD 1KTLB 4YNYA 4BA8A 2CUIA 2HFGL 1T6BX 3FHAA 4AX3A 2EH8H 4YDKL 4BFFA 3KCPB 2LU4A 2ZCLH 2FSDA 3TYFB 2I27N 2YKLH 3QEHA 3TFBA 4JO8A 3G5YB 5FUZL 3UAJA 3FKUS 4BSJA 3SY0A 4A7VA 2XN9E 2O26U 2OMWB 2BHUA 2ZCZA 3DOHA 2KLSA 3D52A 4FYQA 1AI1H 1EBPA 5ANMA 2PYEB 1FORL 4DH2A 2P46B 2UZXA 3ET9F 3QI9B 1FWXA 4Y1SA 1IGCL 2V2TA 2B3IA 1E6JL 1KJMB 4DNLA 5DJCB 5JZ7D 3PIQA 3VXMB 3CZGA 2XWBB 4IEFB 5EV7A 3VWJB 3MV7D 3MV9E 4EUPA 2NXZD 5DFAA 1V54B 3RVVD 1IC4L 1GZQB 3QEQB 4NRYA 5L9DH 2CAKA 2D73A 3T77B 3TTSA 2WXKA 4MLIA 1BVKB 2WZPA 1Q9LB 5HHOA 4DETA 3BLPX 4PWFA 5T5NF 2VZUA 1UZ6F 1ZSDA 2FSEB 5IKCA 2R1XB 2GYSA 1SYSA 1T5WB 2DD8L 1CI3M 5H2BA 4L37A 3WXVH 4EPSA 3KS0H 2HLFC 2WCGA 2KI6A 4NYLA 7FABH 2EYRB 2EUWA 3I2CH 1I1AA 5FUOL 5KBLA 5J13B 3WJJA 4N2AA 2A1WL 3HS0A 4GRWF 2IBZY 2WJ7A 3KYAA 4I87A 4ZD3L 3EFDL 3UYRL 5F3BB 4JGNA 4PJXA 1WIUA 1K9TA 4AL8C 5E94B 4Y4FD 1MIML 3RKDD 4OKVB 4TQEH 3ZO9A 4GUQA 1ZPLA 3GSRB 5B3NA 3CLFH 2N7BA 5GGVL 4B50A 4NZRL 1LHZA 4MQ7B 4LE8A 4TQIA 5L4MA 4OJCA 4JHVA 1GL4B 2B1HH 5DHMC 1F3DJ 5FV1L 2HRGA 2WZAA 3CC5A 2CBQA 3HBPA 4EUPH 1MJ7H 1KIUB 1QR1B 1YY8A 2ATPA 4K2UH 5TDOB 1EWHA 5ALCL 1EDHA 4WGVB 5KSAC 2SODB 1OE1A 4G6MH 3GUTA 1TETH 3HZYA 3X2QB 2DWEB 5IMLA 4KQ4L 2C3GA 4GXVL 4N2OA 5E8PB 5C0AB 5AB9A 4U1MA 2HFGH 4KDVA 4A55A 4JFFB 1C7TA 1VFBA 4UT7H 3DRQA 2AF2A 1E42A 2OK0H 5JW4N 3BEVB 1I1YB 3O41B 5F0PB 5AOMA 4UIKH 5E4AA 1CIUA 1CS6A 1VPOL 4MXQC 1FI8C 5JUEL 4KTEH 3O45A 1FIGL 4GXUM 5LQBL 4PJ5B 2OZ4A 3VI4B 4DW2L 4PHZA 1JGIA 3B1TA 4MXWH 3FQUB 4RLDA 1RCYA 2WWNA 3L7FB 1JDDA 4MB3A 3SPHA 1AQKL 1XGRA 4LVHB 5FV2A 2CNYA 5H37A 4F24A 3BUYB 1FFQA 3FYEB 4XP5L 4NJAL 2B5IB 2DQFA 2Z8SA 3O8XD 4WI8A 3BZDA 5KVMC 4OZIE 1IC4H 4F9LC 3S8GB 3QJZA 4N0UE 2DEXX 3MCKA 1FF5A 4I0PA 3TXAA 5MHSE 1PS3A 1DFBH 3H55A 5EWIH 5FFGA 1A7QL 1DQKA 4M29A 3ZL1A 4ALAL 4P4RA 5T1LA 2X2IA 1KPRA 4BKLB 4DOHB 4Z7OF 1DR9A 1SFHA 5FUOH 2BS9A 1BJ1H 2AJUL 4LASH 3NIFF 3KR3H 4ZD3H 3Q6FB 1RZFL 1TYEB 3U1QA 4BQBA 4Q9QL 1OQXA 1TQBC 2JTYA 3FH7A 2LU7A 3SKOA 3S8FB 4MFHA 4H20H 1VZGA 4Y4KD 1RLBA 4MXVF 1DBKL 1T3FB 2ZF9A 2OZ4H 4HHWA 5FO8B 3OKEA 5GGVH 1FPTL 1OQOA 2K3TA 2G60L 4NZRH 1RZ8B 2DIJA 3ZT6A 4ZPVA 4A2LA 1FSKB 4XPTH 4N3UA 1W91A 4M6MH 4OM1L 5H37H 4PGEA 2IPKA 4P2OA 3ULUL 4KXAA 5B39G 4J23A 1S5HB 3EH3B 3NZHH 4TSBH 2Q2LA 3FO0L 2DKSA 3GTVA 5HVGB 5CJ5A 1UM6L 4OCSL 3KD4A 5SWQA 1ECZA 5ALCH 2BCMA 4JMXA 4ECNA 2X4TB 2YWYA 5AB2A 3FT9A 2QQKL 4ADJA 5AVQB 5ICZB 2P5PA 1RUML 4MQSB 3B9KB 5AB0A 1M7IB 4YS4A 4YXKH 3V0JA 1UENA 4E41D 2ZXGA 4HUUB 4X6DE 3HG1D 3CMOL 3FQ2A 4ZXBD 4HUVA 3SDCD 4J1UA 3HE6D 4OF8A 5C0ND 2RGSA 1LQBC 5DXWA 4O58L 4OJAA 4EO5A 2J5LC 3F12A 1CDUA 2QTEA 4IBVA 1BMZA 3R19A 3QIUD 5MERA 3MN8A 5AVWB 1FJ1A 1AO7B 1F02I 3AU1B 1W80A 2ED9A 2UXGA 4GP5B 3PDGA 4MAYC 4YHYC 1OLLA 2MTAA 2XWTB 4GRMB 2AZUA 2AV7B 2VRKA 1JZ7A 1KY7A 1MCPL 5EA0L 2OM5A 5I2IB 3QDJA 2WSKA 4NNXB 1A2YA 5IW1A 3UTPE 1EHXA 1A7QH 1U8JB 1AXIB 3OWEA 4J2QA 4M9OA 1XZWA 3NZUA 2MCAA 4HK3N 3MU3A 3MRJB 3ZKNC 4P46D 3H9SB 2QLVB 1IBFA 2AJUH 3OZ9H 2W9LA 