2Z6FA

Crystal structure of neat domain from staphylococcus aureus in complex with heme
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
112
structure length
112
Chain Sequence
b'LTDLQEAHFVVFESEENSESVMDGFVEHPFYTATLNGQKYVVMKTKDDSYWKDLIVEGKRVTTVSKDPKNNSRTLIFPYIPDKAVYNAIVKVVVANIGYEGQYHVRIINQDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Iron-regulated surface determinant protein H
publication title Structural basis for multimeric heme complexation through a specific protein-heme interaction: the case of the third neat domain of IsdH from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Heme binding protein
total genus 26
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05031 NEAT Iron Transport-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2z6fA00
2E7DA 2Z6FA 3QUHA 2MOQA 3SZ6A 2O6PA 3RTLA 5D1XE 2H3KA 3RURA 4H8PA 4YMPA 4FC3E 4WJG3 3SZKC 3QZNA 2ITEA 3QZMA 2K78A 4MYPA 3SIKA 5D1QE 5D1ZI 3S48A 3OVUB 3QUGA 3QZLA 3QZOA 4NLAA 3VUAA 4H8QA 3VTMA 2ITFA 3QZPA 2Q7AA 2O1AA
chains in the Genus database with same CATH superfamily
4LFHG 1A6AA 1A7OL 2COQA 4Z3TA 4XMTA 4S10A 4WO4D 4JL1A 1ZRUA 3CZKA 2EVIA 1CE6A 2EEDA 3LEVH 3HFML 4B5ZA 4XCYA 1S5HA 4NRZB 1WTLA 3UPAA 15C8H 4JZNA 4MJ2A 1X44A 3SCMA 3V6OE 1KJ2L 5HHXL 4KKBD 1Q0XL 3B5HA 2LTQC 3PYCA 4HJEA 5C09A 1DVTA 5EEYA 2OK0L 1HEZA 3IU4H 2CDEA 3MGOA 4ZFFA 4P57A 3HCVB 4K23H 3U0PB 3SJVE 4P07A 4P5TC 3MRFA 3NCFB 4RMSA 4NO3A 4X9HA 4XOCA 1Q1PA 3QJUB 4FDWA 2R83A 4RGNC 1BOGB 5D4HA 3IJHB 4G6ML 4XP5H 1CFQB 5IM7B 3ARSA 5H35A 4DN4L 1QEWA 2BSED 2HT4C 1KB9K 3VFNA 1CZ8L 3QRGH 3SQBA 3BPCB 2VXTL 1W8OA 1MIML 5D1ZI 5AWNL 5I8KH 4JFYA 4FLSA 5IP4A 4PYGA 1RP8A 5ESAA 3F7YB 3PE9A 4UDUB 5BUGA 1RZFH 2CGRL 4NGHH 3DIVA 4L1BA 1XGTA 1WITA 5K9JH 1OOWA 5ID1A 1QTSA 5K9OB 1QYGL 4NQCA 3PJSB 5E0FA 4YSSA 2IGFH 1U8LB 4GUQA 4AMKL 3VNYA 1MFEH 2IQAA 1CL7L 4NQSB 4XVTH 2WXHA 4ELMB 4UV4L 2VR6A 1R5VB 2ARJB 4G1MA 4X6DA 1BMGA 2HRPL 2IPKB 3QS3A 1AXSA 4FQCL 2ZUXA 5CJ5A 4N85A 4KMTH 2NPLX 4KKPA 4WHTB 2XQYA 3TLRA 5J1SC 4YXKL 4F7TA 2BVYA 2EIJB 3OLEA 3Q5TA 4I3SL 5GRVK 1WO2A 4AG4H 4K7PH 4A7SA 2OA9A 4ODSL 3CFEB 2YPLE 2W9EL 2YFNA 3DNKA 4OGAD 4UQBA 5GXBB 4XI5C 3JWOL 1BGXL 1H15B 3FO1A 4O02H 2IPTH 3L4UA 3PHQB 1UJ3B 5L0QB 2GSIA 4PRPB 5GIRA 3MOQA 3QHZH 2LABA 2R39A 3APFA 5CIPA 3FONB 4TKWA 2HJLA 3O6FB 5F88A 3T0EE 1FLRH 5B7EA 3FYIB 3L2LA 1KLUA 1TVHA 4OCWH 4RA0C 3ZHLA 4GXUN 1K4CA 4QAWA 3FF7A 1G6RB 4GRLD 3VFRA 4DZ8A 4PS7A 2Y6SD 5D5ME 1N5AB 3MBWB 2P3YA 4C56B 1T80A 2HWZH 2QSTA 1Q9KA 3SB3A 3HMWH 2VXSL 4LSQL 4Y4FB 4TLUA 4DJMA 5JZ7C 3EJZD 4GG6F 1FWXA 4JFWA 3F6LA 3WMSA 2WBWB 3R1GL 3MRDB 4RMTA 1KY7A 1RIHH 3G6AB 3L7FA 2ATPB 2WWKT 3KXFD 3N50A 4KKNA 1DJWA 4HPHA 3FK3A 2KUTA 5TQ0H 3VSVA 2F7PA 4LPWA 1DO6A 4FMKA 1BD2A 3UZEC 5L88H 2A6DB 1ZOXA 2AABH 5HI3D 1W6WA 3UZEA 2FJGA 2BRQA 1IFHH 2Q8BL 3Q5OA 2FNBA 4P99A 4U0RB 5DMIH 3BVNB 5KSVB 3VXUB 3GJFB 2C5DC 1OIOA 1DANT 3KL0A 3BUIA 2ODIA 3QNFA 2OV0A 4YGVA 2PLTA 4A68A 3CMOL 5IK3A 3EJRA 3OC8A 3V0WL 4DP0X 3GZOA 1X3DA 4HHGA 1BXVA 2OJEB 5IHZB 4FQXC 1CGWA 4FQXA 3O2WL 5BZWA 4Z7UF 5K9QG 3D39A 4UQ3B 4NJAH 2VQUA 4JK0D 2JQAA 4PY7A 1J1XH 3FB5B 4L37A 4HUWA 1JDCA 4HUUB 1DN0A 3O41A 5HDOA 4N8UA 4NNXB 3SCMD 4LVHB 1DLFH 3CNKA 3Q01A 1T1XB 3VM7A 1KIRB 3EUDA 1L9PA 2BLFA 1JK9A 1T3FB 2X9ZA 4A6YH 4OLZL 3KBPA 4L4VD 3ABZA 3RUGB 3VX0A 5CINL 3MO1A 4A7UA 1E5UI 3FB6A 5KAQG 2JKJA 3OTTA 5SWSB 2ZNWA 1P7QB 2AZUA 1LGVA 2G75B 2WC7A 1JZJA 3NGBC 3QBTB 4Q56A 4ETQA 2MEJB 4I5BA 5KZCD 3PHSA 3QUYC 4JY6A 4PU2A 4XCFH 5FYKD 1OW0C 5E4AA 3FRUA 2XV2A 1CTNA 1OW0A 4X4XB 1NPNA 2AXWA 2BHYA 1ZT4B 5KSAD 3LIZA 4XPFL 1CG9B 2HT4D 2FWOB 1IILE 3RWIA 2BFVH 3I85A 1AY1L 2VN6A 3FRPB 4NPJA 3K7UA 1CD1A 3QDAA 3UZQA 2V5TA 5IVXA 1LK2B 3T2NH 5DEFA 2BP5M 4OQTH 4HV8B 5GRYA 4P46B 2VDOL 5E5LA 3L08A 2XWCA 1A4BA 5FOBA 3HR5A 5FYKH 3UPCA 3K8LA 4L9DA 4ICXA 1ZHBB 1QW9A 1A6WH 1MJ8L 4MXVE 3QWQB 3M17B 4UT6A 2V5RA 3M45A 3HNTL 3BZ4B 3TA4D 4AUYA 1B6UA 4PJEE 1P1ZB 1JTOA 3UJJH 4JPIA 4I1RA 4CN4A 1R33A 1JDAA 1MWOA 2PR9A 3DUUA 4M7JH 3LPOA 2FZ3B 3NFNA 4AGMA 3QP3A 1NANH 5IG7A 5KVDH 3N41F 4Y5VC 2FSEA 1TIUA 1VIWA 2GPZA 4Y5VA 2UZXA 4P04A 1ADQA 1IZKA 1CF8L 1T4WA 5TK4A 1LD9B 4QDGA 2Y2WA 5I66A 3I6KB 1KXTA 1MXGA 1NGXB 5JR1L 5IHWA 3Q8FA 2ZP0T 4XI5D 3AG2B 3K6IA 4NAQA 3LD8B 1T5XA 4AV0A 3LZNA 3BD4A 5HGAA 3JVGC 5MI0B 1N6UA 4X7EC 3KEDA 3VYOA 1Y07A 4QHKJ 4YDJA 5E9DD 1NC4B 1J9TA 3PJLA 1JN6B 1WS7A 3P4OA 5CBEB 1TLMA 4DESA 1ETZA 1JJUA 2EYSB 4W9ZA 5HDQH 5JHLL 1NBZB 4OV6F 4XXCA 1F4WL 4PPTA 3UYOD 3WEXB 3T2OA 4BQCA 3BAIA 3GS7A 4X98A 1NEPA 1RZ8B 3G6JF 4RMUA 1JZ2A 1F58H 2ZWNA 2BSDA 2YA2A 1RURH 4XO9A 3H9SE 3MA9H 3PJNA 4K8RC 5F7MC 1DUZB 1FH2A 5J9PB 3AT9A 3RWJA 4EUPH 1CD9B 1UJTA 2WZPD 3QWOA 3OWEA 4JFZL 2A0LC 4OFDA 2W07B 3E6FA 3SYPA 3O8XB 5FGCB 4QRUB 1HCYA 4JFEB 2CZNA 2VR9A 4YHYC 1L3NA 1QLRB 2FHBA 5J12C 2X9WA 3K4DA 2ZXEB 4FRWA 1NM9A 1F6FB 3C6LB 4NZJA 4UYPA 2HX8A 4FGMA 4GRMB 5INCB 4YVUA 1MI5D 1M7UA 4GKZB 4BEIA 2Q87A 3T4AC 3KPPA 3X12B 2ZUQB 4B96A 2CLVB 4YL9A 1F4XL 3ECBB 2BZCA 1E42A 3OJDB 4QRFA 3U79A 2QJDA 2JKSA 3BZ5A 5JIQA 3MRNA 1MN4A 1OP5K 2ZX6A 1OQOA 4EVNA 1E4HA 4LCWE 4ZW5A 1NLBH 