2Z6FA

Crystal structure of neat domain from staphylococcus aureus in complex with heme
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
112
structure length
112
Chain Sequence
LTDLQEAHFVVFESEENSESVMDGFVEHPFYTATLNGQKYVVMKTKDDSYWKDLIVEGKRVTTVSKDPKNNSRTLIFPYIPDKAVYNAIVKVVVANIGYEGQYHVRIINQDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Heme binding protein
molecule keywords Iron-regulated surface determinant protein H
publication title Structural basis for multimeric heme complexation through a specific protein-heme interaction: the case of the third neat domain of IsdH from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 26
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05031 NEAT Iron Transport-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2z6fA00
5D1ZI 2O1AA 3QZLA 3VTMA 3QUGA 2ITEA 3QZNA 5D1QE 2ITFA 3RTLA 4H8PA 3QZMA 2H3KA 3QZOA 3SZ6A 2K78A 3OVUB 2O6PA 3VUAA 3SIKA 2MOQA 3RURA 4H8QA 3QZPA 4WJG3 4YMPA 4FC3E 4MYPA 3S48A 3SZKC 2Q7AA 2Z6FA 5D1XE 4NLAA 3QUHA 2E7DA
chains in the Genus database with same CATH superfamily
4YWGL 2WLLA 2IGFH 2A4EA 1A5FL 4KDTA 1QSEE 1O7DC 1UJ3A 3MRNA 5MEPB 1TSRA 3QUMA 5DRXB 5C09A 4ZAKD 1E42A 3ZL4L 1CE6A 1VENA 2FB4L 1OGTB 1QP1A 4GOSA 5AYUL 2ZSVA 5ID0B 3BGFC 3V8OA 1ZD6A 3X1NA 3LS4L 3M86A 2YD0A 3B34A 1KBWA 4Z7VF 2GC4C 2VM4A 1X9LA 4E36A 4NN7B 3MOQA 3TIEB 3BQVA 2V2TB 3ET9F 1KT2A 3MX0A 3DETD 4G7QB 2OR9H 5D7LA 5IREA 1QVOB 2FIKA 1YEDB 3D39D 1CR9H 3IMUA 1CU4H 2DL9A 4H25B 4PJCF 2HT4D 4RGMC 1KCVH 3DI2B 4AYFA 2H47C 4AV5A 4X99A 5I75B 4ONGH 3UACA 1GS7A 4XNMB 3H2PA 3TJHC 2H8PA 4LU5H 1NSNL 5GZND 2Q7AA 4FDWA 3U4BH 3OXSB 4MA7H 4J3BA 4OJAA 4FG6D 4PJBA 4HJGA 4QKTA 4NZ8A 2G5UA 1NGWB 3VXUE 4HLEA 4BK5A 3BE1L 4HUWA 2AI0H 2FECL 4IEFB 4K5LA 3N40P 1ET5A 1KXVA 4NAMA 2KPNA 3TA3C 1WLHA 2A1WH 3MLTA 1B0RB 4Q52A 4QHNB 3WXVH 5BUAA 3UDWC 4JL1A 4F8NA 6TAAA 1A1NA 3K4DA 2XVGA 4OCYH 4CRPA 1WS7A 2IAND 3IXTB 1SEQH 1XWVA 3ILPA 5AOMA 1MPAH 4HWBL 2HPOA 1VDGA 1USZA 4XNAA 2VR8A 1PY0A 2WP3O 4FHKA 2XKUA 3WKML 4G82A 4P59L 1HJCA 3SODB 4DAGL 1YMMA 4L9LA 2LU3A 2CO3A 4ZUTB 1TZGH 4K71B 2KLTA 4FE9A 1C5DB 3U4EB 3W9DB 4WI9A 4B9ZA 2X87A 1KC5L 4KTEL 5KYYA 3FRPB 1CDGA 2B5IB 5GISH 1NCDL 1IGML 3GMLB 1W80A 2MCPH 3VD4A 3IPBA 1PAZA 1LEGB 1KTLB 4AGMA 4WI3A 1GA2A 5FECA 1DQJA 4AX3A 4N9GB 5TF1L 5C0DA 1E8WA 4WSKA 2VR5A 4QRRE 1BZ7A 3RA7L 4HVBA 1S9YA 5IK3B 2WHVA 3R19A 5T33L 4P48A 2IV8A 3JTBA 5DC0A 5DRZA 2E9BA 3QXVA 3WNMA 3HB3D 4QHLA 4JHWH 3E1F1 3GLAA 3KPTA 3QG6A 5E8PB 5HXMA 1MZZA 2G9HA 1NDGA 5F3HB 1QPPA 1UD4A 3EG9B 5KUKA 2WUBL 2F5BH 2NYYD 3PXJA 5INDA 1A6UL 1KELL 5D7JA 4CVXB 5F9WB 4OZFB 1JZ5A 3QUXA 3O6ML 5LG6A 5TQ0L 2NW2B 3RDTA 3I50L 4LE8A 1TJGL 5DVLA 1NFDB 4IYKA 5ENWA 4ZQKA 3SDDD 1UA7A 2UY7A 3GSQA 1VFBA 3MA9L 3TO2A 3U30B 1H3XA 1O9WA 5J89A 4PYHA 3HHSA 1QRNA 3TF4A 2CDEA 2V3FA 3M7OA 3P73A 1AO7E 1U3HA 1CMOA 3KPRD 3IJYB 3HTLX 3EDJA 3BDXA 4GBXD 4NRXA 4HWZB 3SE3A 1N64L 2JKRM 4FFTA 1OT4A 4EUPB 2ZX8A 1MREH 1H5BA 3DYMA 4KPHL 4NCC2 5AZUA 1T66C 5EU6A 5DHYA 3HG1E 3PWNA 2J4WL 3AB0B 3KCPA 3PF2A 3WIIH 5HSFA 2QPDB 3HG4A 4DH2A 3BAIA 4LLQB 3FRUA 4W9JC 1E5YA 3HG3A 3FB5B 4I9WE 4XCEA 3ULVH 5FFOA 2BWIA 5B1BB 1NC4A 1EFQA 3QIUB 1E90A 3DXAA 1M7IA 1JPST 5EOCL 1DJWA 2B2XL 2I9LA 3RB5A 1I1RA 5SX4H 1NLDL 4ANWA 2CD0A 3GMQA 3KPPB 2YEQA 3KZ8A 2BHZA 1G1YA 2X3CA 1ACYH 1CDYA 4IMKC 5T1MA 2JJVA 2DQDL 1F4AA 4Z7VB 5HVGB 2NY0B 4YDKH 3FU7A 2JJWA 5G5DA 4YSUA 4KK6D 2EDBA 2MWCA 5I1KH 4ZMTA 1N3NB 1S5IH 4B60A 3QCUH 5FK9A 1FFNB 1MCOL 3BUTA 2RMNA 2EE3A 5LQBL 1I3UA 5IQMA 2WMPB 2BIIA 5C7XH 3AG1B 4PJCB 1HT6A 4A6YH 4M3KB 1SM3L 4ANVA 5IESL 4X6DE 2HJLA 3ZRSA 1TDQA 1JGIA 1FC1A 3S5LG 4QAMB 3O3DB 1S5HA 3E9UA 4KQ0A 1TFPA 3VD2A 1XIWB 1B2YA 3CZFB 3TA3A 2WQSA 4DPBX 4E2OA 1HCVA 5IJVB 3UDWA 3FB7B 2XICA 1F4WH 4L2LA 5D2NA 4N5ED 3DBSA 2WQ8A 3MLWH 5D1XB 2NPLX 2K6WA 2W07A 2XZAH 2YD1A 4G9FB 3ESUF 1HHKA 4X7CC 5D7IA 2KPWA 1S7TA 1FVCA 2LTQB 2UWEE 2VH5H 2AF2A 3A67L 4JQIH 4K3GA 4ZNEE 5ECGA 2A6KA 5EC1A 1EPFA 4OUUA 2NNXA 4XCCH 5EC2B 4APQC 1ZXQA 1MRFL 3MBED 3OXRB 3H4FA 3KHOA 3ELAT 5D7SH 3U0PA 1E43A 4TUOA 3FTXA 3EYVA 3P4NA 1G7PA 4YWGH 5C0BD 1MUJA 5E2WH 4M6NL 1DSFL 4MDRA 4MXQD 1AC0A 1A2YA 1SN5A 4TOYL 2QPEB 1AR1B 1E5AA 1W15A 1SDYA 5D5ME 4HEMA 1WBZB 1ROCA 2J20A 4CSZA 3ZL4H 2FB4H 3BVDB 3DBXB 4G6ML 4M7LL 5AYUH 5KBDA 2OPCA 3RVXC 3CZLA 4UQDA 4U1HA 5IWLA 3Q0HA 1A8JH 5EBWB 1PJWA 5I76B 4X0KA 1I7UB 4G1MB 4NJAL 2FATL 2R2CA 4ICWA 3VQ1C 4FCAA 1ZLUH 4PVBA 1X5JA 5DVPA 1JI2A 5DD0L 5EU3B 2CWRA 4NP9A 4A6YA 2P24A 1NCWH 4QXVA 4DEPB 5ICYB 2CNZA 2E76C 3V5KA 2ZF8A 1TQWA 1UWGH 5I0VA 5T1LD 3UAEA 1OSZB 4X4ZA 5CLWA 2WAHA 1JGDB 2VGLM 4FQHB 4PGJA 4QRPB 2W38A 1RMFL 1CD1B 3LZFL 1WIUA 3B7YA 1T2XA 1NSNH 4HWUA 1W0VB 4JPIA 1C7SA 2OYKA 2CR6A 2XN2A 4N9OB 3U7AA 4BFIA 1IC4H 4YHYB 2VYRE 4JQIA 2P1YA 3BE1H 4Z3GA 4Q0XL 4XBGB 4NQXB 3VU2A 5FGSA 4P04A 1TQBB 2CK0L 4PJHA 4KRMB 1IKNC 3VFGH 3N91A 4ZMQA 3D0AA 4AKQA 1KIPB 1XCTA 2NY6D 4I7ZC 1SLWA 4HWBH 4JFFE 5DURB 1XDTT 1ZDQA 3U1SL 4JHAH 2YFNA 4L8SB 4YPGA 2IADB 2W0LA 4IDJL 4P59H 3SZKC 2BFVL 2Q8BL 2QMJA 4DAGH 2C9SA 4RDBA 3MA7A 4N22A 1UD8A 2XWJB 4OM0H 4AEEA 1ZK9A 1M3IA 4XNQB 