5H94B

Crystal structure of swine mhc classi for 1.48 angstroms
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
97
structure length
97
Chain Sequence
ARPPKVQVYSRHPAENGKPNYLNCYVSGFHPPQIEIDLLKNGEKMNAEQSDLSFSKDWSFYLLVHTEFTPNAVDQYSCRVKHVTLDKPKIVKWDRDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC class I antigen
publication title Structural and Biochemical Analyses of Swine Major Histocompatibility Complex Class I Complexes and Prediction of the Epitope Map of Important Influenza A Virus Strains
pubmed doi rcsb
source organism Sus scrofa
total genus 14
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5h94B00
4LNRA 1MREH 5KOVC 2VDPL 1X4YA 1U8KA 1H8SA 2ICWI 4L4TA 3VH8G 4NHCL 1WBZA 3D25A 4YGVB 3PWVA 1NFDF 4LLAA 4QXTA 1PYWA 1S9YA 2Q86A 1AR2A 5LGJB 3SBWC 3IFNH 4OGAC 1HSAA 4UB0H 4XNUH 4DVBA 2OX5A 1IKNC 2GKIA 1XGYH 2WBJC 4XH2A 3ARBD 4LSSL 1CLOH 2EO1A 3L3IB 5FGBA 1T04B 2A1WL 3X3FH 1RUAL 4YHZL 3WYRA 43C9A 3B9KC 4XGZA 4MB4A 1SHMA 2Z4QA 5HHME 2X05A 1FNGB 1I4FA 1SJEB 3U0WL 4UOJA 5K9KB 3P9WB 2XRAH 4KKLC 4IOIB 2YK1L 4M7ZB 1TZHB 2VR5A 3MUJA 1WSST 3D0VB 3V79C 2BSRA 4YK4B 2HJKA 3WLWC 4WHTB 1C1EH 1CXHA 4FRWA 2W65B 2H41A 2VLRA 5CGYC 5TE7H 3RGVD 2NY3C 1XGRA 2OJEB 3BRGC 3GNMH 2GFBB 1QSFB 4HG4K 1YPZE 2PETA 3B6SB 1BWMA 3MGTB 2VH5H 4Y2DA 2YZ8A 4FNLL 2WWKT 3B2UD 1MQKH 3MOBH 4JFDD 4G8GA 3TIEB 4M48L 5AG8A 2H8PA 1ZE3C 3GUTA 1A9BB 2X4QA 4TTDC 3L1OH 3VGAB 2QKIA 5D4QA 5E2VL 3TNMA 1UKTA 2ZP0T 5C0AD 3GRWH 3U30B 3LMJH 1NCWH 1DUYA 4ZO9A 3QUXC 4Y1AD 1AY1L 4X5WA 4HUUA 4TOYL 2R15A 4OGAD 1KEMH 3PP4L 1TVBA 4Q74A 2NY5H 3TH3T 4RRPG 5GSVA 4NOFA 1L9MA 4Z0XA 5F89B 4LVNC 2F9BT 5JTWA 3B9KD 2DLIA 3QEUA 3BP5A 1D5BA 2J88H 3VXRE 2EDWA 2GCYB 1AHWC 1TPXB 3G5VB 4U31A 3T0WA 3U9UA 4HPYH 4F9LC 4KKLD 4LLUA 4JN2B 3BWUC 5GRUL 1JL8A 4FQHA 3RHWF 5EIIB 5L2KB 2D9CA 3MLRL 3ZE0F 3WIIL 4D3CL 1F90L 4LCCC 3U82B 2WW8A 2DTMH 1R3LA 2BK8A 3HPJA 4YDJB 3WLWD 5BRZB 3PE9A 2NY2C 1XIWA 5CGYD 4GOSA 2NY3D 3KYMA 2DQFA 2IH1B 3U4EA 2IG2L 5ACZA 3LEVL 5GHWH 3VMPA 2IAND 4ZD3L 1X5FA 1XGPA 3MRFB 1Z9SA 3JWDC 5I73B 5C71A 2G60H 4MNGA 1BAFH 1G7MA 3BKML 4GMSL 4BQ8A 5K9OA 4YHIB 3V0VA 4NWTH 2YC1A 3B9EA 4JG0H 1UGNA 3E6FA 3GSVA 4TTDD 3O45A 4ZS6C 3HZYA 1R5IB 1BQHB 1EAPA 1F58H 1FNEA 3GZKA 4WUKL 4YHPB 4XCNB 5HGBA 1X44A 4EN3A 1Z9MA 4FZ8H 1QLEL 3QUXD 2VIRA 2XKNB 2MWCA 2CJUH 4KHXL 5HY9B 3KPMA 1EFXB 2A0LC 5DJAA 4R7NA 4BSWB 4ZAKC 4OZ4A 1IEAA 3MRNB 4OCWL 1NQBA 1Q8MA 5ECJE 1V5JA 3BAEH 1JF5A 1I9RL 2FJHA 3EYFB 4JN1L 4UDUB 5EOCJ 2W9DH 5C0CD 3QHTC 3V7MA 1F8TL 3Q6FA 2BY0A 2CXKA 3QXUA 4ZO8A 4TPRL 3GK8L 5GS0L 3ARSA 1CD0A 5IB5B 1BZ7B 1H5BC 5C0IA 5HPOA 1ZK9A 4MA1C 1MCQA 5F7YC 1FL6B 1HDMB 5EOCH 1ZT4B 1OCWH 1T83C 4OCYH 4GKZB 4M7JL 3ZDXE 5EUOB 3GMRA 1AKJB 1MQ8A 3MJ8A 2IPKA 4PJFE 2NY2D 2WK2A 3VGEA 4BZ2L 5CLTA 3RUGE 4YHNB 3ARGB 3RDTB 4K9EC 3EDKA 1TNNA 1AGEA 1I9EA 3H3BC 1BGXL 1G1YA 1I7UB 1QVOA 5DD6A 4NFBA 1XCTB 1YYLL 1LEIA 3OXSB 4AQOA 3CK0L 3OKKA 1DEEA 3TBYA 3MV8B 2XTJC 3X12A 2FLRT 1RUQL 2Q20A 1GOGA 4OD1L 1VFBA 3OBAA 2Y1VA 1KJ2H 4I2XA 2X10A 1LK2A 1MHPL 1V7NL 3LSOB 5F7FA 1JWMB 1IQWH 3E8UL 1G7HA 1T0MA 1QA9B 1KSRA 2A0LD 3PHQB 2R56L 1E28A 4WU5A 4ZAKD 1IGMH 2IFFH 4XAKD 4JRXA 4JFDE 4NGHH 3U0TB 1G9NL 3LEYH 4P5TC 3LN5A 4ODHL 3S37H 1IEBB 4XRCA 3TV3H 1BFOA 3MCKA 2R4SL 4MAYC 2GTWA 3O3DA 3ELAT 4JZOA 1OB1A 5IVXA 3NAAL 4QHKJ 4HKJA 5TE6H 1E4WL 4OIBA 1FE8H 5C0AE 5A3ID 3VFUB 4W81A 4S1RL 4WO4B 2A9MH 5HGHA 3RKDD 2CK0L 5AWNH 1JPSH 4O51A 2YN3A 1Q9OA 1M6OA 1RJZB 3ISWA 4NJAH 1INEH 1KJVA 4LCYA 2CXGA 3HE7A 1WC7A 5CP7B 1TMCB 4QHUA 2R2EB 5D7KD 2CD0A 2LE9A 3GBMH 1KB5L 2OXHA 3G9AB 3L5WA 4OQ1A 4Q2ZA 4KJWC 1UKSA 3VFGL 3M8OL 5IEHA 1MAML 5GISL 5KOMC 1WISA 5A16A 4N8CH 3T4YA 4DVRL 5C0GA 4CN6A 4FN0A 5F7LB 3VRIA 3QXAB 1Q0XH 2W9EH 3FB8B 2VWEE 3MMEA 4ETYA 3WL9A 4XX1G 4PJ5E 4OB5H 2XTJD 1RZIB 3CLFH 4H26A 2QSCH 4XXCC 1RZ8A 3MV7A 4ZUVB 1V7ML 2YD6A 2UZIL 1NAKL 1AQKH 4OSUH 4QEGA 5D70H 3WNPA 2EDBA 3HG1A 5JHDE 3ROLA 2DQHH 3GO1L 1J5OL 5DRWA 1OM3H 2F8XC 5E6YA 3BD4A 3OAZK 3NCCB 5I1KH 4U6YB 3DXAD 4GQPH 1DSFL 3BIAX 1HH6B 4LK4A 3QI9B 4P5TD 2ITCB 4LGSB 1N6QL 3QDJB 5F3BB 4H1LB 5F9OH 4MAYD 5DEFA 3JVGC 3ULUH 2IQ9H 4HT1H 1YEJH 3IKCA 3OMZA 4OCNC 1XF3A 1FNAA 1MEXH 4V1DA 3DVNB 3VG0H 3FT4B 5LCVL 3C6SA 3HS0A 1UM5H 3PL6A 4WJ5A 1U8LA 4JZJA 4M61B 5F7MC 5J0BA 4QRPB 3IJSA 3CFKB 1A7BA 1S8DB 1Z9LA 4P49A 2ATPA 4KDWA 5I75C 3DROB 3WO4C 1BOYA 1LEGB 4JAMA 2E3VA 1JGEB 4HD9A 5CEZE 4KJWD 5AEAA 3EO9L 2JCCF 1NUFA 4BA8A 5TQ2L 4KRLB 1CDBA 3HFML 3TWCH 1MJUL 1XZ0B 3I9GH 5IBLC 4FQ1L 3MLXH 5DC9B 1YMMB 4FFYL 4Y5YB 4MWFB 1EDQA 1H8OA 4ZDHA 4X7CC 2MHAA 3T1FB 3IB4A 3AS1A 4IDJL 1ZLSL 1FFQA 5C92A 1T0NA 3WJJC 3ZHKA 4LCIH 5GS1B 3MR9A 3O8XB 4NIKB 4QTHB 3QHFL 1ZHKA 1S9XA 1A4KB 3ARFB 3ZYOA 1HKFA 3T0EE 2R9HC 1AO7E 4X83A 1O7VA 2D7PA 3BUYA 1U8IB 5BVJB 3C5ZA 4DN3L 1W0YT 3HI5L 4G9FA 4PBXA 3MGOA 1A3QA 2P5WD 4GKNA 4F7EA 1NGWB 3OKDA 4JFFE 4GT7A 3GGWA 2W0FB 4QOKA 5I1IL 1DBBH 4JHWL 2F54E 4NN7C 5JW4M 4KZDL 3GSOB 1T20B 3QJFB 3GBNL 4BUHA 3CFEB 4HDIB 3MRBA 2CDFA 2FO1A 3QFDA 2X4NB 1Q9LA 1U95A 5KSBA 2R0WH 4OV5B 4FQCL 1MFCL 4DFIA 2F8OA 3O4LB 3OKLA 4NO0A 