4XOAA

Crystal structure of a fimh*dsg complex from e.coli k12 in space group p1
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
279
structure length
279
Chain Sequence
b'FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FimG
molecule tags Cell adhesion
source organism Escherichia coli k-12
publication title Catch-bond mechanism of the bacterial adhesin FimH.
pubmed doi rcsb
total genus 53
structure length 279
sequence length 279
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00419 Fimbrial Fimbrial protein
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4xoaA01
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4xoaA02
5AB1A 3JWNH 5LNEA 4XODA 2WMPB 3BFWA 4X5QA 3ZPDA 4AUUA 2UY6B 5FWRA 3ZL1A 2J2ZB 1TR7A 4CSTA 4X5PA 4AVIA 5IQMA 2UY7B 4AUJA 4LOVA 4X50A 4AV4A 2XG5B 4X5RA 3ZL2A 4XOCA 4AV0A 2W07B 1N0LB 3SQBB 4CA4A 2JTYA 3JWNE 1UWFA 4XO9A 1KLFB 5IQOA 3MCYA 5F2FA 5F3FA 2XG4B 1KIUB 3ME0B 5FLUA 5FS5A 4AUYA 4CSSA 4J3OG 5AAPA 2JMRA 2VCOA 4AVHA 4J3OF 5ABZA 3RFZA 5IQNA 5AALA 5FX3A 1PDKB 1ZE3H 3BFQG 3JWNG 4AVKA 4XO8A 4BUQA 1QUNB 4AVJA 4XOBA 4XOEA 4ATTA 5LNGA 4J3OH 5JQIB 5CGBA 4XOAA 4AV5A 3BWUF 1N12A
chains in the Genus database with same CATH superfamily
1NWPA 1HCYA 4DFHA 1JF6A 3B9KC 5EPMB 2EXWD 3NJXA 1JZEA 2XYCA 3RY6C 4G83A 3C5SB 3UCRA 4XVTH 3AITA 4R0LB 2XQBL 2VUKA 4PRHA 3FUIA 1S2EA 3Q8CA 4FYTA 4C4KO 2YUVA 2W07B 4RQQB 3UMNA 2EDEA 1QR1A 3FU0A 4Y2DC 3ZKMD 1UH4A 2LTQC 2CKNA 4CGUB 3RX7A 2N4IA 2WN2A 4ICXA 5ADOL 1KFGA 2IANB 3QQDB 2L7JA 1WCQA 1N10A 3FO9A 1YPZF 4PJ7E 5ID0B 3MJGX 1WBXA 2QVTA 2ED6A 4IOFC 1M56B 4LSVL 4XNMB 5DJCA 5LGYA 4XHJD 2NT0A 2ICES 1LO3H 3HCVB 3QUZB 4IMLB 4LLMB 1HXYB 2PO6C 3QPQD 2V9TA 4HS6B 2FUQA 2ZT9C 1UM4H 1TR7A 4KXAA 3OBAA 2R2CA 3CFCL 3OR7A 1YN7B 5IW1A 4AQZA 5IV2A 5AQ0A 3NEOA 3D0VB 4MMZC 4J3BA 2CGRH 1P53A 3QUZD 5D7KE 1VF5C 1GOHA 5D1ZI 3GI9L 3IEAA 4X99B 1MY7A 3HC3H 2WLKA 3AB0C 3L1FA 3M8OH 2ADFL 1ZD6A 4PRBA 4WW2A 3DPBB 5CM1A 2IAND 3H9SA 1X7TA 4N0UA 4UT9A 5AB1A 2YQ2A 3QT2A 5DZLA 3I84A 3BAJA 4X6DF 4XMVA 1WVZA 1X9RA 4PFEA 5EORL 3CU1A 2F9BT 2ZYHA 3HZMB 2HJLB 1MNNA 3IGUA 4TNEA 4HJ0C 4PJ5E 3U30B 2OR8A 4L8SB 1EFXA 1HINH 1OPGH 1IC4L 1UZ6F 2X5PA 4YR6A 2O5ZL 5EOTB 1MUJA 1T7YA 2BW4A 3H6JA 2COVD 3I02A 4L1HA 5FECA 3KW8A 4U6VL 1BG9A 4P2QB 8FABA 3QI9A 1WISA 2OZ4L 4EEEA 4OUUA 1FBIL 2XHNA 4G80B 1LDSA 2K70A 4NO3A 2WXGA 4NHUB 5FKAA 5INDB 5FLVA 3KPMB 2Y0SA 4NO3B 1SRDA 2X42A 5SWQA 5LGHH 5TE6H 2GYSA 4ESKA 1WE5A 4TRPH 4PV8B 4F15B 2H26B 1ZY9A 4NC0B 3ETBF 2VNCA 1OP3H 3LKNA 4KKBD 4WRLA 1DQIA 4XWOC 1NBQA 3KDMB 1Q72L 1SVBA 1Z9LA 4X4XB 3MRFB 3RPIA 4YFLF 5L8JB 1BMWA 4ZQKA 2M8XA 4OZHF 4GINA 5IW1B 1I9JL 1QO3A 1U8KB 4JL2A 5CGBA 5CJXC 4ZBJA 3VXTA 5AZ2L 1DBJH 5DK2B 4GBXB 4QRUA 1OANA 1MWAB 5B39B 4ZFOB 5L4FA 2A6DB 3WE6B 1KG0B 2EZ0D 5AW3B 4BQBA 3DPBA 3UBFA 2VR5A 1I1YA 4NJAL 3ZKND 1VADB 3MACH 4KKAD 1K5NB 2ZWKA 4RFEA 4WU5B 5AWNH 1SHXA 2R83A 1N26A 4HK3J 2VWEE 1MFNA 3RKPA 1OOWA 3AMKA 3V4UH 3SBQA 1YHPA 3EBIA 2QSVA 4JRYE 1CURA 3L95B 1N2RA 3BOVA 1IFHL 5I30L 3G04B 1NC4D 2YR3A 5AW9B 1ADWA 1XHHA 1P6WA 2YD6A 3MGOB 4OLVH 2OMWB 3TZVA 4CADA 2FJHB 1TQBB 4GRWE 3PV6A 1PVHA 5AZ2H 4N0RA 5MENE 1DL7H 1QRND 5D4JA 5B1BB 4B50A 4N5ED 5GRJL 2Y2WA 3SDDB 5CO1A 1HHGA 3ELAT 5LGKA 4BRJA 1ZGLM 1MHEA 4GKNA 4X80H 1LWRA 1IKOP 1BYOA 1U3HB 5FUZL 1VA9A 4M8QB 2KERA 4H88H 1M7IB 3SKNA 4U05A 1JDDA 1KGUA 4FFZA 2GJ6B 1BQSA 1A6TB 1R6VA 4GXVL 5KZCB 3GUFA 3CFDB 1QBLH 1CYXA 4M7KL 3Q2VA 3WJJA 2DQCH 2GTZA 4YBQD 4F8QA 4GAGH 3QCTH 3MBEC 2Z31A 4G8FA 3CC5B 4OCRH 2CIKA 1C5BL 4LARL 4X6DE 1U6AH 3VSUA 4Z76B 2Y23A 2DJUA 3IYLW 2GHWB 5FOJA 3ULUL 4KK5D 1TQSA 1AIFA 2Q7YB 1FBIH 4L3EE 3D39B 2W9DL 1BLIA 1NIDA 3S36L 4BSJA 5L7XL 3U6XS 1IT9L 4M5YL 3WMPA 4KJWD 3LZFL 3VB9A 5L0QB 2GSIB 2N1KA 3ECVA 1LTXA 2YMXH 4GXUM 4R97C 1WZ1L 4KK6D 5L0QC 4NQEA 4I3SL 4LSUL 2VOTA 2X44D 2XN9D 3T3MB 4KXCA 2HG5A 2H2SC 1IM9A 4Z23A 3ZE0F 4GQRA 3MRMA 3CVHH 3AQYA 4K94L 4MZ2A 4RFNC 1OCCB 2RFXB 4Y7MA 5HJBA 5T33L 2LAGB 1KCWA 2NYZA 2O5YL 3K4AA 2FX8H 3CPUA 1AY1L 3N85H 2CBPA 4E2OA 1CXHA 3BUYB 3LD8C 1AXTL 1PLGH 4MAYB 4ZTOL 2PCYA 3MYZA 3ZZQA 2O6EA 3C5JA 3OAWA 3HNSL 3B2VH 4M7LT 4QO1B 3RWDB 1I8KB 2EC8A 4AL8C 1W2KT 5G4MA 3S8FB 4ACTA 4IHBA 4MZRA 2EO9A 5LBVA 2PUQT 3SZ6A 3MROB 3EOYG 4QLWA 3FTVA 3S98A 5JNYA 1KB5B 1ZDQA 2YARA 4NQDA 3HUJE 5JDSB 2JJSC 5IP4A 1I8MB 2NY4B 5IHUH 1BMZA 4QKTA 4B3EA 2VW4A 1SEBA 2FGZA 1KPRB 1UCTA 2H32A 2HRPL 2HKFH 2APVA 3POHA 5D4HA 4KTYA 3RNQA 2BSED 2IGFL 4PY8I 1OK8A 1YNTA 2ZYSA 5IMLB 1I8LA 3D39A 1A3RL 5EOQH 3RIFK 2X1PA 1MFDL 2X9WA 3U0PA 3QJTB 1TTUA 1AY1H 1VIWA 3OAYH 1R3HB 4ZMAT 4IRSB 2QPSA 3L5WB 3KEDA 5IHZB 2QPUA 3FCSA 2IFFH 2IO5A 3KWWA 4PJ5D 5DHYA 3STBA 1KXVC 1NCWH 2NUTB 4JY4B 5FDWA 5D1XD 1GYAA 1D6VL 2JKJA 5CSZA 5CR1A 2VC2H 4PJXB 3OG4B 3V55A 4CVXB 4OM0L 4CSPA 2OMYB 4M6MH 2XWDA 2V7NB 2HN7A 3VGFA 3VXNA 1AZUA 4GO9A 2VL4A 1EDHA 3CVHA 3EFFA 2ZUQC 3WV0A 3OHMB 1MRDL 4K2UH 4ELMB 2EVJA 1T04A 1CZ8H 5CHNA 3OPZL 4KV5E 3MUZ1 2Q0ZX 1JRHL 2DQJL 3MRQA 4HBQA 5SWZB 2R69H 2ZG3A 4HUNB 5BOPA 2BK8A 4Y1AA 3MKKA 1RMFH 5EIVA 1FFQA 5H37H 1KULA 4PRAB 2DDQL 1IQWL 1HCVA 