1BZ7B

Fab fragment from murine ascites
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
217
structure length
217
Chain Sequence
DVQLVESGGGLVQPGGSRKLSCAASGFTFSNFGMHWVRQAPEKGLEWVAYISSGGSSINYADTVKGRFTISRDNPKNTLFLQMTSLRSEDTAIYYCTRGGTGTRSLYYFDYWGQGATLIVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PROTEIN (ANTIBODY R24 (LIGHT CHAIN))
publication title The role of homophilic binding in anti-tumor antibody R24 recognition of molecular surfaces. Demonstration of an intermolecular beta-sheet interaction between vh domains.
pubmed doi rcsb
total genus 37
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1998-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bz7B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bz7B01
1NGPL 1S5HB 3I50H 5DUPL 5C9KA 5K9OA 2XT1B 5MEPB 3QEGL 1J05B 3EYQD 3D3VB 4GKZA 2HFEB 3S96A 3L5XH 4YXKH 1JZ8A 3QSKB 1CCZA 3AREA 1JP5A 5IBTL 4EDXA 1P7QD 4NO0D 4DGVH 5DRNA 5GGRA 4GBXB 5HGGS 1UCBL 4YE4L 5E5MB 3C5SA 5D72L 4YH6A 4IMLB 2VDPL 3OGCB 2EE6A 4HJ0C 1IRAY 3CH1B 3FO1B 2BXYA 5ITBL 5L7XH 3A0OA 3MRQA 3OR6B 4XHQA 2KH2B 4PV9A 4UT9H 4MDIB 4G8FA 5ADOH 5F3BA 3DRTB 5DJ2B 5D6CB 1GRWA 3BO8A 3MOBL 1S7UA 1RUPL 2AQ1A 1RZJL 2AEWA 1IGCH 5DJDB 4JFQB 3S35L 4IRZL 2CLZA 4UDTA 2VZ3A 1BGXH 1UXSA 3ZYOA 2X89A 3SDDC 3FRUB 4XMKL 4JFHD 4LLWA 3GM0A 4YXHL 1BZ7A 5FEBA 2E6PA 2FX7H 4O2FA 1A1NB 3D3VE 5IW3A 1XF5B 3S3SA 2DQDH 2GQHA 3DIFB 5HHXL 2XN9D 3TFKC 3ZKXB 4N0UA 4OLZH 4HXAL 4R8WH 2JJTA 3WFCH 1NEZG 1OQOA 4IRSD 1TTGA 1ADQH 2EKJA 4I3RL 1Q9OA 1OGAB 2EH7L 4MA3A 2JJSA 1MWAH 4DVRL 4NYLB 2FO1A 1EEYA 1X5YA 4MVBC 1F02I 1JPGB 4YGVA 4JZJC 4KJYA 3SCMA 4RIRB 1MQ8A 1H5BB 5C8JA 1IKFL 4NQXB 3GEWB 1NBZA 1YNLL 3ULSA 1GGIH 3MPCA 3DGGA 2VUOA 4YHLH 2B2XH 3ZT7A 2D4DA 3KGRA 1ROWA 3DPBA 2VZVA 4QCIB 2FEDD 3KYNA 3H42L 4F57L 4M48L 3V0WL 5SWQB 1A7QH 3CVHH 3DUUA 3C6LD 4ONHB 2DLFH 4XRCA 1YN7A 1TFHA 2AEQH 4TPRL 3NCJL 3QUZA 3GKWL 5TFSL 4HZAA 4GO6B 4S1SH 4YFLI 3UEZA 4PRNB 1EO8H 5B4MD 2UZXB 1IAIL 3P3YA 3IDYC 1U3YA 4OD3L 2IPTL 2D0FA 4JM2C 2X4OA 2R0KH 1YJDH 1X44A 3HE6B 4UIMA 3QCTL 1A7RH 3WN5B 5ACZA 4Y5VA 2SEBA 4RWYL 1CXIA 4UNTA 1FYTD 4MD0B 1J0YA 1MPAH 5LBSL 4OAWB 1I8IB 5IBLC 5ITFB 2C3HA 2YD6A 3K1KC 3ARGB 1QUNA 3PIQA 4OFYA 2IJ0C 3ZTNH 4HJ0D 4L8SA 4R2GB 2ADJA 4I9WE 3T8XA 4NOFA 5ECJE 1ED3B 1VGKB 1GIGL 3BPNC 3QI9A 2AK1L 2HYMA 5MHSE 4NCC2 5I1DA 1A4KA 2WMPA 3DX8B 1I7TA 2QLVB 1DBJH 1EDQA 4OLXL 5M94B 4JRYB 5I30H 1A6ZA 4WFFD 5T33H 3B5HA 3MRKA 2ZG2A 2Z91A 5DLML 1NMAL 5KVFH 3G5VB 4UQ2A 2YEZB 4TUJA 3DMMC 2YD3A 1I1AB 5EUOB 4NKIH 4GAGH 2UVEA 4HWNA 1FHGA 5HDBF 3PWNA 4OGZA 3TV3L 5GS2D 4XP5L 1XFPA 2DI9A 2A74A 2NW2B 1N0LA 3IFNL 3TFKD 1F3JB 5IB5A 2R0LL 3FQNB 3RI5K 2LABA 5KSAB 2B1HH 2DQEL 1YJDC 1RMFL 2OZ4A 3TH3T 3ZSTA 4H26B 5F7DA 5D1ZB 2WSKA 3H9SA 2JCCA 5MEQB 1X5ZA 1N5YL 1JE6A 4I77L 4MVBD 1EXUB 1U8KA 4FXLA 3W82A 5ID1A 1V7ML 4MAYC 1G7IB 5AZEL 4DCQA 5F21B 1GAFH 5DTFA 3DUHA 4YX2L 4JY5L 3IXAA 4HIXH 2YPVH 4TULL 4NSKA 3QIWD 2CO6B 2X4NB 3QEQA 3TWCL 3T0DA 4Z7UB 3HI6H 1S7QA 5KANI 3JTSA 1OOAA 4WHDA 2BXZA 5IVZA 5KVGH 3EHBD 1N3NA 4TN9A 2C3VB 4GKSB 2VLLB 4M9PA 3ZYIA 2B20A 2YUWA 3CXDL 1FVEB 4FS0A 3UTZB 1EGJA 4JFOA 4WW2A 5IKCA 1AH1A 3IJSA 3V5DA 3N85H 5C0JB 1JNLL 5GGVY 2PYFA 4ERSL 3INUH 3LPWA 2PXYD 3P9WB 5C0NC 3MRMB 3BH9A 2AQ2A 4TTDC 3ZYJA 3JWDH 5MENA 3L5WA 5I1IH 3EDKA 3ZE2F 3NBNA 5B3JF 1QSEA 4Z95L 1X4XA 1MSPA 1YQVL 4P23D 2PF6A 4NNXB 4OFKA 4G6FB 1IQWH 2LE9A 3DXAB 5EIIA 1JPTH 5GS0L 3AREB 3QQ3B 4OF6A 1T22A 2FO4B 3GSOA 4Z7UE 4YDLB 4ONFH 4O02H 1WFTA 5KSBE 4WWKD 4YNYA 4P46A 4MXVE 2W9EH 3UAJC 5DRNB 1DVFA 5C08D 4WUKL 4ZXBD 4ZDHA 3C5SB 2W07A 4UUJB 1PKQA 2Y9RT 4G8GB 5DMYA 2PO6B 3SKJH 4MNHB 1X4YA 1Y18A 3W39A 4OZHB 3MRQB 4G9FB 4XP9L 3GMPA 5F6HI 4WHYH 1KJ2H 3S97C 3VW3L 5EU5B 3GSXA 5I8CB 5C0DB 5F3BB 1YEFL 3EZ8A 3U6RA 2R0ZL 1ZSDA 4EI5C 4PJ8A 1S7UB 4TSBH 3FT4A 4KROC 4M7ZB 4PRHE 4OF3A 2CLZB 3HUJE 3T0WA 2Q20A 4UQ3B 4HS3A 1UXSB 2XV6B 1E4KC 1U93A 2FIRT 1DQMH 4ZS6D 15C8H 2VDNL 4LLWB 2EDYA 4M03A 3P0GB 5KN5A 3PL6A 1UVQA 4OM1H 5HGDA 2NR6C 4V2BA 1AIFA 1NKRA 5EZOL 3DXAE 3S3PA 1MI5D 4J8RA 4NWUL 4N0UB 3QISA 5FCUL 1FZJB 5AZ2L 5C2BH 1ACYL 2EXWC 4LIQH 4PJHF 2AJXH 4N0RA 4N8CL 1IGJA 1JMXA 4AEFA 3VXQB 3OAZH 3L1OL 1Q9OB 4G8GE 4LNRB 2GTZB 2Y6SC 4MA3B 5BOZG 1L7TH 3FB8A 4DUVA 3CDGB 4OZHE 1EEYB 4Y16C 2LVEA 4G9FE 1FO0A 4YGVB 3I75A 1JZ4A 4LU5H 4ODVH 5C8JB 3MLYL 1KLFA 4BFGA 1QFOA 3NMEA 3DGGB 3HPLB 1NGPH 5DUPH 4KY1L 4Z7WB 4FQJL 3QEGH 4OUOA 3CC5A 1J18A 1ORQB 3VFOA 3PWJA 1I7RA 4Q74A 4CN1A 1ZHBB 2OBGA 3FO2A 2B4CL 2R4SL 1LEGB 5IBTH 3DUUB 4LCYB 1FFQA 4PRPA 5INDA 5FK9A 4X98A 2OQJB 1G7MA 2VZUA 1NQBA 5F6IC 5E8DL 1UCBH 2DQFA 4YE4H 4C55A 5J13B 4JCLA 5J11B 5D72H 5ANMB 3D87B 2VDPH 5JZ7C 2AEPL 4N0UE 3HHRB 5A2KH 4XB7A 5ITBH 1BBJB 2XKSA 3D2UA 2H45A 2X4OB 3FQRA 1MWAB 1B2WL 5F1IB 2Z92B 3OWEA 4DUXA 2C3XA 4NQEA 4Y5VB 3BQUA 2SEBB 4YPGB 1M71A 3MOBH 4NKOB 1RUPH 1PZ5A 1RZJH 4IEFB 3S35H 5DSCB 3UAJD 5JPNA 4IRZH 5BCAA 3PWUA 3O2DL 3FTGA 5IF0B 3K8LA 1R3HB 3UYOD 4EIZC 4I2XA 4L8SB 4XMKH 4Q6IC 4JANA 1UC6A 4XCYA 3T8XB 5H8DA 3WLBB 4YXHH 4Z7WE 3QI9B 4JZOB 3NABL 4FQXC 4F7PA 3MBXL 5HHOD 5IM7A 4OKDA 1LEKA 