3EOBB

Crystal structure the fab fragment of efalizumab in complex with lfa-1 i domain, form ii
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
220
structure length
215
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCAASGYSFTGHWMNWVRQAPGKGLEWVGMIHPSDSETRYNQKFKDRFTISVDKSKNTLYLQMNSLRAEDTAVYYCARGIYFYGTTYFDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Efalizumab Fab fragment, light chain
publication title Efalizumab binding to the LFA-1 alphaL I domain blocks ICAM-1 binding via steric hindrance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/cell adhesion
total genus 34
structure length 215
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2008-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eobB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eobB01
1EJ6A 1A6TA 4NQCB 3V4PH 5JIKA 4DN3L 3AS3A 1YMHA 4MB3A 3BEWB 1BZ9B 1E28A 4WFFD 1DEDA 3WMSA 4ODSH 4F7CB 1NBVH 4QRRB 5T3ZD 5HGBA 4OZGE 4ZO7A 4I77L 2NXYD 3IDYB 1LO4H 5CJ8A 43CAA 1E27B 1JGVL 1X4YA 1HHHB 3LS4L 2DD8L 2GY5A 3A0OA 1YEFL 3FQUA 2V5MA 3IDJB 3RPIB 3MMEA 1AHWC 2VXUH 1OVZA 4YBHA 1KOAA 1BF8A 1SY6H 1N64H 2GK0A 1IM3A 4ONFL 3SJVB 1O0VA 4WW1A 4HS8H 1JNLL 3M07A 2D7QA 4TSCL 1NCBL 2IBZX 5GRZA 2J7LA 1E4KA 1P69B 1OGTB 4PRAA 5IVXA 3W81A 4ZUUB 5KSUB 3O2WH 4W6XB 4WW2A 5IV2B 5DR5L 3HZKB 1HXYA 4OM0L 4WWKA 1E4XI 5DJZB 2C7UA 4LCYA 1KCVL 3VDAA 5DHVA 4LSPL 2WQ8A 2QSQA 1HHJB 4KH2A 1UM4L 3CXHK 1RJLA 4WUKL 4AIZB 5BS0D 3FZUC 2VIRB 1PQZB 1MRDL 2EKSB 5J12C 5JO5A 2D4DA 4NZRH 1OAKL 5BZWA 4LAQH 1ZHLB 3WNNA 4PG2A 1VESA 3MROB 1EFXB 2NTFB 2NY0D 2NW2B 2EE3A 4GG8B 1E6OH 4PUBL 3HNTH 4ELMA 4DJMA 2J8OA 5DRWA 5F9OL 2F8XC 3SO3C 1OAZH 3KYOA 2X4UA 5ALBL 4LSSL 3EFFA 4JREB 4HS3A 3Q2CA 4XI5C 1T3FB 1G7MA 3RGVB 2DWDA 1TZIA 2IJ0C 1RAMA 1D5XA 3EYOB 4NFBA 4XBPB 4M1DL 4LLWA 4PJIF 5H8DA 5B3JF 4UAOB 3RAJH 1CG9A 1XIWB 4U1IA 2V9QA 1BQHG 3LN9A 1F02I 1RIVH 1NC2D 4AL8H 5FYKU 2RBLA 1TDQA 2XTJD 4G6FD 1AO7E 3QNZB 1JJUA 3U6RA 1SJEB 3QQNA 5ERWA 5BV7H 1BIIB 2E9JA 3SDAD 3ARSA 3VRIA 4M7KL 4U2YA 3OGCA 4EI5D 4Z7UA 4Y16D 3STZA 5ICXB 1HINL 4H88L 5GRXG 4RFEA 2H9GA 4OQTH 4A6YB 1CR9L 1H3GA 1YEHH 2ZOKB 2IPKB 4KZEH 2WBJA 5FGCB 4P2OB 2AXGB 3KR3H 4NWUH 2A74B 5DJXB 2AJXL 3QUYD 1QLFB 3QXUA 4JKWA 5FYKD 4MNQE 3HAEA 2PCPB 4HWNA 2AJSL 1JGUH 1GH7A 3OX8A 5GGRB 1WWBX 4B7IA 2HJFA 4QXTB 4X4ZA 4CADB 4K7PH 5HHVH 4EN3B 4O2FB 2P8PA 5T1KD 3S37L 3DO7B 4MNGA 1FFNB 4MA8H 4O02H 4LLDB 1MPAH 2F53A 2H1PH 3G5VA 2EYRB 4H1LH 3EZ8A 4WWID 1OPGH 4C4KO 5J06A 4X6EA 2O61A 4JN2B 5D2NA 5CSZB 3K3QA 5HGHA 1GGIL 1DVFA 2FO4A 4ZAKC 3RVTC 5E8DL 3MCLH 1NQBA 2VXQH 4WCYL 4WU5A 3QFJD 1UWXH 3V4UH 1KJ2H 2GJZA 3PDDA 3MLWL 2O5ZH 4Y4HA 3GSUB 4P99A 1INQA 5I8OH 2CJUH 1E4JA 1IGTA 3UTSA 3E2HC 1YJDC 4P49A 4YXHH 3L5JA 2OK0L 3ZMRA 3ZT6A 4D3CL 1OGAB 5B38A 5ESQA 3NZHH 5D7KE 2IH3A 3N1GC 5HI3C 1JTPA 4MJIA 1JHTA 2R2HA 1MY5A 2Y23A 1J8HD 1WZLA 3I50H 1UB6B 3PHOA 5IW1B 2JE8A 2C1PB 4G80A 4LSQH 5CCKL 3LN5A 4XP1H 2OZ4A 5F3BA 2BVOA 1WZMA 3EFDH 1LDSA 5I8CA 3OQ3B 4HBCH 4L8BB 3GSNA 4JFPB 4BZYA 1B0GB 4YO0B 1C5BH 1HYSC 3FQRA 4OT1L 5L9DH 4JPVL 4V1DD 1IAOA 4MQSB 4H8WC 1IQWH 3BP7A 5HPMB 4LLQA 4NKIL 4CBPA 2B39A 4BZ1L 5DUBB 1FNEB 2AS5M 1JNJA 1TCMA 1KLGA 4XCEB 5EBLB 1B0WA 2Q8AH 4ZFFA 5DS8A 1BFTA 4RAUA 3QIWD 4UOW1 2Q7YB 5DJAA 3AREC 3ZKSD 2UZXB 4S1QH 1IQDA 3IDNA 2E9IA 3HG1A 1U58A 3BRFA 2YD6A 3O2DL 1UM6H 3ETBF 1F97A 2R4RL 2R56L 1AGFA 1G0YR 4Z78A 5TE7H 4Y5VA 4Y4KB 5HYJA 1RUAL 3FB7B 1VSCA 4LGPB 3CSPA 3X17A 3I6LD 2DQCL 2OYPA 4GQ9H 4DCQA 3CX5K 4DKAA 2GQHA 3BQUD 1DUZB 3INUH 1AE6L 3NA4A 3S97C 3LKOA 2WUCH 5GHWH 2FR4B 4G7VH 1P5UA 1FLRL 4G6KH 3EOYG 4OCSL 1U8OB 1R24A 1JWUA 1P7QA 1UJ3B 4PGEB 2QTEA 4FQ2H 2X4OB 5F1NA 3KPPB 3U0WH 3TCLB 4BSJA 4QXUH 1TQCC 1RJCA 2FL5B 3ZDZE 2EDBA 2FWOA 1CL7L 3QUXB 4K55A 2ICCA 1FL5B 3R1GL 2H41A 1OW0A 2FJFA 1UWEL 3OAYK 4MVBD 3VDCA 1MLCA 1EJOH 5F7EL 5AUMB 3C2AL 5D2LF 1RURH 3D85D 4L9LC 1LP9A 2YSSA 3LEVL 3MV7B 5LQBL 1YEEL 4Z7OF 2EEBA 3KXFE 2J8UF 3QCTH 3IXTA 4HKBA 3KJ4B 3QIBA 1VKXB 4PJ7F 4X4ME 1AQKL 3ARWA 4HMCA 4IHOB 1WBZA 5SX5H 3TNMA 2VDRH 3AMLA 2YBRB 4MS8D 3ZE1F 4NYLA 1YEJL 5D72L 3DETD 3ULVF 4MAYC 1X7QB 1KYOK 3MUJA 2Y5TA 1W0YT 2WUBH 1CD8A 2W60A 4GRWE 3HLAB 43C9B 4HJGB 1DQQA 3MUY1 4W4OC 4Y5YA 4AMKL 3QWRD 3STLA 2MQ0A 5CGTA 4QHUB 1Z0NA 3VFPB 4GG6F 3QXAA 3MRBB 4FP8H 4OFIA 1DBKL 1XZ0B 4P3WA 5FDWB 1YECL 1KJ3H 3G5ZA 1GAFL 4GQPH 4MJ5A 2DWEA 5CJBA 1MNUL 5FHBL 1JPGB 4UDTB 4KGJA 5HYSG 4UV4H 5DLML 4ZNCD 5BJTB 5CSGA 2WZPD 1V7MH 2DBLL 3BJLA 3L5WB 1IVLA 3H9YA 1A3RL 3U79A 3G6DL 3MOBH 2IANA 4OZFH 2BK8A 4ODXB 3VXPB 1U8PA 1UXWA 5K9OB 5L6YL 1K3IA 5DRZB 4O9HH 3S98A 2YD2A 4X0KA 3SGEI 3GSWA 3ULVC 4G9FA 4U1NA 4XNMB 5D1QA 3QO0A 4XH2A 1G9MC 2D03H 3P9LB 3DECA 2BHYA 1V3JA 2HKHH 2UZIL 1NMAH 2ZCHL 5C0RL 3OR7B 4RFNC 4GAFB 3S5LB 5KVFL 5BRZE 35C8L 4AEIL 4LCWD 4Y5XA 4JB9L 2OQJA 2WP3O 4U7KA 3BPLC 5FK9A 1JFQH 2R0LL 4ZS6C 4R2GD 4MQ7B 2PYFA 2QR0A 2HFFB 5L7XH 4X7SL 2EICA 4PJ8A 1AXIB 5FECA 4HUXB 1AQDA 3B9DA 5FA3A 5CD3A 1PG7W 4JN1L 4RMTA 2IEPA 3KGRA 2A2QT 4LHJB 3GEWB 1DTUA 5D8JH 2XA8H 3MRCB 2CMRH 3CFDA 1CFSA 4DKEH 4YIQB 3LRSA 5J11C 3NPSC 5GGVH 3ME0A 3E3QC 