1N64L 4L1HA 2FEEL 2BX5A 4M8QB 1H15A 4ODVL 1F6LL 2X4RA 5GGUA 5KW9H 1GCFA 1UB6A 4PJHF 4YJZL 4EDXB 4MA8L 5D7LE 1R0AL 4MCZB 5IJKC 1AGBA 1Z3GH 3T77B 4BSVA 5IBLD 1CCZA 4L8SA 3D3VA 4Z8FH 2AK1L 4I18A 4F37F 3HPLA 4JKPH 5D7KE 2OLDA 3L7FA 3ULVH 5GIRA 4WUUE 3ZKSD 1EERB 4WI6A 1WBXB 4NQUA 2P8LB 5TFSL 1KN2H 4G42A 3MLUH 4HMEA 3JWDL 2EYRA 4LCWD 5GGQL 1R3KA 2ADFL 3MRGB 2R9HD 4Q97A 1W72L 1U8JA 2PXYA 3CMGA 2VDRH 2XFXA 2KKQA 5HYJB 2VITB 4K7FB 3P9MB 1M7DB 2Y06H 5CBAA 1KTDB 3NMEA 4NM4L 3K0WA 4MX7A 4XWOC 5DA0B 2DIBA 3OGCA 3STZA 1CT8B 1TTGA 3PQYD 4JPWH 4JO1L 3P0VL 5ACMA 3BFOA 3L9RA 2VZ1A 4RGMB 4AG4L 2DQTL 3TO2A 3BGMA 3Q5OA 4ZS7H 2F53B 3AROA 4PGJA 5SWQB 2YMXL 1O0VA 4MQXC 1QFPA 3MRLB 5GRZA 2N56A 3OAUH 3OJ2C 4PJCF 4HH9B 1A1MB 1ND0A 4PJGF 5E8PB 2E7MA 3JV4B 4LQ1A 2OYPA 4WTWA 4L5FL 1HOCA 2XN9A 3LH2L 3MJ6A 4EBQL 1KTLB 1XR8A 1A21A 3M1BB 1QBML 2YA1A 2CLVB 2VTFA 2ADJA 4RAVB 1CFBA 4K9EL 4BZ1L 3T1WA 3AM8A 3GHEH 4JO4H 4CVZA 1X5GA 2O5ZL 3NABH 4QCIB 4X9HA 2QL1A 3QUKA 4YBHA 5IHUH 1MRFL 3VWJA 2RAMA 1PJ9A 4QHMB 4K3EH 2PO6A 3F58H 4X4XB 5CJ5A 1YEKH 1KNOA 2PTUA 4RGNE 1EEQA 1F2XK 4XBGB 1E27B 3OB0K 3VFMB 4Z7NE 3G04B 1RAMA 4ZUSB 3V0WL 4OF6A 1FO0L 4XWOD 1BZ9B 3DV6B 4EI6A 5KVGL 4TSAL 3VD9A 4Q0XH 3RVTC 4P2CG 3L3DA 1JHLL 1XEDA 4FQPA 3WMSA 3QUML 4X8JA 1T66C 3UDWC 1BBDL 2DBLH 1P69B 1D5IH 1D6EA 5J9PA 1MFAH 3U7AA 4LDEB 5JPMB 2FHBA 5E6IC 2P5WE 4S11A 2HMIC 1GHFH 2K1MA 5GJTH 1T5WB 2Q8AH 1T80A 3CX5J 4MQXD 1GGTA 2A6IB 1JGVH 4Y19D 5BCAA 5FUZL 1HXMB 1HHIB 3MV9A 4R4FL 3RTQC 5C6PB 1GGYA 4QYOB 4E41D 4PBWD 3UO1L 5J6HA 3IJYB 3BIBX 3IDYC 1NMBH 5FYKH 2YPLB 1OWWA 3ROOB 1YZZA 2RIKA 1KB9K 1P6FA 4NNPH 1VENA 1BVLB 3PABA 3DO7B 5FO8B 1FGVL 4YFLF 2YR3A 1JN6A 1VA9A 2AABH 4DKFL 1QEWB 3DHMA 1KG0B 4OAWB 2B2XL 3QDMA 1K4CB 1IBGL 4QRUB 2CGRL 1QR1B 3QO1B 1KN4L 4LQFL 3RY5A 4HJJL 2YBRB 1YQVH 5HSFA 2VR9A 3MRDB 4PGEA 1SY6A 1A7QL 4KI5F 4OZHF 4KH2A 4YAQA 3FO0L 5D7IE 5DJZA 1NGXA 1V3LA 4ZNEA 4P2QA 1A6UH 3GSUB 1U8QB 5LXGL 4UQ2A 4OM0L 3V6ZB 2CDGA 1BX2B 4OKVB 4CMHC 4P9HL 5KANG 1PZ5B 4NC0B 2UZYB 5HHPA 3MNZA 5T3XE 1OARL 1A7NL 1XR9A 5I1AB 2E7LA 2XV6B 1T66D 3TBTB 3LKNB 4ZXBC 4G80B 4PY7B 5FYLH 4M7LT 4NP4L 5E6ID 4BQCA 1RVFH 2HRLA 3EYUL 2WAHA 4LRNH 1CVSC 4OFIA 4AL8L 2HMID 1RK1B 3ZDYF 3I6GA 3D25B 3BIKB 3F6IA 3FQUB 4XMLL 1QRNB 2B1AL 4Z7VB 4YHKL 2KQMA 5TDNB 3PQYE 2EYTA 3RWIB 5C7XL 2KL6A 3OR6A 3K74B 1LGVA 5I19L 1U91A 3V5KB 5D6DC 5HI3C 3RBGA 2R23A 1MVFA 1BJ8A 5FYJE 2XICA 2PTVA 5GRVK 5IP4A 5FA4B 3BZFB 1MVUA 4XGZB 2X7LA 1DDHB 4ZSOE 2Z4QB 1G6RL 1NFDE 1I4FB 3HR5B 1EXUA 4XNMA 5JO5A 1SY6H 4OUOA 1KENL 1DLFL 1EV2E 5GGSY 4LSPL 1AGCA 5ACLA 4TUKL 3LKOA 1YUHB 4P4RA 4JG1H 1KC5H 2AXHA 3SDYL 4S2SB 4D9LL 3BP6B 1Y0LA 1HHKA 4RMUA 1SEBA 2EDXA 2XPGB 4Q7DA 1IAIM 4HFWB 5GGRY 3QWRD 3NGBB 3PDOB 4DGIL 3HE6A 1A6AB 1VFAA 4LSTL 3H0TB 1C08A 2ARJA 5DEZA 4UU9B 5C09A 2HLFC 3H3PL 3QEGL 3RX7A 5I1GH 4J3SA 1I8IB 4HIEB 4M7ZC 4PV8A 4ZXBD 6FABH 2X4QB 2VDOL 4ODBD 3HLAA 5CD5C 5C9KA 4YK4C 3BJLA 5FF6B 4UV7L 2XZCH 3MGAA 4Y7MA 3TC9A 3NIDF 4GAGL 3BZ4B 2QADB 4QRRD 2RB8A 2JK5A 3CDCA 1DUYB 3ARWA 3P4OA 3GDBA 2XWJA 1MRCH 1ES0A 3HUJE 2ZZUT 5C07E 1G9MC 4OGZA 3QNZA 1CYGA 1TVBB 4K3GA 4NKMA 5ENWA 4WWID 1MY5A 1U3ZA 3MLVH 4X80H 4GW4A 3BYTA 1FCGA 3VGAC 1D5BB 2JB5H 3FN3A 1SEQH 3BESR 1KULA 2UWEA 4Y19E 1S5HA 1CDJA 3U30C 2Q76A 2FH6A 1IGIL 3TT1L 4KTDL 3TLRA 4E41E 5SWSE 4LBEA 4LIQH 5E8DL 1PG7L 1WZKA 5ESAA 4MD0A 3VXOA 1A5FL 4D0CA 1QYGL 1WT5C 3FN0H 2ZUXA 2W9LA 4HQQL 2DYPB 5TDOA 1I8KA 4P3CH 1AI1H 1K5NB 1P2CB 2DQFB 4D9QD 1EHNA 1UWXK 3IDJB 1NJ9B 3EJYC 1VGKA 1JGUH 4P59H 4GXUN 4ZUUA 4Y5VA 2HLFD 3QHZL 1JCKA 1TPXC 4OLXL 4NWUH 1ZLUK 3V4PL 1AGFA 1L7TL 2EXYD 3O4OB 3W82A 5BOPA 3VFRB 3ZE0E 5K9OB 4KAQH 1A6ZB 1JRHI 5SX4H 1S5IL 5DEGA 1JYXA 4GRMA 1ORSA 4X9BA 1E6JL 1AH1A 4K94C 4JE4B 2YUZA 3TBSA 4P9MH 5CZXC 1OAXL 4P23A 4OTXL 3RWDA 1HHJB 4EOWL 1QSFD 1KJ2B 4RX4A 3HZVA 4RFEB 4PRPA 5LVEA 2FWOB 2IJ0C 2EE3A 1IEAB 2R1XA 5I73C 3BD3A 1CDHA 1MFNA 5DK0A 2KDGA 4I8DA 4KRPB 4IRZL 4P3WA 5T33L 2DQIL 2FJHB 4HKXA 3MV01 5IJVB 1HQ4B 1NCUA 3S4SG 1YEFH 2BJMH 2C4XA 4A6YH 4R7DA 3G6DH 1OSPH 4OLVH 5JQ6H 4WFED 1X5ZA 4HWZA 4EKXA 5GGSB 4JPVL 1IMHC 1KLGB 5H35A 3G9VA 2XIDA 3U7YL 3KPSB 2JE8A 1GZPB 2GIYA 1Q9WA 5FV2A 5I1CH 1AFVH 5GGRB 3UTSA 1F4WL 4P4KA 2MKLC 3W11C 2Y5EA 4O5LH 4I4WB 1CGYA 4DK3A 1DQLL 4ERSH 1GZQB 1QVOB 4MXWL 4OLEA 1EGJL 1CFSB 5B38G 1FLRH 1IAKB 5L2KD 4WCYH 4AENA 3VXNB 5DHVH 3DARA 3NZ8B 4JQVA 3LS5L 5EORL 5BO1L 4IRJB 5BRZD 1F02I 3IGAA 3R06B 3O11B 1JWSB 5I66B 5T1KB 2BVOA 1TLKA 5B8CB 3ARGC 1FV1A 3RDTC 2R4RL 1WICA 3BW9B 3SDXA 1YEDB 5EBMB 3ARVA 1ZLVK 4JRXB 1UM4H 3GMOA 2ZUTA 3FQNB 4BFBD 3QUYB 3IAPA 5IG7A 2GJJA 1OB1B 5CS7A 1J8HD 3MRHA 1II4E 3UTQB 4KTEL 1NKOA 4PS4H 3GMPB 4QRRE 2AXFA 4M62L 5HGHB 2DD8H 1AXSB 5CHNB 4O51B 4WTZA 1CDIA 4L8BB 5LGKA 5DI8A 1YNTB 25C8L 3RWFB 1EFXD 1VADA 5JOPE 2FD6H 2EKJA 2LVEA 3RVXC 2CUIA 5CJXC 4U0QB 3DUHA 5DUML 3SE9H 3IAGC 3R1GH 1T03H 2I27N 1PY9A 4HK0A 5JIIA 4YWGH 3UTTE 5GRJL 3B83A 2PCPA 3W11D 4X6BA 4W4OC 1FORL 2XQBH 5E7BA 5EOQL 4F7CA 5IEHB 3O9WB 3U36B 3EYVA 3P0GB 5I0DA 2BCKB 4RMQA 1CE1H 5C2BL 4FG6C 3KPLA 1I85A 4WO4C 4TVPL 2Q7YB 