1Q72H

Anti-cocaine antibody m82g2 complexed with cocaine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
223
structure length
220
Chain Sequence
EVTLQESGGGLVQPGGSMKLSCAASGFTFSDAWVDWVRQSPGKGLEWVAEIRNKANNHATKYTESVKGRFTISRDDSKSSVYLQMNSLRAEDTGIYYCTSVPQLGRGFAYWGQGTLVTVSAASTTPPSVYPLAPGSGGAGSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLNGDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTQVDKKIVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diversity in hapten recognition: structural study of an anti-cocaine antibody M82G2.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Fab M82G2, Light chain
total genus 41
structure length 220
sequence length 223
ec nomenclature
pdb deposition date 2003-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q72H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q72H02
1A6VH 3VWJD 3QFJB 6CGTA 3MLTA 4YEEA 3BKCH 4QNPF 3QIWD 2FR4B 3P9MB 5D2NA 2ZUSA 3HB3D 3L7EB 4NQDE 4OFPA 3ZMRA 5DHVB 1A22B 4KMLB 5D7IE 1PKQA 1FVDA 2APTA 3FQXA 3LB6D 4OT1H 1DANU 5DHYA 4PJ8D 3KPMB 2Q76B 3W39A 2DQIH 3DBXB 1JI2A 1KB5H 1MCFA 5HYFA 1NC2B 4U1LB 3VXMB 2B4CC 5E00A 3S5LA 4S0TD 1U8NB 2LV4A 5C2UB 3LEVH 4HSQA 5DD1H 1SJXA 2ESVA 2X70B 2CKNA 1WTGT 1H3TA 1P1ZA 4KVNL 3E3QC 5IM7B 3WS6C 3K8LA 2NY0C 4I0CC 1H5BA 3B9KA 2HWZL 1IM9B 2LFGA 5FECA 1J1XL 2WMPA 2OYPA 4KUCD 5HPMB 3BX7C 4WDIA 4F8QA 2P5WD 1T2QH 2APWA 3VI4F 2VERN 4KVNH 1CFQB 2VDOH 3ROOA 5ITBH 3DHJA 4G3YH 7FABH 5JXED 2I9TA 3EOBB 2C1PA 3VGAC 4MAUH 3RP1A 5BVPL 5J9PA 2EE9A 2H32H 3H9HA 3SKOA 5L2KA 1R5IA 1F6AB 2JK5A 2WWKT 2CRIA 5DMJB 3HUJB 4LRIA 4M7KL 1EO8H 3K1KC 3UDWA 2F8XC 2ATKB 1I9EA 2XWTA 4LP4A 4HUXB 2XWBA 4OZ4A 4XHQA 1WGOA 1FAIL 4QHMA 2QL1A 3D5OF 1KFAL 1FNHA 3FO1B 1VDGA 1BF2A 4HXAH 2BOCA 1DL7L 4KQ3H 4Y1AA 5B22A 4I9WD 4HWBA 1H0DA 2ZG1A 3CSYA 4NZRL 2KQMA 3KPTA 1T1WB 3HZYA 2AJYH 3KJ4C 5F7YC 1CE1L 4YDLC 1DBJL 1RU9L 1TJHH 3FKUS 3PWJB 2Q3ZA 2R2BA 2NTFB 3MLRH 4QO1A 1KJ3L 4Z8FL 5F7EL 1BHGA 2VAAB 3IU4H 3KLAB 4JY4B 1T03L 4PV8B 4BK5A 1SBSH 2DWEB 5HI5D 3GJFK 1TITA 3OR6A 3FOLA 3NTCL 4WHYH 3EW3B 1IM9A 4Q74A 5T3XH 3SDAB 1I1AA 2EECA 4QF1B 1QYGH 1F02I 2N7BA 1Q1JH 2ADJB 4GW4B 4OLEA 1QSFB 3PGDB 4YDIH 1D5IH 3CFIC 3W0WD 4DZ8B 3EYFB 3QEGH 2EYSB 3JSSA 1DQQA 3TEUA 4JPWH 5LAXB 5CZVL 5F6HJ 3P11H 2G60H 4IJ3B 4WFED 1KCSH 3HC3L 5E56A 1IC1A 4XH2B 1OW0C 3LH2L 1VGKB 1XGTA 1R3LB 4AZ8A 