4D9LH 5F21B 3AGWA 3A6BH 1SYSB 1JFQL 1VFAA 5GRYA 5I6XB 3RJDA 5CCKH 3L9RA 3O6LL 5AAWA 1G4RA 2OPCA 3Q9QA 1AD0B 3CHSA 2DD8H 1XCTB 2EYSA 4MQTB 3BVXA 3NFNB 1JGDB 1H6FA 4YHZL 4PCKA 3KS0H 1ERNA 3QRLA 1QFWL 1JTPA 3S96A 3JYBA 2H41A 2JMRA 3QA3B 4BQCA 1T4KA 5IQNA 1XXFC 4L8SC 4EUPG 1VCBC 1IEHA 3ARVA 4NFBA 4NZFA 3SCMC 5F3BA 4N2FA 4BGLA 3PV7A 1RZKH 1QLFA 4XWGL 2FWOA 1U8PA 2Y3NA 5IUSA 2F1AA 1EHAA 4KDTA 3RVTD 5IROD 2EIKB 5HD8C 3RDTB 4GUQA 4QTHB 4EUPH 1AOHA 3C75A 2PXYA 1IEAB 3WNIA 4IHOB 2BERA 3WO4B 1RJLB 5C0RH 2DW5A 1A6ZA 1KCRH 1KV7A 1R47A 3VXQA 1D3CA 1CGYA 1FN4A 2BSEA 3SQOL 2WNXA 2ZAGA 1XF1A 2DQ6A 5IR1B 4FXKB 5BW7C 2R1XB 3RX9A 4EN3D 3JTSA 4TUJB 3SDCB 5KVEL 4OI8A 1AR1C 3ZQWA 3MLRH 4O4YH 4LRNH 3ZE2F 3SOBL 1PG7H 5MHSD 3H0TA 4KOBA 1NEZA 3V9FA 2BM3A 4HPHA 2FAUA 2NW2B 2IANE 5GGSA 2NX5A 2PTTB 1T1YA 1XSIA 2ZOLB 4GEIA 1UA3A 1O9ZA 4Y5YC 4XC3L 5AZUA 4P06A 2WZPA 2VAAB 3VWJC 5C2BH 4S1RH 3B9VA 5HYSA 3ZBMA 4BZ1A 1U3HA 5BCAA 5ICYA 3PQYD 3CAFA 1UWGH 5E1AA 4XO8A 3LKPB 2VABA 4NRYB 4EDXB 3CXHK 5DHYB 3BEVB 4UT6A 4YSDA 2XWXA 1J0JA 1F8TH 3IF1B 4HUWB 4QT5B 1CGTA 2JJTC 3QJXA 4JM4L 4NWTH 2B4CH 2BX5A 4G11A 5EO9A 4P2QE 5EU5A 3TX4A 4ANKA 4F9LA 2ATPA 3PHSA 4K5LA 2P5ED 4NQSA 1TPXB 2OMUA 4TN9A 3OKMA 5HVHB 2O6DA 2YGNA 1RKRA 3LOWA 5IROA 2XETA 2JKRM 1F4XL 1ZOXA 1FVDA 4C56A 3L3DB 2JB6A 4Z0BL 5C92A 1QSED 4XHQA 2G2NA 3SGKA 4M62H 3WJMA 1CL7H 3J8F7 5IB3B 3U1PA 1S3RA 4EAEA 2XTJE 15C8L 1F41A 5HI3D 3FOMA 4OW6A 1WWWX 3IGLA 1M57B 2VLKD 3GMQB 4PWGA 4O02H 3S5LB 2CJSA 2FUTA 1JPFB 2WBJB 3QZPA 1HXMA 2EDXA 4U4IA 4JHWL 3MLWL 4JO3H 5T3XH 2HKHH 1ZHBA 2YD2A 5DEFA 4AT6B 2D3VA 5I1EL 5E6YA 1GPOH 4BUHA 1NL0L 1QPKA 2XQYA 4X6CF 1DLHB 4K15A 1WLHA 4H1LH 3DI3B 5GXBB 1HIML 5KVDE 1MWOA 2WYIA 2ORBL 3KLDA 4DJMA 1RVFL 4YDKH 1E5ZA 3FOLA 3NSDA 1OTSD 3HHSA 1JZGA 1M71B 1PDKA 1FGVL 4K9JA 1PG7L 1HXYA 1V8HA 2V5MA 3UZVA 3RGHA 4UI2A 1NBYA 4MXQC 2CIIA 4NPJA 1NH6A 1T1XA 4X7CC 1HILA 2YN3A 3GUTB 3QULB 3ZE0B 2X70A 3O2VH 4FA7B 3RKDC 2JLPA 2X70B 2BOLA 3C2AH 4X0KA 4WVRA 4GP8B 2PR9A 4AENB 5D70H 4ZW6A 1YEJL 1BECA 3P73B 4IGBD 4HGKC 5MEQA 1JXKA 3PWPE 4X98B 1IBGH 4C56D 2LLNA 1YY8B 4IIQC 4TV3A 3NVQA 5FYJE 3K7UA 4KKRA 4MQSB 4QNPF 1CICC 4KTEH 3F5WA 5J0BA 4IKLA 4PP1C 5G55A 5E9DD 4KPHH 5D1QC 5DJYB 1B88A 1MCPH 4K7PH 4HFWB 1JGUL 4BCYA 3EUDA 4XWGH 1HWGB 4OAWA 1SMDA 1HH9A 2HX9A 3BKYH 3MSPA 5AZEH 4H2CA 1RFDL 12E8L 2GIYA 5LUMA 3NSXA 2P8PA 4ANXA 1AOZA 3AG1B 2W91A 3DX1A 1UA6L 5IQLA 5GRUL 4EVNA 1LNUA 4M5TA 4ZG1A 1TT6A 2CA4A 3CVDA 2LQRA 4X6BB 4AQ1A 3TV3L 3VM5A 2P1YA 3X14B 1D7FA 1Q94B 3O6LH 5D7LA 2YD1A 3I9GL 4A39A 3OJVC 3S3JA 3MKGA 2VLKA 4HS6A 4YAQA 4ZW3A 1VFAB 2RIKA 4GW1B 3ZDZF 4UCFA 2EE9A 2Z93B 5FCSH 5CZVH 1D5XB 1I85C 9PCYA 1CE1L 1TZ8A 2ITCA 4XAKD 3L7EA 4HP5A 2UXVA 4IEFA 4UM9A 1G5GA 2QFPA 4ZUVB 5KWYC 3W5MA 2JKWA 3HG0A 4BXSV 2X89D 1P7HL 3NZ8B 3HNVL 3WHXA 3N6YA 4RFEB 4K4KA 1NBYB 2XDHA 2Z6FA 3DX4A 3UO1L 5J6SA 4BEIA 3NZ8A 2DIBA 4KWUA 2Z92A 3REWB 2C7UB 3KE0A 3UCQA 1RHHA 2VQTA 2OK0H 1E8YA 1TVHA 2I7OA 2NQDA 3I9GH 4QUOA 2VXTH 4NHCL 1SHWA 3U4BH 4LKCB 4S1RL 4KY1L 3S35L 5ESQA 4WCYL 5KSVB 4F92B 2YZ1A 4YXHL 3ZE0E 3QWOB 2V17H 3PXLA 1ACXA 1S7RB 3OLIA 2IQ9L 1WJ3A 3FAXA 1U3YA 1A25A 1WS8A 2TAAA 3TN0B 3HG4A 3GSNH 1RY7B 2VR9A 3VFUB 4P23D 4OZIA 4D8OA 4PCSA 5LDSA 3TIDA 3OAUL 3CZFB 2O61A 4LU5L 3LPFA 3IJYB 2V4LA 3MUGA 5LAXB 1E42A 1ZGLB 4KQ0A 4GXFA 1X7QA 1TETL 1NAML 1MSPA 2C9RA 1SN5A 1RZ8B 5EIIA 4AIZB 3LZPA 3F12B 1MCOH 3II3A 2ADGA 2XICA 3VYOA 2VXQL 4NAQA 2P24A 4HIJB 1RULH 3SOTA 1KN2H 1WWAX 2R2BB 3APNA 3LH8A 1N8ZB 1JUFA 3EYVB 2XU9A 5ECJE 1I1FB 4G82A 3WY4A 3VD0A 1G7QB 3GMMA 5EZIH 4P9HC 1JPST 4NFDA 4DEPB 4LSTH 4GG6E 2XJKA 4JFYA 1SOSA 3BEVA 4NUGL 5IHWA 1W0VA 3RVXD 4M6OL 2NYKA 1IBFA 4KMQA 5D7LD 4IDJH 2A0LC 2BHZA 3QZOA 4D0DB 3MOAH 32C2A 3GC3A 2I85A 3QR0A 3MRMB 2XV3A 1I9IH 4KRNA 1JK8B 1J5IA 3CX5K 2KLSA 4PB0L 2VN6A 3SD2A 4OFVA 3RI5K 3IJHB 3RTLA 3X1GA 3QYNA 1LD9A 2FR4B 4B5EA 3AVEA 1L6PA 4XCFL 5HHQA 1JZ8A 3WIFB 1URLA 2VLJE 4G8EA 1OP5H 3GHPA 5I1KH 5BVPH 1T0MB 5JR1L 4HZLA 5IMKA 2XVLA 3OKEA 4F8LA 2VUOA 3QHTC 2E74C 1QR1B 5DD6B 4M6NL 3BUPA 4IRJA 3KYMB 4MCMA 3QRFM 3KJ4B 4JM2B 4KI5C 4R9HA 3VXNB 4HWBL 4XN8A 6FABH 4F7EB 3ARGC 4QHKI 4H20L 3L17A 4DKTA 2BNUA 2MQGA 4Y5VA 3BT2L 5DMIH 2Z8SA 4NKDA 4HQQL 5DQJA 3EYOA 3AXLB 2X4SA 1EHNA 3I50L 2EKSA 3W2DL 4NGHH 2X1QA 2NY3C 5JQHC 4IYKA 4L4VA 4PREA 1KBWA 3L5WA 4XNYH 5DRWA 4EOWH 5ESVB 3EYUH 1CTOA 2YRLA 4NM4H 4LVNC 3GSXA 1XGZA 2C5DC 1ILUA 3CX5J 4HF5L 3BISA 5D7SL 3MOQA 4AYMC 5ICYB 3PWPB 1NIBA 4TVPE 3ARDA 5T8IA 4QXGL 5D7HA 5DJ8A 2VDRL 3ZX1A 5C0FB 1UT1A 1N59A 1R5IB 3HNTL 3GXIA 3UMTA 4FXGB 5FIEA 2GIMA 2QMKA 2CUIA 1FFRA 2HVKA 1I7TB 3VXOA 5TDPA 4PI2A 4YIQA 4FI7A 1FDLL 1YEWA 4NYLB 5SWSD 4RMRA 2J1KA 2PPFA 3IMBA 4W1TA 1SUJA 3BSZL 2EP6A 3MV01 3QDJE 5EUKA 2VJ0A 3FU7A 3WE1A 3IDUA 1D9KA 3HR5B 1IKNC 2P5WD 1T7XA 1QPPA 2FX8L 1NGXA 1HSBA 4M02A 2FCBA 3BAYA 2YQBA 4PJIF 3AM8C 3TYFA 3QG6A 1DJWA 2B14A 4ZO9A 2XXFA 4NCC2 4GMSL 3ISYA 4Z3EA 5E7BA 3JVFC 2KUTA 2I27N 4FG4A 2H26A 4OCLC 3S36H 4AGOA 5L7XH 2VUYA 1H8LA 4QXWA 3IK2A 4KXBA 1BF8A 1HCFX 1YNTB 2WLJA 2P26A 4L4JA 2JCCA 2GC4C 1GKOA 4MDJB 