4FQJL 3S98A 4DZBA 2D4FA 3GSRA 3V95A 4K8RC 4LHUG 4GO6B 3QIUB 3RZCA 3B2VH 1FZOB 5IF0B 1AKJD 3T2NL 3EDFA 3U1SL 4LRIC 3QDGB 3U4BH 1KF9B 3MA7A 4D9QE 1FQ9C 2VLKB 5GSRB 2VDNL 3D69B 3ARGD 3ROLB 3O3AA 3OF6A 4Y4KA 8FABB 4C59B 3MLZH 4XB8A 2GITA 5DD1H 2YEZA 2ICEA 3JV5A 3VGBA 4K2UH 3O6FA 5GS2H 2DWEB 2NQCA 4QGTA 5AG9A 2FIKB 3MV8D 4IHOB 4PJAF 1JPTL 3IKCB 4U3XA 2W60A 4LP5A 1QQDB 5EC2B 5AZ2L 4V1DB 1NC4A 3SE3C 4BM7A 2ZUUA 4WDIA 1IFHL 1DTUA 1T1YA 1ZHBB 5FKPA 3MCG1 2PTTA 1QSFE 5I71B 2BY2A 1OP3K 3WFDL 3LHPL 3FQWB 4ELMB 4NZRH 4PRDA 5LAXA 3SY0B 4B50A 1P7QB 4JVWA 5I1DB 4XCCL 1KJ3H 5MEND 3OZ9L 1NGQH 1XGTB 3QI9C 5E4EB 4CADA 4M3KB 2AGJH 3TPUB 5I1HH 3BT2L 1VB9A 1GGIH 4ZOAA 1MNUL 1HEZA 2B20A 4Z78B 5DD5H 3WFEL 1FG2B 4Z5RA 2NYYC 3MBXH 2Y4SA 1EO5A 5GJSH 2FLBT 3BD5A 4WO4D 4LLYB 3MODH 4L4JA 3SJVA 5HYEA 3N50A 1DBJH 4JFHE 3MJ7A 5E2TH 1IM3A 3DGGA 4K8RD 2UVEA 1JYWA 4CU8A 1TFHA 2VDKL 3RL2B 1GGCL 3D0LA 3D9AH 3ILPA 4X6CF 3P4LA 2C26A 5HYSA 3TN0A 4PD4K 2JCCE 3NA9L 3MC0A 1ZHKB 4FS0A 4K7PX 5H37G 2OMBA 1H3UA 3DX8B 2CQVA 2AJXL 2EC9U 3KLHC 3BUYB 4K3DH 1C8PA 5H2BB 4XX1E 3MFFB 4AEIH 3NCJH 3MOAL 4CMMA 1Q72L 1UACL 1UVQB 4XP1L 3FHAA 4PRAB 4WFGD 4L29A 4Y5YC 1QFWI 2GUOA 1CG9A 1MJJA 5L2KE 2F5BH 4NRXA 4Q9QL 2R2BA 4QOKB 3N1MC 5I8OL 5BRZE 4M43H 4KKCD 4NKIH 5GS1C 3O8XC 3LQAL 1S9KC 3N85H 3EYQC 3RP1A 3ARFC 4JFQA 4YBLB 2HVJA 3G5XB 4XP4H 3RIAK 3TBVB 1VERA 4L3EA 1A47A 2BVEA 5HHVL 4UT6H 2FX7L 2MTPA 1I1AB 1H15B 2X4RB 3MPCA 3QI9D 4UNTA 4XB7A 5E9DB 1WBYB 3QDJD 1J8HE 5D1XA 3RPIB 3MRKA 1UWGL 1A4JB 4ZODA 3H6JA 4YUEH 2NYYD 3PGDA 1E4KC 1K8IB 4KUCF 1Z5LA 5EIVA 4HUMB 5EO1B 1H3TA 3D3VB 1MWAH 4ODSL 5L8KB 1FNSL 3IDXH 1CI5A 4FXGA 5HYQA 4LU5H 3HPLB 1CWVA 4QRPD 2R8SH 2AJSH 1EO7A 2OS7A 1HSBA 4JPIB 5T1DL 3L7FB 4PJHE 1P7HL 2AP2A 2YRPA 1NCAL 3HB3C 4IMLB 1DLHB 3ARBA 1ADQA 3LEXA 3I02B 4D0BB 4GG8A 3EOAA 2R29L 4RWHA 5K93A 2ZUVA 5IB3B 3KLHD 2D3VA 4WU7A 1NBVH 4MNQB 5IW1A 5IBTL 5CMAB 1CTOA 2F15A 3FO2A 2HYMA 1YMMD 2VLJB 1H8NA 4Q6IA 2FB4L 3HI6L 3VU2A 5T3ZD 5CBAB 1IGFL 4OZGB 5DF0A 4WV1A 5EUOE 5BMFH 1UJ3B 2RCSH 2AV1B 3AFLA 4U6XA 1F4AA 2AV7B 2HJLB 3OV6A 4JGUA 4U1GB 4OFPA 2XZQH 4OI8A 4HGKC 3O8XD 2P7TB 1JI2A 3PP3H 4U1LA 3EYQD 3SDCD 4JRYE 2G2RA 3MOQA 3RGVA 1VGEH 4K3JL 2HH0H 3TO2B 4GRWF 4RBPK 2EH7H 4XPAL 3GKZA 1NAMB 4YR6A 1EVTC 5K33A 3WN5A 4S1QL 5F1NA 4JFDA 4JQIL 4C56B 4KJQC 4KV5F 3DGCR 3OSKA 4LEOA 2FECI 3LB6C 1AJ7L 2H2SC 1YDPB 4KJYB 4FQ2L 5I30H 5JA9A 2HA1A 2A9NL 4JKKA 4G6ML 4WW2F 5FUCC 3HMWH 4LF3A 1CD1B 5JMRA 1JZ4A 2AI0L 2AJVL 4FFWC 4ODUB 4UUJA 2VXTL 3F7RA 4Y1AA 3O4LD 5EBWA 3SBWA 5GGVH 5MENE 5F96L 1IKNA 3HB3D 1FPTL 4PJCE 4KTYA 2WBJA 1KV3A 1PBYA 4PJGE 1KLUA 3B5GA 2HFFA 5JOEA 2E7BA 4PLJC 1IT9L 4W6YB 2OJZL 2D7TL 5C08E 4QT5B 3LIZH 3B9KA 3WD5H 4TYUA 3PXJA 3GIZL 2L7JA 4D2NA 2KBGA 3T4AA 3DSNA 1EO8L 4L4VB 5JMOC 2OI9B 2VL5A 4R9HA 1TCRB 1TVHA 1BFTA 4NNYA 5CD3A 3CUPB 1G6VK 1DBKH 5DA4A 1A22B 3LKSA 4AM0A 3KS0H 3OTTA 1QFUH 1OQXA 1S7VA 3SDDB 3JSSA 4HIIA 4M1DL 4HK3N 1CIDA 4MZ3A 3DBXA 3K8KA 4QTIH 4ZPVB 1D6EB 4KMTL 5HDOA 1IKFL 1RZKC 5ITFB 2IANA 3MJ9L 4QWWC 1FFOB 1OT1A 4OT1L 5HYJD 4Y5XB 3GKWL 1C5CH 3L3HB 4KJQD 2HT2C 1I7RB 3FB7A 2ZUWA 1NCBH 2I9TA 3BWAB 4GW5A 5ERWB 3FRPA 5FCSH 3LB6D 3PJSB 4JFXA 4PJDF 4WW1B 2EIDA 3CGTA 2HFEA 1FBIL 3RNKB 2A83B 2VDMH 3IS1X 4UTBH 4FFWD 4O2FB 1J0HA 3QUXA 1I75A 2FATL 1D5ZB 1ZGLP 3MUHL 2Q8BH 3PABB 2F53D 1FZKA 1TJHL 5IFHH 4MJ6A 4QRQB 4FQQA 1QLRA 3U6RA 5HHQA 4IOFC 2FR4B 1FVDB 1EEYA 4ZFFB 4HEME 2IPTH 5DZOA 3JV0A 5C0CA 1WTGT 4XAWL 1ZT7A 1JF1B 3IFPA 1ZHLB 2EDJA 4KVNH 5BQ7B 4QRPE 4F9LA 1BJ1J 3K4ZA 3WLBB 5CINH 4Z76B 3I2CH 1RJLA 4NJ9L 1M71B 4B0MM 5IV2A 5F7NC 4CRPA 4LCCA 4WWKC 3B9VA 4BK5A 1KBGH 3PDGA 5DC4B 4HUVA 4NZDA 5FHBH 3U9PH 3F6LA 3KPRD 3MLSL 3MUGA 3T0VA 4OD2A 4MVBD 4OZHE 1VCAA 5EU4A 4XBEL 3X13A 1J18A 3GB7B 4M03A 4QWWD 4MDJB 1F2QA 5T3ZE 3F7YA 4Z0BH 1A1NB 2L4OA 2HT2D 4XMPL 3WS3A 5TPWH 5K59F 4JDVA 3QWQB 1BWWA 2VXSL 5JXAL 5IM7B 1JWUB 3K81A 3OR6B 4XP9L 1DN2A 3CSGA 2Y7QB 5MEPB 2VC2L 2YRLA 3ZL4H 4NBYB 1IEHA 3DHJA 4RWYH 2C4FU 4JHZA 4KDVA 2X7LB 4MLSA 1FH5L 5I1LA 1NL0H 2AJ3B 5JDSB 2NX5E 5CEZH 4HZAA 3OL2A 4KQ4L 3R4DA 5IT2H 1LP9F 5DYOA 4ZAKA 2V7HA 4IOFD 3GMMB 3JTSA 2QQNL 2Y07L 4PRIB 1K8DA 5DJ0A 3VI3E 4LFHD 2BNQD 3NTCH 2V6HA 3U83A 1A02N 4K7PY 1RUKH 5CSZB 4GG6F 3L95B 5IWLC 2X4OA 4TVSa 5MEOB 2YPLD 4NDMA 5FGBC 3VXMB 2Y5TB 4LPXA 4ZUTB 4HLZH 1H5BA 3CMOH 2BMKA 2BXZA 1T83A 2NY5C 2DOCA 2WLZA 2G5RA 3S36H 3QNXA 3ES6B 1TJIH 3KVQA 4WWKD 2HVKB 1JNLH 2VNCA 2QR0A 2Z31B 3QG6B 1SYVA 4JFPB 2WQ8A 5EBGA 3HLAB 4PJIA 1GGBH 1MFDH 1U58A 1M05A 4HKBA 3U0PB 1KELL 1XGQB 4LLVA 3NGBC 1NGZA 4OGXH 2I25N 4YXLH 1A9EA 5I17B 5TF1H 1R3JA 1F3JA 4R97B 1W0WA 5IROC 5BVPL 1EHAA 4KFZC 5HI5C 1IGJA 2MCPL 4HWEL 1UB5A 2FHCA 2QQLL 4QF1A 3DNKA 1HINH 1BZQK 5FECB 1U0QA 4R3SA 1AXTL 5CEXB 4GH7B 4DKEL 5LQBH 3EOBA 4ZFOA 3NIDE 3LN4B 2VE6B 1BQUA 2AJZB 4FTVE 1I3VA 2UWEB 3DXAA 4EUPA 2QADC 2DWDB 4H88L 2XWTB 5L88L 3QUMA 4P5TA 5DDHA 1QRND 4EQ2A 3LV3B 4HGMA 4MAYA 5TQ0H 3AS3A 4A6YB 4LDLB 4GMTL 5ESAB 4ZQKB 4HULB 1JGLH 3D18B 2IAMB 4PJ8B 5BV7H 1JK8A 1TZIA 2XY2A 3AREB 3FCTA 3MXVH 4KROD 3VFSA 3LZFL 4OFVA 3L6FA 