3SJVA 4EDWH 3ZR5A 1PZUB 4FG6C 1DL7H 4FXKB 5C0AE 2QKIC 3OJVC 4X80L 3ROLA 2QKIA 3SE6A 1T1ZB 4YMPA 1P2CA 2QHRH 3X17A 3U2JA 3CWGA 3OZ9H 3EOTH 5FGBC 4YSDA 4TLTA 2AQNA 5FGBA 4AL8H 5CMAB 2NXZB 3DJSA 1KIUA 1FPTL 3UTSE 2PETA 5BVJA 1W72A 3G04B 4JVWA 3ECVA 3CN0A 3DSNB 4HVBA 3CHRA 2K1MA 1GYUA 4I0PD 3MNWB 2HMID 1G84A 2XA8L 3V0VA 1F18A 5I1LB 3OAZK 1F97A 3HB3D 4YUEL 1NCBL 4JM2B 3M1BB 3EBGA 2CRIA 4EN3C 1N8ZB 3IGFA 4EN3A 1KTDB 4JRFA 2ED9A 4ZX6A 3D18A 2BWDA 3MRRA 4NDMA 3MJWA 4YWGH 2E6JA 1JBJA 1IVTA 2EUXA 4OF0A 3U4BL 3UC0L 5KBMA 4BINA 5FIEA 5IVOA 3SQOH 4X8JB 2D3JA 4G43B 3DURB 3SHSA 5B38G 2VRQA 2Q76B 2VR8A 4U3XA 3ZKQD 1UXWB 5HVFB 3H42L 2O5XL 3VFMA 3PWJB 4J8RA 4A66A 2DMBA 4NQXA 2VL5B 3TV3L 3V6BR 2J5WA 1JGDA 4HIXH 2YPLA 3EYUH 4OSUL 2O93L 1KBGH 4HF5H 4K3GA 3BPOC 4O2CA 1QUNB 3L5IA 4Q6YA 4DEWA 4FJYA 2KQNA 4UOQA 2XFGB 4QXVA 3EYOB 4NO0A 3OXSB 3ZUNC 4QOKB 1I8AA 3O45B 3T0EC 3MLTA 3CPLA 3VMNA 3T0EA 1LXMA 3TGXA 3KPMB 1G1KA 3BT0A 5HY9B 2K6WA 4BZ1H 2P8PB 5GGTL 1XF2B 2OM5A 4OF5A 5D5MA 2DQMA 2NMSA 4JFHD 4X7FC 3L4YA 4X5WB 4HCGA 4LIQL 1FCGA 1YUKB 2QQNL 1FBIH 3RWCB 4OZFH 5I15H 3I02A 4LSRH 1A7QL 3A21A 3CGTA 4HKJA 3WN5C 1SFDA 1CDIA 4Z95H 3PXLA 2XXFA 3NJXA 3N44F 3WN5A 2Y24A 2PR4L 1I8LC 3NJJA 3VE0B 1TQBB 3NRQA 1LQSR 2B5IB 1I8LA 3DGCR 3LN4A 4MNGE 3TPUA 5JDSB 1AGDA 3SD5A 3QIUC 2OMVA 1OGAB 4WWNA 1G9NC 2CBMA 2QPDB 3QIUA 3RY6C 3RY6A 1VKXB 5A43C 2JCCB 5E95B 4NUMA 4MA7H 3FT4A 4JANA 1TZAA 3L9RB 5KOMC 2CJSA 4NP4L 4B60A 3NZSA 4Z23A 1MNUL 1C08B 4LP8A 2J1XA 2YR3A 4ZUVB 3NCJH 3VXSB 2Q3ZA 1TQTA 4HPYL 4AMXA 2VXQA 2DQ6A 4ANVA 4FXGC 4B9JA 1QHOA 2A38A 3QI9D 4FXGA 3WGVB 1ZV5A 3F7VB 3QAZC 4S1QL 3MV9B 4CAGA 2P1YA 2WKOF 3TBTA 2A6KA 4ZTOH 2CM6A 4HXAL 1OWRM 3KYKH 1QRNE 4LBAA 1S9KC 1U36A 3OMAB 2IGTA 5DJCA 1YG9A 1A02N 5FK9A 1OPOA 2X89D 1CU4L 2X4PA 2EABA 5LO7A 4NUJB 4HUCA 3QZOA 5JQIB 1OSEA 3BIAX 4TQHA 4NO5A 3QQ3A 3FTXA 3S0PA 4YR6B 4NZTL 5T5FL 3VFUA 2IDUA 4TPRH 3GKZA 3HC3L 5IFAL 2RIKA 2DQJL 2OMUB 2OX5B 3SJVD 1EJOH 4FFZA 2FIRT 3UG4A 4HLZG 1Q38A 3QUXC 3UAFA 3GBLA 3K46A 2B20A 4FG6D 3QUXA 4FQ1H 5E6ZA 4NWUL 1U8HB 1GYCA 5DQJA 2V5SA 2LE9A 2HT2D 1OB0A 1ZPLA 1XGRA 4O58H 3MRBB 3NSXA 2APBA 2Z35A 1NCAL 3U30C 2ZOTA 1QBAA 4HD9A 2WXKA 1E4WL 1TQVA 3OKNA 3VH8B 2DYSB 4JZOA 3FQ1A 4Y1TA 5DD1L 3K71B 1DYZA 1HIML 5HYSB 5IHUH 2VC2B 4F3FB 4PJIB 4P59H 5BQDA 5IMOB 5E2VH 4JX0A 2OL3A 1C16A 1U92B 4PCTA 1XF5A 3QJHB 1MREL 5K59E 5F1NB 3WO4C 4L3EE 1PG7W 3AWFA 4F7MB 4FFVC 5C3TA 5ETUA 1N4XH 2NXYB 1WP6A 4HGKC 3ZE0E 3NP4A 3V5KA 2G5BB 4YHZL 4X5XA 2F53B 3PP3K 1FIGL 4BFNA 1J0JA 4BIKA 4EN2A 3S88H 4PJEA 1TU2A 4B9IA 4Y1AB 2D0GA 4M02A 4J3VA 3P30L 4UILL 5IY5B 1E3ZA 1DEEB 4F7CB 1OHQA 2C26A 1CD0A 5EZPA 3N43B 1C12A 1MLBB 2ZCKH 1F6AA 3TA3B 5E4EB 1GOFA 5DQ9A 3STBA 3T3ME 1H19A 3PUCA 1TZGL 5LBVA 3GMQA 2P4AB 4LB8A 3W57A 5KBLA 1KMGA 2ED7A 3D05A 4LZKA 4ZTEA 3Q44A 4ORGB 3N6YA 4G70B 1S9YB 4X50A 4JDTH 2DI7A 3MLVL 4FTDA 4X9GA 1XSOA 3X3FH 2Z91A 4IDJH 4LLWA 2J4WL 4WW1B 2AP2A 2BHZA 3BT2H 2O6PA 4NO0D 4PGDB 4ZO9A 5D96B 2WW8A 4RGOH 1H6TA 3M6DA 3T0ED 3BGMB 2COVD 5T33H 8PAZA 2APFA 4PLJD 4DKFH 1FZOA 4FP8H 5GRZA 3TNMA 4BQ6A 3QG6A 4I77H 1OARH 2AEOA 5GZOD 1QWUA 1DJHA 1GAFL 3V0EA 4P8QA 3JWDH 2EH8H 3EGXB 4OI8A 1XAKA 1MZYA 4JGNA 2EDLA 3WU1A 3H9SA 3H3PH 3KBHE 4ORZC 2EDKA 5JA8B 3DXAB 3IVKA 3O3UN 2O5ZH 3SKUD 2PTTA 1SRDA 4M43L 5AB0A 1F90H 4Z76A 2WUBH 1T7WA 1X5KA 4JQIH 3DSFL 5EO1B 2O6FA 5GZND 4H1LG 5F8QC 3OQRA 4KTYA 3ZDXF 5B7FA 4Y8DC 1UWYA 1WVZA 5PAZA 4KVNL 1Q9LA 4ADJA 2C9QA 4OUUB 5D8JH 5HHNB 2PCFA 4BGLA 2R0ZH 4UDTB 3WO3B 1KY6A 1S7SA 1U8QB 4POZC 4G8AC 2J1KA 3DRQB 1MJ7H 1WFTA 4ZFOA 35C8L 1CFNB 1HXMA 1FVDA 1KEGH 4JHAL 1LO0H 3VD7A 3SPGA 3LRMA 5G5DB 2V2XB 4XCEB 5DD0H 5DHXB 3VI4F 4RFNC 2GVYA 1PY0A 2ZAIA 5KTEH 2O26U 3UAJC 2VN3A 3UAJA 1HS6A 3ERXA 3N9GH 3QO0B 1SF5A 4QHNB 1FL6B 2BERA 1KCLA 3OXRA 2NW3B 1KPVA 3AY2A 4LCWA 4L23A 4JREB 3RVVD 3V4LA 2F68X 4G8GD 3CSTA 3VRLF 2QVFB 4ZFGL 1URIA 5C0AA 1A0QL 2IAAC 1INQB 5JTWA 3BMVA 5C0BB 2P7TA 5T1DL 4XMKL 4AVIA 3GI8H 3FSZA 4N6RB 3NMEA 1HHGA 3FCSA 5FHBH 5DXWA 4B53A 4UBDD 1OCWH 4LNRB 4PG9B 4Q7DA 2WVSA 1JVLA 2ZUUA 3ETSA 4KTEH 4AI7A 1QFUH 2AXFA 4JRXB 5BPPA 4F57L 1A7RH 1FL5A 3GSOB 3EYQD 4OGZA 3UTSA 5J5EA 2FWSA 3V4VH 5FDYA 3TCTA 5MENB 1UZ8B 2VR7A 4K0OA 5DI8A 4JLRB 5EUOB 1MFCL 2FATH 5DD6A 3GSWA 4S2SA 1KUMA 1RVFH 3D9AL 2P46B 1LDPL 3ZDZE 2I25N 3HVDA 3TCLA 5I8CA 3EO0A 1AOHA 4PRIE 2NSXA 1RJLA 4LSPH 3L7EA 3HAEG 4PJXB 4PUBL 2AVGA 1JP5A 3IE9A 4ZW3A 2BO0A 2WUCH 1E4XL 2CJUL 5DFWH 4D8OA 4BELD 2LHAA 1EANA 1QRKA 4DGWC 4N2LA 3MLSL 5EEWA 1AG6A 2CKBL 2ENYA 2VLLA 3BZFA 1TPXC 4M9OA 5G4MA 3LKQB 3RUGF 1B4JL 4M1DH 4AQEB 5J4MA 1KEML 2F8IA 1ZJBA 5CWSA 4QHUA 4NAJA 2Y72A 1FC1A 1J5OH 5HYFA 3MRMB 2BVOA 1M71B 1WF5A 5DJXB 4QXGL 1AH1A 2OJ1A 1I7RA 3QSKB 3B9KB 1CXLA 3FH5A 4MCYB 2ZJSL 1EZSA 4IRZL 3QNYB 3S5LB 3Q7JA 4P2RB 5AOIA 4MZ2A 2HKFL 2AJUH 2HLFC 4O51A 4F92B 3WHXA 3ZSSA 3VXQB 4EZKA 3DRTA 4KH9A 5F71A 5SWQB 4YAQA 1KGYE 2R4RH 2G0KA 3NIGE 1KCBA 2IH3A 2VH5H 4DUVA 5L4IA 2DS4A 1ZLWH 4QNPE 1CLOH 3BVDB 1D6EA 3B9AA 2NY6C 2Y36H 4YFEA 1G7LB 2QFRA 4QTIH 3MRKB 2C9PA 3Q06A 4JFFD 1VFMA 4APQA 1AQHA 1OSPH 4U1HB 1UGKA 4G80A 1MFDL 3U4EA 4XB8A 