1MCOH 5KOVC 4U7MA 1S7SA 2IAMB 4G6KL 5E2VH 1KPRB 3WFHB 2ICWA 2NXZB 1QTYT 5HI3D 3HZVA 2JIXD 5AEAA 4OIAA 2YZ1A 3VFVB 2BHZA 5HHOE 3LQAC 5EFIB 1HSBB 1QZ1A 4PGEA 2P7TB 5FYKL 3K1DA 2H2PC 4MQTB 3ALXA 4Z0BL 3O3BA 5F7LB 4LU5L 1NCCL 1EVTC 4TNWK 2X40A 3HG1E 2OX5A 1GZPB 1T1YA 4QGTA 2SEBA 3MLXL 1TQCC 1CI5A 4U1KB 5C0BE 2ITCB 3IDXL 3NCYP 1RUML 5E7BA 1LE9A 1JWSA 1S7WA 4DGYL 4R3SA 5F3HA 1YN7B 5EU7E 3QNZB 5L9DH 4OCSL 1V05A 4LVOB 3K8MA 3TWCL 3VG0L 3VXSA 2AJ3A 3MRGA 4JJ5A 2ERJB 2R15A 3WEXA 4NN6C 3D3VE 2DWDA 4PTUA 4JM2A 1OD7A 4PGJA 2QHLA 4NCC1 1QSVA 2DQDL 4M1GL 4MXVF 1FO0A 4ZUTB 2HVKA 3FT2A 1RVFL 1BQLH 4MMXC 4DGYH 5TQ0H 4GKSB 1VFBA 1IAII 5IW6A 1FJ1B 4M7LL 4PJHF 4UNTA 3RU8L 4HIJB 1SEQL 2ZUWA 1OM3L 3NCEB 2Y36H 4F7TB 3D0LA 4GW5A 1KCVL 3MLSH 3STZA 2DMKA 3N0PB 1I1AC 5HYSA 5GGQH 5SV3A 3PHOB 1YEEH 3G6AB 5DEFB 3WSQH 2DJSA 2J8UE 1BEYL 3ZDYE 2XTJB 3B2VH 2PNDA 4G8GD 1J5OH 1EHAA 2FDBP 4ZAKC 3TO4C 3QDJA 3S35X 5TDPA 4OM1L 1QLEH 3DGGB 2OJZL 5KSAD 2SEBB 5SWSD 1ROWA 1NBZA 4L4TA 1TPXC 4TOYH 3MRCB 4MNQA 4NNPH 3Q3GA 4YO0B 4JM2D 2H1PL 4WUUD 4RX4D 2P24A 3O45B 4IRZL 1ZHLA 3X12A 1QD0A 4LRNL 3FZUD 2NY4C 5KANG 4C56D 5C0GB 3GMPB 5FGSA 5DQDL 2EH7L 4QNPE 4PJ8C 3IDGB 5I66A 2J88L 5F88A 5J6GA 3HMXL 2VLRE 3MCG1 4EBQL 1CXFA 3JBG7 1HCVA 2N7AA 5HXMA 1MJ7L 4RMUA 4MQ7A 1TQBC 3DO7B 3LSOB 3O6MH 4TULL 5JIHA 4ELMF 3QWOB 1EEZA 2A74A 4DVRL 3I6KA 5D7IF 3HTLX 5CMAA 3C2AH 3CDFA 4C55A 3TN0B 1AGDB 1GRWA 2MMXA 4NNYA 3DUUA 5I30L 5FYJD 1YEIH 3QIUA 5MI0C 2R2EB 2J88H 2ZSWA 2IPUK 1CYGA 4P4RA 3ULVC 4P59L 1LO2L 2R1WA 4XC3L 3LIZH 4Y2DB 1ORSA 4KUCF 5TH2B 4YHLL 2CK2A 4PYHA 1R24A 4WY7L 4Z7QF 1HKFA 1KTDA 1I8LA 3JV4A 5ESQA 1RK0A 5T1LB 2UWEF 3FFCA 3PV7A 3T2OA 4YDKL 3UMTA 3UO1H 3O2VL 4JRXB 2XRAL 5DK2B 4PJFE 1BIIA 5JW3H 4BH7B 1XIWB 1HHJA 1MFDL 5A2FA 4FQLL 1U95B 1ZHBA 1WBZA 5B4MD 1KLGA 3P4OB 2W91A 2VDRH 1QBBA 3UJIL 3IGAB 3K0WA 3K74B 3V7MA 5L6YL 1QRND 5M7QA 1JWUA 2VLRD 3O3DA 4KFZC 5GGVH 1NANI 4N0UE 4U7SA 4QRUA 4ZMAT 3HMWH 2WSKA 5DRWA 4QHNA 1UYWH 3T0BA 2J2ZA 1V5JA 3KPOB 1F4WH 3PJSA 3RVTC 4DQOH 2EXYC 5D1QB 4GS7B 3VFWA 1U93B 4KXZI 5FGBA 4U0RB 3E6FA 3NH7L 4NNXB 4AIXA 1R5VA 2VR4A 3QJHA 4IHOB 4FTVD 4LIQE 4L3EE 3SEPA 5C0JA 1ND0B 1RIVL 4WEUD 1JGVL 3IFNL 1T22A 4DCQB 3DX9A 5C3LD 4PJGA 4WV1B 1QLFA 3ZDZE 1RZKL 4X4MA 1H5BB 3OB8A 2C5DC 1QEWB 3BKML 1TVBB 3RTQC 3SKMB 1K2DA 3QEHB 4H1LH 1CE6A 4GRLB 5A16B 4MCZA 2B0SL 2OJEA 