4OAWB 4NXKA 1KC5H 5KSBE 3W57A 3S9DB 2XIDA 1NCDH 3S8FB 3GGWB 3GLEA 2OSLA 4BXVA 4DP9X 1DVTA 1S9WB 3BEVB 4YSTA 5H35B 5LCVL 2F7IA 4BA0A 4JM4L 4LLDB 5IB3B 2FCBA 2KT6A 3RWEB 5IEKA 4UMGA 2NY3B 5EEYA 1GXEA 4NNYA 4YVUA 4RFNB 4YSPA 3VFTA 1SOKA 4W6YB 1JI1A 4GIPD 3BKJL 4IKJA 4TS6A 5T33H 1MVFA 5KOMC 1NICA 2X6MA 2Z3FA 3PUCA 1A8ZA 2VAJA 5KYNA 4M61B 2ZWLT 3QARA 3HA0A 3CX2A 3VYNA 2WKGA 3KWVA 3Q43A 3QJQB 1A1MA 1M56B 3IBEA 3A6OA 3QHFH 3HN8A 1AIZA 5F1OB 2DM3A 3VFPB 4D0BA 4YSSA 4HFWB 3VFRA 5JHLH 4TTGA 2GTWA 2WUBH 1DVQA 2HJFB 5E4IA 1A6UH 3NJLA 1KELH 2FZ3B 1UB5A 4QOKA 1DE4A 5EIVA 1QHPA 2D7PA 1G9NH 5E1GA 1S8DA 3V0VB 1V7NH 4P2OB 2WIIB 5IMOB 1ZK5A 4M7ZC 4BD4A 3W0WB 1X5ZA 3NACL 3GBDA 1TJGH 5EZLA 1PX3A 4XCYB 5GGUB 4UTBL 2YEZA 5AFAA 4HWBA 3V10A 1LD9B 2Q0ZX 3T0VA 1N59B 2WBJC 2Q3XA 1AY1L 2QGBA 4MJIB 3GSOB 5T3ZL 3BRGC 1W8EA 2ESVD 2BVEA 2YOCA 3PHQA 5B39G 3VGHA 1KJ3L 2XTLA 3L5XL 1U2HA 3OLIA 5J9PA 5I23A 4P2QA 3VDAA 5F1KC 1CYWA 1MHHA 1N64H 2R23B 4DGUA 4BFGA 4PLJC 1IAOB 4KY2A 4OCMC 3S6CA 3H55A 4A7GA 4KPHH 4LVHC 4JFEB 2F54B 4OGYH 2NY1D 2R83A 1JK9B 3JQOB 2ATAA 2XA3A 2J4WH 4QNPE 4N3UA 3CJJA 2F19L 1DQKA 1SQ2N 4H1LH 3NSFA 3LKOB 5ITBL 1BQHA 3TWYA 4R4NC 2J43A 5FKAB 4CW1A 1H9DA 4JDVA 2ATKA 2J73A 3IDIA 2LAGB 3KD4A 4I3RL 3RTQD 3WIAA 2QTVA 4UIMB 2XFXA 3LKRB 2B2XH 4PJXA 3OWEA 1J11A 4JHUA 5JHLA 4OUOA 4RMWA 1UEYA 1UD3A 3MRMB 4ICXA 4MQXD 3MLSH 5DUJA 5AWNH 3ZGIA 1E3XA 3MODH 4JZJA 2DQDH 3FQYA 3L3IB 5IW6B 4P5MB 3FUMA 5D7KE 5C08E 4KRPC 4ZFFB 3K4ZA 2J7LA 1EUUA 2X4TA 3II1A 4IRSA 4Z0XB 1EXGA 1P4LA 4JPSA 3T6ZA 4BQ6A 4GW4A 2UUDK 4DK3A 1Q9LB 1MCOH 1T7VA 2F1AA 2E3VA 4TVPL 4HD5A 4WJKB 3BN9D 1Y6KR 2RCSL 3BT2L 3QYCA 2OX5A 5C09D 2J6WA 5LKNA 3D1MC 1PD0A 1SM3H 4TL4A 2VOTA 4LCCB 4LL1A 3LKQA 1JGEA 4N2LA 1G1KA 3QEQA 4UM8A 2H2SD 2D9QB 2Y69B 2H32H 3QFJB 4PHXA 3ZZLA 3K91A 2BXZA 1IKNA 5EN2B 3ZTEA 3LN9A 4WKZB 3ZE2F 5AVXB 3G5VA 1QO3B 3C5XA 2HWZL 3IU4H 1S78D 1KDJA 4Z7AA 2L8AA 3IJEB 5D7LD 1BF2A 3Q2CA 4HCIA 5ILTL 2V37A 3SDCD 4HIEB 5F7FA 2LE9A 5CSZA 4H1LA 1IJNA 2A5UA 1MRFH 3BX7C 3PDGA 1JV2A 4YPJA 1ZV9A 3HC2A 4KQ3L 4UQ9A 4PJAA 2VL5A 1CL7L 3DIFB 3GXUB 1CL7I 4J28A 2ITFA 1X7QB 3ZXAC 3N04A 1DSFH 3EDFA 2DLEA 4P3DB 2ICES 5I1IL 2CJTA 4XNZB 1RLBA 4TOYH 5HPOA 3QJOA 2Q7YA 3NH7H 1H0DB 2X4UB 1RZ8A 5F9DC 4LSPH 3B56A 4G6MH 5F0JB 4DEWA 1E40A 1YA5A 5K9KA 5JR1L 2YRZA 5JW4N 5TDOA 1DLFL 3AQYA 2B3IA 4NN7C 1H6EA 3NOIA 4U6YB 4WI7A 1ERNA 2FATH 4M5SA 3TNNA 3U36B 5KANI 1SJVA 4LIQE 1GOHA 2EH8L 5DD0H 3QP3A 4AMXA 3LKNA 3FUIA 5EDXA 1QR4A 4U2YA 3CXFA 5IV2A 3SBRA 1CGXA 5FW6A 2UZIL 3NJIA 2JJUA 2H32A 4JRYA 4XVOA 1KIQB 5I75C 2C3VB 4JZOB 2CGZA 2H41A 2XG5A 4Y0GA 3MRRB 1RMFH 2KZWA 5IY5B 1KGUA 2Q2EB 2JIXB 3HUJE 3EGXA 2QV2A 2VXSL 1Z5LA 2BZ7A 3CHQA 3IPEA 4HKXA 4PREA 3NIGB 2GIXA 2PTTA 4UUJB 3WS6C 4A68A 4F37K 1WEJH 4KZDL 1TENA 4PSPA 1HZHL 2VLJA 2WBJA 3ZTNH 2LLGA 3OKOA 1UT9A 4OIBA 4F20A 1H15A 3GO1L 4PJDF 3VFWA 4Q0XH 4FYRA 4RGND 3ME0A 4R84A 2XV2A 1KGJA 2CK0H 2E7BA 2NX5B 2W88A 35C8L 3KBFA 1ZLUK 3RVUC 4JHBA 4YDIL 1DBBL 3H3BC 4FXGB 5JHDE 2YAOA 1LEIB 4XB7A 5E8DH 2G2RB 3CZJA 4MS8D 5JIIA 3K0WA 1BIHA 3L3KB 3WSQL 2XKNA 3MLUL 3U1SH 4L4VB 5A2JH 1L5GB 1GGYA 4IBTA 5C07B 3QDJA 2L04A 2WVVB 4YNYA 2BFVH 5DD5H 2ED7A 4K71C 3EYUH 1UZGA 4HKBA 2ZP9A 3WNPA 2DWEB 5D7JD 4DEUA 4XX1G 1BOGB 3ZK0A 2B5IC 3RX8A 3W9EA 1KPUA 4X50A 4MJ5B 3QQDB 2IC2A 3D4CA 2DJMA 2EEBA 1R5VA 5BPPA 5JXEC 4K9EL 1TQVA 5KVDL 4DZ8B 3SY0A 5LCVH 4KDVA 3LSOB 1V3LA 2Y2YA 3GSVA 5BZWA 4JM4H 1SLUA 4PMFA 1UXWB 4PCKA 1D5RA 1QRND 4TLUA 3ZZ1A 2OMZB 3UYOD 3ZDXE 2V33A 3KXFB 5I8KL 5GJSL 3MNVB 4HH9B 3EH4B 1U3HD 4MQ7B 1AKJA 4Y7OC 4NPYA 3O3BB 3G7TA 3VXOA 1QFWL 1QFWI 1EVTC 2WVTA 4I2XE 3FT9A 5JZ7D 3BIAX 1WWWX 1HWHB 3QAZB 3UJTL 5IB1B 1MRDH 5F8QC 5F3BA 4ODWA 2GHZA 4LSRL 1QD0A 4I5BB 3ROLA 5F9WC 3KGSA 2VLRE 4QHKJ 5C0CA 4MLSA 2PWDA 2NR6A 4N2KA 5BUGA 2WSKA 1C9SA 4ZI8A 1NC4D 3VXSA 3DXAD 4KOBA 4Q2ZB 4AEFA 4UTBH 3U30C 5I19L 3FO1B 4BA8A 1G0XA 1T5WB 3ZUCA 5PAZA 1KJ2H 2I85A 5T3ZH 2VUOA 4R4FL 1T4KA 3BH8A 2FT7A 1S4IA 4LEBA 4LEXL 2V7HB 3L5XH 3ZE2B 1HH6B 1R46A 1CICD 5IHZA 1JNNL 4UIKH 4OGAC 2BK8A 1Q0EA 5T5FL 4NO3B 1ZTXE 1TUPA 5K33A 3SQOL 3V4PB 3KYOB 3DVFA 4XN2A 3AQZA 5LCVA 2KL6A 1ZT7B 1I1FB 1XEUA 2OMYB 2VMCA 4J8RB 4LCWB 3TJHD 4MTMA 5GHWH 3W5NA 4V2CB 3AB0C 5MEPA 1NGQL 4Y9CA 5DRXA 3D4GA 4CBPA 3T0BA 5GJTL 5ID0A 4LT7A 4UZUA 5ITBH 4WZ9A 2F7RA 3JWNC 3QIUC 4KKQA 1QFHA 2J8UB 5D2LA 1BEYL 3RFZA 1G94A 5C0EB 3V79C 3QULB 1RH8A 3LRSB 1XGUB 5IW3A 3FFDB 1BG9A 1NM9A 4I3RH 4B9CA 2JTYA 1EXUA 3TIEA 3ECBA 2C4FT 3UZEC 2V2TA 3FQNB 4L29B 2YGOA 4CMHB 4HLZH 4E9RA 1YNKL 1MJUL 1QVOA 4ZOEA 4NI3A 3ZHLA 1RAMA 1XAKA 1D5ZB 1YEDA 2R1WA 2YPLB 3WNJA 1Z2KA 1GYVA 4WO4B 2D03L 5K9JH 3ULVD 2JTDA 3OWRA 1BFOB 2AK4B 2VLLB 4O5LH 2WTPA 3GK8L 1VKXB 1Z6JT 3DK2A 4UTBA 4XNMA 3V4VB 5SV3A 3QNZA 2Z65C 4FTVA 4TVPH 1IC1A 4Q4IA 4LRNL 1JCVA 3BT2H 2UXGA 3OXSA 1TG8A 1KJ2A 1TQSA 1A6AB 2IDUA 2Y1ZA 3WS6A 3DMMD 1NGWA 3SCMB 1OM3L 1CGTA 1CLYL 1QUPA 2WNKA 4PJEE 3X1BA 3GBML 1XIWC 3AMKA 1G4MA 1QSFB 2Q20A 2MQ0A 4JZNB 1DZ0A 4LL4A 4N20A 5F0PB 3T2QA 4OD1L 3ZDZE 3KWTA 4I4WB 1ACZA 4UINL 3IXTA 4MJHA 3L54A 5D1XC 3EH3B 2XHNA 4PJDB 1CTOA 3SPIA 1YNTF 4LCIL 2LTQC 