1XCTB 3BWAA 2OR7A 4E42A 1QD0A 5HHXH 1CL7L 3Q3GA 3O3EB 4HXAH 1F13A 4KROD 3DUSB 3KNBB 2NY6C 4GRLC 2ZJSL 3BKJL 3QCUL 1MCSA 5D6DC 4TVPD 4HIJB 4I3RH 4KC3B 5ANME 4IRJD 2EH7H 1KUMA 4DVRH 3DX7B 4C4KO 1S9XA 4PFEA 1IAKA 1EAPB 3PWNB 3GMRB 3DVNB 1MAML 4ENED 2XTJD 1CD9B 1IKFH 3C8HA 5LAXB 5F9AC 1YNLH 4OF8A 1T7VA 1YN6A 3TBWB 4JO2L 2EXWD 1EEQA 2WWKT 1P4LA 4MZ3A 2J7LA 4AH2A 3X12A 4YHZL 2VZSA 4YPJA 4HIHA 3H42H 5F1SA 4F57H 4MJ2A 4M48H 3V0WH 2JCCB 4RZCB 1F00I 5CJ8A 1GC1C 5LCVL 1OTSC 3VWKC 2XICA 3O6LL 4TPRH 2HTKC 4ZO6A 4CAGA 3NCJH 5EA0L 4NBXB 4YC2C 3BDBA 1UKQA 3GKWH 3O4LB 5TFSH 5AG8A 2IMNA 1RIUL 5JPMA 4P48A 4NSKB 2WIIB 1H3XA 1IAIH 1V7NL 1P9MA 4PJIB 3AMKA 5KANG 4OD3H 2IPTH 1S7QB 1JZ3A 3FONA 3JTSB 2F8OA 4ZD3L 1J87A 5IVZB 3X13A 3OR7A 1N3NB 3QCTH 4K3JL 4Z7QF 4M5YL 5IR1A 4RWYH 3OKMA 4DFHA 5I17A 1RJLA 3MJ7A 5LBSH 4JFOB 5SWSB 1WF5A 4NO3A 4WW2B 5IKCB 4MB4A 3FO0L 4YHKL 1F6FB 2YPKA 4G9DA 1DANT 5JZ7D 4JFDD 3UX9B 1T89C 1A6VL 2VR5A 4NPYA 5FAAA 1GIGH 3MXVL 1TPXB 2AK1H 1DUZA 2QQNL 5F7EL 5CEXA 4D0CA 1SYVA 5MENB 1J88A 3IDNA 1MJUL 1NSNL 1F8TL 5GGVL 3Q5YA 4PG2C 4WV1A 4K55A 3QIBD 1BWWA 5HYIA 3PV6B 4OLXH 1OVZA 1JGDB 2VKXA 4HLJA 3RWEB 1IM3B 2PYED 5IP4A 1TJIL 1LNUA 4L9LA 3K2UL 3D18B 5DLMH 1B0GA 2VIRB 1NMAH 2CDEA 3O4LE 4M02A 2FNBA 4A6YB 4PJIE 2F19L 5D1XB 4CRPA 1T22B 3GSOB 1OGTA 2F54A 4FQXD 3PQYA 1VKXA 3TV3H 1SQ2N 2P7TA 2YD4A 3DO3A 5A3IC 4YNYB 4XP5H 3O8XD 4KGJA 3AAZA 2W9DL 3OKKA 3IFNH 2ZOKA 3GRWA 1ZS8A 1JZ6A 2R0LH 2HT3D 3BJLA 4MA1C 4ZUSA 1A0QL 2NY6D 1U58B 4NQTA 1YEIL 5C0CD 4FMFA 5SWSE 4Z7NF 1OHQA 5ACLA 1Y18B 3W39B 2DQEH 1GJIA 3GMPB 1RMFH 5CGYC 1KB5L 3C5ZA 4P4RB 3U6RB 2COQA 4S2SA 1N5YH 4WJ5B 3MMEA 4I77H 1AC0A 3RWHA 3TJHD 1ZSDB 4OIIL 4P5TC 1AHWB 3N1FC 3QIUA 4EI6A 1V7MH 3STLA 5MENE 4PR5B 1BD2D 3VXUA 2EKSA 5JUEL 3IB4A 3QO0A 5AZEH 4AEIL 4RMTA 4HK0A 1TITA 5C9JB 1F4YL 4YX2H 4JY5H 2O26U 4CU6A 4TULH 4D2NA 2VH5L 3TWCH 3BUTA 2BNQD 3CZFA 3BP6B 5KN5B 5I15L 4KTEL 5HGDB 1I75A 1AIFB 2VDKL 3GGWA 4YR6B 2IEPA 5HYFA 5IHUL 4FA8A 1T03L 3GSRA 5IV2B 3CXDH 4NNYA 1NGWA 1G7JA 4L29A 1T5WB 5E2JA 2DI8A 1IGJB 1T7XA 1JNLH 1V3MA 1RSFA 1W72A 4QNPE 4LCCB 4QOKD 4WTZA 4ERSH 3OKEB 4PJXA 4XXCC 4X5XA 2GJZA 3LOWA 1FO0B 4OZGF 3I75B 3B9KD 1CDBA 4D9RE 4HIEB 5D8JL 2A38A 4RMUA 3VWJC 1QVOB 2NTFB 2R2BA 4XBEL 4Z95H 2WWKO 1FJ1A 1HOCA 5HTSA 1YQVH 4H5SA 1LO5A 1A7NL 3DX6A 3UJJL 2NY2B 2O61B 5J9PA 3K1DA 4OFIA 5GS0H 1I7RB 3VMNA 4QRRD 3FO2B 3BISA 1N6VA 4M3JA 1V3KA 1V5JA 3L3GA 3EO1B 5FK9B 4X98B 1G7MB 1L6ZA 4MXWL 4LF3B 1ZHKA 2DQFB 2A6KA 4WUKH 3KXFA 4KJQC 4HG4K 4XCNB 2ZG3A 3J8F7 4PJEA 4HPYL 4EN3D 4XC1L 4G7VL 4XP9H 2UUDK 3FQRB 1JWMB 1HN1A 5HSFA 3VW3H 3O81A 3OJDA 5E4EB 3QNYB 1JI2A 1YEFH 4WHCA 4JRXB 4NQEB 1EK3A 2VDML 2R0ZH 1NAKL 2RBLA 1R5IB 4CW1B 1YC7A 1PZ5B 5A3ID 5EC2B 4OUUB 4XI5D 5JPNB 1LP9F 2AKRA 1SJEA 4JM2F 5HXMA 3FTGB 3ARPA 4HDIA 3CPLA 4I2XB 2VDNH 4JANB 4XCYB 2VL5A 1JWSB 1H8NA 3BIBX 2YD7A 1TQCB 4F7PB 2DM3A 5EZOH 5GRVL 1LEKB 5D7JC 3BWAB 5C07A 4E42B 5FA3A 5DR5L 4NWUH 5FCUH 5AZ2H 1QQDB 4I48A 4P5TD 1ACYH 4NDMA 4Z0XA 4N8CH 4LIQE 4LGPB 5GS1A 3L1OH 5JW4N 1A6AA 3EO0B 3FMGL 3MX0A 4LP4A 1S9XB 3T4AB 7FABL 3S36X 1U2HA 2X9XA 4MNQD 5I8KL 1XF4A 4RWHA 3RTQA 4X4XB 3MLYH 4JRXE 1YN6B 2DQCL 2E8YA 4XVUC 1P4LB 3RGHA 3IKCA 2ITCB 4IM8A 4LLUB 4KY1H 4AH2B 4FQJH 4H1LG 2BNRA 5I1JL 3RWCA 5F89B 5DD5L 3GBLA 5I0ZA 1GH7A 4I2XE 4NBYB 2B4CH 2AJZA 2HA1A 2R4SH 2Y7QA 5E2UL 3LN5B 3V7AG 1UGNA 1MCIA 5E8DH 4OCRL 3MV01 1F4AA 3JSSA 1P1ZB 1W0VA 1R3KB 2AEPH 5JPMB 2NZ9C 3IDMB 4PJHA 2PTTA 4NQSA 1B2WH 5T1KD 4XMLL 2MOVA 2FJGB 3TT3L 4X9GA 2CD0A 4YFLF 5IR1B 1RZ7L 5AD0A 4JQXC 1J8HA 2EDBA 2X4QA 3MJ7B 4AENA 4UI2A 1LGVA 5HJ3A 4QRTA 1T04B 1CXLA 3TO2B 2ARJA 4FZEL 3O2DH 4HGMA 4KJQD 4PJ9A 3QULA 2YPKB 2EXYC 3UBXA 3QFDA 5J12C 4NPYB 1DTUA 4XPBL 3A6BL 1DUZB 2O93L 3NABH 3MRPA 1SYVB 3MBXH 3IDNB 1KPVA 1ODAA 4AQOA 2X6MA 4PP1D 1H8SA 1CL7H 2P5WD 2X9YA 1EHNA 4ODSL 2ZJSH 2D0GA 3BKJH 3QCUH 3FB6A 3UTQA 1LNUB 1JPFB 2XOTA 1I8LC 1B0RB 5GZOC 2CDEB 4WO4C 2B4CC 3FZUD 1HYSC 3SDXA 2IBZY 4XCEA 4F58L 3VD4A 5LGJA 4RGMB 1OGTB 2F54B 2P8MA 3BN9C 1VKXB 2KZ1B 1IJ9A 3RVTC 1MAMH 4MSWB 4EDWL 3ISWA 1FNAA 5D7JD 4M6OL 3OKKB 4XTRC 4L3AA 4HSQA 4NQCB 4JO2H 1PZUB 3L5JA 2NY4B 4BSVA 2FLRT 1L0YA 1I1RA 3I9GL 3OGOE 1Y0LB 5HY9A 5EFIB 1WISA 4YHZH 4Z8FL 3CDCA 3GIVB 1G6RA 4HUUA 5FYJD 5HD8D 3QUXD 4R4NC 3QB7C 5F93C 3MYJA 4UBDC 3RWHB 2BRQA 5LCVH 2R1WA 1JGEA 4EI6B 4PRBA 2HLFD 3C9NA 4BM7A 2EKSB 3O6LH 4YFEA 3RKDC 4HUNB 5IFAL 5EA0H 2EYRA 3MRJB 1G0DA 1LEIA 1RIUH 3B5TA 1T5XA 3JV6B 1V7NH 5EU6D 5JW5A 2YRLA 4BYHA 4Y2OA 3CZFB 1WSST 4XNQA 2MQCA 2IAMB 1QBAA 5E8EB 3UJTL 4ZD3H 2CJUL 3CX2A 2ZUTA 1T7WA 3GGWB 5JOFB 4K3JH 1P7QA 3GKZA 5JHDB 3BD4A 2P5EE 3HZMA 1ZGLA 1NGWB 3TH2T 4G8EB 2E6QA 1NEZA 4L29B 1UZ8A 5KS9F 1DZBA 1UB5A 1RJZA 3FO0H 2FIKB 1PEZA 2D7MA 2EDNA 1W72B 3MLPA 1MFCL 4LLAA 4NQCE 2NZ9D 4MJ5A 1M7IA 1XR9A 5IROC 3GB7B 3R06A 1WZMA 3MXVH 1AXTL 2QQNH 2GJZB 5F7EH 1MJUH 1NSNH 4K9EC 4Y4FB 3BGAA 1F8TH 5EU4B 5GGVH 1UH4A 1DN0A 3ULUH 4GAJL 2FSEA 3KPOA 3U0TB 1U8HA 1TJIH 4OF7A 4H5SB 4R7NB 3K2UH 3CCHB 5DA0B 1I8MA 1NC2B 3O6FB 5C86A 2V7HB 5FHAL 3PHOB 1DEEB 3TNMB 4ORZC 2F19H 4EUPH 3LV3B 5B3NA 