5IB4A 2AVGA 1UA6H 5KVGH 3DRQA 5DT1L 5I1HL 2AXFB 5TH2A 2MSPA 2A1WH 3DROB 4ZODA 4NNPL 1U8QA 1LE9B 1MQKL 5EU7C 1CE6B 1FNSL 2X42A 2I24N 1MCOH 2APTA 3IFNH 4XPBL 3GMRA 4DEPC 1F3DH 1FZMB 1JVKA 2IGFL 3STBA 1F58L 1MAML 3B9KB 1A2YA 1EZVX 4LSTH 5I15H 2R8SL 5E99L 1R3LB 3OV6A 3U4AA 5C07D 2DI7A 3M8OL 5E9DA 3IVKA 3CFKA 3GJFH 2QADD 2ZJSL 5C0ND 1GPOL 3O2VL 4PRPD 3QDJE 5BW7A 4A6YH 1FYTB 2MJWA 4KK6C 3JWOH 3ORJA 4MXWL 4ZFZA 1RFDH 2FX7H 3EW3B 4OGAC 4MD4B 2XWBB 2UVEA 5F7MC 5MERB 4OFYD 5FM5M 3PV6A 3BH9A 2DQFA 4YHYC 3UROR 4P2YA 3TIEB 1U95B 1YYLL 3TA3C 1Q9OA 1S9WA 5GRUL 1JZ8A 4HX1A 1U36A 1PJ9A 5EOQH 4GBXA 2RR3A 2W0FB 1VGKA 5IF0A 1IGJB 2HFGL 1A14H 5J0BA 4Z0XA 2BSED 3CFJB 3RWDA 4GKSB 2BSTA 1RZFL 1RIUH 3EDEA 4MQXD 3BT2L 4P46B 5K59F 5EU3B 3FB5A 3KAAA 5IVNA 3GO1L 3RDTD 5TDNA 2HT4C 1FNGB 4BUHA 3JVGC 5EB9A 2EO1A 1KV3A 3DVFA 1QSVA 1HQRA 3ZTNL 4X5WB 5FF6A 4PP2B 2LU4A 4JZOA 4J7RA 2PW2B 1U3HB 2NY1C 3GBML 4M62H 5TE6L 5L88H 4GOSA 1F6LL 3B9VA 1AXTH 4IMLB 4APQC 5IB1B 5DJ2B 1LO5B 1JPSL 2HT2C 5F7NC 4C56A 3ULSA 3LS5L 1KPUA 5FGBA 5DFVC 3VFSA 1YEKL 3V6ZA 2J1KA 2DI8A 4QY8A 3TNNB 1ND0A 1JHKH 5I73B 2HTLC 1KIUA 2DTMH 2V9TA 5FHAH 1NCTA 1YN7B 3B3IB 4RA0C 3KPMA 1DJSA 5DVKA 5EU5B 5IG7B 3TVMD 2ZSWA 5K9KB 4PJXE 2NX5E 3KJ6L 4X80H 4GKZB 1RD6A 4YDJA 4AYFA 1HWHB 4K7PX 2OP4L 3WFZA 4HUVB 4UIMB 5HY9B 2EDRA 2Y6SC 3QA3B 3RX5A 3OKNB 3RWIA 4ODWB 3WIFA 5DHYA 2AJUL 4MAUH 4F80A 4UT7H 1KTLB 3OBAA 2ATKB 3BH8A 3VFUB 1XFPA 4GW4B 2F58L 1HIMH 3CZFB 1W8OA 3G04B 4Y0GA 2BVPB 2BNRA 3F7QA 1UH2A 2P5EA 4HV8A 3FT2A 5JW5B 1JWSB 3QO1A 3K4ZA 3BDYH 4RMVA 4Z18A 1N6VA 4NKQB 3P9WB 5CZVL 4NQCD 2BC4A 1NAMA 3D25B 3MREA 1J11A 5F7YC 3ARUA 2DQDL 5GZND 3GIVB 1JPFA 4RX4D 4Z95L 4QRRD 5DJYA 1PZ5B 1ZV5A 2KQMA 5FXCH 1WIOA 3V6FA 4NBYB 1OY3B 1A0QL 2IMNA 1WIPA 2EE6A 1RZJH 5TQ2L 4LASH 3ALWA 3T1FA 1WISA 4F37F 3ZSTA 1PG7H 5ANMB 4X9BA 5AD0B 1NDMB 2JK5B 4Q9QL 1Y18B 1KIPA 3SJVD 5L8JB 3MV8E 4AEHL 3P0VH 4P2QA 3MJ8B 4RGNE 2J12B 3EOBA 1DFBL 1XH3A 4KK8D 2NY5H 5ESVB 3RIAF 3DRTB 4YHLL 3T8XB 1GOHA 2RQ8A 3WIIL 3DX8A 4EUPG 1R5VA 3MRNA 4ZOBA 3VG0L 1QEWB 2PXYB 5L2KA 4U1GB 4YXKL 2F54E 5FA4B 3RNKB 3DLQR 3MLXH 1NGPL 2P8LB 2HVKA 4DGYH 1IC5H 4NKDB 1EHAA 3VD5A 5IFAH 4JFOB 3AUVA 4H5SA 5C7XH 5I8EA 5I71B 1DANT 2R1XA 4HEPG 4KRPB 4HPYL 3LQMA 5FYLL 1IZKA 4U4BA 3OGOE 3CK0H 5ACZB 3FQXB 5C9JA 3RGVD 4HCRA 4BH8B 1FAIL 1LHZA 3OAZK 4OGYH 5E4IA 2HWZL 1JZ4A 2B1HH 3K81A 3MLSH 4WEMB 1IFHL 3LQZB 2HMID 3K80A 3RZCC 3V8CA 5M7QA 4OCYH 1WAAE 2HTKD 1XIWD 3VA6A 5DZOA 4JPIA 1BOGB 1G1YA 2ORBH 5GS1B 2C4XA 5J13B 2IADA 2CIKA 3VXMA 1MFEL 4LU5H 2A6KA 2AAVA 3DXAE 4WFGD 4S0TD 4X7TB 1DEEA 1XGRB 1KCSL 4Y4FB 1NDGB 2ED8A 4F15C 3I2CH 4HS6A 3FQWB 5B8CA 2VAAB 2ESVB 3ULUE 1S7QA 4NO0A 4P23B 4X4YA 2XWTB 3PHSA 1PEWA 4JDZA 5JOEA 2FDBP 3UTTE 5J6GB 3WKML 4X98B 4RAVB 2X4SB 1ROWA 4P2OD 3LAFA 3B83A 3IFOA 3L7EB 4UTBL 5FYLD 2BNUB 3BIKA 3OAUL 4NBXB 4JFHE 3SE8L 3SHSA 2XFXB 1A3QA 2JCCA 4S1RL 3OR6B 4XVTH 1XGQB 2G5BA 4N0YL 5ADPL 4EN3D 1F3JA 3GHEL 3GSOA 2G60H 5C08E 4Q9RL 4KTYA 4D0CA 2H2SD 3BZDA 4GAGH 1S78C 3GSXB 3FOMA 1SJHB 2LV4A 4PJ5B 4WV1C 5ECJE 5DMIL 4NRXB 1V7NL 3WDIA 2EXYD 2VDNL 4EXPX 4J12A 5FAAA 2XZCH 4XNXL 3C5ZC 3NACL 4U1SA 3SKUD 3QPQC 3L5IA 5EG6C 3AAZB 3DV6B 4R7NB 1KT2A 4L8SB 4ZXBB 5F21B 3ZHKA 1P6AB 4OIIL 3QUKB 3B6SA 2HKFH 4Z7VE 1NL0H 2X1QA 2CLZA 1FE8L 1QSEA 4HIXH 5GS3A 3HUJB 3O0RL 5KSBB 4JQIL 3PABA 1IGMH 1OGAD 1U8HB 3GMQB 1BX2A 5TF1L 4QEGA 3BPOC 2CIIA 3QUZB 1E4XH 3QSKB 2I60H 1CWVA 1YMMB 1KCUH 1WCBB 3TO4A 3MLYL 3C60B 4PJEE 4HZLB 4CN4A 4FFVC 4DUWA 2FGWL 4DVBB 1UH4A 1MHPH 1EDQA 3ISWA 1K8DA 4HHAA 5HGAB 5T5NG 4Z76B 1CYGA 3TIDB 4KQ3L 3WS6C 4PJ9B 1J1PL 1NGXA 1E6JH 2WLZA 4M9PA 1Q0XL 1QPPA 5DTFA 3WLBA 2DYPB 1YY8A 1RZIB 5E6ZA 2Q76B 2FX9H 3KYAA 3TJHC 2XXCB 1WIUA 5I6XB 2E7HA 3IU4H 3CMGA 2GFBB 3T65A 1YC8A 4R26L 3QRGL 5D1ZC 1K5NB 4O5LL 1V5JA 3BD4A 4H1LG 5IHBA 4OZHA 1OD9A 2R0WH 4JQVA 1J0IA 4I48A 2CDGB 1KJVA 4GMTH 1LEKA 4HC1L 2CXKA 2P7TB 1U2CA 4FQHA 1TJGL 2HG5A 3GIZH 2FEEI 3D39A 4PJBB 4I9WE 4F9PA 4JY6A 1VFUA 4F2MB 3CVHA 1FL3B 2GJ6B 3HC3H 7CGTA 3ARBB 3MTRA 1RUML 2B4CC 4JPWL 1M7XA 5EUOB 3GMPB 3CFEA 2CPCA 1XGTA 1HXMB 3VFVA 1FFPA 4HWZB 3TZVA 5HD8C 4ODUA 4K94C 1J05A 2C1OB 2EC8A 3QUXD 1ULVA 4TNVF 4KDVA 3ARDB 3P30L 3QJFB 1NCAH 4D0DA 4JQXC 3LKNA 1HH6A 4HPOH 1YN6A 1AC6A 2DMCA 4UOJA 1I9JL 1BZ7A 4L1DA 3GB7A 3MV7D 2FYYA 3W11D 3B43A 1DBBL 3DVNA 4YPJA 4AJ0A 2B20A 3AXLB 3P4NA 4OAWA 1TCRA 1QTYT 4MYWB 3PJSB 3T77B 4UT6L 4GLRI 3QG7L 2DTSA 5KVDH 3BN9C 1BGXH 4EBQH 1IAIL 3IAQA 4WFHE 4RISL 2P43B 5GRJL 1A7BA 4U3HA 2YUWA 1NFDB 5D7LA 1KFAL 2HLAA 3PWNB 4HUWB 4KJYA 5D1XC 5AEAA 5EORH 1WBXB 4MMXC 3EYFB 3F8UB 3VMOA 1U93A 3T2QA 3DO3A 1O7SA 5CSBA 4P3DB 5TPWL 5IUSA 1EA9C 4M1CD 5DJCA 3ZKMC 3TCXA 3C8KA 4M7LL 4FFWD 4EDXB 2ARJA 3WIHH 4M7ZB 4Q6IB 2XXMB 3MV9E 1JPST 4LF3B 1F6AA 4YHMH 2GT9A 2VQ1A 3NCMA 5CP3A 3ARFB 1T1XA 4E5XA 3GSQA 6FABL 3LKRB 4R4FL 4YNYB 2E6JA 4HWEL 1XF2B 4MLSA 1CGUA 4L4VA 1BECA 1DR9A 4EOWH 4Z8FL 1LEIB 1A1MB 2W9DH 2F15A 2AERT 4GRLD 3Q1SL 4LAJH 2LVCA 5B4MC 2YPLE 5JDJA 2FIKB 2Z4QA 1U8KA 3NCYP 4F7PB 3WUWB 3HNVL 5C0IA 2NNAB 4HIIA 3HKFA 1FGNL 1TVDA 3UJJH 4G8GA 2GAZA 4JGUA 1IGCL 