2OSLA 4K8RH 4NSKA 1CFBA 3BZFB 3GSQB 1B6UA 5DVKA 2ILLA 3ZYJA 1JGVH 2V2WA 1F8TH 1F4AA 3IFNH 3VRLE 2CSPA 1G9NH 4RAVA 3UCRA 4RWYH 4M7ZB 5TDNB 3VI3F 4ZFOA 3IU3A 4XWOC 5BS0D 1SMOA 1XIWD 4JVPA 1N2RB 1IGCL 5C7XH 1FVDB 1HH9B 2HT4D 1G6RL 4X7CC 4O58L 1A64A 2OJZH 4ZPTA 3SDCB 3VXRD 4BSJA 3ULUE 2IAMD 5HY9A 1H8NA 4HWEL 2VDKH 5C0FB 4XZUB 1G9NL 1RHFA 1YEKL 3EDKA 4Q0XH 4FTVA 4U6VH 4BH8A 3E8UH 1R3JB 4HMCA 1MIEH 4ALAL 4WNQB 2EDWA 4H20H 4JY5L 2E7LA 3TH4T 2JJUA 2VISB 3PABB 5GS0C 4Y4FB 1MJ7H 3QZWA 1JK8B 1QFHA 3LOWA 2VISA 2VZUA 4XP5H 3TNNB 3G5VA 5F7FA 4F57H 2X2YA 3UJTL 4P0DA 5D7SL 4OT1L 3D6GA 4M02A 4YUEL 3PQYD 1ZGLA 4OCLC 3FMGH 4HUWB 4PV9A 3C87A 1PBYA 2HKHL 5E4IA 1S8DB 3QA3B 2XFXB 2O26U 2FNBA 2ZJSL 5ILTL 4LASH 5D8JL 3KPOA 1KIRB 4Y8DC 5EFIA 1CG9A 1KEMH 3GGWA 1MRDL 4UV4H 4L4VA 1NJ9A 1ZANH 5K9KB 3KLHC 2CDEB 1JZ7A 5DTFB 1E28A 5DJ8B 3G5ZB 1FLTX 3UC0H 4HBCL 4Z7UB 5DEZA 4ZYKA 3FRUA 3G6DL 3QNXB 4G8GB 5A2KH 2FH8A 3GSOA 1EAJA 4DKFL 1FFOA 3WIIH 5F1IB 4HG4J 5IMLA 5I8KL 1OP5K 2OBGA 3PGDA 4GW4A 1N5YH 3L3HB 4BKLB 3BIBX 4CADA 4WV1A 5JQ6H 4Y2DA 5CEZL 2P5WB 3OR6B 4Z78A 5D7JC 2DI7A 1I75A 3PL6A 2DOCA 1NC4A 3WHXA 2A83B 1BPVA 3SPVB 2XA8L 3SKNB 1T21B 5IB3B 1KTRL 3S37H 5C0CA 5DK0B 4W68A 3MV9B 1J12A 4MAYC 4RGMC 1CICB 5FOBB 4TNWF 4OD1H 5F7MC 1OAZH 3UPCA 1G7PA 3QEQB 3HE7A 3JWNC 4EDWH 1C08B 5C6TH 1HQRA 2MWCA 4JZOA 4YBHA 1C16B 3GRWL 4QRPB 2PO6D 1LO0H 1UKSA 3ARZA 4J4PC 1UWGL 4G8EB 3BRGC 3ESUF 2G5RA 5EOCH 2EYTB 1SBSL 5D7LB 1G0XA 2JK5B 3WFDH 1FGNH 2BDNL 2E6PA 2WBJD 3QQ4B 2ZPKL 2QEJA 1UB5A 4WW2F 2P47B 5DT1L 3OG4B 1A2YB 1INDL 4EDWL 5DC0A 4N0CC 5HHVL 3JVGC 5I18H 3HPJA 2A6DB 2EDHA 5IEKB 1IMHC 4MX7A 4RGNE 1W72B 1TFHA 1WICA 4ZDHA 4L8DA 5E5MB 2V6HA 3W81A 4XBEH 3CXDL 3F8UB 3G04A 4YDVA 4NDMB 4TSBL 4FQQB 3F5WA 5INDA 3MRKB 4LRIC 2ZUUA 5FKAB 4LSPH 3NZHH 3E8UL 4NQDD 4F7TA 3BIAX 2WP3O 1HHKA 3ZTNL 3RNQA 1WAAF 2NY1C 2LAAA 3CPLB 4OZFH 4GG6F 2C3XA 3N9GL 2J8UB 3DVFA 2V5RA 4YBLC 2D7NA 3BMWA 4P9HL 3F6IA 3VXPA 4JKPL 3KPMA 1SY6L 2PTTB 2V7NA 3P9LB 3ARBB 2F53D 1YECL 1TXKA 5IQ7L 3TT1L 2QADC 5JLZA 3O9WC 5FO8A 3B5GA 3NZHL 4ODVL 1A6VL 4DKEH 2FJFB 1FN4A 3RVWC 1J9CT 4P5KB 1OWWA 3K2UL 4P5MB 4YNYA 2HKHH 3BQUC 4D9QD 2JB6B 4Y1AE 4Z7NE 1TZHA 1BVKA 5D2NB 5EUOF 3FCTA 3EDDA 3EYVA 4WU5B 3WJLA 3P2TA 3SCMA 5SWSE 5ID0B 3EDEA 5K9JH 3O3BB 1RVFH 3P4NA 1OTUD 1VFMA 2DQIL 4P3DB 4DUWA 3BGAA 3D3VD 2AQ1A 2VWEC 3HZKA 3TF7C 2B1HH 