3BT0A 4XP4L 3WE1A 4ZQTA 4WK4B 5CNHA 3QJUB 2IALB 4XMTA 3V0GA 3V5HB 4ZUTA 4ZFGL 2OL3B 5JW4M 4Z7OE 2FIRT 3W9DA 3X14B 1E9PB 3FRPA 4K9EC 1LO0H 4GSDH 5EMYA 2YFOA 4CUCA 3GMLA 3FKUS 2HH0L 4KQ3H 5E6YA 5DK2A 3RZWA 4G83A 5I17B 1J12A 1GGTA 4OSUH 2PCFB 5AYQA 4HOXA 5JXEA 4EUPH 4UZSA 3DV6B 5E2UL 2Y9RT 2IANE 1AR1C 3VI3E 3L9BA 4N9GA 2B1HL 5I1IH 1BEXA 4L4TB 1DTUA 2XVBA 1SFHA 4EVNA 1XBRA 2NY7L 2FNBA 4GRMB 3VFMB 5IK3A 4FNSA 1I9IH 2Y24A 2IF7A 1U4FA 2XVKA 2F18A 2OJZL 1R5IB 4K5NA 4OJDH 5JR1H 1E27A 3JWNH 5EPMA 1DLFH 4DOHE 4J3OG 1N5YH 1S7XB 4JUSA 4KXDA 3HLKA 5E8PA 3AXHA 4X7SL 3HLAA 1WG3A 2V2WB 1IAIL 4PW4A 5F3HA 1IAII 3EG9A 4DEPC 2VZSA 4LSQL 4PBDA 2PPCA 5E8EB 2V7NB 4W68A 2EUXA 4CVXA 4P0DA 2UZIH 1JG9A 5IBUB 1JPSL 1PQZB 2NW2A 1U8CB 5KSAB 1RK0B 1NFDA 4U7SA 1EVUA 3C09B 3CWGA 2ZP8A 5E95B 1KFGA 4PGCA 4UT9L 4BFKA 4YHYC 3HFFA 4D3CL 3LH2L 4KZDH 1J48A 1UC6A 2EO9A 2FH6A 3AW5A 2LLLA 3ECWA 2ZG3A 4LHUB 3O45B 1TQBC 3GO1H 3FK3A 2YAFA 4M43L 4TNGA 4B6ZA 2XOTA 35C8H 3IJYA 3BZEB 3WS3B 5F88B 1FA4A 4YDIH 1LTXA 2O4EA 4OM1L 1P9MC 4WEBL 4HWZA 3ZOAA 3SBPA 4JG0H 2WZPA 4Y5VB 1Z3RA 2CZNA 4L8SC 4EUPA 5B4MC 1BQRA 2RIKA 1RSFA 2VMFA 2Y7LA 3FTVA 1NPNA 2P26A 1IGYB 4MA1B 3EJYC 1RK7A 4QOKD 1MNUH 1UZ6F 4PWHA 3D4ZA 2CDGB 3F64A 3DURA 4HPYL 3O8XB 3FB5A 2YKKA 3KPRE 3D7PA 4K9EH 3R7QA 3QIUA 3WO4B 5KVDH 4NB7A 3WTYA 1MCBA 5I18H 4LP5A 4YSQA 4KXZI 4MAUL 5JQ6L 2J5LB 2NY3C 1FHGA 5D1QA 4HG4J 1TTAA 5ICZB 3CCHB 4RFNC 1JPEA 2Y36H 3KPPA 3FHEA 5ESVB 5GJSH 3UZEA 5I8KH 3FW6A 4ZXBB 4Z7VA 1UH3A 4PRBB 3PGFH 1KUMA 4P2QD 3RVVC 3X11B 1QFWH 5DVOA 1N3NA 3OSVA 3P3RA 4I3SL 4E9VA 4FERA 1FFNA 3ZMEA 4R0LC 4ZG1A 2WMPA 4M5YL 4OT1L 4DIXA 1II4E 3SJVB 3NK3A 3UJTH 3VWJA 3QORA 4ZODA 4PI0A 2BVPA 4U0RB 3JZYA 5HDQH 2IBGA 1OD9A 3QFGA 1K8DA 3N43F 3SE6A 5IBLC 4Q9RL 3O3DA 4P2OC 3QXUA 3ZR6A 2DEYX 3ZHFA 1NA8A 2IBZX 3QUZB 4KGJA 2X89A 1XIWA 3CZFA 4XHQA 1V55B 2CM5A 4HUUA 5IJVA 2OCFD 1ZLVH 5LDSA 5C6PB 4I48A 1A9VA 4Z0BL 3W1ZA 3BD4A 5D1XA 3ZDYF 2QKSA 4L18A 4G9FA 4F2EA 3IPFA 4R4FH 4X5WB 3M1BA 1E7VA 4AQAB 2QT6A 4LEXH 3GJFB 5FM8A 2J56A 4YX2H 1ZY9A 4RSYA 4G70B 5EC2A 3OXRA 4WLCA 5HYEA 2XZQL 4IRSD 1YNTB 3MRBB 5AW0B 5DJXB 3IMVA 1QWUA 1K8IA 2ZYIA 2APSA 2VN6A 3TYGL 4WTQA 2C9QA 1NGQH 1U2CA 4P9MH 3C6LA 4QDGA 2GUOB 4JJHA 3OKKB 1WBZA 5ADPH 1FL3B 4KK5D 4GKZB 5B38G 2IPUK 3DBXA 1WC7B 2ZG2A 5IZ7A 2DI8A 3OG6B 5FGRA 2IOIA 4ONHB 1BEYH 5EBWA 4RISH 5I76A 3N0AA 1I7UA 2BS71 4QRSB 4JHZA 3ARDB 4L9DA 3NJMA 1CYGA 5ES4B 2WXLA 1NUFA 1FQ9C 3QEGL 3ZTJH 2A6IB 4FQ1H 1EQWA 1HVXA 4FXKA 5EU3A 1F58H 5C0BE 3FF8A 5HD8D 1MJUH 5IHBA 4FQLL 4ODXB 3B9DA 5ICYA 2EIZB 5DYOB 2OMTB 2OULB 2D03H 1GYUA 1XF5B 3FH8A 5FM4A 2O6FA 1AFVL 2YQ3A 4GO9A 4W9HC 2F2HA 4QRPA 3ZHDA 3G6AA 1CD1A 4TULL 4N4YB 4ZD3L 4AVHA 1CF8L 1W0VA 4AL8L 4Q9CA 3LXUX 1ZHLB 4LRNH 4GAYA 4LCCC 1QA9B 1VRSA 4CSSA 3VXME 3T09A 4A7TA 1OM3H 4IOSA 4XBGA 4NQXA 1CLYH 3Q3GA 1QWHA 4ODUB 1MW3A 4OD1H 3BD5A 3MRGB 1KIPA 4IU2B 1R6VA 3EYSL 1Y6NR 5C0ND 1IBDA 4WDIB 1HE8A 3QHZL 3WAKA 1OE3A 4PFEA 4L8SA 3TA4D 1HTYA 2IADA 5C6WH 2ERJC 4XP4H 1LE5A 2WLMA 4P46B 3B6SB 2LHAA 3GSNH 4PP2A 4F7MB 5TTRA 1GMEA 1FPTL 2XWJA 4PWEA 4OZIE 1B9ZA 1CGUA 2ATPA 4XZ4A 4XNQA 2D3NA 4OAWA 1BPLB 1VA9A 4JRYD 2CPUA 3FYEB 3KLLA 3V0FA 2XU9A 4AIXA 4N1HB 4CKQA 3GGWA 4PD4J 1L0PA 3NMEA 2HH0H 2IAMB 5F93C 5LG1A 1F02I 1HC1A 5HGGS 4UF7C 3V4PL 5HHOD 1S9WA 3BEVA 1EAJA 1RU9L 4HAFA 5H35A 2XPZA 3GIZL 4FFYL 4XNZC 4LLDA 4JJOA 3QDMB 5D70L 4BZ2L 3BVTA 3WE6B 2VLJD 4XMXA 2WK2A 5B3NA 4UDUB 3GJEB 1L7IH 2CSPA 4L3EB 3N85L 3PS6A 2MJWA 3T2LA 1A7NL 4NUGL 4H40A 4CVWA 2IQAB 3WTVA 2OJZH 5AVQB 1BZQK 4M61A 2I26N 4KKCC 2C3XA 2Z34A 3EO0B 4X7SH 3QDJD 3KVQA 3RY4A 4NKIL 3VFPA 1IAIH 3BKCH 4FZ8H 4HFWA 5D8JL 4LSQH 1B4JL 1NZRA 2HJFA 4K3JL 4N8UA 3II2A 4K2UL 1OAQH 3RWDB 1ACCA 2FZ3A 3NZ8B 3V0VA 5IB2A 4P2OA 5IMOA 3ATEA 3TC9A 4YSCA 2HVJB 3IJ8A 1WHOA 3UABA 4EMZA 1XFPA 4XCYA 4XVSH 5GGUA 2W0FA 3V4VL 2A0LC 1RIHL 3QHTC 3N43B 1LD9A 2NT1A 4F5CA 4UT9H 4N6RA 4NQDB 3BXNB 2DQHL 2WCPA 2J55A 3FU5A 3LH2H 4ZUWB 3FPYA 3GSOA 1RPQA 3GSNA 3M88A 1AKJD 3SPCA 5E5UB 4WFED 2V5SA 1ZOXA 4HUXB 3FUKA 4M43H 4FXGC 1QEWB 4PH8A 1W16A 3JYCA 3C6EA 4FYQA 3ZDYB 5IROD 3HC3L 4KRPD 3RP1A 4OM1H 4W70A 4WEBH 4GO8A 3RNKA 2R23A 3UFIA 5DD1L 4PJ9B 2BH0A 3CXDL 1IAOA 4UQCA 2B16A 2F54A 4Q97A 4ABUA 1JK9A 4FLOA 2OMVB 3ZMRA 4RNRB 1YN7B 2BP0B 2GC7C 3PPEA 2W8CA 4KJQD 3D3VB 1E2VA 5C0CD 2OL3L 4JFPB 1FLRL 3T1FB 2NR6D 2ESVE 1CFQA 1WZKA 3LKOA 1UT1A 3H6JA 4HPYH 3W38A 4LL9A 3NPZB 4AITA 3VXSD 1MW2A 3ULUE 5FKAA 2ZONA 3UBGA 1MH5B 1PCXA 4FG2A 3KNBB 1AXSA 3O6KL 4HJSA 5LN4A 3FUHA 5HVFB 4KXZH 5CU5A 3MJWA 4UIMA 3P0GB 2OP4H 3LKRA 4LFHG 4MAUH 2TSAA 2UXVA 2X1PA 2ZT9C 2AXWA 3DUSB 4QO1B 5DC4B 1DFBL 2WPGA 1T03L 3BMWA 1XT5A 4MZIA 1J10A 1T7ZA 2BSRB 3MRMA 4K55A 2WC7A 1ZV2A 3TV3L 4KBPA 1DVZA 5IW6A 4P5MA 1F4HA 4ZFFA 4DQOH 1CXFA 4Z0XA 1XGQB 2DQUL 4ZS7L 4I3SH 4LSSL 2FWUA 4JY4B 1Q9LA 1YY8A 1PFCA 2QDVA 5EFIB 2VXQH 4AL8C 3QAZC 4M5YH 4TNVF 4BGDA 1O9VA 4UT9A 2CHZA 4S0HA 4P2CG 1ML0A 1CFNB 2CMRH 1NWOA 3WGUB 4LCCA 3S36H 5KVEL 3AWEA 2ED8A 4PS3A 4PJ7E 4BKTC 2WGNB 1WTGT 3PQYD 3QFJA 2H6UA 4M62L 3BFQG 3OKLA 4GY4A 3JWDH 5FHBL 5EN2A 1T0NB 3K6SB 1C5BL 5LXVA 4WKZA 5J0BA 