4ZMWA

Crystal structure of human p-cadherin (enc-x-dimer)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
213
structure length
213
Chain Sequence
DWVVAPISVPENGKGPFPQRLVQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Adhesive Dimerization of Human P-Cadherin Catalyzed by a Chaperone-like Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Cadherin-3
total genus 49
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zmwA01
3LNFA 3LNHA 2O72A 2QVIA 3Q2WA 4AQ8A 3Q2VA 2WBXA 5KJ4A 1O6SB 4AK1A 2QVFB 3K5RA 2EE0A 4APXB 1SUHA 3MVSA 4ZMOA 2X2UA 4ZT1A 3UBHA 1NCHA 2OMUB 3QRBA 1WUZA 4XXWC 4AQEA 3LNEA 4NUPA 1NCJA 5CO1A 4AQAA 3LNGA 4ZMPA 3LNIA 2WHVA 5JYMA 1NCGA 2YSTA 4AQ8C 2YQGA 3Q2NA 3UBFA 5JYLA 2OMWB 2OMYB 4ZMYA 1ZVNA 4AQEB 3LNDA 4ZTEA 2WD0A 2OMTB 4ZMQA 2A4EA 4ZMWA 1WYJA 1ZXKA 3FF7A 2V37A 4ZMZA 2OMZB 4APXA 3K6DA 4QD2E 4ZMTA 4ZMNA 4NQQA 5CZRA 5DZVA 4ZMLA 1OP4A 3FF8A 4ZMVA 4OY9A 4NUMA 1EDHA 4AXWA 3Q2LA 3PPEA 4ZI8A 4NUQA 3K6FA 1NCIA 1Q1PA 3K6IA 2OMXB 1FF5A 1L3WA 2WCPA 4AQAB 4XXWA 3UBGA 4AXWB 4ZMXA 3K5SA 2OMVB 2A4CA
chains in the Genus database with same CATH superfamily
5FDYA 2R4RH 3QDGE 5ECJE 3FH7A 3WNIA 2L8AA 3Q48A 5KYXA 5C09D 4FCHA 2B8OT 2CE6A 4UNVA 1LE5A 5E24E 4DSYA 3D52A 5HHNB 2X6AA 1D9KC 4S1QH 5C9JB 3IU3A 3D0VA 5HDRA 4J6RL 1KGUA 2QSVA 5IY5B 4HHAA 4KI5C 5IFJB 5TTRA 3AAZB 2G9KA 5AVWB 1BLIA 4BFJA 2JXMB 4UINL 1N26A 4WEEA 1I3RB 3MNZA 1XCTA 2DWTA 4AG4L 3GZPA 4D0DB 1ZVSA 1JZDC 3CU7A 4P2QA 3OQ3B 4NQDE 4ANXA 3E6HB 3MOAL 2B1OA 1IBGL 3FSVA 2QMJA 1UB5A 4Z95H 4H8HA 4UIKH 1TT6A 2V3FA 5GSVB 3O3BA 1G9MC 4NP9A 5D4IA 4FX5A 5I8KL 2IAMC 1YEHH 2W65A 2KL6A 3BPCB 4QAMB 3QAZB 5D4JA 1KGXA 4P9MH 2IPTH 4PGDB 1BYPA 2BOCA 2OR8A 3P4NB 4YAQB 3OKOA 5EF2A 1HZLA 3CV5A 4XPTH 5IJVB 1TJIL 4NP4L 5E9DD 1EZLA 3TBWA 5DDHB 3NESA 4L37B 4WCYL 2NW3B 3SE3C 2QZQA 4LCWA 3VFPA 4LSDA 4H1LH 1MN4A 1JL8A 3LHPL 3QPKA 5D1QD 5GS3A 3RAJL 4OZGF 1U41A 1ES0B 4WI4A 3E7JA 2IANB 4K23H 5IMLA 2X2YA 4AEHL 1Z1WA 1BZ7B 1R19A 1OT4A 2D7TL 4NZFA 4F7TA 2G9HA 5BMFH 4GAJL 3MYZA 4B53A 4BSJA 5FOBA 3QORA 1LO4H 4L4TE 4D8PB 4L4TD 3EYOA 4L3CB 4YE4H 1RZ8B 2GTWA 3CGTA 4XH2B 3VXMA 1OARH 4OCWH 1AOZA 1U91A 3V9FA 4HLZH 4UM9B 1J0HA 4JN2B 4PV8A 5JHDE 1OSEA 2BSRB 4EQ2A 1OCCB 1LTXA 1M05A 2Y5QA 5FCSH 4HUNB 2ICWJ 3ZDZE 2PW2A 3S97C 4ZXBD 4NKOB 2OP4L 2X7LB 3QFJB 2ID5A 4OSUL 1CXLA 3QRLA 1YC7A 4DVBB 4XX1E 2AJ3B 3AABA 1BIHA 5DMGD 2MQCA 3OWRA 4HJ0D 4N0RA 1U92B 2JCWA 3VFPB 3QDGB 3Q1SH 4WFGE 5FFLA 4LPUA 1WUNT 3UJIH 3P4OB 5EORH 4NQEB 3B9KB 3GMRB 1NC4D 4DGUA 3WTYA 1KUMA 3LZPA 4KGLA 3GRWL 3DX7B 1QPXA 3M8OH 4YO0B 4QHLA 3VM5A 5CJQL 4G6MH 3WV0A 2DLHA 1JGUH 2OTWA 3F12B 1QLFA 3BLPX 2XN1A 3LZFL 2WUBH 5KS9E 2ALWA 3MV9E 4DP5X 4JGNA 3BH9B 1HK6A 3OB0H 1R46A 1BEYH 3O3BB 2OK0L 2XZCH 2NUTA 5C09E 4Y16D 1GMEA 1PKQE 1A6AB 3V8OA 5AYQA 3SDXA 2Q3ZA 4B9YA 1RIHL 4HJTA 5DUBA 2IH3B 4JQXC 5E2TH 5HGHB 1WRFA 1SGKA 3QUKA 4ZJ9A 3CPUA 5K9QI 2PTTB 4HGWB 1TZAA 1LWJA 1O9VA 3K80A 4MA1B 4Q9RH 3EGXA 1BM7A 3MBXL 3GXDA 2B15A 3AU1B 5IFJA 4XPHH 1O7SA 2PMZA 5LBSH 2Y3NA 1NEPA 3CFBA 1CR9H 3X12A 1N64H 1HHIB 1TEGA 1IBBA 3MA9H 5IW1A 3G6DL 3QXVA 4ATWA 2VLKE 3MCKB 3C09C 5GS0D 4M61A 3P4LA 4KQ3H 4DKTA 1LE5B 3MLTA 5J6HB 2YKLL 4KFMA 2CGZA 2VDNH 4HKJA 2D2CC 3B43A 2Z34A 4Y4KB 1UH2A 43C9B 1M2VA 3VXOB 4UF7C 5G5DB 2WLYA 1M2OA 4OQTL 3E2HB 4U1GB 1U8JA 1ECZA 1DQMH 2VC2H 4JY4B 4MS8D 2WGXA 4OV6F 3PV6A 4DO6A 1O5DT 2YXFA 4YPGA 3A4AA 4Z7WF 1TEFA 2BY0A 3GD1C 3P9LA 5SWZB 2WYHA 2AXHA 3OPUA 4YFEA 1SRDA 1A6AA 1H5BA 4U3HA 4N0FA 2ESVB 2IPUG 4LLQA 5I5IA 2A74A 4PRHB 3VFUB 4Y2DA 1SYVB 1SYSA 4WFHD 3V4VL 2GI7A 3QJFA 3ABGA 3SQOH 4PRID 5L2JA 4GRWB 5KSBE 5T1LD 2LVCA 1F58H 4QDGA 4F3FA 5AB2A 3IU3B 4M93C 4TNVF 1HZHH 3TN0C 1FA4A 3ZDXE 3GFUA 5CGYC 2C7UB 2W95A 5DYFA 2BINA 3DX7A 5BOJA 3BSZL 1D2OA 1MQ8A 2Z91B 4WWKA 3RZWA 4GW4A 1RK7A 4FG6D 4YVUA 4QGTA 1U6AL 4WNQB 4EEEA 1CE1H 2VIRB 4EKJA 4C56E 4QRTA 5KVDL 5KVGH 2X2HA 3BEVB 3ALWA 4GS7C 2VQ1B 2G3NA 4DVBA 3BWZA 4C83A 3LMJH 2CDFA 1G6RL 3A6BH 4UV7L 4XMKH 4AW7A 3FQTA 1UWGL 1S3RA 3BT2L 4S1DC 2WYIA 1NUGA 3O2WH 3WMSA 2VN3A 4GSXA 3N1GC 4JM2C 1NWOA 5DXWA 3FT0A 3GM0A 3NEOA 5DUMH 4L8BB 4XOAA 2DLEA 5EUOF 1ZLSL 2VDPB 1UM4L 5DQJB 3H7LA 4V2CB 4FMVA 1BFTA 3I9GH 3O3EB 4CC4C 3IKCA 1KGCE 1L9NA 3CQFA 3WFDL 3ZRFC 1MREL 1AHWB 3GNML 1X4ZA 2YAPA 3BP7A 4EOWL 1MFCL 1L0XA 3FCSB 4HEMA 2I9LB 2QZ5A 2VXSL 3CPLA 3BDYH 3EO9H 2GJ6A 1KC5L 1KGWA 2PYFA 3GXFA 4IHBA 4JKKA 4EDWL 4KI5E 3T77B 5MENE 3L6FB 1Q94A 1F2QA 3ZY7A 3MJ7B 3ZSSA 2F58L 4FE9A 1KJVB 3WFEH 1WICA 4HX1A 2GY7B 1ZGLP 1QUNA 3ARFD 3MC0A 3QARA 3RDTB 2VZ3A 4M8QA 4P5TA 5LLIC 3VRJA 4ELMF 3KHQA 1J1OL 1J05B 1WBZB 3BQUC 1TF4A 2E9GA 1Z3GL 3OKOB 3OF6A 4LU5H 4XOBA 2VDNB 4PRBA 4U3XA 4XO8A 3BAWA 3EJJX 3WKYA 3S8WA 4OU3A 1E2ZA 1Z3GH 5AOMA 4F15C 1B0RB 1P2CA 2OS7A 2P24A 1A1NA 3OKYA 5KVDE 1E43A 2H2PD 4BA0A 1F11B 2YAHA 3BSZA 4XZUB 3V0WL 5B8CB 5GIRB 4H1LB 5MI0B 2OYPA 2NMSA 3WSQL 4FTDA 2ZYSA 3RTQA 2C8NA 4WHTB 3ARZA 3ZJAA 3WENA 2RCSL 4Z7WE 1FZKB 1N67A 2NY4C 3FH8A 2V2WA 4CGTA 2P5WA 1H3XA 1YNLL 1J9SA 5EZPA 4I88A 5I23A 2XN9A 3QUGA 3DURA 2YXWA 1OL0A 4KXZI 1JHKH 