3BVNA 2VLRA 4U7KA 2IADA 2HKFL 3ROOA 3MBED 4GG6F 1HHIA 3NGBC 2FL5B 2W9DH 2A6KB 5JHDE 3KXFB 4LLVB 5KOMC 4KWUA 1A0QH 3ZLQC 5HDBE 1YEIH 3SY0B 5GZOD 4WO4D 5A16A 2QADD 5IQ7L 2H32A 1BZQK 1KB5H 5DMKB 4KV5F 2IFGA 2DB8A 1RUAL 5DGRA 2EDDA 3C60A 1Z0MA 1XT5A 4MCZA 4OIIH 3BN9D 3RVTD 1SYSA 3BPLC 5EBMA 1JYNA 5JUEH 4NN5B 3V4VL 4AEIH 2AKRB 1LQSR 1F4YH 3AY4A 3E8UL 3JVGA 3CPLB 2HH0L 2VH5H 3WUWG 5CMAB 2XRAL 1MNUL 3H9YA 2RJMA 4QXGL 5I15H 4KTEH 3MREA 1U0QA 5I1CL 1AI1L 2VDKH 4MXQD 5IHUH 1R3IL 3CDYA 4F7TB 1T03H 4XAWL 5JIHA 5IW6A 5C07B 2FYYB 3ULUC 1ZHLB 1BIIA 4LCUA 5FYJU 4Z0XB 2GSGA 3FKUS 3RKDD 3H3PL 4KQ3L 5GS1B 1Q8MA 1CU4L 1OAXL 4EQ3A 1MLBA 2DQJL 3D25A 4HBCL 1OD9A 3NOIA 5E9DD 1T1YA 3CFDA 1K4CB 4QRPD 1T4KA 1EBPA 4JO3L 3LPGA 5GS2H 1EUUA 1FYTA 4PB0L 2AV7B 1G7HA 3ZL4L 3V8CA 5D8JH 4S1RL 2VB5A 4DKEL 4XBEH 2KQMA 4I0PD 4XP4L 1A7NH 2JIXB 3UJJH 4PLJD 1O7VA 1NGZB 1LDSA 4NZDA 1X5KA 5DO2C 3ZE2E 5B3JE 4MB3A 3SN6N 4OZIF 2AJZB 2Y7QB 3EYUL 4JHWL 5DK2B 3WS3A 5I74C 1KB9J 3BP4A 5DJZB 2EDWA 4RCAA 3VXPA 2I9LA 1FE8L 4MXWH 5I0DA 2NNAA 3H7BB 1DCLA 4NQDB 3VA6A 5HDLA 1Z5LA 3SDDA 4KTYA 4HPYH 2R0WL 3KPLB 4XC1H 4G7VH 4NQSB 4J23A 3T3PE 2HP4A 3VGBA 5AD0B 2VDMH 3AUVA 3GSNA 3QWRD 1NAKH 1J8HB 2X4QB 4OZGA 3WLWD 4AENB 3GUTA 4FOMA 1T20A 4LASL 2ARJB 3GBML 4NUGL 4PJ9B 3D39D 3P4OA 3UBXB 3QFDB 2APWA 4E5XB 5E00A 3MRPB 4Y4KD 1V3JA 1PDKA 1KPVB 4JZJA 5DD1L 4ELKA 1LD9A 3BESR 4TNWF 3QDAA 2GK2A 5DR5H 1A3QA 1C5BL 1E28B 1YMMD 4UINL 2ZG1A 4PJAA 3LKQA 5GJTL 4XPAL 4ZUWB 4XPTL 5GRWA 4X7FC 4NQDE 4D0BA 1RZ8A 1I3RA 5GIRB 3FMGH 7FABH 5LGJB 4X7CC 2P8MB 5I8KH 3VGHA 4Y89A 1UACL 2Y4SA 5EIVA 4LDEB 4R26L 2OMNA 4X6DA 2FEEI 4JFED 4Y19A 3QXDA 3ZDZF 4L1HA 5L2JB 2DQCH 1FAIL 2XWTB 1J8HE 2DYPA 3MV9D 5D93C 1A3LL 1I85C 1LP9A 2GJ6D 1QO3A 4K2UL 4MQSB 1J5OL 4JM2A 3TBTA 5I1JH 1G6RB 5F7HA 1AGDA 3EYFB 5DD5H 4ZPTB 1DQLL 3NFPB 5E2UH 5CINH 5CEZD 3QDMD 3ARUA 4MS8D 2MCG1 5GRUL 1JHTA 2DDQL 4LVNB 4PRBB 4Z77B 4K3DL 4OCRH 4XNXL 3SKMA 1U42A 1HEZA 1LEIB 3CX5J 3Q6FA 5H37H 4NUJA 5JW5B 4KK9D 3GJFK 4DOHB 2IBGA 4E0RB 2J8OA 2BCKB 5DO2D 4XMLH 4PTUA 5C0BD 3TT3H 1P7QB 1CZ8L 4NO0B 1RZ7H 1MFDL 3HZMB 3O11A 2JELL 1ZGLB 1UZ8B 1VADA 4P2OC 1UB5B 3HC0B 4FZEH 3O2WL 4U2ZA 3K81A 5DJXA 4ALAL 1NL0L 4JFYA 3TZVC 1EMTL 1F3RB 4DW2L 2NX5D 2WBJC 1M7IB 1XR9B 3DMMA 3IXTB 5L9DL 3R06B 4XPBH 3A6BH 2DI7A 5J89A 2R56L 4PJGF 3DBXA 1ZT7A 1DN0B 5IB4A 4J4PC 5F7WC 4NQUA 4ODSH 5J6GB 5A2LH 1U8HB 2WINB 1I8MB 3I6GB 1DLHA 2ZNWA 1ZMYA 4HAGA 5JORA 1TJGL 1X3DA 2HMID 4F58H 3BVNB 2IAND 2XN9B 1MI5A 4EDWH 4X9BA 4M6OH 5I75B 3D85A 4MAYA 1NJ9A 2G2RB 4IRSB 1GHFL 4JKKA 2XKNA 4UDUA 3JV0A 2HJLB 3I9GH 3LQAC 3V6OC 3KWWA 5JXEC 5C6WH 4BUHA 4Z8FH 4P9HC 2H2PC 5IJKC 4NM4L 4HEPG 1M7XA 1X5JA 3REWA 1VEMA 2BK8A 4K7PX 1TIUA 3KYAA 1QBLH 7CGTA 3HMWL 3LKRB 5FO9B 3I84A 1CK0L 5IFAH 3VDCA 5F88A 4HUVB 3CSBA 4Z18A 4YDVB 1G9EA 1FL5A 3EDDA 1P69B 3QBTB 3HG1D 3RPKA 3WMSA 3ZE0F 3IJHB 5JDSA 5HVGB 3UJTH 2ITDB 3MREB 3C6LB 1JYVA 2CJUH 1I1FA 1F11A 1KPUA 5DJAA 5BVJB 5IW6B 1BIIB 4LCUB 2QQQA 1BFOB 2XN9E 1RI8A 1XCQA 2RR3A 3JTTA 1RIHL 4RFNC 4Z7QE 3LRGA 3T0BA 1MFCH 3D25B 3FQWB 4WFHD 5J1AB 1CLOL 1EX0A 1S7VA 3GZKA 2OP4L 3MOQA 1KB5B 4OBRA 2ZCHL 5I1EL 1AXTH 1T4KB 4NC1C 4YK4B 1WBXB 3QAZC 1FYTB 3ULVC 1G7HB 1HIML 3ARFC 4GAJH 1W8NA 1CFSA 5AWNL 4P2OD 4LVHB 5BZDA 4YQXL 5FYJL 3HFML 3VG9C 1JHKL 5FHAH 2VDLL 5HHOA 3KYMA 4JREC 4FQQA 3QG6B 2I25N 3BP4B 2HKFH 5IK3A 4EI5A 3O9WC 5D2LF 3UROR 3VXPB 2I9LB 3RGVD 3BKML 2C7UB 2VQTA 5DVOA 4LSVL 5MERA 4J4PD 2YA1A 2GIYA 1E6JL 1S78C 1Z5LB 4KFZC 1E4KA 4NT6A 5DJYA 5IG7B 3GBNL 4FHBD 3LIZL 5IQ7H 5BRZE 5ID0A 1T7ZA 2EC8A 3RZCC 4MNGB 4O4YL 1RUAH 4Z7NE 2YR3A 5J06A 3GSNB 3NCMA 4TUKL 1LK3L 3OHXA 5F9WC 3E6HA 3DURA 5CD5C 4OI9A 4HEME 1FYTE 3V4VH 5IJVA 3E8UH 3KJ6L 4HZLB 1EH9A 4EVNA 4GQPH 2HH0H 2D0HA 3BPCB 3FHAA 5F3HB 2XRAH 1MNUH 3P4OB 5JXED 1PQZB 4QHLA 4QXGH 1KG0B 2A73A 5I1CH 1AI1H 4Y16A 1R3IH 4JZJB 3RL2A 4XAWH 2CLVB 4ELKB 2EDHA 1EVUA 4AIXA 1KT2A 1SEBA 2ADGA 3QXTA 1OP5H 3V5HB 4M4RA 4F8QA 3UDWC 3QIWB 4GG6A 4KQ3H 1R3JA 4ORGB 1Q9LA 1CU4H 3OG4B 1OAXH 4WFFE 2DQJH 3RUGF 4AL8L 5BV7C 4D0BB 4HBCH 1I3RB 1C5CL 2WUBL 1MCPL 4HBQA 4X0KB 1X6LA 2NY7L 4X5WA 3TO4D 4JO3H 5E0QA 4PJ5D 4PB0H 2DKMA 3PGCA 1CS6A 4RISL 3GHBL 3ZL4H 2JE8A 1KXVC 5F44A 4S1RH 4MNGE 2J2ZA 5FUOL 4DKEH 3ZKNC 5IESL 3WKNA 4XP4H 4LSQL 4ODWA 2ZOLA 5JQHC 4OM0L 4DK6A 3UC0L 3RDTC 2PXYB 5AEAA 5EO0A 5HVHB 2M1KA 1QO3B 2OS7A 3RNQA 1XZ0B 4F37K 5INCA 1OCWL 1I7ZA 3OKNA 3EYUH 4JHWH 1VFUA 2QSCL 1YEKL 4HPOL 1HHKA 5C09E 2AVGA 5I2IA 1D6EA 1FE8H 1P84J 1HI6B 5EIQA 2A9ML 3ARFD 3GHEL 4LHQB 2PYEA 4P23B 2BHZA 3QCVL 3NN8A 5E70A 3Q6FB 2R0WH 4GW5A 2X4UA 3TVMD 2VLKD 3P30L 3B8SA 2FJFB 4Q6IA 4WI8A 3SKNB 1U8LA 1KCLA 4U3HA 4F7EB 3BPNB 4FQXA 4XPGL 4QT5B 4R7DB 4WWKB 2H1PL 5C08B 1HWHB 3O11B 5DURD 4ZXBB 5JQ6L 3O9WD 4M7LT 4LSTH 1VADB 4GRLA 4LASH 2BERA 3B3IA 1D9KC 1G9NL 5D6DA 3GBMH 1KJVA 2DJSA 3K46A 4NFDA 4NUGH 1CICC 4NKMA 3N1PC 3PABB 3CMGA 1F42A 1TCMA 3KLAB 2CRIA 3SPVB 4Y1AD 4JGJA 1AGEA 3ZDXF 1MIEL 2Q8BL 1FIEA 4DAGL 4OZ4A 5DD1H 3RZCD 1MCJA 1BD2A 2R23B 1ZT7B 3S9DB 4MB5A 5BQ7A 4QHUA 1C5BH 5CD5D 1U8QA 4UINH 1CG9B 2VZTA 5GJTH 1IEBB 4XPAH 