4FERA 1OWWA 3HC0A 4KMLB 1F6AA 2JCCB 3N43F 1A4KA 1C16B 4JRXE 4M43H 4YX2L 3PPSA 1VGEL 2ESVB 4JCMA 2K7PA 2VZ1A 4XE0A 3WUZA 3WTSA 3FCGA 2Y7SA 1ZA3B 2NNXA 1MHCA 4YK4B 3AWFA 1THCA 4IBYA 4XP9L 3SDAA 1RV6X 2NY1D 1FFNA 1KB3A 5CP7B 3UGEA 2YPLD 1Q1JL 5IEKB 4CRPA 4QHMB 4FXKC 1HFUA 2H7WA 4G59C 3HS0B 4GKOA 2EUVA 2OL3A 3S88L 1E9OB 1W9XA 1R3LB 1TJHH 3TO4D 1X5MA 5IW3A 2ZX7A 3D4ZA 5F70A 1X5AA 4LRIC 3X3GH 3CIAA 4LSPH 2AXJA 4LSDA 3KH4A 2P44B 4PCTA 5EDXA 3HZYA 4KFZC 1HCZA 2NCMA 4OZGB 5IY5B 1JD7A 1NKGA 1MH5B 4IK7A 3EFFB 5EUOE 3R1GH 3AT0A 4NRZB 1SN0A 2BNRE 1VERA 1FC1A 3Q48A 1KELL 3V8CA 3GDBA 2C3VA 3TJHD 3D18A 1YN6B 3AQZA 3A3YB 3HKZA 4CADB 4QYOA 4W70A 2P8MB 3UEZA 2KZ1B 4JY5L 1WF5A 4KROB 5EZJA 2ALWA 2AV1B 2PLTA 3MRGA 4W93A 4ES8A 3X12A 4XVJL 4MQ7B 1FP5A 2J88H 3LPOA 4LASH 2BJML 3D85B 5AW7B 1RK0B 3QIBA 4TOYL 2O6PA 2ZOTA 2IGFH 1FL6B 2K4AA 3L4TA 3QIWB 3H7BA 5EN2B 3UTSA 2DWDB 3DBXB 4YGVB 3Q06A 2HMIC 1N0LA 2D7PA 2P5WA 4X0KB 5DDHB 1WFOA 4GY4A 4XP4H 3T09A 4Y7OC 4XOEA 1NDMB 1UASA 5D7KD 4KMTL 5BRZE 3A23A 3I6LD 3MXVL 5D93C 4MXWL 3VGDA 4R7NB 3WUWA 1BIHA 5MEOA 3L13A 4ZAKA 4OZHB 2H1LM 3WFZA 1O7SA 2WTOA 5BO1H 3DUSB 1FHNA 2X4SB 1UOWA 1RZ7L 3L9YA 4XMXA 1J8HE 4ANVA 4L05A 5BS0D 1YA5A 1EDYA 4PS8A 4R0LA 1D5XA 5FXCH 4YZFF 2UZIH 3NPSB 4DT2A 4FLHA 4DP2X 2IADA 3NCWA 5DU7A 5I71B 5DJ8B 2ZSWB 5CZKA 3PXHA 4K8RL 1JNLH 2CDEA 3GKWL 4FQIH 4RBPH 2LHAA 2AS5M 4L5FH 3CV5A 5BVJB 5KSUB 1WIUA 1UD4A 4U6XA 4BH7A 5TD4A 5IFJB 1JIBA 1KN4H 1V3LA 4F3FB 5DZJA 2X1OA 2VDQB 4PGZA 5J6HB 2XUWA 4XO3A 2HPTA 3BE1L 1FVEA 3KWTA 3FFCE 3MXVH 4YVNA 2K9FB 1WBZA 1TU2B 5E6SB 3U46B 3NEEA 3N55A 2R0KL 3GJFA 3B2PA 4XP6H 4Z7VF 5D1XA 4FL4B 1XF2B 3ATEA 3NJFA 4GRLC 1V3MA 5FW6A 2V2WA 4CMHB 2JQAA 1UVQA 2AZUA 3S8GB 2AERT 4AG4L 4F7PB 1IEBA 4X0NA 2J6EH 3OZ9L 3AAZA 1RUQL 3BPNC 3MNWA 4LHUA 5CJOL 5FO2A 3PGDA 4J27A 2ISDA 1EEZB 4KZCA 1XF3B 4Y19D 2WCSA 2AV7B 4UQBA 4GBXA 4ICWA 5JTWA 3HE6D 1PAZA 5T1MB 4LVHC 5C0AB 2FHBA 3FRPA 1YPZA 5D4IA 5GJSL 4AEHH 4CC4C 1RZKL 2ZUWA 4KVPA 1QUNB 4WWKC 4Y4HD 1U4EA 4JQXC 2Q8BH 4C47A 1MFCL 3F83A 4TXVB 4OCSL 5CINH 1QG3A 2VDNB 1FZKB 2DH2A 4YDIL 5J13B 1S5IL 1KCUL 3LQMA 4DVRL 3MRNA 3B34A 3VSVA 1JYWA 1AZZC 1G7IA 4ZD3L 4MJ6A 3STZB 3VRLE 4IKIA 2EDQA 2BOBA 2NYYC 3ZE2E 1JNHA 2ZQKA 4XAKE 2PYEA 1I1AA 2ED8A 3VWJD 3HCVA 4LLMA 3N42F 4DZ8A 4XT1C 1NCAH 3IJYA 3HOGA 3RZCD 5J6HA 3SE3C 2DBJA 3A5VA 1PSKL 3V4UL 1KJMB 5C0JB 2C1PA 2VMJA 2R69L 5MI0B 4QY8B 4KI5E 4DKDC 5DD5H 3F12A 4BZ1H 3QDJA 4LIQH 2WZ0A 4K71B 4BKLA 4QF1B 4K7PY 4KK5C 4FG2A 3S6CA 4QRPD 4S1SL 1MI5B 4JRWA 1KC5L 2WUBH 4YHNA 1J0IA 3FB8B 3TF4A 1KCBA 1R34A 1X4YA 4YNYB 1Y6MR 4J3OF 2BY3A 4WI0A 3LQAL 4ZMOA 2E27L 3VD2A 4UV7H 2BP3A 2KKQA 4XPTL 4F1ZA 3HN5A 1G6RH 1NLDH 2F1BA 4NO5A 5HI3C 5J9PB 5LJYH 4P2RE 2WINA 5EO9B 5EU5B 2PCPA 1K8DB 3DX7B 5AENA 2ADJB 3N06B 3PJSA 1CVSC 1GA2A 4WCYH 2QADD 4UOJA 3ZR6A 1F56A 1ZT1B 3DI2B 1U8KA 1RAMA 1Z9PA 3M1CA 2YPLE 5GGRA 1ES0B 5LGHL 5FUCE 1IILE 1TNMA 1ZJBA 4AYFA 1A8ZA 4GP4B 1RXLA 2WD0A 2XRAL 2R2HA 1KTDA 5C08B 1EO8H 1JXJA 3NIDE 5GGSB 2VL5B 4KRLB 5GRWA 4BFIA 4XXWC 5EWIL 1MJJA 5AAMC 4JPIA 4JDZA 4L3CB 2NY0C 3BDYL 3DX9A 3QFGA 4N3TA 4ABUA 3EJUA 1SF3A 2QMJA 4B5ZA 2AEIT 4AMWA 4AGMA 3ZE1E 2R4RH 1YQVH 1UUSA 5AG8A 1NJ9A 2YAFA 1S7UA 1XF4A 1KIUB 3GSOA 4CSSA 1ZRUA 4R5VA 2K4WA 5EORH 1NFAA 2BJMH 4JVPA 4NN7C 2NXZD 2XXMB 2QJDA 4U1SB 3X14A 3MFFA 2AV1A 2NY3B 3UAJC 5I18H 4DQAA 3GB7A 4R26H 4Z3FA 2IPUG 4Y5XC 1YEHL 4QYOB 1NAMA 3O4LB 1FNEB 3MNVA 3IVKA 5IQ7H 4JFOB 2J8UB 2XACC 3O3AA 5F9OL 4WFHE 1AANA 2EILB 3ARQA 5I19L 4BFOA 3TU6A 1T4KB 1E2ZA 3QULA 3L2MA 4RESB 1CFNA 2LR4A 4PJXE 4K7PX 2XG4B 1BV8A 1XSKA 1MAKA 3L4ZA 3O11B 1LDPL 4N8VG 1ZK9A 3MV8B 3IDYB 4P57A 4UZSA 4XNZC 3MV9A 3Q5OA 3BWAA 1GW0A 4MNHA 1YEFH 3BD5A 1E43A 3CMGA 4TLSA 3RGBA 4NB7A 2AABH 1QNIA 3TIEA 2EDFA 5D1ZA 4X4YA 3TWCH 3GTVA 1DFBL 3GD1C 1H9VA 4OQTH 1CXIA 1JPSH 3Q2NA 3V6ZB 2O5NA 4Q9BA 3KPRB 1IKFH 4ONGH 3F58H 2EXTA 2ZAIA 3F62A 1SFDA 2KDYA 4QPEA 4FTVD 3TV3H 2QVFB 2AITA 1KGXA 5BPPA 1T7VA 3W9EB 3G5ZB 5F7UA 1BXAA 5LNGA 1OD7A 1RJYA 4NQXA 4LOUC 4WI0B 1HEJC 1FYTB 1KPUA 1LWHA 1OY3B 2K78A 5CLXA 3BO8A 5EF1A 4G8GD 4AYEC 3FPYA 2FYVA 1QFUH 2RA1A 3QC6X 4FQJH 4TNWF 2EIZB 2UZIL 3QJHB 4TNWK 1T6VN 4MVBD 1RLWA 3BIAX 2KZKA 1OE3A 1IE5A 2LVEA 4F7KA 5JUEL 4K23L 2WXJA 3L3DA 1A1NA 4JR9L 3RJQB 2D7MA 3BH9B 1U21A 4RNRA 3D4YA 4PTTA 1UJ3B 5D1QE 4HJ0D 2O72A 3VI4F 4MNQD 4HIXH 4NQVA 4LSQL 3IDXH 2YAOA 4W4OC 4OLZL 6PCYA 4HGWB 1I1AB 5E8EB 2Q6WA 4Q52A 3VU1A 3L6FB 4YJZL 5I2IA 2F8XC 3ZL1A 3O2DH 1P9MA 2GPZA 4ABVA 1S9XA 3CHPA 2GFBA 5I0WA 1FDLH 1CDYA 2YGOA 3WXWL 4LGRB 3KYAA 3DGCR 4FMKA 4D9RE 3OC8A 4U2ZA 1K8IB 3PGFH 4EJ1C 4OFYA 3JVGC 4JZNA 2VZSA 2AJ3B 4HFUH 1QFWH 3TFKC 5JDJA 5I5RA 3O6FB 2EUXA 5IMOA 4JDTH 5FYLL 1Z3RA 3MRIB 5FV2A 1FL5B 1ZT4A 5FM5M 2IAMA 1BVZA 3V5DB 5JORA 2GSMB 3BKCH 5CGTA 1ZTXH 4O51A 4RGMB 1F45A 3VD5A 5C0BB 3IJ9A 1GCFA 1UWXH 4XXCC 5ITBL 1Z9SB 1LILA 1D9KD 3EGXA 2R51A 5DEGA 5DK0B 3JTSB 4BM7A 3ESVF 1I3GL 4H8WC 1I7UA 3QWRA 5TPWL 4DUXA 1U8OA 2YEZB 5EZPA 3SJVA 3ARUA 3I6GB 4IBTA 3WS6A 1RK7A 3O2DL 4HWBH 4K5NA 2P80D 4FQPA 4P4KB 1TKWA 3S5LG 1NTDA 1IO4C 4OZ4A 3WLWC 2V2XB 