4ZMWA

Crystal structure of human p-cadherin (enc-x-dimer)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
213
structure length
213
Chain Sequence
DWVVAPISVPENGKGPFPQRLVQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Cadherin-3
publication title Adhesive Dimerization of Human P-Cadherin Catalyzed by a Chaperone-like Mechanism
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zmwA01
4AXWA 2OMUB 5CO1A 4XXWC 1ZXKA 4NUQA 2QVIA 1EDHA 4XXWA 3K6IA 1NCJA 1NCHA 5KJ4A 2X2UA 4ZT1A 2OMVB 3LNIA 1ZVNA 4NUMA 2WHVA 3FF7A 1SUHA 4ZMTA 5CZRA 2OMTB 3K5SA 1NCIA 2YSTA 1O6SB 3LNGA 3K5RA 2OMXB 2OMWB 2O72A 3LNDA 3MVSA 4ZMPA 2OMYB 4APXB 3LNEA 1Q1PA 2QVFB 4NUPA 3Q2VA 4ZMVA 3Q2NA 4ZMOA 2YQGA 4APXA 2WBXA 3UBHA 1WYJA 2WCPA 3LNHA 4AK1A 4AQAB 2OMZB 4ZMWA 3UBFA 4ZMQA 2A4CA 4AQ8C 5JYLA 1FF5A 1WUZA 2WD0A 4ZMXA 4AQAA 3PPEA 3Q2WA 4AQ8A 3K6DA 2V37A 4NQQA 3UBGA 4ZMYA 4ZMNA 3LNFA 4ZMLA 1OP4A 4AQEB 5JYMA 4ZTEA 2A4EA 3Q2LA 4QD2E 2EE0A 5DZVA 4AQEA 3FF8A 4ZMZA 4ZI8A 4AXWB 1L3WA 1NCGA 3QRBA 4OY9A 3K6FA
chains in the Genus database with same CATH superfamily
2YGQA 3D0VB 2VQ4A 3LS4H 4UDUB 2I07B 5DS1A 1H3WM 5GIRB 1T0PB 2RGSA 3NABL 1TNNA 3X1EA 4HK0B 3LDBC 1EV2E 2X88A 3U9UB 1X5KA 3DV4A 3D12B 5KS9B 2FEDD 5LGJA 2PF6A 2VERN 4ZNEA 1A3RH 4XP6L 4DP8X 2GEQA 3WENA 1UXWA 1SHMA 5FW6A 1FI8C 4N2GA 1JVOA 2F7IA 2VWEC 1VZHA 3NJXA 1QPXA 4UOQA 1EAPB 2DZEA 2XYBA 4KKLD 1HESA 4XXCA 3X12A 5IEKA 2EADA 5I8CB 2JK5B 3MROA 3HI5L 4OD1H 4UV4L 4A39A 4Z5RA 1JGLH 2UY7B 5FB8B 1A6AB 2BW4A 1IE4A 3ZT5A 2GJPA 4G6ML 3JV0A 3NG5A 4YXHL 4GG6A 2G30A 1PLCA 4L8BB 5E5MA 3T0EE 3WTTA 3S36L 3DJTA 3WIIL 1FE8L 4KX7A 1OSPL 1D6VH 2VC2H 2BJMH 2X89D 1OAXL 2M1KA 1O6SA 4LCUA 5E4OA 4G6KL 2ZPKL 4R0LA 3Q5YA 3PE9A 3X3FL 5KYUB 4GOSA 4G7QB 5H8DA 1SXZA 3BKJH 3P4MB 3WIHH 5DJ8A 4KXCA 2I9LB 3BYTA 2CMRL 1NKOA 3FCGA 4RFNB 5G5DB 2FUQA 3MXVL 3C2AH 5EO0A 1O9WA 3EYSH 3RWJA 4AIZA 3IN2A 3QUGA 4ONGL 4P2RE 4XX1E 3H9YA 2DQEL 4NGHH 1DVSA 2KL6A 1IGFL 4MMXB 4QR7A 4Q2ZB 1ETZB 4JFYB 3QDJB 2ORBH 3ZMNA 2WXQA 4E5XA 3KBEA 1ZLEA 4NENB 1M9WA 1YPZE 3ESPA 3MOAL 3PL6A 4P4KA 1XF4B 3QFGA 4JPSA 3B5GA 3GSRB 4DN4L 4HOWA 4UT9L 1CF8H 1XVSA 3IFPA 2BOLA 2IGFL 3U4BL 5I1LA 1TLMA 4GKOA 3SPGA 3QIUB 4N5EC 3TN0C 5GJTH 3QUXB 4Y5VB 1Z9PA 2Y22A 2QZQA 1MIEH 3VG9B 3NSFA 3P77A 2C9RA 3BUDA 3CWGA 1Q1JH 4IDJH 2Z9TA 5A3IC 3LEXA 5KBPA 1D5XA 4N8UA 1FSKC 5K59F 4X9GA 1CDUA 4WO4A 4L8DA 1TQCC 1E8WA 5I1DB 3MR9B 4PUBH 4XC3H 3PWJB 3T0EC 2LLNA 4YPJA 3B2UD 2XBDA 4X5WA 4PJDF 5MEQB 1SYVB 5ADPH 3E2HC 3EFFB 1KB9K 1A1NB 1LNUB 3DDGA 2VDQH 2KLTA 4JDTH 3APFA 4LRIC 5FKAB 5C1MB 4M7LH 3K2UL 5CO1A 3FO1B 2XA3A 3TESA 1KBKA 5FC9A 2E7LC 3GSWA 5CSBA 3SZKC 2J57A 2V7NA 3QQXA 1NCTA 1BJMA 2EYRA 4XMXA 3ZKND 3V0VB 1CPUA 2ITDB 2P42B 2ZSWB 2AMUA 3IWVA 1Z9SA 3ZO0A 1NKGA 3PL6D 2NNRA 4K55A 4P4KD 5AW2B 4OFIA 2P80A 3KNBB 4UNTA 3D69A 4WW2B 2P28B 3US1A 3UPCA 2FJFA 4HF5H 3OL2A 3FH8A 2ETWA 2K7QA 2EIZB 1UM4L 4JFPA 4NZRH 4HWBA 1P7QB 2K6WA 3QA3B 1L9PA 5HYEA 4UNIA 3HFMH 2FATL 2DV6A 3BAJA 1W6LA 2CHDA 1F11B 4MCNA 4WFFD 4WO4D 3VXRE 3ILQD 3OR6B 3KYMB 5GRVL 1GC1L 2GUOB 3HAEG 3HS0A 4B3EA 3FSZA 1TU2A 1R5IB 1FVDB 1GGCL 2G3XA 4ODHH 4DIXA 1H5BA 3GBMH 3DURA 4JRYE 3L3KA 4S1SH 4K9JA 1ML0A 2HA1A 1SDYA 2EDTA 5C0FB 2BP3A 3P54A 3T5WA 3HAEH 1H3TA 4CVXB 4DCQA 3ARDA 3D05A 3PQYA 1GA2A 1N59A 4R7DB 5JHLH 1BQLL 3TZVC 5TQ0H 2R4RL 4X50A 5IB1A 3WKML 4ZQTA 3EOTH 3D6GA 4EUPG 2WWMC 1QR4A 4YFLF 3A4FA 3HPJA 2B1AL 5EU4B 3B2DC 4JFQB 1PAMA 1N6VA 4LNVA 5HDOA 2CLZA 4NO0D 4XBPB 1RURL 4K9EL 7PAZA 5JPNC 4DGVH 1EZVY 2OA9A 2P80D 4L5FH 2V6HA 5ADOH 3ATAA 5CP3A 3Q8CA 4JFFB 2LAGB 1BD2A 3ORJA 3MU3A 3UZVB 5FKPB 2QDWA 4L4TA 5B3JF 3ZUCA 3NJGA 1PQZB 1H9VA 4NJAL 2FYYB 1TF4A 1U9KA 1CD0A 1U3HB 1YJDH 4EZKA 3G6AB 5J7CC 3AU0A 3LRKA 4PJHF 2FBJH 3ZIYA 4ZI8A 5I23A 1EBAA 5MENE 3EYUL 3E6FB 4KZEL 5CEXA 1MHCB 4H8WC 2OYKA 4M56A 5F7DA 1PDKB 3LB6C 3L7EB 2AJSH 3QEQB 3D06A 4FXTA 2YD2A 4GBXA 4KTDL 5JW5B 5J13B 3EGSA 3SDDB 3AG4B 1AJ7L 1CJYA 5E1HB 2XHNA 4MNQA 4PFEA 4EN3A 3ARDD 2DMKA 3TWCH 3PQYD 3IDJB 2OMUA 3X1GA 3QPQC 4HIQA 3RQ3A 5DHDA 2CRZA 3JV5A 1FNHA 1T66D 2HJFA 4JCWA 4K7FB 2FJHA 1BQ5A 1A5FH 1QYGH 5SWZE 1N0XL 3HNTL 3MYZA 2FNWA 4GKSA 4N0UB 1QSEA 4YQXH 5AZUA 3T6ZA 4WU5B 4QI3A 1MCPH 1SEBA 4WFGD 1WBZB 4GAJH 4MYPA 4P5RA 4ZUTA 3IETA 5T3ZE 3U0TB 1BF8A 2IPUK 4XODA 4O2FA 1KY6A 3VD7A 4L3CB 5HPMA 2AVGA 3MBEB 1BD2D 3RHWF 5I8OH 1D7BA 1TVHA 4YIQA 1HDMB 2IJ0C 2XRAL 1WIPA 3BP7A 4L4TD 5JIPA 3MBXL 2HVKB 5DJYB 1HHKB 2CR0A 2DLHA 4WFHD 1LO4H 1RULH 1TZOA 3ZYZA 1T21A 3LCYA 4NZTH 3P4OA 5B39B 3W38A 4RMUA 4OLVL 4NP4H 4MSWB 4M1GL 3ILDA 3T4AC 4WI5A 4I0PA 2OV0A 3ARGC 2KKQA 3INOA 2JB5H 4FHJA 1MWAL 5HJ3B 4PBWD 4ZPTB 2OX5A 4HD5A 5J6HA 3M88A 1NAMH 5F9JB 15C8H 5TDPB 4U1LB 3GINA 4MNQD 3RHWK 4EN3D 1U30A 2EDDA 4PP1D 2FJSA 3IKCB 2Q8AH 1F4AA 1J9QA 3Q2WA 1BM7A 4HUKB 3NCCB 4AM0B 4UT7H 4LL1A 3FNKA 3VE0B 4HEME 1HIML 2FH8A 3RJQB 2VDOH 5ISZB 3DUSB 2BVQA 4M8QB 1JZGA 5ALCH 4BH7B 5CJ5A 4UOJA 1QSED 2JJWA 2E3VA 5IHUH 2EILB 3ATFA 2R1XA 1ZD6A 4HK3J 5F7EH 3LH8A 3TO4B 4LQ1A 1D7DA 2R1WA 3ZOAA 4XMPH 4RNRB 5DHVB 2EABA 3IAGC 4FNLL 