4JHZA 1WZ1L 2VDRB 3KEHA 3KPRB 3FCTB 1JZEA 1NFAA 3WJJC 4GRLC 2GC4C 3C5JB 1FVEA 1R5WB 3KJ6H 2QBWA 2V8LA 5DF0A 1MHCA 4PBVC 4PWGA 4Z7WB 3UIYA 4JY5H 4O58L 2OCFD 1AO7B 1OXYA 3QNXA 1XIWD 5TDPB 4ZTOL 2MNUA 3IN2A 2AGJL 2L7UA 3P02A 3BT2H 5FKAB 2UXGA 3CX5K 1HSBA 3LPWA 3HG4A 5E8DL 3LMJL 3U4EA 3DUHA 4U1MB 2HPTA 1IZKA 2AK4D 4N2GA 1R1CA 2JF1A 3L9EA 4Z7UF 3HAEH 3BXNB 4MJID 3B34A 2P45B 3MLRH 1IGML 1TYJA 3HN3A 5DT1H 2GQHA 1F3RB 2AMGA 3ARBA 2VDQB 1WFNA 4R7DB 2DIJA 1NUFA 3PJSB 4PJ9A 3VG9C 2ICWA 1HESA 2M26A 5AVYB 2MTPA 1A6VL 2QJDA 4JM4H 4KDWA 2B0SL 2R23A 3ZTCC 3PWVA 12E8L 2GIMA 3B7RL 4N2AA 4ZO8A 5EFIA 1N6QH 3PS6A 4NKIH 4M1GL 3BEVA 3L5IA 2A4EA 4FF9A 3SJVD 1S7SB 4X7SL 3SKMB 2J44A 3V4VH 3D39D 1SMOA 2Q20A 2YGNA 4KY1L 1U93A 3G5VA 4RRPM 4QRPB 3HB3C 5EU6A 1QI4A 3QPQC 1XMWA 4I4WB 3RX8A 4P2OB 1FLTX 1IKFL 1IAMA 2Y07L 4FKEA 5DWPA 4DN4L 1XGQA 1S9VB 4DP1X 2DQUH 2FQEA 4S1RH 2J73A 1JPTL 3BQUB 3VO0A 4MJ4A 4WY7L 3CN0A 4LPCA 2AF2A 3VXUE 4JLRB 1OGTB 3LS4L 2DQJH 2H1PL 4MJIA 4XNXL 5JORB 1SYSB 1SYVA 3G6JB 4NLHA 1DQIA 3FTGA 1ONQA 5DC4B 2AJVL 2CSPA 5GS2H 3UTQA 4BWTA 5A43C 4YGVB 2YMXH 2L0DA 1C1EH 4ZAKC 3IDYC 1EGJA 4A2GA 5AALA 2GK0B 3LKQB 5T1DL 1VPOL 3B9DA 1TTRA 5D1ZA 5CF3A 5FCUH 4LLAA 4OI7A 1K4DA 3QXDA 4Z7UA 1KNOB 5I26A 3FRPB 4OQ1A 2FBJH 4V1DD 2VR6A 3SKUD 4EZKA 5JORA 3NJMA 4G7YH 3JXAA 4LDCA 5CSBA 4X4YA 4KKCC 2LVEA 2V17H 4YLBA 3DKHA 1BQSA 3S4SB 3VA2C 1G7HB 3V4LA 3ZE2E 4FQ2L 4JO1L 4LVNC 2H0JA 4QJ4B 2QDWA 4QXWA 1J1PH 5D6CB 4L3EE 4FGMA 5AYUL 3WUWA 4ETYA 3D25B 4OZGE 5IWLC 3CFKA 2N1KA 4CVUA 3MRNA 1HILA 4B9KC 1R5IB 4XMLH 1E5UI 1E4KC 1QX1A 5EU5A 4JZJC 3OMZA 3LZFH 3QUMB 1CFNB 2JH2A 4KMQA 1WV7T 5CGTA 4G6ML 4HIHB 5CJQH 3OPZH 5KSVB 1AQ8A 3FUMA 1IQDB 2ZNXA 2DM3A 3DVGA 4DFIA 5H37A 1QFWH 2WXFA 1L3NA 3BUIA 5CBEB 4X83A 1A1OB 2J12B 2ZF9A 3MOQA 4HFWB 4AGNA 2FO4B 4PP2B 4L0ZA 1AR1C 2EIBA 2FGWH 1AGCB 4N2MA 4H25B 4F27A 4WI0B 3M1CA 4RAVA 4AOFA 1BYNA 2TSAA 2OPCA 1TU2A 3FUKA 5GGRB 3WY4A 3TZVC 4ELDA 4QJ5B 3IJSA 2MIZA 4M5TA 2E5EA 4HUXB 3GSVB 4N6RA 5EU4A 3EGDA 1VACB 3ZKQD 3BUPA 4N8VA 4TUKL 3TO4A 5BV7L 5IMOA 1VCBC 2WYTA 3EOBB 3MCYA 1ID2A 2WZ5A 4RGMC 3BI9X 3EYQD 5GGTL 3ZL2A 1GJIA 2VE6A 3CFCH 1IB5A 2D3JA 2AAVA 5B38G 4ZMLA 4PRAA 3B3IA 4V1DA 4LHUD 3F7YA 5EOTB 1MHCB 2AJ3A 3B2XA 1UD8A 3HE6D 3EGSB 4TSBL 1OLLA 3P9WB 3ZTJH 3FO1A 4NUMA 4WW1B 3OV6A 2OYLA 2Y2WA 3US0A 3JV0A 4UT6L 3DURB 4BH7A 3FQUA 2J5WA 4KQ0A 4Y5YC 4ZTOH 3FU9A 4PWIA 3BN9D 1V55B 3QIWC 5E8OA 5EUKB 3V6FB 3QFJE 3VH8G 2HFFB 2FT7A 5FW7A 4U2ZA 3RUGB 4L1HA 4HD5A 1QBLH 4YIQA 1B2WH 3SB3A 4YC2C 3VE0B 3RL2B 2ZX6A 3B7YA 1A6ZA 3G08B 4WHYG 2Q3AA 4KTYA 4X5XA 3HE7D 1FI8C 4MXQD 4J3OH 2MCPH 1JV2A 4OT1L 1SJEA 4HBCL 1NC2D 4XNZB 2YEVB 2X40A 4YDKH 4TQIA 3LY6A 1T1WA 2YAFA 4WTZG 1CGTA 3W11C 4L8SA 1D9KA 1TVBB 2VLJD 3MRKB 5MEND 2FYVA 1EDQA 3REVA 3CFEB 4ELMA 1AXSB 1D5ZB 5CEXA 1KTLB 3UOAB 1I9RH 1I8AA 4GKZB 3CQPA 5DO8A 4H0GA 3UAFA 2BFVL 1A6UH 4Q6YA 2HSIA 1LEIA 1ASQA 4YXKL 5F0LB 2OZNA 2D3LA 3IKKA 1V8HA 4GI9A 4X7TA 4Z3EA 2A83A 1RULH 3NJJA 2OW6A 2XI9A 4PMFA 4MQXD 1IAKB 1UWFA 3BP7B 4QOKE 1HKFA 2ZOUA 3LNEA 5EC1B 4BE6A 3BIKA 1KXTB 1ADWA 4QHMB 2DMKA 1B4RA 3C5ZC 1X9RA 1J1XH 4A2MA 3FMGL 1J1PL 4YHIA 1UCBL 3U4KA 1R3KB 3BLKA 3ECVA 5FKPA 3PABB 2VSCA 4WTZA 5TGBA 4LF3B 1K8DB 1WPCA 1KC5H 2JJSA 3BAYA 2EADA 3BN3B 3DPDA 3MRJA 4N86A 3DHUA 2C3WA 3LEXB 1T4KA 1BQHA 1IAII 4K3GA 5IHUH 3K6SB 5F7NC 2OBGA 1I1FA 1R17A 4E9YA 2OAAA 4L0YA 4YHPB 1QI5A 5C9JA 3SGJA 4OCYL 2J1ZA 1G7JA 4XO4A 3C8HA 1ZHBA 1Y6MR 3FFCE 1BDYA 2D7NA 2VIRA 1AGFB 4BFGA 4Y2DC 2Y9RT 4LLMB 5DS8B 5C07A 1TJMA 4Z76B 2FEEI 4NKQB 1KXVC 2O61A 2YMXL 1VSCA 3I3EA 4PI2A 2BVEA 2X3AA 3KBEA 4BKLB 5BVJA 4MMYA 3IDMA 1NGQH 1NFIA 4F2MB 4IIZA 2HTKC 1T22A 4F3FB 2UY6B 3TIEB 1NEZG 4HYTB 2J20A 2B2XH 1T5WB 1HINL 2FYYA 3SGKC 3NH7H 4IOIA 3ETSA 4LIQE 1G6RB 3OG6B 1OF0A 1SDAB 3CAFA 5FF6A 3IVKB 3C6EA 3UFIA 4F58H 3GSWB 3BKCL 4WJ5B 4PGBB 2QADC 5HJ3B 1QTSA 3GMNB 5KZCD 5FO8A 4ONHB 1CE6A 1D5IH 1JGDA 5DD0H 1H5BB 3BUYB 1H3PL 1ZDSA 2YBRA 3ATEA 4X9HA 5J1AB 2F8IA 5KVFH 1OP5H 3UBGA 5AOZA 4KQ4L 1HYRC 3RGHA 1OIOA 4KNTA 2AK4A 4YPGB 4U6HB 1Y18A 4NO3B 3PQYA 3CVCA 4XMTA 4I3SH 3CZNA 4WFFE 4LB8A 3SDAC 1RUPH 2Y72A 3LVTA 3Q5TA 4W6YB 5J13B 5A2BA 3NABL 1UFGA 4KTEL 5G4OA 3V5KA 3JSSA 3KPRE 4HIPA 1COBA 5D2LB 4D3CL 4MA8L 2D03L 5KBLA 4ZOCA 3IBOA 2DQFA 2XY1A 1N59B 1UXSA 2BSDA 5E9DE 1G7JB 4K3EH 3NTCH 3U4AA 3MLVL 3B9VA 4WWOA 2WO3B 3MAWA 3KPRA 4A55A 3T0VA 3AU1A 2R29H 4KGJA 4PH8A 1WCBA 4HU8A 1QLEH 1VJSA 3GXNA 1FBIH 2CQVA 3P0GB 4GXVH 3JWDC 4LSVL 3WFCH 3EJPA 1KJ2B 4PCSA 3DMMD 1WIUA 2AXJA 5FFGA 1HIMH 3NYKA 4WO4D 4HSAC 3FYIB 4OJDH 5AUMA 3IGKA 3MRPA 4M7KH 4YHZH 3FONA 4OLYL 5HHOD 3WTUA 4I0PB 5I1AA 1QSFE 4ZUTA 5I66A 5BXFB 5J8OA 1IAKA 2WM0A 4U1HA 5GZOC 4G80B 5D72H 3P1VA 4XO5A 3VXTB 4M62L 5DCCA 2EABA 1H6UA 2H47C 4Q56A 5E99L 1FPTL 5I15H 4XC1H 2X89A 5CSZA 5I74B 1RIHH 2FX8H 5BVPH 4B9CA 2OCCB 5EZLB 4FP8H 1VRSA 2F5BL 2JCCF 4M43H 5CILH 4DTGH 1PZ3A 4I3RH 3AUWB 1FFPB 5DFVD 3NN8B 2F53E 3P4OA 1S5HB 1RIVL 3QNYA 1E5YA 1PMYA 3DSFL 1VEOA 5TQ0H 5D1QB 1BEYL 2C4FT 3SKJH 1QPKA 2W07B 1OAKH 3CC5A 5HGGS 1NC2B 3P54A 