4XPGH 3GMNB 5DJDB 3ZYZA 4ODWB 3QXDA 1VGKB 1DQDH 3EYSL 2ICWB 2F53E 1L0QA 4HMDA 3K4AA 1TNMA 1DFBL 2I60H 3HHRB 4M1CC 1TVDA 4S1DC 3S35X 1QNZH 4G8EA 3DO3A 4LVHB 4EQ3A 3QDAA 4LAJH 4NT6A 4XP6L 3ARRA 4LEXL 1F11A 4CDGC 2ITDA 2X4TA 4HXBH 4JO3L 1HYRC 1WZ1L 4NZUL 1I9JH 2HKFL 2X42A 3L3KB 5FB8B 3RVVD 3EDJA 1ZS8A 5DHVB 3F12B 1FVEB 4HV8A 4LARH 4FMKA 2Q6WB 1NSNH 3P4NA 5HI5D 5IFAH 4U1KA 1INQA 5D71L 4XXCA 3P73A 3OB8A 1YEHL 3O4OC 4OI7A 3L3GA 4Z7WA 4DW2H 1LE9B 1MIML 3KPRE 1HK6A 5BZWB 1ZLWH 3QO0B 4MMXC 3GJEB 2R1WB 4BYHA 4JZNA 4KK5C 3C5SB 4R7DB 1Q94B 2QADD 3IU3A 2P5WA 2HWZL 4ORZC 4TUOB 4PJEF 5D8JH 3E6HB 4G7VL 3JVGA 3H9SE 4CAGA 3QEHB 3TM6A 4YHOH 4J3UA 2IALB 4D8PB 3BO8B 5DQJA 1KACB 4GW1B 3BPLB 4IMKC 4KRPC 3UYRL 2ZCLH 2FL5A 4UQ3A 5C2UB 4F58L 4U05A 2WANA 4BFEA 2P45B 1CXIA 4XPFH 5E2UL 5KANI 4M1CD 4S1DD 1G0YR 1FNLA 1WEJH 2BNQE 3GIVB 1N8ZA 2NW3A 4R8WH 2AEWA 5D72H 4XVJH 3IU4L 2J8UF 3RX5A 4M6ML 3AAZA 2EE9A 3RWGA 1OD7A 1UWEL 2VDQL 5L2JA 1UCTA 2DYPD 4JM2B 1K6QL 4AY0A 3AY4C 1GC1L 4HJGA 4J3TA 1EVUA 1DQMH 1PY4A 1X5HA 5FCUL 2F58L 3P4MA 1UC6A 3BEVA 2DQEH 3C2AL 3W5NA 5A1AA 1A6TB 3WJJA 4X6FB 3TCLA 3GSNH 1I1FA 4CUCA 5DJYA 4LCWA 1A3RH 1XMWA 2CDEB 3KPNA 4PJBB 3MRHB 3RFZC 1KCUL 1HHGA 2VABB 1YC7A 4KK5D 4IRJC 2OQJB 43CAB 1TETL 2EDFA 2GJ6E 3WHE0 2AXFB 3QQ9C 1JGDA 3O6KL 3N9GH 4M9PA 3MA9L 1AE6L 1L7IH 5B8CC 1BLNB 1HH9B 1N59B 1RUPL 5KSUA 2CK2A 5D1QB 3KPPB 3HMXL 1N0XL 3PHOB 4S1SL 1QZ1A 3PQYA 4FFZH 1Z6JT 3L3JA 2DIJA 4HX1B 1ZGLA 1FDLH 3G08A 3ORJA 1UJTA 3QUYC 4KRPD 4X5XB 2H26A 1BJMA 4KUCD 3KPLB 3IJHA 2SEBA 5KVMC 2EDTA 4ZSOA 1N3NA 5HHMB 3TFKC 1GAFH 4RMVA 1EEZA 1QRNE 3ULUC 4X8XA 3CIQA 5IW6A 2EH8H 2DMKA 5FO7B 2YPKA 4DQOH 2BVQB 3IFNL 4YPGB 4GRLB 4XNUL 3RZCB 4FQLH 3KPSD 1XGYL 4J1UA 4IIQA 4PRBB 1E4XH 4JPKH 5D5MA 2C3VB 3HNTH 4LLWB 1CLOL 5IJKA 3OHXB 1KPUA 4X98A 1TXKA 2XOTA 3QWOB 3NOIA 3QQ4B 4HAGA 4X6DF 3CH8A 3V4VL 3X3GH 3O9WC 5GGVY 1NDGA 3CFJA 1DE4A 1J0YA 3MLTB 5T3XH 4TRPL 4KKNA 4HUWA 1YPZB 4N5UA 4MJIE 3CSYB 5ALBH 2EDLA 5B39A 2IC2A 2FCBA 5E8EB 5DJCA 1HNFA 5FYKU 5CKGA 1OAUH 3QIUC 3G6JF 5E8OA 3RWJB 4XC1H 2YD9A 5I9QB 4U1JA 3P0YH 1BBJA 4F33A 1X5AA 5DK3A 2Y36H 3FONB 4FZEH 4IRJD 3VGDA 1ONQB 1DN0B 4NO5A 1C1EL 2AQ2A 2VKWA 3QQ9D 1T1YB 1SBBA 2P8MA 3DIFA 5TE7L 2AAVA 2UY7A 1UZ8B 1Q9KA 4YDKH 5JHLH 5FDWA 1J10A 1P4LA 4PRDB 1W0VB 4H20H 4XMKH 2K7QA 5FYJH 3UPRB 2JJUA 4ONHA 3HUJA 3MOBL 2FGZA 4PJAE 3QUYD 3TT3H 5SWZE 3VH8A 4HGWA 2FZ3A 4Y16B 3L1OL 3LDBB 1U8OB 1GYAA 1I3UA 1U8NB 4M5ZH 1AP2A 4HZLA 4RISL 5DMJB 3TFKD 3GRWL 3ZE1F 3FZUC 3VXRB 3LMJL 2BXYA 3VMNA 1NCCH 4Y19A 5I71C 3DGGB 4ZTOH 3BI9X 2I5YH 1CLYH 2H3NA 2F74A 2GSIB 4PG9B 1S7TA 1MWAB 3EHBC 1RFDH 4ZUWB 5E4EC 5E24E 2NY6D 2BOCB 1T4KB 3QEQD 2P46B 5IQ7H 1ZT1B 2G75A 3O2VL 1U6AH 4RDQG 3UBXG 4YDLB 1MPAH 4LLMB 3O9WD 4D9RD 2XNAA 3B5HA 3MACH 1PAMA 1YEIH 2OR8A 2C9AA 2PR4H 3DETC 1HI6B 3P30H 4Y0GA 2J88L 3HNSL 3SGJC 5CLWA 1JYVA 3CFDB 1YJDL 1J1XL 2NTSP 2GUOB 2ERJB 1CG9B 4UIKH 3C8KB 5C6TH 4X6CE 1YEEL 2R2BB 2FH8A 1EHLH 3QIUD 3LQMA 2FJGA 1WVZA 5I6XB 2EDOA 3O3BB 5JPNA 1QO3B 4I0CC 1PX4A 2DTML 1A7RH 3QDGD 2WMPA 3M07A 4MQ7B 2VZSA 5HVFB 4LSRH 2VLKD 1ZVSB 3ECBB 4PJ7F 3ULVC 3SGKC 2A6JA 1CFNB 1EFQA 4FMFA 2BC4B 4NCC2 1KIQA 4NKQB 4DZ8A 4YEFA 4RMTA 1RU9H 1U3YA 2G60L 1BAFL 1YNLH 5D1XB 2DQJL 1X5YA 4NCC1 1OAQH 4NWTL 4JG0L 2JLLA 1NLBH 2LQRA 3UDWA 2UUDK 4R2GD 5JNYB 5CJBA 3CVHH 5E6IA 4G8FA 1F58L 5IBUB 1HHHB 4XCEB 3FZUD 5E7FA 4J2XA 3F5WA 4YBLC 3ZKXB 4J12A 5F93C 4AT6A 2CJUL 5HYQB 1M7IB 3BX7C 2DRUA 1MAJA 4XI5C 1ZVYA 1P7QD 5C86A 3VJ6A 3RTQA 1I1AC 1NEUA 3ARBB 3EHBD 1FN4A 12E8L 4WHYG 3BAEL 4PJFB 4KPHH 2AK4E 4HBCH 4URTB 3KPOA 4PREA 2W9DL 1RK0A 3RUGB 5MHSE 3U46A 4O2CA 2B4CL 3HRZB 4OJFH 4DTGH 3EAKA 5E00A 4XWGH 1QFHA 4X99B 2X09A 4APQB 4XPBH 4GKOA 3CFCH 1I8MB 2IFGA 5EOCL 1OCWL 5D2LA 4ZMAT 3KPSE 1N7MH 5ICZA 4R90H 5C0JA 2BOBB 4XNZB 5CAYB 1SBSH 4E5XB 3MBEB 1VFOA 4LKXA 1MIEH 4Z7UA 1CFVH 3QWRA 4TUJB 3QPXH 4JANB 1OD9A 4UDTA 2BSTA 5DJ2A 2QQKL 3QQ3B 2Z93A 2NNAA 2Z92A 4JFDB 2LU4A 5ANME 5DQ9A 1UJ3C 2BSSB 4HIJB 5IB4A 3REVB 3SCMD 4ZXBA 1X6NA 1CS6A 1RURH 4U1GC 2OK0L 3G5ZB 4HK3J 3RWEA 3DV4A 2WZPD 3WNNA 3THMH 2PUQT 4NRYB 4HJ0C 4LF3B 5C0AB 1RULH 1W8NA 4QRRA 3GHBH 5AYQA 2H1PH 5DMGC 3EUUA 4JVUA 4W70A 3STLA 4OF7A 4JFZH 4PFEA 5JDJA 4XI5D 2Z35A 2KQNA 4ODXB 1ZVHA 2A6KB 2IFFL 1I1AD 4U6VH 5GGTA 4KV5E 4J3WA 3LEYL 4FQXB 5DVLA 2HFFB 2LV4A 4OLWH 3S37L 4DFHA 5E9DD 5D6DA 4YHML 1FGNH 3CPLB 3BVNB 1T6WA 1KPVB 3VFOA 4WHCA 5F44A 3BMWA 1VEPA 1FE8L 4I3SH 4QXUH 4MXQC 2A9ML 4LPCA 5AWNL 1JPSL 1PSKH 3FQRB 4NZTH 4YGVA 2HG5A 1INEL 5CD3B 1N26A 4U1IB 5LGJA 3O3UN 5GRXG 3CX5K 5HVHB 2AERT 2AVGA 2VXVL 1MJ8H 4PJ5B 3QEQE 4DGVH 3I85A 3L3IA 5EZLB 1T04A 3GI8H 3RAJH 4D9RE 2BVUA 2M26A 3ZKNC 1JNJA 7CGTA 1IGCL 4B53A 3D39D 4N8CL 5JHDB 5C0EB 4MNQD 1FNGA 3OGOE 1F42A 2J3SA 2VB5A 1SJEA 1Q0XL 2W9EL 4Z7OF 2VLJD 3BP7B 2OI9C 5K9KA 3HTLX 2NY7H 4POZC 3WIFB 3FB7B 4OB5L 4IOIA 2J2ZA 1TZHA 5ID0B 3CLFL 4Q9RL 4HS6A 2YXMA 1LO4H 2QSCL 3D0VA 5KS9B 3QDGE 3SDDC 5I1EH 1ZEAH 3OPZH 4LPUA 4WHTA 1GRWA 1QFWH 1AQKL 2W65A 5D70L 2D0FA 5DMGD 3T2QA 2DQHL 4MXVF 2GFBA 1OM3L 4H8WC 1WFNA 1QSFA 2JIXD 