1IC4L 1YECL 5DHVH 5I6XC 2WYTA 1LEIA 3TX4A 2EEXA 2AQPA 3BUTA 1RZKC 3OSKA 4UAOC 5A2CA 4GT0A 3VD3A 1U8IA 1G5AA 4MMZC 4MNGA 3UL4A 4MMZA 3SKNA 1IGTA 3C8KA 1E6JH 1CYXA 2IAMD 4YSCA 1FFPA 4DVRL 2YQ2A 1LO3H 2OSYA 3HZVB 2VE6B 3DMMD 5ISZB 4GUCA 2WN3A 2FIKB 1N0XH 2QT6A 4FZEL 3LQAH 2HFGH 4XCNB 4N2MA 4N8VA 4RMQA 1EFXA 1U2YA 2VLJB 5HDBE 3QDJD 4OJCA 1MNNA 1GA2A 1SN0A 2CDGA 1WIPA 5I76A 1NSNH 2N0MA 3BKML 5DTFB 4RVBA 2DOCA 5HHMD 2GUYA 2Y69B 3IDNA 3TBCA 4AT6B 3D87B 4FQQB 4XNXH 2PPAA 2KLSA 1HWWA 1W0WA 2CK0L 4ACPA 5KVEE 1NIAA 4F20A 1XGYL 1CS6A 2F18A 3O3EA 4X6BA 3VD1A 1YC7A 1QRNA 2H2SC 4LPXA 4MAYC 3LNGA 5EIIG 2DM3A 4MAYA 2K9FB 3MRCA 5C8JB 3D2UB 5CEXB 1VFAA 5C0JB 2X7LB 1PFOA 5AW0B 5IFJB 3K72B 5DJAB 5E7BA 3GSRA 3RGBA 4JO3L 1MCRA 5KN5A 2OTUA 4KZCA 2NY3C 3V6FA 3SBPA 1BXAA 3PWUB 3FB7B 3L4WA 5DT1L 5FR3A 4R5XA 5I8OL 4LCWD 5DDHB 1KPUA 2EXTA 1GJUA 1KB3A 3KYOB 3OWRA 2V9TA 3KLKA 4AGQA 4HWZB 3DK0A 3RWEB 5E51A 4WEMB 1A6VH 1R6VA 1ZV9A 2V9UA 4TULH 5IT2H 3IJSA 3JYBA 2XWDA 3V7AG 1E5YA 2CDFB 2Y2TA 5DHYB 3W3BA 2CXKA 5LAXB 2YMXH 4W93A 1LO4H 4NKOB 2MPAH 1NUNB 2N7BA 2Z3FA 3EZ8A 2EKJA 2Y5EA 1PNCA 4DO4A 1NKRA 3R0NA 1PCXA 2XWJB 3NRFA 1LE9A 3DX8B 5CSZB 3ELQA 5LG1A 1V27A 2GJZA 1L9TA 2CRYA 5BMFL 2J57A 2J88L 3L95A 5GRVL 1A4KB 3FCBA 4HU2A 1YEJL 3L4TA 3N1MC 4JAMA 4L3EA 3GMNA 1FNEA 4HHWA 4ANXA 2YSSB 1YYLH 4KK8D 1OT4A 3TURA 5CLXA 1J9QA 1DDHA 3W82A 2EXWD 1CGTA 1N59B 1ZT1B 5E00B 5I1EH 3FU6A 4OFVA 5LUMA 1BVKA 2GI0A 4D0DB 2LFEA 1JHKL 2WQXA 4XN2A 1U6AH 1XIWD 4WRLA 3TJHC 4KO6A 2XN1A 2ICWI 1MCSA 4AQ1C 4WDIA 2X4SB 4K94C 4AQ1A 3CC1A 4IRJB 1JGUL 4PD4K 2D8KA 4R96B 2J73A 4HIIA 5I5IA 3B37A 1B90A 3FUHA 4JM2F 2X28A 4K7FB 3WFHB 4F7PB 1NAKL 3KL3A 4I9WE 4WWID 3VJ6A 3ISRA 4ZAKD 4KRPC 3VQMA 4AJYV 5LQBL 2OS7A 4HCRH 5C7ZA 3NJNA 2PXYB 1DBML 1R9FA 4NNYB 1WIUA 3OHXC 5E6ID 2H7WA 3CFJA 2EUWA 3OHXA 3QIBC 2GIXA 4R2GD 4R5TA 3HMXL 4Y4HC 3B1TA 3QIBA 4LVEA 5DYFA 5D7SL 4MD5B 4TQIA 3HE7B 2W92A 3WLWD 3KCPB 2H41A 3WNJA 4Z78A 4AYFA 2PO6C 3INOA 4M6OH 1OAJA 3W2DH 1IAKA 5F1IA 3GJEA 2PO6A 4LHUB 1IAMA 2MFNA 2JTYA 3AABA 3TF7C 1E6OH 3DGGA 4X0NA 1AOZA 4DGVL 3JV4A 5GS2D 3I84A 5JW4R 2R2EB 3QFJB 2DEYX 5AVZB 3PWPB 4ZUUA 4APQD 4LASL 2FWUA 5H37G 1BXXA 1MKFA 3FFCE 1VENA 2X4RA 1RIVL 3EKCA 1QBLH 3PAVA 1EHKB 3EYFB 3FRPG 1U95A 1HFUA 3GBNH 5DLLA 2JI3A 4GRWH 5J11B 3U4KA 5EG6C 3IJEA 3VI3B 2WINB 1DVYA 1U2HA 3ZT5A 3B3IA 4TNGA 1ZT7B 3Q6FB 5CJQH 5FX3A 1G7IA 5AZEL 5FB8B 1OK8A 1RLWA 4H4NA 3O3AA 2H3XC 1NGPH 2G60H 3HW7A 3DDFA 2Q7YA 4CU7A 5ICYB 3WJMB 1EFXD 5BV7C 2P24A 2F9BT 2LW3A 1UKSA 2ZOKB 1WEJL 2VLME 1E9OA 3GIVA 3QDMD 2DLTA 2XQBL 1NUGA 4L4TB 1JHTA 1WZKA 4PY8I 2W65A 5JMOC 1LVEA 5DSCB 4MB5A 5D1QC 4L8BA 1IL1A 1QRND 5D1QA 5ACMA 4PHXA 4O9HL 2JCCF 2CD0A 2V33A 1P6WA 3FTGB 1RKRA 1A3RH 1ILUA 4M8UA 4X4YB 5EU4B 4L1LA 2EDRA 3REVB 4P2YA 3MC0A 2DWEA 4H2CA 1KGUA 3KVPA 3HLKA 4GFXA 1TF4A 1T1WA 1R0AH 2NYYC 1QSFD 2ZKMX 3EFDH 5EBLA 3B2VL 1UWFA 3ZHNA 4XMLL 3MBXL 3IK2A 5BQ7B 3F58H 2AJZA 3IJ8A 3Q2LA 4MJ5A 5D1XD 1G4RA 1IGJA 2DM7A 1YYMH 2CMRL 4WFFE 4XX1G 3OAYH 4AGNA 4YE4H 3AAZA 1U41A 1TMQA 4FYQA 4HT1L 3RTQD 4PRIA 5DD5L 3BQUB 2FJSA 4FCHA 3OPZL 2JKLA 2ZUYA 4HHAA 2VDNH 5AUMA 4XVUD 3I75A 2G3MA 4KQ4H 5GRJL 2K4WA 5LCVL 3TXAA 2P5WE 1NBVL 2DW5A 3AY4C 4Y4KD 1HCVA 3AY4A 2HVJA 4E9XA 1DO5A 3GZQA 1MCBA 3L3JB 1Q0YL 3ES6B 1XL4A 3KJ6H 3JTBA 2Z31C 1E8WA 2Y06H 3A6CH 3O3BB 4S1SL 4OFYA 2JQZA 4L3ED 3ZE2F 4GG6E 3W9EA 4QWWD 2MQGA 5EWIL 1LO5A 1RJZB 5IJCC 5GSVB 4LOFA 3X1FA 1EDQA 3Q0HA 2NDFA 1FRGL 1IAII 1ID2A 5DJ6B 1U93A 2CUMA 5IJDC 3LPGA 3BEVB 3DROA 4IS6B 1SEBA 4NN7C 5D71L 2ZKWA 3TJHD 1LHZA 4ONHB 4PJIF 4GY4A 1YQ2A 4M3HA 1X5GA 3I74A 1QZNA 2ZSWB 4M6NL 5JW5B 1EX0A 1T22B 4OGYH 3MCLL 4PJBB 1HHIB 5DFVD 3IYLW 3FOLA 4CMHB 4M8VA 5E2TL 4UV7H 4XP1L 4KRPD 4FQHB 1F11A 5KS9B 4YFLF 2DEXX 2OCJA 3BH9B 3IFPA 1L9SA 2VC2L 4U05A 2EIZB 3GMPB 2A9AA 3L3KB 1N64H 2NTSP 3QIBD 2UXTA 4ENED 3QZNA 4HIHB 4Z7UE 4TNVK 2WBJB 1X6NA 3N43F 4YIQA 1BZEA 4W9IC 4UNUA 3QQ9C 4U1JB 4LAJH 3KAAA 4KXZI 3TZVB 3GSXA 4XPAL 3W39A 1Y1UA 5DR5L 3FQNB 5BRZE 4BKLB 4PG2C 2H1LM 4KROC 2HH0L 3I9PA 4PG2A 1M6OB 5C3IA 4KC3B 3FW6A 3QQ4B 3ARDD 5F7DA 2YQBA 4DAGH 4Q9BA 4YZFF 1JV5A 1YJDH 4M5YL 4PJAE 4WO4B 3WNIA 2IWKA 3GSNH 3FN9A 1A9EA 4MJIE 4QHLB 3CBKB 3KPNA 4I48B 1INEH 3P77A 4X0KB 3C09C 3SKOA 1CI3M 1VA9A 4NUPA 4FFYL 4P5MB 2HXAA 4JFDE 2R29A 3GTVA 2PW2A 4KNTA 4EDXA 3FQ4A 3FUJA 4Q2ZB 3ESVF 5A3IC 3U9UB 1HEJC 4MQ7B 3C5SA 2CO6B 4X6EA 1JYXA 4Q9RL 4BRJA 3QYNA 2VM9A 4LLDA 1ZMYA 1BHGA 1PLAA 5BVPL 1FE8H 1SBSH 1JYVA 2G2RA 5DUMH 4AVHA 1DSYA 1BW8A 1OT2A 4RAUA 4DP9X 4QRRE 1IIIA 3C08L 1YRKA 4PTTA 5DZAA 2NUTB 2QQKL 3LPPA 4B9GA 1R5WA 3G3LA 3IDUA 4PB0L 3HS0C 2JVUA 2C9RA 3HS0A 4ODVL 4PJ8D 4WNQA 1RL1A 3TBVA 1NPUA 4HX1B 2HAZA 4LSVL 3FB8B 4U1LA 2WWMC 5KBPA 3WAJA 1FYHB 3LXUX 3S98A 1LWHA 2Q5BA 4YXHL 3SOTA 3S9DB 3LMJH 1MW2A 1II4E 1K9TA 2EDJA 2FT8A 4Y89A 2BS9A 3VWKC 2EE3A 1BZ7B 3SGDH 3VWKA 4ZNCD 3DX7A 1J88A 4R5VA 1KCRL 4XPHL 1FNSH 4WSGA 2AV7A 2WV3A 4TNFA 3CBRA 5JXEC 5FPIA 2A83B 4HOWA 4M7KL 2CAKA 1DBJH 5JQ6L 1T20A 3F5WB 4WEBH 4P3WA 4DPBX 3NFPB 5F7EL 2I26N 4JPVL 1CMOA 1ZVNA 4IHOB 5E1GA 2IF7A 2BIPA 3ZTNH 4A7QA 4P3DA 1IGYB 5IB3A 4MNHA 