1P2CA 1RK0B 1PKQB 3G6JA 1TPXB 3SGDH 2C3WA 1MEXH 3T77B 2X2IA 1T1XA 4JJ5B 5E1AA 5CZVL 2Q8BL 3MLSH 4FYSA 1KB5B 1CTMA 4X5PA 3QUKB 1NBVH 3M46A 3ARVA 4NKIL 1IBGH 3F64A 4NKMB 3VX0A 5KVEH 2BX5A 1IAMA 2WQVA 4I0PD 4FRWA 1Q0XH 1YN6A 3B56A 4L29B 4LF3A 2JI1A 4GRWE 2JIXA 3WNMA 2UWEB 3IMSA 3VFGL 4P3DA 5K39A 1AS7A 1A6TB 2IFGA 3WTUA 2R83A 5DT1H 3CGTA 1RV6X 3UYPB 5BV7H 2IPTL 3TS8A 3JWNH 1CGVA 1AR2A 1J1PL 3TXAA 3LHPH 1ZVSB 2Q7YA 4LLVB 2DQUL 3FTUA 1KIUA 1Q72L 5EOTA 5CNHA 4HUCA 3D4GA 2F7QA 1J0KA 5DTFB 3G9AB 3MRMB 4L0PB 5D1XB 4E9LA 3WEOA 1EZVX 1M42A 1Z5YD 2JCWA 4WTXA 1HSAA 3DDFA 5A2CA 4JLRB 3VCLB 2Y7QB 3GMLA 3KLAA 2ZWKA 1K9TA 5DJAA 1T0NB 1VEMA 2NLJA 4E0RA 2XQ0A 3H1ZA 5JIMA 3C5XA 5HI5D 5HDWA 2C3GA 5CJXC 4U1NB 4P5MB 1ZGLA 3H7BA 4JZJA 4QRRE 1JPGA 3MKGA 3UMTA 4JFEE 1CTNA 1ZHLB 2V2TA 3CVIH 4BSVA 4IKNA 4JG0L 4BFEA 1CU4L 2OZ4H 2Z8RA 3EUUA 4OGZA 1J88A 5CF3A 3GUTA 1AI1L 1I9JL 3TT3L 4MA7L 4FEMA 5B1JA 2CBMA 3P11L 1UXSA 2JIXD 1F6FB 3U2SA 3JV4A 2Y1YA 5HDBE 3ABMB 5IK3A 4AM0Q 3NJJA 3SOTA 4L4VB 1ZLSH 4RGND 1U8KB 2KZKA 3RE0A 3I75B 4PMFA 1SXNA 3FB8A 2QVMA 3GYRA 3EFDH 1QRNA 3VFVB 5F9WB 3DTXA 3OG4B 4NI6A 1FL6A 2VLJA 4MXQD 4HWNA 1TOXA 2ADGB 1M3JA 3GZQA 4QRFA 4M6ML 1OHQA 4HW6A 4OZHF 1HCZA 2Y25A 3Q8EA 2GCYB 1YY8B 4J1UB 5F71A 2IPKB 2BSTA 1LVEA 5BZDA 1I3VA 1BHGA 1UJ3A 2P4AB 5C6WH 3HPLA 5D7JB 2DJ4A 5C07A 2WXMA 2DL2A 3BP6B 2EACA 3MUY1 4KUZH 5FLUA 3AUWB 3F7YA 3FN9A 3O3EA 3OV6A 1HXKA 4UZUA 4QHMA 4ZO6A 5E9DE 5CD3A 2QHLA 3TN0B 5I1JL 2LU5A 3VGBA 1IJNA 3BVVA 2R0KL 3N0AA 4P5TA 4YE0A 5E2WL 3TYFA 5AKSA 5LGHH 5C7XH 2EICA 2VKWA 1H0DB 2CRYA 2WOYA 3VQ2C 1FSKB 1G7QB 2A73B 3NEEA 4Q9BA 1TQCB 3SKOB 4CDGC 5I8KH 3T0EB 1U4FA 2DQGL 2OZ4A 1IT9L 1WK0A 3H3KA 3E2HB 3PJLA 4X6BB 4Y19A 5IZ7A 4CRPA 1AP2B 2YLHA 2J1KA 2WHVA 1AQMA 3MA9L 4X6CB 3G5XB 4IBSA 5IMLB 3I6GA 3QW9A 4YO0A 5B3NA 4WY7H 3EZ8A 4NQXB 3VGDA 4ELDA 2IFFL 1QRND 1NCIA 1L6ZA 1M57B 3A5VA 3RFZC 3T0AA 1J1OL 2VLJD 2X0VA 4MX7B 3IU4H 1R46A 2Z35A 3C5ZA 3VFMA 3DKHA 4DQAA 4P2RB 5IKCA 3G5YA 3M17A 1DLFL 2V2WB 2OMYB 4LPXA 3O3AB 4JY6A 4Z3JA 4I77H 1YPZB 4Z76B 3Q2VA 5C07D 5B38A 3GHBL 3PHQB 2A6KA 4EQ2A 4HVBA 2W65A 3HS8A 2PABA 1EFXA 3C08H 5HHVH 3MUJA 4LEXH 5HBBA 4PW9A 3B4NA 3RY5A 4P5TD 3WN5C 4DJMA 5IMOB 2B59A 5EN2A 3MLTB 1UD5A 3WI9A 4H1LG 2WN3A 1N8OE 5F3FA 3JWOC 1NAKH 5CUSH 4DK6A 2XWEA 2GT9A 3AU1B 3GSQB 3U82B 1ZT4A 1KCRH 2BY2A 5E8DH 4LCWB 5C0ND 4PJGF 3SYOA 3X3GH 2K8MA 1A4CA 4Y19D 3EG9A 2RALA 4YHLH 3L3JB 4X8JA 5LAXB 1OY3B 2CDFA 3FRPA 4X6EB 4ZD3L 1RJZB 2KMWA 2DS4A 3JZ7A 1T3FA 4FFVD 3UFIA 2R0ZH 2OULB 3BZFA 4TLKA 4PTTB 1M56B 1K85A 3TZVB 2WBKA 3AACA 3SD5A 4PJCB 5IR1B 5EIIA 3REWA 2E8ZA 3C5ZD 5AVRB 2VR9A 5FYJL 1YC7A 1ZSDB 3GLEA 1U21A 4ZW8A 4MXWL 2ODIA 5LWYH 5A2AA 4JHAL 2MPAH 3QRBA 4MCYB 1FFTB 3U4EA 4FFZL 4QNPF 3LH9A 3VU2A 5GJSL 1R3IH 4NNXB 2FWUA 1GJWA 1KEML 1N5AB 2IOOA 1EFXD 1F90H 1WCBA 4FF9A 4JQXA 4O00A 4UMSA 4XBMA 5E0FA 1L9OA 2JJSA 2WV3A 2W91A 3ZE0E 2EXWC 1OZUA 3WNNA 4KKCC 2H8PA 3LKOB 3Q2CA 2ZX8A 4Z7UE 4ELKB 4PP2A 3EIFA 2PCFB 1ZDQA 4R8WH 3I9GH 1WTGT 2QPUA 5IB2B 1KB5L 3ETBJ 4F1ZA 3EDKA 3OAZK 4OSUL 1DQIA 3MXWL 3UTZB 1FL3B 4G43A 3N41F 4MKMA 1P1ZA 2WB1A 3VXRB 5GGVY 5ALBH 4DF9A 3OZ9L 2HTKD 1NIEA 4FQJH 1DUZA 2OMVA 2GTZB 4ZG1A 1O6VA 4GQQA 2WUCL 1BFOB 4HCGA 4LT7A 4J3SA 1ORQA 4QMEA 1A02N 4JRYB 4KX8A 5F3HA 2WK2A 4UB0H 4XPFL 3MREA 3NJHA 1TR7A 2YPLE 3QCUL 1O9VA 4W6WB 4WIQA 4XVSH 4J4PC 4F8LA 3LPOA 3WFZA 4JK0D 4C57C 1Y6NR 3LZNA 1X7QB 6TAAA 3ZLQC 4TUJB 3CDCA 4IRZH 2DYPA 4IBZA 4DGWC 2P5PA 2FVNA 1SJHA 4OKVB 2DYRB 3A22A 2WWKO 1ZTMA 3WY4A 5CGTA 1AXSB 2DBJA 3AXHA 4JPKH 4BDVB 5I6XC 5ESVB 1ADQL 1KIPA 4U1MA 2QSTA 3RY6A 5CLWA 1TZ8A 4NQTA 4NQDE 1DDTA 3VRIA 1F45A 3WE1A 3KPNB 2AJ3B 3ATBA 4S10A 4YHPB 3VQMA 4PGEA 4ANUA 4X9BA 4RZKA 1B0GB 3PWUB 2X42A 4TQIA 4UBDD 2K9UA 1JL8A 1PFOA 3ZHDA 1BMGA 5ID0A 1NDGB 4LCIH 3T4AB 1YYLL 4AZ8A 1VADA 2CCLA 5J1AA 4TQHA 5D71H 2FIKA 3CU1A 4MNGE 1ECYA 1NEZB 5AOJA 2QR0A 4LAQH 3FQWB 5EZLA 3QO0A 1RIHH 3U7AA 2BIQA 5BRZD 3O4LA 2HRGA 4HWZB 4QLWA 4N2AA 1SJEB 1WFOA 1S7VA 3OQRA 5DLMH 5KSAA 2DIEA 3JVGA 2QLVB 2CALA 1SDAB 2BOCA 2UV3A 4LPVA 3SCMA 3RWEA 4A2GA 1JJUA 1J5OH 3HG0A 2OR9L 4GXVH 4YUEH 1YEGL 3VTAA 1ILSA 3DSNA 4ZS6D 2DYPD 2QQKL 2BSBA 1WZLA 1QW8A 2WQXA 4GXUN 5EU3B 2CUHA 1D5ZA 1IBZA 2JQZA 1S3KL 4MDIA 5H94B 4GQZA 4I5BB 2CUMA 4PYHA 3ZVVA 4PY8I 1H15B 3M8OL 4XP1L 3U6XS 3VFUA 1G5GA 4ILDA 5EOCL 1RUAH 2R0LH 2YC1B 3D4ZA 5KJ4A 3Q8FA 4XCNB 4A68A 1EO5A 1G7LB 2DQFB 2HG5B 3OX8B 3V6BR 1Z9NA 1LO0L 1VAHA 4L1DA 2BW5A 5DZNA 3AAZB 5AUMB 4JHWH 1YYMH 5D7HA 4AGPA 1KTDA 2F9BT 2FX8L 2FZ3A 4PJBF 4F58H 5TGBA 3BISA 5AALA 4LU5H 3O4LD 4Q6YA 3VWKA 3MKKA 4G9FB 2B15A 2ICWJ 3L3IA 4Z1PA 1GZPA 4RMSA 5KSAD 1KV7A 4XAWH 1NCAL 4Q8BA 4L48A 4JDZB 5I9QB 2A4ZA 4JFHD 4HS3A 4BEIA 3C8KB 2MNJB 3CFDB 5IW3A 1MF2H 1HNFA 2F7RA 3SCMD 1T0MA 1IC7L 3QE5A 4R7VA 4LRNH 2BVOB 2G0LA 3VXSE 4U1IB 2CKNA 3VI3F 2VL5A 5HVFB 1ZA6B 2IH1A 1AGFA 3DPBB 5DJ6B 1E4KA 3RVXD 5K9QG 3FUFA 4AQAB 3BUIA 3ILPA 1U91B 1Q4NX 3TTYA 2EEDA 1GCYA 4HIXH 4NRZA 2HT3D 4AYFB 3LRSB 5FF6B 1KGIA 2QPFA 4HLEA 2VDRB 1F13A 3HC2A 3R0MA 2BSRA 1XGQA 4QO1B 4BUQA 