4Y8AA 2NDFA 5JHDD 2A99A 4P2QE 5BQ7B 4MCZA 3ECBA 2EIMB 3NSFA 3PPEA 1Z3RA 1TCRB 1J1OH 3TO2A 1ZGLM 1JNNL 1D6VL 1RHHA 3AW5A 4YZFE 4DPBX 2R2HA 4WV1A 2W88A 1BOYA 1B4LA 2BSRA 2MNWA 3GKWL 3L54A 5LO7A 2F58H 1NCIA 4PJXA 4AVHA 2QFPA 4MD5A 1XD1A 4UM8A 3OHXC 2O30A 5DO2C 1JFQH 3VXMB 5L2KD 5ILTL 1KCLA 3NRPA 3B56A 1BGXH 4JFDE 4KRPB 4LNRB 1V7MH 4GXUM 4LCVA 4AIOA 5K9JH 2UWEA 3ZE1F 3GSUB 1W8NA 4GO6B 1E9OB 5CJ8A 1NMAH 3GNMH 1GVIA 2OX5B 3MQIA 2IANA 3I9AA 2TRHA 1TZGL 1IJNA 4MMZB 1ORQB 5FUOL 4IJ3C 5JPMC 4OV5B 1YLBB 3F58H 3NACL 1UKSA 3ARBC 4MD0A 4MAYA 2VDOB 4QHKJ 1A9EB 3VJ6A 4L5FL 2DLFH 4YFDB 3H9SE 4ZBJA 1JD9A 3P11L 3WNPA 1TQUA 4BV1A 1IGIH 4EI5A 4Q6IC 5ESQA 1BHGA 4YOKA 2Y1ZA 5SX4I 2L7JA 5C92A 2J8UA 5AVZB 1Y0LB 2PO6B 4O2EB 2WXLA 3S5LA 2ZX9A 3MHZA 1QNZL 1AY1L 2IH9A 4GUPB 2QTVA 1JWMB 4NO2A 1H3GA 5F1NA 2HB0A 1MAKA 4N8VG 2LTQB 4OUUB 3PU7A 3B2VH 4JHUA 3QJFB 2E27L 1CLYL 2UY7A 1KJ2H 3NJGA 3SDDD 4ES8A 3EXJA 5IJDC 4OZIA 1JHLL 1HS6A 3F62A 3MACL 1WVZA 3IM1A 1TR7A 1KELH 4RGOH 4D9RE 3LEVL 4MXWL 1T1XB 3PHQA 5DLLA 5TDOB 2ESVA 3GIZH 5F88B 2F19H 2DV6A 3E6HA 4BHUI 1TZHA 3T3ME 1ET5A 5CBAB 1Q72H 1A6WL 4PWJA 1NMBL 1YEFH 1FH2A 4GAFB 4YXHH 3WJMB 3M1BA 4UYQA 1TYRA 5E7BA 5ESAB 2BWQA 1HSAA 2LU7A 2Y5EA 3MUHL 4APQC 5IW6A 1Z5LA 2NTFB 3QULB 1QBBA 4IBUA 4PN6A 3RVWC 3SQOL 2EE6A 3JV4B 2YR3A 4GMTL 2XRAH 2BSBA 3BQUA 3ESNA 3ZO0A 5JA8B 1YPZB 3MN8A 3MRDA 4F2EA 3D30A 2ITDB 3MCKA 3WEBA 1PD0A 2B4CL 2HX9A 2KZKA 1ZV5A 4IKJA 3DV4B 4TSCH 2CO7A 4LDEB 5D7IF 3D2TA 3U4BL 2VZSA 1EFXD 1FFTB 2O4EA 2VM9A 1S7SA 4L5FE 1NEZA 1ZTXH 3M6DA 4LK4A 2AKRB 1JNJA 3CVIL 1WBYB 2IGTA 3O11A 3HC3H 4JQVA 3TWCL 4I1RA 4O02A 4X6EB 2V9QA 2AJXL 3H2PA 3OZLA 5JXAH 3IWUA 5EEXA 5EO9A 5HGHA 3SDDC 1GH7A 5T1LB 3SO3B 2R23B 4G11A 1OM3H 1Q0XH 1MCPL 3O3AA 3FKUS 2GJ6D 3NJFA 3VDAA 2HVKA 4OLZL 3Q13A 5GGVH 1LHZA 1C5CL 1UD6A 1WS7A 2I9TB 4GRWF 1YEKH 2B20A 3NSXA 1OAUH 3Q6GH 3WJJA 3TU6A 5KAQF 4Y4HC 1KFGA 4POYA 3MBXH 2R1XB 3LPOA 5LQBH 2PWHA 2E8YA 1F4WH 3GRBA 3K5SA 4CN1A 3B4NA 1A25A 4Q74A 4G6JH 4QRUB 2FCBA 2NY7H 5E2TL 1ZA3A 2EVGA 3T0EB 1XGQB 2ZUQB 1YY8A 2TRYA 3FT9A 3NCEB 4ZW5A 2MCMA 1MCOH 1CU4H 3TYFB 2IH1A 3VXSA 4ZUSB 3QO1A 1RKRA 2XZCL 3SGEH 4QHUB 3AG2B 2YD6A 2BSSA 1RV6X 4FHBD 4TVPE 5EN2A 4TRPL 5HDQH 1RUQL 4PV1C 4CC0A 5J6SA 3BJ91 1SHXA 1XDTT 1IU1A 5L8KB 2ARJQ 1Q9LB 2NQCA 3EDEA 4UU9A 4G7VH 4XODA 4CVZB 1MXGA 2NZ1A 1BOGA 3FFCB 3WHE0 1BF5A 1MQKH 1WF5A 4N9GA 5E4IA 1AQMA 1ZT7B 3V79C 4Z78A 3BMWA 4XVOA 5J1TC 3M8OL 2Q76B 2A7BA 2VH5H 3A22A 3DRQA 2D3NA 1QHOA 4JG9A 5AVUB 3DO7A 3I75A 3IMTA 1J12A 4UQAA 3WTTA 3AGWA 5JTWA 5HI3C 1JWSA 2E9IA 3U1SH 3DV6B 1R3LA 2SODB 1MCDA 4KOCA 2Z31C 3CFTA 2WTRA 2L7QA 5IF0A 2HPOA 4PJ5B 2NQ3A 3TX4A 5DRNB 1F3DJ 3PXLA 1Z9OA 3FT3A 2XWRA 4JO4H 3VXSD 5IBTL 4ZMWA 3T0ED 3QNXB 4AEIL 3CFDA 1CB4A 1N70A 3OR6A 3QDME 3P73A 2AC0A 4NM8H 2X6CA 2J2ZA 3PRZA 5JNYA 4JS7A 1WHOA 4DZBB 5JDSB 3Q01A 3HHMA 3ZDXB 1UZ8B 2BLFA 4F9PC 1KJVA 2XN0A 3J07A 5E1HB 4XX5A 4PJEA 4FMKA 3SD5A 1P9MA 3V5HA 1S7QA 1IGFL 3ROOB 2JKSA 3LSOA 2GJ6B 3FB7B 3HG2A 3HRZA 1WFMA 1YEDA 5D2NB 5CLYA 3GJEA 2VJXA 4LARL 3BAEL 1WSST 4I1PA 3QUZA 2LLNA 3Q44A 3QFJD 3D07A 3A4FA 4TVPL 4V33A 2FH8A 1NTDA 4WHTA 4L9LA 4N25A 2FWOB 2VAJA 3G04A 1FUNA 2YN3A 3DV6A 2OM5A 3SZ6A 3F05A 2I24N 2HMIC 1L9QA 4L18A 4P06A 1GHFH 4H20H 5DZPA 3RHWK 1E2VA 4NP4H 3TCLA 2CR3A 2X10A 3NCMA 2IFFH 1K4CB 1SF3A 4Y5XC 4XZ4A 5T5NG 4W9LC 4IOSA 3VNZA 4DF9A 2DYRB 1XCTB 2CJUH 2FATL 4PP1D 5GJSL 5CGBA 4GSDL 3E1ZA 3S7GA 4U1JA 5DSCA 1CK0H 2EDWA 2UVFA 1IL1A 4OLXL 1FNSL 4AZ8B 3A6OA 1YEHL 4P5TB 2V2XB 2FJGA 4HS8L 1PLAA 4I18A 5C6TL 3AS1A 4KUZL 4Y1AD 1CZ8L 3HCVB 4YN3A 4WFEE 4IIQC 4N1CA 4ORGA 4X4XB 4A6YH 1I8MA 3FZUD 4ZUSA 2NSXA 1DJZA 4WI8A 4DO5A 1R75A 4NNYA 3SPIA 5DK2B 1MPAL 2J2ZB 5JNYB 1R0AL 4WTXA 4RISH 1ZEAH 5T5FA 3GSRA 5E9DB 1JYNA 2NUPB 1LILA 2ZUUA 4MB4A 1ZA3B 3WLWC 3VMNA 1D3CA 4KVCH 5I5JA 2MJWA 3U83A 1PS3A 2VNCA 1Q0YH 4OFDA 4A37A 1AFVH 4KO9A 1J9CT 1BVKB 1ZT1A 3AXIA 2ZXWB 1DBAH 1NGWB 5J3HD 1I7RB 3BGFB 4U05A 4K3JH 3MUZ1 1SVBA 5J13C 3IJHA 4AQ8C 3VGBA 5SWQA 4U0RC 4I18C 4XMWA 3Q06A 4Z3GA 4MDJA 5DK3A 4B95C 3GUTA 5A2JH 2FJFB 4X0KA 1A7NL 1U8OB 32C2B 1JOIA 1AP2A 3IJYA 1GY1A 4PRPA 2OMUA 4C55A 1KJ3H 3B9EA 5JHLL 4GO9A 2P1YA 4NDMB 3JUZA 5IEHB 3BD5A 2E9BA 1OF2A 2BP8A 3BUQA 3HBZA 3H6AA 3O6MH 3SE9H 4FG4A 2WC7A 4NRXB 1FNLA 1WWCA 1YYLL 5DEGA 3APCA 2F54B 3IMVA 2OMZA 1I1RA 1ZANH 3PWPA 2WWMC 4TMPA 1PQZB 3RNKB 1L4IA 3ZE0B 4FFZL 3VD3A 3HG1E 4J23A 2OQJA 3N55A 1GC1L 1KLUA 5B7FA 1A02N 2VDQL 4NQCB 2GFBA 2NCMA 2XCMC 2R0WH 4JQXA 2QKIA 4NFDA 4YWGH 1RPUA 5KYYA 4W4OA 3MX0B 2AQ1A 3RWHA 2WWKO 3HKFA 4EXPX 1CL7H 3DBXA 3EH3B 1RK1A 3K6FA 1PG7H 3HG1A 5SX4H 1G87A 1EAPA 5AVQB 5E56A 1N2RA 3L4XA 4O2FA 1A3LH 4EZJA 1CD8A 2V3EA 3NBNA 1XWVA 1XBRA 2YEZA 1N7MH 3M07A 5C0BB 3VXUD 3VX1A 1IM3A 1WDAA 1N6UA 5AW6B 3FTZA 2HH0H 1MFDH 1JGLH 2H8PB 3PFQA 4JGUA 4L3AA 2ZPKH 4HSQA 5G5DA 2XZZA 1IKNC 43C9A 4UMSA 4Y4KA 1I75A 1JNHA 4Y7MA 2GBVA 4GRMB 3VCLB 3IB4A 3FBQA 2CBPA 2W5PA 1GZPB 1YEFL 2XNAA 3OLIA 4XVJH 4A6YB 4DGVH 5K59F 3D3VA 3W11D 4OI8A 1GYWA 3CVDA 4Y5YB 4N0UA 2VQ4A 5IW1B 5E1AB 3B5GA 4DQAA 1B3JA 