1NL0L 1AC0A 4P48A 5E2WL 5GZOC 2C7UB 1LILA 1QLRB 2FATL 4E41E 4MQXC 4KDTA 3HRPA 3OJVC 2HG5A 1MCBA 5D93C 2D0FA 2P8PB 4XB8A 3VRLF 4DUVA 4UT7L 1LWRA 3T0XA 3LKOB 3TESA 1G6RB 1N64H 3MV7B 4S1QL 4KMTH 3HC0A 1MJ8H 1OPGL 2HWZH 2JIXA 2L7UA 1WZ1H 3KPLB 2D0GA 3VE0A 5CEZH 3N1FC 3W2DH 4U0QB 1JNJA 2A9NL 4I5BB 1NL0H 3O4LE 4HAGA 5D5MF 5I1HL 4I0KA 4JDZA 3QDMD 3C5SA 2EO1A 4WI4A 1MRFH 5CJ5A 5T3XD 2QSCL 3O81A 4XCEB 3WD5L 2EDQA 1KBGL 4PPTA 3AREA 3TJHD 5D6DA 5FKPA 3IDJA 4HKZA 3R0NA 4JHWH 2RJMA 4YXKL 3S36H 5I1CL 1G9EA 1AP2A 1G7QA 2P49B 4O5LH 1H15B 4RX4A 3QQNA 2YPLB 2VSDA 3OGOE 4HKJA 4G9FE 4QOKB 3QUMA 1K9TA 4YFEA 4DKDC 1H3UA 4I0PC 3HC4H 2F53B 3S4SB 5LQBL 2VOTA 5K33A 1J05A 1GGIL 1K6QL 5T5FL 4Z7WE 5J12B 5K9OB 2YSSA 3FO1A 3FO9B 1ZS8B 4Z9KB 1U8OA 3K2MC 1A3RH 4PRHB 1ZT1B 1JZ8A 3GSVB 1T04B 4OZGE 2WBJC 2QKIA 2G2RA 4XNZB 4JQVA 1A7OH 2EDJA 5HYQB 2CR6A 4R4BB 1A9BB 4S11A 4P59H 2HRPH 4Y0GA 5CS7A 3FT4A 4N1EA 5J9PB 4LNRB 4S2SB 1RFDL 3HI5H 4R26H 1DBKL 1X5JA 4DZ8A 1PY9A 1PW3A 3ARED 3GMLB 4NGHH 4PGDB 1U91A 3U4BH 2PW2B 2X89D 2ADJA 4IS6B 3FOMA 4M4RA 3FQNA 4ONOA 4HEME 3ILPA 5F1OB 3C5ZB 3MNZB 5DI8A 3LCYA 2I5YL 4HPOH 4Y19E 2D7OA 3MRFB 4FZ8L 4J7RA 4PJ7A 3KYOB 2CUHA 1KCSL 4P2QB 4FOMA 4OCWH 1WTLA 1AD9A 4G6AC 1BBJB 1T66D 1CGUA 1GOFA 1QNZH 2HJLB 4DEPB 5C71A 1T5WB 3ULVL 3CDYA 4LLUA 2CMRH 3EYQD 1I8KB 4U1MA 1J86A 1I7TA 5C07A 4ZQKB 4YX2H 5IQ7H 4NDMA 2F58H 4W81A 4ZXBA 1JNNH 4X6EA 3NH7H 5DJ8A 2VZ1A 4JPKH 3B5HA 3U30C 3ECBA 1OL0A 1FFNB 3LKRA 4R7DB 3BP5B 2CRZA 4S1RH 2IG2L 4LLWA 4ODSL 3H7BA 1IARB 5DHVA 4FQ1L 3OR7A 4DN3L 1DLHB 4NKDA 1TVHA 1JYWA 5EBLA 3H9SA 4PREB 1A7RL 4MVBD 3UPRA 3B43A 3BJLA 3PL6D 3PDGA 4JFFA 3EHBD 1DVFB 1HZHL 5MHSE 3QULB 4R0LA 1VESA 1NLBL 4JZOB 3D18A 1RZ7H 1MY7A 4WI2A 3OB0H 2BOBA 2ICWJ 3BW9B 5IVXA 5DVNA 1VFOA 3LV3B 1XF2A 5JOEA 3KYKL 4KMTL 4NKIL 3RI5K 3LS5L 4HC1L 1BQLL 1CWVA 12E8H 3WS6A 4G6JL 1XGQB 3BH8A 3MJ9H 2Q8AH 4H88L 3QHTC 3QNYB 5EU4B 1UJTA 4XX1G 1LDSA 2HN7B 1KENL 3V6OE 3SKNA 4XBPB 1MPAH 5LWYL 4TN9A 3QHFL 2CLZB 1HOCA 1HKLH 4Y5XC 4Y16D 5CCKH 4HWEH 1NSNH 1MRCH 2AJSH 1XF3B 4M7ZC 3ILPB 1P4IL 5LVEA 4DTGL 1P7QB 5E7FA 3IDYC 5ACZB 1IBGH 1FCGA 4WUUE 1VADB 4D0DB 2R23B 1OAUH 2DICA 1KIQA 1B9ZA 4X80H 2PW2A 3LPFA 5CJBA 4G9DA 4PRIB 4PRBB 2IJ0C 5F1IA 5IMLB 3EYUH 3PWPD 1FBIH 3JV5A 1EFXD 4S2SA 3NA4A 5JW5B 3RWIA 1EAPA 1VEMA 4KZEL 1HKLL 4PR5B 3GBLA 1J8HE 4DJMA 5D7SH 2YD3A 2NZ9D 