4ZMWA

Crystal structure of human p-cadherin (enc-x-dimer)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
213
structure length
213
Chain Sequence
b'DWVVAPISVPENGKGPFPQRLVQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cadherin-3
publication title Adhesive Dimerization of Human P-Cadherin Catalyzed by a Chaperone-like Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 49
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zmwA01
3Q2WA 2OMXB 3K6FA 4AQAA 3MVSA 2A4CA 4ZT1A 2WD0A 4XXWC 4XXWA 1FF5A 3LNGA 5CO1A 1L3WA 2OMYB 4APXB 4ZMQA 2OMTB 4ZMOA 1Q1PA 2O72A 3UBFA 4ZMVA 2QVFB 4AQ8A 2YSTA 4ZI8A 1ZXKA 1EDHA 4NUPA 5KJ4A 4APXA 4AQEB 4ZMPA 2V37A 2WBXA 2QVIA 3PPEA 1NCJA 3K5RA 5DZVA 4ZMXA 1ZVNA 1O6SB 4ZMWA 4AQ8C 2EE0A 3K6IA 1NCGA 1OP4A 4ZMZA 4NQQA 3UBGA 1WYJA 2OMUB 4ZMTA 4AQEA 2OMVB 1WUZA 3FF8A 2YQGA 2A4EA 3Q2LA 4ZMYA 1NCHA 4NUQA 4QD2E 2OMWB 2WCPA 3UBHA 4AXWB 5CZRA 3K5SA 1NCIA 4ZMNA 4NUMA 4ZMLA 3LNIA 4AQAB 3LNFA 3LNHA 2WHVA 5JYMA 1SUHA 3QRBA 3FF7A 4AK1A 3K6DA 4OY9A 3LNEA 4ZTEA 2X2UA 2OMZB 3Q2VA 3LNDA 4AXWA 5JYLA 3Q2NA
chains in the Genus database with same CATH superfamily
3NIGE 4JRXD 3ROOA 3I3DA 4QXTA 3WELA 5IVZB 2UUDH 3QHZL 1B9KA 4MSWA 4PBXA 4W9EC 4JN1L 2DQEL 1L9NA 2IAMA 5JMOC 4U1MA 3FFCB 4UNUA 3I2CL 3ZL2A 3TO4B 1T0PB 4LOVA 5IV2A 3EJSA 5DRNB 1I7RA 2DM4A 3FT1A 3UZVB 1QHOA 5IJVA 3PNWB 2WTRB 4Y16A 3RGVC 4DP2X 3SGJC 4ALAL 3MRFA 4M43L 5ECJE 3OL2A 4BKSC 3MFFB 1CVSC 1M2OA 3BWUC 3DMMD 4P4KC 4PHZA 3FOLA 5L2JB 4G9FD 4K7PL 3VGFA 4NQCA 2F5BL 2X70B 1M3IA 4Z7VB 3ZZQA 5BXFA 5JHDD 1WD8A 1CURA 4JM2D 4ZSOB 1YG9A 4MA3B 4NSKA 1S7VA 1HWGB 3X14A 5I8KL 1TVBB 4GBXB 3BH8B 3HKZA 4F33A 2XNAB 3NIGB 5CXPA 2BVQA 3DRQA 3GSVA 3PFQA 4G7RB 4TQPA 4DJMA 2H1PH 2NY7L 1O75A 2ZP0T 4BZ2A 4JW3A 2F1EA 3HRZB 4XN1A 4K71C 1LO0L 3SY0A 2OPCA 1FL5B 3KAAA 5JTWA 1NGQH 2D31B 1S7SB 4HIHA 4PGEB 1A25A 4D3CH 4KUZL 4IEFB 5HDLA 5LQBL 2BWQA 1XX9C 3WJMB 3B9KA 3VXOB 3C60A 3D33A 4BQ9A 4MA1B 2YN5A 3QXTA 5FV1L 1AGBB 4O4YL 4R8WL 5HHNB 4KTYA 3BISA 5F89B 1KBWA 4XNQA 4MVBC 4P57B 1YECL 1MIEH 4XTRD 4JMNA 1A7OH 1EXUA 1NFAA 1HAUA 1ZTXH 2G5UA 5TQ2H 5D8JH 5MEOB 3MCLH 3RIKA 3R8QA 2P8PB 3CFBA 5CEZE 3QWOB 2DD8H 4R84A 1GC1C 5AYUH 4BXSV 5BZZA 4XMTA 1JK8B 1KN4L 2FAUA 4PW4A 3D69A 2E75C 4Z7WE 5DEGB 4AIZB 2X4TB 1ZMYA 3VNZA 4FI7A 5AVRB 4DZBA 5HDRA 4FQJH 3SGDH 4NJ9L 1KGXA 5T1DL 5DTFB 4JFXB 3CD4A 2C3VA 3TF7C 2ZJSL 2CHNA 2V7NB 4XNYL 4P4KA 1LK2A 3ILDA 4FULA 4NYLA 3Q0HA 4QCIB 5T1KD 3F6IA 2MQCA 3N5AA 4OIAA 1KB5L 5I1IL 2F54A 4Z18A 2Q86B 1QLEB 5K9KA 2XACC 1MFDH 3MVSA 2OL3B 3ZE2B 3EFDL 1AIZA 3FT3B 1G7QA 3HE7B 1QYGL 1LO5A 2JKNA 1D5MA 4H0LC 1YN7B 1CDUA 2FSEA 2XG5B 1EDYA 3ULVF 4LGPB 4WI0B 4UNVA 1UD2A 3PP3H 4X8JA 2P24B 4BE6A 4QRSA 4F8NA 4Z7WB 3KPSA 4LEOA 4UM9A 2K8MA 2X4OA 1I3VA 5D6DC 2B20A 1KJ3L 3H9SD 2BSRB 3L6FB 5JORB 4X5XA 4ZTPL 4DSYA 3U9WA 1T83A 1MCIA 1XGTB 1Q1JH 4NKIL 3BKMH 4OUUB 4HKJA 3PL6B 2M8XA 3GQFA 4FAAB 4K9EH 8FABB 4LL1A 3DPBB 4PJDE 5DC9B 1QSVA 2YMXH 1DBBH 3WMQA 2OULB 2EKJA 3B7UX 1IJ9A 5DUPL 5E9DE 1XCXA 3MV9E 4MNHB 2OR7A 4HZ1A 2QHRL 2E7MA 3VA6A 2A1WH 4RX4A 3RWCA 5ICZA 4RSVA 4IOSD 1FAIL 4PCTA 2B14A 3IMSA 3MRCB 1SFHA 3PGDB 4MHHI 5EZPA 4ZPTA 2OJEB 2X6VA 3KLAA 1JS4A 3HLAA 1PG7L 1RHHB 2VDPL 1KIQB 3Q6GL 2ZE0A 3SPGA 1CTOA 3EJCA 3GNMH 1Y6NR 5BVJB 1YNTB 1QBLL 1P7QB 1UOKA 2GJZB 3MNWB 3LXUX 3QVAA 1DJGA 4M5YH 1QVOA 1YEJL 5E6ID 5I23A 4OQTH 4WGVB 3U0PA 1ECZA 5IB3B 4HC1H 5HI3C 3HMWH 2R2CA 3G6DL 4EVNB 3P9LB 3CZKA 1HCFX 5JQ6L 3QXDB 3QHFH 3X3FH 4KI1A 4Y4FB 5E9DB 3UYPA 2Y07L 3UEQA 1AMYA 3MV9B 4RFEA 2D03L 2R2BA 3K71A 5F7EL 4MAZA 2ZCLH 2IV8A 4HT1L 1FYTD 3KYOA 3SQOH 4OU3A 3AB0C 3DNKA 1DEDA 1M56B 3DVIA 3RVWD 1YEGH 2OZ4H 3S88H 5L4FA 3HZ3A 5E99L 4MWFB 3T0AA 5B3NA 5KEZA 4CUCA 1S7WA 1RZQA 5I0XA 3RDTC 2Z4TA 5TE4L 5IHZB 1FL3B 4ADJA 4YEEA 3ESVF 5I19L 4UQCA 3ZHFA 1F45A 4TL5A 2OKMA 2AC0A 1LDPH 2AJVL 2CJUL 5AYQA 1BVKB 3B34A 3VGBA 3H55A 4O2EB 2NY6C 2X6MA 1MZYA 3TA3C 1R5WA 4N4YB 1IT9L 3BO8A 4LL4A 4Z8FH 3HR5A 1GSKA 3ASNB 3TBWB 1ZXQA 1XH2A 1M6UA 3BAEH 3VI4E 4TYUA 5MP6L 4PJ8C 4WWKA 2DLTA 5MI0C 4G83A 5IVXE 3VX1A 4YXHL 3QNXA 3V0VB 1Y7VA 5FUOL 2B2XL 2K9FB 5DC2A 5DMIH 5HY9A 2L4OA 5E9NA 4B27A 1I7TB 2Z31A 4K9EC 4M1CD 3SB3A 2XWTB 4KVCL 4M61A 1F56A 1ZXKA 2FJFA 1ZA6B 3QRLA 2IEPA 2C8NA 2JJSC 2OMTA 2VLJE 2DZEA 4I0PC 2Q6WA 3HE6D 1KXVC 3ECBB 4BKTC 1J1XL 2NY0B 2NSXA 5I76B 1KB3A 1NGPH 4JFHD 2RHEA 4H1LA 4NPKA 4O2CB 4GLRI 4PJIF 4WK2B 2XPGA 3TIDA 2AEQL 1KXTB 5HPMA 4OV5B 1TQBB 3ZO9A 4NFCA 5G5DB 3C5JB 4PHXA 4RETB 3ZUCA 2ZUSA 5EBWB 1BQLL 1C16B 4PI2A 3H42H 3JVGC 1BQ5A 1PPIA 3MV7E 4JRWA 5KYWB 4FNUA 4DFHA 1NPJA 2X1PA 3K2UH 3CVIH 5GISH 1JNHB 1C7TA 3JV6B 1RP9A 4JANA 4D9RE 1Q9KB 3CG8A 1TU2A 2EUVA 2UYLA 3ZKND 3D05A 4RIRA 3RBGA 2GITA 3UTQB 3UOAB 2AQTA 5E8NA 4B7IA 1LNUA 3RA7L 3L3KB 4OV6F 3RDTA 1CGVA 4BK5C 3A5VA 3QDAA 4PPTA 4V1DD 4M8QA 5TFSL 2FO8A 4ZS7L 3CVHB 1SVBA 3A6OA 4CA4A 4PYHA 1QEXA 2HJFA 3C8KA 3N9GL 1R3KB 2AAVA 2J88L 3FO0L 3RUGE 4OCMC 1G84A 3BPCA 3PAZA 2L3BA 2Z93A 4JRYE 5IUSA 1I1AB 1U33A 2C4XA 3IFNL 1HKFA 2VKWA 4ZUWB 4PJ8A 2L7QA 3BIKA 1HSAB 3MV7B 2NYYD 3D25A 