3APNA 2E9WA 5F7DB 3OG4B 1QO3A 3D2UB 4Z0BH 5A2LH 1SEBB 4X5LA 2BSSB 1QBMH 3IJEA 4Z95L 1KYAA 1USQA 5KJ4A 2BIOA 4YZFF 2JJSC 1LVEA 2XNAA 2IV9A 3O0RH 5AVZB 3BZFB 5E1HB 2XWCA 3ZDWA 2H3NB 5C09E 2ROXA 4HIEA 1P1VA 1G7MA 2MQGA 2DLHA 1D5BB 4QRBA 1KTBA 4U6TA 1A65A 2FGWL 2VQUA 1HJBC 3ETTA 1EEUA 1WZ1L 3DIFA 4WTXA 1GOFA 1MAJA 1H9VA 4FTVD 1X7QA 2GYSA 2HMID 4P3DA 4UQIM 4YDLB 3V0IA 1S2EA 5F7EL 4ADJA 1L9PA 1E3FA 5HJBA 1A0QL 2WINB 2VZ1A 4JN1L 3E7JA 5D7LE 4JFWA 1TTFA 2VB5A 4UI2A 3CFJB 3FBKA 4ZO7A 3S4SB 3VSTA 4TUJB 2B1AH 4A39A 2GBTA 4Y1AD 2PMZA 1HHHB 1O7VA 5GGVL 1QI5A 4H13C 3QEGH 2VXQA 4U6YA 4X6DF 2F1EA 6CGTA 4CMHC 1Q94B 3V9EA 2WZ0A 3DECA 1R19A 2XRAL 3MLXL 3V6OA 2VW7A 5J1SC 4FQLH 6PAZA 1R24B 1JK8A 1FYTB 4M00A 1OM9A 5DQDH 1J1OL 5I1LB 1KIQA 4NO0D 2C3VA 1F18A 4JZOA 1XR9A 3MRRA 4ZMPA 4FC3E 1JXFA 4IK7A 4L05A 4AGNA 5KSUB 3ZSSA 3MRPB 4KK8C 4TULH 2JIXA 4PLKD 4AL8H 5F1SA 3GHBH 3TCLB 1JTTA 5IVXE 3SCMC 2OR7A 4KXCA 4OI8A 1KN4L 4LPYA 2R8SH 3PWVA 2NX5A 1GC1L 4ATTA 4EXKA 2EEXA 4JM2F 4FXGA 4K8RD 3EYSH 3QRFM 1A6PA 2G2RA 2EVHA 4EDXA 2DY2A 2WQAA 3DHMA 5D5MF 3L3KA 4P9HH 2F8VA 4XWGL 5DO8A 3TFBA 4I77L 4TVPD 4L4VA 1L5GA 1BAWA 1XCXA 1Z66A 4QF1B 2WVVA 1P5VB 2MQCA 3L08A 4BWUA 5CCGE 4MD5A 1I9JH 4LPTA 3BPCB 2DWEA 2ENPA 3FB6B 1CFMA 1H8LA 1BOGA 4X6FA 2EDWA 4QRRB 3EXJA 2VJ8A 2FEEI 4BJLA 4PV1C 4MHHG 4RGNE 3QQDA 2APFA 2H45A 2ZUVA 3DNKA 1FL6B 4G7SB 4HV8B 1VCBC 4PP1D 3V4PH 4H2AA 4E42B 4JMXA 3W37A 1CVSC 1CXKA 1RU9H 3OAYH 3ZKNC 2F53E 3LSOA 1W6WA 1D6VH 3NCBB 4FFYH 1NIFA 5F2FA 1UXWA 2F7OA 5D70H 4BZ2H 9CGTA 2BWQA 2OMZA 1GW0A 3KXFA 5FS5A 4FHJA 1OKEA 1LWRA 4PJ8D 4Y8DC 3MNVA 4HH9A 2A77L 3CBKB 2HFEB 4MQ7A 4ZFZB 4DPAX 2OZ4L 3RBGA 1KEGL 4K3DH 3O3BA 2XFGB 4OCSH 3CZNA 4KJWD 1I31A 1IM3B 1Q9WA 2AHIA 3CSPA 3R4RA 5A6MA 1CT8B 4HG4K 1N70A 1TO4A 4HIXH 4W1TA 2WZPD 2BO0A 2VERN 1KGWA 2ZUXA 2FH8A 2XQBH 3ZKSD 1AQHA 4PRPB 2EE0A 2CKNA 2LFEA 3KPQA 2MEJB 4F8PA 1A9BB 5K39B 1B4JH 1QRNE 4I5BA 3MFGB 4FLQA 5CHNB 3BKYH 3ZYZA 5IMLB 2EKJA 1KXQA 3HS8A 2P5WE 2OQJB 4RRPM 1AO7B 5KSAC 1XV8A 2VXUL 3C09C 4FI7A 1YLBB 2G30A 4OF8A 1V3JA 4M03A 3QH3B 2COVD 4IIQB 5E6IB 3FO1A 3CDZB 1RIHH 1KB3A 2Z8RA 3G5ZB 4PGEB 5D1QD 2XY1A 2ZKHL 1T5WA 4BFJA 1SLXA 1IGJB 1KTKE 2BSCA 4R5XA 2X44D 5KSBF 3QCVH 25C8H 4FL4B 1R3IH 2BHYA 2JJSA 4B9KC 2NY0D 3CMOL 2V7HA 3BIBX 3ECQA 2WLZA 1HH6A 2NUTB 2JELH 3FHAA 2BCMA 3OQRA 1KENH 2CKBL 4Y2OB 4NO3A 5FF6B 3HC3H 4TPRH 4F33B 2Y2TA 3V4PA 2K4AA 4Y5VC 1XMWA 4FKHA 5DD1H 2XZCL 3CXDH 2IOOA 5CN1A 1ZT7A 1I1FA 2OMYA 4GQPH 4ZK8A 4ES8A 1IARB 4J8RA 4FFYA 4LCWA 5I26A 5CGBA 3EYFB 3VWJD 4J5VA 4YIQA 2Z4TA 4BZ2A 3EJZD 3QORD 3HI1B 4YHKL 5FUZL 4CNIB 4Z7IA 1X3DA 3P30L 5DUML 1A6WH 1G7HB 1NMAH 4JFVA 1WAAE 3EYQC 2Y7NA 3MRDB 3L4UA 2OL3H 1Z32X 1KCUL 4F24A 3O8XC 4HXBH 1JHKL 4LOUD 3E6HA 4X7FC 1XIWD 3LPGA 3WO4C 2J8UA 1SNRA 1X9RA 4JY6B 1LM8V 3QULA 3LRSA 1XGUA 2K7QA 3FFDA 3L16A 2J5LC 3FT0A 5MEQB 3DX6B 3RRQA 1UURA 3F5WB 5D1XD 5KS9E 2AMGA 4H0IA 3FU3A 2YMXL 1DFBH 3FQNA 4L29A 2I9TA 4KZ0A 4ZXBC 3RHWF 1P4IH 4KO6A 4U7KA 3ZUNC 5AVRB 5ABDE 1CJYA 1D5ZA 3H6AA 4XPHL 1EEYB 3TV3H 4A2EA 3D69B 2YPLA 3VG9C 4X6DB 3IGFA 4WO4A 3ZMNA 2O6CA 4ELME 1BFOA 2DQUH 2Q3ZA 5D96B 3VD5A 2HTKD 1VKXA 5K59E 3B7UX 1GJIA 5DMYA 1NAMB 5D2NE 4U0RC 1AR1D 1HXKA 2G9KA 4JMNA 5IVOA 3C6LD 3SBQA 1YQVL 2J12B 1TEFA 5EEVA 5D7IE 3SCMA 3TH2T 2H2PC 1FC2D 2EDYA 4Z7WE 2DS4A 1G87A 2W91A 3QUZC 4HWEH 4JZNA 1QSFA 4M62H 2MH4A 3ZHKA 5CP3H 5GGRY 4XPFH 1J5CA 2N0KA 1LK2A 4RA0C 3D85A 5E5RB 3OL2A 1C5BH 4I4WA 3Q2VA 5HTSA 4LRIA 4WI0B 3ULVE 4X7TB 2OMNA 3WYRA 1ORSB 4DN4L 1JXJA 1GYWA 4QNPF 1ZLWH 3HCVB 5EOTB 2YPVL 2E46A 4Z95H 2YXFA 5GSVB 4LMQI 2IALA 1DL7H 4JM2B 1U93A 3TV8A 4ONOA 2BP8B 2OL3A 5D5MB 2P3YA 4F9PA 3X14A 1NMBL 1E9PA 4Z6AT 3PREA 2FGWH 1JRHL 4QRPD 1JRHI 4KNTA 1WV7T 4QUOA 2G3ZA 3DV6A 1YN6B 3CFCL 4L4TA 2DM4A 5F7EH 4GS7B 2ZWNA 4P5TB 4PD4K 2VDKB 1MVUB 1NUGA 1SJEB 5ETUB 2UZYB 3BLKA 4GRMA 4IOSD 3HZKB 3NJKA 4BGLA 5CWSB 1TCMA 2HRGA 1MLCB 4LK4A 3T4AB 2PO6B 2BW4A 1R5IA 1NOLA 3POCA 3ARDC 4YHNB 4K7FB 3C2SA 5DURD 1S7XA 5C0GB 3GTVA 1B4RA 1OARL 2V2WA 3ISYA 2WW8A 7PAZA 5LN8A 2XRAH 1NKRA 5E8EA 5HYSG 1O6TA 2V7NA 3AQDA 1GYAA 3EJYD 1MFNA 1PX8A 8FABA 5HI4C 1AG6A 1J1OH 2CA4A 3GKWH 1PQZA 5J5EA 4U1NA 5CP3A 1D9KB 1DHKA 1TTRA 1U8CA 4JGJA 5KSAA 2ENSA 3GINA 4JW3A 2DJUA 2ENQA 1EO8L 1ZGLP 5AKVA 5FYLD 4JN2B 2XJLA 3LRMA 3WFCL 1X44A 3TTSA 2HPTA 2MCG1 3LIZH 1HYSD 1FNAA 4LHUA 2ADGB 3O45A 4X98B 5F6IB 5LXGL 4YHIB 1HL5A 1OGAE 3B5TA 3WS3A 2VR6A 4BH8A 3CZEA 4LVOC 1ES0B 2DWDB 3RVVD 5BXFB 4M3JA 2P5PA 1BMGA 3UOAB 5KSBB 4DKFL 3EFFA 4Y5VA 3JUZA 4XWGH 4P46C 3WIHL 4DUVA 3L4ZA 3J8F7 1IGYA 3FCTB 3PJLA 3WEXB 1RIUL 2ZXEB 4GYBA 2ICEB 1DVUA 1W0YT 3GJFH 3PHOB 4UOJA 2WUCL 5DS8B 1WTLA 2A9ML 2CDGA 2IAMC 2JKTM 1DQVA 3D0VB 1FLTX 2VLKB 5K9QG 1X5HA 3F7VB 1EO7A 1SXBA 3KLHD 3WJMB 2Y3AA 1VCAA 4K7PX 1YQ2A 3NIFB 1J0IA 3MUY1 4OCLC 5ICZA 5JW4R 1MZYA 4HX1B 3CCHA 3DDFA 4YVNA 5ESVA 1I8AA 3K74B 4ZXBA 4FXTA 3O2VL 2NOYA 3DHUA 3OHMB 4PRBA 3BDBA 4QOKE 3CFQA 3HUJF 4LCYA 2G60L 2VDOB 1JVOA 4AYBA 4OZHE 4PCYA 2H3KA 5AKRA 1CWVA 2F54D 2AITA 3F00A 1XD1A 2GJZA 2O5XH 3SJVA 4HK0A 4AZ8B 5E4EB 4KQ4H 1J0HA 4YHML 3LIZA 5AVUB 1DVSA 1OHZA 1L3WA 