1TQBB 3B6SA 4OM1L 3MGTA 4IS6B 1IC1A 4WEMB 3GSQB 4Y5XC 5IMLB 2A1WH 4F7TB 4C56D 5F9OL 2J4WL 1RUAH 3ULUL 4PJDE 2IQ9L 4PPTA 4HT1L 4KWUA 1YEJL 5ID1A 1MRDL 1TIUA 1A9BA 4LSUH 1MEXL 4QXGH 3VG0L 4MXQD 1CFQA 2ARWA 1UM5L 3IF1B 1FIEA 4R0LB 3VXUB 1XGUB 1MFEH 3HZKB 4XNYH 2L0DA 5IBUG 3HC0B 1OP5H 1T1XB 3WUWG 1MUJB 3SKJL 5IEKA 1WT5A 1FL3B 1MCEA 2D31B 4M4PA 5JIHA 5LJYH 4WHDA 5FFLA 4R4BB 5F89A 4OD2B 1Y18B 4G6JH 3T0EB 1AO7B 3TWCL 3I9GL 1RSFA 3QT2A 5CJQH 2EDYA 4OIIL 1OGAD 2GCYA 3G5VA 3F7YB 4POZD 4MJ4A 4JN2A 1S78C 5EIIA 4JFFB 5L2KA 5DRXB 5SX5K 4Q58C 2X4UB 1P4BH 4FFVC 4LCIL 3SDDD 2F54B 5E2VH 4YDJA 5BRZA 1G9MH 3E0GA 3Q0HA 2N4IA 2E7LC 3N1FC 2XI9A 2GW5A 3O6MH 2IH1A 2Z0BA 2V17L 4LPVA 2YKLH 3H3KA 3MRFA 1MH5A 1P5UA 5K59E 3V4UL 4YHIA 4A2MA 4RSVA 4G43B 3SQBA 1DBBL 2F5AL 4PGCB 1H3VA 1PQZB 3X14B 5D7LB 2E9JA 1N4XH 5ITBH 5F72S 5EN2B 3KYNB 2ZUYA 1R5IA 1BQHA 4YHPA 4XCNA 4XXDB 5GRUH 5CBEB 2YD5A 2XKNA 3OX8B 2D0GA 1J88A 5HY9A 1EFXA 3UROR 5BV7B 3QNXB 4D3CH 4BSWA 2AJYH 2YOCA 1UZ6F 1JP5A 5KW9L 4MYWB 4PJHA 4AMKH 4WUUB 3MRNA 2RJMA 2FIRT 4GG6E 2EDHA 1BFVL 3OKMB 1T1ZB 2YD1A 3UCRA 3EYFA 1MLBB 4UDUA 3REWB 1Z3GL 2R0KL 4U1MA 4OLZL 1JTPA 4I48B 1CXLA 2RGSA 5IB5A 1BZ7A 2ESVE 4Z8FL 1JMZA 3QZWB 4QNPF 4NKOB 2PYFB 1A9EB 1S78D 1HDMA 3KWWB 3MYZA 3VDCA 1ZT4A 1F3JB 4GKZA 4OLUH 3ULVL 4FFVD 5EUOA 1IGJB 1AKJA 4PY8J 1BIIB 2HFTA 4DJMA 2X1PA 3MLUL 4WUKH 1J05B 3D39E 3RHWK 2Z31C 4YHNA 3ARGA 2X1XR 3O2WH 5E6ZA 3WO3B 4HC1A 3G5YB 1ZGLM 4KHXH 2VDRL 1KFAH 3KLSA 4NO3B 1I7UA 2VLJE 1XCTA 1CQKA 4NNXA 2DMCA 5DDHB 2Y06L 4OZGE 2W07A 3OXSA 4NOBA 3DX7A 4R97C 1KPRB 3MV8A 4KUZH 2H32B 1Q0YL 5IFJA 4JPWL 3WHE1 4NPYB 3GK8H 4TPRH 5F6HJ 5GS0H 2XA3A 3LSOA 1JWMA 3C5JB 3O41B 1AD9B 4RMRA 3SO3B 5KSAD 1QA9A 4ZS7L 3PHQA 4NC1E 3U0TA 4JKMA 1UM6H 3VGGA 4C56E 1ZV5A 3CCHB 3K8MA 4BZ2H 1IEBA 4PRID 3RU8H 1KEGH 1OTTC 2CR6A 3K4DA 1UENA 1KCSL 3UJJH 2IAMC 2X40A 1BGXH 4PJ8C 3VXMD 4AIZB 4J6RH 3VFUA 4Q9BA 4WO4A 3AREC 4YHYB 1YYLH 1WQVT 1CGVA 4RGNB 5JLZB 4ZFGH 4YQXH 4OQTA 1RJZA 3WFZA 4YPJA 3PWPB 1FIGL 5CP7A 1RUQH 4RMSA 2R2EA 4ONFH 4U1KB 2DQGH 4LVHC 4LRIA 3HC3H 1C16A 3L3GB 3SE4C 1AIFB 1MCLA 3QH3B 5IHUL 1F4YL 4EI5B 1UCBH 2Z31D 3E8UH 4GAYA 3F58L 1F3DJ 2OR9L 5LBSL 1OGAE 4JM4H 3GSNB 5FUOH 1MHEB 1PDKA 3RVWD 3BSZH 1EJOH 4ODHH 1LE5B 3FB8A 2FYYB 3NAAH 5IVXF 5KJRH 2ZSVB 3EKCA 3STBA 3DI2B 4Q0XL 3C8DA 4S1RH 1L0YA 4ZUVA 2OM5A 3SE3A 3TNNB 1T21B 2DBLL 1MFAL 5DD3L 2V5SA 3QG7H 1U3JA 1NMAH 3EBAA 1HCVA 3EJZC 1GHFL 5HGDB 5GJTL 2Q8AL 4PJEE 1M4KA 1JGVL 3FQTB 3QI9A 1CK0L 2ITCA 3QDJA 5KVFL 5F3BA 4H1LA 5EZIH 3F62A 3QISA 3ZE2E 1IAOB 1JNNL 4YDVB 3AAZB 5GISH 1BVZA 4HIXH 4OQTH 2IMNA 3VWKB 1NMBL 2GK0B 3OG4B 3FO1B 5FYKL 2IAMD 4DVRH 3BPLC 4PJ8D 3DVNA 4DKAA 3V0AC 3ARED 1RY7B 3FT4A 4XP5H 5JA8B 1CLCA 2W92A 5EOTB 4HJGB 15C8L 1UXSA 2Z8VC 4NNPL 5D7IB 4M61A 4HUKB 4FQIH 2ID5A 4QRPA 4WNQB 3FB5B 3CXDH 2VERN 1CR9H 3WDHA 3NACH 2YWYA 1DQQB 3CFKA 3ZHDA 3V6BR 4NKDB 1U93B 3TCLB 1V7MH 4WI8A 4ENEC 2J8UE 3QCTL 1RZ7L 1LEGA 1JGEA 3PGCB 4F2MA 3QCVH 3TESA 1YQVL 2IEPA 5JORB 4EXKA 1MCKA 1N2RB 1XZ0A 1S7QB 5CGTA 2VZVA 4JM2C 1YMMA 4Y5YA 4MWFA 1A6UL 5JZ7C 1IILE 3T1FA 2JELL 3HC4H 3KYOB 4NUGL 4XCFH 5ISZD 1NC2D 4I9WD 4RZCB 5DVKA 4JR9L 5GS1A 3O8XA 1LDPH 4QTHA 5AZEH 5LCVH 1K2DB 4LVOB 1A4KA 1T2QH 4K23L 3SDCA 3SDAB 1U92B 1A6VH 5FYLL 4MQSB 2H26B 2MSPA 2OR7A 1U8IA 2SEBB 4E42B 1P4IL 1KTRL 1RVFL 5BVJA 5HHNA 3IS0X 4ZSOB 1ZXQA 4LRNL 3EJZD 3BHBB 1EEZB 1NFDB 3EFFB 3S7GA 1A6WH 1NGWA 2YPKB 2W0FA 2V5MA 5DZNA 5D1QC 4IIQB 4PRNB 5CZKA 4OCSL 3P2TA 3HFMH 4HPOH 3GSOA 4QRSB 1E4KA 1KPUB 1MJUH 1T20A 3QJFA 5DMIH 4HDIA 4FFYH 3IXTB 2X4NA 3IYLW 2V2TB 1NDGB 1WGOA 4Y4HB 4IDJH 1H3WM 4RAHA 4KMQA 3O4LA 5IKCB 1PG7W 3VGHA 3PWNB 4M8QA 1SY6L 3CH1B 4P3DA 4ENED 3QHFH 1IC5L 2FHFA 4EDXA 3WE6B 1SMOA 4GRLC 1ACYH 4JG1L 1KC5L 3RZCC 5T3ZH 1BBJB 4X6DE 4MCZA 4H25B 5I15H 3T77A 3O2DA 4JM2D 2LTQB 3ULSB 5DMKB 5INDA 4X6EB 4MD5B 4LOUC 5I1IH 5CWSB 1RMFH 5FK9B 4KZDH 5C07B 1JNHB 3QXWA 1WBXA 2WINA 1MHCA 2CSPA 1S9WB 2P8LA 3P9LB 1RPQA 3VH8B 4CN4A 6FABL 2FZ3B 3MRGA 3VA6A 1K3ZA 1FL5B 4BJLA 5I9QC 1OGTB 5KSBF 3FB6B 4U7SA 4C83B 2XZCL 4GSDL 1GPOH 4HZLB 1R24B 3JUYA 5H94B 5GS2D 5HYJA 2VITA 4K7FA 1M7DA 2H3NB 3BJ91 4MNHB 3NIGF 5KZCD 2FX9H 3JXAA 4N0CC 3CVHB 5D1QD 4O2EB 1YN6B 5JW5B 1CL7L 4E41B 5SWSB 1CT8A 3DVFA 1EX0A 3F65A 3MLVL 4X80L 1SYSA 4PTUB 1D9KB 2VJXA 3EZJB 5DD0H 4Y16C 3QNYB 4L8CB 3LDBC 3ZE1E 3K7UA 2JB5L 3LD8B 1SEQL 2F53A 3ARPA 5HHMD 4KRMB 3MRLA 1B0GB 5JIPA 3BN9C 5GGQH 1A1MA 1KXTB 4GRLD 4LIQL 5E8PA 3JV4A 4YBQD 5C70A 1UQSA 5DS8A 3HAEG 1IC7H 1T89C 3FN0L 3RX8A 2GTZB 4M7KL 1KTLA 4P3CL 1HQRB 4YDLC 3M1BA 2ZCKL 2DBJA 2AKRB 2CLVA 1JGUL 3FRUB 1QKZH 1OF2B 3ARDD 4LOUD 1LVEA 4P59L 4PLNC 5CIPB 4CJ1A 1T0PB 5F88B 4HWUA 3SOBL 2H6PB 4HS8L 4UMGA 4X7EC 2ERJC 3KJ6H 2XZAH 1ZHNB 3WIHA 4RGOH 3HZMB 3IAQA 3V52H 5J89A 3NPZB 5I6XC 4QHMA 1NBZB 4NQXB 1QLFB 4X4XA 2B1HH 2C1OA 2GI7A 3B5TA 2ORBL 4P9ML 4XBGA 3OXRA 3KPTA 3F5WB 3VFMA 2AEQH 3G04A 4ZUSA 3AUVA 4N0CD 5ISZE 1FVCB 1S7WB 3LH2H 4XNQB 1FN4B 1OPGL 1XF5B 5D1XC 1I3RB 4BSJA 1OWRM 2C3XA 4PREB 1MF2H 4JY6B 1YEFL 2BJML 4EZMA 2OTUB 3R0NA 4A6YL 5JPMA 3NA4A 1P9MC 