3NESA 5ABZA 5K9QI 1TZIB 1PTZA 1NC4D 2QADC 3V0IA 3ZJAA 4JN1H 4OCRH 2XWZA 4YUEH 4H25B 1A1OB 1CUOA 2N3JA 5ALBH 2QHRL 2JIXD 5T1MB 1GMIA 5AVRB 5E9DB 3E6FA 5L2KE 5T5FA 1JPTH 1JTTA 2ZXBA 3NIDF 3PP3K 2WBJD 1JZEA 4W9GC 3FTVA 1NGQH 3PLYA 1YNTB 4MS8D 3ULUH 3U1SH 5IWLC 3FB7B 4WHCA 4HUXB 3CH1A 1PDKB 3AQDA 1F11A 2GG1A 1KJMA 1FUNA 4AUYA 5GS1B 1AE6H 1G0YR 4IEFA 2X4OB 4L1LA 3BLKA 3VWJA 3FQYA 5CIPB 4X5PA 4QHUB 4LPYA 3MRGB 4WLCA 3V0WL 4ZOBA 1GZQA 2BRQA 3W5MA 3T77A 2CQVA 1LE9A 1IBGL 2E7BA 4WWKD 3TIEA 1Q9LA 2VXSL 4OGQC 5L7XH 1W15A 2VLJD 2UWEB 3MLUH 2R1XA 2XQBH 4Q6KA 3FB8B 3QJFB 5EBWB 2G9HA 5TE6L 2F7PA 2HTKD 2NRDA 2A4ZA 3DMMD 3QT2A 5BOZG 5C0EB 4N85A 1QNZH 5DURB 3U4BH 1RUKL 1AACA 5AW2B 4FTVB 5HGHA 3Q1SL 5F3BA 1MG3C 2D4FA 5T5FH 3MUUA 4MA3B 4DVRL 1T03H 1Z3GH 3SE4C 5AW8B 3GMPB 4PJDA 3D34A 4JS7A 3SDYL 1WHOA 4GXUN 4RQQB 5EOQL 1HQRB 3TBCA 3AACA 3V0AC 5I66B 5ID1B 1MCPH 5LXGL 1QVOA 5DZJA 4NLHA 3NPSC 1M6OA 3GINA 3QUGA 2W65B 4NCC1 5GGSA 4BE6A 3DDGA 1XF2B 3T4YB 5A7BA 1P84J 2BP8B 1OY3B 3FJTA 5EUKA 1RURL 5AENA 5CBEB 3ZDXE 1INDL 1A3ZA 2YSSB 1SOSA 3ULSA 1QR1A 3QBTB 2X0VA 2B4CC 5DRXB 5D1XC 4GRWH 4EDWH 5IFJA 4ZBJA 1TQWA 3FRPA 1GYWA 2Z91B 3NJKA 4F8PA 4XMZA 4HH9A 1A7NL 5E8PA 1VF5C 3EJSA 2GBAA 2HA1A 2VLMD 4JFFA 1WRFA 4NPJA 4O2FA 3KPPB 3QCVL 4WKXA 4FMFA 1IEBB 2R9HC 5B4MD 2X70B 5DQJA 3C60B 4IM8A 1T1WB 2A6IB 3HHMA 2IDCA 4NQDB 4W6YB 3N3EA 2B0SL 5F21B 3GSVA 3RU8H 4B41A 1MW3A 1HHKB 1IGTB 1W0VB 2OMZA 3WIHL 4LF3A 4Y2DC 4GG8B 2W8CA 3NZ8B 4KO5A 5G55A 2ZUUA 3FBKA 3FQUA 5I71C 2FBRA 4CU7A 5CU9A 1JL8A 3IFPB 2IFGA 5JHBA 4ZX6A 2HMIC 1IFGA 3L6FB 4JPWH 2D8KA 3P3UA 4WO4A 3O3DA 3WKYA 2WAHA 3QHZL 2IJ0C 1NMCC 1L6PA 1D5ZA 1AGEA 5IQLA 1JN6B 4CVXB 4Y2OA 1KBKA 2Z1KA 3HBZA 3HZMA 5CLXA 5B38G 4E0RB 2H6PA 4NQCD 5BVPH 5EDSA 5KVDH 1TKWB 4L8SC 4BUQA 3S3BB 1XL4A 43CAB 3F58L 3FU7B 4NQEE 5KJRL 2AQTA 3ZMEA 4ZMOA 3QPQD 4N1EA 4AM0Q 3B83A 2FL5B 4WSGA 5K9JH 2CJUL 4G8GA 1F86A 5CCHE 2F74B 1GCYA 4Y1AB 5TQ2L 3ZU8A 1NKRA 3VSUA 5JHLL 3RTQA 5IZ7A 5H4YA 5GRJH 4DVRH 1WGVA 5I5IA 2FWOA 2HFTA 3BUPA 1DUYA 1W8NA 4P5RA 1M2VB 3MODL 2Y06L 3MA9L 2J8UB 4Y16C 3WTTA 3ARQA 3F8UB 1RZ8A 1Z3RA 4POYA 2RJMA 3K6IA 2NW3A 5JMOC 4LIQH 4DCQA 4XPHL 5E6IC 1GGUA 4CSSA 4EJ1C 2ADGB 2P49B 4MMXB 3WAJA 1T89A 3TEZA 3CPLB 4XOEA 2O72A 4BQ8A 5K9OB 2Y72A 1E9OB 1CI5A 2IH1A 5AZ2H 3DURB 1MWAH 2X4TA 1I8IB 4Y4FB 1XF4B 4U0RC 3BPOB 4ES9A 3B9KA 3U0WH 2GBVA 1KJ2A 4L1DA 4A2DA 4NN5C 2D3JA 1T83A 4J3UA 1JXDA 4RIRB 3KVDD 2E9GA 4WFED 4OGYL 2P45B 3BIKB 5FPIA 3UZQB 5EZJB 1Y07A 5ISZD 3IDIB 1Y6MR 4BKSC 4B7LA 4HLEA 3A23A 1QKZH 3ARYA 5BVJB 1HKLH 3F7RA 12E8L 2COVD 3HZVB 1AO7A 4HS6B 4APQC 5F9WB 5J0BA 3KCWA 3QFDB 3HZKA 4MVBC 3TCLB 3CDYA 4JFHE 1I8MB 1U2YA 1I7TA 2PPCA 3LKNA 3NJIA 2Z9TA 3VFTA 5D1QB 1KN2H 1S9YB 3SCMA 4NNXA 4AGOA 3KGSA 2CR3A 5FUCC 2AVFA 1DN0A 2HPOA 3CZEA 4J3OH 3LHPL 3DSFL 4R26H 2NY0C 3F58H 3X1NA 4HG4K 2P52A 4YSEA 4K0OA 2XWDA 3I9GH 3MRNB 1T7XA 5F8RC 3FT2B 4HIXH 3HR6A 4MDIA 3MRJA 1KJ2H 2CJUH 3FU0A 5DWUL 3B8YA 3CE1A 1XT5A 1YC8A 2C3VB 