2OJEB 4NSKB 4OI7A 4G8IA 3V4UH 1R3IH 4N8CH 3RUGB 1X6NA 1AJ7H 3WNPA 5HD8D 1NKRA 3KPPB 3NN8B 5FYLD 4QYOB 5EN2A 5GSVB 3DX8B 5AAMA 5GRVL 1MLBB 1S9WB 4MA1B 4WGWB 4OCNC 3I2CL 4MDJA 4OUOA 4ZUVB 5EORL 1MAMH 1OGAB 3GNMH 4PLJC 4QOKA 1FO0H 5SX4I 5C0JB 3L3JA 1SJEB 3HZMA 4M61B 5J1SC 1HXMB 3V4UL 4B7IA 1KYOK 1S9VB 5HHPB 2GK2A 4MD0B 3RUGE 4BQ6A 3U7WH 1IC5H 2H32A 4NQTA 2MCG1 4DKFH 3BH9B 4MS8D 5DRWB 3OAZK 1OAQL 2VZTA 3O8XB 3RWEB 4GQPH 4XVSH 4PJBA 4YPGA 3UZQA 4PBVC 3ZDXF 4LEXH 5TE7H 2HFFB 2VC2H 4EN3A 4GRLD 2BVUA 2DQGH 3QO0B 2F58L 1BIIB 4HZLA 5JHDE 4X9GA 1J0YA 2WANA 2Z92B 3EYQC 5HJ3B 3GMNA 5IVZB 5IWLC 5JNYB 5J11B 3CFBB 4JVUA 3V5KB 2HFTA 1D9KB 1D6VL 4OZHF 3C8KA 2NQCA 1RULL 4OAWA 4EQ3A 2DKSA 1AIFB 2GSGA 4CVXB 5TE7L 5C0CE 4R96B 3FJTA 4QXGL 3QFJD 3BP7A 5D71H 5BV7B 5EZOH 1GGBH 1NFDE 3BKJH 5T1KB 5ICXB 4JM2F 2CIIB 3OL2A 5I76A 1QHOA 1B0WA 4NNYB 4DWHA 1BVZA 1RD6A 4ZSOB 3F62A 5F1NA 2BDNH 2F5BH 1D6VH 2PO6A 2VLRB 4U1GB 3NFSL 2IANA 1RIVH 2H26B 4HWZB 2EDYA 3FFDA 4KC3B 4P2QD 1NEZA 4OLXH 3L5WA 4P3CL 3ULUC 1J0IA 3SE4A 3BD4A 4WTXA 5D2NE 5F9OL 5FM5M 3RA7H 5I1KL 5J6HB 2XI9A 2VXUL 1NMCC 4QLRA 5IK3A 1FNAA 2MHAB 1LP9A 2DLTA 2Y5TB 4UQ3A 4AH2B 3K80A 3WO4B 2B4CH 2MOVA 4L8CA 2BVOA 5BJTB 1JGLL 2C4FU 3X11A 4XRCB 4OIIL 2J6EA 4PGBB 1ZHNB 1PKQE 3H9SD 5HGGS 3HPLB 3KPQB 4OJFH 3WYRA 2LTQC 3Q5TA 1IILE 5IR1B 2R0KL 3LDBB 4Y2DD 3D2UD 4MJIA 3VCLA 3VFNA 2DB8A 1YMHA 1A6ZA 3T3ME 2DN7A 1A6AB 3OXRA 3P0VL 1FFPB 3MRPA 4P2YA 5DD5L 3QXDB 4KY1H 4QT5A 3C5JB 1CFSA 1OSZB 5INCA 3SDDB 3U1SH 4PRPD 1OY3B 5C0CD 3ZE1F 1A9EA 2FX7L 4IDJH 1YEGH 1H3PL 3BPLB 1DN2A 4KMQA 1CQKA 5HYSB 4PG9A 4AMKH 3ZHDA 3QH3A 3P0VH 3KXFA 3QCTL 1FIGL 2VABA 3KDMA 1CXKA 4ZUSA 4JY6B 2J4WH 1I1AD 4OZHB 1YJDL 2DQTL 1FLRL 3INUH 4EN3B 3X11B 5BZDA 4MQXD 4NJAH 4MD4B 1H3GA 1B88A 2DS4A 2AV1A 3BSZL 4CNIA 2I9LB 4AEIL 5DDHA 3VXNB 5DFVC 3HE7D 3HE7B 4IRJA 1SJVA 3SGKA 3BQUB 1JMXA 2JJSA 3IB4A 1RZIB 1OCWL 4L4JA 3CXHK 3GIZL 1CD1B 5D72H 3LEYH 4Z7OE 3DMMD 4EN3D 2VN4A 3VGFA 1EXUB 1B6DA 4BUHA 4L5FL 2O5XH 4EEEA 1VPOL 4X0KA 1MFCH 2Q20A 4WI3A 5IHUH 4QGYA 3SGKC 3BGFC 1F3RB 3BFOA 4NRXA 1HHIB 4LCYA 4L3EB 2Q7YA 3TPKA 1JZ4A 3H42H 3DUHA 5ITFB 5DVLA 1DSFL 3QI9B 4C83A 3LEYL 3X3GH 3SO3B 1S7TB 2UWEA 4PJXB 5KVFH 3KPNB 2D31B 1U58A 2VKWA 2D31A 1MCQA 1DN0B 3RBGA 1FNGB 5JOFB 3KPNA 4H0IA 1AGEB 1QA9A 2BNRA 1BOGB 4KK5C 5DEFA 3ILQC 3L3OB 3VWKD 4PB0L 3BP4A 3Q1SL 4RISL 1NMBH 