1CN4A 1Z9MA 5DEFB 5J6HA 2VDPH 4OQ1A 1I1AB 4KI5F 4U3CA 1ERNA 3P3YA 4PJAF 1IC7L 3W2DL 1FGVL 2DDQL 3N85L 4QRPA 1KELL 3MLUL 1R5IB 4XCFL 4Z9KB 5FOBA 3VMNA 3FO9A 2H2PD 3ESUF 1QNZH 2GSIB 3VWKC 2E9WA 1J7VR 2VLLA 1BWWA 1QRNA 5DK0B 4XP6H 1T2QL 1RJZA 3OHXA 1P7KA 3KLHC 2CO7B 4LVHC 3EO0A 4Q0XL 5CZXC 4OKVA 4ZTOL 5J12B 1N59B 1T2JA 2AEPH 4NM4H 4ZUVB 2WWMD 12E8L 2DKSA 4K2UH 4RMWA 3L6FB 4MHHI 2CGRH 2Z35B 3B9KD 3TT1H 1PG7X 4JM4L 5KS9A 4WI9A 4QWWD 2GJJA 1Q94A 4O4YH 1DDHA 1KN4L 1I3UA 2DQJH 5JW3L 5IGXH 3I6GA 4IRZH 2QKIB 4KI5C 3SO3B 1PSKH 3QCUH 2FATL 4BSVA 1MJUH 3OSKA 4OZFG 3ZYJA 3L9RA 5D7IF 1Z3GH 1PGRB 4ZUTB 1FYTD 4XCYA 4P2RE 2XACC 2VDKH 1PYWA 4PLNC 1RIHH 4I0PA 3FFDA 3SE3A 1SYSB 3QJHB 1OTUC 4DTGL 4KHTL 4Y2DA 1E4WH 1ZLSL 2VNCA 5DO2D 1QZ1A 1S9YA 3T0EC 1QSFB 2R23A 3I3EA 3OKLB 4HXAL 3NCEB 3ROOA 5EZLA 4NSKA 2I27N 2IQ9H 3QWOB 2XY2A 2PO6C 4UNUA 3U0TB 1MCKA 1FZKA 3VXNB 2B0SL 5FCSH 2F74B 2QEJA 4BSWB 1QR1A 4P46D 3V4VH 3CU7A 4IDLA 5BOPA 3WFHB 3VXSB 4K7PY 3EGSB 4YDLC 2OJEA 5T5FL 3VI3E 4GXUM 3DYOA 3MNZB 4M8QB 1P6FA 4RRPG 5IVXE 4D9QD 1UENA 1OSZB 4E41B 5JDSB 4HKZA 2AP2A 2AJYL 4JAMB 4X6DA 1CIDA 4C55A 1U3HD 4LSRL 1A7OL 1AGCA 4KK5D 1UWGH 4PP1D 4XC1L 4PJIB 3LKQA 5BZDB 4F9LA 2CUIA 2WWKT 1Q9KB 5LG1A 5GSVB 5AZEL 2HRPH 1BVZA 3MRDA 3LZFH 1R3JA 4FXGA 4JRXA 3BOVA 3HC0A 3QQ9D 3S3PA 4KKAC 3FO0H 4X99A 4U6XB 4QO1A 1GC1C 5JHLH 1RUPL 4ZAKB 1DQLH 2NY7H 4XCCL 4ELME 2BJMH 3F58L 3LKSB 3MA9L 3QNYB 5E2UL 4EZMA 3O3DA 3T0VA 1UWXK 1XT5A 4X8JA 5E08L 4PGDA 3E2HB 4OF6A 5C8JB 2ITDB 5EBMA 1CGSH 1KCRH 4CJ1A 5KG9A 3PQYB 3FO2A 1B2WH 2UYLB 4GSDL 3GI9L 4YPGB 4DFHA 1T1ZA 2CD0A 3E6HB 4F3FA 1U8IB 2DOCA 3SKMB 4KKCD 4BKLB 1AD0A 1NSNH 1OLZA 1UGNA 4IEFB 5E5MA 1WVZA 1MHCA 4XP4H 1HHIA 2NYYC 3RUGF 5MENE 4XWGL 1A4KB 3NIFF 3BUYB 4G5ZL 4QCIB 4Z7UE 3H7BB 2K3TA 1NAKH 5IW6A 3UJTH 1BQUA 4JO1L 4W4NA 1I7ZA 5LCVH 3NAAL 1CXIA 5E8PA 3H3BC 4PIRF 3OJMB 4JHAH 4YE4H 4ZOEA 5FCUH 2Y36L 4UB0H 4KJWD 4KRNA 5H35A 4OGXH 3ALXA 5JOPD 2EC9U 1RZKL 4XVJH 3WEXB 5J9PA 3AREB 2C3VA 4NHCL 1DQTA 4MNGE 4J8RA 5EOCH 2WM0A 5DHVH 2F53E 2FO1A 2UWEA 2D0FA 4C57C 1GZPB 1A8JH 5LWYH 1CD9B 4ZFGH 1ES0A 1YPZA 5HYQA 3DUUB 2R2EB 3C2SA 4JZJA 3U0PB 4WIQA 1N6QH 3VXQB 5D2NE 4FQIL 3O8XA 5GRWA 4LCCC 3ROLB 1A6AA 4FQQA 3OKOB 4FQXC 1AFVL 5TQ0H 1EO8H 3RVXD 3QRFM 3UAJC 1T1WB 1C12B 5F1KC 4JFZH 5IMOB 2X70B 3PWPA 4A2LA 3RWJA 3UTSE 1NUFA 2YD7A 5HYSA 4M48L 2PXYD 2WK2A 5J3HC 3NVQA 4KDWA 4NRYB 4GO6B 5HDLA 1TQCB 1U8JB 4NQEA 1Q9LA 2X40A 3QDMB 3RRQA 1ZWIA 2BOBB 3AM8C 3O6KH 3QXVA 5HHOA 4XNUH 4DGIL 1MRFH 3N1MC 4ODTL 4XC3L 5I75C 4L8CA 3QI9C 5C9KA 2A38A 4I3RH 15C8H 2X1WL 4KRPD 3V6OA 4PR5A 4L9LB 4HXBH 2ITCB 4AT6A 4UIKL 3AGVA 5EBWA 3NIDE 4G3YL 1I7UB 1NGQL 3F7VB 3G6JA 5SX5K 5EC2B 4XNQB 3GJEB 2A9ML 3MJ9L 1ZHNB 4BK4A 4GMSH 4NZJA 2V7HB 3H0TA 3V4PL 2PYEA 4MAYB 1KTDA 3TM6A 2SEBA 4XPHH 2OTPA 1YYML 4G7YH 4LNVA 2JB5L 3BIBX 5HDQH 3SE4C 3AY4C 3IFPB 1D9KB 1WZ1H 2G9HB 3HAEH 2EDXA 2NQCA 4Y4FD 1X5FA 3O11A 3BGFC 3OB0H 4PBXA 3VJ6B 2ESVD 4UTAL 3X3FH 2D0HA 4YBQC 4P23D 4ETYA 2C5DC 2COQA 3GI8H 1GHFH 5CINL 5HYJE 1HEZB 3UZVB 4HAGA 5D2LB 5TF0A 4JFDB 1QFOA 3TYFB 4JG1L 2LE9A 2CQVA 2W1NA 3BEVA 5EIIA 3TGXA 3C8DA 4MWFB 1MWAL 1JI2A 2J8UB 4O2CA 4TQEH 1DBJH 5D70H 4PJ7B 2OTWB 3TBSA 1N2RB 4MD5A 5FIEA 5I74C 2Y72A 32C2B 1MCBA 1BAFH 3LOWA 4AH2A 1FSKC 3CMOH 4ONHB 4ISVA 4KC3B 4YC2C 4PJ5D 1CE1H 4PJIE 4RFNB 3DMMC 3KYMB 1IGFH 4DW2H 5K93A 3HNTL 3BPLB 4Z7QF 4GG6B 3MPCA 4EDWH 4M1GH 3QIUD 4ZXBD 1CT8A 1LP9E 4QGTA 2HAZA 4LRIC 3GHBL 4PRIB 5GGVY 5FKPB 3HZVB 2OCFD 1UFUA 1I1YA 2CKBA 4PB9H 4UDUA 1HILB 1I9EA 5EBGA 5EPMB 5BS0A 1S7VA 2R2CA 3VH8G 5INCB 1S7UA 5J11B 2BNQB 1FNHA 2ED7A 3ELAT 3NPSB 3RFZC 1Z2KA 2XZAH 3FQNA 4D9LL 2GY7B 3QUZD 1ZVSA 4KAQL 3BD5A 4XNZC 3RVWC 1YMMD 2ZOLA 3C60D 4NQVA 4BQBA 2Y9RT 4IMKA 4D0BB 5BV7L 2E9BA 3FT4B 5CEZH 5SWZB 2PTTB 4DEPB 1VCAA 1A47A 2OR8A 4U6VH 3HCVB 1FO0L 1MJ7H 3HR5B 3S5LG 4GRMA 4U05A 4PJ9D 1ZKAA 3GUTA 1IILE 4KK9D 3T1WA 1JK8A 4P9HL 5KTEH 4YXLH 2VLKB 4JVUA 5F96H 1ORQA 3VXTB 3SDCC 3GJFK 3PWJB 1S5HB 2IANE 3FHQA 3GMLB 1NC2A 5GSRB 1MCDA 4OLXH 3MRRB 3WO4C 1Q1JH 2IG2H 4KVCL 4L5FL 5GGRY 2NZ9D 3SDAA 4G9FE 3P0GB 1UC6A 4YHYB 5IB5B 4EI5A 3RHWF 1JI1A 1CF8L 4MX7A 4Y16A 3TA3B 1G9NL 2BVQA 2D7TH 4LLVB 4D8PA 2A6DA 3EHBD 3QQ4B 1AD9B 1CBVL 5CD5C 2I9LB 3QUYA 2Z31C 2YRLA 4GW1B 2GJ6D 3ARBD 2O5ZL 4MJ6B 1KNOB 1PX3A 3GRWL 1EAPA 3X3GL 1K4CA 4HIJA 2DQHL 1KG0A 2IAMD 4PV9A 3EOAB 5T1KA 5IFJA 4X6BA 3G9VA 2CLVA 1U8LA 4GH7B 1KEGH 1LWRA 4X6FA 2FX8H 1JV5A 1F4YH 1Z6JT 3VFOB 3ARDD 1QD0A 4PJCA 4MDIB 1CICC 2NY1B 1FH5L 1JF1A 2Q86A 2JF1A 5HBBA 5TDPB 1IMHC 1YJDH 3HB3D 4APQB 5I76B 2DM7A 3VCLB 1QBLH 3QFJA 5IT2H 4K8RC 3SY0A 3QH3A 3DGCR 2ERJC 1IM9B 3JWDH 1T0MA 3A6CH 2ATPA 1KC5L 4JO4H 3IXAB 4XHJD 4NZTL 5IQ9A 3D2UB 3RL2B 1JWMB 5E9DE 1J8HA 2CSPA 2CH8A 1NLBH 2VITB 5ICYB 4K3EH 2K7QA 4X5LA 5C0EB 4S1QL 3LVEA 3X12A 1HE7A 2XZQH 4RWYL 4GAYB 3IFLH 1T7WA 1KIQA 2X4QB 3U7YL 1W2KT 4IRJC 4JKPH 1S7XA 5LAXA 3KPLA 5MEND 3S96B 4J3WA 4ODHH 2I9TA 3FQTA 5J1AA 4XZUB 5ADOH 1PW3A 1VADB 4V1DA 1G7HB 1NKRA 2CDEB 1KACB 5CBEA 2FBOJ 3DUSA 2DLEA 4WI7A 4QGYA 3RZWA 1P1ZB 1AR1D 1NPUA 3ARFD 1PDKA 1L7IL 3FOLA 4NNYA 