2EZ0C 1FNSH 4ATTA 1M42A 1YYML 1M05A 5E00A 3N04A 4YNYA 1UXWA 3BEVB 5GZOC 3FT0A 3V4VB 2Y2TA 5KOMC 1XCWA 2H2PC 4YXKL 1SLWA 5DK3A 2Q3ZA 1S7QB 3NCYS 2ZXGA 2A83B 4PB0H 4K94H 4LCWB 3B5GA 5CHNB 1KTDA 4I0PA 1GJUA 5J12B 1V54B 5IBLC 3ARED 1KXVA 3UYRH 1UB6B 4XP5H 5GGSA 3OPUA 4WI5A 1G6RH 5JW4R 1KENH 3OG4B 4YHYB 3ARBB 3VXSD 2BINA 4P2RD 4B97A 3O45A 3SZKC 5E7BA 3MRJA 1XT5A 2A6JB 2E3VA 4JRYB 4JZJB 3BP5B 4PV8B 5EZJB 3ZGIA 3QEUB 3JVGA 4MMYB 4Q0XH 2DQHL 5BO1L 4OFPA 2FTAA 3GSOB 3HPLA 3N1PC 4I85A 4OLZL 4V11A 3MRRB 2Q10A 3SPHA 4APXA 4QO1B 3GSWB 4OQTA 2IQ9H 2E7CA 2CDFA 2DM3A 3UC2A 4HC1A 4DKFH 1E6OH 2DM7A 4M6NL 4PJEB 5D5MF 5FUCE 3WNJA 2B1AH 4ELKB 1CQYA 2UY6B 3L4TA 3O11B 4JQXC 5FK9A 5A2CA 2VC2B 3FQ4A 5J3HD 1L7IL 1OAZH 1UQSA 3NMEA 2ZP8A 1F0LA 4AG4H 4BK5A 1KXHA 3N41B 1HSBB 2ZAHA 3GMPA 5DJ0A 1ZANH 1CFQA 1CFBA 1FORL 3LYRA 3FU7B 5HJBA 4L8SC 1T0MB 3WKML 4KWUA 2OSLA 3EGXB 3IJEA 2M2DA 5DO8A 2DQIH 3CFJA 4MTMA 4Z1PA 1AMXA 1LYQA 4NN5B 4YWGH 5IMKB 1VRSA 3STBA 1QR4A 2V5RA 1JWMB 4MKMA 4PJ7F 1TQSA 1YC8A 2VSCA 1J5HA 4NUQA 3ZW3A 2E6JA 1D9KD 2LV4A 3FK3A 4K3EH 4X83A 4W9GC 5G4MA 1OAJA 2WLIB 1OB1B 4Y89A 4N8VA 4IMLB 4HH8A 5CD3A 4BFJA 1O6TA 3N42F 1JWUA 2LAAA 5B1JA 2R59A 3NFSL 3OM3B 5BOPA 4LVOC 2CBTA 3E2HB 4LF3B 2VZUA 4F37F 3G7TA 4L3EB 5E2TL 4WU7A 2CCLA 1AFVL 4IBZA 2XXFA 1AGFB 4HU8A 1ED3B 1WFJA 1LEKB 3EHBB 4JZOB 4UU9A 4P9HH 4JDTL 5EIIA 4AYMC 4PRDB 3HPJB 4GFXA 2I26N 4U3SB 3HG0A 3CH8A 3MX0A 4JDEA 5BZDA 3EIFA 4YX2L 1DVTA 4YGAB 2GVYA 2QGEA 5GGTA 4AC2A 1GYAA 3B2UC 1BM7A 5GQBA 2ZAIA 4YK4B 5DC0A 5JNYB 4L9LC 2EEBA 4FYRA 2HTLC 2PYEE 5DC4B 1VIWA 2V2TA 1N67A 2FL5B 4G7SB 3X3GH 4JRXA 2J2ZA 3CC5B 4XPFH 2JE8A 2W0LA 1JNLL 4K7FB 3PJLA 4KAQL 4PW9A 1FBIH 3IFPB 1G7JA 2P5WD 5F8RC 3RZCB 4ENZA 1CDCA 5JPMC 1ADQH 1XGPA 5ESAB 1BQUA 5ESQA 3OHXA 4LSSL 4AVHA 2H0JA 3QFGA 3L3HB 4DAGL 3NSDA 1EHAA 1BD2E 3VH8A 3BH9A 2YMTA 1LQSR 5DMKB 5T3XD 1GC1L 3MBWB 4BSWA 1PZSA 3DMMA 3VMNA 2A9ML 4G9FA 2HKHL 1KZQA 1N6UA 3BZFB 1FL6B 4FI8A 2F7IA 4K8RH 2EICA 1IO4C 4XODA 4JM2F 4KJYA 1VADA 2HFFB 5JHDA 5A16B 3T6QC 1CR9L 3HB3D 2PYEB 4EBQL 4J3OF 5CM1A 1A3LH 1T4WA 4XN5A 2BHYA 5KSAD 3K6IA 5CJ8A 5F0PB 3T8VA 1CD9B 3ULSB 4ZFOL 5JOPE 1FZJA 3SDAC 3CPLA 5GS3A 4ZS6D 4K0OA 4HS3A 2PO6C 4HCFA 4Y5VB 4ZAKC 2YKKA 3K6SA 2VQUA 1P6AB 4R6UA 1FWXA 4TNVK 2DLHA 2YRZA 3F58H 3UAJD 1J5DA 4ANWA 3EH1A 4YBLC 2F53D 4HUWA 2JELH 1WBYA 5EOTA 4DP7X 2HX8A 1O9VA 3C5ZC 1ROWA 2ICES 1BD2B 2WMPB 4QD2E 1GGTA 5G2NA 5CEYA 4HJ1A 2NDFA 3L17A 5KSVB 2BIIA 2YUWA 2DJ4A 2FLMA 3HLKA 2X3BA 4XE5B 4P46A 2V2WA 5I15H 2I07A 4L9LA 3TH2T 3AXLB 4P9HC 4U0RB 1EEZA 3QEHA 4F15C 1BLNB 1QSFA 2PTVA 1G6RA 2X88A 3N3EA 2PR9A 1T5XA 4FERA 4YN3A 3PHQA 2H1PL 4G8EA 5LBGA 1UH3A 3QNYB 4LESA 2JKXA 2P8MA 5IGXH 3DK0A 2HT4D 5TH2A 5JPMA 2BZ7A 2CUIA 1NGQL 2RACA 4U0QB 1UGNA 2Y7QB 3KYNB 4D3CL 5DK0B 1DBKH 1E42A 4DP0X 1UENA 3OMAB 5C92A 4X4KA 3L3DB 2GJ6D 3AACA 3BUQA 4NQXB 1S9YB 1IM9D 3MLRH 5T1JA 1XH3A 2NY1D 2VJXA 3ARZA 3M1OA 1NINA 3RVUC 5KN5A 4P3WA 2BC4B 1MIEL 2OTWB 2NXYC 5CGYD 1A7OL 4M5SA 1GYWA 5TQ2L 3TV3H 2EDMA 3MCLL 1A4JA 4QOKE 2GFBA 3TBYB 1RL1A 5I6XC 2IMMA 1J8HE 1ACCA 2DD8L 5AYUL 1EAPA 4ANKA 1IV8A 1UKSA 1E65A 1WWWX 2WBKA 2IH1B 3D09A 3UH8A 1ICTA 4K8RC 2PO6A 1PZBA 2E7LC 3S96A 5KJ7E 1MPAH 1KOAA 2ZF8A 5DRWB 4FQJL 4Z7NE 2VXSL 2W95A 2V9UA 4C47A 1S9WB 5LKNA 2Q76B 3VD3A 4Y4HC 3B2PA 4WW1B 1W9XA 5LXGH 2OTPA 3V7AE 3PPEA 1NGZB 3SDCB 3VD0A 4KI5F 3BDBA 3QNZB 3GM0A 1Z9MA 3QIUD 4HGMA 5IHBA 4IBYA 4KNQA 1MFDL 3EJQA 5BV7B 5J8OA 4OZGA 5A40E 1F8TH 1JMXA 2XLLA 4JZNB 2VXVH 4QOKB 4XBPA 3C5XA 1SMDA 3T5WA 4CKVX 1QKZH 4LP4A 5J5EA 1J8HB 2IWKA 5B4MD 2IPKA 2G3NA 4IOSA 5F9AC 3D3VE 2QPUA 1AHWB 3GGWB 3B56A 1WFTA 4LVHB 3KLLA 4ABUA 2XVLA 4E9TA 5K39A 3OKNA 1NGXB 4QHNB 3UBXA 1U4EA 4F7EB 2ZCZA 3IWVA 4B6ZA 4BGDA 3IN0A 3QUZD 1XF3A 2QBWA 3DOIA 3UO1H 2Y5EA 5EA0H 4NUMA 4W9CC 1Q1JL 3DJSA 3SDXE 3VD4A 4G8GD 1IEAA 3BKML 3QFJE 3KEDA 5JYMA 3RFRA 3DX9A 4MDIB 3JTTB 4HSQA 4K23H 1WIOA 5D1QE 4MKTA 1U2CA 5C9KA 3F00A 4K9EL 3UTSB 2ZNXA 3OLIA 4BM7A 2LABA 5E1AA 2EE3A 2OXHB 2YMXL 1DBBL 5JIDA 1E5ZA 9PCYA 5G55A 3WEBA 1NMAH 4DOHE 3VWJD 4QTFA 4A55A 4OIFA 3W0WE 1P2CB 2A1WL 3ECUA 1BWMA 3SKUD 4G1MA 3E9TA 3EYQD 1TZ8A 1V7MH 1FYTA 4KMQA 5MEQB 3D3VB 2V7HB 3LN4B 1XGQA 1GGYA 4P2OC 4PIBA 1U95A 1U8NB 3W5NA 1D2OA 4UNTA 5H8DA 4PFEA 3OB8A 1G9NH 5ETUB 1KJMB 3RVVD 4AM0Q 2HJKA 4UAHA 3GNML 2XQYG 5E4EC 4BFBD 2WLNA 5C3IA 4TLSA 1LP9B 1UD6A 2A0LC 2YUXA 3B9VA 4M5YL 3SDXB 3T4YB 4PD4J 5C6TH 2GSMB 3QFJB 1F4YH 1ZWIA 1CFNA 4OQTL 2K8QA 5D1QB 4JPWH 5CSBA 4WV1B 3WNPA 5I16B 3OF6D 4HC1L 3L7FA 2DICA 3HMWL 4Y2OB 1SOQA 1CGYA 1XVSA 2FECI 1KGIA 1TZHA 3QHFL 2M83A 5E5RB 4N86A 2IGFH 4WO4B 3X3FL 4FG0A 4CMMA 5IVXF 3T2OA 1TG8A 1A6TA 1EFQA 3WFDH 5BRZD 4DOHB 4HOZA 4ZX6A 2UZYA 3W0WB 3TVMC 3S0PA 1JGEA 1JGUH 2ZCLL 3SQOL 1S5HA 4QRBA 3EDDA 3TT1H 1YEGL 4QRQA 1NGWB 2OZ4L 3S88L 2ALAA 3QCUH 3DI2B 5HDBE 3UC0H 4YIQB 5DJXB 4CVWA 5F9WB 4DETA 3U6RA 4G82A 1IRAY 3GJFB 3W5MA 3HR6A 3INOA 1WWCA 3QC5X 3LN5B 2EEFA 3NCCB 2BFVH 1U8PB 1LDPL 2R9HD 1AC6A 5IMMB 4KRPD 1AD9B 2GI0A 3RL1B 4CSPA 2X4SA 2J20A 1OWWA 1WAEA 4PWFA 4N2OA 4O02B 3WHE0 