3LNDA 1H6FA 1MEXL 4RIRA 4B41A 2R9HD 4WEEA 3LRSB 3UTPD 1CQYA 1J8RA 3WS3A 4HXBH 4YO0A 3F6IA 3GF8A 5CHNB 2J6EH 4PWIA 1FFTB 5FW6A 3WNLA 3RRQA 2XZQL 3NA4A 4EIUA 5IF0A 5GISL 3PUUA 2F19L 3APNA 1XEUA 4ZDHA 1KF9B 3WXWL 3LZLA 1NFAA 3VXNA 4HW6A 3SZKC 2DQDH 4NERA 2WVVB 3I50L 1FZMB 1MDAA 2DQUL 1JIBA 2AJSL 3CZGA 3KM2A 4ZG1A 3PWVB 4IEFB 4LLMA 3RL2A 5C2BH 3IAPA 1RK1B 3C5ZC 3S8GB 3G6JE 4GEJA 3C5ZA 4N0CD 1DJYA 4WU7A 3CN4A 3DV4B 3QJVB 4YQXH 2AJYH 4FOMA 2E7MA 1MJJA 1SOQA 3P9LA 3S5ZA 1U91B 3T8VA 4KRNA 2D7TH 5E2UL 4OM1H 2R27A 4L9LC 4UTBL 4XBEH 3V4UH 2LU7A 3DVIA 1BV8A 1EBAA 4L9LA 3MA7B 4LBEA 1DVQA 3A67L 1ASQA 3IS0X 4XTRC 2CPCA 1QASA 5EC1B 1A6UH 1VESA 4DFIA 1NMAH 1MFVA 4HIPA 1J1PL 1M42A 3NDZE 1EJ6A 3GSUB 3U36B 1OCZB 2Z6FA 3BISA 5J3HD 5HPMA 1CDHA 5CJOH 1V54B 2BDNH 2B7DT 2Y7QA 4N2EA 1IU1A 5C07E 1BM3L 1WPCA 3OR6A 4LRIC 2HG5A 3GRWL 3MUGA 4L3AA 4LRIA 1AYRA 4L0YA 3FFCA 2R69H 1KTJA 2XKNB 4MLSA 2EYRB 5I19H 1QFWH 1RI8A 3CUPA 3ECUA 5E0QA 3CU7A 4KKZA 2WXGA 1WZ1H 1CICC 3P9WB 1CICA 1MWAB 2FEJA 1JI1A 4M7ZB 1MCLA 4AQ8C 5BUAA 5IV2B 4JFVA 4AQ8A 3GBMH 1BLNA 1SN2A 1TETL 1GYVA 1XT5A 3DBSA 3PWNA 5JOPE 4G8IA 4QO1B 4P2OD 2ENSA 2XXCB 1KPRA 3N85L 4FHBD 3SQRA 3VG0H 2Z9TA 1A7PL 5DVLA 2L4OA 5K5YA 1LMIA 2IIJA 3WFDL 2V9QA 4FCAA 1CTMA 2OP4H 3NP3A 4GAJH 4GG8A 3ABLB 1HYSC 2XNAA 3OQ3B 1HTYA 4JKNA 2A3TA 2KS0A 4LKXB 2E6PA 3R8BB 1RZ7H 4G59C 4L4VB 4W9EC 5ITBH 5I71B 3QULA 4M61B 2ZCHL 1FYTE 1BVNT 2J43A 1V05A 5E6YA 5E99H 4N3TA 4V11A 5C6TL 1KCSH 5L2JB 2E9JA 5KZCB 1JF1B 4OLYH 4M8QA 1UD4A 1HQ4B 2BMKB 5GGQH 1BF2A 4TV3A 5KSAB 3WMPA 3KG5A 2WLHA 1TENA 4BFEA 5C7XL 1FG9C 2ENJA 5ALBL 1DUYA 1PVHA 4B0MB 1AGFA 1QVOA 1UWGH 1XGUA 5IQNA 2X4OB 4XNMB 3BEWA 4U1SA 5FKAA 5DJYB 1AGCB 2RQEA 1IAOB 3N40P 4PS8A 1IEHA 1HINL 1AO7E 4JGMA 4XVJH 4ZRGA 1IEBA 1V3LA 3FT0A 3H6AA 3NEXA 4JPWH 5K39A 4JKLA 1A1MA 5DUJA 3T8XA 1IO4C 4RWYL 4YX2H 2P5WA 3KGSA 3O2DA 4LSUH 3L3IA 1YEKL 2DB8A 1UGNA 4MZIA 1GZHC 2LR4A 1FNLA 1GZHA 4LCVA 3U1SL 2Q3AA 1FV1A 1HHKB 4GG6A 1A5FL 5D1ZD 1L9MA 1ZJAA 3B83A 1JPSH 1T2XA 2NQCA 4N90E 1GZQB 2CE6A 4Y2NA 4S11A 2J5LB 4AH2B 5B1CA 1AR1C 1I8MB 2XX0A 1KYOJ 4JO1L 4DT2A 4F1ZA 1BEYH 1DVSA 4U3SB 43C9B 1D9KD 1SOKA 2ATKB 3UX9B 1KSRA 1HSBB 3IT8D 5EFIB 3OKOA 3DJZA 3QUZC 3OKEB 2IWFA 4LLAA 4MAUH 5EOCJ 1PQZA 1I75A 3QUZA 3LNEA 1ZS8B 1YQVH 2WLYA 3C5ZD 4S0TD 5EZOH 5B1KA 4B9CA 4ABQA 3VGAC 3GRBA 4EUPB 2BNQE 2HTLD 4I9WD 1YY8A 2WKLA 1PZ5A 2HJLB 5E9DB 5JUEL 3ZT6A 3GEWB 4KJWD 3JTTA 4M7LH 2DH3A 3HC2A 3HG5A 1JWSA 3KNBB 1MY5A 3HC0A 1IGCL 3EJUA 5C0RL 2I5YL 1O7DE 3AMLA 1YMME 3RP1A 3WFCH 3I6SA 1N0LB 4XTRD 3JZ7A 4Z7UA 2WY3B 5F89A 1F6LL 3PNWA 4QTHA 3WG7B 5EO0A 4N0YL 5CKGA 1AI1H 3A3YB 3B9VA 4LCUB 3T4YA 5IGXL 1I4FB 3RWDA 2DDQH 3O11B 5BRZA 1VAHA 2B3IA 2BSRA 2DZEA 2C3VB 2RTTA 1UADC 1QFHA 1BZOA 4N0UB 1XX9C 4MKTA 3UDWC 2FBJH 4DEPC 4TVPE 4NC2B 3UDWA 5B38A 1CURA 1S9WA 4OD1L 4OD2B 4PJAA 4LARH 1DBBH 1DFBL 2ADJA 5C0CD 3O6ML 4MJIA 5CGBA 3NJIA 4UNTA 2CBOA 2ZF8A 5K33A 4ZXBC 4G5ZH 4MA1B 1JCVA 1OPGH 4ZXBA 4JFDA 1P4IH 1MI5B 2ADGA 1HT6A 1L0YA 2GBAA 4W9HC 1OAYH 1XGQB 2ICEC 4JM4H 4NYLA 3GM8A 4WV1C 4JBSA 1WK0A 1OE1A 2ICEA 1YMHB 3VGEA 5BJTA 4WV1A 1NMCB 1JZEA 3BCDA 1HL4A 3RAJH 1J10A 2CCVA 2LVCA 1EVTC 4JEGB 4UQ2B 1U42A 2GT9B 2VXTH 2Q3XA 3CH8A 5E4OA 2NY5L 4XNAA 3ZYIA 4QRRA 2VLMD 5HYQB 5ACZB 4B95C 5DQDL 1F4YL 1KLFB 4OFKA 2DQEL 3S5LG 3VTAA 5LXGL 3ARPA 3MLUH 3SY0B 5LWYH 2XJKA 1X4ZA 3KBFA 3SKJL 4YHOH 5IKCA 1N5YL 3ULUF 2DYPA 1J18A 1JFQL 4XWOD 3KW8A 4HPOH 5IJKC 2WMPB 4PJ9B 5IJKA 1ORQA 4OJYA 1QW8A 1N7ML 1NBCA 5CILH 1J0IA 1M1XA 4M93C 4R7NB 4NM4H 2F8OA 4I0PB 1AS8A 1JXGA 3IXTA 3T0AA 4IBVA 2M1KA 1UZ6E 2YN3A 1CFVH 3EOAB 3LB6C 5IMMB 4WFHD 5KUMA 3PS6A 1FDLL 2QGCA 4LEOB 3D0VA 2DQTH 2R0WH 3NTCL 4QRPD 1X9UA 4Y7MA 3KYNB 1XBRA 4H40A 2NY2C 5F9OL 1CWVA 2OR8A 3UZVB 3RFZC 4AQAA 3DJTA 3WL9B 3RFZA 2FX8L 3LH2L 2DWXA 3PV6B 4ELME 4F2FA 4Z3EA 1NIEA 3PIQA 2WLIA 2A9NH 4HAKA 4FLRA 4PJFE 4HWEH 2LVEA 1MUJB 1EAPB 3BHBA 4TXVB 2FO4B 2V2TA 4N4YB 4X6CF 4ATTA 2BY0A 2YD9A 2UXVA 1DFXA 1KB5A 5DEGA 5G2NA 2F5AL 4B9KC 1A3LH 4UTAL 3NZUA 3PY9A 3QZMA 5IESH 2HJFB 3PGCA 4BSWA 2P5WD 1T21A 2EAEA 1IGFH 4HUXB 1UACH 3IPEA 5E1AA 3EBIA 4RRPG 1K8DB 1S7UA 1JZHA 2F1BA 5DS1A 2QVIA 4OZFB 5E8DH 3S35L 4HK0A 4LP4A 3CXDL 4JPIB 3G6JA 3QR2A 2VDQL 1IBDA 4IIZA 2VDKL 4JO8A 1GOHA 1IKOP 4PRPE 5D7LD 4RH4A 1GVIA 2Q8AL 3WDIA 1P4LB 5JORA 3DWTA 4PMFA 3W11D 4JFPB 4D9LH 1UURA 3QCVH 4OIIL 5IEKB 5M95B 4JHWL 1E4KC 3F65A 4J6IA 3QCUL 3TBWB 3MV11 1E4KA 4FMVA 3V7AE 3V55A 1GTNA 1UUNA 2K3HA 3QNXB 5CN1A 4C56E 3S3JA 1Q9WB 2DTML 2BP8A 2ZXBA 4KK5D 5JXAL 2RHEA 1VPOH 5FO9A 1KG0A 2VXVH 3LS4H 2FJHA 2I69A 3EJTA 4P4RA 3UAEA 3ZW3A 2JKNA 3NJFA 2YXWA 1MG2C 4ZMTA 3QQDB 1KCUH 5C07A 1TEYA 2YD5A 1A4AA 3QW9A 3MV01 3RWGA 2OMWA 1F1GA 4Y7OC 3HG0A 3UO8B 3WDJA 4P9HL 3L4CA 2K6YA 3TIDB 2A77L 1A6ZB 5ADPL 3EH3B 2GEQA 2DJMA 4D7BA 4GBXD 4PH8A 1VEOA 5KYUA 3VXUE 1XFPA 4AQZA 3HLAA 5B1AB 2YAFA 3H2PA 4KUCD 5BRZD 1SGKA 1KNOA 3L16A 1UM4H 4E5XB 3KPOB 2BIQA 4FG4A 3QI9B 5CEYA 4ELKA 1JWUB 4J39A 1AQDA 4RDQF 4ZI8A 4ZT1A 1ZLWK 1I3RA 3RZCD 4MRCA 1DJSA 2P80D 1BQHB 4FYTA 3LSOB 4MJID 5I17A 1KZQA 3LIZH 1A4JB 4U1KB 1KBKA 1KFAL 2DWSA 4PWKA 2I7SA 