4MD4A 4R7NB 2WQ8A 4UF7C 3O8XA 3ECUA 4WCYH 1G9MH 1M4KA 1A4KB 1EGJL 1RJYB 1U8JA 3HBQA 2B77A 3OZKA 3ULUF 3NSXA 5IGXH 2EZ0C 4I4WB 4BFRA 2CJ3A 2WN2A 3UG3A 4CC4A 2VDKB 3QHFH 1K3IA 2Y7SA 3D8MA 4I48A 1DL7H 3VX1A 3QB7C 1S7TA 3QC6X 5IFAH 4HFWB 4LOVA 2KT6A 2C1PB 3VWKD 3HKZA 3T8VA 2DQTH 1ICTA 2D3LA 1BQHA 1S6NA 3E8UH 3GNML 3JTSB 3NACL 4U6XA 4P05A 3I3EA 4EQ3A 5F89B 4GRWB 1RZIA 3BWUC 2XDHA 3KDPB 5DQ9B 3KLKA 1AZVA 3RNKB 2VUKA 3L16A 1EHAA 3RVVD 3SQBB 2P48B 3RPBA 4MB5A 3D2UB 3VTMA 3OR7A 3MJ9H 1XT5A 5BQDA 2A83A 3B9KB 1T7YA 1GW0A 2UXGA 2VM3A 5GGQL 3MJGX 5IW1B 1SLUA 4JM4H 3WXVH 1XIWC 3WFDL 4N9OB 5A6LA 2B3IA 1FN4B 4QWWC 5CEZL 1UZ6F 5CN1A 1KSRA 4QDGA 2VXVH 2VW4A 1BIHA 3BIKB 4F9PA 3BLKA 4UM8A 5L2JB 4F9LC 4BSWA 1DQMH 2DEWX 5JOPE 4YSUA 3O8XD 1CUOA 3GJFH 3VFOB 2KERA 1S9VA 1XF5A 5D2LE 1OV8A 2KUTA 5T1DL 1GGBH 1NTDA 2BDNL 5DGQA 1YO4A 3ZDWA 2IADA 4MA1C 2E76C 3SPVA 4HAGA 2A9NH 2KBGA 1MSPA 3MA7B 3K6OA 3WEAA 4D0DB 3PFQA 3FOLA 3H2PA 1DEEB 4IKIA 3K74B 3VDBA 4XMVA 2DM3A 4PJ5A 3WS6A 4QRRB 2AJYH 4U3SA 4BSJA 5BOZG 4JFEB 3T2QA 1BYNA 3QQ3A 4TTDD 1DDHB 2P52A 1IGTA 3LNEA 1XHHA 3ALXA 2ZIDA 5LN4A 2OJEA 1DSYA 1AZRA 4H8WL 3G08B 4I87A 1K2DA 1XZ0A 4XAKD 4Z77B 1PNDA 2HUHA 2XFGB 5HDBB 3B8SA 4FFTA 5D1ZA 4BK8A 1ZVYA 4AE1A 3G04B 1N0LA 5BVPH 2QMKA 3L5WB 1E28B 4JPVL 2YAPA 3RAJL 4Z0XA 3RFZB 1GOHA 3UTSB 2F19L 5F93C 1SBSH 1KFAH 3GSOB 5GS2D 3NT0A 5E5UB 1LO3H 5LLIC 2HWZL 2UY6A 4FXKB 3H9SA 3QIBC 2E75C 1YMMA 3EBAA 3SE3C 4B27A 5HYFA 4OZGE 4Y2DD 4TM9A 1JZ3A 2C7UB 5ELIA 4LVEA 2GTQA 1NDMB 4ODUB 3QFDA 3KG5A 1B4LA 4Q89A 1HL4A 1I31A 3AG1B 4QHKI 3V5DB 2ZCHH 2GAZB 2WINA 3EYQC 2PXYA 4NCDA 1KBWA 4O2EB 3WE6B 1IFHH 1CXHA 4RVBA 4HOXA 1Z9MA 3MODL 4C4KT 1TEGA 3GJFA 4RWYL 3WN5B 3GSUB 5E9DB 4IRJC 1J9TA 4G8EA 5DD1L 4LSQH 3V8OA 5CN3A 4HOZA 1TXKA 2A38A 2JCCF 5G55A 4YXLL 3KPLB 4PJ5D 1B3JA 3SBQA 4AYDC 3V79C 1K8IA 1VFBB 4ICWA 1IQDB 3GMNB 4W9DC 1L7IH 3D85A 4L3EB 4HV8B 2ZKXA 5BRQA 1RZGB 1R6VA 2CXKA 5JLZA 2FTAA 1SQ2N 1UZ8A 3QYNA 2YK1H 4LSRH 5DMKA 5FW7A 3BD3A 3FB5A 2CCWA 2DD8H 5FAAA 2F8IA 5D1ZD 1YNKH 1I82A 5I71C 3AXLA 1A7PH 5EPMA 1MHHB 4DWHA 1BLNA 1AS6A 2H26A 1K6QL 1RSYA 2AP2A 3SEPA 3ZUNC 3KWXA 1IM9A 1H8SA 3RX8A 3UG4A 4LXFA 1NGQH 1B6DA 1CE6B 4KI5F 3EO9H 4YMPA 1Z66A 4M6NH 1WJ3A 3KYOA 3OAYH 3H9SD 5D9SA 2ROXA 1YMMD 3UPRA 5IT2H 5CR1A 2H3NA 1TQUA 1FFOA 3GI9L 3GSXA 3LZFH 4MD5A 3QYMA 3CZFB 2PTVA 4IOFC 5B7EA 5L2KA 2AFNA 2DM4A 4LLDA 4ZJ9A 2NQDA 3AZUA 1P4IH 1FQ9C 2VN7A 3RZWA 4KKAC 2PXYD 5T3ZL 4NDMB 3AADB 3LIUA 4HC1H 5GSRB 1NEUA 2HFEB 2YXWA 2HAZA 2PW1B 1IKFL 2NY5H 3GC3A 2FUTA 5IFHH 2WZ5A 1FZKA 3LQAC 3R4RA 2D7PA 4PLOB 4W9JC 4B41A 4G7YH 4WV1A 1PLAA 4RISH 5BVJA 3RB7A 3ZU8A 1KT2A 1KIQA 2XI9A 1EIBA 3O9WD 4PGBB 1UXLA 3DUUA 3D85D 2AEWA 2JB6B 2HVJB 4UINH 1B90A 1R5WA 4P5KA 4APXA 2AXJA 3PJSA 3TEXA 1KJ3L 3W9EA 2XOTA 3FT4A 4WFGE 2DW5A 3BQUA 3NCYS 3Q1SL 1LTXA 4KJQD 3WEXB 4ES8A 3EXJA 5DZ9A 5I5RA 4PGDB 2Z31A 3GMRA 4X5LA 1OAQL 3QQDA 4JX0A 1IM9D 1SJXA 2N59A 4JG9A 1MFEH 2XVGA 4H40A 4C83A 4H8HA 4NBYB 1KCBA 4PV8B 3X14A 5FPIA 3IMWA 2CGYA 4UYQA 4WFHE 4NQCE 3T6QC 2AQNA 1OT1A 4JUSA 3HLAB 1U93A 1CB4A 4RAUB 5L2KD 1U8HB 2MCMA 1OL0A 3ZGIA 2YGNA 4IJTA 4G1MB 2QADD 4MAUH 5D1QC 1AXIB 1DJGA 1U8MB 5HD8D 4BFKA 1S9XA 3FO2B 4LCCA 2K7PA 1ETA1 2X70A 2VDRL 3AQZA 3KGTA 4P3WA 3NN8A 2XKUA 1GVIA 1XGZA 3CFKA 3QORC 3JTTB 3P3YA 5D1ZI 3QEHA 2GFBB 4HC1A 2N7SA 4K07A 4NKOB 4NPYB 4DKTA 1FH5L 1W0WB 3VI4F 1MCNA 4Z7UB 2LR4A 5HHNB 2W0PA 4MA8L 3ZSTA 1QEWA 2Y9RT 4RFEB 5BO1L 4JREC 4K3EL 4QYAA 5DHXB 5CJOL 4YDVA 4CGTA 2VDKL 1IKNA 2HKFH 3PHOA 4UAHA 5SWSD 1KCWA 2YEZB 2KDYA 4HCIA 5I5IA 4ZFOA 2CDEA 1FO0H 3F04A 4PJFB 1GY1A 3OZLA 4DZBB 5FHBL 2R39A 3BQUD 2IGLA 3HG1A 2Z31D 1SHWA 3OB0K 5E6IB 3GB7B 2XX0A 4H88L 3AS0A 4Z7QF 2X6AA 3L9YA 3JWDC 3L1OL 4G6JL 2K1MA 2F53A 1DBKL 4PD4K 3FUNA 2YPLB 3H4HA 1E67A 1B3IA 5JZ7C 3UADA 4NYLB 3CUPA 3WJLA 4LEOB 1NMAL 2NZ9D 4LKXA 1WC7A 3CXDH 2L8AA 5EV7A 3PRZA 2VL4A 2N56A 1NCBL 4X80H 3NP4A 1F18A 2AJZB 1MVUB 1BAGA 1LO2H 1XGPA 1QSFB 4PJAF 5CIPH 5ES4B 1X3DA 1PL3A 3OGCB 3T2LA 3GS4A 4NQDB 2QKSA 4OJFL 1IC5H 1DJIA 5E8PB 4TL4A 2OMWA 1A4BA 3X17A 2EE9A 3MNWA 1NOAA 4ZAKC 4HIPA 2DQDL 5GRUL 3U46B 1J5IA 2V5RA 4L8SC 3UG5A 1ACYL 3UJJL 2A9CA 5KBDA 5AVYB 3OMNB 1NOFA 4JRFA 4MNGB 3WTXA 1C08A 2VZ1A 4ZZKA 5C0GA 3VWJB 5HHPB 3HG1D 1ZTXH 1P7KA 2W5PA 2LU4A 3RX9A 3T08A 4BCZA 1Y6KR 2PPEA 4NQQA 3PWNB 3B2VL 3F12B 4N0YH 4Y4HA 2BNRE 2ITCA 4ZW7A 5IG7B 2F53D 5IOPA 2Y06L 4IHOB 3WFBL 3HB3C 1T7ZA 1K4CB 5EF1A 5FA4A 5DUMH 1S7SB 2JCCA 5EORL 3ZKXC 3QEGH 3ZHKA 5BZZA 4OW6A 3F7PC 3MGTA 1FLRL 3MBWA 3HZYB 1W8NA 2C3VB 4RLDA 2K0RA 3WMQA 3MTXA 4XPGL 1FV1A 4F7CA 4K8RH 4UANA 4WEEA 2ADIB 3F8UB 1KYDA 1BVLB 3ESVF 3HKFA 2R2BB 1MAKA 1QHPA 5AVVB 2Y2TA 3LQZA 4AQ1B 4BH8B 5INDB 4NBZB 2D2CC 1ZRUA 2B5IC 4DQOH 1GS6X 4ZW3A 2OR7A 4RGNE 1KXVC 2COQA 4OCWL 5FGBC 4Y4FA 2XQBH 3L5JA 2YQ3A 3SDYH 1C16A 3NH7H 3JWOL 3SKMB 2RQ8A 2WNWA 4XPAL 4DVRH 3NEOA 1KTBA 3D0LB 4X7DC 4AGQA 1A0QH 4CKVX 4S0HA 5IBUG 3V5KA 4IMLA 4G5ZH 1DUYB 1HL9A 4NM8L 4OZIF 1AAJA 3QI9C 1X5FA 1A65A 2R2EB 5ICZB 4YHYC 3RYMA 3NIGE 4PJEF 4F8TA 1D5RA 3NAAL 4Y4HD 1ZEAL 