4LSTL 4N0FB 3TJHD 1RSFA 2Z7WA 3P4NB 4H8WL 3L3GB 5EO9A 5TQ2H 1ZXQA 4FERA 2HTLC 4YLBA 4XCNB 1UWGH 4AYFB 3FFCA 4QOKA 5GS2H 1NBZA 3GB7A 4ZUTA 5JW5B 1CFQA 1Q94A 3MODH 4U1HB 2W80C 1K2DB 2ZD0A 4NUJB 2X41A 5LO7A 5ADOH 2AXFA 4OD1L 2WO4A 3AWEA 1BXAA 2BNUB 3E6HB 3PJSB 4AVIA 2Z31B 5CLZA 5A2BA 1GJIA 1IUZA 5CCJA 1N6QL 3HMWL 4HUXA 1TVBB 3ABLB 3N41B 3QXDA 4GQZA 4NOFA 3KPMA 2FATH 1GKOA 3ASWA 3UPAA 5GS1A 3HG5A 1DL7L 4PRHD 3ESUF 4QHUA 4WI0A 5CIPA 4DN4H 3MRGA 5EN2B 5IFAL 1S7WA 3JVGA 1LE5A 4PJ7F 4JE4B 4QF1B 5KYUA 3UG5A 1UH2A 3J07A 3KXFD 1IEHA 1E4HA 4KKAC 1EDQA 5ABAA 5FFLA 3BX7C 3P4OB 4YZFE 5ICXA 5JORB 2W9EL 1K5WA 1NC2D 2DIAA 5C0RL 4DQAA 2WQUA 4PJ9B 4FTVA 4L48A 1G9NC 3IWVA 5DJZB 4LRIC 4QRRB 1WZ1H 1E9PB 4H7VA 1PYWA 4UAHA 5HJ3B 3UABA 1QWUA 2DI8A 1XZ0B 3L5XL 4PCYA 4UQDA 3NCYS 1GAFH 2UUDK 1JF1B 3K1KC 2VMDA 4KK6D 4I9XA 2ZQKA 4XNZC 3LV3A 4RQQA 2QT6A 5JOPE 1QLFA 4NHCH 1SHXA 4YX2L 2XG4A 4ZXBB 3OJDB 4MAUL 2NUTB 4P4KA 2J7LA 4Q6IA 4Y88A 1YY9D 3OKNA 3T1FA 4NZUL 2BP8A 2H9GB 1QFWL 1EBAA 4F8NA 3ARXA 4Y5XB 2G2RA 2P8MB 5I8CB 1ZRUA 4ZTEA 1SMAA 4ELKB 3L17A 4UV7H 1B4LA 1OE3A 1LO0L 4ZG1A 4AIZA 3IF1A 3IU3B 4H8WH 3GBDA 5E8OA 1YSOA 3F84A 4JRYB 2A38A 4L4VB 1DO6A 4BSVB 2P26A 2VM4A 2G9KA 3CHPA 3I6LE 3MVSA 1EVUA 1E4KC 1F2QA 3PWPD 2F1AA 5BXFB 4JZJC 3OSKA 1IVTA 1JK8A 1U3HA 3SQOH 4NQDA 4CN4A 2YUVA 5E5UB 1FHNA 1UA6H 1QPXA 1IC5H 3DVNA 3QPXH 5PAZA 1MOEA 1TFPA 3OJMB 1W0VA 1ET8A 4X5RA 5DLML 1BOGB 4JRLA 5GSRA 3UTOA 4PJIB 1IKNC 1N6QH 1ED3A 5EU5B 1RQ5A 4TULH 3BKYL 1OF2B 1JJUA 1WCQA 3IS1X 3LQAC 2YPLA 2CE6A 1WT5C 4PLJC 1NC4B 5I9QC 2X28A 2F8OA 4X7EC 4G6FD 1AZZC 3GMNA 5IFAH 4GP8B 4X6CA 5GRUL 5DQ9A 1ZLUH 3OQ3B 4J3VA 5I5MA 3ULUE 3QQ4B 2Q86B 3RY4A 1JZGA 2AZAA 4MB1A 5IW3A 2XX1A 1MFAL 1TKWA 3UJIL 1F4WL 1H3XA 1FVCB 1E5CA 3T8MA 1KCUL 4ATWA 5JTWA 3O11B 1YNLL 3AGWA 3F85A 2FR4B 1O7VA 3MLYH 1BYOA 4MNGE 2OULB 4PB9L 4UF7C 1EO8H 3IKKA 3RWEA 2R69A 2ZXQA 3MNZA 2VM3A 3P30H 5GZOC 2Y6SC 1QWNA 3IPEA 2AEWA 3I6KB 1NOAA 3K8KA 3L5XH 3GEWB 4AVJA 3MV7A 4JO4L 4FHJA 2ICWA 3MX0A 4KHXL 2WUBH 3HNSH 3RIKA 2J8UA 2VDRL 2ZT9C 4TN9A 4AE1A 5FO7B 2EIJB 3BVXA 2VLJB 4FXLA 1U92B 4C56B 3FOMB 3W37A 4XH2B 4OZGB 3BVNA 3CN3A 2V9QA 4V1DD 3EOAA 3DMMB 3IYLW 1FYHB 3QDAA 4MMXA 3U2IA 2HX9A 2PYEE 4XC1H 2Z4QB 1PLAA 4FQCL 1E9OA 2PPDA 1OL0A 2JKWA 3MPCA 1WA0X 3KS0J 4Y4FA 3SYCA 2DBLL 3O3UN 1BXXA 2MHAA 2Q20A 3VXME 3ZQWA 3ZT5A 5I0YA 4UDUA 5C71A 4X4XB 1MCRA 1RIUL 1BZEA 2OI9C 4GRLD 2LW3A 1NL0L 1DE4A 1NKGA 4MGXA 2R69H 4J3XA 3AREB 4D0CA 4PBDA 1S7UA 3QEQE 3EJUA 4MXQD 1XCXA 4O4YL 4POZC 4TPRH 4I77L 4HQQH 4PYHA 4PV8B 4DK6A 2NW2B 3LYRA 1YYCA 3E1ZA 1WA2X 3NACL 4L2YA 4KK8C 1ODAA 5BVJA 3KPLB 3Q2LA 3WFHA 3Q05A 4UANA 4QJ5B 4H8HA 2IC2A 3DIVA 35C8L 4XO3A 2NTFB 3MRDA 3TV3L 2E0PA 4YXLH 4UYQA 4JW3A 1I8MA 2GC7C 2Q9OA 4M6AA 2CBPA 3BWAB 3QQDB 5MEOA 3U7WL 1S9YA 2ATKA 4GAYB 1E28B 2CJTA 2XTLA 1HC1A 1E8ZA 4WNQA 4PSRA 1MLBB 2BP0A 3PXJA 4W6WB 4P9HC 4IOFC 1F4WH 4YHLH 3SDDD 3UJIH 5LWYL 3LPPA 1YN7B 4P9MH 1YNLH 2DQMA 4HUKB 3V7AG 5J6GB 2NT1A 1THAA 