1IM3A 2OMTA 1OGPA 5B4MC 1A9BB 4ZXBD 3STLA 3SY6A 32C2B 5EU3B 3H54A 4HK3J 1IGIH 2NNCA 1QHQA 2W0FA 1X7QB 2TSBA 4JJ5B 4W4NA 4FQJH 2HPTA 4EPSA 2AHIA 3AXLB 2YZ1A 1L4IA 4X8XA 5JO5A 1UA6H 3UIZA 1CDGA 1SY6A 2J1YA 3ILPA 1FYTA 4U1GC 4CSZA 1MAKA 1B3JA 5D93C 1F2QA 4QRRD 2E3VA 2V2WA 4RZCA 3LEVL 1FO0L 4GKSA 5DRNA 4PRDB 5SWSE 1TKWB 15C8L 3GO1H 3K6OA 4MA8H 2PCPA 2PP9A 4UT6H 4WWKB 3LN9A 4AK1A 1R34A 3N0PB 4YHIB 4ZW7A 2EIEA 2XSKA 4HBCH 3IU4L 3PDDA 4HETA 4OKDA 3D34A 2FUQA 3MNZA 2TRHA 5GGTA 1GS6X 1QLFA 4K23L 4AENB 3CSGA 1K6QH 1S5IH 1H9DA 4MDJB 3LXCA 1AO7A 4Z7QB 4R7DA 2ZYIA 3GMRB 3VD0A 3M7OA 3MREB 3WDHA 4XP5L 4XH2A 1RPQA 1H3GA 4YHLH 3MJGX 3SDDC 3QRGL 3SDDA 5HDLA 1T6VN 2NY2D 3AT8A 4NPYB 3NSCA 5I8KL 1BYPA 3OR7B 5IMKA 4A2FA 4TTGA 3NIFE 2BIMA 4GPVA 2QPFA 4F91B 3B2DC 1T83C 4ES8A 4EOWH 3MROB 2MCPH 4L4JA 1RZFL 1G9MH 4NGHL 1T83A 1VFUA 1T0PB 5K9JL 3BD3A 4J3TA 4HKBB 2ZG1A 3WGUB 1ODUA 2NTFA 3VFOA 3P0VH 1MFEL 4J4PD 5I1DA 4XVTL 3BWAB 4PR5B 3R0MA 3TBSA 2KYIA 3S36X 4K8RH 2VM4A 5TDNB 3L6FB 1DSWA 1QP1A 2Q1EA 4KMTL 3H0TA 3CXHK 5DJ0B 5KW9H 3ARVA 3CFKA 1U33A 1ZVSB 4MD0A 4PJGB 3WIFB 2ZWSA 4A2EA 2BNQA 1G94A 3F12B 1CFSB 4Y2DD 3HG1B 1NICA 3I9AA 1PX4A 3T2LA 4AG4L 1EJFA 4K7PL 1YUHB 4GAYB 1M56B 1HWHB 5EBMA 1O7DC 4XX1E 2R0LH 5C0GA 5T5FA 5AW5B 1YMMA 1W9XA 1PW3A 2WKOA 3SOBH 2W0KA 1ZWIA 3HAEA 1ZKAA 5IBLC 5JW4M 4O02L 5FOJA 2IPTL 5I26A 2QVTA 1HH9A 3ILQC 4D3CH 4PGJA 3OZLA 1SJMA 3QHZL 3ATEA 1M57B 1B0GA 4GXFA 4Q4EA 4AGLA 1PSKH 1FLRL 3LKRA 3MODH 4HSCX 3I6LE 2GJ6B 4OCWL 2OMVB 3H7BB 4PSRA 3NOIA 5C07D 5FDWB 1TVBA 4V33A 3HG2A 3OKLA 1N2RB 2CR6A 3FTUA 5AYQA 2HG0A 3TBYA 4TUOA 4J5VA 2EINB 2HWZL 3HMWL 3WENA 2XVBA 5E7FA 3BRDA 2C3XA 2CIIB 3M86A 3NJHA 3NCEB 5FGCE 3BP4B 4JFEE 1MCDA 1AKPA 1GGYA 1RIHL 3K5RA 1W72H 2JXMB 4NRZA 2YUVA 3QJSB 4KZEH 3Q1SH 2WIIB 1EEQA 5EOCH 2CG9X 5TQ0L 5I9QB 5AAMC 5DRZB 3VG9B 5CGYC 5AAMA 2VZ3A 3VA6A 5L88L 2AABL 4G8GB 3V8OA 4GQQA 1IFHL 3HCVA 1PX8A 3RIFK 3SDXB 5E6RB 3U0PA 2I27N 3KDMB 3M1CA 4KXCA 2EVFA 1TJXA 5C97A 1MFBH 3FO9B 1KXHA 2P5ED 5B4MD 3MDJA 2MOGA 4YUEH 3IDMB 1BOGA 3IJHA 5AW9B 1CFQA 7PCYA 5IM7A 2XWRA 2LLNA 3BWUF 4YSTA 2FR4B 4HK3N 2GFBB 3BPCA 4BFKA 4RDBA 1JMXA 1IUZA 3D69B 3KGTA 4YDVB 3RPIB 3TTSA 4NJAL 3BDYH 1MVUB 5DQJB 1FF5A 1J1XL 3F7YA 4UDUA 4HIJB 1W80A 1I8KB 1DLFL 5C9JB 1SQ2N 3BDXA 4YNYB 5K9OA 2OYMA 2QBWA 3NSFA 3PJSA 5T3XD 3F04A 2H2PC 2YOAA 3QVAA 4A6YL 3ESMA 1U8LA 2W60B 4YGAB 4GO8A 4OD3H 2QV2A 1TITA 2QR0B 4NQSA 3T3PB 4FN0A 4JPKH 4ELMA 1R5VA 2ARJA 2QL1A 2I60H 4PJFA 5F7UA 2IPKA 1AO7D 4ISVB 2OL3B 2D9CA 4JY4B 4XCFL 4WHTA 3K6FA 3SBWC 3LVEA 1JUFB 4L8DB 1IM9B 1KTRL 3NFSH 3SBWA 4A67A 1UOKA 3GXMA 5LN8A 1TMCB 3SDDD 1B4TA 2EUVA 3O9WD 5IBUB 5T3XH 3U83A 2BFVL 3VCLB 1J9CT 3CFEA 1SZNA 3QPQC 1KJ3H 3RTLA 1HDMB 4GQRA 1JMZA 1F13A 3CFDB 3RHWK 3SPCA 3T2NL 2ICWJ 3ZZSA 5IQOA 4OQTL 1H15A 3OLGA 4K3HA 1UJ3C 4AE0A 2X3CA 3FU8A 3PHQA 2ZX5A 3OAYK 5L0QC 1A7QH 1UJ3A 4PRPA 5FYKL 3BVVA 2KZ1B 2F7OA 2WCPA 2XZCH 1R4XA 3O6FC 1I3GH 3FONA 4QOKE 1C7SA 3O6FA 4ABUA 5AAWC 1A6WL 4U3CA 3HKFA 3A4DA 4GMTH 4UZGA 5AAWA 4HUVB 3VRIB 1ZS2A 3LKOB 5SX4I 5LBSA 3ET9F 4LLUB 4E9QA 5HGDB 4YXLH 2LAGB 4X6DF 1G6RA 2C9VA 4JFFB 5MEQB 2NR6C 3LN5B 3UJJL 1KGWA 1N5AA 3MBWA 3ECWA 2VCOA 2NR6A 5C70A 2J71A 2VXQH 2GSGB 2XIDA 3LQMA 4Y4FC 3CSYB 3U6XS 4C56A 4Y4FA 4L0ZA 2BNQD 2BSTB 5BW7A 1QTYT 3UPRB 3UAAA 4KX7A 4NC1E 4DCQB 5KVDL 3MRDA 3VD9A 1K5NA 3G6AA 1XGPB 2ATPA 2IAMB 5I74B 3ABMB 1AYOA 1L5GB 3DMMB 2DWDB 2A6DA 4HJGB 1H8LA 4RBPH 3P1VA 4OM0H 4GW1B 3U48A 1BF5A 4U0RC 1TVDA 2JCCE 3QDJB 3BVNA 3ILQD 4JRYD 3VXUA 5KSVA 2JLPA 3GJFA 4URTB 2Y23A 3DI3B 2CHNA 4R97B 1M4KA 5IJBC 4N68A 4XZUB 1MFUA 1V8HA 4KOCA 2HRHA 5HHMB 3CQPA 5HDQL 1BAWA 1BECA 2X44D 3BKYH 3ZZQA 5ICXB 1U8OB 1SXSA 3RLSA 3VXSE 3MCYA 1JZGA 2DQJH 2E86A 3OMZA 3SODB 2OJEA 5IHZA 5LN4A 2CNYA 1F58L 2GTQA 1IIKA 1RURL 3BAYA 4Y8AA 4KNSA 3MA9L 2B9AA 5EEUA 1HXMB 4UQ3A 5BS0A 3BVUA 5EOTB 1V3MA 1WG3A 5D2LB 1C5CH 3FB5A 4LVHC 3FQUB 2WYIA 4HUUA 3S3CB 3UP6A 4NNXA 3LKSB 1HEHC 2PCXA 3HS9A 1T1XA 3DDGA 3GNMH 1OV8A 1RZIB 1KIRA 1T3FA 3KL5A 3LHPH 4HJUA 5HDRA 3RUGA 4IRZA 4YLQT 1N9PA 5T3ZE 3FDWA 1H6EA 5SWSA 4KTDH 3T0WA 4PJ5E 1NOLA 2FSDA 1P7QA 2XWBB 2G75A 1KN2H 3IDIB 2HLEB 2YPVA 5LGYA 1WSST 4S1DC 5AQ0A 3RBSA 4X4XA 5CS7A 1ZT4A 4ZSOB 5ABZA 2WD0A 3S36H 3T04D 1CG9A 4HEME 3G5ZB 4NCC1 1NLBL 2FWOA 4EDWL 4XO3A 1DL7L 3R8QA 4E9VA 3FRPA 1Q9OB 2CK2A 4MLIA 1LK2A 2FGWH 1KYFA 1RHHB 2QHRL 5ENWB 4PJIE 4N25A 1RZQA 1W2KT 2CHZA 2QSCH 4HV8A 4P46C 4L05A 2FEDD 4KDVA 4P46A 3EOTL 3F3HA 5TTRA 3DETC 3MV7B 5E8OB 4AL8L 4Z7NB 1I85C 3QS2A 1MAMH 1I85A 1ZHBA 3NCYS 3M17A 5F7YC 4LCCB 1XIWB 2F53E 3NIDB 3BZ4A 5GGSB 1P1ZA 3TO2B 4Y1AE 3HG4A 4Z7OB 4YBLB 1YY9C 2YD1A 3A47A 2O4EA 2VDRH 2FZ3A 3D3VD 4BUQA 3OLIA 4JRWA 2RALA 3U7WH 4K2UH 3QK0A 4YWGL 4BZ2A 3D25B 4ZAKB 3PXHA 1MCOH 1FJ1B 2NRDA 1LD9A 2R8SL 3I6KA 2JKTM 4UWQB 5E6IB 2O30A 4OKVB 3MXVH 4R2GB 1NGXA 5EU6D 4W70A 3EZJB 2FQGA 3LD8C 2IWGA 3H4FA 3U0TB 5MI0C 4GRWB 4YE0A 1MW3A 3MRIB 1QFOA 1NC4A 4GUPB 5DHDA 4BKTC 2VLKE 1WZLA 4HIXL 1JN6A 5CBEA 3EYUL 4AM0Q 2R51A 3Q8AA 2EYSA 1GGIH 1Y6NR 1XSJA 4HF5L 1NBZA 1LEGB 5AKSA 5IREA 1Z5HA 2YQGA 3BVTA 4APQB 3WEXA 5HDWA 4UTCA 5BZDB 