4NFBA 5BOPA 5I1LB 4XPTH 4DFIA 1PW3A 1AXSB 1YY9C 3IDIB 1MFBL 2ZCKL 1DLHB 1YPZF 4FRWA 2MCPL 1NFIA 2VN7A 4HD9A 5D2NC 4IOFC 5I8EB 3T3MF 4PG9B 1MI5B 1X5AA 3QUKA 1UACH 3HMXL 3DETC 3TBSB 4R97B 4U4BA 3MLZL 4R26H 3VWKA 1E4XI 3T0EC 4YDIL 1FAIH 5C08E 5JR1L 4F7MA 1A3LH 4KK8D 2R1XA 2E7LC 4K8RD 5J6HB 4JAMA 1J5OH 1T6VN 3TT1L 4KXZI 1TXKA 1ITCA 3REWB 1DQLH 2M8XA 3MCG1 1KN4L 2BOBA 1S9YB 3EFDL 4JN2A 5B8CC 1HKLL 4N9GB 4RDQF 5C6TL 5GRUH 3AS2A 2WP3T 2DDQH 4K3DH 1WCQA 4W6WB 4XNXH 3RJDA 4MA8L 2QSVA 1FL5B 4CBPA 2FATL 5F1KC 1I8KB 1T89A 5D7SL 3RDTD 4QRRA 5IB2B 5JDSB 3EJYD 4XP6L 1OW0C 4JDTL 3MZTA 4RFOL 1H3PL 1I1FB 5DJAB 4TUOB 1CZ8H 4HUXA 3LMJL 4JKWA 1HQRA 5C0IA 1MFDH 2JELH 1FNLA 4PG2A 1F4WL 5EU7C 2W65A 4X99B 1XCQB 3O2WH 3JTTB 4OGAC 3TEUA 5FB8A 2W9LA 5ICYA 4ALAH 1KPRB 1NL0H 3QUML 1EMTH 4DW2H 1NDGA 3N1MC 4NKQB 1S8DA 5L9DH 1KIQA 2CO7B 3PWVA 4JHAL 1H9VA 3MJ9A 2FECI 1JTOA 2UZYB 5DHVA 2R56H 5DHYA 2NY3D 3JUYA 1WAAF 3KS0H 4PREA 1GPOL 2AGJL 4HV8A 3FJTA 1FNGA 2R2EA 1PY9A 5FHBL 2EC9T 5BZDB 5IHLB 1D9KD 1RHFA 4R90L 4H1LA 3HE7C 2X4TA 1CICD 2Q3AA 5A2IH 1BQSA 4BUGA 4LVOC 1TJGH 3ZSSA 5HHOB 4N0FA 3VXMD 1WQVT 4FQQB 2XZQL 4XCCL 5IK3B 4P5TA 4KROB 2VE6B 3TNNB 1GHFH 1B6UA 5MERB 1S9KC 4S1DC 1RJYA 3F6LA 1UH3A 4IRJB 4LBEA 4NT6B 5DJYB 2HKHL 5KS9B 1JUFA 3DGCR 3RFZC 1VESA 1KF9B 1Q9WA 1YY9D 3GMNB 3Q6GL 4CVXA 4NM4H 3RZWA 1UKSA 4GW1A 1KTRL 4MNQA 5ID0B 5FUCC 1YNTA 2XTJB 3FO9A 5DD6B 3HNSL 3OHXB 4LGSB 2AS5M 4YHPA 2NZIA 5HPMA 3DURB 3GDBA 3HMWH 4XVTL 1CK0H 4BH8B 5I6XB 5KVMC 5MI0B 2D31A 3IFOA 4PJGA 5EZJA 5IJVB 4B0MM 4EVNB 3TM6A 4C56D 4KQ4L 1GCFA 3KG5A 4PGDB 3P77B 4XXCA 2A73B 2E9BA 4X6BA 4LARL 2MJWA 3RHWK 5HHOE 4KJWD 1RAMA 3CUPA 2H8PA 4WNQA 3VWJA 2XZCL 2ADGB 1XGRA 5FO7A 4GG6B 3ZDYF 1RIHH 3QRFM 1Q9LB 4U1JA 3E2HB 3V95A 4TVPE 1ZANL 2HG5A 5T1KA 1CLOH 1U92A 3WIHA 2VMFA 2OP4H 4G42B 5I1EH 2ZCHH 5IBUB 5KS9E 1XF3A 3QUYD 5HHPB 4X5WB 1OD7A 1VPOL 5I71B 4WY7L 3VH8A 3L3JA 4P0DA 1HIMH 3PGCB 4I4WA 2XTJE 3FFDA 4Y8DC 5ESVA 5LXGL 1IEHA 4HWBL 5AWNH 2ZOLB 3X17A 4JFDB 1ZKAA 4YQXH 5FYJH 3HFMH 3RNQB 1JHKH 2VDLH 1KC5L 1RHHA 2BVTA 3OV6A 4GRWF 1XR8B 2P5WA 4DGYL 2WP3O 3LB6C 3QIBB 1D6EB 3BKMH 1ZOXA 5DQJA 4LPCA 2I60L 4MWFA 2PYEB 2VITB 4KI5C 4LSVH 1TMCB 4P99A 1E6JH 5HYQA 3QFJD 2X4UB 3LKPB 3EOAA 3BHBA 4Q6IB 4GG6E 3GBNH 3QH3A 4FQXB 3U7AA 5HBBA 4O4YH 5D7JA 2YPLA 3O8XB 4TUKH 3QDJD 1LK3H 4XNMB 4LRNL 2ZUWA 3L7EA 4LCWE 2NY6B 5C0CB 3B3IB 2IQAA 3KJ6H 4KV5E 3WEXB 1KJVB 1MRCL 4NKMB 4KU1A 2W0FA 4HC1A 5CIPA 5J0BA 2ZUYA 2F53A 4JFDE 4PGJA 4N1CA 3L3HA 3RWFB 3UTTA 2UUDH 4KKCC 4OZ4B 4F3FB 3SDAC 1BD2B 4OZIB 3TBYA 4N5EC 5CKAA 4OFDA 3BD5A 4MDJA 1U8QB 4AK1A 4M4PA 2BNQB 2D2OA 3CJJA 3F62A 2PYEE 3HR5A 4U1HB 1R24A 2HRLA 3BE1L 4AL8H 1C5CH 2WUBH 1MCPH 1OARL 4HULB 4AT6A 2NY7H 3OPZL 5TGBB 1G9MC 1NFIB 5B39G 1A47A 2CLRA 3F7RA 3E3QC 4QRQB 5JLZA 3BZ4A 2Q76B 2OTWA 4XGZB 4RISH 3GHBH 5DUBA 1HHGB 4P2YA 1KYOJ 5FUOH 1GYAA 5IESH 4J3VA 5C0FB 4LSQH 4F7MB 4PJBF 4QOKB 4OM0H 5F6HJ 1U3JA 1ZVSA 3UC0H 5IQ9B 4FXGA 4YZFF 2R4RL 4BFEA 1BX2A 5C0CE 1JWUB 1CDUA 2BHYA 2ZWLT 3B9KB 4F33B 1OCWH 2YBRA 4LEOB 4JQXA 4NO2A 2QSCH 1YEKH 4HPOH 1D6VL 3CLEL 2NXZC 2A9MH 3GHEH 3PWPA 4UAOB 1QFUL 1P4BL 4QHNB 1AGBA 3TYFB 1VFMA 3DV6B 1JHLL 3QCVH 4ZTPL 4OZIE 4PRIA 4NN6C 3P30H 3WUWA 1NBVL 4QRRB 4CVUA 2UWEF 2BNQE 3RUGA 2O5YL 4XPGH 3SCMD 5IEKA 2D7NA 3MBEA 4HUXB 2H1PH 4YDJA 1HQRB 5C0IB 5JQ6H 1A6UL 1L9NA 1A21A 3IDGB 4BZYA 3IFPB 3MRNB 4P2RD 1L0QA 4OI7A 1G9NH 4EN3B 5GRYA 1BREA 1PD6A 1I8LA 3VE0A 4WO4A 3V0AC 1NDGB 3K74B 4QOKE 3MLUL 5F9JA 1MIEH 4JFPA 2Q8BH 4DAGH 32C2A 4OD2A 5ESQB 5JA9A 5EOCJ 3GMOA 3L5HA 1PX3A 2CKBL 3QUZD 2JB6A 2IF7A 3OB8A 2R2EB 4MA1B 2HT4C 4WENB 5HVWA 4H1LB 1MFBH 3R1GL 2VZ1A 1W0YT 1X5IA 1DP0A 2P4AB 1QRNE 2MCPH 4FZ8L 4QRRE 5CBAB 1D5MA 1XAUA 3AB0B 3EOBA 3ILQD 4P5TB 3HMXH 4M1GL 3SDAD 4JDVA 3MLZH 1G7PA 4ZFZA 2A1WL 4N5ED 4F7CA 2YD8A 4YDIH 5JR1H 4GFTB 1MHEA 1BFVL 2CXKA 4OFYD 3CSYB 5IMKA 5CZVL 3ET9F 4LBEB 3GMQA 4OTXL 5E9DA 1JUFB 1BJ8A 3GSVB 4QRPA 4JLRA 3TT1H 4MYWB 4GW1B 4MNQB 3ZDZE 3DWTA 3HAEH 1KN4H 3EFDH 1YNTB 1RU9L 3FO9B 1HKLH 5C6TH 4P2QD 2C1PA 3G9AB 3HZYA 3FB7A 5HPMB 4XNZC 4JPKL 3RI5F 1G9NC 3IFOB 4PJGB 5EZJB 5GGRY 1VFOA 4MA8H 1FZKA 4V1DD 4LOUD 5ENWA 3HZKA 3WNPA 2FATH 5EZIL 4ELMF 4XZUB 5D7SH 3W81A 5IROA 3DO7B 3VGGA 4XP6H 4IJ3C 3EDFA 4NRXA 3GI8L 4JDTH 1BQHB 1NLBL 3GSUA 1H3PH 4RFOH 5C1MB 2HFGL 1YPZA 3REVA 2J5LC 4BK5A 3LMJH 3AC0A 3CUPB 2H8PB 1MFAL 4KKLC 1F4WH 3PXHA 4UOW0 3V7AE 1XGRB 5FO7B 1Q9KB 4PJ7F 1T7YA 4M6AA 5K9KA 2BVQB 4U1JB 4M1CC 3SJVD 3T09A 3QUMH 5DXWA 2HG5B 5T1KB 1U92B 4ONOA 3O3DA 3H9SD 4JHAH 4GT7A 1FG2B 2C5DC 1XF3B 2CH8A 2QBWA 4LHUD 4TSAL 4DVBA 2YMXL 5KOVC 4X9IA 5ELIA 5FDYA 4I4WB 4PY7A 4X83A 4YHIA 1GPOH 3FFDB 2AGJH 1T1ZA 1XGQB 2EEDA 1ACZA 3U2SB 5FHBH 3S35X 3SGEI 1JNJA 1QA9A 4NJAL 5FGCB 4K8RL 3QEQD 4R90H 1YYLL 4GLRH 3QO1A 3HKFA 1T83C 5IHZA 2DQHL 3QJHA 3V5KB 1OAYL 2KBGA 5ISZD 2XZQH 2P5WB 4XCCH 5CAYB 1FNFA 3H3BC 3K8MA 4HWEL 5GS3A 1GVIA 2W0KA 4MWFB 2R2HA 2APBA 5DDHB 5CLTA 4N9OB 3DTXA 1HILA 4R0LB 1ORSB 3LEXA 2HKHH 3BHBB 4JPWL 1N6UA 3RWDA 4ETQA 2GTWB 3QHFL 1IGYA 1YUHB 5DRZB 4NZJA 2PW2B 3TLRA 3E0GA 3Q6GH 1DQQA 4U33A 2ZSWA 