3IAPA 1BZ8A 2WY3B 4UBDD 2E6PA 4D0CB 4YH6A 1KCWA 4YXLL 5CINH 3DHPA 4OVVA 1B0GA 1XSOA 5DMJB 1PU0A 2Y23A 2CKNA 4WO4B 1NCHA 3ULVH 4U1IB 2X88A 4AYFA 4OJFL 5JXEA 2J71A 4YSSA 1I3VA 4YSCA 2DBLL 1USQA 2X4RB 1LQBC 5ANMB 3UG3A 4LNRA 1U2YA 3VXUA 3CZGA 1UT1A 3FB8B 4I0PC 1ETZA 1HT6A 5D7JA 4P2CG 4HGMA 3K0WA 2B39A 2DLFL 4H2AA 1T3FA 3L3DA 4BJLA 3NCJL 4ERSH 4FNLH 4GO8A 4DP0X 3K71B 3KPOB 1EGJH 4XVTL 5E08H 2I69A 3VFSB 3ECBB 3UZEC 1UACH 2DWEA 3V0IA 1NCBH 3ATAA 1T03H 3EYQC 1W91A 3C9NB 4Y1TA 2FO1A 1PQZA 1FAIH 4I0KA 3EDKA 1XR8B 1FDLL 2PO6A 1P5UA 3KDPB 4NJ9L 4O2EA 3S5LB 1LP9E 4AGLA 4HK3J 4AYBA 2AEPL 4WJG3 2RJMA 5CHNA 5HJGA 4DP7X 2PCFA 3WMQA 5BUAA 5GSRA 1IM9D 1VFAB 3TZVD 3EADA 2M2DA 4JPWL 1FFPA 5TQ2H 6FABH 2OJEB 1U36A 3FO0H 1FL6A 4AKPA 4RZCB 5I0WA 4PPTA 4JANA 2WNWA 5EBLA 2F74A 3EH1A 4X5WB 3NEEA 3P4MB 3LKNB 1AZRA 1GTNA 3MOBL 4TNGA 3ISRA 4JFEA 1BQKA 3G6JF 4NQDA 4S1SH 4ZUTB 4NQSA 4G71B 1BVNT 1A66A 4GQZA 1H3WM 3M88A 2AXGB 3MKGA 4AENB 5D7KE 4FQQB 4G9DB 2ZOLB 1SEQH 1TZIA 3WFBH 5IFHL 2IAND 4D0DA 1N10A 3C60C 2VR8A 2GTZA 1S7RA 2GHWB 1TCRA 4IJ3B 5DZAA 4AVJA 5IMLB 5K93A 4E41E 3KWVA 2ZE0A 1I3GH 4ZPVA 1MWAA 4L8CA 3I6GB 2HKHL 2E4FA 1O6TA 3FRUA 3ARPA 1E8YA 3U46A 5I1GH 2D8KA 4LCWB 1HU8A 2EACA 3NCJH 4ERSL 4M7KL 2IFFL 4ZSOB 3WKNA 3IETB 1LDPH 2VSKB 3H4HA 5D9SB 1AACA 1QZ1A 3OJMB 1QBML 2VLKD 1DJIA 4ZUUB 1FHGA 1M7IA 1RURH 1SLVA 4JFYB 1XR8A 3TA3D 5EV7A 4HD9A 1CLVA 4XBPB 2V2XA 1UOWA 4OZ4B 4KDTC 4ZYKA 1EXGA 4LGPB 2NX5E 3QZWG 2ZXCA 5CSZB 1N68A 3BZ5A 3PPSA 3MUGA 1UA6L 5ERWA 3LAFA 4ZAKD 3L45A 3SY6A 3IXTB 1FGVH 5ACMA 4E9SA 1M53A 1BZDA 2J88H 4M5ZH 4WO0A 4YXLH 4PJGF 1H19A 2GVYA 2KHAA 3LS5L 1LEKA 1HKLH 1OGAA 1BF8A 5GQBA 4HIJB 5SWSA 2DDQL 2PCPA 4LLWB 1T04B 4PB0H 4D9RD 2GG1A 4ZNEE 1MWOA 4J6IA 4D9QE 2YUWA 2BIHA 4UQBA 4FI6A 1FSKB 5EU3A 3VFTB 1JHTB 4OJAA 1NGXA 3C5SA 1KPRA 1NCAL 3F3HA 2OMYB 4B9IA 4LSQH 1IGCH 1WFTA 2P42B 4J4PC 3R06B 5C7XH 1JGLL 2DZEA 2QKSA 1T22B 3MODL 4PFEA 4TUOA 4F33A 5E8PB 5ELIA 4LAJH 4PTUB 1I8IB 4WWKC 1NSNL 1QTPA 1XGUA 1D5IL 3U2SA 3AM8C 4PJ7A 3HJ0A 4FD0A 1BCIA 5DS8A 2ED6A 4NUJB 5ICYA 1SHSA 4DCQA 3QXAB 1PG7L 3R4DA 5F3FA 4Y9FA 4PLKC 4BCYA 1O6SA 1RLBA 3QA3B 2H6UA 2CO6A 5JW3H 4DN3L 4PGCB 5I75B 3DTDA 1QMUA 1BZ9A 1GPOH 3QXUA 3RWCA 1BBJA 4MCMA 3EDJA 4ANVA 1GC1H 4P5KB 5I1CL 2A6KA 4HJUA 2D73A 1BQHB 5HDBE 1J5CA 3LEXA 3S9DB 3FU7A 4FNUA 3OAYH 5FGBA 1NGPH 5B38A 4Y4KC 2XFXB 3LRSA 5ISZB 3FTWA 5JUEL 2LLGA 1IO4C 1T7YA 3WIHL 1SY6A 3WEAA 3V4PB 3C60B 1O7DC 3G6JE 2P7TB 4AGMA 3BIKB 2XV0A 4G6JL 4N9GB 4MCYA 4M8RA 3FFCA 3ME0A 1ZY9A 1ZLWH 2ZXDA 1E8ZA 1T7VA 2HJFB 1OAQH 1H8LA 3QO0A 3SYCA 3ZTDC 1QWUA 1XB3A 4FZEL 4GLRH 4F93B 3D0LB 2C9QA 4MMYB 1LE9A 3DLQR 3WE6A 3IRPX 5E0QA 4PREA 3GB7B 3IGAB 3W0WE 1Z0MA 2VO5A 2I7OA 4JW3A 3II3A 4W93A 4RMRA 3OXRB 2Y7MA 3V55A 4QRUA 1VFOA 3IJ9A 2DMHA 3KS0J 3ZMEA 4Y9GA 3CVIH 4WSGA 1DQDL 4LPTA 3X13A 1AP2B 2P47B 1GPOL 3DO3A 1VA9A 4M00A 4XR8C 1R3HA 5HHPA 1JPGA 1F45A 4QNPE 2H5UA 4K0OA 4QRBA 3UYRL 4NQVB 2GTQA 5CUSL 1E6OL 4IU2B 2AAAA 2BSTB 1DQLH 2JKJA 1UOVA 3JWOH 4U6TA 5JLZA 5JPMB 1CXEA 5FB8B 4RGNE 2I7SA 5IB5B 5SWSB 4E9XA 1KJMA 3DX9B 4A7TA 4S0HA 4LFHG 4G9FE 2YRPA 2ZTBA 3MPCA 3H9SA 4MJ2A 5AZUA 2XBTA 4G6KL 2J56A 2WP3T 1MIML 3ARFC 1BM3H 2PXYD 3BIAX 3D48R 1CK0L 4ZX6A 1IGCL 4HFUL 1MW0A 3U48A 5JO5A 2QKIC 3RGBA 4HHGA 4LCCB 3LQMA 1Q0EA 2BOBB 3GF8A 1I8MB 4PJ9D 3AS0A 4JL2A 4P23D 4PJ6A 4U7SA 1I8KA 5I1HH 3HR5B 3B3IB 4V1DB 4DAGH 3N6YA 2RBLA 1G1OA 4X8CA 5F89A 5DFWH 4ZUWB 1EZVY 3OJDA 3DK0A 4MNGB 3AB0B 3EZJB 4PI0A 1G9NH 2IPKB 1DE4A 3O2DH 2G5BA 4LARH 1D9KB 5D7IB 3CFUA 5EB9A 1LQSR 5DZOA 5FYLE 5CNHA 2VDKB 1FORH 3MLWL 2FGZA 4WUUB 2XDHA 1MCQA 5EC2B 2YD3A 1S7RB 1BP3B 2GTZB 2Q7NA 5BRZE 4KKZA 5IKCA 4S1DD 4LOUC 5DJAA 3BUTA 2BHFA 3KR3H 3S35X 2FWOA 1FYHB 1ZSHA 2LABA 4FLHA 4H0IA 1CXFA 2Q86A 1TOXA 4XVSL 1JF5A 2BCKA 5IB1A 3F58L 1U8NA 5IHZB 2BNRA 4YHKL 4CKQA 5I1GL 4GMSH 3IGLA 2DI9A 3U36B 2FHCA 3I6SA 1AQHA 3T4AA 3EYSL 5KOVC 1RP9A 4ALAC 3LNFA 3TPUA 3NPSC 1TSRA 2V3DA 5CIPA 3ZSTA 4JKLA 1KBWA 3TN0D 4ZUWA 4N2LA 4UQDA 1DVFB 3LHAA 3NIFB 3QEGL 3KLHC 1BWWA 2XPGA 3SO3C 1QFWL 4ZDHA 2Z92B 5HTSA 2ARJB 1QSFD 5E70A 1ZE3H 1ZOXA 5IMOB 5B1KA 3FU0A 2HX7A 2PWDA 3BH4A 1PDKB 4FQXD 4TTGA 1TTGA 3QQ4A 1KB9J 1OT2A 2ZJSL 4MKTA 5IVNA 4LHUA 5ANME 3CFJA 5IB2A 4AY0A 2A4ZA 2DI8A 4PCYA 2B3RA 2PPCA 3POCA 1A4BA 4JO1H 4DTGL 2LT9A 4AGOA 4GPVA 3IDNA 2XVBA 4D0BA 2WXNA 4LCYA 4XMVA 1G1CA 2V17L 2NXZD 3WE1A 4AV0A 4BGDA 5EF1A 2HCZX 3UO8B 3KS0H 4IEFA 1XF4B 2UXVA 4HPHA 3CWGA 3KNBA 4FXKC 4XVTH 3Q0HA 2PF6A 1F1GA 3UTSB 1M6OA 4RFOL 3MU3A 4IW4C 4MNHA 3CFKB 1O9WA 3ULUD 4GAGH 4PVNA 5DVNA 2C5DC 4LHQB 5GGVL 4XAKE 1CDGA 4WFFD 4JRYB 1F90L 2RQEA 4QMEA 5CP7B 2MOQA 3AFLA 4Z3IA 2AJVH 1CICB 3H9HB 4Y16C 3VCLA 3O6LH 2I07A 5TPWH 2C4XA 2R1XA 4OJFH 2XT1B 1OQXA 1F97A 4PU2A 5JW4R 1NLDH 3BP5B 1OAXL 2Z8SA 5EF0A 4BK4A 4F7EB 4L4JA 3HB3B 5EZIH 2QPDB 4NUQA 1XGTB 1CVSC 1A6TB 2AABH 4LBEA 4O4YL 4LNVA 3WIIH 2FJSA 4DN4H 2QQLL 5C0AA 4QXUL 2JIXD 4WDIB 4YJZL 3X1BA 3HBQA 3OGCB 4OW6A 1S7WA 1A9BA 1N0XL 1N2RB 1VZIA 3PWUB 4O2FB 5T1LA 1WBXB 1W0VB 1YG9A 2A6IB 4J3TA 5AVXB 2BVUA 4X6EA 1BJ1H 