4Z8FL 5EC2A 2R39A 4NQCE 4JAMA 5HYQA 1SRDA 4EF3A 3WSQH 1IILE 3IXTA 1QACA 3MPCA 4DP6X 5HD8C 3BAEL 1SUJA 3HI5H 1P5UA 5CD5D 5HHPA 1Z0MA 3V6BR 1QQDA 5KVFE 2DI8A 4WJKB 1GS7A 4WTZA 4BXVA 3Q9QA 4NC1C 2I25N 4KGJA 5DMIL 3QIBA 2BP8A 3CVDA 4QXTB 4F27A 4Y8DC 3LNIA 4WNJA 4P2OA 3MOBH 4O2FA 5ADOH 2VRKA 1TEFA 3VSUA 4EZKA 5HDBB 4A38A 4QHLA 4QHUA 2CJSA 4N90D 4DK3A 1M9SA 1UCBH 4YHLH 1A3ZA 1UUSA 1C08A 4PW3A 5IV2B 1I7RB 4AV5A 1ZA3A 4Y16B 5IJVB 1S7RA 2NQ3A 2Z8RA 4JO1H 5FR3A 1P4LA 3MRFB 1DQQA 2B5IC 3OGCB 2C3HA 3RUGF 1NGPL 3Q43A 4ZUVA 3ARDD 5DD6B 3CLFH 4PS8A 4AMKH 4NQCB 4DKDC 1G9NC 3OG6B 3D39A 4TNFA 3H42L 2J5WA 1AD0A 5TE6H 5BXFB 3K2UL 3TVMA 4QRRA 1UD3A 1S6NA 3CVIL 4KRMB 1S7VB 5GISL 3X14B 3KG5A 2HG0A 4F33B 1Z9NA 3NGBC 2GBUA 3S9DB 4GAGH 3TTYA 3W9DB 3DRQB 3GSVB 3LPGA 1QABA 1OOWA 1JHTA 3T3MF 1J0KA 3EYVA 2COVD 2DI9A 3LZFH 4HS6A 3RTQC 5I73B 1HJBC 1DVFD 3RGVD 3SY0B 1M9WA 4HG4J 4N2BA 1CG9A 3FB7B 3JV0A 1A7BA 5F97E 3AREA 1TTRA 2F18A 1K5NB 4NQDA 3B9KB 1E8ZA 1FZKA 1U8LB 1EHXA 3UMNA 2Y25A 4BFNA 3KNBA 2XJLA 3LV3A 4CNIA 1RZJH 4W6XB 3BP4A 4XNQB 4MDJA 4XNBA 5GJSH 2ZWNA 1EXUB 1FNSL 2BNRD 2EVIA 5DI8A 1ZDSA 4QNPF 3CFBB 4QR7A 4FXGA 5ES4B 1JWSA 3BZ4B 4DF9A 3CMOH 4WENB 3RFZB 3B3BA 4LKCA 3TZVD 3D69B 3O2DH 4KDTC 1MFNA 4PB0L 3JQOB 4BKLA 2AK1H 2AK4D 2ITEA 1EGJH 4GJTB 4DZBB 3FH8A 4RA3A 3UYRL 5K1NA 4XP5L 4K5LA 2FH8A 2QV4A 1G6RL 2C3VB 2OMNA 3LB6D 5JW4Q 1KENL 2CZNA 1Z2KA 2EECA 2VUYA 1LK2B 1G43A 3GWJA 3TN0C 4LEBA 2F54B 5CSGA 2FR4B 3CFKA 5K9KB 4NQED 5AB0A 5FYLH 2Q8AH 4ES8A 1A7NH 1ILSA 2G2RA 4Q0XL 1BM3H 2R27A 4U1GC 1G7QB 4X5RA 5I8CB 2IDUA 2QVTA 1LO5B 4E41D 1CXFA 1PD0A 1D5MB 4H2CA 2QQQA 4Y5XC 2YRLA 2FSEB 2IQ9L 1GW0A 1CFTA 2QPSA 5DJYA 5ISZD 5FFOA 5LN4A 3FTYA 4DKFL 1E6OL 1AO7A 3APMA 3T0EC 1CPUA 2B1AL 1N19A 4QRSB 4RMVA 4LAJH 4BFGA 3KPSB 4LEOB 2X4OB 4DGUA 3EOBA 3P3YA 4F9PA 5LG1A 4AG4L 4DVBA 1QNIA 3UPRB 4KY2A 4X5XB 4N2CA 2WVUA 4NM4H 1ZANL 2ZD0A 2EP6A 5FDYA 5C07D 2J21A 3GXDA 3W37A 5CP7A 3GINA 5KBDA 4YSSA 1J10A 4HKJB 1AOZA 3VX0A 2DQIL 1ETA1 3ATFA 2BY3A 1B3IA 4YWGL 4IRSD 1GA2A 2FK9A 2JJVA 1U3HC 2Z3FA 4K3EL 4URKA 2FJGA 1Y6MR 3RWCB 1DJSA 3K6OA 1YMHA 4XAKD 3BI9X 5F9OH 3OAUH 4ZPTB 2ADYA 3HLAB 2NW2A 4ORGA 1ZGLM 4Y19A 5I6MA 1RZJC 4TMPA 4KDTA 2X9XA 3P2DA 2P5WA 1H3TA 1O9ZA 3H4FA 5L4MA 2VRQA 3SCMB 2XYCA 4P9HL 1D6VH 4M8VA 4A63A 4EIZC 2WNXA 1QVOB 4JO3H 4X9YA 5DVKA 2QGCA 2VDRB 3TLRA 3QG7H 3U0PB 2FJHA 3TN0A 5FB8A 4P05A 4J3VA 3FU9A 4N22A 3EBGA 3ZDYE 2ICEA 4QJ5B 5AYTA 4P2CG 3UYPB 5LG6A 4RFEB 2R2BB 3K71B 3KYOB 3X3GL 4GRWH 3CWGA 2QTEA 4XPFL 2F1BA 1Y6KR 4GUPA 3ZYIA 2MIZA 3L45A 1FBIL 4P04A 1OQXA 1QPXA 1S7WB 2OX5A 1N5YH 1ADQL 2EEDA 5AOMA 3S3BB 1F00I 3AG3B 1ZTXE 3I9IA 5EORH 4Y9BA 1EJ6A 2C9QA 3JWNG 2XY1A 3MLZH 2GK0A 4CSTA 4XHQA 4AJWA 2Z35A 1JXKA 2F53A 5KVEH 2XFXA 3VM7A 5HI3D 3UL4A 3QZWG 1R5WB 1L9OA 3GRWH 4X6DF 3BO8B 1EBAA 1NFDA 2W9DL 1ZHNB 4L1LA 3HR5B 1UC6A 4TQ8A 4K8RL 3Q5TA 4KK8D 5IW1A 4JFUA 1DQMH 1IGJA 4TQEH 1QTPA 1RY7B 4IKLA 4WWKB 2W60A 4U31A 3DBSA 4LFHG 3IAPA 4IDJH 2Y5QA 4PV9A 4B0MB 4BCXA 1A3LL 3QNXB 4HJSA 1I8IA 5KG9A 3LEYH 3D0LA 5HY9B 2YPLA 5MERA 3Q8FA 1E4XH 3CAFA 4OFQA 2Z31B 3QR1A 2XKUA 1IVTA 3ROLA 4M61B 1F41A 1B90A 2FJFB 4IK7A 4LSQH 3LRHA 4FFWD 3I75B 3F58L 2OMTB 2Q6WB 3KPNB 4JGUA 2V5SA 2XJKA 2JELL 4A1RA 1TYJA 2IG2H 2V17H 4Y9FA 4Z9KB 3MJ8B 3TPUB 4L3CB 4H1LB 4Q8BA 3TIDB 1RHFA 2P47B 2XPGB 1S3KH 1FH2A 5HPMB 1R5IA 2WB1A 3QUMH 4NRXB 4ZZFA 2QQLH 1O7DE 1ZLUK 3WJJC 5I15L 5DUBA 3GSQA 2FZ3A 1E9QA 5KS9A 1J11A 1Z1WA 1MCPH 2EH8H 3MRIA 2FHCA 4JANB 3KVDD 1FLRH 3QQNA 5F7LB 2WXPA 4R3SA 4X6BB 2VIRA 1TU2B 2UYLB 4K9JA 5IGXL 3BUIA 4PJFF 2GITB 4MBOA 2Y06H 5T3ZD 4Z7NF 1LNUB 3O6KH 1XH1A 1ZVNA 3RDTB 4NHCH 1KYOJ 2DLEA 1DBKL 1QBMH 2IFGA 5B8CA 4GRMA 4M8QB 1AYRA 4ELDA 3Q1EA 4LQ1A 4MNGE 3QWRA 4HUUA 2ITDA 3ABLB 1MAJA 3C8KB 4Z3HA 3MLRL 3VWKD 5ADPH 3M8OH 1OSZB 3FB6B 2HWZH 3BPCB 3BKJL 2Z93B 4QYOA 4PJ8B 4LXFA 3BIKB 4Y1TA 3TV3L 2HVJA 2HMIC 4DP8X 1W91A 1IKNC 4X9BA 5E00B 1I8KB 1UXWB 5HHQA 2VMCA 3DIFA 3FW6A 4YHOH 2O4EA 4NCDA 4MHHG 5AD0A 2Q9OA 4L1HA 1MPAL 2PW2A 3QUZA 1KTDB 4XNZC 1NCTA 1QTYT 2CO3A 4I0PB 4K2UH 3WU1A 1KF9B 3GZPA 5LXGL 3LNDA 2VN3A 1WFIA 4WCYH 2CGYA 3QORD 3MLPA 1SJMA 4P5TC 4KTGA 32C2A 2FWLB 3KPPB 1G0DA 4A7VA 3MRJB 4OZHA 3WIHH 1KGYE 5DS1A 2BY1A 4KKCC 2EO9A 2V3DA 4IW4C 1LO3H 4KX8A 3SODB 1F8TL 2VXVL 3HPLB 3OPZH 3KLKA 1QKZL 2JKLA 2J72A 4NZJA 4APXB 5DF0A 1PEZA 3QQ4B 1NCNA 2CDFB 5C0CA 1PQZA 4FFYH 1IE4A 1Q9LA 2WUBH 2VMJA 2CKNA 1I1YA 4UOW1 3RIAF 5FK9B 1SDAB 1UQSB 3UO1L 5EA0L 3RURA 4PCSA 4ZZKA 1UB5A 3IBOA 4F57H 3DYPA 3NJFA 4M7LH 3GMPB 5DJ0B 1DDHA 1DLHB 4P49A 4K23L 4HIPA 3VFOA 2OSLB 3IJEB 3CFJB 1MN4A 1X5FA 4JUTA 1ROCA 4RLDA 4B3EA 1MW0A 3EBAA 1NMAL 4XOAA 2XQ0A 2G9HA 3L5WA 3WN5A 1WAPA 4MJID 1CVRA 5BRZA 3INUH 4HD5A 3HC3H 1MG3C 2IH3A 3FHAA 1V7ML 5DYOA 2HX9A 4N1EA 4NAMA 4N8VB 4FCAA 1VESA 4JRXE 5CD3B 4P23A 3GRWA 3QQ9C 1JWUB 1BZ7A 3SYQA 4GOSA 5DHMC 3N42B 3P0GB 4KROB 3U4EA 1G9NL 4WU7B 3L2NA 4ACPA 4AGMA 1YQVH 4YGVA 5GS2D 3WHXA 1YY9C 4W9LC 3B3IB 2PCPA 4UU9B 2MTPA 4HMEA 5EIIB 5C6TL 4FKEA 1F4YL 1ZLUH 5IUCA 1GOFA 5FA3A 1LM8V 4JPWL 4B5ZA 4KY1H 5CLXA 