1PZ5B 3BGMA 3JQOB 4Z7UB 3FT2A 3NP3A 3US9A 5C70A 1HSAB 3VM7A 1FAKT 2YAQA 4N0FA 3BHBA 3L3GA 2B9BA 4M1GL 4PBWD 5FHAL 4AYFA 3ML9A 3O8XA 4GI8A 3Q1EA 1A7RL 3QNZB 5CN3A 2XPGA 2NX5B 1E27B 1K2DA 1KIQB 4G5AA 5C0AE 3DO7A 5EOTB 2VDRH 4GG6A 1W0WB 4JFFE 1MFEH 1ZT4B 4WJ5B 2BNUA 2F53D 4LKCB 5JXEC 1Q0EA 3IN0A 1PW3A 2WYIA 5EOCL 5FCSH 3EGXB 2WCPA 1RUAL 3N9GH 5TJWK 4FCHA 4AQEA 3RQ3A 4NKDA 1IM9D 1K72A 2D7QA 4L8BA 1SN5A 1AXTH 1WC7B 4LESA 4TXVB 1Z9OA 1DVQA 4PJ5E 5GGTA 3VI4E 2WW8A 3QE5A 2D3VA 2ZG2A 2ZWZA 3BESR 2CA3A 3CDZB 4TF4A 3OLIA 5DD6A 5EN2A 1AQDB 1XH2A 4Y4KA 2N59A 2CO3A 4DEPB 2XZAL 4G7VH 1JK9A 5E2VH 5EZOL 4FNLL 5C97A 4UTBA 4ZQTA 1NL0H 1N18A 4A63A 1UTDA 3P4OA 3RP1A 5I0DA 5KBPA 3TT3H 3A5VA 4K5OA 1X4XA 2WBWB 4O4YH 4KRPB 1IAMA 3S5ZA 4HKJB 3GLAA 4CC0A 5TFSL 4BH8A 3NK4A 1BZOA 5BW7C 5DJZA 1P7BA 5I8KH 1DBMH 4X9FA 3N42F 2PXYC 4DOHE 1QZNA 4MAYD 4U1SA 1XZ0A 2K4AA 2VC2H 5CSZA 3VO0A 5CZVH 2A9MH 3OPZL 3LTVA 2NNAB 5JPMA 3X3GH 3UYPA 4I7ZC 1ITBB 1CFSB 4XMUA 4A7UA 4JRXD 1BBJA 4E41A 1CD1A 1FFOA 4BSWB 2OSXA 3HG1A 1KC5H 1XX9C 4YDJB 3SDCA 3DPDA 3PGCB 5M95B 3HE6A 3Q3GA 1A3QA 1WBXB 1H6TA 2H9GA 5GGTH 3MV01 4PW9A 1DVTA 3G5WA 3MOBH 3PS6A 3BSGA 5I8CA 4YL4A 3ZKND 4B9YA 2AK4D 1Z9SA 1SFDA 1G9ML 2AHIA 5LB1A 3QIUA 4M8QA 3AGVA 2QQNH 5D5MF 4MJ4A 4UTBH 4H13C 4IKKA 4P05A 5T1DL 2BXYA 4ZDHB 1TQUA 3GRBA 3FTXA 4XCYB 2GJ6B 5FHAH 4BSVA 5HY9B 1A7RH 4H0LC 3NIGB 5J8OA 5AYQA 4CC1A 2VGLM 4GKSA 2EH7L 4A7GA 2PW2B 4OUUA 5KS9F 4X7CC 5SX5K 5TF1L 5F72S 4LMQE 5SX4H 3RGVC 5MP6L 2PMZA 1OKEA 4HPOL 1SLXA 5JW4Q 1DCEA 2IPUG 3J2PA 3O4LD 4X5XA 3Q5OA 4C54A 3GSWA 4P46A 1JV5A 2DI7A 1NWOA 3C2AL 2V2XB 5HYEA 1I7ZB 5BQ7B 3TPKA 2IGFH 3I85A 3N43F 2BOLA 3Q48A 1NC4A 4F20A 3FO1B 5D55A 5JNYA 1AO7E 3KDPB 2JIXA 4P5TC 2A6KB 5CP7A 3ZDXF 1R46A 2FECL 4FA8A 1GHFH 2C1OA 3IRPX 4WKZA 5I1LA 3ARGB 2WBJA 3EBAA 2GSGB 3HC0A 2I7OA 2NZ1A 4FFZH 4ETQA 2KKQA 4GPVA 2EIEA 1T1YA 5FF6B 5JPNC 1JWUB 2QSVA 3L5WA 2IDFA 4JZNB 4NEHB 2C1PB 2CR0A 4ENZA 4MJIB 4QHPA 1JNNL 4U1IB 1RZKC 3I6KA 4IRJC 3H9SE 4I5BA 3STZB 1OM3L 4WTZA 3ZTEA 1H5BB 1KELL 5C09B 3V0EA 4UIMB 2GCYA 4HV8B 2M2DA 3HRZA 1NGWA 3LQZA 4WWKA 1P2CA 3KXFB 4F58L 5FHBL 2LFEA 4ODXB 4P49A 2VLJA 3P4MB 3E2HB 2QKIA 2X1XR 2CO1A 2ZYRA 5E9DE 3GFUA 4FXKB 4IHOB 5ABDE 5B8CB 1NC2B 1A9BA 3BP7A 3DMMA 3IXAA 5LKNA 5IVNA 3MLPA 1TT6A 5D6DA 4IBZA 1NCHA 1IQDA 4CADB 3MRBA 1UWEH 1JXKA 1KWGA 4G3YL 5E08L 3QCUH 3PNWB 4W9JC 3ILPB 5ETUA 3VD9A 3P77A 5E1AB 3STLA 4KDWA 4AI7A 3ZKMC 2NY6D 3LIUA 1JMZA 3TTYA 3IPBA 1AS7A 4PD4K 1A6TA 1YJDC 3MCLL 4HPYH 5AZUA 2NSQA 1SLVA 3IRZA 5TF1H 5AL8A 1RZIB 4PRBA 4Y2DD 5MP6H 2D2CC 2UWEE 1F13A 3V6OE 3VFNA 2NW2A 1U42A 1XSJA 5AOIA 5HYSA 1KIRA 3WS6A 3G6JB 3ULVF 4D0DB 2DH3A 3TBYB 4J7RA 4OKDA 1QEWB 5E00B 1M57B 4FXGA 3LZFL 3L9RA 1S7XA 2NTFA 3FCGA 4FTVE 4HKXB 4LBEB 3SSGA 2JB6A 5D4QA 1H3UA 2I7SA 1KG0A 4K55A 1QRKA 1FG9C 3BWAA 3QQDA 4H8QA 2QZQA 5KZCB 1WTGT 2O6PA 1REIA 4GAYA 5D4JA 1E90A 1CLOL 1ZGLA 1MLBA 4I3SL 2FLRT 1PLGL 3WEBA 3WS3B 4YHNB 3OLGA 2C7UA 1YN7A 3O3EB 1V10A 