4OD3L 4JEGB 1FZMB 3VXRD 4F8TA 1T5WA 1JHTB 1H0DB 2A6IA 2O5ZH 3ZKXC 2J8HA 2QV2A 3BN9D 1A0QH 1HXMA 4UTAH 1HHIA 2BNQA 4E9LA 5F7DB 4QYOA 1GJIA 3IJYA 3ARBC 2YPLA 1AFVL 3ROOA 3QB7C 4LKXB 3QRGH 3K46A 3MJGX 3EO1B 4GKSB 3UX9B 5JW4Q 1DQJB 4XPTH 1U3HB 4U1SB 3VG9B 3V0WH 3MUY1 1FO0H 2FBJL 2XXCB 2BSTB 4ERSL 1BVLA 4Y2DD 1AC6A 3DO7A 5FO8A 4TSAH 1DL7L 4WWKA 4APQC 1QEWA 2Z92B 1FLRL 4OAWA 5KSVB 3TP4A 5DGRA 2EE6A 3BDYL 2VN4A 4QRUA 4L8DB 5IB4B 3QO1A 1DBAH 1QR1A 2E27L 4XNZC 5D9SB 3KLDA 3MRDA 4G9DB 4S0SD 3MBEC 5E8NB 4PBVC 3T8XB 3SPVB 3C09B 2BVPB 3GSUA 1U8QA 2ZG1A 3V6ZA 1Q1JL 1BX2A 4OKVA 1UM4L 1VFMA 4E0RB 1PZ5A 3B2UC 4C4KT 4PJBE 2X9YA 5I1AA 3UTTB 3TBTA 3D1MC 3LKNA 4MHHG 2DB8A 4G80A 4PY7A 1RHFA 2NY0B 4PS4L 1URLA 2DD8L 1RK1A 2HG5B 3BIKA 2AQ3A 3FQUA 3PWLB 1IL1B 1QRNA 4Z7VA 2O61B 2CGRH 1KN4H 2FD6L 5E99L 5CCKH 2WBKA 5TDNA 1J0JA 5J13B 3SE9L 3GRWA 3R1GL 3SE8L 3UPCA 1XF4B 4FQXC 4LCUA 3RWIA 1A7QH 5IWLA 3QP3A 4YWGL 2NTFB 3V5KA 2XQBL 4X4ZA 5FA4A 2MNUA 3BZFA 1DDHA 1QPXA 3FT3B 3WNMA 5HDBF 3HR5A 4YDIH 3OAZH 5EPMB 4APQD 1A7NH 3DRTA 1M7XA 1G7LB 2NXYD 2VWEC 5F70A 3UTOA 5HVHC 1YUHA 4HS6B 5CUSL 4S2SA 2ED8A 3FKUS 4F7MA 3BP6A 3HKFA 2XPGA 3EYUH 1GVIA 3MBED 4AL8H 5IESH 3VD3A 2EIZB 1RZFH 4HFWA 1YMHA 3PDOA 4XMLH 4YHKH 1A6AA 5CEYB 4MZ2A 2E7CA 3L3OB 3H0TA 5IROA 1HZHH 2EDDA 1KJMB 1W8OA 4UU9A 4TN9A 3UBXI 3LKRB 5DD1L 4LMQE 2OZ4A 2ZOKB 5I19H 2VQ1B 1MCWW 3HN3A 1I8IA 4HIEA 5CP3H 5ID1B 2MCG1 1QBLL 4L4TE 3FT2B 4M4RA 1MCHA 5CKAA 1NDMB 5FF6A 1CFQB 4Y8AA 4MXVE 3IETB 3BZ4A 2HFGL 1KENH 1FNHA 1XCQB 3TCXA 2B5IB 4TUKH 4NZRL 2DM7A 3MCLH 1CDUA 5IVOA 1ZA6A 1TQBC 1KJ3L 3SDYH 5D96B 4D9LH 2O5YL 1BQLH 4NRZB 4FQXD 2W0KA 5IEKB 3FAWA 3C9NB 5CSBA 4I13B 2JCCB 3C87A 5I1HL 1GGIL 2AQ1A 5DD5L 3L5XH 3MBXL 3RY4A 5GJSL 5KN5B 4G3YL 2APWA 3H3PH 1DBJL 4R0LC 4RFOH 3S34H 5L6YH 5E2TL 4WI2A 5J7CC 1N5AB 1MJ7L 5F9JB 1S7RB 3SQOH 4PJ5D 1RUMH 1E6OH 4KQ3H 1T7WA 3CLEL 2VLRE 2CMRL 4GAGH 2DYPA 3WFCH 4U33A 3UJIH 2ZG3A 5EH1A 2OZ4H 1K5NA 1P2CA 2DTSA 3UMTA 3EYOA 3IDJA 4K3DL 1J7VR 1NJ9A 4MB5A 3T0EC 5JHDD 2YRZA 4OLYL 2Z9TA 1LDSA 4G8GE 1MH5B 2I07A 1LO5A 5MP6H 3PWJB 3VFRA 4X0KB 1A6ZA 2NY1D 1J8HB 4PP1C 1HIMH 1F97A 3RL1B 1ETZB 3W0WD 1J0KA 3DTXB 4M5YL 3N85L 4M9OA 2V2XB 1IGIH 4XP4L 4HUXB 1Z9OA 4RIRB 1HHJA 2I24N 3TZVB 1NUDA 1P7KA 1KJ2A 4IBLT 2OTWB 4RFEA 2FWOA 4PJHB 1P1ZA 3RPKA 4P2OB 3MFGB 3WSQL 4IMKA 5LKNA 3JWOC 4EDWL 4GJTB 3VFVA 5HYIA 2W0PA 5CEZD 1DQTA 5IJVA 1PX3A 1A8JH 1HQ4A 4PV9B 4U1MB 5A3IC 4G5ZH 1A7PH 3QHZH 3BGAA 3RKDC 3G6AA 5FYJU 1L7TH 5EU6B 3IXAB 3IDXL 3UPAA 3VXUD 5GGSA 1MCDA 5CSGA 3QCUL 1MCSA 1KLGA 2AJSL 3NFSL 1UH2A 2FJFB 4MCYB 5DUBB 3KPSA 5BV7C 1GZPA 1INDH 2O5XL 1E6JH 3KPQB 4OFYD 4XPHH 4LSVL 1JBJA 2KH2B 5GGRA 3HG1D 3DRQB 4I4WA 2AJUH 3AY4A 4XCYB 1JZ2A 1SJVA 3I6LD 4JRYB 4EOWH 1UG9A 3T0ED 5DT1H 1W2KT 1AO7D 1NBVL 3T2OA 1G7IB 4PB9H 1UEYA 1GZQA 4QNPE 4PP2B 5KG9A 3BKCH 4NNXB 1CFSA 3TA3B 2X5PA 3DX7B 1IAKA 5BMFL 2DQIH 2RCSL 4JFFD 3OKOA 3VXNA 4PP1D 5IFJB 1Y6NR 3QXVA 1NPUA 4X7FC 2M8XA 2XZQL 3NZ8A 2F54D 4IRJA 2EIBA 3R06A 3O11A 1JWSA 2VAAB 5I66A 3H9HB 5T1KA 3ZTNH 4N68A 1R3IH 2MQCA 2BDNH 5B8CA 4JPVH 1ZTXL 2EDQA 2P8PB 3BW9A 4JFYB 1VKXB 3EOTH 1YEDA 5EBMA 1IARB 2BRRH 1WAAE 5MENB 4UT9H 5MERB 3FQNA 4PJCB 1AQDB 4PJGB 3QUYA 4KI1A 2Z8WC 1BD2B 3UTQA 1J1OH 5D7LD 1N5YL 5C08B 5H37H 1KB5B 3GMPA 4MXWH 1SM3H 4YX2L 3HMWL 1AXSA 1EGJH 2X2YA 5CHNA 5F1IB 1ADQL 2A6DB 4PB0H 4L8BA 5IUSA 1QSEB 2GAZA 5I76B 3H7LA 1YNTA 3OB0H 3SO3C 4HKZB 3RWFA 1HILA 1MLCB 1CDCA 3H42H 1WWCA 3CX2A 4JQXC 5EORH 5BO1H 1OAYL 5DRZB 4RNRB 1C16B 4WUUD 5E0QA 3KR3H 4FABH 2Z91B 2ED7A 3QEQA 3W9DB 2EDKA 3CU1A 4GAYB 1KYOK 4JJHA 3O9WA 3U36A 3LIZL 2V9TA 2C3HA 2BCKA 3WD5L 2CPCA 3SDXF 4YHYC 1QSVA 2Q7YA 5FV1L 1PG7X 4WI3A 1BP3B 4RGNC 4LKCB 1O7SA 5A2JH 4JKWA 1DBKL 2X9XA 3QIUA 1FZOA 5IF0A 4B41A 1KUMA 4IRSB 1QFUL 1G1CA 3LS4L 4I0PD 3IDIB 4M62H 1WWBX 3RWCB 4OZIF 3QDGA 4QTIL 5F1OB 4EI5C 2VLKA 5GSRA 3D69A 4TQEH 4OF0A 3LPGA 4B7IA 5DVOA 8FABA 4P57A 5HJ3A 2CIKB 1R3HB 2HRPL 1R5VB 3B4NA 1C5CL 5IVXE 4ZOCA 1JFQH 3VFPB 1FORH 1NCBL 2DWEA 3GM0A 5EOQH 2FIKA 5KS9E 3QJHB 4IHOA 3W0WE 1WCBB 3BH9B 5A2FA 1QQDA 4NCDA 5EC2A 1FYTB 4FQJH 5C9JB 2DM3A 2FGWH 2YUVA 3H7BA 3K8LA 3Q48A 1ZHBA 1UXSB 4P2RD 2APTA 3FQWA 1DR9A 4ELMA 3SY0A 1P7QA 5IFHL 5I1DA 4OF3A 1NCDH 1KXVC 5GS3A 4BFGA 1XGTA 4N1CA 5CGMA 3VXTB 4Y89A 3MRIA 4HEPG 4F2MB 4X7DC 3TPUA 3MO1B 5HYSG 1H3PH 3S5LB 4Z78A 2IPTL 1IQDB 1FG2A 2PN5A 2IADB 2VSCA 5I18H 5IB1A 3VWKC 4OZHB 2XXMB 4MGXA 5JW4N 4JFOB 3SGJA 1T7YA 3VXUE 3INUL 4LLYA 4RGND 4N9GB 5DVMA 1NGYB 1TZGL 4N0UE 3I2CL 3PWPD 3VFWB 3RL2A 2XKUA 1C5DB 5AZ2H 3FOMB 1IAMA 1IFHH 3HG1E 2WLYA 1KLFA 4MDIB 2BZDA 3I3EA 5BS0D 4EI5D 3DX8A 3SDCB 3U9PL 3I6LE 1CE6B 3A6BH 1CXKA 5F9DC 3WFDH 3LPFA 1WFOA 2V2WB 5H2BA 1G7QB 2D03H 3SGKA 3MFFA 5HHNB 3IT8D 4XCCH 3OZ9H 2NX5B 1A7OL 2LAGB 1UVQA 3ARQA 4PRAA 4QHKI 2IQAB 3JV6B 1G9EA 5J4MA 3WHXB 3VE0B 3GSXB 4O00A 4ORGB 3PV6B 3UTZB 3MNVB 2P48B 4LVOC 3SDAC 4RWYL 5E08L 3G5XA 5EC1B 3TBVA 5F7EH 1NL0L 3IDNB 5D7SH 1J1PH 3ZDZF 1OLLA 2VDKH 1GGCH 5IT2L 1C7TA 3DPBA 4KZEL 1IAII 5HGAB 1I1AA 1ZSDB 4P3DB 3NA9H 2J12B 2YA2A 5E9DA 1WBYA 5IVZB 3RPIA 