3ME0A 2WXLA 1MW0A 3UYPA 5T3XE 4M61A 2XOTA 1XH0A 1DZBA 1XT5A 1IBZA 4HLZG 3RVUC 4G6ML 4I0PD 3FQWB 4JFYB 4U7KA 4Z7IA 1KYFA 1J8RA 5B8CA 1INQB 4I1RA 1H5BC 3DRQB 3VCLA 3WI9A 5CLWA 2FGWH 2VJXA 3VW3L 1YYCA 4OZHE 2F58H 3KWVA 4TMPA 1GAFL 2NY7L 1NUFA 3N1PC 4MJHA 4PGEB 2F7IA 5L2KE 5E4EC 3R8QA 4B9YA 3IFLH 4XBPA 4YHZH 4HBCL 4H0HB 5C0CD 1J1OH 5EEUA 4KI5D 1QLFB 4PS7A 1LWJA 3FQ4A 4HUCA 2AQPA 3TA3C 2DJMA 2WXMA 2XVBA 3DA0A 3TESA 1N18A 1ZV9A 3EYQC 5EFIB 3TO4A 2AJZA 4BGDA 3QHZH 1SDDB 4I8DA 1S7VA 1MFAL 5T1DL 3S7GA 2XKUA 3PAZA 3WHE0 2OV0A 1NUGA 5CGMA 5J57B 3GRWL 1AFVH 1OTSC 2WLZA 5TH2A 3GLAA 4ECNA 3WSQH 1DANT 3EYVA 1VKXA 1SJMA 2DYPB 4Y4FB 2AABL 1AGDB 3QFJA 4PTTB 4GS7B 4RAVA 2HG0A 3F05A 2GSGB 1DQJA 4YDZA 2NR6C 3HI5L 2ENQA 2GK0B 2YUZA 3B2UD 3KW7A 3T0XA 5T3ZL 5F0LB 1J5HA 3ULAB 4JDEA 5AOJA 1XBRA 4YDVA 2VDPB 4JO1L 1A6UH 4KX9A 3SY0A 3FO1B 2ADIB 4HKBA 1K5WA 3L5XL 1B90A 4MAZA 1D7DA 1V55B 2YPVA 5FF6A 3H9ZA 3VXPB 4GEJA 2IDCA 5DHMC 3QDMA 3I50H 4RZKA 1J0YA 2LE9A 1YNKH 3PP3K 5B39A 1QWUA 5L9DH 3HMWL 1CYGA 2D2OA 2XN9E 1JHLL 4Q56A 4X9FA 1EHLL 1R0AH 2XQYG 2HKHL 4XPHL 4ZPVB 4F1SA 2XIIA 4RA0C 1ZANH 5DVLA 4PJHB 5LCVL 3T3ME 4HU8A 1REIA 2VW6A 1T1WA 5HDBB 5I6PA 4FULA 2AEQH 1HI6B 1F4HA 3IE9A 3UJJL 2IG2L 3QUZA 4XPBH 5E8DL 3V4LA 2FK9A 4ZFZB 4PH8A 3P9LA 4F2EA 1ZHNB 1Z9MA 5FCUL 2F68X 1OW0A 5F71A 2BMKA 1KJ2A 4L4TB 2CBTA 5K1NA 2EVIA 2HTLC 4L29B 3RX5A 4MAYA 5SWSE 3FT2B 4LLDA 2EXWC 4RBPK 1G9NH 3K3QA 4N6RA 4XXDA 5HGHB 3INOA 3O81A 2D7OA 1N9PA 2VDNH 1A21A 2VQ1A 4OGZA 1WTLA 2B4CC 2DIAA 2Z8RA 5D7EA 3I75B 5EBMB 1DBMH 3VFRB 3QFJD 3ARDD 4JX0A 4PB0H 4WWKB 5CD3A 5C09E 3QDAA 1GC1L 4P3WA 1JYVA 4AM0Q 3L1EA 3LKQA 4AZ8A 3QIUB 1EMTL 5DHDA 5AKSA 5IOKA 4OLUL 3MGAA 3CZSA 5SWSA 3RZWA 5EF3A 1B6UA 2CM6A 2WQRA 4PJ7B 3WFDH 5D2LB 3FT9A 3L8QA 3GS0A 5HYIA 5B7EA 3V0JA 4KVNL 1PX4A 5DFAA 2VLRE 2FD6L 2IOOA 1YY9D 1J0ZA 4Y1AD 1IAKB 2QR0A 4UIKL 1F11A 2P9RA 3H56A 4S2SA 3IDJB 4AC4A 4B9CA 1QBML 1T03H 4LNRA 2Y3AA 5C07E 5BUAA 4UT7L 5DVMA 3VFWA 5JHDB 1MCOL 1T2JA 4ZX3A 1AS7A 1FPTL 4GSDH 2VL5A 1PDKB 2IWKA 1GIGL 1SQMA 4NQCA 4F33B 1S5HB 3HZ3A 3PREA 5C1MB 2NCEA 2IV9A 5C08A 3RL2B 4HG4J 2E8YA 3L4UA 3RA7L 3U6XA 4LMQE 3IBEA 4ZUSA 3H42H 2F6AA 3LHAA 1G6RB 2J8HA 2OXGA 1E4WL 4MBOA 4XGZB 5F96L 5CEZE 3LS4L 4GAGL 1YNKL 3BH8B 2ILLA 2Y7QA 1NCUA 3E6FB 3O4LE 4OKVA 1PLBA 2Z7WA 3C6SB 4GH7B 4R2GD 4JREB 5E4IA 3GEWB 1E3ZA 3SGJA 4BQ9A 3FAWA 5IFJA 3M07A 3UTZA 4PR5B 4G8FB 3FBQA 3LKRA 5EA0H 3G5YA 1Q8MA 5C3TA 5ESAA 1DYZA 4KAQH 2CKBL 5GRJH 4KDWA 1Y18A 2WM0A 2FQDA 4OGYH 4IRSC 1SJEA 4N9GA 2R4RL 1NGYA 2WGNB 5I24A 3VXUD 4TKWA 5JLZA 4JM2A 3E2HC 3DSFH 4V1DA 4WUUB 3BQVA 1IAIL 3EYSL 2AJXL 4LCUB 1WAPA 1R75A 3IFOA 5D96C 2CLVB 4JANA 1WAAE 3ECWA 3SPVB 2J6EL 3GNML 4YE4L 2NRDA 3BN3B 4Y4HA 3VFVA 2A6DA 3WE6A 2J2ZA 3D39E 3NJGA 3U0WL 4I13B 2B1HH 2WQSA 5CZXC 3KGSA 4I0CC 5GHWH 4W68A 2TRYA 3BIKB 4BZYA 3BP4A 4WFHD 5E7FA 1KJ2L 2F7RA 4CBZA 2WXKA 2YKLL 3I74A 2GY5A 4WGWB 1J5OH 2EDLA 3FFCD 1EEYA 4M48L 5CN1A 4K0OA 1M53A 4ZMVA 1X6NA 5I1GH 5GGTA 3ML8A 1L9NA 3TA4D 1FCCA 3ASOB 3L81A 4GMTH 2OMZB 1SOQA 3FTGA 4MYPA 4NM8H 1JYNA 1A9BB 2J5LC 3WFDL 4TPRH 4GKSB 1PX8A 4MLIA 4LCWB 1Z0NA 2B4CL 4YSQA 4JPWH 4ORGB 1ZHLB 4NNXB 3F58L 4P2OB 1NAKH 4PJ7A 1GGTA 2EIMB 3DX3A 3IMTA 1RLBA 5KBKA 3KHOA 4J1UA 4G9FD 2C4FU 4OT1L 4AYBA 4H0IA 4X4XA 1IM9D 3AU0A 4X83A 2CPUA 3FO2B 2P24B 2B39A 4HIJA 5F2FA 1OB1B 3SGDI 2E7LA 4XNQB 3L2LA 5FHAH 5FAAA 1MG3C 4R5XA 1IGMH 3T0EA 2BSDA 3WTVA 3I9PA 4ZOCA 3CUPB 1UM5H 2FH6A 2WWOA 4L1TA 2CALA 4AVIA 2H0FA 5KSBF 5GRZA 5B7FA 3M17A 2CHDA 1N3NA 1OIOA 2WYZA 3L3IA 3OX8A 1GPOL 3C60B 2ZKHH 4BFGA 3MACL 4DKFL 5JPMC 3ABKB 2UYLB 3PGFL 2YC1B 1MCCA 3KLQA 3LNHA 1IEAA 1CQYA 2C9VA 3UTPE 5T33H 1IUZA 2AJSL 4NQEE 3A4AA 3EO0B 4V1DD 1AS8A 4NKIH 4Z95L 3S4SG 4KJWC 1CLOH 3EGDA 1L6ZA 5JZ7D 3FONA 4B60A 4GAYA 4ZMZA 4TTDC 1WBXB 4URKA 1M4KA 3Q9PA 2JB5H 1W0YT 2P3YA 5H94A 5D5MF 4FNLH 5FC9A 2HTKC 4Z3TA 5E9DE 3GYRA 2F54B 3Q5YA 4QRRB 4LCWE 1WT5A 2Y7MA 3IETA 3P4MA 1A22B 3HB3C 4WKZB 3W9DB 4RQQA 1FCGA 1ZE3H 3LZNA 1E9PB 2F7PA 3QYMA 1Q1JH 4KKCD 3EADA 2DI7A 3HB3B 3CSBA 4J39A 3AW5A 3MO1A 4OCRL 5EO0B 3U7WH 5IIEA 3WSQL 5AUMA 5J89A 2J8UF 2P8LB 4LVNB 5DR5L 3UBHA 3WFCH 3A67L 7PCYA 1FO0L 2JIXB 4D9LL 4O00A 3ZDXB 5CSZB 5EZJB 1KN4L 1PZUB 2J43A 3C5ZA 2PYED 1WHPA 3DMMC 4UYQA 3GJFK 3MV9E 1FWXA 3OKDB 1D5MA 3MYJA 4M5SA 5JOEA 2NW3A 4XMTA 3BVNB 5T3ZD 3N44F 4HIHB 3ARYA 3MLUH 3U0PB 1H9DA 4DGVL 3U7YH 2B77A 1KYOK 4N1CA 2BRQA 1W16A 3DHPA 2VDQH 4FFWD 3GPSA 5EA0L 5LNEA 5I1IH 2AAAA 1WPCA 4JZNB 4DP0X 3TC9A 5D1ZD 3MRKA 2ODHA 1AS6A 4NT6B 1XEUA 4XZ4A 5BUPA 1IM3A 3PDOA 4BH8B 5ESAB 4D9RD 3P4NA 1XQ4A 3JWDC 4QR7A 1K3ZA 3QJFB 3RWEA 3QK0A 4HWEH 4KMTH 5ENWA 1INQA 4P2RD 1GZQB 1U3ZA 1D5ZA 1D2OA 4QXTA 5IWLA 3K6SA 1GGBL 3FB7A 1PSKH 3HMXA 4FEMA 5KW9L 1FC2D 2PWEA 3B37A 2EH7L 1TO4A 3PRZA 1N12A 3GMNA 3ZHDA 1NCAL 5CEXB 3HLAB 4BDVA 2PNDA 5DHVB 3BZEA 4QTIH 4PW9A 3WEBA 4ETQB 2IDUA 5I16B 5AW1B 3QNYA 1BZ9B 4RWYL 2DQIL 1G0YR 1PEWA 5IJKA 4X4MA 5AVSB 4XB3A 2OMTA 3TURA 1FLRL 4JPKL 4O5LL 1T5WA 1ZWIA 1Z5LB 2C7FA 5T3ZE 4WHYH 2XWRA 4RMTA 1TQBC 3T9WA 3UYRH 2FHCA 1F11B 3E1F1 4I3GA 2XJLA 