1NDMA 1B9ZA 1R3HB 3ZBMA 2EVFA 4PS4H 5MHSE 1TTFA 1LO3L 4JM2A 3D1MC 1N6QL 1WG3A 2PPAA 3NPSB 2HH0L 3Q8EA 2Q6WA 2V9TA 4IIQA 3VI3E 2AV7A 1WS8A 3C8KA 1A6WH 2EDNA 4JFZH 1FP5A 2AXFB 2VLMD 4TLSA 4ZXBC 1BZQK 2ZCLL 3HE7A 3ZKMC 3V5KB 4K7PH 3NG5A 3ALPA 1W0YT 4UTCA 4QRRD 4HWZA 5I1DB 5IJCC 5EZJA 4XP5L 3IFNL 1PZAA 3ESVF 1CLZH 1G9MH 2BPBA 4I3GA 1U93B 1F1AA 2RIKA 1X7SA 1FNGB 5IB3A 1CFMA 3TVMA 4IEFB 2Z65C 2HT2C 2NSQA 1T0MB 4MJ6A 3HMWH 5L4JA 1UD3A 1AY1H 2JIXA 3BZ4A 3RP1A 2OR9H 4CVWA 1NGQL 1RPKA 4V2BA 4X4KA 3WAJA 4KDVA 2YJQA 2KZ1B 3N43F 4CNIB 3OBAA 3NSCA 5HYQB 1DJWA 1DSYA 3MROA 4P5TC 1U3NA 2NNCA 4GXUN 1UT2A 4PGBA 4W9CC 4F8NA 3CFJB 4R7DA 3PGDA 3RTQB 4PSRA 1TVHB 5A7EA 3O6ML 4Y1AA 2A9NH 2ZUWA 1XV8A 1DLHA 3RZCB 1TEYA 3LIUA 4ODXA 1PDKA 2XACC 4IM8A 2PR4L 2V5RA 4WUUA 5CR1A 3WS3B 2J1XA 5DI8B 1YN6B 3W5MA 2AJSL 5IHUL 5KN5B 5AKVA 1EHLL 5ILTH 3SPVA 2P8PA 2RCSH 1Z9NA 4Z76A 5CZVH 1S9XB 2XPGB 4TLKA 3RNQB 4DERA 3MUY1 4HT1L 4LSRL 4PJIF 4CUCA 4V11A 1A2YB 1ZVHA 4NM4L 1KY7A 1AS7A 4PTUA 4BZYA 2LV4A 3EUUA 4NHCH 1KB3A 1R5WA 1DBAL 3TOPA 5DQ9A 4XP6L 3NIDE 4I18B 1ADQA 1H8SA 3T4AB 2CR6A 1JPEA 4P3WA 1V3MA 3I6GA 3BVDB 5AENA 4WU5A 2MPAL 5DSCB 1U8HB 1F3JB 3S36H 1TITA 3G5WA 1A7RH 5DJ6B 3ZK0A 1T1YB 1VFBA 2HT3D 1R0AH 4IBSA 5CKGA 2E76C 2GUYA 3DSFH 1AQKL 1QQDA 3AROA 1P7QD 3DYOA 3CDZA 4WUUD 1RHHB 3GLDA 3OVUB 1HDMB 1EMTL 1YUHA 3G04B 5J57B 4J7RA 4QNPF 1PZ5B 1D9KD 2VLJA 3GTVA 2H6PA 1RAMA 2LU3A 3ZYIA 3HC2A 4A7QA 3VW3H 4M62H 4LDLB 1N0LA 1NANI 3UZQB 2VZOA 1P84K 4HUUA 4J1UB 4B0MM 1ZHNA 4N90E 4XCEA 4HZLA 3VFWB 4UCFA 4YDNA 2EVHA 5H8DA 4OGQC 1FJ1B 1TKWA 2VXQH 4BA8A 2A9NL 4PJBF 5J0BA 1KN2L 4YC2B 3KPSE 4J3OG 1X5LA 1N4XH 1GR7A 3WFCL 4G7RB 2YD4A 4LSVH 1K8IA 3ARED 4FXGA 3AT8A 5A2AA 4GLRI 1EPFA 2OR9L 3WS3A 2NY1C 3OKKB 3RWDA 3QO0B 2D2OA 2HG0A 2X1XR 3F5WA 4G80A 3U7WL 3IMUA 1L9OA 3QEQA 2CLRB 3B1UA 4R3SA 1JV5B 1DLHB 5KVDH 3HG5A 5K1VA 2Z7WA 3MLVH 3QXTA 1PJWA 1RCYA 1ZS8B 4G43A 3MRBB 3B2UC 2VWEE 5DQJA 1JERA 3CFCL 2NY3D 1SOKA 2O6DA 3FTVA 4MA8H 3BSZH 3I74A 1NCCL 4AKOA 1WC7A 3GUFA 2HT4C 1CFTA 3PV6B 1W6LA 1A65A 1OSPL 1LO3H 3FQ1A 2HRPL 3LB6D 4JO5A 1S7TB 2V7HA 4CJ0A 3R18A 1F6AA 2RQ8A 3F7VA 4HWZB 5I1DA 5JXED 4P5MA 3E9TA 4ODHH 2PLTA 2FL5B 3UL4A 2H0PA 5HHMB 3D4YA 1MAJA 4P2RA 4QUOA 3BAJA 2WNKA 1C5BL 2CK0L 4PJ7B 4RIRA 2C9XA 4YSTA 2FZ3B 3U7YH 1HJBC 2ZAGA 2N59A 2UXFA 3ME0B 1D7DA 1KBGH 1XCXA 2FQGA 4I9WD 4A1RA 5GGRA 2ZX8A 3ZQ9A 3PAZA 4BFNA 3JQOB 3X3FH 4R97C 2DBJA 3D18A 3T1WA 4FEMA 4KRMB 4QJ3B 3L3JA 3DSNA 1YEIL 3WN5B 4LXFA 4Y2DB 1NGZB 3SYQA 2CHXA 3MLXL 1GW6A 1ETZB 5E6UB 1R9FA 2C9SA 3FU7B 1UD2A 1J7VR 4LLQB 3IGUA 4P46A 2R51A 3MA9L 5A3ID 3MLSL 5HVFB 4ANKA 1X5GA 2K7PA 4M8UA 1DVSA 2CXGA 5KSVA 3GTNA 3GMPA 4F7MB 2ODIA 2NY7L 3D3VE 3DBXB 2ICEA 4UDTA 5IESH 1J0IA 3L81A 2G75B 4Z23A 4JN1L 4Q89A 1G9HA 4HLEA 3KXFD 2AKRA 2WWKT 1FWXA 2B1HH 3M17A 3FUDA 1BV8A 4XPGH 4H44C 2PCYA 3EBHA 4HZAA 2O5ZH 1B90A 2CUMA 3KYOB 4U4IA 4D0CA 4XNUH 4NQEE 3BHBA 3L2MA 2B77A 2ITDA 1MCPH 4GKSB 2PW1B 2HVBA 1OCZB 2XNAB 4Y2OB 1YECL 4L29A 1S2EA 1YY9C 2FL5A 4KKAC 3F00A 4UT7L 1OB0A 1HJCA 2KH2B 1NIEA 4JRYE 4ZPTA 4S0TD 5IQNA 1TUPA 4HAGA 2LFGA 4PG9B 3LV3A 3ZE2B 4PY8J 3FN0L 3TEYA 2X6MA 4R4BB 1HSAB 4FEIA 3S2CA 5IW6B 4FS0A 4WY7H 1QD0A 1F8TL 3RWIB 3RPBA 1A6UL 1HNGA 3TEXA 5JR1L 3PABA 3CE1A 5IG7A 4RGND 4PJFF 2ZICA 4PV8B 2YPKB 3RDTD 5FO7A 1VCAA 2AXGA 3UAJD 4CMHB 3DNKA 3P3UA 3LN5B 1JZFA 4GG6F 3S37L 1XD0A 4LPWA 1REIA 2XRAL 3RGVB 2G5UA 2WBJD 4UTAA 3NGBC 1JV5A 2KC0A 4Z0BL 4HK3N 3TCTA 3FYEB 1JE6A 4QO1B 5EPMB 1QUPA 1PFOA 4PWEA 5EBLB 1EV2E 2DQEL 2K70A 1FYTE 1ES0A 3V6OC 4DKEH 3KGTA 2X1QA 3L95B 2J8UB 1K8IB 5EIIA 4TTDC 4GRLA 4ZQKA 3U6XA 3ET9F 1OW0C 1JK8B 2WIMA 2GJZA 5LJYH 4Q6IA 2CPCA 3QRFM 2XZAH 2IGFL 3MMEA 3CDYA 3K46A 1KJ2L 4TVUA 1CLYH 5CHNB 2VZVA 5MEPA 1X5MA 1M9SA 1HYSC 3T5WA 2KBGA 4OR1A 4FFVC 4NERA 3STLB 4UNTA 5GRWA 3LZQA 4LLYB 1MHHA 1CXKA 3QI9B 4JHAL 1WJ3A 1A14L 2DJSA 5G4MA 2XWDA 2BCKB 3LHPH 1XO8A 2ICWB 4Y4FB 4KK8D 2NY0C 4Y5VC 3NJNA 5F9JB 1CFVL 2APTA 5GS1A 2IWKA 5E6SB 1V5JA 4RCAA 1T3FB 5DEFA 3X2QB 1KB9K 1Q1PA 4XMPL 3BLBA 2WN3A 2QLYA 3ISYA 5GGTH 1JF1A 3LZOA 4PCKA 1EX0A 5LB1A 2DM2A 2XY2A 4L3CA 1NPJA 3WIFA 1PAMA 1WWAX 2AW2A 4FQJL 3HJEA 5KOMC 5FOBB 1SJHA 1I3RA 4GUCA 4HFUH 1AR1B 2Q10A 1GGBL 3MFGB 4X7EC 2X0WA 3H9ZA 1BM3L 2IPKA 4UV4H 1QRND 5TDPA 1P4IH 2R15A 1XGZA 2PCXA 4JFOB 1CTMA 1OD9A 2XWBA 3E9UA 4J8QA 4J3OD 4OF7A 4NFCA 3MNVB 3TBCA 4R4NC 2IWEA 1NLBL 4FFYA 4HS6A 1QSFA 1UOLA 2WPGA 4WUKL 2H32H 2XWZA 4RMTA 2GI0A 4M7JH 5E1AA 5FYKD 2Y3AA 1ZPLA 4WI6A 5JDSA 2PR9A 3TH3T 1D5BB 2X3BA 3T3MF 5FYJU 4NC1E 5LUMA 4MMXB 4N8PA 3S36L 4MJ5B 3FU8A 3M7OA 3FN0H 4IRSA 1J88A 4GQPH 4R83A 2I26N 2JJTA 3KM1A 3LKPB 3P69A 1DR9A 4E41B 3GHBH 4ZNEA 3FT3B 4ISVA 4PJDA 2I25N 2DYSB 5KBNC 5DK0B 4G7QB 5HI5C 2ORBL 2BP5M 3DOSB 5TQ0L 1OZTG 5HI4C 4FG0A 3QIWB 4KKBC 3VB8A 1LJMA 3FQRB 3PHOA 1FGNL 3NCYS 3F7LA 3VGHA 5CJXA 1I1AA 1AQDA 3SPCA 5GGVY 4OF3A 2OR7A 3QUZB 3UACA 2IQAA 4LVHB 3V9EA 4Z7AA 1HL8A 4Y2NA 4NKMB 2AJSH 2LHAA 1EHLH 5H37G 2YPVH 1MFEL 3HLAB 4G7YL 3VI3A 2ICCA 4F7CA 5TK2A 1UKQA 4NN6B 2F0CA 2OMTB 5JZ7D 4XAWL 3IS1X 1MFBL 