3IFOB 4N8VB 3OAYK 4F7EB 4Q6KA 1WHPA 1MELA 2F1BA 3MXVH 1L7TL 3K2IA 4JCLA 4P2QE 1CF1A 1ORQB 3EFOB 3EADA 4J7RA 5CINH 4MNGE 1AZVA 1A7BA 1J9RA 5AW7B 2ZKHH 4AUJA 3F7RA 4X5WA 1L0QA 4MMXA 2AAVA 2ZXWB 3OLEA 5I71B 1F41A 1DANT 3B2UC 3CMOH 5FUCE 1QI3A 3JSSA 3GJFA 3NCJL 4Y9BA 3KL3A 3ZO0A 3WTUA 4M7JL 4JKWA 5B1KA 2E5EA 3GIVB 1YNTA 1OZTG 4M9PA 4NC1C 3MRBA 2BNUB 4PJ9C 3HN3A 5GS2H 1N8ZA 1XHHA 2X4NB 4A2FA 2ZXGA 1IBGH 4KROB 1IL1B 4OLXL 4URTB 3UGEA 5E7BA 3HZMA 3JWOL 3F58L 1SXSA 4YHKH 5FUZH 1TFHA 2OJEA 1S6NA 3P30H 2GUOA 3OKKA 2GSIA 2QPSA 5LUMA 3GI9L 3B2VL 4GKZA 1KCUH 4QHPA 3V0AC 4RBPH 1WC7A 1SBBA 2BERA 3CFKB 3NFNB 3BKMH 4EF3A 5ICXA 3L7EB 2CM6A 1OB1A 1SY6L 2DJSA 4ONHA 4FOMA 3WKNA 1FE8H 2EH7L 4DGWC 1UM5H 4QRSA 3ARDA 4YGVB 4ZUUB 2A6IA 3A6CH 5AB0A 4NAQA 2YMXH 4M8VA 3PG2A 3BP4A 5F96L 1CS6A 4I1RA 3F01A 4ODXA 5D6DA 5DYOA 2ROYA 1CB4A 4OLYH 3V9FA 2OMTA 3CVHB 4DPCX 2DYPD 1XF5A 5DHEA 4E9TA 4ISVB 3I2CH 3X3GL 3VGDA 4K5MA 5I1JL 1T20B 1GY2A 3LNDA 2IH3B 1MY7A 3VJ6B 2EIJB 2OMXB 2DKMA 1ZHLA 2XX1A 1YQVH 1QA9A 2D7TH 2R0ZL 1ASOA 3CBRA 1AH1A 3IDGB 2AXGB 2W81C 3QS3A 5DMGC 4ODUA 2WGXA 1S9XB 1LDSA 3RWJB 3MRGA 3FMGL 4IU2A 2GJ6D 1TTBA 1UEMA 4WDIA 1QW9A 1TVBB 2WXHA 3KYAA 4JE4B 4DN4H 3H85A 4ZTOL 1ANUA 1BJ1J 1GOGA 4WEEA 1A14L 4P46A 3B6SA 2QADB 4F7MA 3U1PA 4BQCA 4B7IA 2ARJB 1X5AA 4XPAL 4UNVA 1I8KA 4WJ5B 1NMBH 4A67A 3GTTA 3L2MA 3GSXB 4AIOA 3MGAA 2IAMA 1JRHH 2HUHA 5IFHL 3IS0X 1SMDA 4FFZH 4OY9A 4YDLC 2X9YA 3QDMA 4S2SB 4NP4L 4U33A 2CRYA 2XLLA 3WE6A 3GJEA 4H8VA 2WXKA 4L3EA 3ZW3A 5IB5B 1MCWW 2NX5D 1D5MA 1ZLWK 1BQ5A 1TYEB 5C86A 3RL2B 1D5IL 3Q9QA 4MJ4A 1I53A 4WW2A 3S8GB 3SE9H 4NN6B 3DROB 1RERA 1D5XB 4JRYE 3T6XA 5IVNA 4L4VD 5GGQH 5HHOE 3GBEA 1AQKH 3EH5B 4Z3HA 3ROOB 4HZ1A 4Z78B 4PJEF 3OAUL 3HUJB 1DN2A 2MPVA 1K3IA 4PGDB 1MQKL 3RWDA 2VLJE 1LXMA 5DUBB 1P4BL 4D0CB 3NZ8A 3MV11 3ASWA 2KZBA 2V5MA 4L23A 1T21B 5IIEB 1OTTD 3IN2A 1KG0B 4DESA 3PWPB 4YN3A 1UZ8B 4YXKL 2BJML 3FAWA 1NAML 2MOGA 2AJSL 3MV9A 4NQDA 3BXNA 2ZUSA 4M5TA 4Z7OF 2ZE0A 3GD1C 4QXTB 4ZUWA 4WU7B 1S9VB 2Z7YA 4YL9A 3BJ91 3QDJE 4RZKA 4R7VA 3S0PA 4HUXA 3SYQA 1QEWA 1IZJA 2NXYB 1F3JA 3BSZH 1NUDA 4ZO6A 3VI3F 3CTTA 3MO1B 1XGPB 4G6JH 3FOMB 4PJ9A 4FFZA 3JWOC 3UYRL 4Y9EA 2IH1A 1UM4L 5B7MA 1NCCH 4LARL 4UOW1 2C7UA 1PVHA 1U8OA 2GABA 2OMVA 4RNRA 1YN7A 2BP0A 1RIUH 2Y1YA 3D3VA 1NEZB 4JFPA 3T1FA 4KAQL 3VXQA 4WFEE 2CPCA 4OR1A 4AGOA 1AHMA 1AXTL 3KNBA 5FUOL 3RGHA 2NQCA 4U6VL 4AJWA 4YC2B 3LZQA 4ZUVB 4TUKL 1EV2E 3JTSB 4I2XB 2CQVA 2NZ1A 1BD2A 4XOBA 1Q38A 4G8EB 2VDKL 5DFTA 2Y7QB 4XVUC 2BSRA 2XXMB 4FLRA 3SDAB 1G4RA 4DT2A 4CVZB 3ZYIA 1L4IA 1NBZB 1FG2B 5C0CE 1WIOA 4GG8B 4OTXL 1OAZL 1XGQA 3QG7L 1X5KA 4JY4A 2VSDA 3PWLB 4X9YA 1NCJA 1DQLL 1OSYA 3VXSE 5EFIA 3GJFK 1E30A 4MJ2A 1BJ1H 4NWTL 3GZKA 1KTCA 3F04A 1CFNA 1XXDC 4HULB 2IFFL 2CK2A 3Q1EA 5B1AB 2XWRA 5DI8B 3HMWH 5I5RA 3H9ZA 1GS6X 2YD8A 3SE4A 1J9CT 2B4CL 3DOSB 3BSZA 4XH2B 5EZJB 3K6SA 1PZBA 1CLZL 1T0NA 4IIQC 1IIIA 1XGTB 5E6IC 2JQMA 3V4UH 3WG7B 3EAKA 4G42B 4OQ1A 5F7DA 4GQQA 3D2UA 1OAXH 2XYBA 5E2VL 3KL5A 4OD3L 4FL4C 2BSSA 2Y5QA 2Z4QB 1SDAB 3J7HA 4P4KA 4KKNA 5BJTA 1H8SA 1E9OB 1LDPL 4FTDA 4FNTA 4OIFA 2YPLD 4RAVA 5K1VA 5CR1A 4OZGE 1D5BA 4WO4D 3IEAA 3FQ4A 2DQFA 3L3HB 2WXRA 3I84A 2MSPA 1BBJA 3PQYE 1W72B 1U95B 4Y1SA 5D2LE 3TEWA 1JD9A 2OK0L 4RAUB 5E00B 5I16B 4KK8D 4Y8AA 1A3QA 3ASOB 4NCC1 1AZUA 2DMBA 4G7YL 2IH8A 3MRFB 1H3WM 2O6EA 5E51A 2WINA 3GI9H 1FAIL 1HHJB 1SJHB 4U7MA 2YAPA 3D85D 3CFJA 1SY6H 4L1LA 5HHPB 1XF3B 4G6KL 4MLIA 4TUJA 4OF7A 1XGRA 3CFBB 1HHHA 1PD1A 4HF5L 1UHVA 5A1AA 2E27L 1A3LL 4ZO8A 2M8XA 1MIEL 1ZSDA 4FTVE 4H1LG 4M8QB 1E28B 2YR3A 5F96H 2ZKWA 1R24A 1FYTA 4S1SL 4JBSA 2CBMA 4G8IB 4F7PB 5I1LA 3SKUD 2VDOL 4PJEB 1QNZH 4M02A 3HG0A 5KSUA 3MRPA 3VNYA 5GGVY 3BWUF 4Y1AE 1SN2A 4RBPK 3ZKND 3FUEA 3QI9D 2DIJA 5I30L 4JPWL 4PB9L 2K8MA 4M8RA 4ZW3A 2R0ZH 1J8HD 4XPGL 4JFDB 4OV6F 5K9OB 2Y5TB 4FEMA 1WBYB 5K5YA 2WKOF 4Z7OB 1WRFA 5KZCD 2C9RA 3WEMA 2WYHA 2CGRL 3FSWA 4QR7A 1P6FA 5TH2B 4AW7A 4ZTOH 3AUWB 4JM2C 2ZOKA 4QF1A 1A14H 4U4IA 3BW9B 1P5VA 3VVVA 2VDNB 2IANB 1AKPA 2GKIA 3VI3B 1E4HA 4QXWA 2DQIL 3BVXA 1LO3H 3BPCA 2F9BT 3FB6A 4M5ZH 3CV5A 4ODHH 5SWQA 3RLSA 4XPAH 2PW2B 3RIKA 4QRRA 3HHMA 2B59B 2OBGA 2BVYA 2O93L 4F2FA 2ITDB 1L0YA 1SY6A 4HV8A 4N0YH 4E42A 5IFHH 1T2QL 3SO3B 4KTYA 4AM0Q 2XV3A 43C9B 1CGVA 2RJMA 4CA4A 3CU7A 4OVUA 1F4YH 1L6ZA 2EECA 5I6LA 2I07B 4GS7C 1JPGB 2JI3A 4P5TC 4DZBB 3INUH 4NQCB 3CQQA 5KAQG 4JANB 4ZFZA 4BUHA 2HFEA 4FG0A 1D2PA 3BAYA 3T4AC 2Z1PA 2PO6C 1X5GA 1IM3A 1KV7A 4FQ2L 2CE6A 1MI5D 1CT8A 3ECVA 4MX7B 4MGXA 2D0FA 3R4DA 3IM1A 4PAZA 1MCEA 2R2HB 1IV8A 2V9TA 3VFVB 1TZHB 5E70A 4PRPA 3ATFA 3CFUA 3AT8A 2C4XA 2ARJQ 4IBSA 2GFBB 3VVWA 4PJFF 4OF0A 4AV4A 3MR9B 2E59A 3HB3B 3KJ6L 1A9BA 2I25N 5K39A 1MQKH 2NY2D 1DLHA 3H3KA 5IMLA 3VRJB 3E2HB 1D9KC 2B4CC 4DP0X 2OQJA 1AO7A 2AAAA 3US9A 4Z3FA 2QPUA 5CKAA 4BKLA 4JGNA 2WCGA 3QH3A 4IIQA 4U6HB 4YXKH 2B3RA 3CDZA 4MMZB 4PV9A 3IYLW 2IWGA 2DQ6A 4X9FA 5I6KA 3G5ZA 4OZIF 2AJSH 4R6UA 3RTLA 5LO7A 4JAMB 2ZG1A 3OTTA 5F6IC 1GAFH 1MWOA 2N4IA 4ZXBD 1OL0A 4KKZA 3SDDB 4GB9A 1LYQA 2NUTA 5FF6A 3CNKA 4Y2OA 5CAYB 4F33A 3OKEB 1EHAA 1FVDA 4XWOD 4Q6YA 3KPRB 4NX0A 5ALCL 