4MNQA 5EUOB 5I8CB 2AI0H 1Q1PA 4MMZB 2GSIA 1QSFE 3Q5TA 4KK9D 3BWSA 1A2YB 3QXDB 1NBZA 3H9SE 3D3VD 5IBTH 1MLCB 3D48R 3ETSA 4W9LC 5JPNA 4TUOB 4N0YH 4QGYA 4TSCL 1F6FB 5EUKB 4Z76A 4LBEA 1MVUB 2IH3A 4YVUA 5A2FA 3PABB 2XBDA 3BWZA 4DSYA 4PGCA 4QD2E 1IC0A 1RJZB 3PLYA 5FCUH 2YBGA 3QJZA 2DWTA 4PGDB 4HDIA 1GSKA 3MA7A 3MC0A 3CH8A 3VFPA 1EVUA 1A4KB 1CL7L 1P69B 1PEZA 3VQMA 2DQJH 3ZTNL 3OPZH 1M6OA 1ED3B 3UJJH 5GS1B 1DCEA 4G43B 2ICWJ 3V0FA 4RGNB 3QRGH 3EO9H 1OSEA 2WXFA 4LVOC 4OI7A 3AREB 1BZOA 1EGJH 3TPKA 3RFZC 4M3JA 1FE8H 3Q1SH 3ZDZB 3U7YL 3QCTL 2DQHL 5CD5C 3GKWH 1GS7A 4FQIL 3CFDA 5DD3H 4ZX5A 4DP8X 4EN3C 4K5OA 1NGWA 4PLKC 5LXVA 2VAAA 2I60L 4TNVK 4JM2F 5FYJD 1HJCA 4NZRH 5CJ5A 3CBKB 4JG0L 4IGBC 4WO0A 3L4CA 2J21A 3KWXA 3HE6C 4HZAA 1DCLA 1R5WB 1MFDH 2R23B 3RWCA 1CD1A 1XO8A 1D7CA 2C34A 4ISVA 2B1AL 4QOKE 5C0IB 2R56L 3G6JA 1AQKL 3KS0J 3UJIL 3SSGA 2J73A 2JI1A 1CIDA 5HPMB 2HKFL 4P05A 3QWNA 5CKAA 4A7QA 1RL1A 2BIOA 2CHNA 2GG1A 3QQXA 3LTVA 5IT2L 3VFGL 4EKXA 4R96B 1HH6A 1I4FB 5DA0B 1A02N 4Q89A 4WO4B 5HGDA 1FJ1B 3GMLB 4L4VE 1OARL 1FORL 3IDYC 5DYOA 4TOYH 4YSRA 4EDWH 4QRTB 1B2WH 3VI3E 4YHOL 3N85L 4ZFFB 4HWZA 4WJ5B 3RBGA 5IB1B 3II2A 3MV9B 3X1BA 2B5IB 2XKNB 5KBMA 5T3XD 2KPWA 2PWFA 1S7QA 1B9KA 2NY2D 4O2CA 1BREA 4HQQH 2VSCA 2H2PD 3SE4A 4ZNEE 3VXSE 5DXWA 3WTTA 4BSWB 5A40E 3FONB 4KVCH 1G7MA 1XSJA 3GXFA 3WOVA 3WEMA 1XGQB 1MJ7H 4X4ZA 1NBVH 1O7DE 1P84J 4PWFA 3KLAA 3ARBD 3FQ2A 3V6BR 1DVSA 1AHKA 1BXXA 1OSYA 1F5WA 2VLJA 5E2UL 4FKEA 4NUMA 4P49A 4YXHH 4MJ4A 1BD2D 5AVXB 4PJFE 4QRQB 4EI5D 3TCXA 2CNYA 4X98A 1S7UB 4PG2A 4NCDA 4N2LA 4PJBB 1FG2B 5C3IA 1JE6A 5IG7A 1JDAA 4MKTA 3QDGE 2XWZA 3IDMA 5EU7E 3ZTDC 1YO4A 2XWTB 2AQSA 5ABAA 5M7QA 4NKMA 1KIQB 5DS8B 1G9EA 4B9KC 25C8L 1O6VA 3HRZA 1KUMA 4IKKA 1SMOA 1PIGA 1TSHA 4UTCA 4HIEB 3T4YB 3PJNA 5DJ6B 1TZIB 3AGVA 1XF5A 2C9PA 1HZHH 3DGDA 4LE8A 3TO2B 3O3BB 4N4YB 4PRBB 1IC1A 4F2ME 2YWZA 2DYRB 3OLDA 1A0QH 2WB7A 4FABL 4KQ3H 4JQVC 2Q9OA 4RX4A 4M1CC 4ZPTB 3IAPA 1WC7A 5FV1L 4EUPA 4UQIM 5DGQA 3OHXB 5E2UH 4P9HL 4K3EH 1BQLH 3DHMA 4O5LH 1KYOJ 2XQYK 4BQ6A 1G6RL 1NLDL 4OFPA 2B5IC 1N6VA 1KIRA 2ZF8A 1DJHA 1JL8A 4N86A 2A77L 1W8OA 1JF5A 1ZEAH 2QEJA 5BRQA 1A6VL 3KNBB 4IQHA 2Z1KA 4M1GL 1FZMB 3EXLA 2FYYA 4M03A 4M3HA 4WAFA 4ZO7A 4K7PL 2NXZC 4E5XA 1JK9B 1L7TL 2G2RB 4H8WH 4FDWA 3HTLX 4FCHA 4XBMA 5T5FA 1OAKH 2HFFA 3V0DA 2VRKA 4S0TD 5L6YH 4JKKA 1IL1A 4DPRA 4ONHB 1DUYB 4KUZH 3NK3A 1CBVL 4J3WA 4MSWA 5FYJL 3TV8A 1JXFA 2XZQH 3H2PA 1HOCB 4OLYL 1O7DC 2VLJD 2NUPA 4N0FA 5CBEA 5B39G 4R4ND 1Z5HA 4LQFH 3G6DL 1J9RA 5B1AB 4OR1A 2BP8B 4W9FC 3O2VL 5JUEH 5I17A 2R69A 4NQSB 3BKML 3LQAC 3OHXC 1A9EA 3PWJA 5EF2A 3U1QA 1NZRA 4MMZA 4M4PA 4OGXH 1S7TA 4ENEC 5F1NB 1OXYA 5DJDA 4FZEH 1ONQB 4AL8L 4I4WA 5C0EA 2I9TB 2BWIA 3BZ5A 1V54B 4N20A 1ZHKA 1EAPA 2WNKA 43CAB 3C5SA 4KX8A 1R4XA 2XX0A 5FYKE 1KBGH 2DWXA 2ZP0T 3F7RA 3X11B 2JKSA 1T83A 3ULSA 3N2JA 4J3VA 4TLUA 4XCEB 4ZUSB 5ESQB 1MRFL 3KXFE 5DD3L 3BX7C 4KJYA 4KOCA 3CSFA 3SODB 5I1EH 2YFOA 4M43L 5MEND 3TBVA 3BT2H 1OF2A 1FSKC 4LOUD 4E9LA 2HLAB 1TJGH 2ERJC 3PFQA 2OZNA 2F54A 3RWGA 5E4OA 4MJID 3KPRA 2K7QA 3E6FA 5CEYB 1BOGA 4UU9A 1NGZA 4NP4L 4POUB 4EZJA 3VI3F 1EFQA 2EE6A 3EJYD 3MRHB 1FN4B 3VO0A 2O5ZH 2ZD0A 1HINL 5I1DB 1JPGA 3IVKB 2MOQA 4NN5C 3PAUA 1D2PA 1RD6A 4E9TA 3STLA 2ZWZA 2O1AA 4LHQB 2A6JB 3LV3A 4UBDD 3RNKB 2VISB 1CYWA 2XLLA 5ADPH 1A6TA 2CO4A 3ZHLA 2ZXCA 4MMYA 4YHMH 5IJVB 2MSPA 1CFNB 2PCFA 2WLLA 2EYRB 2ZUYA 4YGAB 2BOCB 4NIKB 3OKYA 4OLXH 2Q3XA 4JRYB 4YBQC 3DUUB 1SJXA 2ZKHL 2FEEL 1F3DJ 3E0GA 2F7QA 5CJXA 3NSJA 1LO4H 4G1MA 4AE0A 2CDFB 1ND0A 3LVTA 1UZ6E 2P52A 1SXNA 3TVMB 2HMID 2AI0L 2BHFA 4LNVA 3FTZA 2HH0L 3NPSC 1SXZA 4HCFA 1BQHB 4PLJC 2AC0A 1I53A 3B7UX 3U2SB 4YQXH 1RZGA 2D31B 4XN2A 3SCMB 5CMAB 2EDRA 4ZDHB 2R2HB 2CBOA 3NCJH 1ETB1 2BZCA 5D70L 3MJ7B 1BFSA 2VIRB 2L7QA 1BYPA 3RAJL 1FL3A 4E42A 3QEHB 4LHUD 3VI4E 1T1WB 3TNNA 2NY5H 1VFOA 4O4YL 1SOKA 4G7RB 4H0LC 4CN4A 5I8EB 5FO8A 2QPFA 4JFFB 2OQJA 1OSPL 4DO6A 3KAAA 1QEXA 2R56H 4R4FL 5E5MB 5EC2A 3A22A 3UG5A 4F37K 5C8JA 2FYYB 1W6WA 2VZVA 1KTKE 4P5RA 3RGVD 1PZBA 3VXPA 2LT9A 3WNJA 3FQRB 3SE9H 4C8XA 2I60H 1MIEL 3CVHL 3L5JA 3QUXA 4K94H 5I8OL 2ROXA 1FI8C 1UKTA 2Z0BA 3VA2C 3RFRA 3QEGH 4Q9QL 1IGCL 2CUHA 3DO4A 1P1ZA 2C3WA 4UILL 2VH5L 4X9IA 3DMMB 3OC5A 5CP3H 5EO1A 4OSUL 3RVWD 2M1KA 5C7XH 3B7YA 4J3OD 3QQNA 2YK1H 3JXAA 43C9A 2AZAA 4FI8A 1GMEA 4TRPL 2AXWA 3WJJC 4C56E 2DQEH 1FAIL 5TQ2L 3IDIA 3MBEA 4PGBB 2V17L 3WJLC 5C0AE 3ARGD 4OKDA 1KPRA 1BZ8A 2H32B 3B4NA 4IOIB 4W9JC 2Q3ZA 3CHXA 4P4RB 2B2XL 3B2XA 4OCYH 1D5RA 4P2QA 3KL0A 3NAAH 4XOBA 3DV4A 4I1NB 2HLFC 3MRBA 2HRGA 2JB6B 1A6ZB 2IDFA 3FQUB 3VXQB 4AYID 3MJ7A 4JFDB 3GLZA 3TBSA 4PJAB 1DJGA 3FU6A 1I8KA 1ZA3A 2DS4A 1ZJAA 2EDHA 4PIBA 3ZHNA 2GW5A 3AS0A 5EU6B 3RIKA 5G5DA 3O0RL 4X7TA 1CN4A 1B0GB 3M1BA 4EI6A 4HS3B 5GRUH 5DI8B 3SO3C 4KKLC 1MAMH 1CLYH 5DCCA 3CG8A 1AKJA 1BWMA 4WWPA 4LCWA 4A6YA 1ASOA 3DURA 3U4EB 4A04A 4NN7B 3OQ3B 4OD2A 2PCFB 4ZS6D 1BBJB 4UIMB 3NRQA 4JPKH 1WFMA 2NNCA 4S1QH 3IRPX 1TVBB 4E0RA 4QTFA 4LQFL 3DNKA 4UQ2B 1TETH 1ECYA 5C3LD 4M00A 2BS8A 3GJFB 1PFCA 2HSIA 4HX1B 4Q58C 2NT1A 4X8JB 2YUXA 