1ZE3H 3IMWA 2VQ4A 2FD6H 3JYCA 3T8MA 1RZ8A 4C56D 8CGTA 3EJYD 1Z9OA 1U8IB 4WW2B 5AW2B 3GC3A 3GLAA 1JD7A 3DXAE 1DUZA 4X4ME 3UJTH 1T66D 5J9PA 4XHJD 2A99A 2CCLA 3RBGA 4AYEC 4BZ1L 1CE1L 3UGEA 1RK0B 3ROOB 4WTZG 1Z32X 5E8EA 5I15L 3ISWA 1FBIL 3O8XC 1EHXA 1F45A 3CVHB 4EXKA 4LSRL 2PP8A 3O8XA 4QRUA 2AVFA 1EFXB 4JFEA 1T6BX 4Z95L 3VXUD 1QLRA 3C6LC 2FBOJ 3C6LA 4R4NC 4I1NB 2OYKA 4GRMA 1UZGA 1VF5C 3HC4H 3BSZH 1X5JA 3QDMB 4NIKB 5INCA 4OZIB 4G6AC 5L9DL 1VRSA 4RNRB 4GKZA 3TM6A 1DVFB 2ZUQC 4OQ1A 2WZ6A 3RB5A 3X12A 4XCCH 4MWFB 2CLVA 5ANHA 3ECBA 3CC5B 3OJDA 4WGVB 5DEJA 4HZAA 5J57B 8FABB 4KHTH 5F9JB 1QRNB 4JFUA 4MA7L 2ZUWA 4R3SB 1MFCH 2A9MH 1CVSC 1DCLA 1KBPA 4FXKC 4KKLC 4Y9CA 1AMXA 4OZHB 4FXKA 1QNIA 4KJPC 4M3KB 1RSFA 4NKIL 1TZ8A 1T1ZA 5C0BE 4WSJA 1NKOA 1Z5YD 1JZ4A 4G9DB 2JFCA 3KLLA 1AZUA 5GJTH 2VDNB 5EUKB 2NXZC 1QSFB 3SYQA 5CMAA 1JPFB 2VABB 4JRXE 4QJ3B 4R7XA 4EUPG 5D1XB 2F7QA 2J20A 3HZYB 4ZTOL 4H8WL 4E42B 2JKWA 3G04A 4FJ6A 1M2VB 4MQXC 1SNRA 5TJWK 5MENE 5EF3A 5EUOE 4KKAC 3DSNA 1U8KA 4LSSH 5SWSD 3RTQB 3HNSH 1KELH 1JERA 4IQHA 1P7QD 3MNWA 2ZX8A 3QGVA 5LGKA 1MIEH 1OM3H 5I1LA 5TGBB 4JM2C 1NCUA 3V2AR 2ENPA 3M1BA 4JM2A 2ODHA 4S1DD 4NKQB 1N8ZA 4PJXE 3L5XH 1KTDA 2EDMA 4UT7H 4WHCA 3UACA 2YD0A 1QG3A 2DMHA 2E46A 4IOFD 4TPRL 4Z9KB 2J7LA 3NVQA 3M46A 4Y4KB 1EJOL 2TAAA 2AXGB 2KMWA 4CSPA 2ZOOA 4FQ1L 4RESB 1O9WA 2E7LC 1MW0A 1NIDA 1GZPB 1GW0A 2ZTBA 4IRSB 4X8JA 3KLHC 2E7LA 3FYEB 1EGJH 2M83A 4G43A 3DURA 2CGZA 2Q76A 4O58L 1UXWA 4P46D 1D5IH 1FNGB 3GMLB 4QRAA 1ZANH 1BOYA 3LRGA 3PWJA 4JFSA 3AITA 2AEPH 2VL5A 2YSTA 3K1KC 3K80A 1XCQB 3NEOA 1W6LA 4M5ZH 4F1SA 3Q9QA 4TUUA 5IHUL 3D30A 4P59L 3EJCA 3LZQA 4IM8A 1QUNA 3IXAB 3Q6GH 5EN2B 4Q9QH 3UTOA 2GG1A 2WXMA 4P2RE 4Z7QF 4AMWA 1NCCH 4ZPVB 4DW2H 4HIIB 5JDJA 1YY9D 3EYOA 3OXSA 4QOKA 3O45A 1N4XL 4UM8B 3SE3C 4F8TA 1C5DB 1KJVB 3SE3A 2Q86B 3KPMA 2OXGB 4G6KH 5HY9A 2FE0A 3TEYA 3S88L 2P8PA 2EDYA 3WUZA 1XF2A 1AZBA 4LAQH 4X5WA 3ZL2A 3ARYA 3RWCA 2WO3B 1HZLA 1X5XA 2ZCKL 4NC1C 1P5UB 1HNFA 3A6OA 2X42A 3REWB 1AS6A 2B5IC 3QUGA 3VE0A 1NC4D 5HI4D 1TZIB 3DUHA 3FZUD 5IVZB 5JDSA 4W6YB 3GXUB 2YD6A 4JDTL 3N91A 5I16B 1OGAA 2YO3A 4R90H 4C4UA 3X3FL 3IU3B 3NA9H 3ARDB 4IDJL 3CE1A 4PW9A 1VKXA 2R2CA 1RSYA 2JCCA 3KEHA 5ISZE 2KBGA 1XWVA 2X4RB 3BT2L 4JB9H 2JWYA 1NGYB 5HI5C 3C2SA 3L9RA 5BO1H 3D08A 4H0LC 4RGOL 4F8NA 3WEMA 2VLJE 3DHMA 3C9NB 5T33L 2E75C 1C08A 4AC2A 5FXCH 2KZKA 4XMXA 2BOCB 3TU6A 2YBRB 4DKFL 1TTBA 4FP8L 4ZUVA 3S5YA 3VXSA 4I77L 1S7QB 1OARL 3ATFA 5LCVA 1U30A 3FTZA 1C7TA 1EZVX 5J89A 5GSRB 3G9AB 5D5MF 5I8OH 3F7VA 2ID5A 3JWDL 3MV9A 4CBZA 2FAUA 3JSSA 3DUSB 1E5AA 2XBDA 3WNPA 3H3PL 3D4GA 3FF8A 5JW3H 4IJ3B 2O5ZL 4P23D 3H55A 5ES4B 1F90L 4OZFG 1Q94B 2XTSA 4NUJA 2WUBL 1NDGB 4JQIL 4TQEH 4XE0A 4G6AD 4L8CB 4H0GA 2D7MA 4PJ8B 4YR6A 3BFQG 3WTUA 2E8ZA 4FYSA 2ADFH 3EO1A 4B6ZA 4GI8A 5D8JL 1M3JA 5C08B 4CSTA 2OMUA 4BSVB 2ZT9C 5EPMB 2R0ZL 2OX5A 4LQ1A 4AJWA 4PJ5A 1MJ7L 4NKMB 4ADGA 1V7MH 5BMFH 1KEGL 2OJZH 1LO0L 5JHBA 4ZZKA 1U8HA 5DD0L 5KTEL 1HH6B 3US1A 2CSPA 2FX9H 1DCEA 5HP5A 3MRBA 2BOBB 4FC3E 4I3GA 2HP4A 3N9GL 3QARA 4AYID 4HEMA 4TYUA 4QT5B 3ULVH 2C4FU 2BY3A 4AYDC 4D9QD 3VH8A 2CO7B 2HLAB 2PP7A 3LPWA 3K71A 1UXSB 5IWLC 4I9XA 2F6AA 4MQXD 3UBXB 4A7GF 4CU6A 5IWLA 3GI8L 5I18H 1H5BB 4PJIA 4F3FA 3SDXF 5IMOA 3GRGA 2F5BH 5FHBL 1SMAA 1FHNA 1OCWL 1U92A 4AGPA 3CSBA 3MCG1 3QJHA 2Y3AA 1WAAE 4KTEL 1QFUL 5F1NA 4XO8A 2CUAA 3QJZA 2VL4A 1A7RL 2NXYC 4IU3B 4PBDA 5CP3A 4F7MA 2Y6TE 3V4VL 2R4SH 3MYJB 4M00A 2FATL 2G5BA 4NFCA 5K1JA 2F53A 1IGMH 3QEUB 4E5XG 1WCBA 2HKAA 1MJUH 2EDOA 2XQYK 4PB9H 4Y1AA 4HULB 1FZKB 1HKFA 4FE9A 1YEWA 4LSPL 4F7CA 1DEEA 1G7PB 4ZMPA 1WLHA 2V7NB 2A9CA 1FSKB 5E4EC 1MLBA 3TA3C 2WUCL 4B7LA 4XNUH 3TA3A 1QHPA 3TF4A 1ZAGA 3AJ7A 2CIKB 1QACA 4K55A 4U6HB 4ORGA 4LHJB 3AT0A 1S9YA 3JUZA 4N2HA 3TH4T 1GSKA 3P4NB 3T3PF 4K5NA 4M1DL 1ML0A 4GQZA 1WE5A 4NENB 1ORSB 2XZAH 2E5EA 3F6JA 4YL4A 2YRLA 3RG1C 5D96C 1J5OL 1KBVA 4WW1A 4BQ8A 4PGDA 2XCMC 3UMTA 5IB2B 5GS3A 1QBMH 3BGMA 3NH7H 3MNVB 5ID0B 4MXVF 5EOQH 2Q2EB 1ES0B 2OPCA 5KANI 3WLBB 3R18A 4NN5B 3DVNB 4YFLI 2AJUL 2D31A 5AW3B 3EGXA 4PLKC 1DQMH 3PWPE 3H56A 5DLMH 5FYJU 3T0DA 1HCFX 4BE6A 2ARJQ 5I2IB 5I6NA 4YDIH 3DXAA 4X4MA 1KZYA 2R4RL 1OY3B 5ACLA 2VAJA 4UZSA 2Y1YA 2IXQB 4U2ZA 2I32A 1U21A 2VH5L 3J07A 1I9RH 5IROC 1E9QB 1CLOL 5IROA 2Y36L 1EDHA 3MKKA 2HA1A 5EO1A 3VI3E 1QWHA 5BZXA 1P5VB 2EXYC 4QTIL 2Y07H 1WH0A 3MBED 1NGWB 4P2OB 3QRFM 3PNRB 5HDBB 4OUUA 1TZHB 1IAIH 5HHNA 1WHOA 3X14B 4JY5H 4UDTA 1U8QA 4DGUA 2AJXH 3ARRA 3DRQA 3E2HB 4H25B 1CFNA 3VXMD 2VOTA 3QEGH 3JUYA 2CKNA 1FNAA 1BQRA 1E6JL 2WO4A 5G5DA 2V2XA 4XCEA 4WI9A 4GIAA 1MRCH 3VXSD 3DK2A 2V7HB 1LO3L 2O5YH 3DX2A 4PGBB 2EO9A 4L4TE 5DGRA 4RMBA 3QO0A 4QHNA 1X9QA 1FL6A 4JREC 4MS8C 2F2HA 2NW3A 4YSOA 1N0XL 4HSQA 3VD4A 2HFGL 3Q2CA 5ECGA 2F54D 3IB4A 2YGQA 1INQA 2P49B 5C0BA 1L3WA 4N6RA 1NSNL 2OFQA 1UOWA 1EA9C 3EH4B 4UM9D 4PG9A 3IFNH 4W9JC 4XNXL 2AQ2A 3WFZA 2EO1A 3JWNH 1ET8A 1OK0A 2VDPH 4JRXA 3MJ9A 1O75A 3GSOA 1TJGH 5DURB 4DSYA 4K15A 2ILLA 1D7FA 5MENA 1UZ8A 1XF3B 5CZKA 4JLRA 5EUOA 4UTBA 4KXZH 1R3JB 4ZS6C 4GSDH 4PJ5D 3RVTC 1AD0B 1SPDA 1YC8A 2W0PA 5FYJH 3W9DB 3LEYH 1ROCA 3LNFA 