4OLWL 1DSFH 1M6OB 2AQ2A 5B3JE 4ZUUB 3BHBB 1FJ1A 3QG7H 3R06B 5LQBH 4I3RL 3Q0HA 2XQBL 3L1OL 3H3BC 4HUKB 1MFEL 4XP1H 3DSNA 3KPLA 1N5AB 4GJTB 2BY2A 5EZIL 5EU3B 1BZ7B 1T7WA 1YEFH 1HXMA 2ICWI 5EU6A 3NCMA 2PETA 3RKDD 1HEZA 5FYLL 4HZAA 4R2GD 5T33L 1CLYL 32C2A 1UWGH 1XGQA 4EXKA 2DMCA 3DI3B 3MBEC 4EI6A 1XGRB 4BA8A 3WNOA 3ALPA 4LFHG 1YN7A 3I75B 1JK8A 4KTEL 2IPKB 2XIDA 5AYQA 1CLOH 2QHRL 4MDIA 3QUXA 5SV4A 1XGPB 2C4XA 2XZQL 2X4RB 4QRRD 2VQUA 1CDGA 4UUJA 3V5DA 5IBLD 3S36X 4ETQB 5J89A 3NGBC 3ARTA 1OB1A 4YGVA 5MEOB 3W5NA 2BP3A 2Z91B 4KDTC 5C08E 2X4TB 4O9HL 1I8IB 4Y4HA 3DTXB 5DS8B 1UKQA 4R6UA 4ZFOL 3OGCB 2VDMH 5GSRB 1H3PH 1P4LA 1MCPL 4FQIL 5DLMH 5JPNA 4LHQB 3CFCL 3W9EA 3LKRB 1BX2A 3MYZA 1RJYB 4FMFA 5HPOA 3GI9H 3MRLA 1IL1A 1M7XA 4V2BA 1IGIL 4X6EB 3S88H 5KSBF 5HI5C 1T7YA 4JFDD 4HXBL 5AZEL 4QT5B 2EYSA 1AXTL 3JWOL 2AQ3A 3B9EA 1MNUH 1QUNA 2B5IB 3Q5YA 1OHQA 4WI6A 3FONA 5AUMA 4ORGA 3VG9C 2H3NB 1YY9C 3VGHA 1NMAL 5F9WB 5E00B 4ZDHB 5IB4B 3AY4A 4HK3N 4L8CB 1F4XH 3V9FA 5TFSH 4KJYB 2V2TA 3JUYA 2L0DA 4ZNEE 1VA9A 2DLHA 3GMMA 4FXKB 3IETA 1R5VB 5I1GH 4KI5C 4NNXA 5JPNB 2Q8BH 1P4LB 1D5MA 3M45A 2QQLH 3U36B 4JB9H 3P77B 2FSEA 3VXME 3T77A 1SYSB 4H8WH 3SGDI 3EO0A 5MEPA 4MA7H 5I19L 1FQ9C 3D3VB 3V6FA 2Z9TA 2HTLD 4OM0H 4R7DA 3QFJA 1MOEA 4WO4D 3T2NL 5I76B 4HS3A 3G5YA 5FUCE 4LAQH 3V52L 1ZKAA 2HLAB 4MDIB 1EBPA 1MI5D 1T5XA 3I75A 5JUEH 3T3MF 1QFWI 1DTUA 1WIOA 3NIFF 2J5LB 4NM4L 5IEHB 4GFTB 1X3DA 3K8KA 3ROOB 4MB3A 3Q1SH 2BCKA 3GK8H 3CFJA 2WINA 3ESVF 2XQYG 4J3TA 1R6VA 3ARBC 5DUBB 3ARRA 4TSAH 1T4KA 4L3CA 3F65A 2E3VA 2FEEI 2Z31A 5I16A 4GAGH 4KQ4H 1N4XL 4XXCA 3C6LA 3L6FA 4OCYL 3X3FL 3BAEL 4MXQC 1J8HA 5D1QC 1FZKA 4U6XB 1I7RB 1CLYH 2BNRB 2A74B 1FNGA 5BQ7A 4OD3H 4X8JA 4NQCE 2XKSA 1G7LA 3ET9F 1A9BA 1QBML 1ZV5A 1I1YB 5HYQA 5KN5A 4FRWA 3U2SA 4X9BA 3O9WD 3E2HB 4XCNB 2EYRB 4D9LH 2PR4L 4UTAL 2NR6D 3VWJC 4M5YL 3C8HA 3GUTA 2HVJB 1PLGL 2CRYA 4LCYB 2P24B 1WIPA 1MI5A 3BE1H 4J1UB 2GCYA 3MV7E 5FHBL 1D9KD 2DBJA 3HLAB 2FIKA 4OD3L 3RX7A 2P43B 4UV7L 1DDHB 3P9MA 3RUGA 1KGCD 1U3HA 3NACL 1JBJA 1SJHA 1WBYA 5DZLA 2IMNA 3QT2A 1D6EA 4M5YH 4JFQA 1FVCB 5GJSH 3V6OA 2NY0D 4MJ4A 4X4ZA 4PJCB 3CLEL 5FGBC 2VLLB 4YHYB 5JORA 1CXEA 2YPVL 4IRJB 4Z0XA 2VAJA 1G0YR 4OCWL 3D0VA 4N8PA 3HNSL 1EMTL 1UA6L 1NKOA 4I5BA 4K71C 5CGYC 5IG7B 2VDNH 1FSKB 4I1NB 3VXPB 1XF3A 5DWUH 5J13C 1J1PH 5EU3A 4YHKL 2JIXB 3Q2CA 5EZOL 4L3ED 