1TYJA 2FWLB 5FFGA 1M6UA 5JHDA 1A7RH 2J44A 3CDZA 4X4XA 3QZNA 3C75A 2GIXA 3RUGA 3VXSB 1XIWB 3LD8C 5FA3B 4YE4L 4ZO7A 1UADC 4AE0A 3LKRA 3SPIA 1TLKA 5C0EB 5I16B 2BP0B 1UC6A 1B4JL 3AY4C 3QJXA 4MQXD 3NSCA 2JI2A 3QIWC 3QXWA 2H7WA 3QJHB 3GJEB 4JFOB 1C5CH 1YEJL 2C9AA 2IDQA 3MOQA 4AVIA 1C8PA 2CBTA 4PHZA 4AV5A 2FGWL 3DARA 2JJTA 5TE7H 4O58H 4XN8A 3WNOA 4MA1B 5I76B 2V7HB 1OIOA 5C8JB 3PWVB 4GEIA 4XP9L 4L8CB 1KCUL 3O4OB 4Y4FD 4YS4A 1U4EA 4N25A 3MYJB 3IKKA 4PJ7F 1QRNE 1FNEB 1U6AH 5C0IA 2FSEB 3FONB 1Y0LA 3LKQA 1GS8A 1WO2A 2OMZA 1E9OA 2V5YA 3IE4A 3JWNE 4HUMB 4DFIA 2F61A 4F3FA 2NNXA 2GY7B 4I7ZC 1Q0YL 4JQVA 3LH2L 3CDFA 1XDTT 1JBJA 5F0PB 3ZPDA 4ZMYA 3FXIC 3JTBA 1LO5A 2AK1L 1ZT1A 1OGPA 3V6ZB 4D3CL 2IC2A 1HOCA 5D4IA 3UX9B 1RHHA 2HX7A 2X1OA 3K91A 5JIDA 4PRDA 5FDWB 3RB5A 3DI3B 3BRFA 4HBCH 1JPEA 1BYPA 3QP3A 4PWFA 5IEKB 1EO8H 1QUNB 2ATKB 2G9KA 2HJLA 3MRCB 1A3LL 3QWNA 2H1XA 4A1RA 3QULA 3O11A 3TBCA 3SE4C 2VJXA 3S5LG 5KTEL 2NY2C 1Z3GL 3WTSA 2YD5A 1OAUL 4L23A 4HGWA 4KNUA 4K8RD 2MOVA 3OSKA 25C8L 2F5AL 3S37H 1OANA 4EI6B 1WBYA 2FEEL 4F7PA 6PAZA 2IALA 5D2LB 3IJYA 3QYCA 2AKRB 3NFPB 4YOKA 4QXVA 4LARL 1A2YA 3BEVA 1BXVA 3DHJA 3VXQB 1FVCA 1QVOB 1KBGL 5JIIA 4MNHB 5JXAL 1I53A 3MAWA 1BVZA 1WGOA 4DKAA 3WKQA 5FECB 1T5KA 3CFQA 3IXAA 1U8OB 1WS8A 1WHOA 2ZWNA 4KY1H 3UAAA 4GFTB 4KVNH 3UYOD 3FUJA 1FGVH 3FF7A 5BV7C 3ZT6A 2YKLH 2DOCA 1NGXA 1T80A 3N43F 5ABAA 1MJJA 3CZUB 3V4UH 5IOKA 4HISA 1CGSL 3D51A 1OLLA 4P4KB 3L9RB 1V3LA 3MV11 4AL8H 3WAKA 3WD5H 3K5RA 4WWID 3UDWC 4NQSA 2O6EA 1FFPB 2FO4B 2VLRE 1IEHA 1FAKT 3WL9B 2XG5B 2O5YL 1CYGA 1W8EA 2HKHH 3L95B 1U8PA 3ISWA 4QRSB 3O45B 3NCJL 3IU3A 1D5MB 3H3PL 1HHIA 2TSAA 4WEBH 3L3GB 4MMYB 1MLBB 2CGZA 3C6LA 4OZGB 4OIFA 2EVIA 4BZ2H 3H0TA 1JZFA 3FHEA 4BFFA 3EXLA 1DVQA 4PMEA 2QFRA 3T6VA 1FP5A 5GGSA 2CIKA 3LNHA 1ZWIA 2R1YA 4Y9BA 2ALAA 4HQQL 5CMAB 3S35L 4JQIL 3KGUA 2VC2B 4HWUA 3QZPA 3O6ML 2EEBA 2R4SL 1IEAB 4XCCH 2Q76B 4WK2B 5T1JA 4NZUL 4LASH 5EC2A 3CDGA 1O7SA 1NC4B 3VDAA 1JXKA 4P9HH 3MDJA 4J23A 1WWCA 3FU7B 3GM0A 1YSOA 3BGMB 3QXVA 3ISRA 2MRYA 3TA3C 2AGJH 3CC5A 1MRFH 4XMKL 5EZOL 4K3JL 1HHGB 3B3IA 1QBML 3J7HA 1JPFA 2BNQA 5T5FH 4NO0B 1WBXA 4GQ9H 1YEDB 3MRNB 1AQDA 2HKAA 4JANB 2YZ8A 3EBIA 1BOYA 1EHNA 3HE6C 1LMIA 3MV8A 4YHKH 5I0VA 3BVDB 3BWSA 5GZOA 4JO4H 1XD1A 1Z1WA 3CCHB 2FHBA 3K6NA 3UTPD 3C6LD 4W9EC 4DKEH 3N55A 5FCUH 2YD4A 1AXTL 1XH3B 1OK8A 3FFDA 1X6LA 1ONQA 2WKGA 5C7ZA 2NZIA 3P9MB 4HIJB 4N24A 4AMKH 1S7XB 2DDQH 4Y2NA 3FQUB 5BRZE 3PP4H 5K9OA 1JDAA 2W38A 4TVSa 3BVUA 1AC6A 1MJ8H 3U2JA 1SM3L 3DX9A 4ODSH 1M3IA 4KO7A 1E9QA 1ET7A 5D7IF 3TEZA 4KMQA 1VFOA 1XGYH 1JNNH 2L7QA 4PS7A 5DDHA 4A55A 1L5GA 5E8EB 4B9FA 5LN8A 3UTOA 4UZGA 2NQCA 4WUUA 5EOQL 5IESL 5GRJH 3N85L 3Q06A 3IDGA 3WDIA 3SO3C 1MNUH 4F37F 3CFTA 1Y1UA 4G3YL 12E8H 3BFQG 4O51A 4PVLA 4Z95H 3FT1A 1S9YA 4DKDC 4HZAA 3HMWH 4HXAH 2BNQD 3U6RA 3AMKA 4GAGH 1ZJBA 2XX1A 1PKOA 2WKOA 2ZP8A 5J3HD 5CLTA 1XWVA 1HI6B 2MH4A 4HFUL 1A1OB 2KHAA 1AO7D 3ENEA 5T5FA 3HIZA 1RZKH 2CDGB 2HTLD 4LOFA 1WGVA 3MV8D 4HS6A 5T1MA 4OCRH 1GGYA 1DN0B 1UOLA 3CLEL 2CPUA 5GZOD 1J8KA 2YD7A 2XQYG 1JIBA 5I0DA 4UTAL 1WAAF 4ZFZA 2ZX7A 3EHBC 4PJ7A 2LVEA 4YAQA 1FH2A 5TQ2H 2WZ0A 4NQCB 4D0BA 4F37K 2D73A 7FABL 1FWXA 1RSFA 4N87A 2ZXEB 1CE1L 1HCYA 2YEQA 3MV9A 2UUDH 3KWWA 2ALWA 2WD0A 3GLDA 1R9FA 2QHRL 4GRMA 3PPEA 4WQOA 3OC5A 2J6EH 4B95C 4UAOC 2JELH 1OP3H 4FG0A 5I1IL 4JZNB 5AYUH 4D7PA 4DUVA 2HFFB 4JFHE 4ODXA 2Y5TB 1P9MA 2CG9X 2YPKA 3U79A 4PPTA 5AB9A 4L8SB 3H85A 4WUUD 5DJXB 4HOMA 1PLGH 3KXFB 3OXSA 5FO9B 3HAEB 1CI5A 2WLIB 3HUJE 1NFDE 1JK9A 4AEEA 5B7FA 3EBGA 4CUCA 1WEJH 3OMZA 2W0FB 4LLYB 4R4ND 1ERNA 1HYRC 5IQ9B 2EQDA 3KS0H 4G71B 4RRPA 5I19L 1PLBA 3J07A 4CA4A 3WSQH 4J6IA 2V9QA 3HB3B 1O7DE 3R1GH 3WNLA 4KGJA 4YL9A 5L6YL 4DEUA 2ENPA 4NO3B 2C9UA 2CSPA 3FQXB 5D7EA 4FULA 4HT1H 4L0ZA 4EUPB 3MX0B 4CJ1A 3MRKA 3SKNB 5ITBL 3WN6A 4Q9RL 1OARH 1KWGA 2EVHA 3D4CA 2XWJA 1IM3B 1CLZL 5DMGD 4LDOB 3MV9D 1TQVA 5HY9A 4EIZC 1JYWA 1TFHA 2JKLA 1MI5A 5HGDA 4OM1H 5DO8A 4HAFA 1W0VB 2G60H 5FYJU 5EF3A 2OXGA 3FPXA 1ODAA 1BEXA 4QXTA 3H42L 3HMXH 3OBAA 3N9GH 2EDQA 1MZZA 5I6OA 4J6RH 1S7RB 1OGTA 4XE0A 4LSPL 1XCTA 5FUZH 4HJJH 1MCQA 2A74C 3QQ9D 2OK0H 4NN5C 2N3JA 2XWTA 3GBDA 3PNWA 4XWOC 1HL5A 3E6HB 4N5UA 1J0IA 4PD4J 4UU9B 1DANT 1JFQH 3NABH 4QRBA 3PF2A 3S3CB 2VZTA 4DK3A 5BUPA 1U33A 5EU5B 5H4ZA 1NPNA 1C5DB 3LRLA 2XFXA 3QI9B 3BP5A 4AYGA 1QLRA 2CUIA 4YHYB 5ESAB 4PJ8B 1KMGA 5DMJB 4XP6H 1KCVH 1P6WA 5C0BE 2O6PA 3U7YH 1IVLA 3S3PA 2R1WB 4OT1H 4X6DA 3KBPA 1GXEA 3V7MA 2BNRB 1N19A 2D2OA 4UV4H 3F65A 3TYGH 1CFVL 3LD8B 5TH2B 2IH3B 2X09A 3SDXB 4G6MH 5AAPA 4XVTL 1M7IA 2NY1C 5E8NA 4G42A 2AEPL 3S36H 3TPUA 2ZSVA 2JXMB 1YEHL 2ZAGA 3QIWB 1FE8H 1OSPH 4XXDB 2GK0B 3FH5A 4B53A 1W15A 1W72B 5KSBA 2MQGA 4MB3A 1MI5D 1OAXH 4OD1L 2XV3A 4G6KH 4NKQB 1HEZA 4O2CA 3OAUL 2WXFA 3FCSA 1G4MA 4QCIB 1N67A 2PKDA 5DLLA 5B4MC 4ODWA 5T33L 4WGKA 4K3GA 2WIIB 3MRJA 1K5WA 5C09A 2WJ5A 3LQAL 1JDCA 5HSFA 1D6VL 2O6DA 2VC2L 3HMXA 1NAMB 4CBZA 5I73C 2WMPB 3GRWL 3RWGA 1A6ZB 5IEHA 2DQEH 3IJ9A 3OXRB 1J5HA 1IGFH 1MHPL 1OM9A 3OG6B 2YFOA 1CYXA 3T0XA 5IHZB 