3OMNB 3MX0B 3IN2A 3OQ3B 4JDEB 4G9FE 5AVZB 5BZDB 3RILA 3V4PH 4WZ9A 1MCEA 4P5KA 4M7LT 2IGFL 1R3HA 3KHQA 3BVUA 2WO2B 3WFDL 1ZOXA 1A9EB 2NMSA 3G5ZA 4FEIA 5JHDE 2IWEA 4L4VA 1D7DA 5K1VA 3TFKC 3VU2A 4AK1A 1JGUL 5L0QC 4APQA 5JO5A 4ELMF 3CVCA 3TT1L 2APSA 1UD8A 2QFPA 1GIGH 4JRXB 2AEPH 3APDA 5JPNC 4LHJB 2J2ZB 3QUMA 3QCUL 4WDIB 3UC0L 4LSPH 1G7JB 1CU4H 1U8JA 3N06B 2ODHA 2XN9D 4N1CA 1IBZA 5C1MB 2VR3A 1XGPB 5FYKD 4RBPK 3B5TA 3QG6B 5ESQB 3OHXB 1SOSA 1RURH 2H9GB 2BFVL 4JKKA 4OFYD 2MJWA 4WTWA 4HJ0C 1OCRB 2OBGA 3BN3B 1HCVA 1YEDA 3BH9B 4YDMA 5D2LA 3VH8B 4BSWB 1G1YA 5LJYH 2CK0H 3DMMB 4GIPD 5IFHH 3BT2H 4G9FB 4R0LC 1KEMH 3MLWH 3LD8C 3WSQL 4C8XA 5FOJA 3NA9H 3HI5L 3KDPB 4AGNA 3TXAA 4KJYB 3WKYA 1VADB 1AZBA 2X2HA 5JHDB 4NRYB 3P4MA 1QSFE 5CGBA 2J8HA 4GQ9H 3AZUA 3MOBL 4BHUA 5EN2A 1C5CH 1FZJB 2OA9A 1J87A 5ADOL 5ACMA 3NAAH 2P52A 3CPLB 3QRGH 1BG9A 1LD9B 1UCBL 3QUKB 4YHLL 3RY5A 1DVFA 2J12B 5A2FA 3K6SB 5D4HA 1D5BB 3U79A 1BF2A 4WHCA 5IT2H 1XSOA 4JO1L 5AVUB 3REVA 2JJTA 3BWUF 1XTLA 4JQVA 4HUWB 4OLUH 5EOTB 1WBYB 4L1TA 4ABWA 6PAZA 1ZCRA 4N8UA 1N70A 2CO1A 5CEYB 1BAFH 1Q0EA 4X7CC 3CLFL 1OLZA 1UFGA 3ZMEA 5E6UB 4AMKL 2VDNH 1KPUA 1EO8H 1YUHB 3WNNA 5TE6L 4P46B 2X41A 1BFOA 2V2WB 2I07B 4L9LB 1YEIH 1B4RA 1EEZB 3QEHB 2JQMA 3ARXA 3KBHE 2KZKA 2WNKA 1T5XB 4GAGL 4M7KH 3U30C 4M1DH 3TM6A 1SN0A 5JPNA 5HYSB 2X3AA 1A1OB 4G8EB 5EZIH 1TTBA 3WUWG 4AIXA 2XIBA 3LZFL 3UDWC 3WIHA 2P8MB 1DTUA 4LRIA 4ZAKD 3TZVA 2DV6A 5TH2B 2W0PA 3WBDA 5JPMB 1G1KA 4U1KA 5AVQB 4ZJ9A 4LE8A 4BEIA 1FVDA 2ZKMX 4A68A 3ZR6A 1UASA 1OP3H 3CU7A 3EKCA 1I1RA 1HC1A 1NOLA 1N0XH 1SEQH 1OXYA 4H4NA 4MMZC 3TU6A 1ZLWK 4NT6A 3CSFA 4E2OA 1RZJL 4A6YH 4ERSH 1OVZA 3DTXA 5GS0H 5KN5B 5GJSL 1ZPUA 4PR5A 4EN3C 4OZGE 4Z6AT 4Z7AA 3WXWH 4EXKA 5INDA 5DQJA 1A4JB 1AGEA 2AQ2A 2GFBB 3C9NA 3DKHA 2XSKA 4EDWH 2HH0H 1EAPB 3CMOL 5LDUA 4I13B 3QH3A 5GGRY 5C9JA 2JNZA 4FQXC 4O58H 3F8UB 4GS7B 3O2DL 4KGLA 2AK1L 2P48B 2PO6B 3S96B 3R4DA 4ENED 4J27A 1EGJL 2QTVA 1ZSDB 1SMAA 1OSPH 2ZG2A 3QJOA 1KN2H 1XIWC 2YGPA 4XHJC 1OE2A 1RV6X 5C0BD 4N6QA 2BNQD 4MD0A 3B6SA 4FEMA 4UYPA 5BOZG 3RWDA 3VXUD 3NPSC 5FYLL 2Q8AL 1A7NL 4P2QD 3M88A 4PRHD 1BM3L 4OZGB 1WQVT 4Y2DD 4YZWA 4L29B 4XBPB 1JDAA 5I6OA 1QNZH 4KVNH 4LPVA 4RBPH 4YMPA 3EOAB 2HRPL 2IPKB 1FYTE 4JN2B 3F84A 3FFOA 3V4PA 2R2HA 3UDWA 2APWA 5K39B 3OKNB 3UBXB 2WBJC 4U1NA 4TOYH 4A2HA 3T2LA 4BELD 4N25A 2L7JA 4DKEH 1SLUA 4NM4L 1FNGA 3KWTA 2DJSA 3M1CA 1IEAB 3QJXA 5E6IB 1JF6A 4F80A 4PJCE 5FA4B 2KKQA 2O1AA 4MAUH 4WW2C 3ATEA 1GS6X 2YQGA 4MMZA 2OCFD 3ZDYF 2GTQA 2AXGA 1DQLH 2WXIA 1X5GA 5E1AB 4PJBF 1NBYA 4G2AA 1QO3A 4MXVE 1WS8A 3QFDA 2WZ0A 3W2DH 4F8LA 3OB0K 5B1KA 1XQ4A 3EOTH 3FUEA 4G1MB 1AXSA 5F9OL 2XUWA 3OAUL 1FYTB 3RIFK 4Z77A 2G0KA 2WHVA 1XGQB 4FQXA 3T3PE 2VDLB 1M1SA 4N87A 1U95B 4ETQA 5GS0C 4UQEA 4OJAA 4DCQA 5SWSD 2G60H 2HJKB 1ID2A 3RJOA 1TETH 2PP7A 1D6VL 2BXZA 1NMCB 3QDJA 3S5YA 2LU3A 5T5NG 4G6FD 4JO3L 2BPBA 1HL5A 1K4CB 3H2PA 1CFNB 1HCYA 4HMDA 3QG7L 4B60A 4L3AA 1EO5A 2G30A 4PJ9D 3L7FB 3GYRA 1JI1A 4W9HC 3EJYC 4A7GF 2VSDA 3RI5F 2WXGA 5DA4A 1TZHB 1TEGA 4J3UA 4ZYKA 3DX7A 4CMMB 3MHZA 2UZYB 1INQB 1NCCH 3SGKC 2ODIA 3BC9A 1S5HB 4LZKA 5HI4C 2FATH 1Q1PA 4RMRA 1FIEA 1QZ1A 1U2YA 4DP1X 3UG5A 3T3PB 1N5YL 1FFQA 1WEJH 2H26A 1FO0H 3U6RB 2K45A 2J1KA 5A6IA 5EORL 1N2RA 2A0LD 3P02A 2C26A 2ESVA 1ZLWH 3TJHD 3MLZL 2DQGH 4U49A 1BFVH 2WIMA 1KB9K 1W8NA 3HE6B 4JVUA 5KVEL 1L9RA 3BQUD 4W93A 3U4BH 3JYBA 1U2HA 2DKSA 3AS2A 3G6JA 4JHWH 4WW2A 3VRJA 1MCNA 1S46A 3BN9C 3W11C 2X4SB 1E3ZA 2C7UA 5J89A 3LRLA 3GRWL 3CFMA 1JZEA 4K3HA 5EC2B 4JAMB 3IXTB 3D39E 1DQML 2ZCKH 3LKRA 4TQEL 1P5UB 1VCBC 4FRWA 5AZ2H 1KLGB 4GFTB 4IJ3C 4ZUTA 4IDJL 3WIIH 4QRRE 4AQ8C 5A2IH 2F8IA 3RY4A 5DD5H 3LEYL 4FG6C 3QIBB 2BP8B 3SGEI 4Q7DA 5CZXC 1E4XL 2PWFA 4FG4A 4O2FB 2XIDA 2JKIS 4FI6A 2EXWD 4W9DC 4QHLB 4QHUB 1ZHLB 1TZIA 4M4RB 4JPSA 4LSQL 1C08B 1NDTA 3DVFA 1S7RB 1ZGLA 1HYSD 4C54A 5E6ZA 1P4LB 1BECA 1KCVH 3UJTH 1M2VA 2IG2L 2V17L 3ARGD 5AOZA 5BW7C 5L8JB 4NQDE 3P0YH 3DX0A 4ZUVB 3EFOA 4FHKA 1S3KL 4ANVA 3EJPA 4PSRA 1KCRH 2WXJA 3BW9A 3QUML 2QL1A 3BFQG 5M7QA 3E1ZA 2DEYX 3D39B 2QQLL 1TQCC 3ATAA 4MCYA 2ETWA 1AD0B 2WGXA 5BO0D 4C55A 1QWHA 4PI0A 4XWOC 5J6GB 1MCPL 4RGNC 1FV1A 5EU5B 1UGKA 2EH8L 5HHOD 3SGKA 4NC1E 4JKWA 1XCTA 3WEOA 1FLRL 1J48A 4A2MA 2CNZA 4MLSA 3L5IA 1PG7W 2BRQA 1JHTB 2MMXA 4AMXA 3CZLA 1ZE3H 2Y06L 3EYVB 3CZFA 2VISA 3K6NA 4HS6B 4R4BA 43CAA 3O6KL 2ARJQ 4NHCL 2E9IA 4AENA 4GW4A 1QBML 4DKAA 3CGTA 2BERA 3EH5B 3DGDA 4XXWC 3G9AB 1UXLA 3GEFA 3AREB 3DC0A 2H41A 5ICXA 5FKPA 4NQDB 3WLBB 1ZD6A 1FZKB 2E47A 2BSCA 5ACLA 5ADPL 3M8OL 3QORA 1P1ZA 3VXSB 3T9WA 2K1MA 5MENA 3IDJA 2HWZL 3HC0A 3LV3B 4EI6A 4TF4A 4CNIB 3BP4B 5HBBA 5C08A 2V2XA 4MDJB 4LCCA 1A1NA 3RL2A 1JG9A 2F74A 1F4XH 5I74C 4K07A 4DUXA 4YHNB 2J1XA 4AQ8A 2IPTH 2XVBA 1FSKB 3AROA 5DI8B 2N1TE 1JRHI 4FXGB 3PGCA 4HIIA 4YHOL 5DHVA 1JWSB 4LLYA 4Z3JA 2FWOA 3RTQD 1JTPA 3B7SA 3RVTD 1AO7E 2NLJA 2XWXA 4LKCB 1RZIA 1T2QH 3FSZA 4BKLB 2ZKXA 3ASOB 5FUZH 3CXFA 3IMVA 1MWOA 2XYBA 4K2UL 3QI9C 4WUUD 1ODUA 3QJVB 3L9BA 2AAAA 4PVLA 1VFAA 4BJLA 4WCYL 4BSVA 4Q89A 5IFJA 5J06A 1M7UA 1JUFB 