4OZ4B 5E8EA 1NGWA 3MJ7B 2HN7A 3BMVA 3L7FA 3QIWA 4LSDA 1OAXH 5E94A 1H5BA 2EDTA 5IOPB 4NGHH 3U0WL 3BW9A 1GCFA 1B4RA 2IH1B 2Q7NA 4ZPTB 1EMTH 3CDCA 3FO1A 4CKVX 4PRNA 4ORGB 3HFML 1DLFH 2ZUVA 2YRPA 1QA9A 1N5AB 2VDLH 1LO3H 1ZLWH 3MUGA 2RFXA 3X14B 1I85C 4NUJB 5CWSA 5EZJB 2VXTH 4K23H 4HIHB 3V7MA 4YQXH 3QUMB 1AC0A 5I1JH 1I3RB 1BFSA 4L4TB 4RGMC 4NDMB 4XTRC 3BQUA 5J56B 1DQDH 2GUOB 1KCKA 4G6JH 1ZA3A 4LKXB 4C56E 4LLMB 5GS0L 1FVDB 2AW2A 1SJXA 1XGUA 4FQJH 3RKDC 1CLOH 1G7JB 1NFIB 3V0VB 4LIQL 1IE5A 4OUUB 2EIEA 2V7NB 3ARRA 2WUBL 3T4AB 5IWLA 3UC0L 4FQ1H 1FORH 2ARJQ 1JN6A 1CU4L 4HK3J 1ZLUH 3FZUD 2B5IC 5JHDE 3SOBH 2IBGA 2F5BH 3ZT5A 3D85A 5C09B 3BKMH 5EO9A 5HSFA 3GSVA 4JLRA 1KJ3L 4POZC 1YA5A 2VLME 4LFHD 1J0HA 1N4XH 4ZO8A 1EEYB 5EU7E 1FV1A 1KIRA 1A1NA 3QWQB 1T7ZA 1FFRA 3VGGA 4UV4L 3X13B 1WJ3A 5HVHC 1I9IH 1V7ML 2I5YH 4IRSB 1FHGA 4KROC 3NFNB 2X9WA 4M6AA 4Y19B 1C5DB 2BNRE 4OLWH 4XI5D 5IB2B 5HI4C 1RY7B 2P5EE 1LD9A 4HJJL 1MJ8H 5E8NB 5HYFA 3J8F7 4N0CC 1C7TA 5CEZD 3QWRA 3RZCB 4LDEB 2EE2A 1A9EA 4RDQG 5FKAB 5KAQG 1WSST 1RULL 5ESAA 4RQQA 1BJMA 2HKHL 4P5KB 1NMAL 3TBVA 1F90H 1QSFD 1RUQH 4JKMA 2Y7QB 1ZHBB 1MREL 4AM0B 2PW1A 3SPVB 3V0WL 1I3GL 4G42B 4J4PC 2HJLA 5IW3A 4F15B 5JUEH 4PJGF 1WBYB 3ULVH 2MCPL 1I7RB 2UUDH 4OLZH 3TESA 3BGMA 1EIBA 4PJFA 1BHGA 2GEEA 4OI8A 2VH5H 3VXSD 5T1LB 3DVGA 4UI2A 1G7IB 1TXKA 4YGVB 2AK4B 1CS6A 5E56A 3LHPH 4P2QE 4WFEE 1I7TB 4YDVA 4RMQA 3X11B 4DOHE 4PGBB 3QPXH 3SE9L 4E41D 5FB8A 3EKCA 3IKCA 3AU1A 2DAVA 5KANG 3HE6C 4OB5H 3WNKA 1W0WA 3S36H 1JE6A 3MA7B 1R3HA 4FQLH 4LCWA 5AAMA 1MHHB 5L2KE 5GGTL 3WHXA 1TJIH 4CN1A 3LH2L 3N9GL 3LEYL 5E2TL 5ID0B 4WV1B 1EPFA 4L3CA 1G0XA 4X7EC 4DKFH 1MI5B 3PWUB 5DDHB 3KYKH 3L3KB 5BVPH 1XGYH 2DQIL 4DN4H 4LSTL 4FNLH 5E70A 2JJTA 4H8WL 1HQ4A 5ETUB 3BP4B 5E2WL 1MCCA 1QACA 1UCBL 3ZL4H 3BZFA 4H1LA 4ZAKD 3RVTD 3UTQA 1YDPB 1DQJB 4JFFB 1LK3H 5FUOL 4TVPE 4G8FA 2ID5A 5CGMA 2XQBH 3FRUB 4LEOA 4U1HA 4N5EC 2DQTL 1XGPA 4O58L 3TV3L 3PQYD 4HK0A 5K59E 5DWUH 5HI3D 1NMCC 3L3DA 1AI1H 5E4EB 4I18A 3VWJC 5DUPH 3BPOB 3BPCA 4KV5F 2C4FU 1BF2A 3VXME 1NAMH 5DQJB 3K2MC 3CCHA 3DIFA 2IC2A 2J2ZA 3NIGF 1MFCH 2A77H 5C07A 1BJ8A 1NCCH 2FHFA 5I1DB 1IT9L 4J3XA 2G75B 4N8VG 2P46B 4PRPA 1HYSD 1OAYL 3WFEH 5DMKB 3ARPA 3SBWA 4OV5B 4JFEB 3EDDA 1A6ZB 3DBXA 1DLHA 2BXYA 4JRWA 3QAZC 3WE6A 4QRUB 3OZ9H 5E2JA 4OFYA 4JRYB 3IDYC 5F3HA 3DX7A 2YN5A 4WY7L 2JCCE 4QTHB 4N9OB 5DJ8A 5I16A 4PD4K 3L3IA 1R6VA 4UBDC 3ARED 1KLFA 3TBYB 3TWCL 3TBTA 4M3JA 4KXZH 1BZQK 3HZMB 4IOSD 2FEEL 5D1ZB 3C6SA 1X6NA 3CSBA 4N0UA 4GT7A 1UQSA 2ADFL 3C5JB 2PR4L 3MLZH 3CUPA 4NNXB 2BCKB 2OXHA 1A6VH 2AKRB 1JGDA 1IEAB 5INDA 1FVEB 3V5KA 1NGZB 5GS2H 3RDTA 3MSPA 3PHQA 3MODH 3MOAL 3QG6A 5EU4B 4Q58C 1SJVA 3ZTJH 1J86A 5ALCL 3MRFA 4BA8A 3SO5A 1FRGL 1YQVH 1Z5LA 1A7PH 3MNWA 1HI6A 1M6OB 3VFNA 1JMXA 2NY4C 4OZIF 1QSEE 2E5EA 4HDIB 1NBZB 1EEZB 4HZAA 3BVNB 4TVPH 5HHQA 4RNRB 1MLBA 4KY1H 2AEQL 1XR9A 3MRHB 4KVNH 4HCRH 5ABDE 1M7DA 5EO1A 2HRLA 2ENSA 2BDNL 3QDMD 1D6EB 3KPSB 3D0VA 2C3WA 1LE5B 3TT3H 1MVUA 4MAUL 1DUYB 4P9ML 3TBWA 1BLNA 3MRKA 1S5IL 2X1PA 2X4NB 3S35X 4KZDH 1BJ1H 2RCSL 5KN5A 1UJTA 1HK6A 1YC7A 4JREC 2FB4L 1UVQA 4R8WL 4YBLC 1SQ2N 5F89B 4OLEA 3WYRA 3TVMA 5HYEA 2F5AL 4N8CH 2QQLH 4TUKH 1UT9A 4FABH 4M5YL 1JGEA 2QL1A 3CDYA 2VZOA 1JZ3A 3P9MB 5TDOA 1K4DA 1F8TL 3ZT7A 4MAYD 5DFTA 1JNHB 1UB5B 1OAUL 5J4MA 1S7TB 3IDUA 3QHZL 4ERSH 3GKZA 4CJ0A 1JGLH 3OJDA 3UDWC 5HPOA 5IB3B 3WFDL 4F7EA 1H3XA 3QFDB 1IAMA 4JPKH 5D1XB 5C0FA 1EGJL 3DHMA 3MLRH 3QNXB 5DC9B 4CMMB 1C16A 4RZCB 1KBGL 2ARWA 4OZHE 2ENYA 4DVRH 1YEGL 2VDQH 2E8ZA 3I6KA 1CD0A 3C87A 5DA4A 5TJWK 5I8KH 3HPLB 1KB5B 4JFDD 3NH7H 2VZVA 3D39E 5I66B 2A6IB 4O2EB 4M43L 1CTNA 3QUMH 4Y7MA 3LIZL 4NQCA 3SDDC 3BEWA 1BZ9A 4LEXH 3IRZA 4F7CA 4RX4A 4QRRA 3BYTA 3V52H 5C70A 1E27A 4NM8H 1HHHA 1OAQL 3ULVD 3QYCA 5JIPA 3WJLA 1VFMA 4TSAL 2YA1A 3IDJA 3RY5A 3RPIA 1WGOA 5IR1B 1XF3B 2EDNA 1Q72H 2NY3C 1QFWL 5AZ2L 5C7XL 3TJEH 4N0RA 1LK2B 2WINB 3SJVA 3I3BA 1U3JA 4YH6A 1T20B 4ZS6D 25C8H 5CJOH 1OGTA 3V79C 2KDGA 5CILL 4ZUUA 4PRID 4WI3A 1MCSA 5KSUA 3CVIH 5IV2A 3HZKA 2R69H 5JO5B 3GKWL 5DJZA 5E7BA 3R8BB 1KENH 3F6IA 1W8NA 1HHJA 2VN7A 2OL3B 3AC0A 2B1HL 2CKNA 4AIZA 2VIRA 4MXVF 5CLTA 1PQZA 4KKLC 2EKSA 4KTEL 3DSFL 3VWKB 2IPUG 5JHDD 3TO2B 5C6WH 2AJ3B 2BNQD 3KWWB 5D9SB 1ZHLA 4LHUB 1T5XB 3UTZB 4QXGL 4LARH 3MROA 2NTFA 3H6JA 1ZEAL 3NFPB 2NW2A 4LVHB 3HAEG 5D7LE 4R96B 4GG8A 4ZS7H 4H0IA 1BBDL 1HSBB 3DJ9A 4YDIH 4RRPA 1T0PB 1I1FB 5SWZD 4QTIH 3NCYS 1BEYL 1J1OH 3RY6A 4WEBL 1MJJB 1T3FA 3RGVA 4DGVH 5CGYC 1P4IH 2JLLA 3P73A 4H20H 2M2DA 1PVHA 3EYOA 4M93C 4XBPA 4YHOH 3QDAA 2Y07H 3O3AB 1H9VA 3QP3A 3TN0C 3RJDA 4G9DB 2VLKD 4GUPA 1MCHA 1XIWA 4BM7A 4XVTL 4PJAB 4KHXL 4GKOA 4YHZH 2AI0H 4L4VE 4JCLA 4KK6D 5K9JH 1BM3L 3OKKB 2FJHB 3QNZA 5F9JA 4OGAD 5DD6B 1SJEA 5SX4H 1BIIA 5GGQL 4BFIB 4HGWA 2MPAH 3TA3D 1KPVB 5ICXA 1LEGB 2I07B 3T0EB 1M7IB 2D7PA 4A6YA 3NGBC 1RHFA 1KN2L 4PLJC 2ZOKA 3QT2A 2IPKA 3DVIA 4KPHL 4P2OA 2AXGA 2A74A 2QSCL 5DJXA 2EH7H 2PO6B 2AXJA 3MZTA 1QLFA 2DQEL 2PCPA 1RZGB 5MI0C 5GGRA 4CADA 4QF1B 4QXTA 4LFHG 4QRPE 4F7TB 1TFHA 4X6CF 4YDLB 4HIXL 4O2FA 4EN3A 1X5GA 3VXUB 9CGTA 4M6ML 