3DX0A 4H8QA 3S3SA 1J8HE 3WIHL 3BKJL 3LN4B 3KPMB 3AC0A 2LABA 4GP5B 4B9GA 3LQMA 5DFTA 2AXGB 1IGCH 2WCSA 3GZOA 3MCKA 1UWEH 3EYSL 5BXFA 1T20A 1FYTA 3OSVA 4Q14A 2Z91B 1LDPH 4RETB 1I8KA 1MW3A 4DN4H 3KH3A 4F24A 1TKWB 3NIGB 1SXBA 1T5WB 3ETSA 3NTCH 3U4BH 3IJSB 2ORBL 5BZWB 1HH6B 5E08H 4ABQA 2VLLB 4J28A 3RWHA 1FFNB 2NY3B 2QSCL 3A3YB 2VQTA 1LWHA 3Q6GH 5EN3A 1XAKA 2BRRL 3KD4A 5DJAB 3F05A 3NZ8B 5JOFB 1NQBA 1AD9B 4F7MA 1KYFA 2J56A 1WISA 4XO9A 5AAWC 4LDEB 3QO1B 2XG4A 2P7TA 3LSOB 1JPGB 3ZQWA 3W37A 4ONFH 1LILA 2P49B 4FP8H 5E2JA 4KNSA 1NMBH 3NFSL 4Q6IC 4P2YA 3QZBA 5F8QC 5DJ2A 2YKKA 4TUUA 3RGVC 2GBUA 1ED3A 1CZ8L 1TCRA 2F6AA 2F7PA 2J72A 3A4DA 5A16B 3JV4B 5C09D 3R0NA 3K2UH 2V5TA 3K72B 4Z7WA 4PUBL 1VA9A 3L9EA 2WXLA 3CZSA 5CGMA 2WO3B 2MPVA 3P73A 5J5EA 4YSRA 2OMTA 5ACLA 4U31A 2KZ1B 4J12A 8CGTA 3ZW3A 1X7TA 4YXKL 3BSZA 4OD2B 1BOGA 1JZ5A 2ITFA 3OKOA 5AVXB 5EO1A 2QVFB 2UYLA 3W57A 3D9AH 1DVTA 1C9SA 1WAAA 1T22B 3EGDB 4GP8B 4X7TB 2D31A 4PG2C 3SZ6A 4APQB 5BV7B 4ZX6A 3B6SB 4M7LL 4U4BA 3W11D 1RXLA 4K4KA 1FYTD 2F7OA 2WBXA 2XBZA 3ZTEA 3NJKA 4QYOA 4ZUVB 1KN4L 3KL0A 3VXUE 3DXAE 1UM4H 3P3UA 1T0OA 4UT9A 2I7OA 3H9HB 1PPIA 1TO4A 3JWDL 5IB4B 4X2UA 4J8RA 3WIAA 1TVBB 5EFIA 5AOKA 3ARPA 1EJOH 1HCVA 1TTGA 2DLTA 2VDLH 4FQCL 4U1KA 2X4SA 1P5UB 2IDTA 1ACZA 1A6VL 1GC1H 4HUUB 1AANA 4KO9A 4X6FA 5D7SH 3HZVA 1I9RH 4JG1L 3TOPA 5CWSB 3DOSB 1MCWM 4NZRL 5E56A 1IAIM 4JRWA 2ZKMX 3VRLE 3HFML 3ZT7A 1LP9F 1GL4B 4PG9A 1PS3A 2N7AA 1RK7A 4RIRB 1T6WA 2ZNXA 3HBZA 4MD0A 4RWHA 5IVXF 3T3ME 4AYMC 2CA4A 4P4RB 3RVUD 1A3QA 3IS1X 3FF8A 1BQLH 2B0SL 2QVKA 3DX7B 2HN7B 4ODHL 1PZ3A 4AH2B 4B9JA 4I2XB 4S1SL 3ZXAC 2ED8A 1L3WA 5IM7A 1HXMB 1JUFB 1UOVA 2QT6A 5DK2B 3WJJC 3S8GB 2H6OA 1H3PH 1RURH 2JKSA 5EBGA 5C70A 5HHXH 2Y5EA 3PG2A 4JM0A 1KGJA 3G5YB 4YVNA 2GYSA 5TQ0L 3OVUB 4HHAB 3GBLA 5L8LB 3EOTL 1NJ9B 1II4E 5T1LA 3SBWC 3IJ8A 3WS3B 1NCJA 1OAZL 3E80A 1UQSA 1SOSA 2GI7A 2YD6A 3OKDA 5KBNC 2WM0A 4ZT1A 3EDEA 4BELD 3HE6B 3TBSB 3MFFA 4KOBA 4JO8A 4DGVL 3MNVA 4PH8A 1HKFA 2VLRB 4EI5A 4NUMA 4L5FL 3J8F7 4F27A 3DYPA 2VXQH 4BUHA 2ID5A 3Q01A 5KWYC 5I75B 2FL5B 4KRPB 1UB6A 3GIVA 2B39A 4QRUA 1X5JA 4C56E 5SWSE 3HHSB 1RVFH 2Q3XA 4JY4B 5GZNC 3CH1B 4I9WD 4GQRA 4KTDH 3CU7A 1YVLA 3TL5A 5CCGE 4ODTH 2EO9A 4IIQB 5LGYA 1YJDL 2IVFC 4JFWA 1UEYA 1NBCA 3MNMA 4HGKC 2Z7WA 2FBJL 4LCYB 5HGAB 5A7EA 1IAIL 2JV6A 5AQ0A 1DJHA 3F7KA 1UM6H 1E5AA 5HHQB 1BP3B 1LD9A 2CNZA 3BAEL 4F2ME 5TDOB 4WAFA 1OB0A 3V5HB 2AJSL 4G9DA 1N0XH 5C0DB 3NSYA 4IRSA 1KPUA 4Q4IA 1IBBA 1QLFA 1KENH 3PWLA 3AM8A 1EUTA 2Z4QB 4DVBB 1E8ZA 4Q0XL 1MXDA 5DO2D 2ARJB 3ROOB 2Y3NA 1TJXA 4TVPL 1SOQA 3UYRH 4YZWA 2X44D 1HE8A 4N2BA 3SGKC 3ZTCC 3VQLA 1E50A 2CIIA 4N28A 1AGDA 5T1LD 2OM5A 1A5FL 4QEGA 4TLUA 4TQ8A 2AHIA 2QKIB 2XRAH 4YQXL 1V5JA 1KLGB 2E6QA 1MCIA 3PNRB 3NK3A 4GAJL 4XVUC 5EU6A 1T4KA 2IH8A 4EI5D 5IB3A 3RBSA 3GMMA 3EGXA 4K2UH 4P04A 4PWIA 1DTUA 4P2OB 2EJ1A 1MUJA 5EZJA 3EHBB 4Y8DC 5HYSG 4YK4C 5I8OL 2PO6A 5F7KC 4LESA 1MWAH 1E5UI 1WD8A 4JM2C 4GB9A 3ARWA 3REVB 3JBG7 4OCLC 3X13A 4HETA 2JWYA 1RULL 1W72L 4GJTB 3UAFA 2P8MB 5EEXA 4NZTL 3AGWA 5GS3A 5B3SB 4O5LL 4NP4L 1UACL 4UAOB 1RK1B 4C47A 5BRZB 2HFGL 3JV6B 5F1OB 3OWEA 4RQQB 3QJRB 3UH8A 2JB5L 2W95A 3L4WA 1HIMH 1G0DA 4H1LB 3EJYC 2ADFL 3NFNA 5DI8A 4HK3N 5FFLA 1NAML 3QUYA 1HYSD 3F5WB 4IRSD 4MA3B 2R23A 2OJZL 4PCKA 2VXUL 3HZMB 2JH2A 5C0JA 4YDLC 5JIHA 3D0VA 3BEWB 2VO8A 4XO8A 3DI2B 2I07A 1L9TA 4FLQA 1OB1B 4UT7L 5GIRA 4F7EB 2YPVA 1ZLVK 2BHFA 4HK0A 1BG9A 3MC0A 5ALCL 3V6OA 2F08A 3WMSA 3U9UA 2NTSP 2WGXA 3X1NA 5D5MF 5IHUL 5T3XH 1AGBB 2KH2B 1NSNH 5EU6D 3DMMC 5F7EL 3S36X 2WBJB 1BVNT 3MRLB 3RILA 4NKIH 3ASWA 3LV3A 4HH9B 4R26H 1EAPA 4LPUA 4N8PA 3TA4D 3MNZB 4G8GB 4U6YB 4Z7NF 2PO6D 2JK5A 5I8CA 1NBQA 4J3OF 4XO3A 1MEXL 2DTML 2NY5C 5FB8A 3P40A 1A6AA 2BVYA 2NZ1A 3MRQB 3FHAA 4G70B 3MLSL 5DR5L 2ZCLH 4L8BA 1JYXA 1MWAA 1ECZA 2P46B 2APBA 1IBGL 3BI9X 4S1DD 1EEZB 5D2NE 5KVEL 5KVMC 2R69L 3FZUC 5EUKB 4X4YB 5KYUA 2A74B 2DN7A 1PW3A 4NN5B 2Y6SC 1J1PH 4PRPD 2NYYC 3P4MA 4KMLB 1GOFA 3F83A 3QUYD 2I9LA 1G7PB 3ZBMA 4G82A 4A67A 1GCFA 5EH1A 4OI8A 2ARJQ 3VFTB 5G5DA 2DQUH 3BPCB 2VSDA 1Q72H 5JYLA 3HUJB 1NFDB 4HU8A 5D7KD 2I60L 3O41B 3PXLA 5DT1L 4MMXA 3OLEA 4Q2ZA 1ETZA 4JFYA 4UQBA 5BV7L 4IMKA 2PTTB 1FLTX 1SQMA 4NENA 4GLRH 3LHPL 4FYTA 3TLRA 3K8MA 1AH1A 3EJCA 2ED6A 1XF4A 5DUPH 3OAZH 2DWSA 4NNPH 3GSRA 3Q44A 1OEZW 2CBOA 3QJQB 1U8CB 2WIMA 4NOBA 2WXOA 5CCKL 2NY1B 4C4KO 3QIUA 4PBDA 3BRGC 2EXTA 3QUXA 4Y5VA 5J6SA 3KHQA 3A0OA 1JCVA 1EHKB 1AI1H 1I9JH 3OKNB 3R06B 2QGDA 2C7FA 3TT3H 2IQAB 3KJ4C 3P11H 1I1AB 1UA6L 5I1DA 3MR9A 1EVTC 3PWJA 4HJUA 2W9EH 3BQVA 3KDMB 4TPRL 3ME0B 2RAMA 1CQKA 3G3LA 3FKUS 5MEQA 1SYVA 3BDXA 5DVNA 1A1NA 3HRPA 1LNUA 2J1XA 4OZFG 2H3XC 3CPLB 4AGLA 3FW6A 4EIBA 3KPSE 1YEKH 4NKDB 5FKAA 3ECBB 3OHXB 3FH7A 3K0WA 4MJ5B 1KC5L 5L4MA 3FO1A 4ADGA 3RUGE 1ZLSL 3I6SA 5ETUB 2R0WH 4EF3A 4OZFH 4WKXA 4KK5D 3V0VA 4ADJA 3EFDL 4JE0A 2ITDA 2XACC 1L0YA 3PXJA 2ZSWA 4YBLC 2MOQA 1UGKA 4UNVA 1R19A 2H2SC 5BQ7B 1U3NA 4Q9QH 2UVEA 3BKCH 2AERT 1TMQA 5H37G 2LTQC 5C0BB 4RGOH 3TV8A 5I1JH 3KNBA 2R0KH 4WW2A 5E2WH 3SPHA 3OMIB 