3Q5OA 3QH3B 3QWOB 4LHUG 2F15A 5IVXB 3RP1A 5D7JB 3T65B 4RAVA 3L7FA 1BLNA 2XYCA 3ARRA 3BN3B 1QSED 2VAJA 4XVTH 3TCLB 1TZHA 4A2MA 1WAAA 2IQAB 3QZWG 2DMBA 4OJFL 3G5YB 1JK8B 1X5FA 2W0FB 4KQ4H 1RZKL 1D5XA 2F8VA 3QUXB 4BQ9A 3DVIA 4MQXD 4ZQKA 4NHUA 5FGCE 4YGAB 3L3HB 1B88A 3ZT6A 3OL2A 3FT3A 3OB0H 4LARH 2E7CA 4UU9B 5ICXB 5J8OA 4P46D 4UILL 4HF5L 1DVFD 5DFTA 3ZE0E 2XZCH 1WIPA 3O3UN 2P5WE 4PS4L 3G6AA 5D2LB 5EU6B 3RVWC 2VXQL 2Q7NA 1OTUC 4OB5L 1R24B 5FKPB 1ZANH 2I27N 1U8MB 1EZVX 3H9ZA 4AT6B 2YN5A 3UO1L 2GUOB 1F4XL 3ZKMD 4LPWA 2P8LA 1VPOH 2MPAL 4Q58C 4PJ8D 4WY7H 4AY0A 4OLUL 5IVXE 3MLTB 4B7LA 5LXGH 3CFEB 3EYOA 4HWBH 5HGBA 3BPOB 3I6KB 2NX5A 3WXWL 43C9A 1BX2B 2AAVA 3GMMA 4M1CD 3PL6D 4U6TA 3WO3B 5FA4B 4HS8L 4Y5YB 1KC5H 5FYJE 2APVA 3AFLA 2K1MA 2Y72A 2NY1C 3MRIA 2YBRB 4ZMAT 4NO2B 4PRDA 4DGYH 1Z0NA 5JMOC 2I26N 4ZPVA 5T1LA 2L0DA 4FNLL 4L4VA 3G6JF 1SY6A 2F9BT 2H26A 2I60H 4NN7C 5FFLA 4GRWH 4JVPA 3HZVA 3QA3A 1AGBB 4ODTL 1MUJA 3P4MB 3U4BL 4PGEB 1C16A 5D2LE 5EU6E 5J12B 3PUCA 2F5AL 2R1YA 3MBEB 1FYHB 2KKQA 1CF8L 2V2XA 4LRNH 1KTLB 4GS7C 1JRHI 2EICA 3OKDA 4KVCL 4J3OC 3OAUL 1MRCH 3VFVA 3PF2A 4U1IB 4WO4B 2QADB 5FF6B 4YXLL 3U82B 1P2CA 1KSRA 3RX5A 4GJTB 5LVEA 4P4KC 2AP2A 2JLLA 4AIZA 1QR4A 1UJTA 3FQTA 4HX1A 4PRPD 5HGHA 5DVNA 5CWSB 3KPSD 1INDL 3GMOB 5FYLD 4MJIE 2G5BB 4HFWB 3HPJB 2Y5TB 3L9RA 2PCPA 3P2TA 4RNRB 3T2OA 1I85A 3HG1A 3D2UD 1JPST 1U8PA 3BE1H 3BP5A 1A6TA 2C3GA 2XY2A 1OARH 1KGCD 1AGFB 3OPZH 5AAMA 3ZHKA 3BQUD 1KLUA 4ETYA 5HYSG 1D5MB 3A67H 2CUIA 4QRUA 3DVFA 2CIIB 4JDVB 2VXVL 4X5LA 4NC0B 2OMBA 2F58L 2APTA 3P0YL 4JEGB 1A7OL 3UZQA 1GGUA 2BSTA 3LZFL 2R4RH 4LSPL 5E9DB 4QRPB 4U1MA 4JLRB 1HXYA 1E27B 3V2AR 3W5NA 8FABA 1FCGA 3MFFA 1ZA6B 3IJYB 2ZSVA 3EGSA 3LQMA 1FH5L 4YBQD 5D7KD 1AR2A 3V8OA 2NY0D 1D6VH 2IPUK 3CLEH 3RVVD 1D5ZA 3B9VA 4JPVL 4I0PB 2ESVA 3BIKA 1QFUH 4P2OA 1P4BH 1JHLH 2X7LA 4ZTPH 1REIA 1FGNL 3EUUA 5ENWB 3TZVA 3OJVC 1V8HA 1NBVH 2WBJA 5M7QA 1IGTA 2RFXB 3MCLL 4JQIL 2J8UE 2F8XC 5GPRA 2IH3B 4HMEA 2O5YH 3MQIA 3U0WL 4M61A 1YPZB 3REVB 2NY1D 5F7KC 1KEGL 1A6UH 1YEHL 1XF2B 2CRMA 1MCDA 4J4PA 4HKZA 2BSRA 2FZ3A 2VXTL 5SX4I 2WIMA 1RQ5A 1WC7B 2CUMA 1KCSL 5FYKD 4XXDA 4PJBA 3L3KB 4UV4L 1LWRA 3O3DB 2GW5A 3MLUH 4GKOA 5CP3H 5E9DE 3T77B 5LWYL 3GJFH 3OJMB 4DVBB 4QRPE 3JWOC 3S4SG 3MGTA 3VXNB 5K93A 3KR3L 1T3FA 3O6ML 4PY7B 3NGBB 5FKAA 1AD9A 2ERJC 2VWEC 2CKBH 4IOIA 1QA9B 3D39B 1CFQB 4DWHA 2P46B 3V6OA 5JXEA 3KAAA 2DLEA 3R1GH 4X7DC 4JG0L 5IJKA 1NCDL 2FECL 4Z7VB 4Y4KB 5IHZB 4GXVL 2FBJH 4FZ8H 3VDAA 4P4KD 5IB3A 4J3WA 4S1QL 2UWEA 4AEHL 5HHVL 4M1GH 3BPLB 4LNVA 1YMMB 1B90A 4D94A 1IT9L 2A1WH 2QJDA 4KDVA 2V2WA 2R2HB 2V17L 1YECL 2CDGA 2M2DA 4KGLA 1BFVH 1FBIL 1HHHB 3T3ME 1HILB 3DTXB 5CZVH 3LEXB 3GSQA 3WDHA 4OTXH 3CLFL 3RWDB 1CIUA 3DHMA 3QPQC 2ZSWB 2L4OA 1II4E 3MCKA 3SO3B 1QRKA 1RU9H 4RA3A 3VFSA 4RAVB 3ZTJH 5F1NA 4DZBB 4KI5F 3CX5K 4JFEB 1ES0A 5C71A 4JPKH 3MV9B 3EZJB 5FCSH 1OSZA 1S5IL 4GRMA 2A6IB 4IS6B 2GJ6B 3LHPL 4CU7A 4H8WC 3CH8A 1EIBA 1D5XB 5EZIH 4CN4A 4ZQKB 3UP1A 3D39E 4H0HB 3GI8H 3P4NA 4M6ML 1XGUA 1UKTA 1EO7A 1T1XB 1NLBH 2F54D 3FT3B 3QDMB 4L9DA 3PQYD 4YO0A 2HFGH 5EOQL 3BYTA 3U48A 1DE4A 4Z7VE 3ARFA 1MFAH 2ZUSA 2LU3A 3LRSA 2NY4D 1A5FL 1YMME 3FL7A 3O45A 5DRWA 2OJEA 2UYLB 4OLVL 1QPXA 3C5ZD 3S34L 5C0BB 5JO5B 3R8QA 4TSAH 1X7QB 1KIRB 2YMXH 3VGDA 2P8LB 3CU7A 3QIUD 3F12A 5E2VL 3O9WA 3HC4L 4HGWA 3VXUD 1LE5A 5ALCL 4I5BA 1R3LA 1CFVL 4LSSL 1CTOA 3F7YB 1W8OA 3EYOB 3NIFF 5EB9A 5HGBB 2FX8L 2LU4A 4JFEE 2DIJA 4NJAH 1YEGL 4K8RH 2X10A 3MV9E 2NX5B 3WHXB 5D71L 3G6DL 4ZOBA 3GMMB 4YHNB 1YYLH 4KRPD 2GJ6E 1TQBC 1S7RA 2DQHH 2I24N 3RZCA 4X8JA 5DJ6A 1OAYH 4M1DL 1ZLSL 4L4TA 5IUSA 4Z78B 1E0OB 1ZEAL 3G5XA 3QDME 5FYKU 1RURL 4HWEH 2H26B 5CZXC 2A6DA 2PETA 4W70A 3NPSB 3QA3B 3QEHA 3GMLA 3QXAB 1WUNT 5E7FA 4HAFA 1WBZB 1KTKE 1C16B 4JPWH 3NIDE 4PJ7A 5IW1A 3QHFH 1AFVL 2Y06L 1HQ4B 1SEQL 2IANB 1MEXL 1W2KT 1EVTC 4PJDA 4I3GA 4G6JL 4ODBD 4ODXA 5C0BE 4WW1A 3PP4L 1WWAX 2BVEA 3OKDB 3UDWA 1HWGB 2PNDA 4OJFH 2YRZA 2OZ4L 3WYRA 1RZKH 3LQZA 4QTIL 4ZUVB 3THML 3AXLA 2NX5E 3MRHB 5CJXC 5BZWA 4HX1B 1E4WL 5HGHB 3VI3E 4UILH 3FRPG 4HF5H 4L3EA 4FN0A 4IIQC 4GRWB 4O2CA 1KV3A 3NPZB 1NLDL 1NFDA 4HKJA 4GMSL 4PS4H 2VXQH 2W91A 3W0WA 3HG1B 1WCBB 2FX9L 3RDTA 3QDHA 4I18C 2VLJD 4OB5H 1U8PB 2EYTA 4OF5A 1N59A 1QHPA 5EU3A 4C54A 4GUPB 3NFNB 2WNGA 3UO1H 3ZKXC 1F4XH 2GCYB 5DZLA 1KLUB 3ZDYE 1I3GL 2MPAH 1IE5A 4OLUH 1EGJL 3MLRL 2AK4A 4QRUB 2IANE 1RZGA 3EYVA 2ATKA 2IALB 3BUYA 5EC1A 4BH7A 2XG5A 5JIKA 1SMAA 4DKDC 5F7NC 3UPAA 3ZKSD 3WXWH 4PRAA 2ED8A 3QYCA 4ZUUA 1A4JA 4NWTL 5ABDE 2JKXA 2AV1A 1HXYB 3LKNB 1NEUA 1QLRA 4HS8H 8FABB 1YY8B 3MFFB 3BGFC 2CIKB 4U6XA 5C07D 1S9WA 3BT2H 1NBYA 3WE6A 3HCVA 4LPTA 4TVSa 2EIBA 4FNLH 3AGVA 4WUUA 1N5AA 5D96C 1AO7A 3BIKB 4P2OB 1D9KA 4ODTH 2X7LB 1CICA 4GRWE 1NGQL 3U4BH 4M9OA 4M6NL 2P8PA 4QY8A 4RGND 3BWUC 4A6YL 2E27L 1IGTB 1RPQA 3VFRB 4P57A 2F5AH 2MHAA 4LPXA 1XEDA 3EFFA 2A83A 3U36A 3RTQD 4OI8A 3RGVB 2EDRA 2AXHA 3VGFA 4P5MB 1RUML 4NC2B 1CF8H 1NAMA 5DQ9A 3PNWB 3BXNB 1LO0L 2BSRB 2FZ3B 4LL9A 1D5BA 4KVCH 4HK3J 1UADC 3OAUH 3IT8D 5HHME 3HE6C 4Y5XB 1PG7L 3WN5C 2BNRD 1MHHA 5EPMB 3VA2C 3WD5L 