3UYRH 4G71B 1AGCB 1R47A 1UM4H 3BFWA 3EYFA 3HAEB 4GBXB 2EUVA 4D8PB 3HI1A 4XXDB 4C83B 4CNIA 2NUPB 3MLRH 5D1QE 5DT1L 4DO6A 1G7HA 2ICEC 1I7RB 3LRKA 3MRDA 5E94A 4KAQH 1P0SE 2WBXA 5DDHB 3T2OA 4CSPA 3QGVA 2LGNA 4N2IA 3ZX1A 4JY6A 1OAYH 1AXTH 4C47A 2CO7B 2IBZY 2X53A 5MEQA 3DX6A 4U6VH 3SBWC 3F5WA 4TUKH 3UTSB 1IMHC 1E6JL 2VDPB 2VKXA 3WLWC 2OM5A 4LIQL 2VDKH 3DTXA 3UP6A 4AWJC 4XBEL 1JFHA 2C26A 2XTJD 5DGQA 3TU6A 1QLEH 1EEYA 3J2PA 3D69A 4KNUA 4U2ZA 4X6DA 1K4DB 1UOWA 4LESA 2PWHA 1KNOA 2OS7A 4N0FB 2FQGA 1QNIA 5JMRA 1M7UA 1DQLH 3S3DB 1L9OA 3SGKC 2QQNL 1M05B 4H44C 5E4EC 3TESA 4ALAL 2YWYA 4HBCL 1G43A 2EIKB 4NBZB 1BM3L 4NWTH 5D1XE 3WHXA 2IFFH 4N2DA 2VE6B 3DX4A 3B83A 1SOSA 3K8KA 3AM8A 2HB0A 3MKKA 4ZNEA 2CIIB 1HQRB 1X5FA 2B4CH 1W91A 2LABA 1CLZH 5AUMB 3ARDD 3DGDA 4WI0A 4AMKL 4X7TA 2GT9B 4E9XA 1ORSA 3UG3A 3P3SA 4QHMB 3HCVA 1KN2L 3LN4A 3QWRA 3L1FA 5EOTA 1OTUC 3QFDA 4OD3H 4KV5E 4N3TA 3WN6A 5GSVA 4A7UA 1EJ8A 5I71C 4JM2A 1HX0A 3FCGA 4B5EA 3OAWA 1Q90A 2BP8A 1LDPH 3SYPA 3ULUF 4U1MB 1AXIB 1FJ1B 1GW6A 5D5MA 5I15L 5L4FA 1A4KB 1YNLL 1THAA 2LT9A 2VZTA 2EINB 1FWXA 1S46A 4KROC 5SWZA 2OK0H 2CRMA 2BOLA 4L8BB 1NH6A 1Z9PA 3MBEB 1YN6A 1IEBA 3ARQA 3FSZA 3ARRA 3L5HA 3UC0L 2GY7B 4U3XA 1A21A 1BVLA 4P5TA 4X6EB 3REWB 2Y0SA 2GSGB 1SJEA 3HIZA 2UZYA 4R9HA 5ETUA 4G72B 5C0BB 5C0JA 2C1PA 5SWSB 5CWSA 3AS3A 1WQVT 2K9FB 1V10A 1MLCA 1T89A 3REVA 1ECZA 3T4AA 5JLZB 1YEFL 2FGZA 5C0AD 2PO6A 3LXAA 1L6XA 3SGJC 4G6KH 3AREC 4WWID 4HF5H 4YHNA 2A9NL 4GFXA 2DIEA 2WVSA 4TN9A 3RWCA 1LK3L 3C60D 4FYTA 5C0GA 4UCFA 5DFWH 2P44B 5HI3D 4V1DE 1MIEH 3KAAA 3SOBH 3NJVA 4WK2B 1UCBL 2ZAHA 4ZDHB 2X05A 1M53A 5IEHB 1A7PH 3D08A 3HKZA 4IQHA 3VXMB 2OMBA 2FJFB 4G3YH 5HI5D 1D9KA 2IAMD 4BUQA 2VDOH 4LGSB 4PJFB 2XBTA 1FP5A 4OW6A 1ZVNA 5FIEA 4JN2A 4MZRA 2O1AA 1V7MH 4XO5A 1YECH 3QWOB 1IM9D 2JKJA 5I30H 1FCGA 2EC8A 4PB9H 5E2JA 5HYQB 2FO1A 4XPGH 4L3ED 1U42A 2ADGA 2GUYA 4X98A 3ULAB 1KCBA 4CN1A 4YHIA 4OH2A 2ZNXA 1K6QL 4PWFA 4OZIB 1UACL 1HHIB 1AD9B 4F1SA 3ECUA 5FR3A 5BXFA 3JV0A 5KSBA 5F6HI 1ZTXL 2CGRH 4KKBC 1P6WA 4IMLB 2I69A 2QADC 5FYLE 4OZFG 2NY6B 2FJUB 3FCTA 4YE4L 2W5PA 4X6CE 4YDNA 5F7NC 3WEXA 2DQIH 2DQEL 5DYFA 4BFFA 1J0KA 4XMVA 1I7ZB 3PHOA 4XPTL 5DS8A 4QYOB 5E9DD 1XH1A 4UTCA 1OCRB 2VLKA 3TBYA 3KLKA 5IM7B 4C8XA 3F7VA 4BFEA 1W72L 1T2QH 3C08L 4XP5L 5DZOA 5D4JA 3WJMA 5IMMB 3LPWA 1QAWA 2HLFC 1JGLL 3GWJA 3SIKA 5IJDC 3M7FB 1IT9L 2EICA 3MV9D 3W11C 2B08A 1BF5A 1O5DT 2BVTA 4Y2DA 2IPKB 3CFTA 4XMUA 3KPLB 1JPTH 3S37X 1UA3A 1T83C 1MFDH 4XN9A 1CYXA 2J2ZB 2TRHA 4GPVA 5JA8B 4EQ3A 1BXVA 1YEKL 5KJRH 4DO4A 3ATBA 4NN6C 3FTGB 5DWUL 5CM1A 3Q01A 2L7JA 3WHE1 5IVXF 3QXWA 4A2DA 4ALAC 3UPAA 2MPAL 3OVUB 2Y6SC 4L1TA 1Q1PA 3K6OA 4RX4A 4F5CE 4AZ8A 2UZXB 1EIBA 1VZIA 3B9EA 4H8QA 3CK0H 1YYLL 3I9GH 5CSGA 3IFOA 1N7ML 4S0SD 4AQOA 3PU7A 2ENJA 2P80A 3RGBA 3JWNG 4LLVB 4IGBD 2X9XA 3CVHH 5KANG 2X6BA 5C2BL 2AQRA 3EFDH 4RWYH 5F8RC 5JDJA 1GSMA 5CD5D 3MV01 1KLFA 2GJJA 1ORQA 1UATA 2YZ1A 3EFOA 5H37G 4ZX3A 4KJPC 3UBXB 1BD2D 3QQXA 3QQ4B 3WD5H 3G5YA 4GI8A 3H9SE 4L3CB 3ES6B 3RDJA 2DRUA 3VXRB 1T6BX 4GRWE 2QJDA 1QSVA 2FSEB 3GIVA 4R8WL 4X0NA 2GEQA 1U21A 2BNUA 4HS8L 2A4ZA 1Q9OB 4BZYA 2X4NA 2P8MB 5ALCH 1IL1A 2VN3A 2WZ6A 5BZDB 4P57B 3KG5A 2WBWB 1B0WA 3A0OA 5J3HC 4OFIA 4FI8A 5DT1H 4HU2A 3GNML 4CMMB 1OANA 1EZVY 3P9MB 1AC6A 4GI6A 3BJLA 4KKLC 1OVZA 2NY1B 1ROWA 3NFNA 3ZR5A 1LQBC 3I3BA 3L7EA 2KBGA 4HK3J 5F6HJ 4WNSA 3DSNB 5TFSH 2C9AA 4YC2C 4YGVA 4J23A 3D2UD 4ZUUA 4QTHB 4XN8A 3CN0A 3PV7A 2ADFL 3TN0D 4P4KD 3MPCA 5E5MB 4LIQH 2OAAA 4PRHA 4XBEH 1REIA 5ACMA 5DD3L 3APMA 3RTQB 4YXHH 1NDMB 4HA1A 1AHWB 3CVHA 3F84A 2G4EA 2GY5A 2WQVA 4ISVA 4JFYB 1T20A 4XR8C 1J5HA 3VTAA 4Q58C 2IH3A 4WI4A 1NCAL 5FYJU 2QQNH 4MJJA 3VJ6A 4HFUL 1Q72L 1E7UA 4Y9GA 1J5DA 4ALAH 4NN5B 2VDQB 4X42A 1ZANL 4YBHA 4QLWA 3IDGA 3EJUA 1HHGB 2AXGA 1N67A 3QZNA 3QUMB 4P2RD 5C09B 1S9XA 2B0SL 4NT6B 3RWJA 3VMPA 1FCCA 3N06B 3AS2A 3HJEA 1RZGB 3GS4A 1TU2A 3EBHA 1WAAF 5IOKA 1KN2H 3N42F 4WO0A 3S5LB 1Z9NA 1RULH 2KYIA 2BP5M 5ID1B 5EDSA 1FYTD 3QO1B 4NWUL 4RWHA 1KT2B 4WJ5A 1FFTB 3MX0B 1KZYA 4TLSA 5I15H 2IPTL 5D7LB 5KN5B 5KS9F 3PJSA 3S2AA 3SDCB 3OPUA 1IAMA 1FF5A 3WI9A 1OLLA 2GJ6E 1J1XH 4MAYD 4S2SA 1YAIA 3NIDF 4UQAA 5FX3A 3AVEA 1Q0YL 5DK0A 5ACZB 1EK3A 4QGTA 4ELMF 1VERA 5FM5O 5IB5A 1TEGA 3V6OE 2C3HA 2XZZA 5K59F 3RL2A 1SJMA 2VN4A 1QWNA 3DROA 4LSVH 1D5XA 4YDZA 4PSRA 3U0WL 1IGFL 4BCXA 4BSVB 1LK3H 2VLMD 2NZ9D 3O11A 5D7IF 4Q56A 5CIPB 4HPOL 4Z7WF 2FBJL 1GZPB 4FFVD 2VDPL 3ROOA 4Z78A 1ZHNB 5D6CA 2JB5H 1UCBH 2GJPA 3NIGE 1I82A 1N4XL 4UQBA 4XXCC 3LHPL 4PGDA 5CSBA 5BNXD 5DUBA 5IVXB 4D0CA 3ULVF 4GT0A 4JO8A 4UQ2B 1GGBL 4L9LB 4B9PA 3N40F 5IIEA 3QYMA 4HUKB 3A4DA 2NQ3A 4HT1L 3PWPA 4UV4L 3ZL1A 1G5GA 2HT3D 2HT4C 2IDTA 1UZ8A 2HAZA 3A3YB 4ILDA 4JO2L 5KYYB 1KLGB 4XCFH 4PS7A 3PHSA 3ESOA 4OZ4A 3UMNA 1E9QA 1KGIA 1ZS8B 4QXTA 3D25A 4ZOCA 4WU7A 3ZTDC 3Q5YA 3QNYB 3U4KA 1DZBA 5GZNC 4HQQL 5FECB 3ESMA 1CDJA 4FG6C 3L5WB 4HHAB 1K6QH 3KEHA 2WTRB 2E4FA 5DGRA 1UACH 4GQ9L 2FHBA 2YD2A 4R96A 4ZFOB 3V9CA 5TDNB 3TBVB 1XGPA 4RGNB 3BYTA 2ZXAA 1ZTXH 3FOMA 4CDHA 1SBSL 4O51A 4PRPD 2FJHB 2RB8A 1V27A 5MEND 1QPKA 1DO6A 3BOVA 5HPMA 2F53B 3QUGA 3CH8A 