3V4UH 1RSFA 5IESH 3WIHL 3CFKB 4P59H 4UBDC 3HA0A 2PXYD 3M45A 2LT9A 4KHXH 2G2RB 1LO3L 4OBSA 3MXVH 4QDGA 3WMPA 1JAEA 4MJIA 3OPZL 5CZKA 1D9KB 1J5OH 2NY2C 3AS1A 5D93C 1EJFA 3NGBB 4E9LA 1DJYA 3O4OB 1U6AH 4YQXH 3CDFA 1CFTB 4JFOA 5TF1H 2B9AA 2ZPKH 4FFYL 1X9UA 4OZ4A 2IH9A 2J5LC 2IAAC 1AO7B 2WUBL 3O8XD 3HRPA 1PZCA 4Y19E 1EHNA 3MBED 1S9VA 2AJ3A 3EOBB 4RAHA 4ICXA 3PJSA 4DVBB 4F57L 1FRGH 4M7LL 4MS6A 2X42A 1AS7A 4BFKA 1QMUA 4DO5A 3SBRA 4M6MH 3ULAB 3ZRSA 5CP7B 2NQDA 1I85A 4M3HA 4PAZA 5C0GA 3KJ6H 4ZXBC 3VDBA 4A67A 1ZE3C 1JV2B 4PN6A 2NX5E 4LMQE 1FO0A 4UQDA 1B2WH 2RGSA 2XWJB 4LU5H 4WHTA 2K6YA 4TLKA 2CM5A 2YPVA 1QFHA 3I74A 3KW7A 3INUL 3HC3L 1J1PH 2FJGB 2VDKB 3L3IB 4I1RA 1T03H 3I85A 3CX5J 4OAWB 3F65A 1YMHB 3HAEH 4AT6A 2VR5A 1HILB 4M7ZC 2FB4H 5FO7B 2NW2B 4ORGB 3RWHA 3T0EE 2YK1H 4Y19B 1BQRA 3FH5A 4FYQA 4OZFB 2P5WB 4JFFD 2IXQA 2XPYA 1R34A 2YN3A 3BFOA 1BDYA 1YQVL 4W9JC 4MMXC 1LVEA 3QI9A 1WS7A 2VJ0A 4HX1A 3LQMA 1WPCA 5C0EA 5LGHH 3JT2A 1FHGA 2MOGA 2AXHA 3S5LG 2F53E 5LAXA 5E6YA 5DS8B 4KY1L 4L48A 4LBEB 1I9RH 1CLYH 3T6VA 2FJHB 4RFNC 3TN0B 4M6AA 1F18A 2ARWA 3V4PL 2PLTA 3OZLA 3DX1A 1NFDE 4BZYA 3BSZH 2WN2A 4ZTOH 1X7TA 3AJ7A 3GMOA 3DX3A 4PLNC 2ICEB 2OTUA 4IRZA 3RX9A 4ZX3A 4QT5B 2Q8BH 3U1QA 5C0AD 4J1UA 1UVQA 2E9GA 3QE5A 2XHNA 3FQWA 1GIGL 3F6LA 2AEPL 5KSAB 2YPLE 1TCRA 4LFHD 4E68A 3O6LH 5K5YA 4GUPB 4LSPL 4K7PX 1CU4L 2CHXA 2WKOA 3R18A 2WK2A 4OH2A 5DD3H 2EUXA 1QWNA 2OX5B 5F3FA 4AH2A 2EVJA 1RURL 2XG4A 2GK0B 4KX7A 2Z35B 1NPUA 3BESR 3STZB 2F53B 5ACZA 2XFXB 5CMAA 3T71A 3FF8A 4TQHA 1GJIA 3CIQA 2CK0L 1BXUA 5IFHL 3BT2L 1KT2B 5DD0H 3QUYD 2A4EA 2ORBH 4XAWH 1KEML 3MLWL 5J56B 1NFDB 5J0BA 3FUIA 4UOJA 5IM7A 3NA9L 2P42B 4X6DB 2EIBA 3AY4C 5IW1B 1IGJB 3NEEA 2W60B 1EIBA 4IRJD 2CHDA 2YGVA 5KS9E 2JTDA 4PV9B 4JCMA 1CLOH 4FXTA 1X5AA 5F9JA 4DN3H 4PH8A 3EXJA 1PD1A 4GQ9L 1I8IB 5KG9B 4HAFA 3D0LB 5MERB 2FYVA 1C5CL 1GZHC 5C6WH 5HVGB 3NAAL 1E6JH 2X2JA 1Z9SA 3QRGL 5FYLD 3VGDA 1ORSB 4B9FA 2JCCF 3ROLB 3MMEA 4G72B 1SXNA 2YD6A 2FWSA 1ACZA 5IT2L 1X4ZA 4MMXA 5J9PA 3A67H 3H8NA 4ZDHA 1AG6A 1WZAA 1Y1DA 3ET9F 2PPCA 2WP3T 4OLUL 1MOEA 4M62L 2YZ8A 1UHVA 3Q2NA 2IAND 1WSST 2GJ6B 1RIUH 1Q9WB 2C5DC 2E56A 1MCOH 4FTVA 1BAFL 3K6FA 4GMTH 2W8CA 1WFOA 1NBVH 2X38A 4H13C 4FDWA 2VDNL 3ETTA 2JQAA 1UKQA 1EO8L 4JK0D 2AXWA 1TTCA 2NY1B 2ZZUT 3K0WA 1NUNB 1YEIL 5DUBB 3GSQB 1M6OA 5CWSA 2DTSA 1RZKH 4GKZA 3VG9C 5I30H 4UTBH 4M7KL 3MRIB 4M1DL 2KDGA 2OSYA 4PRPD 5EZIL 1YPZB 4R3SB 3IFLH 3L4ZA 2VIRB 3PWJA 3QDGD 3I6LD 5CN2A 5CZVH 1BEYH 5HHMD 5DJAA 1OARH 5FWRA 2Q3AA 5I1KH 1F5WA 5IIEA 4ZI8A 2RAMA 1WITA 5B8CB 3PAVA 4GRMB 3CXDH 1S78C 4AZ8A 4CJ0A 5AG8A 1QRNA 5A2AA 5EUOA 1HEHC 4PJ5A 3NDYE 2FBJH 4R9HA 2HLFD 3NN8A 1U58A 2ITDB 1N0XL 1SEQL 3UROR 5C0BA 4ZX5A 2ZX8A 3ZL1A 1P6FA 5EN3A 4A6YL 4OZHE 4XX1E 4ERSL 5GS0L 3VXUA 2JIXD 4PTTA 2KC0A 1XBDA 3FO1A 4QYOB 4D2NA 1CK0H 1P7BA 3PWLA 1KJ2A 3U7WH 3WXWL 2HVJB 1M7IA 2PWHA 2YD4A 2ZSWA 4U6YA 1I8UA 1YDPA 4LNVA 4EDWL 5HHQB 2HH0L 4LLDA 4OCLC 5C0CE 1GZHA 3QBTB 2ZYRA 4GKLA 4O58L 5AD0B 3V5DA 2R1WB 2VR8A 1WGOA 3ABKB 5MHSD 1MCFA 2PW2B 1YSOA 2CUHA 2GSGA 3G5YA 3QUZB 1QLRA 1OSPL 4WSJA 3T65A 4PJCF 3ISYA 5KVDE 1KN2L 5DR5H 4GRWE 3HAEA 3QXAA 4G8GB 1NSNH 2XQYA 5IOKA 1P84J 2HT2C 4LVEA 3F7PC 3D34A 4LVNC 2HUEA 4F2EA 32C2B 1PG7X 4OZHB 3X1BA 2H7WA 5DD1H 2BHUA 2J55A 3S2AA 2DIAA 3PWPD 1WRFA 1EDQA 2A6IA 5KVEE 1QBAA 4NM8H 4Y5YC 1N3NA 1QNZL 4KVNL 3X11A 2WWKO 3BT0A 1TT6A 3IMUA 1VKXA 5D7JD 3EAKA 2OJ1A 5C0CB 1PQZB 1LILA 3QK0A 4JFDD 1Q9LB 4K3JH 1DSFH 3BSZA 1ZLDA 3O4LE 2Y72A 3GB7A 1XGRA 4TOYL 1A7RH 1QATA 1RMFH 1SZNA 4KK6D 1ZS8A 2CQVA 4YFEA 1E0OB 5SWSA 4UQ2A 4DKEL 4JJ5A 1R19A 1UB5B 3LH8A 1RZKC 2R1YA 3NZUA 3CSBA 4NJAH 1MHPH 3BOVA 1DDHB 1PL3A 1KMGA 3LNGA 4OKDA 5CLWA 5DRXA 4MAUL 3Q1SH 1BHGA 3DLQR 3VFOB 4TVPD 3R7RA 5M95B 4AITA 1RK0A 3C8DA 2ATPA 3T6XA 4L9DA 4JHUA 1DQLL 3MLTA 4J8QA 4L5FH 4ZW7A 5LBSA 3W39A 3W2DL 4Q74A 5AL8A 2G9HB 3L5WB 3WN5B 5FPIA 3KMDA 3ARSA 3PQYE 4L4VE 4LCYA 5BRZB 2MNJB 1OLLA 2YOAA 5KBMA 3EOTL 4FFVD 2IH3B 1BZDA 5DYOB 1HAWA 3OLGA 2DWSA 2H32H 4N5UA 4YSOA 1CS6A 4P23B 4LHUA 2NY4D 2ZKYA 4KQ4H 1NZRA 3ZKMC 4G8IA 5IEHA 3TESA 2V9RA 1BZ7B 5D7LE 4YH6A 2JXMA 3OTTA 3ZY7A 3CZNA 3VCLB 4P3CH 2G60L 4X5QA 1B4LA 1TETL 2BCMA 4YGVB 4C4UA 1URZA 4TLTA 5JXED 1RZ7H 2PCPB 2XKNB 4HPYH 4HUMB 4JFEA 4R4FH 3BQUA 5FA3B 3L1FA 5D2LE 2KZWA 1F4HA 5E94A 1E7VA 3T08A 3VI3A 3ABGA 3UBGA 1Q8MA 2CKBH 1KY7A 3QHTC 3ILEA 2PABA 4MJ5B 4S2SB 3RG1C 4HIXH 3SQRA 3P9WB 1R3HB 2MH4A 3G5ZB 1I8AA 4UUJA 2G4EA 1OTUC 4L4VB 1C5DA 4ZFGH 1NCCL 1CIUA 4HETA 3V4LA 4WHYG 5FYJH 4APQB 2RMNA 5JO5B 1HKLH 3E3QC 3GEWB 1WCQA 3S35H 1WICA 2FATL 2NPLX 4IHBA 2R2EA 5D7KD 5I75C 3QUMB 4WGWB 5L2KD 2IDFA 5EB9A 1T1ZB 1U8JB 4NOBA 2XZQH 1WEJL 4FKHA 1FO0L 4F92B 4AJVA 4PJAF 2I32A 1T20A 1QFPA 2PYFA 3L7EA 2DQGL 1TJXA 3FPYA 4UTBA 1BFVL 3L1GA 2UV3A 3CFEA 3IJHA 3ECVA 3ESUF 2YC1B 3B2VH 4H8HA 3ARGA 4MCZA 4JHWL 5AOLA 5DVPA 5D2LB 4HEPG 3ARDB 4YSTA 3D18A 1V3KA 2ERJB 1RU9H 5I71C 1BQHA 2WLHA 3CFCH 4ODVH 5L4IA 1RXLA 1XAUA 2CXKA 2CALA 2HXAA 2ZCKL 2ZYIA 5I1JH 4ODBD 4QTHA 5AZ2L 4XB7A 5F7DA 1CXLA 2BSEA 3WIIL 3P4MB 3KWVA 