4K9EH 3DO7A 3IB4A 2HT4D 1FFNA 4LLDA 2ZUXA 4DK3A 4XP9L 4QHLB 3RA7L 3G9AB 5DGQA 1QRNE 5D7IB 1CL7I 2NY1D 5CJQL 5GS2D 4ZOAA 2VC2L 5IESL 4YLQT 3QZWB 4JN2A 5CSZA 5KOMC 1INQB 4APQD 3OKYA 4MB4A 2FJGB 4I5BB 2EYTB 2HT2D 2VXVL 5HDOA 4Y89A 4AQOA 5DFVD 4KQ4H 2EDQA 1OCWL 1EX0A 3GSUA 4MA7L 3ULUL 4KDTA 1IM9D 4MJIB 5FUCC 5KS9E 2HTLD 2YK1L 3DUHA 2BSRB 1FN4B 3EIFA 5GGUB 1OGAA 5T3XE 1B4JL 1ETZB 5CEYB 3D2UD 1EHXA 1TQBC 3ZO0A 1UB6A 4TULH 5IW1A 2C1PA 3EYVB 3RWGB 3E1F1 1ZT1A 3S36X 3TPKA 5J7CC 1MEXL 5ITFB 4WJ5B 2Y6SD 3MGTB 1WZKA 5DD0L 2R0WL 4L8BA 1LDPH 4JFPA 1B0GA 1S3KH 1T83A 2BMKB 4YO0A 3BIAX 4DQOL 5C6TL 4O51B 5A43C 3DX6A 3ZDXF 3MBEC 3BD3A 5HPMA 4X5XA 2HH0L 5DUBA 1FNEA 4XCEA 3HC3L 4NJAL 5EBLA 3B2VH 3VXRB 2Q7YA 5C0CB 1Y6MR 2CR6A 3EO9H 4BFGA 2C4FT 3U7WL 4CVXB 2WW8A 3SDXF 1M4KA 1A6WH 4X6DE 1RZ8B 3QCVH 3RX8A 1EXUB 5ICZB 1A7RL 4OCRH 5T1DH 2X44D 1QYGL 2XPGB 2B4CH 5EZOH 3HE7C 4PFEA 4NN5C 1KEML 4OM1H 4L4TD 1DUZA 4K94H 1KULA 4P2CG 3SKNB 1YY9C 5KJRL 1EO7A 2XQYG 2FR4A 1U8NB 3BDBA 5B39B 4YFEA 4NQXB 1U8OA 1YEIL 3IJHB 2XIDA 3BRDA 1KLUA 1UJ3A 2FJFB 5IEKB 1FDLH 1RK1B 3RUGB 2X4OA 4LCCB 3KPPA 3TCLA 4FQXB 2FL5A 2EIZB 3U4BH 5KVEH 3QUXA 2ZUSA 3CSGA 1FL5A 3WBDA 1ODAA 4LCUA 2D2OA 1OB1B 4TOYH 4KMQA 2DF3A 4HT1L 4K3DH 2ZKHH 1V3MA 5AUMA 5IFHH 5DJDB 2Z0BA 2AGJL 2QQKL 3EO1B 1TPXC 1H3UA 1KF9B 5T33H 2OMBA 3MV7A 4JKLA 3S6CA 5JXAL 4PB0L 1VERA 1VKXA 3ESVF 1RU9H 1VGEH 2GITB 2ED9A 4IHOA 4NC1C 1JZ5A 3OG4B 5I75B 3UO1L 3QI9B 4YK4C 1AXSA 2X4TB 3BAEH 2NLJB 4RGOH 2BXZA 1RVFL 1DQML 3SN6N 4LP4A 4YHML 3SKJH 1BVLB 2RHEA 2V5TA 3N06B 1CD1B 2CXGA 1X7QA 4MMZC 1EBAA 4Y19D 3WXVH 5EZIL 5IBUG 5FO9B 3OXSB 2Y06H 1UZ8B 4MNHB 3E8UL 1MFDH 3HLAA 2FEDC 1CDCA 43C9A 2JTDA 4HJGA 1T22B 4R0LC 5HHPB 1UM5H 3W82A 1KB5H 2R29L 3IF1B 1YNTB 3RZCD 4QHUA 3VFPA 5CUSL 3MRBA 2DKUA 4CVZB 2IPUK 3WD5H 1XZ0A 5FDWA 3JV5A 5HHXL 4JR9L 3O81A 1WV7T 4UDTA 4NZUH 5I1EL 3M17B 1I9RH 2M26A 2Z8RA 5FEBA 3LRHA 2VDPL 3BGFB 5BJTA 2XG5A 5I1CL 5LVEA 3OB0K 1UXWB 3T0EE 4NUGH 3L5WA 4WI6A 1EO5A 5ACLA 3O9WC 4ODXA 4HF5L 3VXPA 1X5IA 1YPZE 2YR3A 5D1QB 5T1LD 1F4HA 5D7JC 4ONGL 5I19H 3MACL 4GFTB 4MCYA 5K9OA 2AK4D 5DRZA 1MCQA 4GRLA 2R0KL 3KYNB 5F7DB 4XNMA 3MXVH 4HLZH 3MCKB 4UNVA 3P9LA 5A1AA 4JM2F 2Y1VA 4AZ8A 2ADGB 3OR7A 3PWPE 5LBSL 3S5LA 4CUCA 3NA9L 3ARYA 2WP3T 5I74B 4PBVC 4C83B 2A83B 4LSVH 5DC4B 2KPNA 2MKLC 5FECB 2OL3H 1FSKB 2G2RB 1NEZB 2EZ0C 2X05A 3AS2A 1X9QA 4NQEE 1N0XH 1S78D 4MQ7A 5I0ZA 4YC2B 5LGKA 1TETH 1DBAL 4NO3B 1MI5D 2HFFA 4CMHC 2DQGL 1EUTA 2Z93B 5HHOE 3DMMB 4WEUD 1B90A 4HUXA 4UV7L 3C5ZD 3QPQD 4B50A 2EH8L 1C1EH 3MRCA 3MXWH 4JFFD 3E0GA 4YIQA 4JDTL 4G6MH 5I18H 3MYJB 4FFZH 5GIRB 3QDGB 3G6JE 2AXFA 1RIHL 3U7AA 5BVJB 4HFWB 5DMGC 5ITBL 3DROA 2GTZB 1H3PL 3F5WB 4M3KB 1LE9A 3FN0H 2FRGP 3LPGA 4BH7B 3PP4L 1CE6A 4WTZA 1OL0A 1Q0YL 2PYEE 4QRTB 2YWZA 1ZSDB 3C08L 4NJ9L 3W9DA 2OMNA 5FUZH 4JM2C 1A3LH 1FZMA 2R0ZH 1DP0A 4XNZB 4I2XB 4JO2H 4QOKB 3DGGB 3OWEA 4UUJB 4XPAH 3B9KA 3SCMC 1HWGB 3Q6GH 4FFVD 3PGCB 3U9PL 2DM3A 3DX9A 1R3LA 3WDJA 1VFAB 5GISL 2IPTH 4D9RE 5FO8B 3HC4L 4FRWA 4KUZH 3WNOA 3U4EB 1FNLA 5IQ7H 2JELL 3NCFB 3VFGL 1FYTA 2CDFB 4JFED 1D5IL 3EOTH 4OV6F 4HEME 4ZUWB 2AQ2A 4MD4A 2XWBA 5MERA 2R1WB 4JRYD 1S7WB 2J4WL 1VGKB 3SDCB 3TIEA 4X9FA 3P4OB 2FD6H 1U95A 3R8QA 4WFFE 5ILTH 5DEGB 3TJHD 3WO4B 5T3ZE 3U36B 5BXFA 2W0FA 4PJDF 5D1ZD 2X6MA 1IGJA 3VMPA 4Z7WF 3CFJA 1AY1L 4GKSA 2BRRH 3LZFL 2AV7B 3MJ6A 4P46A 5EU3A 4LMQI 3FO0L 1QKZH 1EFQA 3VE0A 1X5LA 1FNGA 5LXGH 3MGAA 2BJML 1OTSC 2Z31B 1I3VA 4R7DB 1A7NH 1WEJH 3DV4B 4X5WA 4U1GC 4PP2A 5F6IC 3GSRA 3F6LA 2NMSA 2PW2A 3KHOA 1U3HA 4YUEL 1P4LB 2R2BB 2MNUA 1ZLVH 1RHHB 4TSBH 4E0RB 3KPOB 1A02N 5BS0E 4IMLA 3K2UH 4R6UA 5HD8D 5IB1A 5IJKA 1ND0B 5DJ2A 4YX2H 4I3SL 1LO5A 1DZBA 3KPSD 4MZ3A 4KKNA 5EU6B 1DN0B 1CICB 2A6JB 4HUMB 3TNNA 3O3UN 2XKNB 3WCYA 4JZNB 3BE1L 5ACMA 1HH9B 1YN7A 2LU3A 3UZQA 3B3IA 2VABB 5IG7A 3G6AB 4LK4A 5K9KA 5AYUL 1X6LA 1NAKL 3P11H 3QQ3B 1GJIA 1RI8A 3BKCL 2XQYK 1NCNA 2ERJB 4AG4L 4LPVA 3MRLB 4GKZA 1OD7A 3W39B 3FT3B 4L3EB 3H9SB 4LGSB 2Y25A 3GBNH 3KPRE 3BN9D 4HUVA 1S7SB 4UIMA 5HY9A 3WJJC 1UYWH 1JBJA 3PDOB 3QA3A 3OKNA 4ODWA 5IMMB 4M6OH 2PN5A 5HDBF 1BFOB 3KS0H 4OF8A 3Q5TA 4OLVL 5I0DA 3P77A 1KTLA 1QLEL 2XTJE 5EOCL 3ZE0F 2ATKA 4PY7B 5D1XD 3NABL 4KI1A 3VFMB 3QO1B 4CVWA 3VFUA 3WLWC 4GW4A 3CZFA 4IRJB 2E27H 3O6FC 1GGCH 3G04A 5LWYL 2BVPA 5DD5H 1ZT4B 3ZKMD 3NFSH 1JWSA 3DOSA 5JW5A 1K6QH 2GSGB 3N50A 1JPFB 5FGRA 5DVNA 1F11B 3ZTJG 5TQ0L 3T2PA 5E6IC 5FYKE 1G7LB 3D25A 4PV8A 4ZTPH 3RWEB 3V6FB 3PGFH 4OLYL 3GIVA 1T03L 1PLGH 4ODVL 2WIIA 1W0VB 2FNBA 1PZ5A 3WIHA 1IGIL 3UP1A 1VDGA 5B4MD 2WQRA 1MIEL 4X83A 4PJCE 3IDXH 5ANMA 5JPMB 1MRFL 1AP2B 1ZLWK 2NPLX 5AD0A 1NDMA 2JK5A 4I3RL 1Y18A 2YZ8A 3FMGL 5DI8B 3NCBB 4GKNB 1MCLA 3MJ8A 3G5YB 4RGMB 3FFCB 5GRVL 4I77H 3QFJE 4Y1AB 1JGVH 1TNNA 2VN4A 3LS4H 5ESVA 2DD8H 1WTGT 4P0DA 3I75B 1YEFH 3DRTA 1LVEA 4JJ5B 3T8XA 2F9BT 2WSKA 5CJ5A 4ODBD 1UZ6F 2J6EA 1QEWA 4XXCC 2PXYA 5I30L 4FOMA 3VWKD 5FA4A 5I8EB 3RNKA 4XGZB 1INEL 5J8OA 1P9MA 3CC5B 5HXMA 2P8LA 4ONFH 5DSCB 4G7YL 4NKDA 2CRZA 3MGOB 4LHUD 1NCBH 4TSCH 4NO5B 1J8HE 4OZGF 4JFOA 3KLHD 1MCPH 3L5XL 2B5IB 1ZLUK 1MELA 5DR5H 