3T6VA 4PJXA 1B2YA 4EI0A 1RUMH 3QH3B 2YJQA 4MA3B 2AQRA 4HFUH 2CRMA 2MH4A 1EBPA 3CLEH 2XZZA 1Q4NX 1XR8B 4CRPA 1E4JA 3I9IA 3QFDB 4X4KA 5E23A 5J13B 3LKQA 3PWLB 4TNWF 2ZCLL 2ZWYA 3GRWA 4LK4A 1EEYB 4TULL 4IIQB 4ZBJA 5IT2L 4U6YB 4AQEA 2ZYRA 5D1ZB 3ESUF 2XC8A 4WI0B 1I7UB 5AKVA 3NCBB 3L5WB 2IBZX 5ECJE 4LXFA 5C86A 3S2AA 3KHOA 2KPWA 3ZTJH 2YMXL 2MPAL 2AANA 1OF2B 3MRMA 1M71A 1XGZA 2NXYD 4OVVA 5DJXA 4NQUA 1D9KB 3B9KC 5AOJA 4MCYA 3B9KA 4IYKA 3QNYA 3IKCB 4Y1AD 3S5LA 2DQGH 4P2RA 1IFRA 5I30H 2X4TB 3VXQA 4ZMAT 1YYLL 2DWYA 2YKKA 3POCA 5SWQA 3TA3D 1D5BB 3ABKB 3K81A 2I7OA 2OYPA 4R4FH 4Z7NF 1KJ2B 4WFGD 4P5TB 1RMFH 4ZS7H 5ESVB 4PJBE 4N2KA 1BAGA 1AJ7H 4H26B 2XPGB 1U6AL 5DR5H 5FECB 4LBEB 1G7LA 2J6WA 5JYLA 1U4EA 3MRKA 5KS9E 2V5YA 3NIDF 1J1OH 2D2OA 3AC0A 2R29H 1AZZC 4U1HA 2NY7H 5KVEH 2FO1A 3ESPA 1WA0X 2F7RA 4TSAH 5IHBA 2MTPA 2N1TE 2YS4A 3ZKMC 2VLKD 2JSFA 3ML9A 1OP5H 4FFYH 3WTYA 1MHHB 1TJIH 1OM9A 4FJZA 4LF3B 3UC2A 1K3IA 1YEHH 1NCWH 4ZO8A 4N87A 1ZIAA 2GTWB 5KBDA 3HZVA 2VE6A 5ISZA 2FUTA 3NQKA 1OSZB 2FIKA 4KK6C 5C0CB 3TJPA 3H85A 3X3GH 4XCNA 3DOSB 3WOVA 2WAHA 2VLJA 5L8JB 3WELA 1OANA 1PZCA 2FH8A 3DBXB 4M6OL 3W2DL 3ARGD 4HJSA 4J23A 4KRMB 4K9EH 4YJZL 1XH3B 5GS0H 5DTFA 1E6OL 4RRPA 1SDDB 3GIZH 4XMVA 4JFXB 5CCHE 4AT6A 4FQQA 4HG4K 2JJVA 2MWCA 4UUJB 4YBQD 1QLEH 3WD5H 3LDBB 5IB4B 4KPHH 1IRAY 4W6WB 1J48A 4Y5XB 3UOAB 1SHXA 2JJUA 4XC1H 1QBLL 3D12B 3EJSA 3P69A 4YXHH 5C8JA 3D2UA 3J2PA 3GBNL 1DQQB 2VZUA 5CEXA 4E0RB 5C0JA 2X7LA 2ENQA 4HUNB 5BS0D 5CU5A 3JV6B 3K72A 5DJAA 3W37A 5IFJA 3FUKA 3WY3A 1Y7VA 5JIMA 4QCIB 5TK2A 3K2UH 1MCJA 1MF2H 2XNAB 4NI6A 3PWUA 4KAQH 1ERNA 3FB7A 5CJQL 1F00I 1UD5A 1NGPL 2G60L 1AANA 1HXKA 3IE4A 4JDVA 5DDHA 4CC1A 1JRHL 4HZ1A 3VO0A 3KYOA 4HWZA 3RWEA 5MP6H 5C0FB 4R84A 5ABDE 4DK6A 4F7EB 4FZ8H 3TPKA 3IDXH 1NM4A 4OZIF 3UEZA 2CDFA 5DHYA 5EDSA 4ZNEE 3G5YB 3S3DB 5LAXA 4QRPB 1HHJB 4NKOA 5FO7B 2B0SL 3ZQ9A 1I53A 1OCRB 3QUMH 4Y16D 2UY6B 4N2OA 2XWJA 3GB7B 2R59A 3DX8A 4BD4A 1E28B 1UHVA 4OCNC 5CSZA 4M56A 2XTJD 4XVSH 4YSAA 2CGYA 1A3RL 2NNXA 1H3PH 2ZYHA 2VIRB 1A4KA 5ILTH 5DEZA 1GKEA 1WAAA 3H7LA 4DP1X 3MN8A 1AD9B 1NAML 3CN2A 4MCMA 5E70A 1R0AL 3EFDL 1GGTA 2FRGP 2G5RA 3QG7H 2PYFB 1N59A 1ZT1A 3F58L 5E00A 4CVZB 3BLBA 1JNLH 1QABA 4FG2A 4GIOA 4N2FA 4DTGH 1AKJD 4KHXH 4D0DA 3F8UB 1YYML 2KZBA 2YGVA 3OJ2C 4YE4L 3UFIA 2BJMH 3B2XA 2YD7A 4E41B 4M1GH 1FA4A 3MMEB 1XSIA 4DOHE 5F44A 2B1AH 3B56A 4YHKH 2X4SA 3VMPA 3MLXH 4IRJA 3RYMA 1Z7JA 3NN8B 4B9YA 1CLVA 1MCPL 4KJYB 4R96A 5D2NB 5C9KA 5L2KB 2ZG3A 2VDNL 3W38A 4J6RH 1O5PA 5D7LB 2IDFA 1L9RA 4K7FA 3NSDA 2BY1A 1UFGA 4KQ4L 4LDEB 2Z1KA 5T1MB 3WFHA 4F7PA 1JRHI 4Q4IA 1JWMB 1E5ZA 2PXYC 1IC5H 1OOAA 1TJHH 2WIMA 4QLRA 3KJ6L 2PXYA 3ELAT 4NNYA 2YMTA 3OKMB 4LOUD 4UIKH 3A6CL 2Z4TA 2JMRA 5K1NA 3GMMB 2WVTA 4WUKH 5EF1A 1PZSA 5K59F 3HE7C 1AXIB 3F84A 4MD5A 3HE7A 3L4VA 3KCPA 2YRBA 1RZJC 4NX0A 3UXFA 3RKPA 2L3BA 3ZE0F 4LHUA 3H9HB 1EXHA 3V9EA 3DHPA 1AR2A 3ATDA 3Q2WA 3QUYB 4AEIH 3HJ0A 1HL5A 2XN9D 2R2EA 3K1DA 4GSUA 3DPBB 1U8JB 2BIIA 3QFJA 2VGLM 3PWPA 5PCYA 3ZUCA 3CIQA 3G6DH 3PNWB 1LDSA 1UM6H 4OGYL 3ESOA 3BKCH 4GBXB 3EYFA 5KYWB 4JDEB 1XR9B 5J11C 4LLQB 2JELH 1C5BL 4KVCL 3FUDA 4UV7L 2MSPA 2WINA 4U49A 3VI3A 2AEIT 1GJWA 3FSVA 5K9KB 3HS8A 3DX4A 4Y9EA 1ZT7A 3Q6FA 2OCCB 4F2MB 2H4EA 4LL9A 5FB8A 2DD8H 2NT1A 2B4CC 1N64L 2H5UA 4U2YA 2GHWB 3RZCB 4MJIB 5I0ZA 4KK6D 5ICYA 3BJLA 1JG9A 3WJMA 4DGYH 2VLJD 4UZUA 5I6LA 3ZHDA 4HEPG 2IDTA 3V0IA 4FNLH 1KGCE 2O1AA 4BUGA 2ZOKA 1ZLSH 4PWGA 3WE1A 2XXMB 4UTAA 1U8MB 4L4TA 5KYYB 4ODWB 2F8XC 5DSCA 3OJMB 4DAGL 2C9SA 1SDYA 1VADB 1I1FB 2MQCA 4UNVA 2OR9H 1YJDL 3P3RA 4L4VE 3GSNL 1MRFH 2N01B 3O2DH 4BK8A 2DL9A 3FTGA 4KQ3H 1INEL 1OZTG 1UB5A 5E2WH 3MGTB 2YC1B 4X4YA 1DP0A 2ICCA 3MOAH 5EU4A 5D9SB 2K4AA 3REVA 4PIRF 2V3FA 3VXPB 5LGJB 4QMEA 1S78D 3O0RH 2WO2B 5FYKE 1ACXA 3NSYA 1VGKB 1XCTB 3MLRH 5BQ7A 5DA4A 4P5RA 4DQOH 3TYGH 1BFTA 3ZLQC 5F0LB 1FE8L 1EUTA 1SBSL 1BZ9B 1KLGB 1B0RB 4OLVH 5DUML 3IFLH 3BQUC 5CM1A 3EJQA 3ABGA 2X2HA 1SDAB 3BQUA 1CVRA 4NBYB 4KZDH 1O6TA 3RWFB 5EU7E 4PLOB 1RXLA 3OMNB 2RFXB 3RZWA 5KVDE 1FFNB 3S6CA 1QATA 2BOLA 1NFDB 2H1PH 3GS4A 2WXFA 4LMQI 3L3JA 3ES6A 3BUYA 4F37F 1GY2A 3O3BA 1SBBA 1A1OB 2QELA 1FNSL 1L9QA 3L3DB 5F1SA 2IFFH 3ARZA 1DBJL 1NCOA 4K73A 1UEMA 5T5NG 4WEBL 1RJZA 1SLVA 2QVKA 4FQPA 4N26A 5GSVA 4A04A 1T2QH 4NRXB 4OLWH 3CHSA 1JGIA 3KLAB 1QSEB 3EGSA 4LVOB 1LE5B 5DJ6A 3ZTNL 3ZDYB 4CW1B 3BEVA 1TJMA 4IS6A 4M6AA 4N5EC 3ZDZF 2PYEE 1IGCH 2R7EB 3T4AB 3R19A 4DZBB 3CSPA 4ONHA 2OMZB 4G1EB 4IRJD 3H9YA 5EORH 2QGDA 2ZSWA 3MI6A 4HXBL 5JW5A 4Y2DB 2J6EL 4Q97A 1T22A 1RH8A 4PJDB 4K3DH 4PJBA 1HHIA 4CMHC 5E9DE 4XAKD 3DA0A 4PV9B 4XNZB 2DQDL 5EBGA 2JTDA 4FQHA 5AW6B 2PXYD 2AQQA 5KS9A 4K7PY 3V5HB 2YA1A 1RIUH 4BWUA 3BH9A 1Y6KR 1ZSHA 4PGCB 2HT3C 2EIZA 3GMPA 3L3KA 3MRHB 5FV2A 4AQOA 5C2BL 4GI6A 5LNGA 2WBJC 4YQXL 3PRZA 4HIHA 2AJYL 2OXHB 5AEAA 4F58H 2WBJA 1GPOH 2HRGA 4NB7A 4GXVH 4EIZC 5B39B 4U1JA 1N3NB 2D7TL 3TZVC 4KGLA 3P73B 3GMOB 3PU7A 3TZVA 3ULAB 4AK2A 3FC8A 5IUCA 1AXTH 3FQNA 4BKLA 4XBEL 3V4UL 4IBYA 4LKCB 2ZQKA 2HUHA 4N0UE 3QQ4A 4KK9D 1JPEA 3N06B 4WO4C 1A6UL 4WO4A 4MSWB 3QAQA 1NMAL 4Z0XB 4QHLA 3GZKA 1E90A 2ZX7A 