2Z8SA 3WAJA 3T8MA 2O93L 3AM8A 5LXVA 5DD5L 4QRTA 5HHOA 1SF3A 2YAQA 3RWFA 2WLYA 3HG1D 4UNIA 2GSIA 1CFSA 5EN2B 1BVOA 5HP5A 5TD4A 3IB4A 4KV5F 5B7MA 1DLFH 3P9MA 4PGDA 1DVFB 2V5TA 4TNVF 1M57B 5ANMB 3REVB 2HKFH 1KCVL 3ES6A 1HE7A 3UJTL 2V8MA 3OSVA 5EMYA 3ZLQC 2KZBA 4CN1A 1UXMA 2X4RA 1PMYA 3LXAA 3OC5A 3P0YL 4X6CA 4HULB 2YSTA 3WJLA 2DM2A 3Q44A 2KT6A 1KCRL 3ERXA 4JEGB 1F6AB 6FABH 3GZQA 3OJVC 4JE0A 4NUJA 1KPUB 1A7PH 1WGVA 4KKLC 2DDQH 4F91B 5DMGD 1CICC 1DDTA 5BZXA 1BFOB 2MKWA 5L0QB 2D3JA 1HDMB 5B39G 5FO8A 4BQCA 4MJ6A 1A1MA 5B3SB 1DHKA 2HTKC 5CGMA 5JPNB 2IDQA 3MKGA 2P4AB 1XGZA 1R24A 3TZVB 3KWUA 1CYXA 3FRPG 3M7OA 4U1KB 2YPKA 4UIMA 2IC2A 1U0QA 1FVDB 4KMLB 4WUUA 4ORZC 2Y9RT 3K8MA 4PRIA 5D2NA 5F7MC 4PCKA 4HA1A 2FNWA 3WFZA 3PY9A 1XGYH 2CIKA 3ARFA 3FUMA 4G6JH 1WBXA 5EU6D 3RLSA 1IQDA 1JZFA 2ZX5A 3DUUA 5D1XC 3IMBA 4AGPA 3DTXB 3SE9H 2Q5BA 1F4XL 4PR5B 5AZEH 5INDB 5DQJB 4E41B 5I0ZA 1AGEB 3C9NB 4ODTH 2AJSH 5IVOA 5CFAA 5CBAA 2JB6A 1WAAF 4XAKE 3K0YA 3QH3B 3N44F 3OR7A 1E28A 3V6OC 5C9JB 1IZJA 5LCVH 3O8XA 2DWXA 4FNPA 2LE9A 5FUZL 3PG2A 5AAWA 3MBEA 3MUZ1 4PTUA 5T33H 4ATWA 1MEXH 3NABH 4L37B 1UTDA 2E5EA 2GW5A 1JZHA 3BXNA 3PWUB 5EEXA 3FB5A 1F4AA 4WKZA 4WRLA 5C07B 3V6FA 2WWMD 3WTWA 4IM8A 3UAAA 1TJIH 3LEXB 3QP3A 4MD0B 5DQ9A 1K9TA 1VDGA 3B6SB 3V4UL 2CMRH 5K9OA 4P59L 4LBAA 1DJZA 3RWDB 1AZVA 4KHXL 3I6GA 3QXVA 3UTZA 4BZ1H 3MXVL 5D1ZC 2CBMA 3FQRB 3MGAA 2X2IA 2QZQA 5CJXC 1J5OL 4QRPA 3SBWA 2QEJA 4YQXL 1U6AL 4Y1AE 4L4JA 4NUGH 5KYXA 5TF1L 4Z7OF 4X50A 5EIQA 2ZPKL 4XN7A 1MRDH 1OY3B 2UWEA 3V4PB 2R2HB 1COBA 1PW3A 3FN9A 1NCOA 1OAQH 2QSCH 4U1NB 4WLCA 1QLEH 3PCYA 1FH5H 3TO4C 3WO4B 1FRGL 4B95C 3BUYA 2OL3H 1FNGB 3MDJA 3QDJE 4XHJD 2PN5A 2W07A 1LO2H 4HSAC 1J05A 4M6ML 5EO0A 3ZQWA 4N2HA 3O3BA 3UPCA 3WFHA 3POCA 2J6EH 2YJLA 3KJ6L 3IDGA 3HW7A 5IFAH 2BZCA 1KDIA 3S3CB 3P2BA 2F7QA 3TO2B 1VCAA 1D6EA 1B2WL 2AXGB 4LU5L 1NBYB 3CHXA 4PY7A 1QO3B 5D7EA 2DQ6A 2OV0A 4LB8A 3QFDB 4KPHH 4PJBB 1S3RA 1J1PL 3QZWA 3UACA 3MRPA 3VDCA 4CBZA 2VAJA 1E27A 1NCGA 1T03L 1OP4A 3KE0A 1GSMA 1AXSB 3BZEA 1SN5A 3D9AH 4Z77B 1OK0A 3RX8A 3V6OA 1BIHA 2FB4L 5LGKA 1SYSA 2WBJD 2YK1L 5DZJA 4PJHA 2BOCA 3UABA 4ETQB 5C8JA 1F13A 2XQBH 3FAWA 3HRZC 4Z5RA 3VGGA 3NRPA 3S36H 3H3KA 3LIZA 3FTXA 2ESVE 1E5CA 1A2YA 5TJWK 5LGHL 1N8ZA 3OKOA 3QDJB 3L5JA 3UZQA 5D6CA 1W0VA 2J1WA 4NXSA 2IOIA 2K70A 3IDXH 2UX6A 3G6JE 1I9RL 1CLYL 3U2SB 3AGVA 2JQZA 4WEBH 5I1CH 1EVTC 4Z7IA 1OQOA 4MA1C 4MJHA 5GZNC 3QUYA 1JDCA 3BSZL 4ZTOL 2K0RA 4K7PY 3IK2A 4ZYKB 3DX7B 4IKNA 1AHMA 2NUTB 4NEHB 3RE0A 2R7EA 2V3FA 2Q8BL 2JKTM 2AQQA 2ZOOA 3FDWA 4TKWA 1FFOA 3DX6A 2G0LA 3O6LL 1O0VA 3TTSA 3V0HA 4KOBA 7PCYA 4YE4H 3DA0A 5DD3L 2VDOB 4CDHA 3E80A 2H26B 1M71A 4XMLH 4HCRH 3VD1A 2Z4QB 4RRPM 1N2RB 4K5NA 1GYCA 5DHYB 3CNKA 1PYWB 2F7OA 3IWUA 2WW8A 3JT0A 3G6JB 1OHZA 3TEYA 3VRJB 2C7UB 2ORBL 4XAWL 1SXBA 3D4ZA 3F62A 2ZYSA 4XCEB 1J0IA 2X70A 3LKRB 3TV8A 2WSKA 3VM5A 3BPLB 4ZUTB 1KCUH 2B77A 1CLOL 2H3NA 2CDGA 4DN3L 2VR6A 4JREB 1MNUH 1X6LA 1PKQA 3MLUH 3RX5A 1NC4D 1E6JL 3O9WD 4YBQC 3QDGA 2OYLA 3Q7JA 3QO0A 1DBMH 5CEXA 1Z9OA 1CWVA 3R19A 1G9EA 1F3JA 1FG9C 3A67L 2CR3A 3QJHA 2P26A 4HEMA 4X9HA 2YZ1A 5H37A 4PGEA 4IGBC 2CXGA 5EBMA 3LZQA 1RIUL 3NCEB 3BN9D 2APVA 1MCOL 1U8KA 3EFOB 3V0WH 4GMTL 1UACH 1NBVL 5LCVA 2R4SH 3PL6C 3BW9B 2NYKA 4C57C 5MENE 15C8H 3IPFA 1AGBA 4HBQA 4YSRA 5C08E 2E8ZA 1HNYA 3IETA 1NPNA 5AL0A 3TBTB 4J3OG 4IQHA 1RZKL 4WUKH 5I30L 4UTBL 3SBPA 5MEOA 4NXKA 3QT2A 5IG7A 4MNQD 2VR9A 1XCTB 1U42A 3MRDA 4BFOA 5A1AA 3QWOA 3IFLL 3F5WA 4FJ6A 4PJGA 5FC9A 1WIPA 3U48A 5AAPA 1BEYL 5EF0A 3CZFB 1JK8A 2VISB 1OARL 3NTCH 4PP1D 4R4BB 43CAB 5DEGA 4AIZA 4BZ1A 5I1KL 4Q9RH 4AENB 4GW4B 4GRWF 2JJWA 3CXDL 5E51A 4V2BA 2AF2A 3B2MA 2EXTA 4NO3A 2JKSA 2K4WA 4POYA 5DTFA 1AQ8A 5ICXB 3FMGH 5FKPB 3B7RL 1T3FB 4UT7H 3SGDI 3P11H 1QR1A 1P7HL 2V7NA 3DGCR 3CXHJ 1LMIA 3QORB 1WFUA 5MENB 4AE0A 3B37A 3HC0B 4Z7UA 4EI6B 1RD6A 3UZEA 4LPXA 1VA9A 1OD7A 5C08B 2V2XB 5BUAA 1CK0L 1E4HA 4LCCB 3U7WL 3RL2B 4YSUA 3IVKA 4JQIH 1U91A 1H19A 3PWPA 3ETSA 4Y4FC 1QUPA 4RGNE 3ZL4H 2ZOLA 2WXRA 2DYSB 4GW5A 1TTUA 3PGCB 4HIIB 5T1LD 5DHVB 4EZJA 3TYGH 2FH6A 3MNMA 4LLYB 3CVHH 2FWOB 4EAEA 2OCJA 5I0DA 4KVPA 4L4TE 1RZIB 4JFDA 5IROC 3Q9PA 4YDZA 2ADIA 3IJ8A 1HHHB 1QP1A 1NEPA 1RUAH 4OB5H 2FO4B 1JN6A 3A6BH 4GSUA 3BPOB 5JORA 2WQ8A 1OSYA 1BQSA 3MRHA 5F7NC 2AXJA 4IGBA 5DR5L 5A43C 3AMLA 3QIWD 2EYSA 2YD1A 1XGTA 1PFCA 3QSKB 4PBDA 3F64A 5D70H 5DEJA 3VMOA 1NSNL 2X53A 1VFAB 5DUMH 2J8UF 3N43B 2AKRA 4HJGB 1DZBA 3NCBB 5E5MA 4BSVB 5HYJA 5IFJB 5F7WC 4ZFFB 3RTLA 2R69H 8FABA 1HQ4A 5HYFA 1AGCB 1K8DB 5DD1L 5ID1A 3IGUA 4HXAH 1XF1A 3FTSA 4MJIB 3RAJH 4NM8L 5IHHA 1LJMA 1WZKA 4OGZA 1GY2A 4IKIA 4YHMH 3VGEA 4DP4X 3FQYA 4JFOB 1K2DA 3PGDA 2I69A 4K3JL 1DSFL 1TLKA 1Z5YD 3PNRB 1A7RL 1RMFL 5F7BA 1MZZA 1CTMA 2DJUA 4MBRA 2AJ3B 1A4AA 1OWRM 4FTDA 1W80A 3TCTA 1KIQA 1ZT1A 4IIZA 4C83A 2N01B 2OAAA 2E6PA 4NJAL 1MHPL 5JXEA 1KV3A 3D85D 2GJZA 3MNWA 1A8JH 3D4GA 2C9AA 3Q1SL 4NO5A 3VU1A 1SHWA 5C0GB 1VLXA 2E27H 5GGVH 2D7TH 2F15A 5IB3A 1XL4A 4L5FL 5KTEH 4IBWA 1ETZA 4HCRA 1TQBC 4EVNA 4WHTB 2FQGA 2EILB 2VC2H 2FBRA 4OJFH 5JDJA 