5CZXD 4OM0H 1ZT7B 1KCVH 4LSPH 2DM2A 3MRPB 1UM4H 4WUKH 5ACZA 3FQXA 3RL1B 1MRDH 1J12A 4BH8A 1OAKH 1GYAA 5HVHB 1OWRM 3LQZA 1CQYA 1GOGA 4KI5D 4KROB 2H26B 3ECBA 4PJHB 1BOGA 4PUBH 1T0NA 5GJTL 5B8CB 5GS1A 5C0BB 2YWYA 3VGHA 5F9OH 3NTCL 5IBTL 4Z7QE 1GXEA 1S7QB 3OG6B 5ALBH 5I1LB 5FYKH 4X7TA 1YEDB 3MR9B 4LSSH 5D4QA 4Y4FA 1NDGA 1OTUD 2FZ3B 3FQWA 2J88L 1F4WH 4QYOA 4R3SB 2VAAA 2ESVA 3WS3B 1D5MB 5BV7C 3F7PC 4U6YB 5C71A 4P23A 2OLDA 3T0ED 2XWTA 4JHWL 4V2CB 3RKPA 5J6GA 5IVZB 3PDGA 4X98A 4RAVA 1U41A 2X4SA 2X4PB 1I8IB 3I6LE 4J3SA 4UZGA 3L7EA 3MRMB 2PO6D 4XBGB 3WN5C 2OZ4L 4HJ0C 5DQ9B 2XFXA 4WI4A 2UUDK 3U1SL 3OR6A 3T08A 3NN8B 1RSFA 1OP5H 4DAGL 1XGQA 3HMWL 2O5XL 4M7KH 5CMAB 3GSNL 4M5ZL 4JO3L 3VXUD 2NCMA 1MRCL 1HINH 4H88H 1CR9H 3SGKA 1WFTA 4ETQB 1CQKA 3MV01 4HKJB 4U1SB 3GSXA 1SJHA 4PJ5A 4XRCB 1KT2B 3HE6B 2W0KA 5A2FA 2LFGA 4NRXA 2AJXH 3OKMB 4RIRB 2YA2A 1G9NC 2AJSH 4F57L 2QHLA 3AAZA 3DV6A 5EU6E 4L8SA 3QIUA 4ZXBA 4XMKL 4OFVA 3QUKA 1QQDB 4KKAD 5K9QG 4EI6B 3WUZA 3A6BL 4NOBA 3HUJA 5KSBA 4PJGB 1ITCA 4L8DB 4NKMB 4HFUL 3KHQA 3GMQA 1NMBL 3H3PL 5FM5O 2YC1B 1GGIH 1FNFA 3EDFA 1L7TL 1IAII 3QUZA 2IG2L 5E8DH 1MHEB 3LB6C 4WCYH 1YMMA 1WCBA 3C60A 5LGHL 4XCNB 4XPTL 4HZLA 5MEQB 1MFNA 3MLWH 1CZ8L 1I8LA 2UY7A 4DVBA 1NMCB 4UILL 3L1OL 1LO0L 4YWGL 5CBAB 3VWJB 1RQ5A 3S35L 2OK0H 4D3CH 1Z9OA 5HGAA 1U8MB 2JJWA 4Z76A 5I1KL 2B7DT 1PKOA 4FTVB 4PJ9A 2NYYD 3I02B 5C92A 3V9FA 2R9HC 4LCIL 5CCKH 3GK8L 5GJSL 5EOTA 1RZIA 1IKNA 3VXRD 1LNUB 2Q76A 4PJFE 5MEOB 1OP3H 1UEMA 1MCNA 4JCMA 5C0CD 4I48B 1F2XK 1WTLA 2GFBA 1KJVB 2APBA 3QAZB 4XAWH 1K5NA 3VRJB 1INDL 5DJ6B 1I1AC 4NKIH 3B8SA 4BZ1H 1K2DB 1XF4B 2B1AL 2P7TA 4NQUA 1SHMA 5E00B 4LCWE 1ZANL 4PJBA 2DLIA 2XRAL 4FZ8L 1QBLL 1T89A 4F2MA 2GJ6A 5CJXC 3ARBA 4JEGB 4G43B 3O2DH 2H32B 2XA3A 3HTLX 2IAMA 2VZUA 5EUOA 2R4RH 5E1AB 2R56H 4DK6A 1BFVL 1HXMA 2AJVL 4FQXD 1RUAH 2C1OA 3VW3L 1YN6B 3UAJD 2WBKA 4XPFL 1RK0B 2DQCH 3ARDA 3QJFA 3RWFB 3JTTB 1IGYB 2NY4B 2W59A 1J9CT 1AE6H 1R3KB 2ZCLH 3F7YB 5H94A 5C0JB 5J3HD 1FLRH 1G7QA 4OCSH 2HFEB 3D9AL 1J10A 4IDJL 1CDYA 2YUVA 4ODHL 5ID1B 2LTQC 3AXLA 2JB6B 3LDBC 3QI9D 1CL7H 3PJSA 4LPUA 3R1GH 3O4OC 5I1AB 1T80A 2EECA 3T77A 5GS0C 4ZYKB 4YBLB 1IKFL 1G7PB 3CLFL 2XN9B 1UWEH 4WI8A 4U3XA 4MXQC 3KPNB 4NQSB 4MSWB 1NCWL 5C07E 1XCQB 5D6DA 4UT9L 3KPRD 5F7EH 3C2AH 4DUXA 4OCXL 4PRPE 4LSUH 1NLDL 1NFDA 4YDKL 5LQBH 1YEEH 4POYA 3BZEB 1AQKH 3ZDZF 3K1DA 4HQQL 3PWNA 4HUWA 4PRBB 4TPRL 1IEBB 1RUKL 5DK3A 1WBXA 1ADQL 3EYFA 1DLFL 5JOFB 5MENA 5D72H 4OZIB 4WUUB 2E7LC 3V6BR 3LV3B 4QRQB 4EDXA 1G6RB 4Q6IA 5I1JL 1PAMA 4LF3A 1II4E 5GGSB 5D96C 4G6JL 3ARFA 4N0UE 2VO5A 1H8NA 2ZCKH 3D1MC 5T1MB 3LKRA 3OL2A 1H8OA 3UXFA 4AMKH 4UU9B 4HIEB 4YNYA 1XF2A 1U0QA 1CIUA 2Z4QB 4U6HB 1DBKH 4OD3L 1LEIA 1A1MA 2DJ4A 1YECH 2DIAA 4PGJA 1GAFH 1EHLL 2D3VA 4YZFE 1PKQB 4IIQC 4G8GB 1MNUH 3ARZA 4WHDA 2FIKA 2ZUUA 2ADJB 5FHBH 3SDDB 2EDDA 4GRWF 4F7PA 5DLMH 3WUWA 2CRMA 2DMBA 1RMFL 1MIML 2NNAA 4QNPF 2X7LB 1BQHB 2DBLH 2MCG1 1A3RH 2F5BL 3G6DH 3PWLB 5DEFA 2F19H 2FBJL 4JFQB 1EEUA 3C09C 1PZUB 1AHWA 5L6YH 2H6PB 2NY3B 1SYVB 1N4XL 3DMMD 1R5IA 3MJGX 5HHMB 2GSIA 2UZIH 2ZCHH 5C0RH 3T3PF 4J3TA 5KVFH 2IFFH 4DZ8B 35C8H 2H45A 1GRWA 1FZOB 4KWUA 3MLPA 4JB9H 5DK0A 3RTQC 5MHSD 2BERA 2R0LH 3CLEL 2NW3A 3QDGD 5JQ6H 4ZPVB 1ZA6B 3PIQB 4X7SH 1N59A 4ZUVA 4JN1H 4PG9A 1OSPL 3VU2A 3L6FA 1AJ7H 4U1LB 4QOKD 4TRPL 3RVWD 5JW4N 1EEQA 3L9RB 1VACB 4HH8A 4JY4B 5I1HH 2HLFC 4OLZL 1W72B 4NN7C 1SEBB 4NNPH 1MQKH 3HI5H 1FNSH 1TTUA 4ZUTA 1J8KA 4M93B 1OF2B 4BK5A 3VFTB 4R9HA 1H3VA 3TN0B 2ZPKL 1SYSA 2P5WB 3JWOC 3QJHA 3QPXL 5D7SH 4HLZG 1F58H 1MAMH 1JF5A 3SDCD 1R0AL 2YKLL 4NQCE 2R8SH 4M4RA 5E99H 1RV6X 3BWAB 3UTOA 1NC4B 3W5NA 4PLOB 3KNBB 4Q9CA 2V2TB 3NCJL 1QSFA 1VPOL 4CL7A 3M8OH 4QRRE 5CKAA 3OKLA 2ZJSH 1H3TA 3NOIA 1GPOH 3O2VH 4M61B 1TZHB 3QWOA 1CVRA 2AABL 3KS0J 3U0TA 4YR6B 4K8RL 4MXWH 3VXNA 2F74A 4BSWA 1GZQB 1UXSA 3W0WB 3NGBB 1DSFL 4I0CC 1DANU 1N8ZB 2ICWI 4M8VA 3VXSA 3WFHA 3EGSA 1X5JA 5GQBA 3DPBA 1YYLH 3SJVE 3ZL4L 4WO4C 5GRUH 3MNZA 4M8QA 1N5YL 3ILPB 5CD5D 2Z31D 1OSZA 4H25B 4E41A 4JAMA 2OX5A 3QEUB 2HFGH 5MI0B 4QHKI 4JRXB 5MP6L 1RZFH 1D5ZB 2L4OA 4KU1A 4PJIA 3BT2H 1MCFA 5BZDA 5EDXA 5DWUL 1Q9KA 1CCZA 1AI1L 5GSVA 5JNYB 3VD9A 2W0PA 1AR2A 3GO1H 1QR4A 2YZ1A 2OI9C 2OTUB 5EU6D 1N6UA 4ZDHB 1CICD 3ZTNH 4U6XA 5HYIA 1QVOB 3MX0A 4ZAKA 1SBSL 1L6ZA 3LKSA 3QNYA 4F33B 5TE6H 1FPTL 4K8RD 4X9HA 5CEXB 2BFVL 3HZYB 4JANB 5FFLA 4HGKC 1JPSH 2ITDA 3K74B 5C8JA 4L3ED 3H9SD 3LS5H 3PQYA 1YEKH 4YPGA 2F8VA 2UVFA 4QHMB 5JW4Q 1D9KC 3E6HA 3MLVL 4BYHA 1TQBB 1U8IA 2C3HA 3SKMA 2GHWB 4BKLA 4LOUC 4TTGA 1ZTXL 4X6CB 5JXEC 3IETB 4WFGE 4FXKB 2EDEA 3I3DA 4X4XB 1MFAL 4B53A 3KJ6H 1A4KA 1QO3B 4IRJD 3RQ3A 3BUYA 4QCIA 2OP4H 5DUML 3H7BA 1PFCA 2OR9L 4RCAA 3VGEA 1ED3B 5FGCE 3MBEB 3V5DA 2AJUH 5FYLE 4PJXF 1YQVL 2EIBA 4CRPA 3HMXA 4CGTA 2UWEB 3BO8A 4LNRB 4HLJA 2F58H 3AREA 1FBIL 4P3CL 2HYMA 2H32H 4PGCB 1TVBB 5DQDL 3HR6A 4HCRL 4RBPH 4OCLC 4RWHA 4WGWB 3UX9B 4NHUB 1GZPA 1SM3L 5CZVH 3DUUA 2R2EA 3U0PA 5TFSL 3VXQA 5I17B 3RWHB 3AS0A 3HE7B 1AGDB 3U83A 4ALAL 2DQDH 3FAXA 4NN5B 3ROLA 5I1IH 3OKOA 1HKLH 4Z95H 3DHJA 4XTRD 5A2LH 3P4MB 3FFCD 5EUKB 