8FABB 1YQ2A 3QZWG 4OGAD 1M71A 4JY6A 4MS8C 5ALCH 5GJTL 4UBDD 3L5HA 4F15C 2DYPB 4X7DC 3VXSB 1NFDA 3T08A 3IYLW 1KC5H 3JTSA 2DIAA 3MXVH 5EO0B 3MRRB 2EDDA 5K59E 2WQRA 3SHSA 1QRNB 3HUJF 1UZ8A 4U6YB 1JPTL 3KPSE 4YHKH 2ZKHL 3REWB 1RQ5A 1D6EB 3OKKA 1EHXA 2CO7B 2WUCL 3AUVA 5IEKA 3B9KD 4CGTA 1A7RH 3ARFA 4WU5A 1ZLUK 1A4JB 4JCLA 3WFEH 3EOYG 2FD6L 3WKMH 5CEZE 5BS0E 3MRNB 4OSUH 1KC5L 3ZSSA 5F1KC 1WEJH 4OZFA 2P7TA 2FSEB 2XKUA 4OFYA 4PGEB 5E8DH 1XFPA 3EJJX 3F7RA 2YR3A 3OKOA 4OZFG 3MLPA 4BELD 4ONFL 2ICWB 4M6NH 5BRZA 1ULVA 4ZPVA 3RZWA 5ESAA 5F7UA 4N90D 1C16A 2RIKA 3CMOL 4Y4KC 1Q9KA 4TQEL 3DECA 1LEIA 5DUPH 4ZXBB 3BDXA 4LARL 5IP4A 3KLDA 3OXSB 2PYEE 2JJSC 2FZ3A 35C8L 4N90E 4AG4L 3HNTH 2A0LD 1T0NB 4FQHA 1IBGL 2NLJB 5KS9E 5IB2B 2Y06L 5C0CB 1BBJA 4JREB 4CNIB 3NCCB 1GC1L 1X44A 5ANME 3HA0A 3PWLB 3UJJL 1WBZB 1CL7L 1OAKL 4PP2A 5FUZH 3I6LE 2X4OB 1KFAH 2ENSA 3GSRB 3TO2A 2F54A 3V7AG 3SDYH 3C6SB 4JZJB 2P5WA 5MEQA 5MP6H 2NTFA 1NCWL 4MLSA 3BSZH 4U1GC 4NZJA 1S78D 1Z9OA 3PHQB 1I85A 4LSSH 1BM3H 3HZYB 5BCAA 4GSDH 4A6YH 3GSXB 1MJJB 2HLAA 3ABZA 5FUZL 5E0QA 4OQTH 4LVNB 4NQEB 3QG6B 4MA8L 1GGUA 4ELMB 2EICA 1K3IA 2G2RB 4HS3B 4M9PA 1T04A 3SDDA 3JWDC 1TIUA 1EBAA 4NN5B 1A02N 4QXUH 5ID1A 4RGMB 4X5WA 4G5ZL 1DFBL 2C1PB 2Q3AA 3U0WL 4N9GB 5IFJA 5HHPA 4QCIB 5I71C 4HKJB 3X3GL 2NY7L 1BJ1J 1HEZB 2BVOB 1ZGLB 2W9LA 5J6GB 2WNGA 5KSBB 3RKDC 1P5UA 2MKWA 4HS8H 3TZVA 4YHPA 3MLVH 3X12B 4UQ2B 5FECB 3I3BA 1J0KA 3B4NA 3VWJB 4P2RB 3O2WL 1S9WA 2ZUTA 4P57B 4G6AD 3O3EA 4OFVA 2HFEB 2DTMH 3F7VA 5EOQL 3OJDA 4TPRH 4QRRB 3WIHA 4ZD3L 5IM7A 4X7FC 1VEPA 4U2ZA 3KNBB 1IQDB 2VXVH 3ARVA 5TJWK 5CEYB 2VE6A 2NX5D 1NCNA 2ZCKH 4PJ9A 4MHHG 4NUJB 1Q9LA 2FB4H 5E1HB 3L9RB 5H94A 3BOVA 1KNOA 5D7KE 2GSGB 3G6AA 4JG1H 1UQSA 4NUGL 1RJCA 2DQHH 3RY4A 5IW1B 1PZ5B 3H3PH 5EO9A 2HMID 1CN4A 4NRXB 4KTEH 3VA2C 4K55A 1E6JL 5D7LD 4R8WL 1LHZA 4LDOB 1FE8L 1IQWL 4P3DA 2CJUL 2XZCL 4TUJB 3NFSH 5FUOH 3WS3B 4PJCF 1KTLB 1MY5A 2ADIA 4X7TB 4F2MB 1FO0B 3HG1D 4ZUTA 1OAXH 2O5YH 3WN5A 4X6FB 1VACB 1CU4L 3FZUC 2Z93B 4J6RL 2AXGB 1YEHH 3SE4C 3V5DB 1CL7I 5GRWA 1ORQB 1CFNA 4YXLL 4POZD 4QRRA 1ZOXA 3VJ6A 3ZT5A 4I0PD 5H35A 2H6PA 1MFAL 5JHLL 1A21A 1ZTXL 4OCXL 3HR5B 3BP6A 5D96B 4UT6H 5DHXB 4ZNCD 5JDJA 3UROR 2D03H 4JFEA 2DQCL 1AFVH 2OCFD 2DJUA 3NABH 1C1EH 1BZ7A 2OR9L 1U3HB 4WW1B 1MVUB 5EBLB 3HE6A 1UM5L 1P84J 4X5WB 2UYLB 4PRDB 1YPZE 2XKNB 1MI5B 4B0MM 