4ZO8A 4CDHA 5AVYB 1J87A 3OAZH 1A5FH 2QGBA 2C1OB 4YXLH 1HKLH 1C1EH 5EC1B 5I1LB 4TUKH 5F3HB 4AH2B 1MIMH 1FNFA 1P7QB 4HKJB 4H5SA 4BQ8A 3COOA 4WI9A 3HBQA 4V11A 1F86A 3ESPA 5MEPA 4DGVH 1B6DA 2X0WA 3R06B 3WN5A 5IMOB 2R23A 3MLUL 4P2OC 2BC4A 3NJNA 1X5HA 5DMYA 3SDDC 2OSYA 3B5HA 3QIBD 4Q7DA 4JRXA 4BKTC 2K3TA 3RTQB 1A14H 1CD9B 4NS0A 5KUKA 2JCCE 2C3HA 3DECA 1XAUA 2R7EA 3ISRA 5D7LE 2X6VA 3K4DA 3TXAA 4EZLA 4IRZH 1S9XB 1U58A 4TVPL 3M45A 1BF5A 4BH7B 4GRLB 1GY1A 2Z8WC 3B3BA 3FUHA 4AJVA 4OLXL 2Z7UA 5T3XL 1DQDH 1XB8A 3GJEA 3NFNA 1KY7A 5GGQL 1S7SA 4ZW8A 4FFYA 1ODUA 4PBWD 2WOYA 1R3KB 4HOZA 3QRGL 4Y1SA 4PJGE 3B7SA 2J1ZA 3R0NA 1JWMB 3FSZA 4HHAB 4PQXA 1NPJA 4YUEH 1XGTA 3AQDA 3PG2A 5DFTA 5LGJB 4LAQH 2GB2A 2WUCH 1UCBH 3Q6FA 3TBTB 1N5AA 5FYLE 2VN4A 3IDGA 1DQMH 2EIZA 1QA9B 3QJHA 4GRWH 1CZ8L 1ZGLA 1D7BA 4K2UL 4X4KA 4HH8A 3IGAB 3KYOB 1AKJD 3C2SA 3A47A 5DHEA 2SEBB 5HYJD 4PRNA 5AAWC 5AD0A 5D7JD 1Q9OB 2O6CA 1ZCRA 1AZBA 4KNTA 1OD9A 2MRYA 3B9KB 4IS6B 3QNXA 3HI6H 2XBZA 4P99A 1TTCA 2GQHA 3QUMA 3BZFB 3GSQA 2IBZX 2WTPA 2CBQA 4G5ZL 1X9LA 4ZYKB 3TVMC 2BSCA 2OJEB 2L8AA 2AJYL 2FX7L 2H3XC 4LPYA 1QFWI 1WA0X 2NX5D 3QGVA 1KZQA 4HZ1A 1IBGL 2RFXA 3EJCA 1L4IA 1HAWA 2ZSVA 1EAJA 1RERA 2A6IA 2XYBA 4L3EB 4XMPH 4ZUTB 1S3KH 1QI4A 3VWKA 4EDWL 3TM6A 4UWQB 1VKXB 2PF6A 1J8KA 3E38A 1JD9A 4JY6B 3SJVE 3GZKA 4Z5RA 3SPCA 4L9DA 4CMHC 1E27A 4HHWA 4Z7VB 2VLME 2WXPA 5FO8B 1Y0LA 3QCVL 5DTFB 1LO5B 1E27B 5AW0B 4J2XA 1IC5H 4L9LA 4YPJA 4TUKL 5G2NA 2P49B 3QUYB 2VR4A 1OL0A 4XBGB 4ODVL 5BW7A 1FYTE 2HVJA 1EPFA 1LDPH 1SXCA 3QORA 4FQXA 4YLCA 3TNMB 1GJUA 1AD9A 3DVFA 3VRJB 5JQ6H 4JEGB 2WNGA 4GUOA 3U9PL 4BK5C 1KYDA 2AMUA 35C8L 5GIRB 3HBGA 4UM8A 3DX2A 1GIGH 1S7WB 4U1SA 1C16A 3CSYA 4M93C 2DOCA 4MXVE 3ZTJG 3PPEA 4NI3A 4G1MB 3Q43A 4M8QA 3MR9A 1UM6H 1J5OL 4NO0A 5JIQA 4GB9A 3SD5A 4D0BB 1H0DA 5IQ9B 2KT6A 1V7MH 1C08A 3QXAB 3BN9C 1OAZL 5DURD 3BESR 1AC6A 2Z35A 2R0ZL 4XZUA 2FIRT 4DQOH 1Y07A 4N2MA 3CDZA 3BMWA 5JIMA 3VNYA 1XIWC 2PABA 2G3XA 2JJTA 3UPAA 1DEDA 2YD8A 2P48B 3VMNA 1DR9A 4XPAH 4JVWA 4AW4A 1E8ZA 3L4XA 4YUEL 4AX3A 1JFQH 3BI9X 5CKGA 4A7GA 1AGBA 2HJFA 2UXTA 5ACMA 4XBEL 4CGTA 1EJOH 5GGRB 3B2DC 2CCLA 4Q4EA 3UBXI 3KJ6H 3VU2A 3SGKC 3GNMH 4YE4H 4HAFA 4NQTA 1Z9SA 2IANA 1U3JA 3H9SD 3CK0L 1JGIA 1HHKB 5D2NE 3HG1B 1XV8A 3CLEL 5E6IB 3RY4A 4WENB 1QA9A 2XV0A 3VTAA 2WAHA 4P5TB 3H7LA 1X9UA 3NA4A 5C0GA 3FCBA 1G7JB 3CIQA 5ISZE 4Q8BA 3HZKA 1H6UA 1CS6A 4M6ML 4P46B 2OYLA 1PQZA 5I76A 4HALA 4A55A 4DO4A 4UILH 1UATA 4UDTA 1CLOL 1Q94A 4NBXB 5AKTA 3KGUA 3H2WA 5D2NC 3LQAH 1FQ9C 4ILDA 5KAQF 3RHWK 1A7PH 2X7LB 4M93B 5B38B 5TGBB 4OF3A 3LEVH 4PREB 4LOEA 3LRGA 4N2BA 4GRWB 2VH5H 2EKSB 5GSRB 2X88A 5E95B 4KRPB 2IFGA 3CFTA 4NO5B 1PKOA 1NGPH 3GI9H 3P30L 2YJLA 3ISWA 4WNQB 1E30A 4MB5A 4HFWA 5DRXA 2IF7A 1UADC 1Z6JT 5JHLH 4RIRB 2PO6B 5L2KB 1LE5B 4OU3A 1WQVT 3WHE1 2WJ7A 4PB9H 3VH8B 3ZYIA 5IHUL 1ZSHA 4UT9L 2A1WH 5F6IB 4AQEA 1HNYA 1FORH 1OV8A 2CXKA 2HCZX 3I02B 3KYNA 4EI0A 5FECB 3IKKA 1MVUA 2IH3B 5EBLA 3HE7B 3O9WA 2ERJB 3RVVC 1HDMB 2YGPA 1SLXA 3B9AA 2IPKB 2AK4D 3T8XB 3NRFA 3BGFB 4KKCC 2OKMA 1ZHLA 2FT6A 3VXRA 1CUOA 5FGCE 4FC3E 5I5IA 5DJAB 1JV5A 5DD1L 5DLLA 2IAMB 4DP6X 4N6QA 3MV11 4M3KB 2WBWB 3GKZA 1KJ3H 5JW3H 1JVLA 2VSMB 4LLUA 1H5BB 4UOQA 3ARWA 4JHVA 4KI1A 3H3BC 4YHML 3TBYA 1UVQB 3CVIL 5J11C 3QNFA 3SE8H 1KFAL 1I8IA 3CBRA 4PTUA 1J18A 2Z64C 3PF2A 3BWAB 3T0BA 5D5MA 4EQ3A 3QO1B 3EZ8A 1UWEH 4OJEH 3B2UC 1KJ2H 2BWQA 5LLIC 1L3WA 3KBHE 4WWID 1WBZB 4JM0A 3F8UB 3MBEB 4PGBA 2MQ0A 3OD3A 1AZCA 1CGWA 3KPLA 4LQ1A 2YKKA 5HGAA 1I85A 2Y07L 1NAMH 1YAIA 3BH4A 3N50A 4JFSA 4LSSH 4HOWA 3BH9A 1OB1A 5L8KB 5DLML 5E24E 2J7LA 3QAQA 2ZOUA 3FQUA 4RAUA 4EE2A 4JK0D 1EJFA 3LZFH 2YPKA 3GIVB 2QV2A 5IM7B 3ZTJH 4AKOA 1JZ6A 4MWFA 2F53E 4PRHD 3SBWC 2WVVA 2XG5B 4F7MA 1WEJH 4Y4KA 1S7RA 4NP9A 2VJ8A 5LAXA 2JXMA 2AEWA 4G6FD 4ANWA 4I0KA 2HT4C 3WNLA 4DFIA 3NDZE 1CFVL 5ACZB 3HMWH 4F9PC 3T3MF 3AMLA 3G6AB 4ZTPL 2UXFA 4UNTA 1YQVL 5TE7H 3VFUA 1YEGH 3EOAA 2OR9L 4G7YH 3VXRD 1B0RB 4CN6A 4H88L 2F5BL 2VC2B 3CFCH 1SEQL 5BVJA 3DVGA 3LKPA 3AREC 2ETWA 4PU2A 4Q0XH 3JWOC 1B2WL 1JGEA 2F54E 1UURA 3D69B 2FWSA 3HS8A 2OM5A 5ANHA 1ORQA 3AZUA 1YMHA 1NWOA 1ETZA 2QDWA 4I18A 3OB0H 1R24A 3ZYOA 2JTDA 1G7JA 1BVLB 4PRPB 4AZUA 5KVEH 4TQEH 5PCYA 1OGAA 3RA7H 3T1FB 4I77H 4KITB 1E28A 4UMGA 4JG9A 2CE6A 3KVPA 1J1OL 1QKZH 1ZT1A 4LCIL 1NUNB 4H8PA 3T4AA 1GS6X 2ZP8A 3HHRB 5I6NA 1NDMA 1UGKA 1WZAA 4K55A 4JKWA 3IMSA 3RWCB 5LHDA 3VW3H 3AQXA 1JNNL 4F7TA 3VGAB 3LEXB 3V5KB 2JTYA 4DEUA 4R83A 1EANA 3L45A 1V27A 5F7YC 4ZUWB 1P6FA 3IJSA 4Y8DC 3MNVB 4DTGL 1OTTD 3HA0A 1BQLL 1NCDH 2UZYA 4L2LA 2LABA 5DQ9A 3U2SA 1E9OA 3ARXA 3VYPA 1E50A 5DFVD 3RWFB 1QSFD 1KBKA 4QHMA 4Y4KD 4BJLA 3ULUC 4Q2ZB 3SO3B 2OAAA 3VXMA 5HJ3A 5CCGE 1GY2A 3K2UH 3NIGF 4IBQA 2VR8A 4YE0A 1CLYL 4NRZA 2I25N 3F7QA 4G71B 2Y7QB 4MZ3A 3VJ6B 3EDEA 3KGTA 2P45B 3OVUB 3X1NA 1RIVH 3G5XA 1RZPA 3FSWA 5A2KH 5FW7A 4LESA 4N24A 3DRTA 1QOKA 2Y2YA 3UDWC 1UT9A 5CUSL 1HHJA 4EQ2A 2C4FT 3MGTA 1M1XA 2OMVA 3GMPB 1ROWA 1KCSL 1RU9L 4K8RC 5ID1A 1ORSB 3N04A 4WTXA 4H8QA 2IALB 2WMPA 3W39A 2UY6B 4U1HB 4XB7A 5GGTH 2ZJSL 1WGVA 5IVXF 4O9HH 4LLUB 