1B90A 5J6GA 1GGIH 3BW9B 1QBML 3FOLA 1HSAA 3W39B 1AANA 5IMKB 2L7UA 2NR6C 3ECUA 3SO5A 3AMKA 1YEFL 4D7PA 5L8KB 3W9DA 3MKGA 4M7JH 4ZT1A 3DV4A 4G6FB 4HT1L 4ISVA 2X6MA 3D12B 5T1KD 2ZUTA 2WBXA 1KCBA 5HI4C 1OM3H 3RPKA 3T2QA 3U1PA 4XVTL 3QNZA 1KELH 4G5ZL 4Y16D 1JSYA 1X7SA 5J12C 3FHEA 4PJFB 5EOTA 3E8UL 1T2QL 4IRZL 4NQCA 1MFVA 1HINH 5A2KH 3IMSA 1T1XB 5FDWA 3OHXC 4NKIH 1RJYA 4UNIA 3ZQXA 4FQIL 1ZLWK 1N12A 3FUEA 4AYDC 3SEPA 1F42A 1N67A 1OO2A 4NQDE 3UCQA 4IKNA 4KZEL 3IDNB 4R7VA 2APBA 1KCLA 4RFOH 5KYWA 3F62A 1I1CA 2XOTA 1U93B 2JKRM 4RNRB 4BH7B 5GS0L 4OLXH 3ATEA 3L45A 1TQCC 4MJ2A 3W0WD 4QPEA 4RWYL 4XNMB 4GAAA 1BZ7A 2YPLE 5MEQB 3MACL 3WO4C 1BG1A 1YMMD 1FYTD 2LU3A 1OZUA 5AOZA 1QG3A 2Y24A 4ZMTA 2OXHB 1KBWA 4WEEA 4PRNA 1HZHH 3PABA 5DHVB 4XTRC 3PXLA 4XRCA 4R9HA 4IKLA 5C0FB 3VSQA 3OC8A 1DJYA 4HKJA 1OANA 1FN4B 4LL4A 5CILH 5KSAB 4AK2A 2DYRB 3NFNB 3TV8A 1L0YA 3DA0A 1EAPA 3IDMB 3S35L 4U6VH 4AZ8B 3ETBJ 1IU1A 2B16A 2V2WA 4YBLC 1HESA 2D2OA 2PYFA 2DQEL 1QLRB 5JQHC 2NNAA 4Y1AE 1XTLA 2GEEA 3ZRFC 5CO1A 4H2AA 4MQXC 4HG4J 3OM3B 3ZL4L 2WPGA 3QH3A 2V7HB 5D5MA 2XV0A 3RURA 2BH0A 5KN5B 2NY0D 2HJFA 3TNNA 3KPSB 3RAJH 2J8UE 1S7QA 4I3SH 4TYUA 5FGSA 1OARH 4QLRA 4AEHH 5ISZA 4DPCX 3K6SB 5FOJA 1XCQB 5JO5B 2VXUH 4UWQB 2F2HA 3QJQB 3LEXB 1XGPB 3VXNB 3KLHC 1TMQA 4QNPE 2IAMB 2XU9A 4IDLA 3KWWA 5BS0A 3PV7A 4IS6B 2XY2A 3SGDI 4CVZA 5DJ2A 1JD9A 3HI1B 2NUPB 4XCYA 4YZFF 2VERA 3W2DL 3X12B 2K45A 1G9EA 5HY9A 2OMNA 4P3CL 3AS3A 1P4UA 4NFDA 3QUYB 4ABWA 2DPKA 4R90H 3W82A 4MJ6B 4WAFA 5HDOA 3EOBB 5IJCC 1GS6X 4BV1A 1INEH 1LJMA 3TIDA 4FQXC 4V33A 5GGQH 3GSUB 4JDTL 3II2A 4PLKC 3ARUA 4XN8A 1JVKA 1LP9B 1LL1A 1WQVT 2YS4A 3D18B 2JNZA 3JV4B 3T9WA 2M26A 2WNWA 4KZEH 4KAQH 1S7TA 3RBSA 4YFLI 1GOHA 4N22A 2QTVA 3EOYG 3K4AA 3OWRA 4FLHA 3T3PB 1E5BA 4KY1H 2EE9A 5DJDB 1S7RB 3HFFA 1KLGA 5EZPA 1NAMA 4AM0B 1GPOH 2A6KA 2GJJA 4KKAD 4NC2B 3ZDWA 2YOCA 3EYOB 3QRGL 5J9PB 3HG4A 1H19A 3NRQA 4JRWA 1OAXL 5DFVC 2FEDD 5FGBA 5DCCA 3REVA 5I18L 1MHHA 1QLEB 5CJQH 5D1QE 3BH4A 3WFCL 4KH9A 4F9PC 2F53B 5B7FA 4DO5A 4YHZH 3GJEB 5DZLA 1MHEB 4PTUB 1OW0C 1W6LA 3IDUA 2VM9A 5EC1A 5BPPA 2OR9H 4XNUL 2FQGA 4FFTA 3QQ9C 4GW5B 4P2QB 4PRHA 2MNWA 2CCLA 3SKJL 5I15H 1R9FA 2GHZA 3STZA 1J5CA 4L23A 1LQSR 4X5LA 1USQA 2YRPA 1ETZB 1CLVA 4HV8A 4GKOA 3KXFA 1E7UA 1GMEA 1QSEB 4ODXA 3BGAA 3QZMA 2N0KA 2PWDA 3ESVF 1I8AA 2CCWA 1BIIA 2Q7YA 1NC2A 5JDJA 2J5LB 4B3EA 4EQ2A 2PO6C 1RIHL 3TPUA 1NAMH 1IEAA 1TU2A 2EEAA 3ARSA 1KFGA 3V0VB 5KSUB 3HLAB 5A2JH 4JJOA 3I75B 5J89A 4K8RC 2A9CA 3ILPA 4MAYB 3U2SA 3U6XS 4ZS6C 4CW1B 1KN4L 4F37K 2X4QB 1DVSA 4JRXB 3EGDA 4K9EL 2ZSWB 2FEEL 1RZPA 1U30A 1ZT1B 3WFBL 2BSDA 3VE0A 5A6IA 2GBTA 2YC1B 3D07A 3S6CA 4JFXA 5CF3A 4TKWA 3FW6A 1MLCB 5T3XH 1CXFA 2HKHH 3V4VB 3BIAX 4AW4A 1TQTA 3TA3C 2HG0A 1KT2B 1NGPL 1M3JA 3KVPA 4R4FH 3X1BA 4D0DA 3O2WL 1SOKA 3IXTB 4XAKD 2QADB 4YAQA 1KXVA 4QRRE 1C5DB 2YBRB 5CEXB 5L6YH 3IFNL 5D93C 2L04A 2R1WA 1OHZA 1Q9OB 5AAMC 2BDNL 1MAJA 3HI6L 3PWPA 4AT6B 3HRPA 3M1BB 5IESH 2XTSA 1J9CT 1DJIA 1P6AB 