5KYUB 4I48A 3HLAB 3NIGF 4WK2B 1F4YH 4X0KA 1PAZA 3N1PC 5TFSH 2XQ0A 4P5MA 4QNPF 5CJOL 1DVXA 3TVMD 3KLDA 1MI5E 2BDNL 3LEXB 4KKBC 5LKNA 4Q2ZA 3U9UA 1TSHA 1TXKA 1D2PA 1AQDB 5DC0A 4MQ7A 1TEFA 3ARUA 1ZVYA 4ANKA 2V8MA 1HOEA 2R69L 1AQ8A 2CO6A 1F0LA 1BAFH 2V0AA 1X7SA 5D70H 2PNDA 1QFWL 5I19L 3GUFA 4GNKB 4O5LH 4Y9BA 2CRZA 2HX7A 3IAGC 1WZ1L 4J3UA 2OMNA 5DZ9A 4AGOA 4OIAA 2P5EB 4X9IA 4RISL 5I6OA 3AU1B 2NUTA 2CM5A 2XDHA 2E9WA 3GBML 2GYSA 4QRQB 3IMSA 1VACB 2BSEA 3MLYH 4HX1A 3FB8A 3VG0L 4L5FH 3FOMB 4NC0B 3T1FB 5DZNA 5HDBF 5AZUA 1FG2B 5CKAA 5LGHH 5DRNB 4CADB 4GAJL 2OP4L 1BZ7A 3TTYA 3FQYA 1EMTH 3HA0A 4ZNEA 1E2VA 1YZZA 2A83A 4UU9B 4OCMC 1WZAA 2ROYA 2WXNA 5D6CB 4OJFH 1YEGH 6PAZA 1MHCB 3F5WA 4H20H 1PBYA 3MNDA 1RZ7L 5ITBL 3NFPA 2H32H 4W68A 2Z34A 1K85A 4IHOA 2E4FA 2X0UA 2B2XH 1UQSB 5CCGE 4CMMB 1IGYA 5E99L 2XYCA 1KCSL 3B2MA 2VMFA 2HYMA 5FUZH 3VWJD 1MCQA 1YEEH 1NBYB 1JZ6A 2C7UB 4OLYL 4OJEH 5I8EB 3LRSA 4H1LB 1P6AB 1B88A 5GGQL 2IPUK 3AWGA 5CHNA 3U7YH 1JZIA 2YN5A 4UQAA 1SM3H 1FI8C 3CK0H 3O9WB 3VXTB 3VW3H 3GDCA 1UWGL 4MTMA 4OGAC 2IH1B 4P4KD 2WVVA 2B1OA 1FZMA 4JCMA 4KKCD 3T2PA 5J6HB 2AQSA 3PWVA 2IMMA 4IEFA 1RK1A 4G11A 4XVJL 1OP4A 4KKRA 4WUUE 3T0BA 3CV5A 3QAZB 4JPWL 1GC1C 3DV4A 4ZFQA 3U9WA 4YX2L 1CCZA 1GOGA 2WXJA 4LSUL 4XNBA 1U91A 3SPIA 3MZGB 1NC2D 4YH6A 1EQWA 2L7JA 1F3JB 5FA3B 1WD9A 1P7KB 4L8SB 1I3VA 2Y6SC 1UH4A 3MA7A 5E5RB 2WNKA 4H8VA 4JFHE 1KENH 1JPSL 3EJZC 3CLWA 2V17H 3V4PH 1O6SB 1YNTB 5EC1A 3RU8H 1CXFA 1QX1A 2IGLA 4LLYB 1O7SA 5I0YA 5BOPA 3U36A 3GSUA 1BEYL 1AZNA 1XQ4A 2AQTA 4B3EA 2DKSA 2VWEE 5B3JF 2MOVA 1TQUA 2QQLL 3ZGHA 4X9FA 3CHXA 1B9ZA 3B7YA 5HI3C 5I82A 3ZQXA 3RVWC 4NFDA 2XOTA 4MAUL 1HN1A 5GRUH 1UC6A 2XKNA 4HKZB 1YQVL 2OTPA 4JRYB 1TTFA 1M7DB 2EYRA 2Y4SA 3DHJA 5EZOL 1KV7A 3U30B 4H8UA 2E7BA 2VSKB 4R0LB 3UBXG 4ZW8A 4C57C 4CVXB 1ASOA 4DFHA 1SY6H 4DQAA 4KFMA 4M7ZC 1MWAA 4L18A 3TZVD 1OLLA 4GH7B 2UXFA 5IV2A 3BKJH 5KAQF 4G83A 3TBYB 4BM7A 3P3TA 4QO1A 3WFCL 3HNVH 3GKWH 5C0ND 5F7AA 4CC0A 4RSVA 3B8YA 4QRBA 1RPUA 3VVVA 4HJJH 1AI1L 1GY1A 7CGTA 4M3JA 5A2JH 3ZYOA 1FO0H 2DDQL 4HCFA 3BPLC 4NQVB 3SCMC 4G6JL 1QI3A 4JZJB 3WKYA 1XAUA 2FBJL 4WTWA 1JV2B 1Z2KA 4HJ1A 4LKXA 5FFOA 5I71C 4LARL 1DBBL 4WWPA 3AW5A 4L4VA 1YCSA 5KG9B 2H3NB 4ATWA 4M61A 4HWUA 4G5ZL 1OPGL 5DS2A 1U8NB 1P4IL 5L2JA 3KMDA 1EXUB 1OAYL 4JM4L 1JF1A 4XNQB 2NNFA 4O2EB 4MJ6B 1HQ4A 2BMKA 5KSAC 3GFUA 4RMWA 4IBLT 3RURA 1R5IB 2E8YA 3DV6B 2Z7YA 5KSAA 4Y2OB 2UWEB 3RAJL 1RY7B 5LJYH 4UINH 1GSMA 1I31A 3ARQA 3EHBD 2CBQA 3DC0A 2XWTB 3BW9B 5F6IB 3BUQA 2RJMA 1LNUB 5CGTA 2X4OA 4XNMA 5DJYA 1F86A 2YD3A 1AGCA 1IAOA 1RULH 2GUOB 1UYWH 2VDRB 3MLUL 2WNWA 3QUHA 4Z7QE 5LWYL 1SFHA 3TN0D 4HC1H 4YHOL 4KNQA 3AS0A 4AVJA 3HRPA 5AOKA 4D8PB 4HPOL 4Q6IB 4XN7A 3VQ2C 3N5AA 5CILL 2HVKB 1TUPA 4M4RB 4NM4L 1I1AD 4PJFB 1XO8A 4LOEA 3M7FB 2LU4A 1Z9PA 2P28B 3ECQA 1NCTA 1HHKA 5EC2B 1CFVL 1JXFA 2N7SA 5B1JA 2MCMA 2LFGA 4UQDA 5DMGC 3SDYH 3S4SB 3T09A 4WEUD 1WFJA 1GZQA 3LNIA 3D3VB 4LLVB 2DQTL 4AH2A 2R0WL 3MOBL 1LLAA 1I8MA 5ANMB 2BSCA 2OSLB 1Z5LB 1EVUA 5EIIB 2IOOA 4MZ3A 4U3SA 4HGWB 43C9A 1JCKA 1WD8A 3II2A 4WI6A 2ATKA 1HSBA 1WFOA 2A9NL 2BVEA 3IDJB 4HWEL 5EFIA 4OF7A 1EZUA 5EU6B 5KSUB 3OKEA 4CC4C 4TVPH 1NEZB 1F3RB 1ZS8A 4CC4A 4DETA 4WI2A 1JL8A 1A3LL 2E47A 1H8NA 1SEQH 2N56A 1YAIA 3BC9A 3BWSA 3EF4A 4PJGE 5IESL 4EUPA 1U4FA 5E9DA 1IGFL 3HG1E 1UACL 4DKAA 1SJHB 3NJVA 1JGVH 1N68A 4GW5B 3QRLA 4H0HB 4JKKA 3OC5A 3UGUA 3QXAB 5CUSH 4AYBA 1M2OA 2WSPA 2X1PA 3KNBA 2Y7LA 3V10A 5DD3H 5E8DL 3ALWA 3ZYJA 3N0AA 3V5DB 1JNNH 1N0LA 3DTUB 3BVXA 3KPTA 1TTUA 3PG2A 3TNNB 4G9FD 4LCUA 1K5NB 2EUZA 1I4FA 3H2WA 2JKIS 1J0ZA 1AHWB 1U3HB 3O11A 1ZCRA 4HJTA 2WZPA 3VTMA 2C3VA 4NRYB 1CLZH 3AQDA 3RJQB 3EG9B 4EBQH 4D9LL 2GJ6E 3CDZB 4N0UA 3QCVL 4UOW1 2Q6WB 1KDIA 3VTTA 5DMKB 2YA0A 4NCDA 4GP8B 2R1WB 4OD2A 2WQAA 4GW4B 4W1TA 3RVWD 2A1WH 4WSKA 4JNXA 3GINA 4JKPH 3AM8C 1VEMA 2WSDA 1LEKB 2EILB 4JPQA 2NW2B 3AM8A 3UYPB 2W5PA 4MA1C 1VPOL 1IBYA 1QOKA 3FQXB 2VXVL 3LS4L 2WJ7A 1MI5A 4PWJA 2KKQA 4ZMXA 1KXQE 2PMZA 1KCUL 1XGQA 4P05A 5E5MB 1NMCC 3K0WA 1YMHA 1OTSD 2FVNA 3IMTA 3FTWA 4NHCH 2CKBB 5KJ7E 1HU8A 4UQ2A 2GT9A 4G8GE 1T5KA 1J0KA 4QEGA 5SX4H 3ETBF 4WCYH 3LNHA 1KGCD 1DVZA 1ETB1 3SDXE 5HYQA 4ZQTA 5ACZA 1WC7B 4OCSH 1KLFA 3FQTB 3IN2A 1D5RA 2P8MB 4OFPA 3ZMRA 2JKXA 3LTVA 4IHBA 1UM4L 3SY0A 4FA8A 2PUQT 4KUCF 3VYPA 3FAXA 1UB6B 1ZDSA 1NOAA 4PJ9C 4PP2B 5LG6A 2NLJB 4I4WB 2ZUSA 4U33A 5TQ2H 2X4UB 2WMPA 4PJ9A 2HCZX 2A6JB 3VFVB 1UOVA 2JB6B 2KLRA 4PJAF 3LIZL 4N6QA 1YPZB 1G0YR 3PCYA 4I0PC 2WCSA 4R7NA 2HMIC 4I0PA 4PMEA 3C60B 3HB3C 3EOAA 4XAWH 1IGIL 5IMMA 3HIZA 3SE9H 2VLRD 4W9FC 5I1JH 4J7RA 3PGDB 4FQJL 4LEOA 5FYLD 1E3XA 3B7TA 3D0LB 4G8FB 1MDTA 1UH2A 2FQFA 5TE6H 3KH3A 1UA6L 5E4IA 3KYNA 3UBGA 2E9GA 3T65B 3L2NA 1Z9MA 1NCIA 3UZVA 5ICUA 4ETYA 4C47A 5AB9A 3T3PE 2G3NA 3WL9A 1F3DJ 3PV6A 2BZ7A 1T0MB 3R4RA 3SGEI 4PP1D 3VU2A 3GO1L 3P4MB 1MUJA 1EAPA 4MA8L 4UT6L 5LBSH 5L4JA 2FO4A 1G6RH 4AYMC 4UQCA 3S34H 4HBCL 4CA4A 5HHQB 3AREB 2HJFA 4X8CA 1FP5A 4HUXA 4AEEA 1USQA 5FYLH 3E80A 3FCTB 3QXUA 4ALAH 4BZ1A 1AP2B 3IDYB 3UCRA 4CGTA 3NIFB 1K8DA 1K6QL 1S5IL 4QKTA 5DJZB 1PLBA 2BSSB 3BN9D 1CBJA 2EE9A 4OZFA 2DJSA