4XPAL 2K8QA 1NIFA 3TLRA 2P5EE 3TV3H 1WK0A 3L9BA 3MGOB 4X5QA 5F1IA 5F2FA 1CBVH 2BRRL 3I9GL 4YNYA 2DM7A 5I5MA 3L5XH 4UTAL 3QORD 5EO0B 1M4KA 2EUVA 4IGBC 3PFUA 1OK8A 2W0PA 2GB2A 3HNVH 3MBED 5E9NA 2ENJA 4LLDB 3T6ZA 1ZCRA 1GGCH 3D05A 4W70A 1AO7D 1HN1A 5FHBH 3A47A 4JY6B 3HMXH 1EERB 2NY5L 2AQSA 1DQVA 3QI9C 1XF5B 4PJ5A 2R9HD 2Q8AL 5I8OH 4F8LA 1QNIA 5KVGL 1R3LB 4H88L 32C2A 4X0KB 1YQVL 3LKQA 4NO0B 3T3PF 1CE1L 4RNRA 4BSWA 2CK0H 3D7PA 4XN7A 1KXQE 2MH4A 4KTDL 4HIIA 3B9KD 1IIKA 3OGCA 3E3QE 3B1TA 5FAAA 1XGYH 4JPVH 4P4KC 2WO2B 3FTGB 1NAKH 3L4YA 4OZHE 3H54A 3RWCB 3SODB 4UQ2B 2BWIA 4XPBL 1AD9A 4ZFZA 3RGVD 4KK9D 4P07A 3QPXH 4NN5C 4M48L 4P4RB 3LRHA 5DD3H 2HX8A 1A6VH 2NW2B 3DV4A 4JR9L 1P4LB 4HAKA 4QXVA 4IOSD 3MSPA 4MX7B 1K3IA 4BQCA 3KWWA 4FNSA 5DGRA 4AEEA 1E4WH 2NZIA 4F58L 2C7UA 5F93C 2PYEA 5C08A 3LN9A 5BUGA 1YQVH 2WSKA 3ZW3A 4BM7A 4ETQA 4XHQA 5IEHA 3QCTH 1JS4A 4ZMOA 1NCTA 1IM9A 3QWRD 2VW6A 4G8GD 5L2JB 1KBBA 4XCEB 4DGWC 3U7WH 3HMXL 2WN2A 4PAZA 2IXQA 5CR8A 2CK2A 2VO8A 1AQDB 3U30B 2A73B 4D94A 3SE8L 2VLJB 4XP9L 4WK4B 4KQ3L 1PIGA 4I5BB 1YUHB 5HVGB 3UTZA 3G6DH 3D0AA 2GCYB 2YQGA 1FHNA 4FXKA 2EDLA 1XAKA 4NQDD 3K8KA 4BELD 2VXQL 1I82A 5LCVA 4OFIA 4ISVB 4L9DA 4PJDB 5IGXL 3O11B 4AH2A 1JHKL 5EC1A 1TETH 3C87A 4LL9A 4Q9RL 2VSDA 5K33A 1A4JB 3BPOB 1KB5L 3WFBL 5L6YH 2AQQA 1AHMA 1FQ9C 3VXSE 3MRDB 5EDXA 1LP9A 5JIMA 2B59A 3FTUA 1QVOA 2Q3XA 3V0WH 3FCTA 4LVEA 4KJWD 4NZTL 1DANT 4S1SL 5D96B 2AANA 5BS0B 3HE6B 1NFDF 3REVB 3VWKD 1ESOA 1Z5LB 1IGYA 1CD1B 2BNUA 4L8SB 5D1ZD 1ZLEA 2IF7A 1JZ2A 3D3VD 4LSPL 3BT0A 3NA9H 5E1GA 4DGYL 1ORSB 5CEYB 4RMVA 4BEIA 2X4PA 4Y2LA 5FR3A 2NXYB 3OXSB 4ODXB 4YSQA 4WAFA 4JPWH 3CMOL 4GBXC 5HGDB 1TVHA 1P6FA 2Q5BA 4YIQB 3F7RA 4U1LB 3NCXA 4OZIB 1JZHA 4JFQA 5CLTA 3VD1A 1A1NB 2EEAA 1T80A 5DJAB 4U6YA 2ENPA 2JKNA 2VR7A 3BDYL 3G3LA 4RMQA 3APDA 4OIAA 4XRCA 4E41A 2DTSA 2CZNA 3EG9A 4GXFA 4IJTA 5I0ZA 4IRSB 2WXRA 4J39A 2APXA 2QMKA 2ZUXA 2Y0SA 3HG1D 3DX8B 5F70A 2IEPA 1FL6B 1WT5C 4MZIA 1CGUA 3RDTA 2Y2TA 2UYLB 2PNDA 3EF7A 3FU5A 1JXFA 4EI6B 1DCEA 3UPCA 3BFWA 2QHRH 4G8IA 1B2WL 3SGEI 1V05A 1HL9A 3QDGA 4R97B 1UWEH 2FD6H 1HAUA 2QVMA 3FH5A 3GLEA 3GSNL 4O9HH 2GBUA 4OZGB 3T77A 5D2LE 4KXDA 4U3CA 3WFZA 4NOFA 2Q87A 2IH1B 1SXCA 1U8LB 4LOVA 3VXSB 1IRAY 3IDIB 3WJLA 1LO4L 4ACPA 4OBRA 1WEJH 3DUSA 5KG9B 1FORL 3MLWH 4JO2L 3QIUB 5D8JL 3V2AR 4DGIL 5INDB 4UT6H 2WINA 4K23L 2FQDA 1MCWW 4QCIA 1TMCB 3VAEA 3QEHB 1OAZH 3CIQA 1CLZL 3UO1L 5EEUA 5BXFA 4OF8A 4UM9A 1UEYA 1PCSA 2H3KA 3VQMA 1U6AH 2D0FA 5HYJB 4ZW8A 1VF5C 2AMUA 4GFTB 3W2DL 3RFZC 1U0QA 4MNQB 2HVKB 3TWYA 3I75B 1QEXA 3K81A 4XPTL 2RGSA 3ROLB 1BX2B 2YC1B 4XVJL 4DGVL 5I6LA 4LBEB 4E9WA 5E4EB 7CGTA 5IUCA 2DQEH 5JQ6L 3V7AG 1DVFD 3IJ8A 4PG9A 1KWGA 1RZJL 1UKTA 5DRWA 1MFNA 1F58L 3H53A 4UU9B 4GBXD 1HCZA 4PS4L 4S10A 1R5IA 1MFDL 1C5DA 4PMEA 2YA1A 2APFA 4B9GA 4HAFA 1N7ML 2PW1A 2Q7AA 3AQZA 4GH7B 2BOLA 2QVTA 1Y1DA 4DUWA 3MOAH 5D1ZC 3QUXC 4Y1AE 3LQAH 3QIBD 3TM6A 3GXPA 3AMLA 5EOQL 3C08L 3JWOL 4QTHA 5FA3B 1HL4A 2AABL 2H41A 3WIIL 4HH8A 2WXHA 4KJWC 5CD3A 3CUPA 1M6OB 1OAXH 4CMHC 1DQML 1J5HA 1AJ7H 5AKRA 5AVRB 2R7EB 3EDDA 1ZRUA 4NZ8A 5TPWL 3V0AC 4L8DA 3O2VL 4GW1A 3GBDA 2OMNA 5GRVL 1HI6B 2YLHA 1LXMA 1MFAH 3NJXA 1WD9A 4LHUG 3AREB 3PV7A 4NT6B 4BE5A 1XF3B 3HZKA 2CO2A 3ZKSD 3RPIB 1KJ2A 2VDOL 5MHSD 3QC6X 1N64L 5E94B 1JZ8A 2RAMA 3RVVD 3MRIA 3PUCA 3QAZC 3C2SA 4JY4A 1G6RA 3P40A 4FZEH 2R4RL 5C0FA 1N6VA 1BSIA 5FYJH 1U58B 1YPZF 3RZCD 3VXPA 2A2QT 2EDJA 2Z7YA 2LAAA 4HLJA 2CWRA 3D85D 2VITB 5KAQG 5I18L 4GNKB 3P0VL 2MEJB 3FULA 2GPZA 3MLZH 5E2JA 4JFDD 1DVFA 4X99B 3QWOB 3ARTA 1C8PA 4I4WA 3QQNA 1TJGH 2IBZY 3TT1H 2XWEA 1P7QA 2AV1A 4OGZA 1AFVL 3KL3A 5I1CH 3FTSA 2NNXA 2F8XC 1V10A 3UBHA 2AI0L 1DUZA 2WLLA 2XJKA 4X8JB 1E9OA 1LM8V 4UB0H 4Z5RA 1KBGL 3RY4A 1FLRH 2XV3A 3WY2A 4DN3H 1AIFB 2EZ0C 3QDHA 5E1QA 3RWEB 4MDJB 4U4BA 4FQ1L 4ZOEA 1D2PA 3IJHB 3RGVC 4MNQE 3ETTA 3RI5F 1GCFA 5DC9B 2XG4A 3RB5A 1F00I 2OTUA 2PCPB 1RZFL 2E86A 1MI5B 3CSGA 5BZXA 4CU7A 3BDBA 1LO5B 4OSUH 3NJVA 1KXTA 1C7SA 2BCMA 1MCEA 2PO6D 2APSA 3ARDD 1SXSA 1OSPH 4HC1H 4LP8A 4MBOA 3SGKA 3EYUL 4KH2A 3QJVB 1RERA 3EH2A 3QC5X 4IHOB 4F2FA 3JTSB 5GJSH 3S48A 4JJHA 3VXQB 2NY1B 2DQMA 4NZUH 1URLA 4YHKH 4RGNB 5ESQB 3B9KA 1TFHA 3NPZB 3KDMA 4OZ4A 2VMJA 3OKNA 4XVSH 3KG5A 4G2AA 2R9HC 3HCVA 3QDMA 3QNYB 1A9EA 4MAYB 1PZCA 2W0FA 5JW5B 2QQNL 1VDGA 3A4DA 1AXSA 5DMIL 1QZNA 2EXYC 4S0SD 3JVFC 3BAEH 2J5LB 3PGFH 1P1ZB 2C1PA 4LRIA 2QPUA 2C4FU 4LVHC 5IP4A 1VEMA 3OKEA 1HXYA 1SJEB 2YA0A 4JHWL 5T33H 5F7FA 2VLRA 4JUSA 3WXVH 2P5WB 4O58H 4X5XB 5J5EA 1IVTA 4G8FA 1IGTA 1QFUL 3EJZC 3MRBA 4G83A 4KX7A 4PUBH 4XCYA 4G3YH 5I1HL 5D7LD 3CG8A 5D4QA 1RZ8A 1ZKAA 4CW1B 1F4AA 1E5AA 1WT5A 4I85A 5CCKH 5EDSA 5B8CA 3H55A 5E8OB 3V6FA 1IT9L 4JGMA 1RVFH 3OJ2C 1BZ7A 4ENEC 1PSKH 4H8WH 2A83B 1SDDA 4KKBD 1DLFL 5FGRA 2IPTL 4HG4K 4G6KH 2Y6SD 5I8KH 3ZDXF 3KW7A 2QSTA 4AQ8A 2BP0B 2YARA 1II4E 3EXLA 1ZGLA 1I3UA 4OLUL 1MSPA 4ODUA 5F7WC 3VWJC 4X9IA 3WSQH 1GXEA 1DJYA 4LQ1A 1G0XA 1DJXA 1OTSC 3MJ7A 3SPVB 2VE6B 3U6XS 3CVHB 3SEPA 4DEPC 3IGAA 1BXAA 1U8PA 5CUSH 2CCLA 2VH5L 3ARUA 3MOBH 1FL5A 1BZOA 