3G5XB 4ZBJA 3ILPA 1JYNA 1HVXA 3TF4A 2JH2A 1SUHA 1UWEH 2D3VA 3QUXA 4PWKA 3D2UD 4KQ4L 5DFAA 4AT6B 4S1RH 1BXXA 2ZWZA 4LT7A 4NHUB 2X0VA 1AZNA 3RWHB 4W6WB 5CLTA 4JKLA 5L2KA 3K1KC 4P3CL 4C59B 1NM9A 5SWQA 1K8IA 4LGRB 1IARB 4LARH 4TXVB 1RZ7L 2K4AA 4HX1B 3LXBA 4MS8D 1PX3A 5IHZA 5C0EB 1CC3A 4HPYL 4R4FL 4LHQB 3Q2WA 3F2LA 5LAXB 3T04D 4N24A 1WJ3A 3ZTCC 2CKBL 3M07A 1KBVA 5HDQH 1GR7A 2E86A 4HIXL 2NTFA 2QMJA 3GMOB 1F11A 2WWOA 3NA4A 1LWRA 3DSNA 2OTUB 3QEGH 4LPYA 2CBQA 4ZFGL 3BAYA 5HJDA 4XPGH 4PVNA 4HBCL 4AI7A 5D93B 4KQ0A 1QFWM 3S35L 1DVSA 3VRLE 4MAYD 3FQWB 3ML9A 2WSPA 4N2EA 3HG1A 1TCRB 5BMFH 4YS4A 1EO7A 3WIFA 5LGJA 1BBJA 3DX8A 3FQNA 2XZQL 2EDHA 3WY1A 3L4XA 4AH2B 2JK5A 3OZ9H 4Z23A 1G1CA 2VUOA 1OZUA 1WF5A 2XG4B 1X5KA 1W16A 4GRLA 5I1DB 5JXAH 1S9XA 3KYKH 5IHUH 5J12C 3B2VL 3VQ2C 2OSWA 2F61A 5CMAB 4FTVE 5C09D 3S3JA 2EVFA 5I76A 3AU0A 2WXNA 3QW9A 4K15A 3S2CA 1RU9L 1YAZA 5C3LD 3ARBC 1XGUA 3CFCL 4GAYB 4ODVL 1RH8A 1FGVH 5IM7B 5I1JL 4F7KA 1OV8A 3MSPA 2P8LA 3C5JA 5H35B 1KYUA 4WI8A 5DEZA 5HHVH 4G80A 1OPGH 4N68A 1BWWA 4ZRGA 1QI5A 1FJ1A 2UXFA 4B9PA 5LNEA 2IMNA 1GGBH 1RUKH 2CPCA 3GIVA 4NQUA 2YEZA 3EYOB 4ZOBA 1E2ZA 4IK6A 4LCVA 4KNUA 4LRNH 3S37H 4BCYA 4BQ8A 2YEVB 1Z9SB 4QHMA 1DLFL 1T7YA 1XXDC 2XTJD 3MMEB 4D7BA 5DMYA 4ECNA 3C2SA 3DDGA 3J2PA 4Y7OC 4ZOAA 2IPUK 2JCCB 5J9PB 3VXRA 1HT6A 2DIEA 1Q9OA 2FE0A 4ZDHB 2GQHA 2HKFL 2OI9B 1HN1A 2JLPA 2WB7A 5D4QA 1QRNE 1TTAA 5EUOE 4PJ5E 2CRZA 4EI5D 1BF8A 4FTVB 3RNQA 3MROA 1AZCA 3H7BB 4J6IA 5C0BE 4PLOB 2AXFA 4UQAA 6FABL 2FO1A 1R3KA 4PVMA 5EU6A 1A7PL 2DDQL 1X5JA 3D50A 1CE1H 1N68A 2QADC 1CGWA 2BVOA 3UTTD 2DQMA 4Q9CA 3ECWA 4ZUWA 4GG8A 2PWDA 3OGOE 5CWSB 3Q13A 1WISA 2PR4H 2MCG1 3G08A 3ZQ9A 2CR0A 4UT9H 3APFA 3BEVA 5AZUA 3NJVA 1ZLSH 3ZTJG 1WZ1H 1CCZA 3PWJB 4PJ6A 2FEEL 3KPRD 2ZNWA 4QXVA 1DQDH 2O5ZH 2VDMH 5DJAB 4NERA 3E2HC 5FUCC 5LO7A 4WWPA 5PCYA 1Q4NX 1QFUH 4LCWA 3CQPA 4AZ8B 2FT8A 2SODB 1QRNB 3EHBC 1GCYA 1OW0A 1UB6A 4U1SA 4OGAC 1XGYL 4E5XA 3NN8B 1U58B 2TRYA 4G6JL 4AX3A 4JKNA 2F0CA 4KJQD 5C0BB 1BVNP 3US9A 3ARBA 4FZ8H 1HNFA 2DYPD 4NENA 4PB9H 6PCYA 1PZ2A 3DJZA 3FRUA 4HIEA 1A7QH 3SE9L 2DH3A 3UGEA 3VXUB 2A6JA 1BMZA 2AFNA 2GCYA 2VQ1B 3FO1B 1VF5C 4G6AC 5AZEL 3UX9B 4EUPH 4PRHB 3PWLB 4PV8A 1KJ2B 3QEUA 4EXPX 1S5IH 3PAYA 1XZ0A 1M7IB 3ESMA 4YK4C 4Y2DB 1WO2A 4ODTL 4CVZA 2AJSL 4POZC 2BRRH 3LN9A 4YEFA 4XMKH 1Q38A 4HKXA 5DVLA 2O26U 4LLDB 3GSWA 4MYWB 4QO1A 4LPUA 1Z9LA 1YA5A 3VVWA 3MJWA 2PPAA 3O41A 3SJVD 3LRGA 1E5AA 5IJKC 5LCVL 1MJ7H 3V5DB 4OCRH 4XO9A 1IGCH 4A7QA 4PJEA 4C58B 3NBNA 2YLKA 4KH2A 1QPPA 3QYCA 5T33L 3F01A 4OZIF 1MEXL 4ELKA 2UY6A 3NABL 3GJFK 3NIDE 4F8TA 1L9TA 2GIYA 2GSGB 3G5YB 4NGHH 2LVEA 1QLRB 4ETYA 3T65B 3TNNB 3ILQC 5C2BH 1KLUA 2X1XR 2RD0A 3HAEB 3QXAB 2J43A 5KSUB 4H20H 1TJIL 4PS4H 5T5NF 1QOKA 1OZTG 2OK0H 4GAFB 1IGFH 1T6VN 2CMRL 2EIZB 3IMRA 4X6FA 4EQ3A 4B0MM 2IWGA 2YD0A 4N3UA 2VR7A 4BZ1L 3HUJF 3II2A 3PWNA 3ARTA 4XI5D 5E2JA 3TOPA 1MREH 2HPTA 1PLCA 4Z7QE 3EYUH 2A6IB 5JUEH 4EI0A 2K6WA 1N3NB 3X11B 2QKIA 2P9RA 1FI8C 2DY2A 4NUGL 5EEVA 4CMHB 4D9QD 2OMWB 1VKXB 1OB1A 4IU3A 1MRDL 4G8FA 5EEZA 1A9VA 1UM6H 3ULVD 4MB3A 3GPSA 5SX5K 1JSYA 2XV0A 3UXFA 1OAQL 2QSCL 1XGRB 3DVNB 3GB7B 4N3TA 1DJWA 1F1GA 1KIPB 1QLEL 1ZS8B 2K6ZA 2X09A 3CFQA 2OMUA 3NIDB 1FH5L 4L3EA 4R2GD 3S4SA 5SWSB 4D0DA 4Y5VC 4JJ5B 2OL3L 1YMMA 3P3SA 5BV7H 4U1IA 1ML0A 1REIA 1LO2L 2YGOA 3HVDA 2CK2A 4G6FB 1GHFH 4JFEE 2Q2EB 2HT2D 2J6EL 2KHAA 5DRXB 5IFAL 1KSRA 3EF4A 1RK0B 4PJ9B 2ATPB 4G1EA 3WTUA 4PCYA 3VI3E 3OJDA 4WQOA 2EKSB 3MLTB 3NACH 5B21A 4MX7A 1EVUA 5DZAA 4KPHL 5JZ7C 3ULUD 3ZDXE 3ZIYA 3CUPB 3H3PH 1LQBC 2MQGA 2NDGA 4JGJA 4LNRA 4U0RC 3OWRA 5AVXB 7CGTA 5J57B 5EC1B 1U3JA 1AGDA 4LHUB 3ZHDA 5IEHB 4G8IB 1XD0A 3P4OA 4QHKJ 3IDMA 1LE5A 1HJCA 1AC0A 2JXMB 2XQBL 3PYCA 3ZYJA 4KTDH 2VERA 4WI2A 3PV6A 3S36L 5E24E 5HVFB 3KLQA 1X4XA 3SSGA 2OP4H 4K5PA 3KBPA 1L9MA 3T6ZA 1N26A 3C6LD 4JFEB 1SMOA 1FNHA 3EJZC 3IDXL 4BFEA 2WQSA 3BQUB 5KVMC 4GAAA 1SOXA 2ICWJ 4WEBL 3VXTA 5I1CL 3MUJA 5GS1A 5E94B 3VI3B 4WF7A 2EDQA 3BZFA 3IE9A 5JIPA 4LQFH 3LH9A 4NZFA 3ZDXB 2AJZA 2X0WA 4H8PA 4TUJA 2AQNA 4UUJB 3LQZA 1C5DB 1AXIB 2AITA 2VNCA 3EBIA 4QUOA 1BJ8A 4HLJA 1G5GA 2BHFA 3BMVA 1G7HA 1OTTC 2R2EB 1NOAA 2BFGA 3C87A 3JV5A 4GB9A 4YE4L 3QUHA 3SPIA 1NC4A 3ZE0F 1WTGT 2X1WL 1AP2A 3ESNA 2Z92A 3IF1A 4XMLL 4HCRL 4UOW0 4UIKH 3V6ZA 4DGYH 1W72B 4XX5A 3CDZA 1AR2A 1T20B 2C3XA 3FS9A 3O6FA 4RQQA 1GRWA 1T1XA 3IJHB 3CFEB 4QAWA 4UT9A 3F7RA 4KK9D 4X0KA 1MELA 2NZ1A 4X6CE 3MNDA 3KR3H 2WQRA 3ARGB 1QZNA 4GXUN 4MCZB 4YLBA 1DANT 4DGWC 3H0TA 3SDCC 5A3ID 3ZE1F 3D18B 4FP8H 5I5IA 3OKMB 4LLQA 1J9TA 4XN8A 5D7HA 4WFHE 1BYPA 3U83A 3NFPB 3AG1B 3NZSA 2P3YA 3BWAA 5F7DB 4LSTH 5E9AA 1KCUL 5BV7C 3HI1A 3UYOD 1HZHH 3E3QE 1MNUL 3GJFH 1JPST 2H4EA 4QRTB 4X99B 5HHOB 3MLUL 3H53A 3RWFB 2ZOUA 2GSIB 5F44A 3WUZA 1AHWC 5F93C 4LVHC 3QNYA 1KYAA 1DBML 2GTWA 3W82A 4WFGE 3WDIA 3P9MB 1G0YR 4PGDB 3QDMA 4O02H 4EUPA 1IMHC 1CO1A 3EYSH 1B0RB 2YD7A 4PBVC 5TF0A 4WUUE 4PMFA 4OVVA 1S9KC 4OJDH 4HISA 4PRIE 5D2NE 2X4RB 4OUOA 4X6CB 3F3HA 2W88A 3V0WL 2WZPA 4KJPD 1UACL 2V5MA 4NN6B 2R4SL 1S9YA 1AZUA 3S97C 5KUMA 