3LKOA 5JOPD 4XXDB 4YXLH 2OJZL 3TIEB 1EO5A 5FV1L 5D2NA 1RIVL 1T2QL 3DROB 3MGTB 4XWGL 1P53A 4QHMA 4AM0A 1P7HL 1IAIM 3SBWC 1HXMA 1KCKA 4L8CB 3ARGC 2NMSA 3QXVA 1INDH 4U6YA 4CMHC 4DEPB 1AD9B 3T0EA 1SM3L 3VFNB 2RAMA 4R2GC 1FVDB 3W9DA 2LU7A 4IOIB 2J6EA 4XH2A 1UEYA 3G6JA 2E7LA 1KENL 2DJUA 1P7KA 4OZFH 2VQ1A 3L95A 3TYGL 3TIDB 2DIBA 4JRWA 5IB3B 4O58L 5B8CA 3QRGL 3S8WA 4HH8A 3SGJC 2WWMD 4KDWA 1FZMB 1FORL 3GJEA 1ZT4A 2VXVH 2QHLA 2V2WB 2F58H 3P0YH 1A7OH 3SE9L 1PEWA 3GSQB 2KDGA 3LZFH 4LSPH 4ZO8A 2IGFL 1NFKA 5L8LB 1MCHA 1OW0A 1FO0L 1P84K 1JNHA 3RX7A 4PJ5B 3LDBC 3RY5A 5I18L 4Z76A 5EZLB 3PGDA 1FH5H 3R8BB 2UV3A 5F1NB 2X40A 4YZFE 4E41E 4ZSOB 1HCVA 2CKBB 5KSAC 4JPVH 4BK4A 4U1KA 3KLHD 3R4DA 1HH6A 3CFBB 1WLHA 4JFZL 3MZGB 2MSPA 4XBGB 1FGNH 1QHOA 5D1ZC 2ICEA 2PW1A 3RBSA 4D8PA 3ZE1F 3C5JA 2VZOA 3MCLH 4JQIH 1XGUB 1AQDB 1K8IB 5GQBA 3G04B 3U0WH 2EZ0D 3BW9A 4U0QB 1EV2E 1DE4B 1KEGH 4OCWL 3ARFB 3MUZ1 4HIIA 1YEHH 5BVPL 1G1YA 1A2YA 4N90D 3LRSB 2ATPB 1HHJB 4FMKA 2VXTH 5LG1A 5F97E 1MHCB 4WI2A 3TVMB 2VLKB 3N50A 3RWGA 3VD5A 4CNIA 1KCSH 5DRWB 3HE7A 2OJEB 1OM3L 1IBGL 4UV4H 1EERB 3DV4A 1K8DB 2FWOB 4JREB 5LWYH 5B39A 3QDJA 3O3AB 4ZFOA 4B5EA 5DURB 1A14L 3FAXA 1CD1A 2LTQC 3F12B 3O9WB 3KR3H 4HGWB 4PJ5E 1CYGA 3O6MH 1LE5B 1S7WA 1R3LB 3B9EA 4MX7B 3DYOA 1L9MA 3HR6A 4CN6A 4WTWA 4ZSOE 1UWGL 1LHZA 1FLRL 4JY4A 1S7XB 4Y1AB 4JG0H 1NCDH 1K3IA 2E7HA 1FNEA 2CRYA 4HCRA 4GXVH 4ELMB 3UMTA 3RZCB 5DJ6B 4S1QH 4QRSA 4AEHH 5HHVH 1NDMA 3G5XB 4CKVX 1UXWA 1RZFL 2YHGA 1IT9H 3VGAC 2V17H 3C8KA 1NGXB 1YECH 1WWCA 1FBIH 4LRIC 1OTTD 5GRVK 2VL4A 4PJ7B 3CLFH 3ZYZA 5IMMA 4M8QA 4JY6B 1S7TB 3NCYP 2VLKE 2YD1A 3ILPB 1GOHA 3N06B 4MMZC 3K4DA 3FQXB 3H8NA 1ZA3A 2APFA 1Q38A 2YUXA 1CQYA 1A9BA 2PO6C 4ODXB 1BECA 1FAKT 3DVGA 4WW1B 5CZKA 3C87A 3HN3A 3MRRA 1PY4A 3B83A 1S5IH 4NRZA 3LHPH 1TVDA 5FYKL 5FECB 4UIKL 1CIDA 2XWBA 3LQZB 5BV7B 1TZIA 2BVOA 2EE3A 5DFWH 4M6MH 4M7ZC 5FO8B 4BFIB 1A1OA 2VLRD 3NVQA 4Y1AE 3RWJA 5EOQH 4WEBL 3KHQA 3EJZD 4ELME 3QJFA 1U8IB 2C4FT 2IMMA 4FP8L 3NAAL 1A5FH 1AKJA 1A7PL 3RDTB 2HN7A 1NH6A 2X1QA 4OLVH 2CDFA 2VSCA 2HJFB 5EU3B 3RNKB 1MH5B 3S34H 4NGHL 2NYYD 3GSWB 3C60D 3BDYL 3ARBC 5E2VH 1T80A 1N4XL 1RZGB 2MQ3A 3EYVB 2ATKB 3HC4H 4KKBC 3BUYB 4P2RA 2HLAA 5ALCH 4BH7B 4LSSH 1CFVH 1IQDA 2FX8H 2F74A 4UT7L 1DDHA 3IF1B 3VFWA 2JB5L 4PJFF 1YEGH 3B9AA 3KPRA 5D71H 1KN2L 3G6DH 1NANH 1A4JB 1IZKA 3F5WA 5J3HD 5EO9A 1ETZB 1QFWL 2NY3B 1ZLSH 4M1DH 3N9GL 1NBYB 2E5EA 1U95A 3HCVB 1FFNA 4N0YL 1ZEAH 4JPIA 1RURH 1OWWA 4WUUB 3N1GC 4HLZG 4NJ9L 2MQ0A 3BFOA 1D9KB 4ODUA 5F72S 1EJOL 35C8L 4G6AC 2Q3ZA 1CICB 4HMCA 2P8PB 3MROA 5D5MF 4LLDA 2DWEA 1AFVH 1OGAE 4PRHD 2Y06H 3VXMB 4TYUA 4P57B 1SEQH 1MEXH 1LMKA 5J13C 3EFFB 2A83B 3U36B 4XP1L 2V7NB 3SDAA 3O3BB 4G6JH 3GRWL 1VFBA 5IFHL 5HYJA 4PJCF 3PP4H 3OF6A 2ZCLL 4I3SL 2IBBA 3OBAA 3HRPA 1FFPA 3QNZA 2OZ4H 1UT9A 1MHHB 3DARA 1C1EL 3LKOB 4QTIH 2VISA 2Z8WC 3P4LA 4JN1L 1EFXA 3THMH 2APXA 3CFJB 4BQ6A 3OKOA 4P2QA 5D2NB 1E4WH 2PN5A 1BF2A 4QHMB 4RMSA 1XF1A 3D0VA 4V1DA 1NLDH 5E08L 3OKLA 5IVNA 3W9DB 2AXFB 4C56B 4GMSH 4XH2B 2VYRE 3SDDD 3G6JB 1N64L 3IS0X 4LK4A 2FX9H 1XGTB 1OB1B 4XVJL 3VFTA 1P7KB 4FFWC 2GT9B 2VLMD 4X6CB 1NMCC 4Q0XL 5E03A 4HXBL 3WS6C 5I1AA 1WZLA 2CR6A 1I3GH 1ND0A 3MUGA 1PGRB 3VXME 1EGJH 3G08A 3MLRH 4ZS7L 2BZDA 2X1XR 2OSLA 5BS0A 4PJXF 2A6JA 4Z5RA 1W72L 3LS5L 3DECA 3SJVA 4U05A 4JFFD 2OR8A 1DQJA 1QLFB 2OXGA 2EDKA 4NWTH 3TF7C 4LHUA 3QUYB 1X9QA 2Q1EA 1JNHB 4TTGA 3CD4A 4ESKA 5H2BA 1WITA 3ALWA 1PJ9A 3ARBD 4BQBA 1Z9SA 1DSFL 4KKBD 1IM9A 1HH6B 3U46B 1LK2A 1WTLA 3O41A 3UYPA 5CGMA 3ROLA 3QZWA 1V3LA 4JJHA 5DA4A 4JRYE 3TJEL 2PW1B 1NGQH 4M6NH 4C56E 4D8PB 4ZOCA 4A6YH 1WZKA 2E27H 1T0MB 4OZFB 4AQ1B 3G6JE 1U8OA 3C5JB 2ORBL 1WGOA 2QR0A 2VDRL 5IFJA 3TPUA 5ISZA 3MJ6A 5EUOE 4U1NB 4PJEF 1AJ7L 1RK0B 3T0XA 4X6CE 3GM8A 3AU1B 1RUMH 3VGEA 4HIIB 3TPKA 4Y19D 3P11L 5EUKB 3FHQA 1A2YB 1YDPA 4GAYA 1LO0H 4MJ6B 2DYPD 2FHBA 1G0XA 3QFJB 4GG8B 5A2JH 4P3CL 1JV5B 4PD4J 1PG7H 4JM2D 4G6AD 1A3RL 5ERWA 3WD5H 1D7FA 4PPTA 4LVOB 2OJZH 3GNML 2FLBT 5B39B 2QTEA 3QDJB 1RIVH 4ZFOB 1T2QH 5TF0A 1CD8A 4XWGH 3ARTA 1CD1B 1VCAA 5IBLD 1Q1JL 1SM3H 5K9OB 1EJ6A 4R4BA 1F2QA 4LLYA 4GKZB 5KG9A 3S96B 5GGQL 5EU7E 1L4IA 3RVUC 1KENH 2MKLC 4LCIL 5DQDL 2WANA 4C4KT 3LY6A 3MRDA 1VA9A 1FNEB 2R39A 4RRPG 3KPNA 3FCTA 4EDXB 1KYOK 3TYGH 4FABL 5C0AA 1AC6A 4QXUL 5GGRB 4O58H 3QRGH 1B6DA 1NDMB 4MLSA 5E6YA 2Q87A 1P5VA 3X3GL 4E9LA 1FORH 4DJMA 4O51A 2XZAL 2DQIL 3C8KB 4POZC 1RV6X 1T1WA 3LEYL 1FV1A 4PV9B 3SE9H 5D1XC 4G8FB 3BEWA 3DMMD 4ACPA 3MRBA 2IGFH 4M8QB 3QFJE 3BO8B 1FO0H 1OP5K 5I1KL 5I18H 4TQEL 2ZZUT 2QQLL 1A9BB 2YOCA 3HI5L 2NY5L 2VAAA 4UDTB 4K94L 3JBG7 1T0PB 3EKCA 2I07A 4JFZH 1J9CT 3QXUA 3WFDL 2RHEA 3R0NA 3JWDC 3F7QA 1IKNC 4J3TA 1BZ7B 5EO1A 4O2FB 2BVOB 5DJ0A 3MV8A 1AHWC 4LSUL 3WFHA 4BZ1L 1MQKL 4OCWH 5EH1A 2GFBA 1PFCA 1RJCA 3D85D 3QJFB 4MAYD 4OLYL 5BVPH 3I3EA 5HHNA 4KKAC 3WFBL 1RD6A 5DMJB 4NIKB 2MWCA 2HN7B 2D3VA 2OL3A 1XGPA 4K07A 1OM3H 1IBGH 3Q48A 2YKLL 3MXWL 2CDFB 1T83A 2XY1A 3TN0C 4KJYB 2VERN 3SCMB 5HI4C 2E6JA 4GMTL 5HYSA 1A14H 1NBZB 3ULSB 2GITA 4P2RB 2HLAB 4LCCC 2DQUL 2ZNXA 4J6RL 1JZ5A 1DDHB 3VFWB 1NCWL 