3Q7JA 4JG0L 4OFYD 4ZZKA 4QHMB 4OJDH 2LABA 3BPLC 2NNXA 5CLYA 2CGRL 3B2XA 4PREB 3W39A 1AIZA 1LDPL 2VLKD 5ESAB 5GZOD 1QUNB 4EKXA 3MOQA 4CC4A 4NNYB 3SKJH 3DX2A 1VAHA 5B21A 3TC9A 4NIYE 4H1LG 3GRGA 3RFZB 1WBZA 3VW3L 2C9UA 1F4XH 5EULV 1V3KA 3NJGA 1QBLH 4L4VE 4G82A 5IMOB 3MRRB 2YR3A 3TVMC 3UO1L 3TT1H 3BQUC 1ITCA 3G5XA 5KYXB 5EF3A 1J9TA 3IAGC 1JPST 5DRZB 5EO0B 2I32A 1FL3B 4LCCA 4U3CA 4BH7A 2W07B 1RXLA 1EJ8A 5F96L 1F4YH 3CLEL 4QXTB 3HI5H 4DP8X 1OCCB 4PJIE 1SMDA 1J18A 4G1EA 4XI5C 3ISRA 4E9XA 4FKHA 3EG9A 2GIMA 3QUZC 3TLRA 4N0CD 3AW5A 3OXSB 4HMEA 1YO4A 2IQ9L 2KQMA 1P4LA 2E6QA 3ASNB 4DGUA 3NPSB 4POUB 1QSFD 3X14B 3WFBH 3PDOA 4POZD 3ERXA 2D4DA 4PUBH 4PMEA 1AZCA 2BW5A 4IRSC 1DSWA 5KVFL 4XMPL 4V1DA 3VFMB 3ZTCC 4HOWA 2GT9A 3UZEC 1E0OB 2FBOJ 3DO4A 2YD1A 5C0JB 2WIIA 5D1XB 4OQTL 1P5UB 3HHSB 2OP4L 3MC0A 1DUZB 2KERA 4HIHA 1FDLL 3IDMA 2RH0A 4FLRA 4AZ8A 2J1XA 1Z9PA 3KHQA 1I85C 4NRZA 3GSQB 1R75A 1QLRA 3K0WA 1B3IA 2NSMA 3DX9A 2X88A 2X4SB 3HNVL 4QXVA 1MUJA 1K3ZA 3CK0H 1AQMA 1NANI 3IFNH 4ORGB 1K4CB 1YECH 4OFKA 4DWHA 4GRLA 3E8VA 3GIVB 1T0MB 5DJAB 4WI6A 4AL8H 2YA0A 4JM2B 4M8RA 2XHNA 3RB5A 1WICA 4JG0H 5GS3A 3FN0H 3Q06A 1QFUH 5IOKA 2DWYA 1XCQA 1CYGA 2VLJE 4Y2DB 2VDKB 2XZZA 3VI4F 4C56E 5IHUL 5I71B 4OZGE 1KPVB 3LEXA 2WB7A 3VXNA 3MRPB 2NMSA 2GUYA 1U0QA 1AQ8A 1IGJA 1LDPH 4D9LL 1QLEL 1WWCA 4IS6A 4J4PC 1NMCB 1ROCA 3HI1A 4MHHI 1UCTA 2HFFB 2R4SL 1SXNA 2E6JA 5G4NA 1OZTG 2J73A 4N20A 1R3IL 3VW3H 4EI6B 4L8SB 2Y5QA 1XB3A 4Q9RL 3EOBA 5JXED 3NCEB 3WKPA 1M53A 5HHPB 3SDDA 4I85A 1DDHB 3UO1H 1TO4A 3LIZA 3KE0A 3CXFA 3NJMA 5I1CH 1JGEA 3DKHA 2X4NB 4XMKL 3T08A 3BUBA 3M07A 4HDIB 5KBDA 4KDTC 4TUOA 3D85D 4EBQH 3L9EA 4NCDA 3MRMA 3IMRA 3CLEH 1ZD6A 1DN2A 3ZE1B 5DJDA 1KLUA 3OR6A 3W1ZA 4EIBA 4AM0A 4N8VB 3BFOA 2IQ9H 4Y16B 3QJUB 3F7YB 5AOJA 3CUPB 2JI3A 1K4DA 2KMWA 3AITA 5E6IB 4OVUA 3R8QA 1NH6A 2F53A 5TQ0L 5I1AB 5KVFH 1ODUA 1EZSA 1NBCA 4KUZL 1FGVL 1U8NB 3E7JA 4PTUA 1IZKA 3DIDA 4GMTL 1IM9A 2VTFA 2GVYA 4Z7UE 5L8JB 4U0RB 4YMPA 4IBTA 4WW2F 1DQTA 1XH1A 4L29B 1OB0A 1TNMA 5E1HB 3V4VL 1OD9A 4RAVB 3LIZH 1FFPB 2JJSC 4UTAL 1MIEH 1R3KB 3HAEA 4NN5B 1HSBB 2BSSA 3V4PB 2DLFH 5FIEA 5A2AA 1NKOA 2MNJB 2EXWC 2HJKA 2OW6A 4ZFGL 1B4RA 1KULA 1H8LA 1X9UA 3BAKA 2NX5E 3PGDA 2WKOF 2VDLH 4NQCE 1ZDSA 3O9WB 4R8WH 4R7DB 2YPVA 4WUKH 3POCA 1C1EH 3V0VA 3NG5A 1UWYA 5EFIA 4KJYA 3VXOB 4MLSA 4APQB 3I75A 1SXCA 4QIRA 4MAYA 2FX8L 2Y7NA 1QFHA 3I3EA 1OGAB 4FI7A 2APVA 1X5JA 2D7NA 4PR5B 4AG4L 1FVDB 1NUNB 4JRXA 4NP4L 2FK9A 2Y7LA 3PWJB 3BUQA 4KHTH 3CLWA 3NABH 4GT7A 5DVMA 4R6UA 4WZ9A 3L3IB 2NY0B 2HVKA 3DK0A 1MLCA 2J57A 3ELAT 2JB5L 1LEGB 1BGXH 4GBXD 2X1QA 3GMMA 4LLWB 3V4VA 1QZ1A 2AK4A 1SBSL 4OF3A 3QFJB 1DQML 3HAEH 1PL3A 3L3DB 3OQRA 4PQXA 4UTAA 3SJVB 2DM7A 3MO1B 3VGEA 4TTGA 3L5IA 2YAOA 2CRMA 3D69B 3ZBMA 3BO8A 2XA8H 4QHLA 5AYUL 3VFRB 1BF5A 4X9IA 2J5WA 2YBRA 4XCEB 3FU6A 4P5TD 3P0YH 2DMCA 4JGJA 2P5WD 2BHFA 5IEKB 2YPVH 1BA9A 1IM3D 1G0XA 1U41A 3EFFB 5A2LH 1YNTF 1J1XL 1UACH 2CDGA 4RETB 3HB3B 4A66A 4KQ0A 3QNFA 4QHMA 