3NTCL 1EZVX 4RFNB 1RUKL 5DMYA 1A4JA 4GG6A 2DQDH 4ONGH 4IIQC 3VWKD 5F3HA 1S3KL 1ITBB 2CO6B 3MOAH 1K8IA 1Q72H 1UACH 5T1MA 4RAUB 5EO1A 3S97C 3V5DA 2MMXA 1W72B 2B0SH 3CMOL 5INDB 5DJXB 4Q9QH 4Y4HC 3M17B 3NFNB 5FOJA 4JPIA 4MSWB 4N0FB 5I8OH 3S36L 5CJOL 3TVMD 4IMLA 1DLHA 5M95B 1JNLL 2WINB 3LQAH 1KIRB 1MHCB 3WUZA 3PNWB 3I02A 4WEBL 4D0BA 32C2B 1X4XA 5T3XD 4P46B 2MFNA 5IB3A 3D39A 1JPFB 5HHVH 1GGBL 3SGDI 1MFDL 2DKUA 4TNWF 4D0DB 4I3RL 3MTRA 1FSKB 4MNQA 1XF2B 2H45A 2FX7H 3FFCD 5CMAA 5SV3A 3WXVL 3VA2C 4FTVB 2LTQC 2VLJA 3VDAA 4OGXL 3DUSB 4KDTC 4YXLL 1KGCD 3CZFB 4MD4A 4M7LH 2DLFH 5TF1L 4OZGA 1UJ3A 1WIUA 2AV1A 2QHRH 4HFUL 2AV7A 2HJLA 1HINL 2P7TA 5F7UA 1SYSB 3SDAD 2K7PA 3T3PF 5LQBL 5FYJD 3NCFB 4UV4L 3VDBA 2JTDA 1UWXH 2C5DC 4QHNB 1OAKH 5T1DH 3LKQB 2OSLB 1NAMA 5LGHL 3FL7A 5DTFB 3NIGE 3ZDXF 3C08L 3GMQB 1ZLUH 4C56A 5TQ0L 4JREB 3QIBB 3CDGB 4PUBH 4GS7B 1UQSB 5DS8B 3KJ4B 5ALCH 1XFPA 1YDPA 4KJYA 1PKQE 3UJTH 5BV7L 2WUCH 2ZJSH 4W4NA 1CD1A 4XPGL 1D9KC 2FB4H 4P2RE 1KCKA 4WIQA 4ODUA 5B3JF 2E9BA 4PJXF 1UT9A 1IGFH 4Y4HD 4N1EA 1K9TA 1ERNA 3MROB 3LD8C 4H0HB 3W39B 2I60L 2UVFA 2OL3A 1QNZL 5FAAA 4N90D 2A74B 4F9PC 4YXHH 3ALWA 5CILH 2CRYA 1FO0B 4HXBL 1BQSA 3HI1B 3KPRB 4K3JH 3QIWB 2NZIA 5C0BD 3T2PA 4QT5A 3I50H 4HXAH 2C1OB 3BMVA 3S3JA 4CW1B 1I9JL 5E1AB 2F8VA 3EW3B 3S5LG 1SVZA 3OXRB 4L4VA 4C58B 3EIFA 1EEUA 3PWPE 3LRSB 1TCRA 4JQIH 3CZJA 3CUPA 4ZFOL 4ONOA 2YA0A 1AJ7H 3H9SB 5C07D 2PYEB 3SDDA 5BS0E 2VOTA 2VXUL 1MI5D 1NAMH 1QHOA 3GJFK 2JJSC 3ZZ1A 4OCXH 2AJVH 1F3RB 4ZPVA 1VACB 2GYSA 3TGXA 5ITFA 5CZVH 4JB9L 4LSDA 3EDEA 1FFOA 1JMXA 3AS2A 4Y5XA 4PJEA 1IT9H 5D8JL 3L3HA 1OP9A 3CXHJ 2OJZH 1I7RA 1RZGB 2BNQB 2XN9E 1L0XA 3OJMB 2EECA 3BWAA 4YHOL 5ERWA 5SWSD 3PJSA 4WW1A 2OL3H 1QBAA 4NQTA 2ZCLL 3RNKA 5J06A 5GRWA 2A83A 1D9KD 1OL0A 1JV5B 4R26L 4O2FA 1Q38A 5EA0H 4ZTPL 1D5ZA 4JLRB 1JUFA 5EO9B 3P77B 5J6GB 1C5BH 2H2PC 1WEJL 3AC0A 4WWKB 4AK1A 4QRQA 4KKAC 1YC8A 2XG5A 1ZLVH 2FR4A 1FVDA 2VUYA 1HE7A 1ZANH 2FBOJ 2J8UA 4XVJL 4ZFFA 1CVRA 1JTTA 1TCMA 2X4SB 1IKFH 5LG1A 1QP1A 2AEIT 2MPAL 1JF1A 3QQNA 1NEZB 2GJ6B 1ZHLA 7FABH 1DQML 1U3HC 5BQ7A 3VG9C 2VISB 4Y2OA 3T65B 2DICA 1K3IA 3WLBA 1BPVA 4X4YB 4Z76A 4JO2L 1M71A 3VI4E 4H8WH 4J8RB 5C0DB 1B90A 3S4SB 3NIFE 3MLYL 1OTSC 1RHHB 3D85B 5AAWA 2AXGA 1I9IL 5L0QB 3FFCE 1LHZA 3DMMB 3GB7A 3N9GL 2WWMC 2EICA 4MDJA 1KGCE 5IOPB 4NYLB 2DI7A 5DJ6B 1A1NA 2HKHH 3VRLE 3C09C 3P11L 1X7QB 1G6RB 1CFTB 2BVTA 1DBMH 3T0AA 2DDQL 3DYPA 4XAWH 2BY3A 1A3LH 1HKLH 5IM7A 4TSBH 1JWUA 4LCUB 5ICXB 4V2BA 1FDLL 2Y7QA 5MEPA 1PEZA 4KROB 4OV6F 4HWBA 2NY0C 4RQQB 5B38B 5KSAA 2AJ3A 5JDSA 3Q3GB 4G6FB 5A2LH 2YSSA 2VQTA 2H2PD 1GAFL 3MREA 3QDME 4N0YH 3UZQA 4KKAD 4AZ8A 2EH8L 3GMMA 4MJIB 3DRTB 4PRIA 2W0LA 4FQLL 1P6AB 4ISVB 3VD5A 5J13C 4X7TB 5CSZA 5FA3B 1I7ZB 3W2DH 4F7MB 3L95A 5FXCH 4WFFE 3WDIA 5HHXH 5MEOA 1KCRH 4ZPTB 3VXMA 1OSZB 2Y5TA 1IC4L 3O0RH 2P42B 4L9LB 4P2QE 4ZUTA 3X3GL 1YMHB 1U3HD 5HI4C 5HDBE 5KVDL 4OGYH 2RQ8A 4UILL 4N90E 1OP3H 4PRPD 2VXSH 1CZ8H 4P5MB 5ALBL 5EFIB 5JXAH 3ES6A 5KTEL 1D6VH 2EXYC 2HVKA 2VC2H 4ZFZB 4NQDB 1OAUL 2C1PB 4PJAB 5C0BE 1OTSD 2Z31A 3MV11 3QG6A 5SWZB 2LAAA 4JFPA 5HYFA 1FH5H 3NN8B 2Y36L 4MJ5B 3RY6C 5ILTL 3ZO0A 2AW2A 4KQ4H 4OUUB 4N8VB 3U0PA 2WWMD 4ELKB 1XGQA 2XA8H 3I6KB 4UIMB 1JRHL 4YDKL 1MCNA 3QA3B 5JHLL 1T1WB 2D9QB 4EUPG 5I17A 4XVUC 4XMKL 4H20L 5FYJL 1ZA6B 1YNKH 4HWBH 1EZVY 3C2SA 5JOPD 2IH3B 1MI5E 5DQDL 2EZ0C 5E94A 4KY1L 5J11C 3TT3L 1IVLA 5FECA 1VPOL 1TJGH 3UTTD 5CEXA 3LKPB 4QY8B 1SJHB 3PHSA 1J12A 2V7NB 2NY0D 3LN4A 2VE6A 2AJZA 1R5WA 1E4XI 4LHUB 1B6UA 4UINL 2DWDA 1T3FB 2XWTA 4ZTOL 1CLYL 3LV3A 2B5IC 2FSEB 2KPNA 5JW4R 4X6CB 1U2CA 4A6YA 3BQUB 4ZQKA 1NFIB 5D96C 4PJIF 3D18A 2IAMA 4PJ8A 3VXSD 4ZOEA 4O9HL 3AREA 3SGEI 1U6AL 4L3CB 5L8LB 1MPAL 4HS3B 3EYOB 3GMNA 5DJDA 3MACL 5HI4D 4ODWA 1YEIL 2ICWA 1OAZH 3P30L 5C09E 1P5VA 4FP8H 2I07B 2QQLH 5EWIL 3WS6A 1LO5B 3SE4A 4UIKL 5C6TL 3RJDA 2XWBB 3AU1B 1EHLL 5IMMB 3O3EB 4NBXB 2O26U 2CUHA 2D7QA 4LAQL 1A7RL 3DLQR 5I2IB 4GQ9L 1T7XA 3OKNB 5F7HA 4H88H 4AEEA 3L3KA 1WV7T 5FB8A 2K3TA 5DHVA 3F12A 1P7KB 1FVEA 1NEZG 4XVUD 4GMTH 1L9NA 3VFTB 2Q6WA 4LASL 3MRQA 5C0FB 2CRMA 1EBPA 4RMWA 5DWUL 1CDGA 4O58L 1P1ZB 2J6EA 2EZ0D 1YNLL 3ZYIA 2YD2A 1OAQL 1LE9A 3LZFH 3VFVB 5DHYB 5TGBB 3X11B 3OJDB 1NLBL 3BZEB 5BZWA 3QO0A 3WKMH 3GJEA 2R1WA 2AK4B 4O02L 2VL4A 1V3JA 3C5SA 1DFBH 3QSKB 2ICWJ 4LLQB 1Q94A 3G6AB 1U8MB 2NY4B 4NO2B 4PJ9B 3ZKQD 1QRKA 4TUOA 4JFHD 2A73B 3ZKMC 3TZVC 3E6HA 4JO3H 5GS0C 2QLVB 2WIIA 3QEHA 4DEPB 4WGWB 2IALA 4D8PA 3BO8A 4NZUH 3LPWA 4GW1A 4P2OC 5HPMB 1CXEA 3AS0A 4KPHL 4HBCL 5BZDB 4NC2B 3EGSB 5TH2B 3MLWH 2DIAA 4OJFL 2GT9A 2E7HA 2BSED 4DTGL 5KG9B 3MZTA 4OBSA 2R0ZH 4XWGL 4RBPH 4QKXB 1GL4B 5HDQL 4XPBL 1MCWM 3CFCL 4MHHI 3GJFB 4Z7WF 3GIVA 2VUOA 4PIRF 3EDDA 5J1AB 1N7ML 3OKOB 5HVGB 5ANMB 4C57C 2R2CA 3BP4B 3MSPA 4HCRH 1SBSL 1V8HA 4PR5B 1CFVL 2J6EH 4JM2A 4GRWB 3AMLA 5MEQB 4PRPE 2WQRA 4NQSA 4ETQB 3LAFA 1A6TA 3TA3C 4F80A 4X6FA 2I9LA 4D94A 3JTTB 4KJPD 1NLDH 5BOZG 2CDEA 2LU3A 4PJBA 2VABA 4K7PH 5E2UH 1FRGH 1YN7B 3RQ3A 2OQJA 43CAA 2WV3A 4WW2B 3THML 3QULB 3T04D 3SJVD 1T22B 3OAYK 2H1PL 2BP3A 5A40E 