4P4KC 4DGUA 1JI1A 3BZ4A 4FTDA 3AB0B 2CUAA 3EJJX 1SVZA 4HOMA 4L9LB 5MENA 3QH3A 5F7BA 2QGCA 1UB6A 3L7FB 1LO2H 3D9AH 1N67A 3HAEB 3GBML 4JGUA 3KXFB 4GI9A 3ARGA 2PCPB 5D2LA 2H6OA 1S9WA 4Y5VC 4YHPA 3LH2H 1WTGT 4PJ6A 4PWKA 4Q74A 2QVKA 1WA1X 2DM3A 1PZ2A 1U8JA 3IFPB 1KGWA 3MV7D 1PNDA 3DXAB 3VFMA 1F6LL 4NQED 4XI5C 3V7AG 2TRHA 4PD4J 4CVXA 4C4BA 4GW5A 2OTWA 2XN9A 4HKZB 1HN1A 1N19A 1EGJA 4XNXL 5IB3A 3VXOB 4FJ6A 4D9QD 1G43A 4ONHA 4FXGA 5DHVA 5F7NC 1GYWA 5T1KA 4DGIH 1AO7E 4KKPA 4M7JH 3CFBA 5BQ7B 4GSXA 3HZVA 3U1SL 2VKWA 5A1AA 4H1LA 3L1OL 1ETA1 3S5LA 1WUNT 2ID5A 3MODH 4GXUN 4WY7L 3B8YA 1P5UC 3X13B 5GZNC 1A6VH 5FWQA 5LBGA 4RMSA 1UM4L 1ZTXE 1HZLA 3MNZB 4YSUA 3UJIH 5DUJA 2AJZB 3F7PC 4Q9RH 3KPSB 4KZEL 1NOLA 2Z3FA 1I9JH 1JVOA 1T0PB 1CU4H 2BNQD 2K45A 5F7MC 1QHPA 3HHMA 4KO9A 4MA3A 1IKNA 2VDRB 3DV6A 5IT2H 2F5AL 2LTQB 2Q76B 2Z31D 3TEYA 5B22A 4NDMA 2ITFA 4MASA 4NENB 3D1MC 4UOW0 4Z7UB 4B97A 4HYTB 1F8TL 3RWDA 2BVUA 3BJLA 3ZQXA 2XV6B 4YL9A 2ZCLL 1ZSDB 4E41B 5I66A 3IFNL 5GGVY 1I3RA 4XPGH 3RURA 3GBEA 3VXSB 1MW2A 1I75A 3BYYA 4N2GA 1JPTH 2Y5TB 1Q9KB 2W9LA 4K9EL 1NMCC 4YHKL 3GHEH 3AG4B 2E4TA 2Q8AL 3LX9A 8CGTA 2AV7A 1QASA 3FQWA 1C12B 2HYMA 1CJYA 1QFHA 4NKMB 4WQOA 4O2FA 3LB6C 1USQA 4PJ7F 2HFGL 4KQ4H 5E23A 1VB9A 4OCMC 1UD8A 1SLUA 5I74B 3WS3B 3JT0A 3HE7A 3THML 2MFNA 4JREC 4BK8A 3EH1A 4JHUA 2GITB 1WZ1H 2HG5B 3UBXG 3NOIA 3O3BA 4WW2F 3WENA 2FR4A 1YEFL 5IEHB 4F33A 1C5CL 1NCOA 2VDKH 4G1EA 3K72B 5JHDA 2WYTA 3GSVB 1E6JH 1ECZA 1XGYH 3HIZA 4NLHA 4WNSA 3NTCL 4POZC 4MS6A 1E8WA 2DBLH 3LIUA 2AJUH 5GGUB 5FA4B 3SDAC 3VWKD 2VSDA 4I3RH 3SDCA 5DWPA 3G7TA 2JCWA 4FXKA 3RRQA 3LPWA 3EJSA 4JBSA 4X5WA 4ELMF 2YO3A 1Y6NR 2E5EA 2MHAB 4GJTB 1UXWB 5E00B 3LH2L 2EABA 4KTDL 1VZIA 1ULVA 4X5XA 2C8NA 4UTBA 1DQDL 5KSAD 2BNQA 1NMBH 1XD1A 5IBTL 5HDWA 3FPXA 1W6LA 1HL5A 2OYMA 4WU7A 1IGJA 4FRWA 5E2JA 3WMQA 3MZTA 3X3GL 4B9PA 4Z7UA 3OLGA 4C58B 4WJG3 2ZUVA 3WTXA 4JFZL 3BUBA 1T0OA 5EWIH 2VM3A 2DWEA 1MFCH 3RILA 5T3ZH 1B4RA 4MCYB 3VGBA 2DKSA 4PJAE 2H3KA 1PKQE 2AAVA 3WBDA 1HH6B 2PR4H 3QYCA 3LKOB 1DBBH 3L4WA 3PHOB 4QTIL 1RZQA 5E8EA 4JFEA 1IGTA 2Q6WB 3ZTCC 1CDGA 5BRZD 3ZR5A 3R7QA 4AWJC 5I1AB 3ZE1F 4MDRA 2ZXBA 4MA7L 1N8ZA 3IDXL 4BXVA 3MLYH 1NFIB 1R5WA 3HZVB 1MDTA 3HI1A 1RIUH 5D6DA 4ZMWA 1YEKL 3RG1C 3V4PH 1HI6A 1U8QA 4ZAKC 3PNRB 3Q8FA 5JOPD 1EHXA 1QNZH 2H6PB 2FEEI 1BQKA 3F6IA 1WBYA 2OCJA 1GAFH 2OFQA 1JOIA 2BP0A 4R0LC 2J8UE 3DXAA 5HP5A 2J1YA 4X4ME 2BVQB 4FLQA 5KYWA 3LRMA 4LLAA 4TYUA 3H3KA 2V8MA 4GQ9H 1RZFL 2EEBA 3ARFA 3W9EA 2WO4A 2I9LA 2A38A 3AT8A 1EZSA 1CI3M 4JO5A 5E1QA 4TQHA 5EMYA 5ICZB 5I8EA 4Z18A 4B3VA 4I1PA 4X8GA 4MXVF 4XAWH 5FGCB 4AYGA 1EMTH 5I28A 2BCMA 2WCGA 3TBTA 1XSOA 2XPYA 3E3QE 2QPEB 3RPIB 4CC0A 4UNVA 4NQDB 1UD3A 1BBDH 5FEBA 1X5KA 2QLYA 3FFCA 3BW9B 4QHLA 4GW1A 3FQRA 4JRXD 1KV3A 4QCIA 1BVOA 4QEGA 3GIZL 2ICEA 1SBBA 1KDIA 1TJGL 4P59L 5HGGS 4OD3H 4OTXL 5GZOC 2Q86B 1BJ1H 4OJFH 4P5SA 1F6AB 2R9HC 4Q9RL 4RNRB 3CHOA 1UOKA 4K73A 2VDLB 3RWIA 5I73C 1P4IL 4JRYA 3IN2A 5CJ8A 3PGCA 4OAWB 3PABA 2WP3O 1SY6A 5EZLA 4IU2A 4HPYL 2WKGA 4PBDA 4HMDA 2JXMB 1DSWA 2NY0D 5IQ7L 1J11A 4NO2A 1PLCA 5ETUB 5FUCC 3WFHA 4CC4A 2IQAA 5C0DB 2LU3A 1DZ0A 3DO3A 4WFFD 1D5IH 1IGCH 1NANH 4FQCL 3GJFH 5BRZA 5CEZH 1HSBB 4GQPH 4ZT1A 4QXUL 4PRDB 2X1XR 3SYQA 3LS4H 4UAOB 4ZTEA 2Q3AA 2MPVA 4YEFA 3UTSE 2CMRL 4G6KH 3UAJD 5IQOA 1K72A 3DX9B 1PZ5A 4MAUH 4APQB 1Z1WA 4HU2A 4GUPB 2IALA 4OJDH 3UZVB 2E9WA 4JPIB 2WZPD 2B3RA 2WOBA 2VDKL 1TJHL 2H9GA 4HPOL 2WSPA 2VERN 5D5MB 4CNIB 4BE5A 1G1KA 5D72H 1AYRA 5I16A 3BKJL 1FNSL 3CZGA 4KO5A 2P5EE 4ZRGA 5HDBE 3O11A 4KV5F 5MEQB 5ADOH 2Y7OA 1CVRA 3G5XB 4WK0B 5GRVL 5CD5D 2GAZA 1NUDA 3O6FC 4ZOAA 1EAPB 4X5RA 1I8AA 1OO2A 2GI0A 4P9HH 1ASQA 4NZTL 2J8UA 1BPLB 3DXAE 3WFBH 5H35A 2HLFD 4IDJL 3QJFA 3RWEB 3EBGA 1TO5A 2BIHA 1KGIA 2VXQA 1UYWH 4AIXA 3C5ZB 1RUKH 3IWUA 3ROOA 4KJYB 4TULL 3CLFL 4UV4L 5GJTH 1HHHB 1OT4A 2WWKO 1BD2A 4LO9A 3MRPA 2FJUB 3QORD 4FQXD 1PKQA 4G5ZH 4N28A 2F8IA 3AU1A 2R8SL 3GRWA 4NSKA 5C9JB 4TQPA 1LVEA 5EBLB 1WHOA 3T0DA 4JHWH 2A74B 4TPRL 4XVSH 1HKFA 25C8H 3I3BA 1E7VA 3ROLB 1FNSH 1ONQA 5DS2A 1SYVB 2Q7AA 3APMA 4R90L 1AGEB 3TCLA 1BFTA 3MZGB 3QQ3B 3G6DH 2QDVA 4WV1C 3II1A 1KJMA 2OBGA 1DVFD 2OMWA 3TZVB 3GBLA 3W0WB 4P5MA 2PTVA 1DP0A 4D8PA 3ZDYE 2MTAA 2H47C 4P5MB 1F2QA 1CFQB 2EH8H 5DQDL 3GBDA 1OCWH 3UTTB 3FQNB 2RACA 2BVEA 1OAQH 3JWOL 1ETZB 4PJFB 5IESH 5EEVA 3S36X 4DN3H 1A3LL 4R7XA 5EO1B 1EVTC 1IAIM 1H8OA 3PFUA 1KIPB 5B3JF 2F8OA 4NUJA 2YMOA 3QEUA 2B8OT 4I77L 1B0WA 4TQEL 2VLRD 5E1AB 5FGBA 3W9DA 4NWTL 3EFOA 2IH1B 4P8QA 1KTJA 4OCWL 3DX7A 4F8NA 3HN3A 4K3EL 3GDCA 2CLZA 3L3HA 3I9AA 2PTTA 1F3RB 1E5BA 2ATPB 2ZOLA 1S9WB 5BMFL 3SKJH 4HF5H 3E1ZA 2J3SA 2F53D 1Y1DA 4PRHE 4F2MB 2X4PB 9CGTA 2Y1YA 4DPBX 1W15A 3O3UN 4M1CD 4X7DC 1R3IL 1A1OB 1E9QB 3JV4B 3HPJB 4P9MH 1SLWA 1WRFA 3EO1B 4HJJH 4U1IB 4LVOB 3TNNB 4ZFOL 4XOCA 1WDAA 2B0SH 3MLTA 4XN5A 4RGNC 4W4NA 3MRLA 4JMNA 1C7TA 3O9WB 4OD3L 4OTXH 3OZ9H 4M6AA 1RPQA 5AAPA 2ZAHA 1BVNP 2MNWA 4WSKA 5L2JA 1WZMA 1DVQA 1EO5A 3GHBL 5IOPB 3FSVA 1NC2D 3LZQA 2EH7H 4MYWB 4IOIA 1TU2A 5AW8B 1AJ7L 5F96H 4LSQH 1PG7W 3T2LA 5CILH 3OKKB 1MJUH 