2OTUB 3F65A 3WI9A 1SLUA 5DT1L 1T4KA 4KX7A 3O4LA 4PREA 5F44A 4WFEE 5GIRB 3NOIA 4Z0XA 1XGQB 4G11A 1GGBH 4RFEB 4LSUL 3D51A 4GMTH 4IRJD 1PJWA 1G1KA 3U25A 1Z9MA 3B6SB 2C4FT 2Q10A 1J1OL 2B4CL 3CQQA 3TCTA 2ZAIA 4UTAH 4XVSL 1S3KH 2F7OA 2GJ6E 3P9MB 3VG0H 4GUOA 1NAKL 2XQYG 4FP8L 3T0AA 4ZZFA 1KGIA 4M1DH 2VITB 2VMEA 3NIGE 4ZFGH 4MNQD 5FK9A 2X9ZA 2YUZA 1P7HL 1P4BH 4F2MB 5F9JB 1MCWM 1MXDA 1TEYA 1Q4NX 3FQNA 5DRZA 4KXZH 5DJ0A 4Z7WA 1FL3A 3V5DB 3D9AL 2NSXA 1HTYA 1OAUL 4QXTA 4LSPL 4OCYL 4PD4J 5KVEH 5D4HA 5AQ0A 2UVFA 5D71H 1QW9A 1BREA 2FX8H 2UXVA 3CFJB 4XNZB 2VDKL 1JG9A 2DS4A 1PQZA 3EBHA 1BWWA 2OSYA 3EJZC 3CSBA 4X8XA 2Q76A 1GKEA 1KZYA 1B4TA 2W0PA 1RZJC 4RAHA 3QWRD 4XXDB 1BZ9B 4H5SA 3T71A 3JWDH 5KSVB 2F19L 3C09C 4Y5VA 2VR4A 3BISA 4X6EA 5JDSB 3IFLH 2OL3B 3IMVA 3KPTA 4X4MA 5CN2A 3ZYIA 5C0JA 1HHIA 5CJXC 5KYYA 3EFOA 1A6ZA 3HHSA 1DUZA 1DQMH 4IOIB 1KLFA 1JHTA 3DIFB 3LXUX 1VFUA 3RVUC 4BK5C 1JZ6A 1LM8V 5IW6B 1SY6L 2NZ9D 2EC9U 2V3DA 3S2CA 1A6VL 2BK8A 3FBQA 1NEZG 1S3RA 5AYUH 4ERSL 4HZ1A 3B2PA 2WLYA 4LOVA 2GHWB 3LH2H 4MJIE 4ORGA 3MV8B 3GHBH 3IDJB 4JZJB 2ZKWA 3OL2A 3QDGD 5GGRY 1JVOA 5F89A 5C09E 3V6FB 3AB0B 1YEJH 1U8KB 5AW7B 1J1XH 1KY6A 5CN1A 3KXFE 1EPFA 1NSNH 1OWRM 3BH8B 4Y2DA 4FYTA 2QSTA 5DT1H 2Z65C 2OMUB 4PH8A 4GJTB 4TLKA 1AGCA 2EUZA 3VB9A 1UEYA 4Z18A 3JYCA 1M42A 1E3XA 5I9QB 1ASOA 4RMRA 1DLFH 4RSYA 5CKGA 5BJTB 5CJOL 1J5HA 2N1TE 4EN3C 1S78D 4WEBH 2ZCHH 1EO5A 2B4CH 1N64L 4L5FL 2I60L 2G2PA 1CR9L 4EI6A 4L8SA 4NQSA 5E8DH 3R1GH 2AQSA 4MSWB 4L4TB 4NAJA 1G7HB 5HHPA 5L8LB 1ZVSB 1HN1A 2ZKXA 5F1NB 1DDHA 5E7BA 2YEZB 2Y36H 4XGZB 5IVOA 4MJ5A 3HPLB 3QG6B 1RK0B 1TJHH 1URLA 2X4NA 4LGRB 3V4PL 1E3ZA 1OAZL 4HDIA 3UTTB 3PWNB 5AVYB 2QFRA 3BQVA 4XNQA 4TOYL 1OAUH 3G6JE 1CQKA 2IH3B 4Z77B 3WV0A 3M17B 3QJRB 5E1IA 5T1KA 1T1ZB 3FPXA 3KAAA 4N8VA 2ED7A 3ZYJA 3LRSB 4Y16A 3F05A 1GZHC 3EYQD 1Q1PA 3TWYA 4G83A 1QO3A 2KPNA 3CN1A 2VDOH 3QEGH 4JQVC 2MOVA 2NY2C 4AYMC 1JV2B 4L1SA 1BBDL 2F19H 1YYLL 3BSHA 2B1AH 4Q52A 4DP2X 4NC0B 5EF1A 3IWUA 2QDWA 4QTHB 3C5JB 4L0PB 4L1BA 1RHHA 5EBLB 1E9QA 2K4WA 2VJ0A 5DS1A 3TGXA 2EIBA 1UADC 3W0WA 2Q2EB 2R7EA 4N2MA 4L29A 3CVIH 3OG6B 4NO0D 5G5DA 4ERSH 4RAVA 4KQ3H 2A6DB 1JD7A 4Y89A 5ACZB 3DX7B 1HSBA 5DLLA 1MQKH 1YMMA 1FYTA 4PHXA 1H6UA 4HIPA 5FA4B 5D2NC 1CF8H 1WE5A 1NMAL 2CHDA 2QMJA 4ZUUB 1A8ZA 1LXMA 3VGFA 2A83A 2H32B 3KL0A 1SRDA 4LNRA 4U1LB 3V7MA 3N5AA 1DBBL 4QKXB 3FFOA 3LN9A 3C9NB 3KLHD 1GZPB 4OZFB 4H1LA 2NCEA 1D6VH 2FAUA 2GSIB 1XR9A 3FT4A 4KI5E 4OIFA 4N28A 2E8YA 4MKMA 4M3JA 1MFCH 1CE1L 2ZUQC 4XPAL 4DP5X 4AQAA 3DRTA 2P8PA 2R0LH 3DYMA 5CJOH 2P4AB 3W9EA 5EIQA 1BZDA 1DYZA 4G8EA 3Q2NA 2AMUA 4K94C 5E8NA 1FIEA 3GMOA 4P2RB 4PRPD 4FQXD 1P5VB 3O6FD 1R3JB 4PLKD 1WZMA 2ODIA 4DTGH 2VQ1B 3MTXA 5JO5A 4QRAA 1CDGA 3QUMB 3MO1A 1OAZH 4HJTA 3VI3B 4FQ2L 1N68A 1A6UH 4G8FA 1QI3A 3VFRA 4M6OL 5JOFA 2VE6A 2WUCL 2GFBB 1G9NL 5CP3A 3QZOA 5AYTA 3G5VB 4KPHH 3QJXA 4H1LH 5DFVD 4CILA 5ITBH 1CCZA 4BDVA 1PEZA 2X4RB 1Z5HA 1KTBA 1S9VA 2VQUA 4PLOB 4ZFOA 4A2HA 5TE4L 