3MO1A 1URLA 1UWGH 3KYNB 1FLRH 1I9RL 1UM5L 5GGTA 1RK1A 5C0ND 1NKOA 4TTDD 3F5WB 2Y36L 4XRCB 1ZTXL 3WXVL 1YN7B 2RQ8A 3W5MA 4NM8L 3KPSA 1BVKA 3QUZB 1ZGLP 1FFNB 2QKIA 1RZFH 2PKDA 3SDXF 5DJ8A 1AR1C 4UNVA 3LN4A 1MHPL 4FFZL 5DVMA 3JWNC 4NKDA 2EDXA 5KVDL 4UIMB 2DWEB 3RVUD 5ACZB 5TE6L 4JDZA 4HGKC 3IU3A 4OQTA 4ISVA 4ZFFA 1ONQA 4TNWK 4CDHA 1JMZA 4K3GA 4KUCD 3SDAB 2NW3A 4X4YA 1KIUA 2FHCA 3PIQB 1MLCA 3SGDH 1U3HC 1HSAA 4P2RE 2ADJB 2DIAA 3QNZB 5FYKH 1G6RL 4UIKH 2IBZX 3N1QC 3K8KA 3SDCC 5I1DB 3P9LA 5CCKL 1A4KB 1MCWM 3OKOB 4KKNA 4P2QB 3S4SA 1I7TB 4EI5D 2K9UA 4WEBH 3GIZL 3PE9A 3KJ4B 2EDJA 1A6ZB 1HSBA 4V1DB 3MRKB 2BY1A 4FP8H 3NAAH 2Z91B 5DFVC 3D0LA 4BKLA 2J4WL 1M05A 4UQ2B 4TUJB 3CXHJ 1A7PH 1TQCC 4LEXL 5GZNC 4U1GC 3WHE1 2NR6D 1MVFA 4NGHH 4WEUD 5I1AB 4OKVA 3NTCL 2A74B 1ND0B 3BDYH 4FG6C 4XT1C 3ZZ1A 1N4XH 5IB5B 2OSLB 5FUZL 5T3ZD 3Q5TA 4Z5RB 1BQLL 1BOYA 1IAII 5JA8B 4UT7H 3SJVB 4OF0A 4FFVC 2JB5H 3H0TA 3I2CL 4OCNC 2F5BL 1DQJB 4NN6B 1KN2H 5F7DB 2Y6SD 2RCSL 3H9SB 3QPXL 4LHUB 4UZGA 1RZJC 4Y16D 3NIFE 3TN0D 1U8KB 4Q7DA 1QFWH 1I1YA 5ID1B 5HI4D 1N26A 3T2QA 1KXQE 3N9GH 5C0EA 4P49A 5H2BB 5IIEA 4DCQB 4N0YH 1UFUA 4P2QE 5DTFB 4ZG1A 3IXAB 4AIOA 2ZP0T 4NJ9H 3QEQB 3O41B 3QZWB 4XNYL 1EJOH 35C8H 4HH9A 2ED7A 3RVXC 5L2KA 1S7SA 3VRIA 4WDIA 2XNAA 2EDQA 4RMRA 3JV5A 4P4KA 1JF6A 5ISZB 2B39A 4LMQE 4XP1H 2W60A 5TF1L 5DZNA 3S5LG 3GRWH 3IJSB 3JV4A 3SO5A 3V5DB 1P9MC 4U0RC 4Q2ZA 2AJYL 5EOTA 2PYFB 5A1AA 2ZCLH 4L8BA 1IMHC 3VXTA 4I3SH 4K71B 4FTVA 3RIFF 1AR1D 4I8DA 3BH9B 1C1EH 5GSVA 4HQQL 1TLKA 5JNYA 4JN1H 4PJFA 3IFLL 3L5WB 1QZ1A 3T2PA 1IC1A 1SMOA 3H9SE 2JCCE 5I1GL 3M8OL 1QSEB 4Z7UF 1VHPA 1Y6MR 1FIGL 5KSBF 2EH8L 4JVUA 1U41A 4R4BB 5E08H 4J1UA 1MCCA 4WHYG 1HNGA 4OCXL 5KG9B 1N64H 5EIIB 1U3HD 2R9HC 3QEQE 4XVJH 4B7IA 3FFCA 5I66A 3KPNB 3FCTB 4Q0XH 5FDWA 1J0ZA 4HXBH 4FQCL 5D5MA 4P46B 2ICWA 1DVFB 4ZDHB 4DZ8A 4ZS7H 5CP7A 5ISZE 1PKQB 4GRLD 5BXFA 5I9QC 2HVJA 5T1MA 1W72H 3LS5H 2X4PA 5GHWL 3WL9A 1T1WB 1FGVL 4PJCA 3HUJF 2EEBA 4RGMC 3GSXB 3BKCL 4QXWA 2B0SL 5TE4L 1EEZA 1CGUA 2J88L 3QNXA 4PJ8B 3DX9A 3FT4B 4OSUL 5KSUA 4WEMB 3T2NL 2VAAB 4WHTA 2P24A 3RL1A 4HS3B 1DSFH 1MVUA 3MA7A 1U93B 1QSEE 1WWWX 3WSQL 3WBDA 4S10A 3L5IA 3TJEH 3PL6B 4Z7OF 1UVQB 5EO1B 2AJUL 3WIIL 2JJUA 5HYEA 2ZKHL 2ADIA 2VDRH 5GISL 1SBSL 1AY1L 1H3WM 4J8RB 3MLWL 1AJ7H 3PV7A 3FRPA 1OTSD 3VWKD 4C57C 2HTKD 2GFBB 4RBPK 3P11H 5HHNB 3VJ6A 2BY0A 1U8JA 2DD8L 2NPLX 2IAMC 5KZCD 3B9DA 1PKQE 3JUZA 3LVEA 4P3CH 3FB8B 1A3RH 1XGPB 4KI1A 5FXCH 3GNMH 2VXUL 3GSNL 2G5RA 5HYSB 3KPPA 2PUQT 1X5XA 3KPTA 2GITB 4I0KA 4PBWD 3UTSA 2NQCA 5SX4H 1Q1JH 5E94A 4WWID 1IZJA 4X8XA 5FGBC 1BPVA 1S9VA 4YBLB 3CC5B 2A9NL 5GGQH 3VFOB 3PWJB 1RK1B 4LCIH 1UJ3C 5DQDH 1ZLVH 4Y4FC 2V5SA 3LS4L 4F2MA 1GGYA 1U91A 2PTUA 1JI1A 4PRPB 5INDB 1UCTA 4PJAF 4FABH 5B21A 4XVSL 4QXUH 2LAAA 3KPSB 1SJXA 1LO3L 3SE4C 1MRFL 4HUKB 1JBJA 1CFNA 3X3GH 3RJQB 2G75A 3NZHL 3O6FC 2XZAH 2DQIH 1TENA 3U9PL 3D2UB 4DN3L 3LEYH 2VLJA 3LN4B 1MFNA 3WJJC 4NKDB 2FH8A 3RAJL 2R9HD 3I3BA 3AS1A 4X6DF 3BQUB 5I1KH 1M71B 4IOSD 4ISVB 4QKXB 4TQEH 5F7FA 4Z7WF 1ONQB 4ZFFB 2QQLH 3M1BA 4X4YB 3PWUB 4J3UA 3HI5H 2NY5H 4K94H 2R8SL 5IGXL 5DF0A 3RWIA 1MLCB 1ZE3C 2Q6WA 1AE6L 3WFDH 1FFOA 2ENYA 5JW4Q 1K9TA 2YUVA 3L3DA 2P5ED 2FDBP 1DUYA 1JIBA 5IM7B 5T5FL 5CGYD 1VFAA 1JF1A 4LSUH 4BZ1H 3Q3GB 3NZ8A 2NY0B 3BMWA 5EDXA 1O7SA 1MQKH 4PRPE 1HK6A 4OLYH 3BDXA 1HSBB 2Z93A 5FYLE 3S3JA 3ALXA 4BKLB 5GS0C 3WFBH 1HINL 1M05B 1FL3A 1IAKB 2YKLH 3MXWH 1A9EA 3V6ZA 5H94A 4LDLB 2CGRL 1FL6A 2NY1B 1KGCE 4GMTH 4OKVB 1WICA 4V2CB 4NQEE 4TNVF 5GXBB 4ZAKC 5E7BA 1EPFA 1J05A 2DQUH 3D3VA 4J6RH 4LDOB 3X12B 3U9UA 1NCWH 4HIHB 1FNHA 1I9RH 1UM5H 2YUZA 4FQ1L 1R5VA 1MCKA 4FQPA 5I1HL 3IRZA 3NH7L 2Y36H 3QDGD 1ZTXH 4HKXA 3VRLF 2ILLA 3WXVH 5E5MA 4NM8H 2MMXA 5C0EB 3OGCA 5IIEB 5TPWL 4DTGL 3VWJD 3CH1A 3FO1A 2H6PA 5D7KE 1JGVL 2XKUA 1ITBB 3OR6A 3QQNA 1T2JA 4MDIA 3X14A 4MD5A 1MHPH 4FFZH 3FONB 3WO4B 2R69L 3DLQR 2V2TA 3DRTA 5DJ2A 3QQ9C 5D6CA 4WI4A 3X13B 3OR7B 5KVDH 1OSPL 3VRIB 4WDIB 5TE6H 2IWGA 4HHAA 4P4KB 2BOCA 5CJXA 5DJDA 3MUJA 3OKMB 4JFQA 3U4AA 4ZFGL 1CL7I 5I17B 1RJLB 3WV0A 2W60B 4NO3B 2Y07L 5DRXA 3JV4B 5HI5C 3FRUA 2OTUA 3AS3A 4IIQA 4G9DB 4L8BB 4BFBD 4G7YL 1A1NA 1G6RH 2DLIA 4I18A 1XF5A 1CTNA 5CEXB 5JNYB 3U83A 4D0CB 4PJFB 5FYKE 1TETL 5CCKH 3BSZL 4WV1B 3GIZH 4PBXA 4EXKA 2HTLC 4IDJL 4L9LB 3O2VL 2X1OA 1B0GB 5DI8A 2J4WH 4KZDL 1CGWA 4JFXA 4NYLA 5H35A 3D6GA 1JPGA 4LEXH 4MD4A 5DD0L 4F9PC 5I66B 3PQYB 2P7TB 5FDWB 3VH8G 4NQXA 5D5MB 2YPLD 2YRPA 3NTCH 3AAZB 2OK0L 2ZOKB 5A40E 1ZS8B 3MC0A 5CP7B 1J86A 5FUZH 4ZUSB 5BXFB 1BQLH 5T1MB 3RRQA 2X4PB 3I2CH 5GS0D 4PJCB 2F5BH 5SWQA 4CU8A 1F6LL 2F53D 3C5ZB 4KUCF 1T66C 2RCSH 4ONHA 3QPXH 4XWOC 4S2SB 1JZ7A 3MMEB 1EEZB 3UTTD 2P47B 1IGML 3QIUB 3MTRA 2VJXA 3STLB 1UWXK 4PJFE 3WIFA 3VXUB 1OLZA 5T1DL 3OXSA 1FPTL 3QO0B 4FXKA 4HK0B 4WHTB 2V6HA 2IPUG 1MVUB 3MA7B 4XVUD 4ZAKD 4XNYH 3HE6A 5GJSL 3WN5A 4KRPB 4JVWA 3TGXA 1Z3GL 2OXHA 5A43C 4LGRB 2W92A 2ADIB 4M5YH 3GSRB 3U7WL 5FM5M 4ODHL 4LVNC 5J1TC 2IH1A 3TP4A 4OAWA 1I8IA 2UZIL 4NNYB 5ITFA 5EBLA 2F54E 5TF1H 1G7JB 3PQYE 3SBWA 3ARGA 3EYQC 4TVPL 4YHKH 3MYZA 2QV2A 4DKFL 2OI9C 