4ZMNA 1Q1JL 2DLIA 4WHTB 3QG6B 4Z7UF 2DQEH 3RHWK 3V4LA 1ETZB 1NEZA 5CUSL 3WU1A 32C2B 3Q8AA 1E8XA 2D3VA 4DGYH 1W72H 3QYNA 4XP5H 1BZ9B 1CBVL 2XWZA 1JGLH 1A3RL 5E4AA 1IT9H 3BH4A 4JO5A 2KH2B 4ZUVA 4I2XA 4YHLH 1B88A 3AMLA 1CBJA 4KHTH 2J71A 1VIWA 2AGJL 4G8EA 2Y7QA 2JI1A 4OCXL 4NRZB 4ZQKB 4IRZL 2UY7B 5E03A 4XGZB 3SDAA 2FLMA 4CVZA 1NBZA 1QRNB 1LMKA 1SOXA 5CEZD 4GG8A 2R51A 1KXQE 1MAML 1JHTA 1H3VA 1TQUA 4PHZA 5DWUH 5EIIG 5KYWB 3EOAB 1U3HB 5GSRB 1E2ZA 2P5WB 5JQ6H 2NXZD 3A4AA 3PWLA 1P7HL 4FQQB 4LSUL 2FDBP 4FCHA 3HB3C 3H3PL 3TYFB 4KI5E 1KGCE 3ZQWA 2HX8A 1YYLH 2MNWA 3PFUA 4BSWA 1H5BB 1N7MH 3E2HC 4TTDD 2NNRA 1MXGA 1JFQH 2NYYC 2JXMA 1X7SA 5AOJA 5C2BH 4XH2A 3OB8A 3DOSA 4MB5A 2X6CA 1XGTA 4MMZC 3JTTA 3FOLA 4G42A 3PY9A 4G6AC 3MV8D 1AJ7L 1MCWM 4WW1B 1PNCA 4JREB 3JV4B 4JPKL 4HEPA 1OE1A 4DW2L 2Z4QA 1CZ8H 3L5JA 3ARVA 5JIHA 3SDDC 2LR4A 1OIOA 4MQTB 1OF2B 1E9OA 1WH0A 4GQZA 4JE0A 3UTTB 5D72L 5GRWA 3QPKA 3L3HA 5GZOC 4AUUA 1A7QL 5E6UB 4R8WH 1LO2L 3N42B 3U2JA 1FNHA 1KBGL 2HRPL 1AHKA 1W72A 1U95A 3I6LD 3J27A 2J8UE 3NN8B 1VGKB 2Z7ZA 2X1WL 4RAUA 2PPEA 5E00A 5I16A 3E1ZA 4GBXC 4ETYA 1CICB 5B39B 5C97A 4OLWL 1OO2A 2WN3A 4JRXE 3IMBA 1OWRM 2YD3A 3MMEA 4CVUA 2VDNH 5KS9B 4PWIA 4F8QA 3KWXA 5J12B 4J8QA 4OZHF 2WQUA 3V7MA 5EEXA 1HHJA 5ACLA 5ADOL 3BUPA 4ZPTA 5BV7H 5HHPA 1XF3A 3NIDB 4KVNL 1MJJB 2ARWA 5T8IA 1QZNA 4BH7B 3R7RA 3ZIMA 4FP8L 1EFXB 4ELMB 1S5HB 2JMRA 3K2MC 3QWRD 3BPNC 2IQ9L 2ADFH 2EVJA 4JM2D 3BPOB 4M8QA 2OR8A 5GS1B 5D2NB 1E28A 3NQIA 1U0QA 4O02B 5DD3H 4Z3IA 3K2UL 2WD0A 4JO3L 5D7IB 1GRWA 4F7PA 1FVCB 3QW9A 4Z7WB 4I8DA 3FSOA 3NFPB 4PJEA 1BV8A 3D07A 5SWZD 4AE1A 3EOTL 4KK6C 4OUUB 4HIHB 1NCAH 1OCWL 4MA3B 3WGVB 4HFUH 3BUYB 3U0PB 4PLOB 3UJIL 4AG4L 3EYVB 3DO4A 1ZANH 5JTWA 3QWNA 3H9YA 4JFDA 1MUJB 5K9OA 3BWUC 2CU9A 2Y5TA 1MOEA 1A2YB 4QI3A 1H8NA 4EN3B 3K80A 3CHOA 3QZOA 3SQBB 5HHVH 4H8UA 3DMMB 3UPCA 2XIBA 4DSYA 2DICA 3F3HA 1IKFL 1F8TL 4U1HB 4ZX5A 5TH2A 3MRQA 3UBXI 5T3XD 4MA8L 4GINA 3EH1A 3BZ4B 1FNFA 3BW9A 5E1AB 3EJRA 3VI3A 1BZOA 3MJGX 4PS4L 2LVCA 1J8HE 2PW2A 4UV7H 3OR7B 1BVOA 4A6YB 1BAFH 2IPTH 2B59A 1U6AL 1TJIL 4H8WL 2AEOA 2ITDA 1UA6L 3W5MA 4WFGD 4ZUSB 5DMIH 1XMEB 43C9A 3MHZA 4XX5A 3MBEC 4Z7UB 4NUQA 4Y4KA 3ULUL 5D1ZB 2DPKA 1PIFA 2I07A 1EX0A 1JPGA 4DZBA 2XWTB 4K73A 1GR7A 1M9WA 2X7LB 4NQCA 4JANA 4J39A 2CRIA 4UOQA 5IJKA 3DJZA 5IJBC 1T1YB 1MFUA 3ARPA 1SJXA 1Z9OA 1BFVL 2YGNA 1L6PA 1EGJL 4O2CB 3KDMB 5HYJD 2KS0A 3R18A 3VD1A 2DQTH 4JGUA 3U0WH 2AV1B 1BMZA 2R2HA 3TNMB 1TZHA 3TONA 4HPOH 1CXIA 1XCTB 2GFBA 2VDPH 3IDMA 2FUQA 4A37A 2KUTA 1VHPA 1NL0L 3V0WL 1Z3GL 3LHPH 3MXWL 3S37L 3NEOA 5AENA 1HL8A 4YPGB 2I60H 2R9HD 4OLUH 3VRJA 4N2MA 5G2NA 1J0YA 4BK4A 2VLKD 3K81A 4LNVA 1OGAB 1PZ5A 3N2JA 3QSKB 4HT1H 5L88L 3VSUA 1MI5E 2KKQA 1DVYA 3KPSB 3LEVL 4JO2H 1HKLL 1Z9MA 4U6HA 4MMZA 3TT1H 5C0RH 4O58L 1XR8B 4DVBB 3MUJA 4Y2DD 1C7TA 2P7TB 5F21B 2OSLB 1EAPA 2EDFA 3A4EA 5DFAA 3U6RB 2VDQL 4JAMA 3NZHL 2CH8A 5EBGA 4K7PY 5KTEL 1G7IB 4M4RB 4JVPA 2AJXL 3WLWD 4HQQH 1ITCA 1WFOA 1FZMB 3V0EA 3QUML 3RU8L 4OFPA 4QLRA 4AKOA 1TMQA 5GZOA 3Q8BA 4F15B 2EUWA 3FQTB 3OKEA 3UH8A 1JWUB 4JRWA 3VXTB 1LILA 1WVZA 4C56B 4X5QA 4UZGA 2VISB 2OCCB 4J4PA 2XBZA 3UAJC 4WWOA 1AGCA 1OLZA 2NY6C 1ZJBA 5EZIH 4D8PA 4XXDA 4C83A 3OD3A 2NUPA 3L13A 1QOKA 3IE4A 1I7RA 2P80D 3WNIA 3HZVB 3Q5TA 4D0BB 1NOAA 3VFRB 2DWXA 3IVKB 2GTWB 2A73A 2WP3T 3H54A 3ARUA 3ILEA 3L9EA 3IDYB 1FZJB 5DUPL 1UB5B 1WJ3A 4IBVA 4X8XA 2NNFA 1CBVH 2GBVA 2CO7A 1A3RH 1H6TA 1B2WL 2YGPA 4OZHB 3UTSA 1MHPL 5EZLB 4CC4C 5B7FA 3KLSA 1QTSA 4KITB 4OCXH 3NGBB 3TFKC 4G43B 3L95B 3R06B 5J6SA 1IRAY 1MAMH 3PHQB 1FUNA 2VO5A 2AQTA 5AVTB 1AGBB 2HRLA 2C4FU 4KO9A 4LSUH 3ARXA 4DJMA 1M05A 2ZIDA 4AOFA 4P2QB 3P9LB 4KWUA 2ZXQA 1A6VH 3H3PH 3SDYH 5DEGB 4MNGB 3NJNA 3B7SA 1F4XH 5KW9L 2VE6A 1DYZA 2NW3A 2IGFL 2Z9TA 3D50A 2P5EA 1AS6A 4QRAA 2XTJE 1YUHB 2CIIA 1HQRA 2VRAA 2YRPA 4ZS6D 3T8XB 5AUMA 3EHBD 1R0AL 2GT9A 8PAZA 4JKKA 3FO9B 3UP1A 3DHPA 4UAHA 2I24N 5J1TC 2EDDA 3W2DL 4JPKH 3QEHB 4M1DH 2RR3A 4DW2H 3AS0A 3CG8A 2JCCF 5LAXB 4LSTH 4PRHD 4F7CB 2ATKB 3LZLA 3UXFA 4POYA 4ENZA 2XFXB 1I8IB 4N2FA 1FJ1A 5D72H 1XQ4A 3PP3H 4H8WC 3NBNA 1A4BA 3HVNA 1A4KA 1A7QH 3K1DA 5DZVA 4ZFOL 2EAEA 1KY7A 3EO9H 4JZJB 1CR9L 1NIAA 1RHHA 1CU4L 5F3FA 1OV8A 3KR3H 3ULUC 5JDSA 1KCVL 4N0CC 2V0AA 4XHJD 3N3EA 3MBEA 2EDXA 4IRSB 4ODBD 3S97C 4XVJL 5BOJA 5EUOE 4K5PA 3ZT6A 2EIMB 1VF5C 1L0XA 1DQDL 4F1ZA 1JZ3A 3REWA 1QBBA 4X6EA 3CZKA 2EEFA 3R1GL 3DKHA 2VR3A 3PIQB 1WT5C 4LU5L 4RH4A 2NY1C 5SWSA 2MTPA 3U4BL 1MAKA 1YY9C 5L0QB 1IBYA 1ZLSL 4U3HA 5JLZA 5ADOH 1PLAA 1SHWA 4N25A 1KWKA 4BEIA 4KVNH 5CGYC 1P7QD 3F7QA 5FDYA 1IVTA 4FP8H 2A1WL 4JG9A 4KKBD 4GXUN 2IQ9H 5LBGA 4LKXB 4LQFL 1HSAB 1T1XB 2Q7NA 1NDTA 2QADD 3LAFA 3RTQC 3RX9A 3FCUB 4G8GB 5IEHA 2BDNL 3QA3A 1DBAH 1XH2A 1AHWC 3VXMA 3K2UH 4UTAL 2FJFA 3NCMA 5JNYB 5L2KB 5FGCE 2W59A 1TZGL 4K0OA 4PJFA 5C0AE 3EOTH 1RP9A 5L9DL 1EANA 3N1MC 5CSZB 1OCWH 2DQJL 4NN5C 3UG4A 4WENB 1VFAB 3RPIA 3UJIH 3QWOA 4AG4H 1F13A 3MUZ1 4OZGF 2IVFC 1IGCH 3TJPA 2APTA 5HYQA 1E4JA 1U91B 3QNFA 3RUGA 3BN9C 5DMJB 5D2LF 4B50A 1OF0A 4HUNB 4UANA 2XVLA 2Q7YB 3BFOA 4OZIA 1AD9A 1RZIB 3GHEL 5B1JC 2EDTA 2H2SC 3TPUB 3QZPA 