2ZUUA 2I85A 2EIZA 2ZXCA 4M7LT 4OLUH 5FV1L 3QIUD 5HYJE 3ZE1E 3QUXD 4W9IC 1P7QA 1OW0C 3BYYA 3QA3A 5H37H 1QP1A 5D6CB 1JERA 5E4EB 3WFHB 2Z7YA 3R7QA 2DQGH 1YEFL 2ZUYA 3RP1A 1IT9H 1KCKA 5J56B 3CVHL 3HG5A 4Q6IB 4NQVB 3OR6A 3MA9H 3VAEA 1X5XA 2Y7MA 2GUOA 3KYMA 5LGHL 5B1AB 3BVWA 1COBA 3RGVB 1RD6A 2X4TB 4HPHA 1R5IA 3WYRA 1FVDA 3UAJA 2NYZA 2WCPA 4HDIB 4A7VA 1O0VA 5IROA 2PUQT 4B6ZA 3BD4A 4XRCB 3BPLB 2PPCA 2NY4C 1P5VB 3ARFB 4JO2H 5C0FA 1J1OH 2YA2A 4YSQA 4CVXA 2WAHA 4R7DA 4RMVA 1DLFH 4HALA 2QGCA 2H0JA 1J8HB 4EBQL 3ZTDC 2GC7C 4KZDH 1FHGA 5EU4A 3GHBH 5C2UB 4JFQA 1UENA 2A7BA 2WANA 3IU4L 4Y2DB 4XCEA 4XBPA 2FX9L 4G6AD 4UM8B 2Y72A 5DEJA 3IRPX 3QHZL 3T2NH 4JFFA 4PRHE 3TASA 4Y2LA 5AZ2L 3SPVB 3UZVA 1P7QD 2VT0A 5FKPA 4YGVB 2MMXA 1E30A 1PQZA 3C08L 5HHVL 4LEXL 2FYYA 1L0QA 4FMKA 2KPNA 1U3HA 2EH7L 3G6AA 1JE6A 4H44C 1W0YT 2DQMA 2FQGA 5I1HL 2J8HA 4YSOA 2AITA 3E6FA 4HJEA 3TEUA 3BIBX 4IU3B 1IGML 1MHCA 5CUSL 1NAKL 5D4HA 4MZ3A 4KTEL 5E8DL 5IV2B 1PDKA 3QEQA 4G8FB 4OIBA 5JW5A 3KYNB 3B9VA 3SDDA 4IKKA 3AMLA 3UOAB 4NSKB 4LCVA 4YHLL 4UI2A 5FYJH 1WV7T 2Z0UA 4ABWA 3IDJA 4MXWH 4F8QA 4F7KA 4YLBA 2R0ZL 3KLHD 2QMJA 4K7FA 2NR6A 2WZPA 5GJSH 1HT6A 4N0UA 2UX7A 1DQQB 4WU5A 4U1GC 1TZAA 1THAA 4KJPD 1WBZA 4XGZB 2PP8A 3N91A 3U0TA 3UAEA 3F85A 4ZSOE 2QSQA 3VXUB 3DXAB 4L3CA 2MPAL 1XAUA 2YSSB 3MBEA 1XSIA 4JFFD 1XR8B 2P26A 3ZDXE 5EBLB 4L3AA 1XQ4A 4GW4B 1KB5H 1HJCA 1R3IL 1CGYA 4OSUH 1HDMA 1EXUB 2D3VA 2IXQB 2WC7A 2HVKA 5DJYA 1HHKA 1U3HD 2RCSL 3FCUB 4GW5B 3OZ9H 1MCHA 5B39A 3ZKNC 3TCLB 5BJTB 4WWPA 5JIQA 4Z7VE 4MSWA 1DEDA 2WUCH 43CAB 1AQHA 3O9WB 3L8QA 3MRGB 4IIZA 4R8WL 1DVFB 5TJWK 1HINH 2OFQA 3PL6C 3ULUH 5HGHB 5HJ3A 2XWDA 2WSDA 4ZPTA 4KHXH 3L4CA 3LRMA 1JZ7A 2IMMA 2Q20A 3LKPB 3QEQD 4XPFH 3WFCH 1KG0B 4KKQA 5F9JA 5TDPA 4PWEA 3SDDD 1DJYA 2CQVA 4OCXH 4U1LA 4HSCX 1QHOA 1N6QH 1NL0L 1PZCA 2GJRA 1T1YB 4A66A 1F56A 1TJIL 3IKCA 4RZCB 1AO7E 1OPGL 3ULVC 4HD9A 4AM0A 5D6DA 3MV8E 3HVNA 3FU6A 3VE0A 4CDHA 2ISDA 4LVNB 3SB3A 1BZQK 1XF3B 2NR6D 4J3OD 5ISZA 3DUSA 1INQB 4M8QA 4NX0A 2WZPD 4BH7A 5KYWB 1ADQH 3CQQA 4OIAA 4WHDA 4OTXL 1BJ1J 1CWVA 4FFZA 3T1FB 3VD5A 3D0AA 1FDLL 4IRZL 2P5WE 3TO4A 5DRWB 2WSKA 4AKQA 3FO0H 4RNRA 4Y5YA 1MDTA 4AXWB 1GMEA 2ZOOA 3MBED 1MJ7L 1RK0A 1PKQA 2CHNA 2XWBB 4JPKL 3TBYB 5CZXC 1V7NH 1CDHA 4OY9A 3T77A 3QG6B 4JJ5A 3BWZA 3MUUA 3HCVB 1YYLH 2DKUA 4LNRB 1IC1A 5J57B 4JO1L 1KB5A 3QUKA 4XI5D 4LAJH 4WUUE 4JM2B 4BWWA 4NKMA 3WOVA 4BZYA 4C56B 5SWSB 1KGCD 1JN6B 4BGDA 1ZT7B 1GHFH 4L29A 5IMKB 4LCIL 5DQDL 3FBKA 2BOBB 4DUWA 2J8UB 1BAFL 1AMXA 4TSBL 5D71L 2EEAA 3TBWB 4R96B 2CKBH 4LAQL 2UWEA 2V0AA 2OR9H 1RIHL 4H25B 2BVEA 1A6TA 2VNCA 1I9EA 3FAXA 4LPYA 4F2MB 4K5NA 2QQKH 2UVFA 2XTSA 3BN9C 1KNOB 2X4RA 3B37A 5CGYC 2JKIS 5DLML 2DJMA 5EIQA 5FYJD 5MI0B 5SX5H 3UYPA 4YDLB 3BW9B 2GBAA 5ISZD 2NCMA 1S3KH 2PETA 1ZVSA 2VR5A 2X6MA 2YQ2A 2B9AA 3BAYA 4FNTA 4LLVA 4QXGH 1OVZA 3M8OH 4NAQA 4GXVL 4YUEL 3ZRFC 1H5BC 1ADQA 5DTFA 3TO4D 5DVKA 2WVVB 3MRMA 5D1XA 3C6SB 4ISVB 3CHSA 3QJZA 3DMMB 3R4DA 1LO0H 4JLRA 3VCLA 2Y7QA 2AJVL 3ARDC 1I8LA 4A2DA 2ZUQC 1YNLH 1T0NA 1JZHA 5FGCB 1DBBH 2FX8H 4U1NA 1RUAL 2R0LL 3F01A 4NO5B 4P5MA 1T66C 3QS2A 5A1AA 5AZEL 1QFHA 4XT1C 1ZOXA 1ZHLA 2XTJC 2F8XC 2YA0A 1PF3A 4GP4B 3ZTNH 3SSGA 1RL1A 4PHXA 2W8CA 1A7OL 4YH6A 4S0TD 3PABB 4JHWL 3W1ZA 1YYML 3ARSA 3VFPB 3V9FA 4GAFB 2ZXAA 4PSPA 3V0IA 4AGOA 4FNRA 2D8KA 5D70L 5ECGA 3ISYA 4L4VA 1D5BB 2OSWA 1U8KA 4BQBA 4GMSL 3I75A 3SGEH 2VUYA 2F2HA 3VFVA 1F02I 1QD0A 1G6RH 1UGNA 2BC4B 1MF2L 1UT9A 2ADGA 4TF4A 2F0CA 3DTDA 4RFOH 4LRNL 1VFAB 3EOAB 3BZ4B 5IJKA 2GCYA 5DZLA 1YY8A 2VMDA 4J1UA 5D1XD 5L0QB 4GBXC 2IPKA 4IM8A 2PLTA 1TNMA 5D7JA 3TJEH 5LJYH 2L04A 4P48A 4EN3C 4HIXL 9CGTA 3WELA 1MCKA 3BP6A 1XEDA 1JGEB 3RWFA 5KS9A 2XICA 1NMCB 3ABGA 4RSVA 3VSVA 3TN0A 1Z5LB 2O6CA 4FL4B 5FGRA 4CADB 4WCYL 1G9ML 2WB7A 4XH2B 1H0DA 3PP3H 3KJ4B 1G7QA 4X4ME 3V7AG 4AJVA 4XTRC 2A73A 5DZPA 3NACH 3SKOA 4OCMC 4PJDE 3T0EA 2EDRA 3THML 3QHFL 1J9RA 3BH8B 2MNUA 1G9HA 3B9AA 4POYA 5D2NB 3A6OA 4X6BA 1AP2A 1U95B 5IFAL 1AD0B 1FO0B 1IFRA 2WKLA 3G5XA 3IRZA 3AREC 3P2DA 4X6CA 1MPAH 5IMLA 4L4VD 4LRIA 4X6DE 3IDUA 3DX1A 4NQXA 1OCOB 2GG1A 1SYSB 3OJVC 3APCA 1UG9A 3WFDH 2J88L 4ENED 4HZ1A 1J11A 3MGOB 4MX7A 4J2XA 1QHQA 3L5HA 1JF1B 1YCSA 4KRMB 4P2RA 4XC1L 2OR8A 4NUPA 2EIMB 4YBLB 2BCKB 4ZZFA 3MJ9L 2OMYA 5I6PA 5DJDB 3O3AA 2R2CA 1E8XA 3U6XA 2LTQB 4NFDA 1YPZA 3WXVL 2ADJB 2BDNH 4POZD 2AW2A 1PZAA 3IM1A 5D7JD 2A9ML 3PHQA 5ERWB 4ZMWA 1EGJA 3L4UA 4U7KA 1F1GA 5CIPB 4NB7A 2FCBA 5AVSB 1QMUA 5C09E 3TN0D 4V33A 3UPAA 1F3JB 2MWCA 2LU7A 1SMAA 4PM1A 2F5BH 4JN1L 4QT5B 5IMOA 5A3ID 1BG1A 3MLTA 4IJ3C 1CC3A 4JDVB 1MREH 2W07B 32C2B 2XZQL 3NIFB 4NPKA 1QO3B 4H8WH 3V4PH 5DD0L 3AU1A 3GSQA 4CN4A 4EIGB 3T0ED 1H6UA 4LCWA 5I28A 5LBSH 4JPIB 4ZTEA 3UEQA 5EWIL 2GTWB 2EDEA 2AJYL 5L7XL 1WIUA 3L3JA 5IREA 1MQ8A 3EADA 3EOBB 5I18H 2XA8H 5LAXA 3KEDA 4YX2H 2NY4B 4X6EA 1RJZA 3TURA 3L5XL 2BNUB 1A25A 2F19H 3WEMA 2JSFA 5HI5C 1E3FA 4PTTA 3KPSB 2EDKA 3TZVA 1W2KT 5C0CD 5IJBC 2KZWA 4JCLA 4PJCA 5IR1A 3GBNL 2VTFA 3ECWA 5BVPL 4P2RD 2VZVA 1ZSDA 5I6KA 1NFAA 4HMCA 4L1HA 1T4WA 1YDPB 