6TAAA 2WQXA 2GSMB 1N0LB 3QG6B 5GZOA 5JIPA 5J6GA 3F65A 4AYID 5DJ0B 3LKRA 2HJFA 5D1XD 2CALA 3FCSA 4MTMA 1MZYA 4D7PA 1EDYA 2KDYA 4WI0A 3VE0A 2OL3B 5FWQA 4LP5A 4IBZA 2F2HA 2VLJE 1ZD6A 1CFQA 2YBRB 5G4NA 3ILEA 3MUUA 4NM4H 1INEH 1XCQB 1TQWA 3JWOC 3IVKA 4OH2A 3LH9A 4Z78B 3B8SA 5LBVA 1GGIL 1X4XA 3IDGA 2ESVD 3IMBA 2GITA 2X6BA 3RYMA 4HCRL 4CVZA 1HHJA 5ENWA 3TIEA 5IR1A 4Z7QF 4YPJA 2IADB 2JELL 1A47A 5I16A 4F2MA 1YEKL 2W9LA 4QHUA 4N3TA 5HHQB 5I6NA 2ADGB 3VFOA 1N59A 1UXSB 1I7ZB 1SMAA 2EILB 4Y89A 3QWOA 4P4KA 3H9SD 3RNQA 3ATBA 4HXAH 4PB9L 4BBWA 2CLZA 3GIVB 1AGFA 1RZGA 3HI5H 4FULA 3NFNB 3K2UH 4RX4D 4Y5YA 1GYCA 1RUMH 5IQ9B 2K9UA 5EO1B 4IBWA 4N6QA 5JOPD 3V0EA 4A6YA 1OCOB 4ODVH 3PQYB 3G5XA 1U8IA 2CO4A 1FFQA 3FUJA 3OAUH 4PJ8C 1G9ML 4JRLA 5FGSA 2F7RA 5EU3B 3VFTA 2XG4B 4QRQA 3B7TA 2YEZB 3HA0A 3BPOC 2FX7L 5FKPB 5ETUB 1A7QH 4NC2B 4Y19A 3VGEA 5K9KB 4P0DA 4L3EA 3T09A 4PJCF 3WYRA 1JXGA 1SVZA 4A7GA 3IDJB 2GABA 4W68A 3T0WA 3TYGH 3VFMB 3WEXA 4AYMC 4Z5RB 3KMDA 3US9A 3F2LA 4H0LC 5FYLD 5EZOL 3ZZSA 4WW2C 3IFOB 1AGEB 1HILB 3U2IA 4P05A 2VDRH 3QEUA 1P7QB 1CYXA 3ZIMA 2WAQA 3D2UD 1T0PB 1T0OA 2KS0A 2WJ7A 4S2SA 1HXKA 1MCKA 2WKOF 4U7MA 4A2HA 1N0XH 1CF8H 4JFYA 5ALBH 3S37X 2WWNA 1KELL 4RGOL 2OI9B 4F9PA 2WMPB 1T2QL 2JTYA 4M9OA 4ZW3A 3VMPA 4GUOA 4A2FA 3MV7D 3UTSA 1RZ7L 1YY9D 5I8EB 4LKCA 5C0CE 2E4TA 5CLWA 1AGEA 4PLJC 4ZW7A 1MRCL 2ENYA 3QFGA 1CN4A 4OQTH 5ANHA 1V27A 3FRPA 1KNOA 3L2NA 4ZPVB 5DJXB 4HGWA 2IBBA 3V4PL 4AMXA 1NAML 2EXWD 4MHHI 2VDNL 4C58B 4Y19B 5EOCL 3ULVD 4IDJL 3ZQWA 4R90L 2O5YL 4HXAL 5IB2B 2Y7SA 1E67A 4PGEA 4XCCL 2G0LA 4ALAL 1RJYB 2WLHA 3SE9L 3DXAA 3D4ZA 4V1DE 4LRNH 3I2CH 4OF0A 3RKDD 3ZZQA 1G7IB 3CFMA 3MYJB 4Y7OC 2WLIB 1IIIA 4ZMYA 4MJIB 5I0XA 4AQEB 3LN4B 1XH0A 3F84A 3NK4A 4YLCA 1MIEH 3SDYH 1QLFB 3F12A 4HMDA 3CFQA 1J9RA 3NFNA 2MSPA 1S4IA 1GAFH 1SEQL 3T8MA 5T3ZH 1OGAE 3W0WA 1ADQL 4EIGB 1U8LA 2JKLA 2OJEA 2Z1KA 5E9AA 2VKWA 4HOMA 5F7LB 2F6AA 2DQCL 3EHBC 1AI1L 1YYMH 1U2HA 5CIPB 5LHDA 4GJTB 1DQQA 2VDPH 5MP6H 1J5IA 3BZDA 2XXMB 4RMWA 3FOMB 2WQWA 1XF4A 3EJQA 1R33A 2NXYC 3GTTA 3F04A 3KCPB 2X7LA 1HWGB 2EEXA 1BX2A 3J8F7 3PDDA 3GRWH 4GEJA 3UBXG 4RISL 3VXRE 1XXDC 1QRNE 3W5NA 3IMWA 1V3LA 3S6CA 1AI1H 1YYML 4PP2A 3RUGA 1Z66A 4WV1B 3CZUB 3AB0C 2IANE 3T08A 4OLUH 3UGUA 1F86A 1JNLH 2JI2A 1Q90A 3FQUB 3IPEA 3GZQA 3GMMB 4UZUA 1JDDA 3SDYL 3KCPA 1ORSA 3EYSH 5CEYA 4NIKB 5DJ0A 2G2RB 3X14B 1QSEA 3QUMA 3T6XA 5IJKC 5EEVA 1RZKL 1TTAA 3N9GL 1PSKL 1PY4A 1IBDA 3BZFA 1MUJA 1CD1A 2BNUB 4F7PA 5F1SA 4JBSA 3NDYE 3LXAA 4JL1A 3MV8E 3RFZA 5GJTH 1BQHG 4GEIA 3VWKB 3RIFK 4K8RD 3AJ7A 5CP3H 2NY1D 2OI9C 5EZLA 1KT2A 2JE8A 5F7UA 1KB5A 1H8OA 3ILDA 3O8XC 1W8EA 3AREC 3UBXA 2AEOA 2VL5A 3RVTC 1BF2A 1FYTB 1I4FA 4JB9H 4L1BA 4Q0XL 4S11A 1FBIL 5HJDA 3VXRD 4GRMA 1SOXA 3PWPD 2VLLA 3GHPA 5C0DA 5A6IA 5IVXF 1VENA 4U1SB 4WI9A 4XRCB 4N22A 5CM1A 1F5WA 3MXWH 3N50A 3U9PL 4PRHE 5FYKL 3I3BA 4ONFL 5FB8A 3CCHB 1DSWA 2GIXA 3KEDA 4P3CL 3X11B 5FK9B 4F7KA 4POZC 5C08E 5GGRY 4KV5E 1IAOA 5F8QC 4OZFA 2YOAA 3TO4C 4HCIA 4ZUVB 3DX4A 1MVYA 1W9XA 3NABH 4L1DA 5B7MA 5BRZB 1D6EB 1EHNA 5DJXA 3HHRB 3NSYA 3RWHB 3R0MA 1CBJA 3NIGB 3DWTA 4I3SL 2ZKHL 1UM5H 3HOGA 3O9WA 3OX8B 4P59L 4C83B 2ADYA 3H7BA 1TQTA 4IMKC 2CA4A 3HS9A 3DO4A 1MCLA 1G4RA 25C8H 3MRRB 3PWLB 1KPUA 5FUCC 3U30C 2J1KA 4UTBA 2FTAA 1TQCB 1USZA 3NSDA 3X1NA 2JLLA 4M6ML 1QSED 2G0KA 2I9LA 5HYSG 1RIUL 2Q9OA 3G5YB 1MKFA 4PW4A 4NDMA 2O6PA 5FECB 5D1ZI 3WIHA 2WLMA 3VFMA 3WEXB 2DS4A 3VA6A 1XTMA 1S7VB 2YPLB 4G9FB 3H4FA 1TJGL 1AZCA 4L8BA 3VI3F 1EEZB 2NLJA 5DUPH 3LXBA 3WGUB 4ADJA 2BC4A 4JPIB 3UTZB 2IALB 2WXKA 3GSWA 4WJ5A 3RIAK 2OMXA 4YGVA 4IU2A 3ETBJ 4OAWB 2FNWA 3RWEA 3WO3B 5KSBF 1THCA 4I77H 4BSWB 2EC9U 3N1FC 5DC0A 4EUPA 4JCWA 2ROYA 4K9EC 4KAQH 3E6FA 1OAQL 4NENA 3EJUA 4XB7A 4LCWD 2QV4A 1ZWIB 3GBMH 1KJ3L 4GS7B 4WSKA 2I60H 5LQBL 1JP5A 2YA2A 5FM5O 2APWA 3L3KA 1KIUB 4R7XA 4I77L 3KWWB 1C5CH 2W9DL 4LLMA 5C07B 4R2GB 1BVZA 4I9WE 4OUOA 3K6OA 2VITA 1IEBA 4ZD3L 4Z7WA 5BRQA 5E8PA 5JOPE 4GBXB 2F1AA 1CI3M 4ZZKA 3C5JA 2QHLA 3QK0A 4U7KA 5D2NE 5FC9A 5I6MA 1VESA 5JXAL 5SX5H 2FJGB 1GGYA 4ZFZB 2K3TA 2X38A 3IDXL 1GJWA 2A9CA 3IDGB 4XN8A 5D93B 1OK0A 2X0UA 3NRQA 1MJUL 1T4KB 4TOYL 2OYMA 1ITCA 4IRSC 4TSCL 5IROA 2KMWA 1D6EA 5EUOE 5DHYA 3RVUC 4H2CA 5EOQH 2X05A 1K4CA 5GISL 1E9PA 4Z6AT 3DRTB 5E51A 3UROR 4HJEA 4RFNC 1ZVYA 3P0YH 5GGSB 4NBYB 3WN6A 1F11A 4HS8H 4OFQA 1E42A 4LGRB 3FO2A 3W56A 2PTUA 1UM5L 2Q7YB 1JGEB 3TBYA 4GG6E 2WD0A 3GJEB 4LSQL 1MXDA 2HVJB 4NKDA 1U8PB 2K3HA 3F8UB 1IILE 4OFKA 3DGDA 1OQOA 1S7QB 2VL5B 2JTDA 4AM0B 1OAYL 4QD2E 4H8QA 2F19L 3GMRA 2MKWA 2VDMH 1QRNA 4Y5XA 4H20L 4BFKA 5B8CC 2DD8H 4Z8FH 1FV1B 1NC4B 3CFBB 4ZFFB 4LASL 3ZRCC 1BD2A 1PL3A 4JFPB 4TVPH 1OANA 1OAZL 3QDGD 2YFNA 2TAAA 1MUJB 4F7PB 1UA6H 2LTQC 1KYDA 2R83A 2X4NA 4JKPH 4E9QA 4N2FA 5DHVH 1WEJL 2X2JA 4ZFOB 1T6VN 4J3OF 4JB9L 4X6DB 3FN9A 3DVIA 4FG2A 4XPFL 1U3HD 4XWOC 2QQNH 1X5FA 4N1HB 4HIJA 4ICWA 1GS8A 1UXWA 3DX6B 2OZ4A 4EIUA 3UJJH 4PJXB 5EUKA 5F3HA 1L3WA 3PLYA 5CZXC 4UM9D 2R2HB 2E6QA 4NZUL 1BXXA 4HCGA 5DHXB 4WUUE 4HUVA 3L3GA 1HHHA 2NOYA 4JO4L 3GLZA 4EVNA 5B21A 3DUSB 