1U2CA 3T6XA 1CZ8L 1HK6A 4LSSH 4BWTA 3MBEC 3KPSE 1IFHL 3CPUA 2ORBH 1RZQA 3DV6B 2JCCA 2IH8A 3OAZK 2EE2A 4UBDC 3D85B 2JVUA 2N0MA 3IKCA 4PBXA 4EZKA 1WLHA 4HEME 5TDPB 3B6SA 3DVGB 3N44B 2OL3L 5E9NA 1TTRA 4Y8AA 4FJ6A 1A21A 5EZLB 2ZONA 1XCTB 3KL5A 5AG9A 5KVFE 3G9AB 1H6FA 5HPMB 4PTTA 2YXVA 2VUOA 3BDXA 5F9JA 4F2MA 3QO1B 3N0AA 5HVFB 1E7VA 3MCG1 4JO2H 1DBBH 2BRRL 1JPSL 1OP5K 3MRHA 2X1WL 5CP3H 3KDMA 4LZKA 4QT5B 5GGVY 5CKAA 1OK0A 1W6WA 2PXYB 3V5DA 1X5LA 4LT7A 1LP9E 4ZS6D 3AADB 2AERT 1I1FB 1WTLA 4G6AC 4XE5B 4Y8DC 4E9YA 1CE1H 3WU1A 4CBPA 3ATBA 2EEXA 4RISL 4GS7C 5GGUA 3T0EC 4PCKA 5FM8A 3C6EA 2BPBA 5FYJL 4BM7A 5BO0D 3LQAL 1D5IL 1BJ8A 3MJ7B 1BZ9A 1FV1B 1C9SA 3OKMB 5JLZB 4HWEH 3I3BA 2XKUA 5JDSA 2D7MA 8FABB 4K73A 1IQWL 3B56A 3EAKA 1N5YL 5FA3B 3L4CA 1EGJL 1CIDA 1RUQL 2F53E 2YXWA 2ZUXA 3H7LA 3GBML 4HJGB 1IBDA 4JPVL 4XO9A 1GYUA 3P73B 4IOIA 4YHIB 3DIFA 1FLTX 3MLWL 1XSIA 3VGGA 3VFWB 4HOMA 2Z0UA 3BKMH 3K5SA 5IW6A 2HT2C 4FQ2H 1O5DT 1XTMA 2ADIA 2VLRD 3LX9A 5CGYD 4JB9H 1E4KA 1UATA 2DM2A 1G9NH 1KEGL 4P2QE 2ZWSA 4KNTA 4PJBB 1X5FA 3COOA 3MREB 3JV0A 3RGVB 5D72H 1H15B 4YWGL 5DZOA 5I1KH 2DWDA 1SM3H 1TJMA 4IMKA 1U8KA 4NM4L 2N01B 3Q13A 5HYQB 4RX4D 1B9ZA 4OSUH 3SQBB 1IKNA 2WLLB 2IADA 4MZRA 3QXAB 4D8OA 1A7OL 1KEML 1T20B 1KTDB 4YO0B 1BVOA 1RU9H 3LH9A 1UD4A 4O51A 2AJVL 3UAJC 2EDXA 3FQXA 3WMSA 4RRPG 5J1AB 3VQLA 5IOPA 5DZ9A 1FBIL 4OV6F 4NUPA 4P5TB 5CBAB 1JGLH 3FQTA 2IG2L 2R8SL 4YDIL 1JYVA 5I1IH 3CCHA 1IM3B 3SPCA 4X6FA 3HFML 1OF0A 3B7UX 2W95A 4JRXE 4S1SH 1XF5A 3HC3L 4OFYA 5IT2L 5F1NA 4BQCA 2J25A 2P7TA 2VR9A 3NGBB 4YSOA 4B0MB 5JPNB 4OFVA 1FC2D 3CZUB 4XB8A 1O9WA 2BRRH 2ALWA 4M7LT 4PRIB 2GW5A 1D2PA 4XP4L 2VLKA 4EVNA 5GZOA 4PMFA 3T5WA 4X7SH 4IRJB 3DOIA 4HJEA 3QUZD 2WAQA 4JFED 2DQCH 1L5GA 1O6VA 4S0TD 5F6HI 1HL4A 2IH3A 4Z77A 5IR1B 2JI2A 4DO4A 5DMJB 1YUKB 1WK0A 4MD5A 2C9SA 4AV0A 1I1AC 1T5XA 5DC0A 5ILTL 3Q8AA 3WJJC 3HS0C 4E5XB 3US1A 4HWUA 3RNKB 2X3AA 4TL4A 2BSBA 2WXJA 3ES6B 5F3HB 1ZA6B 3IU4L 2BNRB 2EVHA 4ZAKC 2J55A 4WI9A 1KENH 2EACA 4OLZH 4JREC 4P9HL 3GIZH 4QTFA 1BX2A 1T7VA 1Q0XL 3M8OL 3VFSB 2DB8A 1FHGA 4JY6B 4XN9A 5ACZA 1SDDB 1HE8A 3QUML 1QSFA 1KNOA 2PETA 3KPOB 4U33A 1ZTXL 2OLDA 2H32A 4ODSH 2O61A 4JFTA 3VG9C 4ZMVA 3ME0A 2WWMD 5IF0B 3ETSA 4H40A 3VXTA 3DUSA 1HI6A 1U8IB 3EBIA 1CG9A 3R4RA 4OZFA 1OP3K 2I9TB 4KKLC 1X5AA 4OLUL 5E24E 1KB3A 1SUHA 4J4PD 2B2XL 4PY8I 4ZODA 1NZRA 3KBEA 5IQ7H 1RZGA 1S7VB 1P9MA 3FDWA 3CHQA 4Z7WE 3AG4B 4MASA 2Y1ZA 1HH6A 3TH3T 2OTWB 2XTJC 5FYLL 5EH1A 3GD1C 1NFAA 4IKIA 4JBSA 2R8SH 3RX7A 3S96A 1JGDB 5IQ9A 4ZMLA 1P5VA 4HK0A 1QR4A 4X83A 3SHSA 5KTEL 2LGNA 4O2EA 5AW9B 5FCUL 2PKDA 4Z7UF 4BK8A 2VQ1A 1QAWA 4Z0BL 5D7LB 3QUMA 4NO5A 4TQHA 1XAUA 3U4AA 4XP4H 2JELH 3AT9A 4X4ME 5CHNA 1WFIA 2BSRB 2H32H 4LCYB 5D1XE 3BEWA 2E74C 3M46A 2M83A 4ES8A 2X6VA 4JAMA 2WLIB 5B3JE 1BYNA 5ESQB 4ICXA 2YKKA 5LAXA 4A39A 3G5VA 2JV6A 5J12B 2GY5A 2Y69B 2LT9A 4L3CA 4OZFH 1KYFA 2EZ0D 4RMTA 2BSTB 2XRAH 4O2CB 4LLYB 3OHXB 2A73B 2G3XA 2X4RA 3RX5A 3SQRA 5ILTH 3G6AB 4EOWH