2AJYH 2YZ8A 1A6VH 4N5UA 4PJXB 4X5XB 2H32H 5IHBA 4HQQH 4MLIA 3IFLH 3DX8A 5D9SA 4PJCE 5D7LD 2DTML 3FN3A 5I76A 3MRLA 5I1GH 3M8OH 2R2BB 4M62L 1H15A 3SGJA 5T3ZL 1FIGH 1FJ1B 1HOCB 3PWPD 3NCYS 5HHQA 2EH8H 5E94B 3G5VA 3VXUE 1LO5B 2OM5A 5J4MA 3DX6B 4PRID 4OCXH 5J9PB 1OWRM 2EXYD 4F2MB 1CR9L 3L6FA 2R2CA 3L3GB 2W1NA 4FQCH 1F3JA 3GI9L 1EAJA 1ZHKB 5HDOA 4M5ZL 1NGYA 1IARB 2H9GA 5L8KB 5KSAA 4C59B 4PJEB 3MUHL 4GXUM 2G75B 3OAYH 1G1CA 2E9IA 5GHWH 4H26A 3OB0K 2VLJB 2AERT 1FGVH 5D1ZA 3OJDB 5MEQA 1EXUA 2YSSA 1HYSD 4PJXE 2B0SH 5TE4H 5JW3L 2J88H 5I75C 3LD8C 4OSUH 4IRSC 2R29L 4XPHL 2XA3A 3T2NH 1SJEB 4KDTC 4X7TA 4XTRD 4IMKC 2X4NA 4HDIB 1H8OA 4Z7UA 3WSQH 5KSBA 2DM7A 4XB8A 2UY6A 2ZUQB 3ME0A 2VL5B 2AJUH 3WIIH 2C3VA 4GKSA 4R4ND 3SQOL 4KHXL 1DUYB 1FVEA 3D1MC 1GOGA 4AJ0A 2ZKHH 1UEMA 1VFAB 1SBSH 5GISH 3UTZA 1AY1H 4L5FL 1IL1A 4UBDD 4XWOD 5FA3B 3B4NA 3MLWH 2H2SC 3WKML 4I48B 3V79C 3AY4C 5C0JA 4NDMB 1U36A 4HW6A 1OAKL 4K3HA 4DGIL 2Z93B 3KXFE 2ARJQ 2GSIA 2DD8H 1JYXA 4PJEE 3C6LC 4RGNB 1A6AB 1FC1A 2G9HA 4PRHA 4M93B 4YBHA 1FL3B 3V6ZB 5H94B 3H7LA 3HUJA 2VXUH 1XF4B 2MFNA 3OXRA 3RTQB 1CD0A 3GSNH 4H25A 4F8TA 3WDJA 5B4MC 5DD3L 4NNXA 3MNZA 3IKCB 1LE9A 3DRQA 3DXAA 4G8IA 3U9UB 2XQYG 2BNRB 1HDMA 4LRIA 2A9NH 5EORL 3QQ3A 3RWCB 4PLKC 4OV6F 1IAOA 2FO4A 4YK4C 4OQ1A 1JYWA 1R5VB 3LS4H 3CDFA 5IVOA 1UH2A 3BH8A 3DI3B 4HKXB 1I7UA 5F7LB 4XVSH 5EOCL 2DMCA 4UUJA 4G8GA 1LO3H 2PO6A 3HC3L 1MRFH 5C07E 4LVHC 1JGLL 4MNHA 1W0VB 1C08A 1SHMA 4PIRF 2H6PB 1G84A 1SJHA 4OZHA 3NZHH 1GZPA 4PJHB 4G9FA 2PTTB 3MNVA 3U9PH 5DK0A 1K3ZA 3X14B 4DN3H 5EU5A 4MD5B 5I8CA 2D7TL 5C0DA 5J1SC 3RY4A 2V2TB 4BQ8A 1I9JL 1I3VA 3RIAF 2DM2A 3RAJH 4HHAB 4RGNE 1EFQA 2BOCB 4EQ2A 1GC1L 1NC4D 1C5DA 5HJ3B 5SX5H 1JFQL 4UQ3A 4QRTB 5DRXB 2BY2A 2OTUB 4IIQB 2R8SH 4NP4L 5IGXH 2D7PA 3QULB 4YHML 1HYRC 4JFFA 5J57B 4JB9L 3FQUA 4JKPL 1AE6H 1KTDA 4I18B 3WUZA 1LILA 2BNRE 5T5FH 4O5LL 3I6LD 4Z6AT 1CVRA 5JOPE 4W4OC 1FZJA 3IS1X 3ARBA 4ZYKA 2DLHA 3FB6B 4R96A 2A77L 3UTQB 3VXQA 4LNRA 2GTZA 4QTHA 5DI8B 1HINH 4TRPL 4JFXB 2EYSA 3CDGA 4WGVB 5H35B 4PJHE 3SDXB 4XCEB 4MD4B 1B3JA 4RRPA 1QEWA 4FQLL 1SVCP 2CGRH 4QHKI 3U0PA 1MCRA 1NUNB 3BGFB 3ULUD 3HPLA 1BHGA 3QIWC 2H2SD 2E9JA 3OX8A 1OP3H 4Z7WA 4BSVB 4JGMA 5D96B 3FOLA 1ORQA 5HY9B 3EHBC 1ZHBA 4HUUB 3MV11 4FQ1H 1LEGA 1PLGL 5DMIL 5GRXG 4LCYA 3MJ9L 5I1HH 3NH7H 3MYJB 4AEEA 2OQJA 2R1WB 4N1EA 1JGEB 5FIEA 3WIFB 5ANMA 3C9NB 2FGZA 3OXSB 5DC9B 4FXKB 5TPWH 3CFCL 4DTGH 2EYRB 1ADQA 4GOSA 2PXYC 4POYA 1EHLL 1BBJA 1JGVH 3QHZL 1T5XB 5HVHC 5KBNC 3IKKA 5LGHL 4KMLB 1MWAA 5BRZD 2JJVA 3U30C 3AMLA 5F1IA 2Z92A 4XNQB 2R69H 3LN9A 4PLKD 1OSPH 1F45A 4XCFL 4M8VA 4YPGA 1JCKA 4NKOA 3OMZA 1CDCA 2IH1B 3SDXE 1CLZL 1RFDL 5ALBL 5DSCA 4RAUA 4ZFGH 1MAJA 2P1YA 5EBLB 4LSRL 4P23C 1NEZB 5IF0A 2Y07H 1R3HA 1RJZB 3MLSL 4CMHB 3BOVA 3WLBA 3S88L 4MJ5B 4N90E 1VB9A 4G7YH 4JZOA 4EUPG 3R0MA 5GGUA 3CVHA 4RSVA 1CGTA 4H20L 4WWKC 1XCTA 2ADFL 2DL2A 1G0YR 2PR4L 1TETH 5D9SB 4ZXBC 2X09A 3O3EA 3WS6A 5I76B 3DUSA 3MRLB 3KNBA 2KZWA 3BSZH 4JJ5A 1S3KL 1CGXA 2FSEB 5T1LD 2Q86A 4L4VD 1H15B 2B5IC 4IDJH 5HHQB 3KPOB 4HIJA 2Z4QA 3O2VH 4KZDH 3DX7A 2QHRL 4W6YB 1EAPA 1MRDL 3MV7D 3GMRA 3DVNA 3MACL 5DD0H 5BJTA 2JTDA 2VLRB 3L6FB 3UYRL 4ZO7A 4DOHE 2IADB 3LDBB 3ROOB 5LAXA 4RX4A 1HHIB 3TBWA 2OK0H 4IHOA 1NGYB 2H9GB 4ZS6C 3VXSD 1M1SA 2NTSP 1P5UA 1BEYL 1QFHA 2DF3A 3HA0A 5EG6C 4CUCA 2V9RA 1XMWA 4C83A 5L8JB 3WIHL 1X5GA 5A16B 1T0NA 5C09D 4RZCA 2H32B 1A6WL 2YSSB 3CFKA 4R97C 3C60B 1IGMH 3QEUA 4MCZB 1CQKA 4FQ2L 1SYSB 5EBMB 3KHOA 3O4LA 5T1DH 1FPTH 4Y2DC 5EBGA 4X7TB 2WIIA 4PJIA 5EWIL 1MCOL 1J8KA 5KSBB 5GJSH 5C3TA 4JFHE 4WFGD 1WVZA 4X7EC 1Z3GH 3CK0L 1N2RA 3U7WH 5LKNA 3CFIC 4ODHH 1DANU 1IL1B 5SWSA 2P44B 2UZIH 1L0XA 5FM5O 2VLRE 5F96L 2LTQB 3CVIL 2GSGB 5AG9A 5ICZA 4TVPH 3ETBF 4L8DA 1J12A 4DKFH 3VFGL 2GSIB 1MLBB 4G3YL 5KJRL 3O6KL 3WNMA 3HNTL 3Q0HA 2G9HB 1T1YB 3CFDB 4PRHB 1QG3A 3HUJB 2DTMH 3OXRB 2XTLA 1Z2KA 4H25B 1F6AA 3PV6A 5AUMA 2BDNL 1JGDA 4J12A 4M62H 1IM3A 3RWEA 5T3ZH 4Q9RL 3D18A 5F70A 2ESVD 1NCCL 3MNZB 2VIRA 3VGAB 1LE9B 3DRQB 4O9HL 3EBAA 4G8IB 4HC1L 3MRFA 1HDMB 3TZVD 4A6YA 5D1XA 2V9QA 1IAOB 2WBJD 3D48R 1CR9H 4ZUTA 4JHBA 3WS3B 3BH8B 3T3PF 1N7ML 5F9DC 1I7UB 1CXFA 3GI9H 4M5ZH 1U58A 2NNAB 2E9WA 3NCBB 1DBAL 4S0TD 1GGBL 1C08B 1SJHB 3SDDB 1X6NA 1GZPB 3ARXA 2CR3A 1KJMA 3MNVB 4UOJA 5DK0B 3V0VA 1IKNA 4P4RA 1NMBL 2N56A 4WJ5A 1AHWA 4PR5A 5JW3H 1KEML 3O0RL 4OZGB 3GUTB 3S5LA 2R29H 1C5DB 5C9JA 3T1FA 1ZT1A 3MA9L 4XPHH 1T20B 1JGUL 3CU1A 3E1F1 4IRJC 5KW9L 5GGSA 4YJZL 4JFFB 4QWWC 3BP6A 3FQUB 1KTDB 5CFHA 3PWLA 3WNNA 4YR6A 2H2PD 2KUTA 2XTJC 3VMPA 4ENEC 1LO4L 5E00B 1Y6KR 4OCLC 3SQOH 4KHXH 5IV2A 3ARSA 3TN0A 4M7JL 4L5FH 1P4IL 5SV4A 1LD9B 1T5WA 5I6XC 4QF1A 5MI0C 3WKMH 3ARBB 4Z7OE 3C09C 1IVLA 1W0WA 4PD4K 4PJAB 3LKQB 2EO1A 2NLJA 1OAKH 4ZYKB 4Y2DD 3H3PH 1AGCA 4R96B 4LCCA 1X5HA 4DGIH 4ZNCD 1KJ2A 3OKEA 4QTHB 2IC2A 5BMFL 1VGEL 1RZ8B 2AEIT 4YEEA 2EYSB 1QSFD 1BQUA 5L0QC 3O4OC 4X4MA 3BRGC 4RMQA 2VQUA 5C2UB 5JOEA 1QEWB 2H3NA 4HIEA 4RGOL 3U0PB 2VLME 4ZOAA 1QVOA 2NTFA 3WFZA 4Q9CA 4RQQA 4X6DB 4Y19B 5DD3H 3QXDB 3OX8B 5E1HB 2DYPB 3NCEB 5H37G 2XWJA 3E2HC 2O61A 4OZGE 1IC7L