3WEXB 2GAZB 1HXYB 1OTUC 1BLNA 1HH9A 1N59A 1HILB 2ADGB 3ZKMD 3TZVD 4N8VG 4ALAL 3IU4H 2DQCL 5GS0D 2DI8A 2OMNA 5D1QA 1B0RB 3KPPA 3PHOA 3UTSE 1AR1D 2NY6B 4P2OD 4HX1A 2BFVL 3QEQB 4Z6AT 2VYRE 1K6QH 1GC1H 4X5XA 4NQED 3KXFB 3C2AH 4QXUL 2VAJA 3E3QE 2HT4D 3DYMA 1PSKL 4P0DA 3QDHA 2G9HB 3U4AA 4NZTL 5EU6D 5IHLB 3BRFA 5HHOD 1TENA 5FO7A 4OCRH 2BVQA 5DR5H 4YPGA 5EUKB 5B39G 4GRLA 3ARZA 3BUTA 5JXEC 3B8YA 1MJ8L 4KVCL 4PRBA 2WM0A 2ILLA 2C3VA 3VXSE 1I3GL 4R96B 1TETH 4QHLB 5FM5M 4LLWA 3OHXA 3GI8L 5D6CB 1UEMA 1AE6H 3QWOA 3QQ4A 4M6AA 4F8QA 4JRYD 3R8QA 1BHGA 4P57B 3MLTA 5HJ3B 3FTGB 1YPZA 3CSYA 4EIZC 4GAJH 3TA3D 4JCLA 2NY7L 5E8EA 1CGSH 4M93B 5JIKA 2HT3C 1X9QA 4Y88A 3RWJA 4R2GB 1LO4L 4PJDB 4Z77B 4OZIE 4IRSC 3BKJH 5I1EL 4KKCC 3FONA 4WHYH 1ZEAL 4CVUA 1ONQA 3OPZL 1DN0A 5GGTL 1QFWL 4M6NL 1NGPH 1CF8H 3H7BB 1RIVH 1UZ8A 4LSQL 1IZJA 4WVRA 1OTUD 3B9AA 5T1LB 4OFKA 5FGCB 3ZMRA 5F9AC 1W0VA 2BNRB 3UPRA 5D5MF 4YE4H 4AJ0A 3QAZB 5J3HC 2IBZX 3MRIB 1U41A 3AXLB 3V4VH 1BD2D 1J0ZA 4Y16A 4LSUL 1S7UB 5C08D 5IB1B 1U8OA 4TRPH 4QXGL 1U8NA 1CIUA 2DS4A 3VXRA 1K4DB 2HTKC 5DLMH 1F13A 1QSED 5D7JB 1MFEL 4XNYL 4U1NB 3I75B 4C54A 2GSIA 4PG9A 1EHXA 5JXED 3FQXA 4LLDB 5ICYB 3I3DA 1X6LA 2PNDA 1MWAA 5TDPA 1T89A 2QSTA 4ZUWA 4PGBB 2BOCA 1T4KA 2HTLC 1ZT1A 4NQVA 4Y4FB 4C4KO 4LLMA 1TITA 2ZPKL 4G6JL 4KI5C 4OF5A 1HI6A 3R8BB 3BPNB 5CJQL 3UC0L 3HUJF 3CFDA 1KIPA 3H9ZA 4G8IB 3MUZ1 5IR1B 3C8KA 1V3KA 2HT3D 4YHLH 1KIUA 3SCMB 1FG9C 1P4BL 1DJSA 5E08H 3O3BA 1MFBL 1B2WH 1QO3A 4HF5H 4IRSD 3CNKA 1DCLA 1G9ML 2YD3A 4RISH 3DUUB 4U6HB 4MQ7A 3SDCC 3GEWB 3O6ML 1JI1A 1ZVSA 3ECBA 1OW0C 4WEUD 4DCQA 1CFNA 1LP9B 2YKLL 2BC4A 2WBJD 3SKUD 1T2XA 1B9ZA 4BELD 5FGSA 5J3HD 4U2YA 3KNBB 1MCFA 3O2VH 1GIGH 5BW7A 4YIQB 4GG6B 3BRDA 1WZLA 5HD8C 1N4XL 4JDTH 5ITBL 5JNYA 5F3HB 3F7QA 3SJVE 3HNSH 3SO5A 3RWHB 1FYTD 1P9MA 1HHHA 5T1MB 4XCEA 5DSCB 1YJDH 1J1XH 4L1DA 2HTKD 4TULH 3L7EB 3V5DB 3WUWA 3ZDZE 1BMGA 1YEEH 2ESVB 1S9VB 1M7IA 2FECL 1L4IA 1CU4H 1PKOA 3CU7A 1LK3H 4OF8A 2AJYL 1EA9C 2APVA 2PW1A 1VDGA 4G6KH 4AMKL 1QACA 4QLRA 2HTLD 4DUWA 4NQEE 4PJFA 3BGFB 4RFNC 2YD7A 3D39B 1UA6L 3RUGA 4GBXB 4O4YL 1WFUA 2VLLB 4KI5D 1YY8B 3HRZA 2R1YB 5EU6E 2FRGP 4UNVA 4AIXA 4YXKH 5HHOE 4PG2C 3R0MA 4APQA 4K94L 4X99A 2DQJH 4MD4B 5EU5A 1I8MA 5DURB 4OLUL 2NMSA 2BOBA 3UAJC 1RD6A 4N5EC 4E5XA 4P48A 3MBEA 1LNUB 4L3EE 3O2WL 1BOGB 4P46C 1ZWIB 4TUJA 4KMLB 4JANA 2APBA 3O6LH 4JDZB 1KFAL 4M02A 1FSKC 2JIXB 3CC5B 1MCOH 3GBLA 2NX5D 5DFWH 3BISA 3QQ3A 1WF5A 1WAAA 12E8H 2EC9T 5C0RH 5DK2B 2R0LL 4ODTH 4WENB 2BSSA 1T5XB 4HIJA 4KUZL 5HD8D 3REVA 3QFJB 2B4CH 3RVUC 3GSWB 3CFIC 3G5ZA 3MRPB 3T3PE 5I8CB 1RIHH 3BXNB 4NRYA 5C0AA 5IHBA 2A77H 5L7XH 4JFED 5D2LF 3ALXA 1LWRA 4NN6B 3VFNB 3NZHH 4ODXA 5IQ9B 2OL3B 2A6KA 4XNXH 3LQZB 3AGVA 2HJFB 1UM6L 4ESKA 1IGYA 4FXLA 4FQXA 4YC2B 1DVFB 1BD2E 1OQOA 3FO9B 3CPLA 4Z7UF 4JREC 3RU8L 3BVNA 3QIBC 1KEGL 1KPVA 4GS7C 1PFCA 1YYML 3KJ4C 5EZOH 3PWUA 4WRLA 4EJ1C 1TTFA 3UJJL 4AYFA 1UXWB 4J6RL 2BHYA 1JZ7A 2QQKH 1CLZL 5B3JE 3KS0J 4PJXE 2JF1A 1ED3B 1OGAB 1QSEE 5F8QC 3FQRA 4ZFGL 4YQXL 3F7VA 5DJ8B 3S88H 5GPRA 1D7FA 3S96B 4BFIB 4BKLB 4YGAB 4U1IA 4HC1L 1YY9C 5GZOC 4ONFL 3F7PC 2DQGL 5FKAB 3UAJD 4PJ5A 2OK0H 4ZS6D 4HHAB 3HC3L 4N5ED 5I8EB 1YECH 5EZLA 1UCBL 2R2HB 1DEDA 4P46D 2IBBA 1B6DA 4MVBC 3QIWC 2DL9A 3KAAA 2GSGA 2CIIB 5JHDA 5C0EA 4JM4L 5FUOL 4G7YH 2K9UA 2P5EB 1I7TA 3BSZL 4FTVD 1EJOL 4XVSL 3BP7A 4PJEB 4QGYA 1H9VA 4YHMH 3WIFA 5KJRL 4M6OH 2CRZA 5J1SC 4GXVH 5ID0A 3ZTJG 3RVUD 3N1QC 3WFBH 4X7SH 5KS9A 3W0WA 4Y1AE 1KCVL 5DC0A 5IGXL 4TTGA 3QG7L 4OZFB 1JUFB 1NMAL 3J7HA 2VXVH 5KVEH 1FZJB 4X4ME 1B4JH 4IS6A 2E8YA 1RZJH 5IMLA 3GSQA 4MA7L 4F7TA 5EZIL 2J8UB 3QIBD 4J4PC 1IGCH 4NSKA 4OQTL 4HIXL 1IM9D 4K8RL 2DLTA 2X6MA 3D6GA 1FYTE 3K2UL 4U7MA 1IAIH 3WKNA 4PGDB 4XP5L 1PLGL 2WNGA 5E2WH 1FJ1B 3IF1A 5DRNB 2P24A 4R0LA 3MXWH 3VXUA 1XGUA 1A14L 4JY4B 4FQIL 3HZKA 3CXDL 1CR9L 3NACL 1YY9D 3HC0A 4PRHB 4Q9RH 5GZOD 1T1XA 4N0UA 2ATKB 1MUJA 4R6UA 4LPWA 5INCB 4OFYA 2D31A 1FL3A 2KZ1B 1MHHB 4XHJC 2FX8L 3QCVL 4R4BA 4F3FB 2AXGB 4KI5E 3QIWD 2IANE 4P9HC 4PTTA 3VXPB 2X1QA 2XT1B 2ZOLB 2JJVA 1Y18A 3T0EA 1AO7A 4DGYL 4OM1H 5ADPH 2J4WH 3HC4L 2ADIB 5FDYA 3S35H 1RQ5A 2IBZY 4JFFA 4XCFL 5DRXA 4BQBA 1MRDH 2CO7B 3SGDH 2X4UA 4I5BB 2DQUH 3H9SD 3OKEA 2PYED 2F54A 3A67L 1LDPL 4IJ3B 5AZEL 1T2QL 1A6VL 5EBLB 4YO0B 5KSAB 5L0QC 3CDFA 1BQHG 3ZDYE 2E6JA 1LD9B 2YSSB 3DMMC 2W1NA 3N1GC 3MREB 4U4BA 5EU3B 3MZGB 3SKJH 5I16A 2H9GB 1EH9A 4KU1A 1A6WL 3HRPA 5ABDE 3DWTA 5C0CE 4J4PD 3LCYA 4G43A 4I77H 3PUCA 4PGCA 4DK6A 3X14A 1PQZA 1A1OB 5D7LA 4HPOL 4PLOB 1YEGH 2NLJB 5DMIL 3GMLA 5EN2A 3KYNA 4OIIH 4X6DB 4JFEE 4KROC 4KXZH 5JOFB 4LPYA 3KDMB 3MYJB 4XXDA 2YUXA 5CBEA 3OX8A 2OP4H 3S37X 3IDMA 3MRCB 1U8PB 2J7LA 4CNIA 3BH8B 1P84J 5E5MB 2QJDA 4WUUA 3C6LB 2VXQH 4HAFA 3G6JB 3OKMA 1EAJA 4XHJD 1T1ZA 1JJUA 1ITCA 1ACYL 5T3ZL 1LEKB 5T5FH 1MLBA 2V17H 1NBQA 4U3CA 4BQ6A 4IEFB 3REWA 5I15L 2QBWA 2E8ZA 2ZSWA 4JY5L 4L9LC 2GJ6D 2RFXA 4I48A 5IHZB 4XT1C 3J8F7 1CGWA 3RVVC 3ZT6A 3QZWA 3V4UH 4NKOA 1WWAX 2PYFA 3KWWA 4PGZA 4HSQA 1Y6MR 1D5MB 5I1JH 1X4ZA 1RMFL 2F5AH 2Y72A 4I0PA 1BIIA 5E94B 1J05A 1VFUA