4XO3A 5LCVH 1XBDA 4GI6A 5D7IE 4FADA 5I1EH 1HHGA 4L1SA 3UC0L 1BGXL 2GEQA 3D09A 4M5YH 3THMH 4KU1A 1MH5A 4QIRA 1NC2A 3L7FA 4IKNA 4YL9A 3VFGL 1RZFH 4R2GC 2UUDH 5D1QA 5D9SA 2PCFB 3M7FB 4NQXB 3E8VA 2IQ9L 4PRIE 3VVVA 3BP4A 2ZSWB 2UYLA 3QDJB 3S4SG 1IGJB 2Z91A 3U46B 4HG4J 5DVPA 2O26U 4QRRB 2ENQA 2V5TA 3CH8A 3L9RA 5E00B 4NI6A 1KBKA 5F71A 2VDLH 1SJHB 3UG4A 4RAVB 4XN9A 2Z0BA 2WV3A 2B5IC 2CIKA 3A3YB 3HPLB 4CVXA 4BQ6A 3D08A 1UJ3C 4NZTH 4PS8A 4OFVA 4HS3A 4DOHB 4PRHA 4ZX3A 1RJLB 3CDFA 5HPMA 1BG9A 2V5MA 3FUIA 5CGMA 4N0YH 2LQRA 3TJPA 5FO7B 2B1AL 5F9JA 3US1A 4KJYA 4FP8L 3GHEL 4JFXA 5AW9B 1GAFL 1FDLH 1X9QA 4Q6KA 1S9KC 2RMNA 4H5SB 2AQ3A 5SWZA 1JZ4A 3FQTB 1V3KA 3SQBA 3ENEA 2HFTA 1KIRB 4R4BA 2WO4A 2Q2EB 5JHMA 3MRNB 2EYSB 4U1GC 2FO8A 5C70A 2WZPD 3TC9A 2H9GB 5IGXH 4RAUB 4XXCC 4HWBH 4WNQA 4YHZL 5D6CA 2HN7B 5J6HA 4XCCH 5BZZA 1MAML 2V6HA 5LGHL 5T1KA 1Q0XL 3ARDB 1C1EL 1GZPA 5BS0E 4OCXH 4HH9A 2ATKB 4IRZA 3VXPB 1I31A 1JTTA 1A3QA 4NKDB 3AXLB 2B3IA 1JK9A 3C6SB 4GQRA 1E4KA 2ED9A 4OLWH 1ZTXL 2F53D 3ESMA 5K1JA 3LS4H 1ACZA 1LK2B 3U4BH 3KXFB 5ESVA 5C0BA 1YNTA 4HZ1A 1UB5B 4MASA 4WEMB 4AL8L 4DQOH 5B4MD 3IDJA 1E4WL 1S7XA 1E9PB 1CXHA 3LQAL 4X6DE 2AQ2A 1TZHB 2P9RA 2NCEA 2L3BA 2NQDA 3HZKB 1G43A 2Y1VA 3FB8A 5DJ8A 3GJFA 3MLUL 2PXYC 5ETUA 2F7OA 1FF5A 5I71B 1GS7A 3OF6D 5JHAA 3MNZB 5FIEA 3V52L 4RFEA 4GW1B 4MAYC 1MF2H 2YK1L 3B2MA 3GINA 5ADPL 4ZK8A 1HOCB 2G4EA 4JFDB 2QDVA 5F1NB 4NO2B 2NR6A 3CUPB 4FLOA 3VXOA 5DJDB 2E7HA 1RLWA 5IHHA 1GA2A 4F37F 2B0SH 5D7JC 4QRRA 2VW4A 3H2WA 1KLGA 2FLMA 4G7SB 4R7LA 5EO1A 1QR4A 5DD0L 1RZJC 3W2DH 4FYQA 2HFEB 4NBZB 5H2BB 1UXMA 3G6AB 1NDTA 1EK3A 1P4BH 2WQUA 2WANA 2F15A 3SKMA 3JVGC 4N85A 1BREA 4OM1H 1KV7A 1X7TA 1MJJA 5B7EA 3B2DC 3VJ6B 1C9SA 1F4XL 1FO0B 4X50A 5I8OL 4NCC2 4N2EA 2B2XL 3MNWB 1S7TA 2V7HB 2G75A 2R0WL 1UG9A 3F6IA 3LDBB 4MLIA 5E8DH 5AW5B 4ODVL 1CG9B 5BJTA 4WU7A 3C6LD 1WC7B 4YHML 4WIQA 5HVWA 3ZT6A 3HI5L 3LNIA 3TA3A 1ZANL 2A0LD 1K8DA 2FD6L 3GSNH 1ZTXE 3AWEA 5ICUA 3L5XL 3BXNA 3KJ6L 4YHIB 2C9RA 1KMGA 4M1DL 1XAUA 2DKUA 5IVXA 2NR6D 2BRRH 2X9XA 5EBGA 4W1TA 1KFAL 2CIKB 3S3BB 1WZ1H 2GT9B 1SOQA 5HHXH 3DIFB 4ZFOA 1XFPA 4MMZC 5JHLH 3MLPA 4MLSA 2DEYX 4ZTEA 2JK5B 3DROA 3AS3A 1NKRA 3EJYD 4G5ZL 3ULUL 2ZCHH 1AO7A 2B08A 4QRPD 2R0KH 5D6DA 4AMKH 3FF7A 5T3XL 4DUXA 4NZRH 4PY8I 4FQHA 3RIKA 1UCBH 4GKZA 2NDGA 2P5WE 2QFRA 4H40A 4L37A 1MDAA 4KROC 1TG8A 1Y7VA 4ZMVA 2HLFC 2ITCB 3JZ7A 3O9WB 3II2A 3CBRA 3Q5YA 3LZLA 3QFJA 1Q8MA 1AGBB 2H3XC 1ZPUA 1CFTB 2VB5A 4WGVB 2EIEA 2Y7OA 4H0HB 4LEXH 1I1AB 2DLIA 4M5SA 5ALCH 5E2VH 1T0NB 4I2XE 1I8LC 4JN2A 1MPAH 4JM2F 4Y1SA 3UXFA 5IHWA 1PKQB 2YPLE 4HPOH 4W9KC 2F1BA 3BESR 3OHMB 4B7LA 1WFUA 4JMXA 3Q3GB 4H1LA 4J4PD 3TA4D 4KV5F 5I71C 3QJOA 1CZ8H 3EYOB 3QIUD 2X4QB 4UOJA 1IGTB 1KEML 5CN2A 2FSEB 5DS2A 2Y7NA 5E99H 2FEDC 5DS1A 1D5RA 1KENH 5B22A 3TGXA 5C0DB 5I1KH 2ZIDA 3MV9B 1KLFB 3HW7A 1MI5E 3LSOB 2HUHA 1U3YA 2GBTA 4N0CD 4A2EA 2ZT9C 4U3SA 3WFDH 3MI6A 2WBXA 5D5MB 2YRLA 1U8KB 2JB6A 2QLVB 3WAKA 3A6CH 3HNSH 5F7EH 4NGHH 4EZLA 3P9MB 5DRXA 3ZKND 2DQFB 3FU6A 1I8LA 1HIML 1QFUH 3OR6B 2VT0A 2PN5A 4XP9H 5D2LA 3W57A 1LYQA 3Q8BA 5K69A 3WXWL 2DQDH 4HK0B 3EOBA 1MG2C 2EKSB 3EYVA 5DYOB 5BV7C 3IFPA 5JPNA 1X5YA 5AEAA 5FXCH 1UWGH 3H3KA 3BKJH 4YQXH 4ODTL 1YMMD 5CN1A 3WG7B 4AH2B 3T4AC 2WTRB 3IJSB 4PJGB 5TFSL 4U6HA 1XR9B 5BZWB 2CHZA 1IGFH 2J6EH 2Y36L 2HRGA 3MRLA 3P3RA 2YRZA 2LU5A 4MB1A 4LP4A 3FDWA 4N0CC 3TCLB 3PL6D 1U8CA 2K6WA 1J5OL 1NUNB 3DYPA 4I5BA 4U6VL 4HJGB 2IAAC 1BECA 2F5AH 3GT6A 4PRPD 5DHYB 4PJHF 2FEDD 4D3CH 1T1YA 4PJAB 2Q76A 3DRQB 1E4XH 2GJPA 5FF6B 1QASA 1SHMA 1XMEB 2QPEB 1MHHB 4NN7B 4PJAF 1MEXL 1TQBC 3QSKB 3QIUC 1CFBA 4FXLA 1QW8A 1FNFA 3QDAA 3HTLX 5FO2A 5AZEL 5FYJD 2D3VA 2ZUQC 4HC1L 4JGJA 4RRPA 2ZWYA 3M1OA 4MSWA 4QRTB 5KWYC 4E42B 2PYEB 4B3EA 4AC4A 5I73C 5F6HI 2WLJA 3U1SL 4EDXA 1A2YA 3D25A 5GRVK 2BMKA 2YMOA 3GSOA 1IQWL 3GSQB 4N2NA 3SBWA 2XWCA 4Q9QH 4JPKL 2GY5A 5I2IA 1I9IL 1A8ZA 1GZQA 3QUZC 4MZRA 2WB1A 3TL5A 3PP4L 1JMZA 2EDBA 4PJCE 4XN5A 3MJ6A 3PAVA 2AV7B 3C8KB 2HLFD 1FC2D 4E5XB 5DU7A 3EOAB 3ZGIA 3H7BB 2Q8AH 4FN0A 4FI8A 2BNQA 1S9WA 4X4YB 4IK6A 4OCLC 4BZ2H 4YSRA 1JFHA 1TSHA 5ACLA 7PCYA 1EFXA 4HCRA 1RUQH 4Y1AB 4HHWA 2A74B 1GC1C 4BXVA 1FYTD 3PGDB 3VXRB 3EJYC 5DVMA 3BVUA 4R96A 1EEZA 2NLJB 3MROB 3N44B 3K6IA 4Q52A 3IRCA 2J6WA 1XF3A 1KG0B 1L0QA 3J7HA 3QB7C 5H94B 3CZSA 1EANA 2ZQKA 4KJPD 3ZE1B 4YDZA 2JIXB 1SHWA 3WEMA 2FIRT 5TE6L 1DDTA 5TH2B 4C56B 4XAWH 3UMNA 4JRXB 4ZPTB 2EUZA 1MFEH 2A0LC 2R0LH 4JAMB 3BUBA 1OWRM 1JRHL 3C6LC 4NAJA 2YSSA 5KANG 1VPOH 4XB3A 5DQDL 2F7IA 2CKBA 5LGJB 4AK1A 2CKBL 3TJEL 2J1WA 3DMMB 2XV6B 3BRGC 5DVKA 5J12B 2X9YA 3S88H 4N8UA 4S2SB 2R1YA 1KBVA 1D5ZA 4JRYD 2Q6WB 1KYFA 3JV4A 5AW4B 1EAJA 2OXGA 2YLKA 3EOTH 1E65A 4ZT1A 3IFOA 2VLKB 5BW7A 4GAYB 4KHXL 4OD2B 2HJKB 3WGVB 5HBBA 1MY7A 1KCVH 3L1GA 3CMGA 3IMRA 3FQRA 3PHOB 4EI0A 5D7HA 2J55A 5F88A 4P5RA 1M7UA 2XICA 4W4NA 3ROLA 3O3AB 3UJIL 3KXFE 3PJSA 2WK2A 2VUKA 4HUKB 3APNA 1URIA 5L8LB 2XTSA 2O1AA 3EIFA 1KSRA 1T7XA 3D2UB 3VFRA 4RA0C 2XA8H 4MD4B 4NRYB 3UTTB 4AZUA 4K3DL 1A4KA 3KPTA 1O9ZA 2VXUH 1EJFA 4X7SH 3FTXA