2PP7A 2PWGA 2FTAA 2YSTA 1O6SB 2GK2A 1IKFH 5K9KB 5F70A 4IMLA 4MA8H 3UAJA 5DJDA 4JHWL 5IBUG 1ZVYA 2AXJA 3PDOB 5A2BA 4W81A 3BRDA 4U1IB 5AVVB 1FN4B 4PS4H 2VDRH 1I7ZA 3PNWB 4NDMB 3LKNB 5TQ2H 4P06A 3SDCC 2F5BL 1OWWA 1U6AH 1TJIH 1W2KT 4H8WH 5IM7A 1UA6H 3CSGA 2VQ1A 3PLYA 3PWPD 5IMMA 3NSYA 4JRYB 3ULUH 4LHUG 7CGTA 2XG5B 1MCRA 1YEHH 2IPKA 2CO6B 4WCYH 4RMQA 3KPLA 3TJEH 5HHOB 4CC4A 4ZW8A 2J2ZA 2HX7A 3S3CB 3LH9A 4MZ2A 4MSWB 1JZ7A 1F97A 3RY5A 4AQ1B 5ABZA 1EGJH 2NXYD 4H7VA 2KI6A 2VLJB 4X6BB 2UVFA 3FTGA 5E9DE 1H15B 1I9RH 1KXVC 2B9AA 2YRBA 3OZ9H 1LL1A 1JXGA 3E6FB 3TBSB 1OD7A 4LPCA 1EJOL 4YDJA 1EAQA 4Q4EA 3S35L 4RMRA 1F2XK 2GHWB 2UZXA 4XOEA 3MV9E 4XT1C 5FA3B 4O02L 3S37H 5DFVC 4LLVA 5D93B 3U9UB 3DOHA 1QASA 4L9LC 4N0UA 1BVKA 1KB5B 2FO8A 1T0OA 3X3FL 1JL8A 4I18B 3WFZA 5L88H 4PJGE 3LEVH 1QBLL 4AQEB 1HKLH 3W9EB 5AD0B 4O58H 2RHEA 2ZJSH 4L1HA 4HC1L 3QJXA 3UBXA 3ULVL 2VDQH 3SY0B 3H2WA 3NZHH 3SSGA 1MCQA 4FQIH 5KTEH 3QQ4A 2AJXH 2YBRA 1FYHB 3GSVB 3SDAD 4XTRD 4L3CA 3ES6A 3VXRA 3VD9A 2R4RL 3AT0A 2ZX7A 2FSEA 5IUCA 2YC1A 1A4CA 4RGNC 1ACYL 1HAUA 1Q9OA 2JCCB 4RESB 4YFLF 1ET7A 1ADQH 1COBA 2VDLB 3WFEL 1TSHA 1RFDL 1BJ8A 1JZ4A 2FYVA 2VZ3A 2ZPKH 4MS8C 1JCKA 4MNQD 5BZDA 5TE6L 3CSYB 2Y5EA 2BSEA 4P99A 4CMMA 1DN0B 5C7XL 5B8CB 1BD2E 3P9MA 3DPBB 3UZVB 2YD5A 3APDA 1WT5A 1EGJA 4MYWB 4A6YL 3L3DA 5IHHA 1L9NA 3GXIA 1OAJA 5DUPH 3DSNA 5EBLB 3EDDA 5IHUL 3ILDA 4AEIL 4D0DB 5DQ9B 3LEYH 3CIAA 5DSCB 1EDHA 5D1ZI 4B9IA 3LNIA 1RV6X 2P28B 1GSKA 3ARZA 4DP1X 1TTGA 2I32A 1J05B 4W9FC 4KOCA 5E5MA 4DP4X 3AGVA 3MLWL 3GXFA 3VM5A 2EIEA 2XZAL 4IKIA 1NDMA 3UC2A 1H6FA 1AHWA 1U92B 1JWSB 2YZ8A 5CEXB 1U3HC 1T4KB 1WFJA 3NJJA 4JQIL 4KI1A 2N7SA 4JFYA 5CGTA 4QRTA 4XCCL 2D2CC 5HDWA 4L1BA 5CIPH 1Y0LB 5D7SL 3SE3C 3U82B 4U6XA 5JZ7C 1H5BC 1GTNA 3IMSA 5KW9H 5E2WL 5HY9A 2EDRA 1HHGA 2CCLA 1F1GA 1I9EA 3DGCR 5DRNB 2DV6A 1WFMA 4NT6A 3BESR 4OZGB 3EYOB 3CDFA 5FWQA 1RL1A 1R0AH 1YUKB 4BM7A 4EZLA 1G5AA 2EXSA 1RZGA 4JREC 1ADQA 5B1JA 2H1XA 3P4OA 2N7BA 2NYZA 3PQYB 3WHE0 1PL3A 2K3HA 5D2LB 3W2DH 3RFZB 3S5LA 4Y88A 3CSBA 2J72A 4I88A 4XZUB 5ID1A 4MVBD 2AANA 4WHDA 1EXUB 3QO1A 3CHXA 4X4MA 3ECBB 5IKCB 4XE5B 4XO3A 3EBIA 2P9RA 1FNEB 5KN5A 4DUWA 5B22A 4KXBA 1NCWL 4GXUM 3ZQXA 3SDCA 2R1WB 4P2RE 5GGSB 2VWEE 3P11L 1CICC 1NC2A 1UWGL 1N18A 3MCKB 2QLYA 1A7RL 1O9ZA 3HNTH 4NPKA 2R1YA 4XVJH 4YEFA 5DLLA 2OMUA 2XI9A 3MLVL 1DQDH 5ACZA 1MFCH 4JFDD 3R1GH 4JJ5B 3AU1B 2FBOJ 3B3IB 3QNZB 4JFTA 4FTVB 4P3CL 2XN1A 2N59A 2K7PA 2EKSB 1IC4L 1FYTE 2XWDA 1KJ2B 1ZLSH 5IGXL 4P5SA 3D30A 4J1UB 4XNBA 3US1A 2PABA 1JZIA 1KBBA 4B27A 1PD6A 4NQSA 4JS7A 1L9MA 3VFGL 4BSVA 3KWWA 5LGYA 1OE2A 3NSXA 4QD2E 1Z1WA 5CIPA 4GW5A 3QC6X 3BPOC 1KBPA 4LQFH 4X5PA 3CHPA 4A7VA 5B38B 1GZPA 5GS1C 2BW5A 4JDZB 4NFDA 5D2NC 1ZHNA 2C9VA 4AY0A 1TVHA 4Y1AB 2X2HA 3UO1H 4F80A 2K78A 4I3GA 4AMWA 2GW5A 2BDNH 1BZ8A 4JHAL 1E4WL 5I0DA 5IVXA 4O2EB 2CO2A 4UQ2A 4UTAH 2Q5BA 4OM0L 1HOCB 5JW5A 4Y5XB 1PZ3A 3WAJA 3VU1A 4KV5F 4FHBD 1P4UA 4NS0A 3N1QC 4YDMA 4F58L 4Y4KD 5L9DH 2DQJH 3ULVC 1KLGA 4A04A 4O00A 1JNLL 5JO5B 2IDFA 4NO0B 2X6AA 5DK2B 1DEEB 2VLME 4NQCD 2Q3AA 3UJJH 1ZS8A 4U1KB 1BLNA 2IG2L 1BZEA 3QNYA 3KYMA 4KX7A 3QXDA 4R7LA 4EN3C 2QV4A 4GMTL 2WXNA 3L5WA 4HHAA 3L45A 4WGKA 2WTRA 4PGZA 4EVNB 4MCNA 3DMMC 2J1WA 4AH2B 5IBTL 5LGJA 3B1UA 3GHEH 3NJFA 4U3CA 5DHVH 4ZFOA 2E56A 2YUWA 2CUAA 3HBQA 4P8QA 2V6HA 5TDNA 3TBVA 1QATA 3LTVA 5IWLC 2BIMA 3WY2A 3NFSL 2BXYA 2FJHA 1KSRA 1ZE3C 3ABGA 2YUVA 1E27B 4FZEH 5EPMB 1FORH 3ISWA 2F53A 3APCA 3OMNB 4J3VA 5E8NB 4JM0A 4WHTA 1UWEL 1XZWA 1ETZA 1HE7A 3HLAB 3QHFL 1KTRL 32C2A 5JHLL 1NJ9B 3B5GA 4I0PB 3VX1A 1X5MA 4G59C 2NNCA 3BH9B 2ZP0T 4C55A 3UTPE 1N0LB 1BZ9A 5DEZA 4TSCH 5D1ZC 1G9NL 3RAJL 4PLNC 1CI5A 1V7NL 4JO1L 4EDWL 4HHWA 4G6AD 3GMOB 5D4HA 1JPFB 1HH9A 5BQ7B 1GJWA 4PRPE 4XB8A 5MENE 3CC1A 4NRZA 5JA9A 4PGCB 4NRYB 4XGZA 2SEBA 2YPKB 2A9DA 3C9NB 4UTAA 3SPGA 2QHRH 2CG9X 4AYID 2YOAA 5GZOD 2COQA 3STZB 4PJ8B 4HYTB 1BQUA 5KYWA 3UTOA 2L7EA 3EOAA 5GSRA 2P5WA 5K93A 2CHXA 1HWWA 4YE0A 1TTUA 2WO2B 4FQQA 4JVWA 3FCSA 4TM9A 4YL4A 4J4PD 1PZSA 1EJOH 2X40A 3S35H 2WXJA 4JPVL 1AGDB 3TYFA 3DJTA 1UCTA 2X4SA 1BG1A 3PYCA 4MWFB 3HE6A 4O02H 4OGYL 3ASNB 3QVAA 1OK8A 1XF2B 1NKOA 4ETQB 2QZ5A 3X3FH 1I8MB 3V8CA 5DHVA 5E08L 2K6YA 1SUJA 5CEZE 3TASA 2OMWB 1QBLH 2W9LA 4YK4B 3DURB 4X6CF 4YZFE 5AVSB 3UTSD 4WW1A 1F6AB 3V6ZB 3IAGC 3BWAA 3V52L 3VFUA 3JV4A 4HC1H 1RK1A 1MVYA 3F7KA 1DVFD 2AQ3A 4X8CA 5KSVB 2HKHL 2WANA 4XCNB 1OF2A 3QS2A 1J9QA 3UTTA 2Y2WA 5D1QB 1MCIA 4DVRL 3H0TB 1BSIA 2GI0A 1WAAA 4F15C 2R4RH 5AWNL 3MLSL 2ITCA 1N12A 2VM3A 3MODL 2IIJA 1VGKA 3NN8A 5EA0L 2WXGA 2PYFA 3WFEH 5B39A 1RFDH 1CICA 1MCCA 4KNQA 4GIOA 4XO9A 2G2PA 1RKRA 3MV8E 1ZE3H 2W95A 1NCIA 5TE6H 2EQDA 1X4XA 5KS9A 5EEWA 2Q2LA 1DQQB 3ILQD 1QLFB 4HAKA 3ZYOA 2P5ED 1IX2A 4Z23A 1IVLA 1XBDA 2VR4A 3VWJB 1BQLL 3QORB 1SVCP 4RRPG 2BVPB 2BCKB 5I1CH 5LWYH 5E9AA 1K8DB 1BWMA 5LHDA 2WXOA 1MJJA 4BH7A 2VERA 5IHUH 1J87A 5HGHA 1E6OL 1EFXA 1QABA 4PJ5B 2X42A 4AEIH 1Z0NA 4ELMA 4QJ5B 3I6LE 4QRFA 5I8CB 4QMEA 2FQDA 4HUUB 2DLGA 1N9PA 2IXQA 2LAAA 1ZAGA 3NGBC 3Q05A 5GS1A 4I48B 1J8RA 4A63A 3ATAA 3PGDA 4KK9D 3IU4L 2OTPA 4O02A 1R3LB 1D7DA 3TEXA 2EC9U