4XP6H 5TDNA 3JV4A 15C8L 4AW7A 1NMBH 1T22B 3F7VA 4NUJB 5F71A 4N20A 4XNMA 3GHEH 5SX5H 1ZV5A 2A6KA 3Q6FA 4WUKL 4GAJL 3KLDA 1OGAD 4FXKA 4RDQG 1ZGLP 4MJ6B 1A1MB 5IQ7H 2MCAA 3GIZH 3P73A 1ZV2A 2YD5A 3SOBH 2TSBA 1FDLH 4JCWA 4ICWA 1WA0X 1R24B 4L5FE 2OW6A 3NTCL 3R8BB 4Q9RL 1TPXB 2YPKB 4UIMB 4WUUB 2KPWA 2XA8H 3CDGB 2DTMH 3ZMNA 2UUDK 3FMGL 5D2NB 5FYJE 4UQ3A 3IU3A 3R06B 5KVFH 4UT7L 3D52A 3P11L 1F2QA 1RI8A 1BIIA 2CIKB 3ARFB 3M1BA 4G6MH 4OD3H 2OMBA 2AHIA 1WBXB 5D1QC 1IQDB 4KKLD 4WV1C 2I7SA 3DUUB 2J71A 2AQSA 4HLEA 4BZ2H 2PXYB 4JQIL 4HOMA 3BJLA 3CFNA 4HWNA 1AG0A 2XZAL 3H6AA 3W9EA 3ZL4L 1LL1A 2XICA 1B3JA 1EZVX 4HP5A 4QRPE 1J9CT 4NRZA 1MAKA 3TYGL 4ZMTA 4JM4H 2OM5A 5IEKA 3CVHL 4H0GA 2UWEE 3OR7B 1E28B 4JCLA 1NLBH 1T7ZA 2IPUG 4QHKI 1JZGA 4JFYA 3O8XB 3DARA 1IAIM 2XA3A 1UWXK 2DAVA 1PIGA 2GI7A 3LKSA 3MBEB 4NZUH 4PTUB 1RUAL 4OB5L 4ZOEA 3A6BL 3V7AG 4F7EA 6TAAA 5F9WC 3L3OC 4LCUA 4MDRA 4C56D 5IWLC 3HG3A 3BXNB 1T7WA 4LIQE 2WNGA 5SX4H 2MPAH 3FB5B 5CS7A 5D70L 3V6FB 3D85A 1RJYB 3ZIMA 1HHGA 5DUML 2ICWI 1BJ1H 4J2XA 5DQ9B 2R69L 3FPXA 5K9OB 3UTSA 3Q5OA 3OV6A 1QFWH 1II4E 3I6GB 3UTZB 3MO1A 4HXAL 2R0ZH 3VB9A 3F6JA 2NXZD 3RAJL 3SE8H 1UD4A 2VCOA 3GXTA 4QRPB 4WNQA 4DP5X 4YHML 4NX0A 3DX2A 4Q97A 4Z76B 3RY6C 5ABDE 5JW5A 5KYXB 1W8EA 5KWYC 2IH8A 3V6OE 3D2UA 2UWEB 2P5EA 3GHBH 3WDJA 1IBGH 2CE6A 4PJHE 3STLA 3MTXA 2AERT 4RMTA 3HIZA 1U8NA 3SN6N 1UCTA 3H9YA 2RQEA 3HS0A 2VOTA 2PCXA 2BWIA 3T1FA 2YKLH 3BUYB 4NAQA 4Y16C 2J25A 1JZ3A 4HGWA 4UDTA 2W07B 1WLHA 3EUDA 1J05B 5EO0B 1IM3D 2KQNA 3O3BB 4UMSA 3WFHB 1MWAA 2E27L 3IDGB 2EAEA 1U8CA 4DZ8A 5GGVL 4E9VA 2D7TL 5F3HA 3RWGA 1ZT7A 1OKEA 4HV8A 1H8OA 3NJKA 2J6WA 2XCMC 1D6EB 5KTEL 4PY7B 2VZ1A 4FQQB 2VC2L 3DXAA 4OI9A 5IY5B 4OR1A 2EXYC 3QZWB 4OJFL 3ETBF 3AG4B 3MRPB 1E27B 1ZSHA 4HHGA 3WKQA 2CCWA 1UWEL 1OTSD 2Y6SD 3RIFF 3BZEB 4MAYA 4DPAX 4S1RL 3KPMA 1M4KA 1X4YA 5EG6C 2IVFC 1SYSB 1JZDC 2BOCB 1EAJA 3FFCD 5C8JB 2R8SH 5JIHA 2PKDA 5I73C 2OYKA 3ATBA 3LIUA 3L3OA 2VMFA 4LARL 3IM1A 3HOGA 5IWLA 3WE6A 1N8ZB 3OKOB 4PU2A 1Q0XH 5D6CB 4L2YA 1W0VB 1NC2D 1JFQH 4GKOA 3D08A 1MUJB 1U8PA 1ZEAH 3B9KC 5IMMA 4HFWA 1AD9A 3HG2A 2FHFA 1WT5C 3RL1A 5HDQL 4FYSA 3QUYB 1R3JA 3GS0A 4O02A 1JFHA 3M17B 4ZNCD 2A9AA 1T80A 2VLME 1G9MH 3QEGL 1L0YA 1SHSA 3ZOAA 4B7LA 2R7EB 2VQ4A 4H2AA 4IRJB 4M00A 3DRTA 4XPGL 5GJTH 4EE2A 1R0AH 3N50A 4GBXD 4K5MA 4NFDA 1URLA 4XP9H 1G5AA 5JIKA 3RY6A 1FFOB 1PKQE 2DF3A 3V9FA 1B88A 2F6AA 3OAYK 3UADA 3DX6B 3WKNA 2B3RA 5BMFL 2VDRH 1NJ9A 5CAYB 1TSHA 3RFZC 4IU2A 1U9KA 2XTSA 4G71B 1RK7A 1DQVA 1M71B 1SNRA 1T2XA 3BKYH 4GG6F 3OZ9L 4QAMB 1C7SA 4DO4A 5JXAL 4HEME 4IDLA 3KYKL 2YXWA 3T8XA 4LMQI 5IHUL 1H15B 4ES9A 4WI4A 2Y2WA 2VM4A 3PU7A 1JL8A 3VGAB 1FVCA 2VQTA 3OGCA 2JB5H 2MNWA 1CTNA 4EI5A 5IVNA 1MW1A 4M6OH 4HIQA 5GZND 3ZO0A 1IB5A 4JG0H 3U36A 2VN6A 4UTCA 5DD6A 3CVBA 3CSYA 1HTYA 1FGVL 4B9JA 4Z3FA 1HWHB 2WKLA 4DEWA 3D51A 5HHVL 1GYUA 5B3JE 1OPGL 4ANUA 2H3NB 1UWXH 1H3GA 3KBFA 2CDGB 5F88B 1NAKH 1GGBL 1KDJA 2AQRA 3IDUA 3UIZA 1RUKL 1MH5B 3OZKA 1PKQB 3GUTB 3KPQA 4J3OD 2F1AA 2F08A 2YUVA 4I1NB 3FJTA 4LRNL 1BBDH 4PJGE 4PRPB 4XBGA 3W9DA 4L1DA 3MGOB 4W81A 3QDGB 4OF5A 4BUHA 3QO0B 3KPRA 5CEXB 3QRFM 2MKLC 3AAZB 5E5UB 4QF1A 1QBBA 1F3JB 2VSMB 1NIAA 3QJHB 3FB7A 4L3FA 4EZMA 4S0HA 5EBMB 1T83C 1MAMH 4DKTA 3A0OA 1K5NA 1U8KB 3D06A 3H6JA 1RJZA 5H4YA 1U8LA 1AQKH 3RP1A 2D7PA 1WT5A 3FSOA 4M4PA 5E8EA 5BQDA 2QVKA 4CW1A 4HGKC 1UH4A 2J73A 5DFVC 2DYPA 3II3A 4Z7UE 2ARJB 2BIMA 4FJZA 1CE1L 1H3PH 3VXMA 4HJUA 3HE7D 3ZE2E 3IETB 4NO0D 5EIVA 3AFLA 4GUOA 2PR4L 1S7XA 4MJ4A 2WV3A 5LNDA 2V37A 3DUHA 4JL1A 5CEZD 2DWEA 2FUQA 4UT9L 5E8OA 5IG7B 4NNPH 2E9JA 3MRDB 4NBYB 1ZLSL 1J1OH 1WZ1L 4AQZA 2AMGA 2EYRA 3BZ4A 3F5WB 4PJGB 3GMQA 3LJ3A 3NIFB 4H1LH 4JFDE 3RFZA 1DQDL 2O5ZL 2VDML 1NGYA 4OIBA 5AB9A 5BCAA 4Y2NA 4Y4KC 2IADA 1G9MC 4FCHA 3QWQB 1JZJA 4NO3B 3IGLA 4HJEA 3SCMC 4N8PA 1MDAA 4PM1A 2FIRT 4LOUC 3PL6D 4RGOH 1QR1B 2WZ5A 3SDDC 4FZ8L 5HYJE 2XETA 4PB9L 3P3UA 1HEJC 1A7QL 1ONQA 4Z7UB 2FR4A 3EZJB 4DTGH 1D2PA 2VABA 4PRBA 4S0SD 4JPKH 3IVKB 2WQVA 1S5IL 1U91B 5AW2B 5I8CA 3PWPB 3CXHK 2X4QA 2UZXA 4JO4H 2ZOLB 2BRRL 2SEBB 4GW5B 4Z3IA 4XMKL 2G2PA 4BE5A 4OVUA 5D7JB 4CILA 1MJ7L 2BS9A 4OCRL 1IGCL 4MD4A 4JFDB 4U6HA 2ADIB 2W38A 3BGFB 3SPJA 2ZAGA 1LK3H 4A2GA 1JN6B 2A74A 1UM4H 4NGHL 5I17A 5JYLA 3GBNH 3UPRA 3PJNA 1YY8A 3MRHB 3FCBA 4IGBB 1P7QD 4YC2B 5IBUB 5C2BL 3NRFA 2EYSB 4PS4L 2A4CA 3DJRA 2OK0L 2AKRB 3NZ8A 1IGFL 5E5MB 5HYIA 2GHWB 5HYJB 3BMWA 1MCKA 1SJEB 4KI5D 4JR9H 5FGSA 2EE2A 3ZX1A 2XV6B 3OAYH 2UZPA 4P4RB 1WFNA 1CI3M 1HQ4B 4FQPA 4I87A 2XWDA 3ULUF 5ID1B 2BCKA 1MREL 5I0WA 1HL9A 3EYUL 3NJIA 5EFIB 4WWKC 5JUEL 3RKDD 3HNSH 2QPEB 5JIIA 5L9DH 1YNLH 1UM6L 2NR6D 1CI5A 1K2DB 1EERB 2NY4B 3N55A 4KKRA 1BPLB 3ZYOA 1EJ8A 1FA4A 2Z31C 4KZCA 5L2KE 4YL9A 4HK3J 5I1AA 1S7UA 1SJVA 4N5ED 4Y4KA 4AEFA 4FA6A 1G1OA 1ZT1B 2KBGA 4C83B 2X28A 5BV7L 1ES0A 2ENQA 3SCMA 4TVUA 4HALA 1GHFL 4OLVH 2XRAH 1EBPA 4NO5B 1JV5B 4XVUC 5BQ7A 4YDVB 4ABQA 4EQ2A 3SDDA 2HRLA 2WYZA 2X89A 3GLEA 3NACL 1ETZB 3C8HA 4HWEH 4PLKC 3H3PL 2WLLA 4V33A 3CBKB 3ILPB 1SDDB 4C4KO 3P30H 3E6HB 5GHWH 3QUXB 3L95