3S97C 1SBSL 2CA3A 4MCYA 4EXPX 1LO3L 1JV5B 3OJDB 1UA7A 1TTUA 1XEUA 1HZLA 3MODH 4NNXA 5A2FA 3C5JA 4ANXA 3P0YH 1N5AA 2A5UA 5DD1H 4QTFA 1YUHB 1WAEA 3G6DH 4YXLH 5B3JE 3WU1A 4K3DL 2WGNB 4OF5A 4YHNB 3LKOA 4ELKA 2ZCHL 3QCTL 4YR6B 1KUMA 2PCFA 1CK0H 5HYJB 1X5LA 1IFHL 1T83A 5IB2A 3W2DH 5F96L 1B2WH 4WHTB 5GRZA 8FABB 3KZ8A 3UTZA 2PCPB 5TE6H 1FL3A 4LCWD 2X6VA 1IFGA 2NDFA 2HLEB 3KVPA 3VXRA 4BFGA 4QAMB 1PEZA 2FQFA 2GTZA 4IOSA 2CO3A 1QABA 3S0PA 1BFOA 1K6QH 1NCOA 1WA0X 1CIDA 4JRYA 3QDGD 1LO5B 4NQUA 2PP9A 3KW8A 3DVFA 3BWAB 1JTTA 2YK1L 3ES6B 5GS0H 2DD8L 3TZVD 2J1YA 1YNKL 2B16A 3SE9H 4PV1C 3T0VA 2RTTA 2ZOKB 3GI9H 4HMEA 4KK8C 5IBUB 3RJDA 1ASOA 1RZQA 1X7QA 2O6FA 2Z0BA 3PGDB 5IHBA 4TUJA 5CEZD 1MQKL 2IV9A 2AQSA 4U1GB 1BAWA 4ACPA 5LHDA 4I3RH 4BV1A 4OKVA 5A2BA 2VMEA 4BDVA 1WWWX 1AXSA 1NGQL 2A4CA 3FQNB 1OD7A 3EO9L 1SLXA 5ESVA 3VGAC 4I9WE 4KHTH 5HDBF 1IKFH 2VZSA 1TZIB 3WDJA 5IT2L 3FU0A 5KZCB 3BUTA 2OZNA 4Q9CA 1MY7A 3KPNA 2AJ3A 1OAKH 3HS9A 1LM8V 2A6JB 4PRHB 3K0YA 4YHPA 1OWWA 4PS8A 4GH7B 2VDMH 2CR6A 1B0GA 3GQFA 1F97A 2QQNL 1SOXA 4XNXL 1NDGA 2NY5L 4H20H 1AR1B 5IFHL 1FL5B 3T4AA 5D93C 4N1HB 4ETQB 3OD3A 4B96A 4M7JL 5E4IA 3SGEI 3VXRD 1H8OA 4FMFA 5KOMC 1NEZA 4DKFL 4XWGH 3FFCB 4IOSD 1IGIH 3LB6D 1UCTA 3NZHH 4RH4A 1ET8A 4IEFB 2YGOA 4HWZA 2YGVA 4JRYD 4E2OA 1SJEA 2FR4B 4UINL 1QA9B 3WFEH 3DVGB 2P8PB 4EO5A 3HC4L 2CK0L 4MYWB 2KLRA 3QPQD 1AYOA 4KZ0A 3BH4A 1RY7B 5G4NA 2DMCA 4J27A 2ROYA 3SYQA 3K4ZA 4XP4L 3C87A 3NIDE 1UB5B 4DPCX 3CX2A 5G2NA 4ZFGH 1RJCA 5EU3A 3S2CA 3EF7A 1F4WH 5H94A 1ASQA 3C6LB 4I5BA 1IV8A 1UHVA 3POHA 1IL1B 3VFNB 2X9XA 3SBPA 3ZX1A 1BZEA 1WRFA 5DEZA 1FH5H 5ABDE 4ZSOB 4MAUL 2YC1A 2VN6A 1D5IL 3ZDXB 4XCNA 2XT1B 3OX8A 1G7LA 2DQFA 2HG5A 4GRLC 5JHAA 4E68A 3C5ZC 3CN2A 5DD3H 1FUNA 5AFAA 5L4FA 3AAZA 2YEVB 5AUMA 1HHJB 3S5LB 1Y18B 5HDLA 5FHBH 4Z7VB 1OWRM 3GKZA 5AW6B 4PBVC 1PJWA 4G9FA 5MP6H 3MLZL 4FABL 1RJLB 3CG8A 1X5MA 2EDYA 1ZA3B 1HKLL 4JDZA 4S0SD 1JWUB 1G7MB 2JI3A 1FO0L 3C8KA 3CFDA 3LX9A 2QPSA 1NOLA 1ZS2A 2V3DA 1F8TH 1AO7B 2JJUA 3PIQB 5E99H 2BVOA 1TZHB 4U1IA 5LO7A 2MTPA 4XBEL 2GKIA 1ZA6A 5SX4H 4U1SB 3DPBA 5DJ6A 2DWTA 3EZJB 5SWQB 4AQAA 1U91A 2BHUA 4UQCA 1K3ZA 3ZDYB 2XY1A 5T3ZD 4AYFA 3LRSA 2VXSH 5FF6A 1FZJB 3RRQA 2P5WB 2YUXA 3CXDL 3IVKB 1QFWH 4QO1A 1KB3A 2B1OA 5GRUH 1A9BB 2DQDH 3CFEB 1FGNL 4MJHA 4R7NA 3QDME 4Q74A 2ZUQB 3US0A 3TVMC 5BS0E 1A4KA 2YUWA 1RJYA 4E42B 1LO2L 3QZWG 5CJXA 5JPMB 5KVDH 4I4WA 4JAMB 4HUXB 1ACYH 1UD2A 1K8DB 1HWGB 4PRPE 3UJJH 1CGTA 5DZVA 1IC5L 2BXYA 2Y3AA 2XTJB 1A6WL 2XKSA 4MMZC 1VRSA 3LXBA 3IJEB 3HEIB 1YYCA 2C1PA 2VSCA 4G9FD 1DVZA 3B2VH 4JQXC 3DROB 3JTSA 5C0AE 3L1FA 3IK2A 3A47A 5F7WC 3GBEA 3VH8G 5F89A 3T65B 3WFBH 2X1PA 3ZE0F 2NY6C 3POCA 1RU9L 3T3PB 5DQ9A 3RNKA 3NCMA 4Z7UF 1UWYA 1ZTXL 3SQBA 4Z3EA 5LG1A 3D2UA 2AI0H 1V55B 1FLRH 4DOHB 4ZNCD 4N0YL 3B9KA 4OZHE 2X2UA 4MAYC 4XVOA 5IW1A 3L13A 3G5VB 1IRAY 4XPGH 1PX3A 1FN4A 3OB8A 1BJ8A 5AW9B 5GQBA 3F7LA 4M1CD 3BCDA 4BQCA 2XUWA 1L0XA 2Z64C 1DO6A 3RKDC 5EEUA 3BIKA 1HC1A 3E3QE 1M71B 2NT1A 1Z9OA 2EIJB 5L2JA 3CN4A 3ZE2E 2I24N 1I3UA 3WTVA 3VFOA 1DSFL 3QQ4B 2AAAA 3DVNB 3PGFL 4N2FA 2IQ9H 3GLAA 4AJWA 2L7EA 2DLFH 3ETTA 3JWOH 3MA7A 2GBTA 3FL7A 4XPAH 4D0DA 4QJ5B 2VZUA 2XKNB 3S6CA 4NC1E 1DEEA 3RX5A 2WTOA 1P69B 5L4JA 4QRRA 4LSVL 4JFEA 3SDCC 4DT2A 2PPAA 4IKJA 4Y9EA 4HUVB 4FKHA 1R24B 1TTBA 1DBJH 2Y5QA 2XWZA 1DDHA 4HSAC 3QZMA 1RIVH 1OXYA 3QBTB 1ZEAH 1PMYA 3G08A 1JPSH 4N9GB 4Z77A 3AREB 4G1EB 4P2QB 1A0QL 5AVUB 4AEFA 1JVLA 2WW8A 3G04A 4HUNB 1JXFA 5E5LA 3L5WA 1E28A 4YE4H 5CD5C 5EF2A 3D2UD 3TFKC 1XCQB 5IP4A 1MCSA 3UTSA 3RFZA 1QWUA 4WLCA 3B9KD 2V9TA 4ZOBA 3GSOA 1SN0A 2X5PA 4M1DL 4FXKA 2UXFA 2TRHA 2C7UA 3P30L 3TEYA 1CLCA 1NDMA 4B9IA 2EC8A 4OFPA 4ODUA 4DESA 1D3CA 1U8IB 3JVGC 3D39D 1LWJA 3PAYA 2HB0A 3MACL 3V5DA 4ETYA 2GAZA 5AG9A 4O2EA 3GIZL 3WE6A 4F20A 1RUQL 1A9EB 4LSSH 4JNXA 1ILUA 5AYQA 3VGFA 3WN5A 4N8VG 3GSUA 3B2PA 1ADWA 1Q9LB 5E9DA 2CHZA 4E41E 5TE7L 4O58L 3KPLA 4OQTH 1ZIAA 4QRRD 3BO8B 4PJGE 4JFED 1J48A 3IT8D 2J1WA 1Q0YH 3JVFC 4LFHG 1IQDA 3GMNA 3IDNB 4L3EA 4HV8A 1RZGA 5IUSA 2AEIT 1IARB 3MQIA 4PJDB 4AYEC 5EUOE 1U6AL 1IB5A 1ZK5A 2NMSA 3BP5B 4D3CH 4WWKC 3AFLA 4KWUA 4M61B 4FZEH 3KYKH 4AEIH 3BSGA 3FOMB 3Q13A 1MHHA 3U7WH 4UIKL 4LK4A 3DC0A 1XO8A 2UXVA 4W9ZA 2J4WL 2ICEC 1EEYB 3UTSD 4M02A 4S1QL 3ULVL 1A3LH 1XBDA 2CU9A 1CL7H 4TV3A 1CE6A 2E86A 3AG2B 2ZYIA 3UCQA 2CR3A 2J25A 2ZSVB 5EDXA 3VVVA 4H0LC 2Z7ZA 5E9AA 1JNJA 1RKRA 3CZFA 2F5AH 2PW2B 2VW6A 3MLUH 1MCJA 2WXNA 1V3MA 2ERJC 1N7ML 4WTQA 1V05A 1ZAGA 4NDMA 4C4UA 1E5ZA 3NPSC 3FC8A 4XVJH 5GSRA 2HFEA 2PWHA 3GT6A 2PW1A 3KWUA 1AQ8A 5E9DD 5HVGB 4OGAC 1JTPA 3FTSA 5JXAH 1FFQA 2CWRA 4YDIL 3S37L 3A23A 4H5SB 5JW4R 5HHOB 1G1OA 3DETD 2DMBA 4PGBA 1S5IH 2N0KA 3CFCL 3OWRA 4L3ED 2JB6A 1GYVA 2HVJA 2YHGA 1N6UA 1NBZB 3QNYB 4NOFA 5FUCE 2KI6A 5SX4I 1JMXA 3OC8A 4NC2B 3O8XC 4CVUA 4N6RB 1PZDA 3E1F1 2GITB 3WEXA 5CBEB 4PGDA 4LLMB 4WK0B 2AZUA 5KYXB 1L0PA 3L4VA 4HWBL 1ID5I 1MFBH 2FHCA 5DS8B 4CC4C 2UZIH 3NCJH 3V4UL 1X5HA 3H3PH 2CNYA 3P9LB 4UDTB 2Q86B 3BAKA 2JLPA 4N85A 1SHSA 4HJIA 1SNRA 3EO1B 3HLAA 4RAUA 1U8HA 4DO5A 