5EA0L 4Y1AD 1T1WA 1C12A 3HI1B 5F88B 5IMOA 2HJKB 3GGWB 2K1MA 2X70A 4HG4J 1A0QH 4CN6A 2ZG1A 5TQ2H 3RKDD 3A6OA 1G84A 4NRYA 4U1MB 1OGAE 1C08B 4Q9QH 1U8JA 2YMXL 4WHTB 3QDMA 4X7DC 5A40E 2BOBA 1JGLL 1Q38A 1YZZA 4W81A 1X4XA 1H8SA 4BZ2L 3KPQB 1DFBH 3BP6B 2P45B 1TPXB 4L9LA 3DI2B 4YHLH 2ITCA 3WIIH 3SDXB 3VG0H 4POZD 3IDMB 4YXKH 1D3CA 5I8KL 3EYUL 1BD2B 1I7UA 4OIBA 4HWBL 1NGPH 2EEAA 3F7VA 3Q3GB 4YK4B 4EQ3A 5EC2A 3PNWB 3RX7A 4XNQA 3AROA 1M05B 1ZHNA 5B3NA 4KROD 2V7HA 4MAYA 5DD1L 3JXAA 1NUGA 3PL6C 1T4KB 4HPYH 3R0NA 4TNVK 5C0BD 5FYLH 4WVRA 5HI4D 1J0YA 2P5WE 4R0LB 3IFPA 4BQCA 2G9HA 1IARB 3D6GA 4N0CD 5L2JA 4W4OA 1UKQA 1FAIH 3VJ6A 4PRHB 2HWZH 1X3DA 4HK3N 5EIIB 1IFHH 2Q1EA 4MXVE 3H42L 5HTSA 4ZQKA 1CLZL 3EUUA 1HEZA 4BQ6A 1MSPA 5D2LA 4JFDA 3D3VB 4I0KA 4J4PD 1QFUL 4FZEL 1MFEH 4MWFA 2J8UA 3CVIL 4NT6B 4XVUC 4PJ7A 1JNNH 2OTWA 1KCSH 2AQ3A 3O9WB 4OSUL 3CXDL 5BO1L 4EQ2A 1N2RA 1V3KA 4XMLL 2W9EH 1NCDL 5D7JB 5E8OB 3ARGC 32C2A 1YNLL 2VOTA 4RGNC 2ZWLT 1WAAF 3RU8L 4Y8AA 5M94B 3IDGB 4M7JH 2ZP0T 4ONHA 3S3SA 3WKMH 4N68A 4PLKC 3HA0A 2Q8BL 3HE6D 3O41B 1VB9A 4UTBH 3QXDB 1LO2H 3OAUH 4S1SL 5HHNB 3SE8H 3I85A 5IEHB 2XT1B 4G8IB 1T5WB 2VLRB 4GG6A 1EGJA 4NN6C 3ULUF 5ADPH 4K71C 3OPZL 3FRPA 3MV7E 1HCFX 4PRIA 4XAKE 3UJIL 4CMHB 4S11A 1HKFA 5F9DC 3EZJB 5FKPA 3HZVA 4WDIB 4ZO9A 1SVZA 1T1YB 1HILA 5EPMA 4LGRB 5DMIH 3ZYIA 2A0LC 5F7HA 1V7NH 2VDNH 1FG2B 5JHDA 3SGJC 1BQSA 5INCA 3KLDA 2BNQA 1AKJB 4XNXH 5AG9A 5FUCE 1MCJA 3CX2A 2NR6C 2VRAA 1HSAB 5K9JL 2EKJA 3CVHL 4OIIH 4N5ED 4JKKA 1MF2L 3S3JA 4PRDB 1VHPA 3O4LB 1IBGL 1IAKB 2FGZA 1FE8H 3VGAC 4KFZC 4Q6YA 5IKCB 1D6VL 3F62A 3GUTB 3PWVB 4UQ3A 5SWZA 2PTTA 4JM2B 2Z92B 3O0RH 3VWJD 5I9QC 3WDHA 4P5TC 3HR5A 1H0DB 3SCMB 2VLJB 4LBEB 4FN0A 4FTVD 2MKWA 5TF1H 2FLBT 5L0QC 3QXWA 3ULUC 2VLKA 4Z7VF 4MA1C 3MLYH 3VXTA 1GGBL 4QRSB 3MCG1 5D93C 4TUJA 4C59B 3PWJA 4FQCH 4NQDB 1S5HA 2RAMA 2FGWH 5GSRA 3GMNB 4K9EL 3VFRB 5B21A 3QEHB 3L3HB 4BQ9A 1P7HL 4XPGL 2Z8VC 4KQ3H 1U91B 1DCLA 5IB5A 1CFBA 3LMJL 3TA3A 1J1PH 1ZS8B 3OF6D 4UBDD 4LLVA 4PJEF 1Q0XH 3QQ4A 5IROC 1AD9A 4N90E 5F7UA 3WL9B 4GW1A 3B5TA 2CLVB 4R26H 3QRGH 4MJ6A 1KNOA 4O5LH 2YXFA 1QRKA 4IM8A 3EOAA 2VZ3A 1CGWA 1JF1B 2IQAB 3O6LL 5GZOC 3JVGA 4XXDB 1M71B 3NPZB 3LSOB 1TJGH 1FC1A 3KG5A 3VFOA 5KSVB 5F6IB 4MDIA 4TUOB 4TULL 1HOCB 2NY4D 1ZLVK 1CFQB 2MWCA 5TDPA 1EFXD 2V2XB 1G6RL 4APQA 4F7MB 5I76A 4EVNB 1RUMH 4FG6C 3VCLA 4JPWH 1MCIA 1LDPL 5EN2B 4YFDB 1XMWA 4IRSC 5C2BH 3VFWA 2ICWB 1IM9A 4PJDB 4OCNC 2XN9D 2L0DA 3P30H 2BY0A 4R90L 4F58L 4Z7WB 3IXAA 4NPYB 3X12B 3D2UA 3RL2A 2ZUQC 4AK1A 1I9JH 5KAQF 3QEQB 2VITA 5ICYA 5C0EA 1AGEB 1FYTE 1DBBH 3VRLE 4GAJL 3ZZ1A 4GAYA 4EUPB 5C0AB 2X4QA 1B0RB 4V1DB 1A6WL 4UT6H 3QG7H 1EH9A 4PGZA 3G08B 2VJXA 4MD0B 4WUUD 2HN7B 1IAIH 4XZUA 4NO2B 1AIFB 4PRHE 1VADA 5GRJH 1G7HA 5CHNB 1NANH 4HKXB 1P1ZA 4U33A 1LMKA 3LQAL 3O6FB 4OZ4A 1KFAH 1ZGLB 2A9NL 1DE4B 4P59L 3OXRB 5IOPA 1FDLL 3AMKA 1U9KA 2N7AA 1BOYA 3RWCA 2FH8A 5TPWH 4RFOL 2YRZA 2IH1A 3JZ7A 4ZPTA 4M7LH 4D9QE 2VL5B 5E6IB 3SDDD 1VFBA 2K9UA 4LLUB 3CFCL 4ORGA 4S2SB 1DL7H 5T3XL 1Y0LB 2VR4A 3SKOB 5F93C 2E7CA 2XWJB 4L3AA 4YHNB 3IS0X 3X14A 2BSSB 6FABH 4NUJA 4R4FH 4HD9A 5EZJA 4HIHA 4HWEH 5LGJB 3QUMA 3EJJX 1I3RA 3LN4B 4L4TA 4OJFL 4NDMA 2GUOA 5HGDB 1W72L 5DF0A 4Z8FH 4LKXA 2VDML 4N1HB 4LLMA 2NY3D 3V0AC 3Q1SH 1FVDA 3JV6B 4LVNC 5HHMD 4UINH 3HNVH 1G7JA 1NFIA 4Y2OA 3V0VA 2FECL 3LD8C 3LPWA 2V7NA 5TGBB 1R3IL 3T4AA 1IGCH 1MWAB 4G8EB 4BUGA 5ISZB 2C9AA 5E4EC 1S7RB 3WXWL 2QQNL 3LY6A 3S34L 5HGGS 4NQTA 3MUHL 1IC7H 4ENEC 3W2DH 4KKLD 3OAZH 5AWNL 5JMRA 3N85H 1KTRL 1KELH 4V2BA 3MLUH 4XCFH 5C09A 4XMPL 5D5MF 2VMFA 5DRXB 5SWSB 5C0DB 1MCRA 3SDYL 1A7QL 1WQVT 1EEYA 3X13A 1T2QH 2DIBA 3REWB 1TTGA 5IK3B 2Q3ZA 3TYGL 3NFNA 2VB5A 3C6LC 4Y19A 4Q0XH 1C5DA 4ZTOH 4AENB 5IB2A 3T4YB 3HHRB 4KTDL 1P2CB 4OTXL 5CGYD 5C0GA 4BFEA 5E8NA 1DBML 3V5HB 2PUQT 3Q5OA 3TN0D 3P0YL 3RZCA 2P5WD 4D94A 4JFXB 3MXVL 2O93L 5FKAA 3UYOD 4JM4H 1MUJB 1KN4H 4P5KA 2P8MB 1RZ7L 1NC4D 5JW3H 5JOPE 1HHGB 1CLYL 5KSAC 3VI4E 1QBML 2FATH 3UBXI 2Y7QA 1ZHBA 4AM0A 3SPVA 4Y4KD 4NFDA 2Q20A 1J5OL 1TETL 4KJPC 1WBYA 5FYJL 1I7RA 5BV7B 2NXZC 4OZGB 3W0WD 5ANME 3LEXB 1AGBB 4DTGH 3GM0A 4PLJD 4KHTH 1F4XL 5T1LA 1ZLSH 5D6CB 2WV3A 1G7IA 3BZ4B 3EYSL 4YGVA 1FO0B 2AK4A 2J3SA 1TENA 4U31A 4Z7NF 1I7TA 4IOIB 3D48R 3X11A 2ICES 2YEZB 4PGBA 3WN5B 3K0WA 3QULB 4HXAH 4MDJB 1CTOA 5FYJU 1TTFA 1OP5K 1F42A 2AV1B 3CFIC 3MA7A 2B0SH 1BVKB 1FNAA 1MHHA 3HRZB 4P4KC 2CK0L 2EDFA 5CS7A 2E6QA 5HI5D 5TE4L 5ID0A 1HQ4B 1A3LL 4WV1A 5T5FH 4KMTL 1MI5A 3PWUA 3MRQB 5DDHA 5CP7B 5J57B 5BCAA 3GM8A 4XAKD 2AJYH 3C5SA 3C5ZA 2JJSC 4QHNB 3BP4A 5ETUA 4J6RL 1HDMB 1MQ8A 5L8KB 1YDPA 4LSRH 1A7OH 1ACYL 5FYJD 4JFFA 3W5MA 3T0XA 5IQ7L 3OKEA 3FRUA 4XNYL 3VI3F 1KJ2B 1WT5C 3EOTL 1HZHL 5IVXF 5J89A 3AVEA 4P5MB 3RNQA 3GNML 2IBBA 3DIFB 4KRMB 2FD6L 5I2IB 1Z0MA 5HJ3B 3NCCB 4FXLA 5FV1L 3T2NL 1P5VA 1RUPH 4XCCH 3MA9H 3F58H 5E2UH 4LQFL 3CH1B 2XICA 1XR8B 4LLYB 5DQJA 3BDXA 5E08H 1KYOJ 2MMXA 2ESVE 5I1DA 2G75A 1AO7B 1TITA 3JTSB 4GSDH 4E9LA 5DMKA 3CGTA 1KTKE 1U3YA 3D0LB 4OV5A 4JFEA 1Q8MA 3WS6A 3Q0HA 4ELMF 1A6ZA 3MBED 1QBBA 2YUZA 4QRUA 2QV2A 2VXSH 1WEJL 4EEEA 