1T5KA 3UC2A 4P23A 1FG9C 1BGXL 4OCXH 4ELKB 3BLKA 5C0ND 4W9KC 1MEXH 3QI9B 2PETA 4LF3A 3V6FB 4F37F 5TF1L 1KT2B 3T3PB 2MIZA 2HT3D 1XGUA 2DQHH 3MLSL 4BELD 2YSTA 5KJRH 5A2CA 4I85A 3BAEH 4U6XB 4R8WL 1AO7A 1NAMB 3O4LA 4XVSL 1DN0A 3LIZA 1UXSB 2QKIA 1SBSH 3BQUC 2EKJA 3EGSA 4CJ0A 5LQBH 3ZE2B 2DIJA 1AD0A 4ZUUA 3ALWA 3UTPD 1GRWA 3QWOA 3SE8L 3LN4B 4FFVC 5DF0A 3M46A 4FMVA 5K5YA 2FWOB 4HEPA 3JZYA 3C6LA 2CLZB 3L3HB 3WEXA 1F3JB 3TH2T 3FN0L 1KCVH 2Y6SC 4NN6B 4X9HA 1A4BA 2GTWA 5DUPH 1MCRA 1AJ7H 2G3ZA 4H0GA 4PAZA 3WHXB 2VDRH 2V2XA 1IBBA 1G9NC 1OARH 3P40A 4J4PD 1V3KA 2OI9B 4WUUA 2NY2C 5KBDA 1OKEA 1MQKL 3BIKA 5CGYD 4OGQC 1J5DA 4ALAH 1OAUL 3QE5A 1JWSA 4W4OA 5IFHH 3JBG7 2Z7ZA 3Q8EA 4WO4A 2J5LB 3TH3T 3Q3GB 2G2PA 3CQFA 4FYQA 1A64A 4O2FB 1HNGA 1NKRA 2F19L 3U6RA 4ZJ9A 4EVNB 5B21A 1P2CA 2V5TA 1V5JA 2ZE0A 5E8OA 2YJQA 3OKNA 1U8LB 4EI5C 2DRUA 7TAAA 5KS9A 4PD4K 4ERSH 4OFKA 3ATBA 3WNPA 3ECBB 1ADQH 3CXHJ 4G43A 5LCVH 4I0PA 3E9UA 1YCSA 2X6CA 1EXGA 3C60C 4NPYB 4H20H 4KGJA 3N1MC 1OP3K 1T66D 2GEEA 3O45A 5DUBA 3D2UA 2D9QB 5D7IB 2CPCA 2G4GA 5FKPA 5FDYA 3FH8A 3P2DA 3FF8A 4CNIA 3IAGC 4Z0XB 1T2QH 3EH4B 2BIIA 1IGYB 5EBGA 1UM5L 4U1JA 4RMUA 4TTGA 4WWOA 3KLHC 1NEUA 1X5JA 3T2NL 1NCNA 1R3KA 5CIPB 4XNUL 2MCMA 1S9KC 1K4CA 2WLIA 2X09A 3V0HA 3GTNA 4UT6H 3WNMA 4WI8A 3VA6A 1I9IL 3K6OA 1CFBA 2W81C 3WY3A 2WXRA 4OJFL 1N68A 5B38G 3CQQA 2BIQA 4LCCA 1XFPA 3IMVA 5HHMB 4Z3IA 5LXGH 1MREH 4M6OH 4NZ8A 3L3OA 5I75C 3DJTA 2R7EB 2Z1PA 1P7KA 2W9EL 1MVFA 1BYNA 4GW5B 3ZL4L 4N87A 5I0YA 4LLYA 2W8CA 4ATWA 2GBUA 3N41B 2R0WL 1DSYA 4OQTA 2GKIA 1DVUA 3F65A 4S10A 4DK3A 1H5BA 4I88A 2A74C 3C6LD 3I75A 2R1YB 1NC4A 2FDBP 1WG3A 4XP5H 2EADA 5MEPB 1LGVA 1T20B 4UQEA 4ZYKA 4OZGA 1JJUA 3LN5B 3MBWA 4KZEH 1TJXA 3AS2A 3OGOE 2W65B 4G8IB 3BJ91 3QDMD 2IPKA 5SX5K 3U82B 2XY2A 4PJDF 1AIFB 3RVWC 2Y6TE 2HX7A 3OV6A 1UTDA 1WO2A 1URIA 4P5KB 1KN2L 2ICEB 4IRZA 3ZYJA 1AR1B 3IGAA 2E7BA 3BKJH 5HYFA 4HEPG 3BW9A 3LH9A 4K3HA 3QBTB 5EBMA 5CD3B 2LOEA 3FK3A 1N6QH 3SQOH 1D5BB 1JTOA 4MJ5B 5HDRA 1LEIB 4N1EA 3ZW3A 2W59A 4WEMB 3VXMD 4BDVB 4L4VD 3BZEB 3CZUB 3JT2A 3K6FA 3P9MA 5DVKA 5ISZD 1GYUA 5BV7H 4WNJA 4HJTA 1U2HA 1AQ8A 2ZG1A 4OLWL 3O8XC 3TL5A 2YLKA 3P9LB 1J48A 1ZTXL 1DBBL 5FF6B 2ZSVB 4QHLB 5HJ3B 4L4VB 1VEOA 2DKMA 3ESNA 1F90H 2Q1EA 2OW6A 4F57L 2VXTL 4NHCH 1GTFA 3MV8E 4X80L 2J55A 1A6UL 3QDGB 4YSPA 1WBYB 4DEWA 3UPRB 4OGAD 3G04A 4GPVA 4BHUI 3S88H 4ZFFA 2AEPL 5KN5A 5EEYA 1WA2X 1XWVA 1G7HA 1M3JA 4KJQC 4PJ9B 2NTSP 5BZZA 4JHAL 3CVCA 2O26U 2C26A 2QZ5A 1QVOA 3NEXA 4PRAA 3FZUD 3LXBA 4FMFA 5IB2A 3MJ8A 3L5HA 5EEXA 1EJ6A 1MWAL 4HUVA 3BDYH 4XN9A 3WMSA 4A2MA 1TJIL 3T08A 3FU7B 3PXJA 4E9WA 1HHKA 3KPPA 3IM1A 3ZMEA 3MRCB 4JW3A 5CN2A 5BV7L 3NAAL 4PWEA 3DYPA 4U1KB 4AVHA 3X13A 3OMAB 1RIVL 2D0HA 4UZGA 1E5UI 3C6LB 4TSBH 4JDEB 5E1GA 1BFOA 2X4UB 1AGBB 2HJFB 3PDDA 4HBCH 2Z9TA 3WTWA 7PAZA 3H4HA 3U48A 2MCAA 3AG2B 2IVFC 4Y2DB 4RMWA 3BYTA 4XAWL 3T77A 5I9QC 2HTKD 4WW1A 3D12B 2IMNA 3ULVL 5JHLA 3KBPA 4RSYA 1DLFH 3NH7H 5B1JC 1KXHA 3HPLA 4AE1A 4OM0H 3NFSL 4YSTA 5C0BE 5ECGA 4M56A 1DEEB 5K59E 2N3JA 2CSPA 5IMMB 4HT1L 3S3DB 5I1HL 1VADA 2HFEA 1U36A 5B7MA 2W80C 3FBKA 4X42A 3MOAL 3WEXB 1RUKL 2DB8A 2FHFA 4ENZA 4OY9A 4YHKH 1Q9LA 4FQJL 4EIGB 5J6GB 1IU1A 4JDVA 4BD4A 4NUGH 4FABH 3WFEH 3S97C 4BIKA 2ESVE 2R8SH 3O8XB 1QMUA 4G80A 1JNLL 3N9GH 2DQMA 4TF4A 3R06A 8FABB 3ABLB 4MQXD 4OJAA 4HH9B 1YG9A 5E6ZA 4PJCB 4RAUB 5GS3A 2X4QA 1OWRM 3BVWA 3S4SA 1OZTG 4F8OA 2WO2B 5DZNA 2C1PB 1DQQA 3QCUL 2EYTB 3GXNA 3V6FA 3W1ZA 4GSUA 3RAJH 3FT4B 1CICB 1AGFB 1G0DA 3HPJA 5DMGC 3EYFA 1N64L 3NYKA 4WEUD 4B27A 2DTML 1IMHC 1HQRB 4MAUL 3T2PA 4I9WE 1R46A 4UINH 1QBAA 1DJSA 3M86A 3AWEA 1PW3A 3WIIL 1ANUA 4HC1A 3FTGB 2AKRA 4TS6A 4HFUL 4DP5X 2FSDA 1G9ML 1NBVL 5DMIL 2WQUA 2XZZA 3ERXA 3EFOB 1KBBA 4JRFA 1AHWB 4L8CA 2A6JA 3LV3B 2DN7A 4W81A 4QRAA 1O5PA 2VDOB 5AVTB 4AGNA 3L3OB 3UZEC 1JMZA 4CC1A 1JZIA 3LZRA 1W91A 4IRSA 2X9XA 3K4ZA 1KWGA 3S9DB 4B6ZA 1WITA 5I6LA 4WWNA 1EEZA 4J6RH 1K4CB 4WW2B 4IBSA 1PPIA 3GBMH 4JFXB 3IFOB 2IH1A 1JVKA 4F5CA 2NXYB 1OM9A 1C5CH 2K6ZA 1FZOA 2CKBB 4U0QB 2YEVB 5E5RB 2X2IA 5DHVH 3R19A 1GMIA 3CFNA 2BSBA 1NCJA 1RK1A 1UWEL 2PPDA 2GK2A 3RJOA 4NT6A 1J9QA 3MQIA 4XP9H 5CF3A 5IQMA 4JM4H 4YC2B 3HG2A 2K6WA 1TTRA 1ZS8B 1P0SE 4YC2C 5FWRA 2YGQA 3KPQB 3PAYA 3ABMB 1NQBA 2O61B 1TQCB 2WPGA 5A3IC 1USZA 3BPLB 3JV6A 1EO8L 5K1VA 5LWYH 5GGQH 1COBA 2IBGA 3MU3A 4OZIB 3NZHH 1X3DA 1B0RA 1IX2A 3LN5A 5J11B 1E2WA 3WD5L 4NZDA 3RZCA 2FTAA 2YAHA 3JZ7A 3K1DA 4ODSH 1NC2B 3S48A 3ROLA 4GFXA 2QPDB 1DJXA 4G9FA 5HVHC 2W1NA 3DOHA 1V10A 2R9HD 2V3FA 4H26B 1FE8L 1ZWIB 2DEXX 3BO8B 5LXGL 1W8EA 3PL6D 3Q8BA 4FQ2H 4OSUH 3X1FA 1I1CA 3SIKA 4P46A 5FUOL 1BLNB 3VRLF 4X6FB 1DE4A 4XPTH 3V79C 1E9PA 4WFEE 4Y16A 1Z66A 3EDFA 4MJIE 4NAMA 3IJEA 4GIAA 1E4WH 2WXIA 1D6EA 4R7VA 3Q2CA 1KC5H 3WUWB 2F53B 4XP4L 2IMMA 1KMGA 2BS71 3KJ4C 2FQGA 3GGWA 4WI6A 1MHPL 3AY4C 1GGIH 5F9OH 4HG4K 1A5FL 1UACH 5KYXA 4HS8L 1NKOA 2BO0A 3OXRA 1OQOA 4YHLL 1H3WM 3FMGH 3QRBA 5EOCJ 3T0EC 3LN4A 3GXUB 4FI6A 1LM8V 1IE4A 1OE2A 2VLRB 4S11A 2NY5L 1A7PL 5F72S 1FGVH 5B1KA 1INDL 2AFNA 5EU4B 5B4MD 1JK8A 4ZPTA 1BIIB 1LNUB 1EH9A 2FD6H