1Q38A 4ONHB 2HKHL 4G1MA 4HQQH 2VE6B 1GW6A 2FQEA 2VN5A 4Z8FL 1U8MA 3S35H 2Z1PA 4XE5B 4JQIH 4KK9C 4AZUA 3FO2A 4WEBL 1TZGH 2R4SH 2EXWD 1EZLA 1OE2A 1HAWA 4BRJA 4KKCD 4ZUWB 5IBTH 3QEQE 4BZ2L 2QPEB 3JTTA 3Q1EA 4QHUB 4Y8AA 1BZ9B 4LEEA 4ZXBC 5DRZB 3UACA 2GFBA 3D25B 3K6FA 3O6LH 4NPYA 4DSYA 3OM3B 1W0WA 2CAKA 3E0GA 1AG6A 3ATEA 4Z7UA 4CSPA 5HHNA 3X2QB 4DP1X 4KVCL 2Q7NA 2BRQA 4PJHB 2ICWB 4RFEA 2HXAA 1NCDH 4JS7A 1QWNA 3MUZ1 1HOEA 5D93B 1OSEA 2CZNA 4XMKH 4K3JH 3CXFA 1CTOA 4XCCL 2YEZA 1A3ZA 3OMAB 2FJUB 4LASL 3UGUA 4FQ2L 4DZ8B 4J39A 4PJFA 1ZV9A 3GXNA 4DZBA 3L3DB 7CGTA 5B1BB 4P9HL 4YJZL 3K80A 3BLBA 4PB0L 3QJVB 5D2LF 5E6IA 2B2XH 3TU6A 3GB7A 3KWTA 2ZTBA 4J4PD 3EH4B 1A1MB 1BM3L 3WEBA 1LL1A 4RGMB 2YPLA 1J0YA 2VJ0A 3LPWA 2BIPA 2APSA 3D1MC 2X41A 4E9RA 4NYLA 2DKSA 4Z76A 1AXTH 4PJ9B 4OFYA 4K71C 4LEOA 4AG4H 3CK0L 3PU7A 2ATPB 2G5BB 5E2TL 1D2OA 4J3VA 2AJZA 3I6KB 4NN6C 1MVUA 3PV6B 4JO4L 2MCG1 1KGCE 1SM3H 1QSFA 3SJVB 5HGGS 1CFSA 3HW7A 3OGCA 1I3GH 4NQDA 1UM5L 4QTIL 5E6ZA 5F1NB 4JQIA 2PYEB 3GTTA 5E8PA 1SJMA 1CN4A 4GRLB 4AVHA 3STBA 5EOQH 3VW3H 1CG9B 5AL0A 4PTUB 2DDQL 4EDWL 1NGZB 2NW3B 4LHUG 3U46A 2J71A 1FC1A 3CBRA 1MJ8L 4G3YH 2ENJA 1UD4A 5FYJE 1MLCB 4EKJA 4LOUC 3CSYB 3BXNB 4WK4B 3NEXA 5ISZE 3K7UA 5ANME 4MNGA 1BZ7B 2OXHB 2APXA 1RUML 4HIEB 3WHE1 5GRJL 3VWJA 5HHPA 1EXHA 2VDNH 4HFUH 2MJWA 2CM5A 1MNUL 1UYWL 3TJPA 5E6ID 12E8L 4AUJA 3PWNA 3F12A 1JGDB 4Z95L 1UXMA 2YOAA 3KPQB 3M7OA 5IG7A 1XBRA 4IHOA 1PCSA 2PR9A 2YPLD 1JYVA 1K4CA 1LE5B 1XGTB 3PUUA 4OFYD 1S7SA 4NZ8A 3WIFB 1ID2A 3RL2B 3QUMH 1G4RA 1CE1H 2VDLB 3STZB 4LHJB 3UTQB 3EDFA 4OCRL 3UTTE 1O5PA 4W9LC 4JCMA 2QHRH 3LZLA 3HZYA 2FD6L 2AJUH 3PAZA 4KC3B 2C3VA 2LOEA 5I8EB 3T4YB 1HL8A 1QSFD 3WY3A 5I1IH 3FU9A 4NQDD 2ADIA 4FTVB 1BVLA 3TVMB 2R2BA 3ULUE 1GPOL 6CGTA 1R5VB 2UWEE 5INDA 4AQ1A 4BH8A 2QZ5A 2DBLH 5H35B 4ZW5A 3Q05A 1NBYB 3CC1A 3O6FC 4RDBA 4XXWA 5CKGA 5EZIL 2J6EL 1X5ZA 4NNYB 3ROLB 3B1TA 3DV6B 4MMZB 4U1JB 1E65A 5AYUL 3SKMA 3D0LA 4HJ1A 2HX8A 1DUYA 1PLGL 5HD8C 5I19H 1ZGLP 3BJLA 2R2EA 3RI5K 2NY6B 5ICZA 5L6YH 1E4XL 1VERA 1WEJL 1BJ1H 3FN3A 4QGYA 1CLVA 3QRGH 2FEEI 3KPRB 1EA9C 2ADYA 2H41A 4WV1C 3RA7H 4AK2A 4BCXA 2VWEE 4OB5L 5I1EL 2J73A 4Q9RH 4GSDL 4PRIB 2AJXL 4MAYB 1OM3H 5K9JH 4UTAA 2IOIA 1GGIL 3VXSA 3WSQL 1FPTL 1CLZH 1XIWA 4HLZG 4WTZA 3R1GL 3CVBA 5DGRA 1UZ6E 3R19A 5FA3A 3WO4C 1Q1PA 1BWWA 3CXHJ 1EXGA 5IMMB 3VJ6B 5C0EA 5K9KB 5I16A 2BP0A 3CNKA 3KJ6H 4G6FB 4M7ZC 1P4UA 2QTVA 2Y36L 1TT6A 4I18C 3QJHA 1B0WA 3GJEA 3NCBB 3H42H 4JFOA 5TE4H 4F9LA 2IWEA 2Z31C 4OCNC 4HLZH 1E4JA 4LSPH 4D0CB 5LKNA 2EZ0D 3QDMB 5I76A 2V7HA 2X89A 5DWPA 1L9SA 2N7BA 5BS0B 5C8JA 3ULUC 2EDBA 4OM1L 1NUDA 2OCJA 3PWVA 4FFYH 4JKPH 4L8CA 1RERA 4PRPB 5I1GH 1JD7A 3L6FB 1F0LA 1A7NH 3MYJA 1QI3A 4NEHB 5KJRH 3SDCB 2NZ9C 1A9VA 1FNEA 1E7UA 1YAZA 2VR4A 2QVTA 4J6RL 4OM0H 2EE6A 2WO2B 2FSEA 3D33A 3FONA 1FNAA 4LLQB 5FUZL 3V9EA 2OK0L 4UTBH 4IGBC 3CMOH 4LCCC 4H26B 2VM9A 4NERA 1JFQL 2FWSA 5C0AB 2W9LA 4PU2A 4Z3HA 4G7VH 3LN5B 2QFPA 1CFVH 3FTZA 4PJXE 3V6ZA 4WZ9A 5E95B 4QLRA 4XVTH 1UT1A 2PYFB 1I1FB 1SJVA 5FDWA 1KCVL 2AEPH 2VW7A 5KS9E 5JIKA 3AGVA 3LZPA 1YEHH 4EPSA 3U7YL 3VXSD 8PAZA 1EWHA 1XIWD 3BE1L 3LV3B 4OT1L 1N4XH 3DGCR 3CJJA 4OZHB 4QWWD 1QUNA 4CNIB 4XP5L 2ATKA 3TH4T 1T6VN 3PXHA 1QZNA 2B9BA 3FTVA 3HJEA 3MRCA 4TNEA 3OAUH 5GRYA 3TYGL 1H6TA 1A6PA 3E8VA 2BVPB 4MASA 2ZJSH 4N20A 5T33H 1MWAB 2EDHA 4XCYB 3QR0A 4ELME 4FERA 4N0RA 3LQAH 5FXCH 5FM8A 3ZE2B 4EI6A 3AW5A 1ACXA 3GRWH 4M8UA 4X6CE 1NCCL 5D2LA 1PIGA 5CZKA 2AKRA 3VXTB 3NFPA 2HT2C 1MHPH 1HEHC 5HYSB 1YNTB 3IRCA 1VGEL 3VXQA 4FQLL 1QVOA 4RMQA 4F8OA 4MNHA 3FFOA 5C0CE 1WA1X 2OCFD 5C97A 2CM6A 5GPRA 5FECA 4MQ7B 1U8OA 2I5YL 1TTRA 4OCSL 2APFA 1G1KA 4WWKB 1ZY9A 3UGEA 2OQJB 3LZQA 4HJGB 3LNGA 1JCKA 5HVHB 2NY0C 3K8KA 3RDTB 3H6AA 2W88A 4F15C 2QSCH 3DUHA 1SDDB 3LNDA 2BRRH 1IGCL 1KPRB 3N40P 2ICEB 1DN2A 3D52A 1NICA 3L9RA 1UWEL 1MFCH 3RWDB 1B0RB 1LDPL 1EVUA 3WKPA 4KI5E 3I2CH 1FFPA 2FO4A 3KLLA 1GY2A 4LVOC 1KFGA 4NCC1 4DP9X 3B2MA 3NTCL 3WL9A 2XG5A 5C0RL 4KKZA 3VA2C 2YQGA 3L95A 5E08L 4QRSA 4I0KA 3O45A 3MTRA 3NFSH 3Q6GL 1D5MA 2J12B 1DO5A 1M1SA 3DBXB 3L3GA 4MMYA 1MLBA 3GHEL 1OTTC 1CZ8H 4OZGA 4LCWE 1WCQA 1JZ8A 4DP2X 4KQ3L 5JXEC 3IFLL 1JPTL 3NPSB 5JOPD 4ONFL 1AY1L 4PWJA 4TNFA 1GIGH 1MRDL 4FP8L 3UO1H 1A66A 2V37A 1NMBL 3G6JF 5CMAA 4YXKH 5AAMA 3QDGE 2ZG3A 3UBGA 1IEAA 2Q76A 3FSWA 1I7TB 4L1LA 2VLKE 4MB1A 4E41B 1NC4A 1ZLVH 3NRPA 4PJCE 4PB9L 4WI3A 2Q2LA 3WIHA 1KGXA 4PJGB 4NIKB 3FU7A 2PWDA 4L37B 1TJHL 1YUKB 3BGMA 4JEGB 1VACB 4KO6A 5CEZE 1KN4H 4OI9A 3QAZB 4BFIB 5KSUB 2P47B 4NQEB 5EUOB 1HHGA 1WSST 3QPXH 1KXQE 3D9AL 3JWDH 4KDVA 2WP3T 1LEKB 5IQMA 1BIIB 4NO0A 3FB7B 4OUUB 1GYAA 4FQCH 4X0KB 1YEDA 1NIBA 3MRNA 1RUPH 2LHAA 4DTGL 1MH5B 4JANA 1A6VH 3QWRD 2PPFA 3JYBA 4WWNA 4JG1H 4KI5C 3BH9B 2BVTA 3MOBH 4RAHA 3CCHA 2C3HA 4G8AC 3FDWA 3ZY7A 5LDSA 2XZZA 1RFDH 3U4KA 1XH2A 1EJOL 2N1TE 2VDLL 3I9AA 4S11A 4KKAD 1XH3A 5D72H 4M4RB 2A77L 1D7CA 3RTLA 4W4OC 5LBGA 5I5JA 1DP0A 1Y1DA 3P9MA 4HIJA 5IIEB 2CUAA 5CXPA 5D7SL 1I9RL 1S7XA 2B0SH 3HE7C 3FQUA 4ZXBB 1HN1A 2NXZB 4BGLA 5DQJB 1UVQB 4AV4A