1C5CL 4JRYA 4QTHA 5HVFB 1UACH 2QHRL 3U30B 4XWGH 5SWQB 1U92B 3TBYA 1A6UL 1E4KC 4G5ZH 5D1ZA 3U9UB 2DRUA 4MNQB 3S88H 3MRGB 1PY9A 3MO1B 4JO1H 4WW2C 4WWKC 3NAAH 1VENA 5DMYA 1V3LA 5A3IC 4N90D 2J6EH 2Y36H 4PJ5E 4EIZC 5D71L 2VSCA 3C5JA 4NNXA 2BCKA 3U2SA 1FVEA 1NGZA 1QFWI 4JHBA 2DLHA 4CDGC 1CFVL 3HE7D 5EU4A 3ILQC 1K8IA 1RZKH 4Z7UF 2X4RB 4PG2C 5HDBE 1YY9D 1WWAX 2XNAB 5E03A 1SEQH 1JYWA 1G0DA 4MGXA 1ORSB 2C3XA 1MVUB 4HDIA 1NBZA 3EYQC 1IAIM 1EEZA 3AB0C 2DLFL 3BVNA 1A1OB 2ZNWA 3HUJE 4RNRA 5SV4A 5KSBE 3MRHA 3I9GL 1D6EA 3KPSA 1LE5A 2O5YL 4FQIH 3RI5F 3C8HA 1DUYA 3JV0A 3FJTA 5I1GL 3D18B 4JQXA 2X4NA 4U7MA 1YMME 3PG2A 1T66D 5F89A 5SWSE 5T3ZL 3KLAB 1CVSC 2OJZL 4M48H 2EDKA 3BFOA 1BD2D 2LTQB 1FVCB 4KJQC 3M1BB 3LDBB 4U2ZA 3O4OB 1CFNA 3P9MA 5JIIA 3GMOB 4LVOC 1ZVYA 2DM4A 4DGIH 4ODTH 1JHLH 1I8KB 1NUNB 1JNHA 4LDLB 5EC1B 3VG9C 1WFUA 1UB5A 1H15B 4XVSL 1S7TA 1OARL 3K8MA 5JORB 2BVEA 3MFGB 2FEDD 2WBJC 4UIKH 3JWNC 3TH3T 5IB3A 3QFDA 4QKXB 4G3YH 2CKBL 5D1XA 3ARQA 1OM3L 4CMMA 3QNXA 4PRHD 1I1CA 4RZCA 2A9MH 3ZLQC 4NP4L 1L0YA 3TH4T 5KW9L 5E24E 3HPLA 1KB5A 3CU1A 1R5WB 3TFKC 1YYMH 2YUXA 3D3VD 3UTPD 4PJBE 5I66A 2A6IA 1F5WA 4O2EA 2JB5H 1N7ML 3NIDF 4I8DA 5D96B 4FS0A 1JZ6A 4MA3B 2GJ6E 4BELD 3O9WD 2C26A 5D2NC 1DVFC 4OZFB 5D7JD 1GGYA 4XBEL 5EUOE 4UTAH 3WNMA 1SVCP 4JY5L 3IAPA 4OFPA 5CINH 4IIQB 4K7FB 4X9GA 4Y4HC 3DURB 5IR1A 1XF3A 2YD1A 3ES6B 1TZGL 4JG1H 2KZ1B 1MCPL 3SGEH 1MWAH 3D69B 5C2UB 1NBYB 1X5XA 1LK2A 1A64A 3D87B 2WINA 2VLRD 1T20A 1WC7B 2EZ0D 1KPRB 1I8MB 1FJ1B 1OOAA 3C09B 4I3GA 4ORZC 1BBJB 4EJ1C 2VZSA 2YOCA 1IZJA 2OL3A 3EJYC 2MFNA 3KXFB 3VWKA 3EJZC 3TO2A 4I4WA 4OCWL 2AJ3A 3A67L 5H2BB 3KWWA 1AKJD 5D9SA 3RTQB 4LHUA 1T5XA 3UTZA 1T04B 3D5OF 5DRNB 3UYRL 1NFDE 5FYKL 3GHBH 3NFPA 4ZOCA 3V95A 4W6WB 1EK3A 5DMGD 4R96A 2NY2C 2YS4A 3O4LD 3U82B 1HSBA 2JIXB 1F4WL 3ZE2F 3P73B 5J1SC 1I1FA 4GRWB 2IMMA 4JM2D 1A21A 1MAKA 5DHXB 2MHAB 4GUPB 1MJJA 2EEDA 2RGSA 4U1KB 4LPTA 4TNWK 3SCMD 2VLJD 3BP5B 1JYVA 4OD1L 4OBSA 5F7WC 4D9LH 1LP9F 3O3AA 3BKYL 5DK2B 4KAQH 3O6MH 4G9DA 2IALB 1J0ZA 1LGVA 5F9JB 4NN7B 4Y5VC 4PJAA 4NQDD 3GJFB 4F8QA 4HGWB 1CK0L 2PF6A 1MAJA 3OKKA 2FJHA 2FSEB 4R97C 5DD6A 5IJVB 1FO0H 4ZD3L 4PS4L 4R4NC 3RPKA 3QXTA 4BFIA 4OLUH 2V2WB 1TMCB 1XCTB 1KPVA 2XG4A 4P9HH 1BQLH 1LEGA 2ZG3A 1F3RB 2I07A 2MQCA 1GIGL 1M7IA 3T0EA 4JG0L 4Z0BL 5AYQA 3SQOL 3RIFF 2NZIA 5A2IH 4Q2ZB 2PO6A 4KVCH 4L5FH 1OW0C 3L95B 1OT1A 2A73A 5BRZB 1RZGA 5F9WC 4N9GB 3BJ91 4QF1A 3BSZH 4F7TA 1JRHL 3VXUA 1OP9A 1V05A 1CF8H 5EFIB 4WO4B 4HUUB 1FL6B 1GVIA 1G9NH 1OTSD 3KLSA 3QIBC 4ZFOB 2V5SA 4QHLA 1MH5B 1YUHB 3WSQL 2NY6C 5D7IA 1CBVH 3HI6L 4M6NL 4OF0A 1MFBL 3DTXB 3UBXB 3QZWA 3GRWH 4YHIA 1NGYB 3X3GH 2FJGA 4I5BA 4CW1B 2DQHH 2EYTA 2OI9B 3B8YA 1U3ZA 3H2WA 1J1XL 4Y5YC 3FAWA 3L3JB 2BSRA 4XT1C 1FN4A 3JWDC 1FH5H 5DD3H 5GGUA 4AY0A 2ICEB 1ETZA 1ZT1B 5CEYA 5EH1A 4GS7C 1ACZA 3IDIB 2P24B 3QEQD 2RJMA 2Z91B 3EYVA 3BHBB 3RWGA 4ODSL 1BREA 3E6FB 2EYSA 4XAWL 3FB6B 1NBVL 1A9BB 4YAQB 3QISA 5CEZE 4LIQE 2VWEC 1LO4L 5ITFA 4WJ5A 2D7NA 5C0AD 3MGTA 3QDJB 3DX6B 4X5XB 1KC5H 2BMKA 1ONQB 2VXUL 4NZTH 2M1KA 1QSFE 3IU3B 2LU7A 1QLRB 1SY6L 4O51A 4UQ2B 1JL8A 1N64L 4TN9A 5D1QC 3WLWD 4WU7B 4HS8L 3O6FD 4RWYH 1D7FA 3VXRA 3O2WL 1HN1A 5A16B 2OSLB 2E7MA 4Y5XC 2CR3A 3U7YH 3VXSE 5C0CA 1VEOA 4CNIB 3ZSSA 4DZBB 1IEHA 5MEPB 2OBGA 2ZZUT 3DYPA 5IVOA 3MFFB 5E6ID 3VXOB 4HMEA 1V8HA 4CVXA 2D7MA 4E41E 4PJ8C 4PYHA 4NZRL 3FCTB 1RZ8A 4LAQL 1EXUA 5ICZA 1QP1A 3N1PC 2ZCLL 1L7IH 4KKBC 5KANI 2XPGA 1J87A 4FMFA 5B3JE 1KLUB 1E6OL 1ZMYA 4RBPK 2CLRB 3SKNA 3UPAA 4FMKA 3L3GB 1OAZL 1U8NA 4R4BA 5B39A 4NQXA 3Q6FB 1F13A 2DBJA 1ZGLM 3IJHA 4LCUB 3HFMH 5IEKA 1RK1A 3RUGA 4LCCA 3C9NB 1JPTH 4FQXA 4J3UA 2EIZA 5FGSA 5F1IB 3IGAB 3RAJL 4LSUL 5ISZD 1OB1A 1RIVL 2FHCA 4AL8L 2K7PA 5ENWB 5GS0H 5DJDA 3PQYE 3EO1A 3F65A 1AXSB 4NRZB 4OI7A 1S9XB 3MNVB 4PJXB 1Z9SA 3UYPA 5SWSD 2NX5B 2D31B 1CXKA 3FB8B 5BW7C 2JJUA 3AM8A 3PGDB 2GITA 4LIQH 5IMKB 3QI9A 4OQTL 2X4TA 2NLJA 4QXWA 1FG9C 1NJ9B 3UC0H 1YEHL 1IL1B 1BVLA 4KZEL 2ZCKL 3IJYB 1CD1A 1CU4H 4QNPE 2VE6B 3KR3L 4NWUL 5GGSY 3KPRA 5FO9A 3OXSA 1UZ8A 4MNHA 4GBXC 1RJYB 2PNDA 2DYPD 1JGUL 1T22A 5HHPA 4K7PL 5DYOA 5HHVL 2AJZB 3IF1A 4PTUB 1YNTA 5FV2A 3HS0B 5DJ0B 1JUFB 3S4SB 4MA8L 1B6UA 4O02L 2W92A 3PL6B 4CVZA 1CI5A 1HCVA 1MPAL 2KZWA 2H1PL 4PY8I 5M95B 1T7XA 2HVJB 2P47B 3VH8B 4U1JB 3R4DA 3T3PE 4U0RC 2CUMA 3SE4A 1OPGL 3AY4A 4MCZB 3M17A 2YPKB 2F19L 1NCUA 4HJJH 4MCYB 1MCWM 1AH1A 2DKMA 4GRLB 3MCLL 2VXQL 3OKDB 5JPNB 4U0QB 4WTZG 5C3LD 2MQ3A 3R0MA 3V4UL 1KJ2L 1RULH 4PTTB 1WCQA 5I8OL 2CJUL 2HT3C 2IFFL 4LKCB 4M02A 3KYNA 5F7DA 4YXHL 3MCKA 5FGBC 4HJ0D 1MREH 3M45A 3V0WH 1I3GH 4J1UB 3NZHL 3MV8B 2ADGA 2V9RA 5JQ6L 2MCPH 4C83A 3ARGB 3I50L 4RGNB 2A83A 5C3TA 1HNFA 4LSQL 2G2RA 4L29B 1NEZA 3HPJB 5F7FA 4XP1L 1ADQA 4NC0B 1N3NB 3QDME 5EWIH 4NO3A 3G5XA 3EFDL 1AJ7L 4B0MM 2RB8A 2Z93A 4HBCL 3DMMA 3SE9H 4ZUSB 2F54B 1C5BL 4HUNB 5DVLA 2BOCB 3N1QC 4NN6B 5L9DL 4K71B 1X5AA 4LRIA 1IQWL 3ZKNC 4GRWH 3HI5L 5GGTH 2Q8AL 3CPLB 3MYJA 5GIRA 3LH2H 3N9GH 3LEYH 3QDGA 5E2TH 3W9DB 4Z5RB 2YHGA 5BVJA 4HFWA 5DMJB 2GTZA 3F5WA 5D7SL 1JZ7A 4BH7A 2DQIH 4NWTH 3PP3H 4QRTA 2XYCA 1ZSDA 4P57B