2XN9E 1ZLSH 1UM4H 4WCYH 4I18C 3PV6B 1V7MH 4PGCB 3WFHA 1JUFA 1WQVT 1S7SB 4JQXA 3G04B 4YDVB 2D7TL 3MJGX 3WJJC 1YUHB 2EDEA 1QQDA 5HYJD 4JRYD 3B9VA 4Z76A 1CXLA 4PR5A 3BXNB 3VWKA 2NTSP 2CH8A 1NQBA 4F7CB 1UCTA 5A16A 5ERWB 5EU6E 3KNBA 5ESVA 5C3TA 3MCLL 1EJ6A 4P99A 1IAKB 5DC9B 4FFYL 3VDAA 2MQ0A 3GHEH 1ZA3B 1YEIL 5IUSA 1W8OA 4Q2ZA 3B5TA 4NQXA 3E6HB 3BJ91 2ICEA 4XNXL 5BZWB 1HOCB 2ZSWB 1A6PA 4HH8A 4YHIB 5IHBA 3V0VA 5T3ZD 4QRPA 1RUKL 1HQRB 5IT2H 3QNYA 1CD1A 3RWHB 2FECL 5CFHA 3TVMA 4ETYA 1IM3B 4QXWA 4XWGL 4NQEE 1KN2H 2H45A 4YFDB 3TJHC 3UYRH 4QXTB 1T6VN 3TVMB 3QDME 3MLZH 1RUAL 2RB8A 3NFNB 3GSNA 4XHJD 5C8JB 3O11A 3O2DH 4BSWB 4Z6AT 2VNCA 5L2JB 1JPFB 5CJ8A 3TBWA 2GTWA 5I1IL 1KLGB 3V4PH 1SEQH 4ZFFB 3BP7B 1XF4B 1L7TL 3OKOB 3HUJA 2EC9U 5BVJB 1MWAL 3KPRB 4R97C 1N4XH 4OZHA 3KWWB 1CLZL 1A1OA 4OCYH 3EKCA 1BD2E 1D9KA 3LKSA 4H5SB 2FWOA 4NQUA 2AAVA 4NP4H 5DF0A 3CJJA 1EH9A 4PG9B 5ACLA 4QWWD 1S9XB 3DGGA 1GSMA 1SEBB 2WBJB 3AFLA 4LLQB 4PJXE 1D7FA 4EUPB 3GEWB 1B4JL 4IBLT 2V5TA 4UILH 4MXVE 1Z9SA 5FA3B 1YUHA 4XC1L 2BVPB 1YY9D 3PWLA 2GITB 1UH4A 3C5JA 2E6JA 5CD5D 3WUWG 4KPHL 2A77H 3FN9A 4U49A 1GHFL 4ZFZB 5CBAA 2XG5A 3BUYB 3MR9B 3QEQD 4PIRF 4DOHE 2BMKA 3T3PF 2A73A 5HDBF 1KF9B 3KYAA 1C7SA 1HK6A 4PJ7B 4RGNB 3FO0L 3HAEB 1IKNA 1NC2A 4U1LA 3VXMA 4TTDC 5BJTA 3TCLA 3EFDH 5J13B 1C5BH 1VFUA 1K4DB 2XZQH 4AH2A 3GBNL 3IJHA 3R4DA 1XR9A 4RAUB 3TYGL 5J4MA 1H5BC 1RMFH 4HPYH 1P9MA 1NEZB 3MGTB 3SE3A 3CLEH 2ATPA 1MFBH 4PJCA 3CUPB 4LGSB 2XZAH 2YMXL 2DM7A 1LO3H 4IRSD 3FO0H 3P0YH 4F58L 1IEHA 2A9MH 4IMLA 3U4AA 2CIIA 3QFDA 4UINL 5KS9B 1CT8B 3O6FB 2VH5L 4TUJA 3WS3A 5TE6H 3RWIB 3TLRA 1VENA 1XH3A 1DBAL 1IGIH 3V2AR 4POZC 3QIBD 3MNVA 4M4PA 4NOBA 1AH1A 1MFDH 4PRIA 1NFDB 1OQXA 4FQLH 2CRMA 2R0ZH 4NRYB 1KXVC 1T20B 4AQ1B 3FQWA 3MRIA 1UXWA 3GMNB 2A1WH 5IIEB 2W92A 3B8YA 3MV8E 2A9ML 2JELL 4ZFOB 3HE6D 3RWCB 1XGTB 4PYGA 2E7HA 1I1FB 1M05B 3A6BH 4XH2A 4PJEA 4LIQL 1V3JA 4PGZA 2VH5H 3EO9L 1AI1L 3ZKSD 1NGZA 2OTUB 4ZAKA 1KJMB 1ZE3C 4XCEA 4UIKH 3TO4A 1I7RA 4M8VA 2VTFA 4XMKH 3UTOA 2X09A 4LSQH 1IAIH 4GRLA 3AC0A 5HHMD 2BVEA 3BEWA 1JHTB 1ZANL 3OJDB 3O3EB 3MUZ1 4HLJA 1EA9C 4J3XA 4MWFA 4HHAB 4ISVB 3WXWL 4EI5B 4P5TD 4XB7A 1BOGA 5I75B 4PRPB 1KB5L 1G7IA 1I4FB 4FFWD 1UG9A 3V7AE 3WFCH 1S9VA 2EEAA 3MV7A 4JY4A 4M6NL 4M43H 2ITCA 4H8WL 2P8MA 1ONQA 1NUNB 1TCRB 3QJHB 5CILL 5DC4B 3WIFB 1NH6A 2X1OA 5JZ7D 5IEHA 1NAKH 3H9SB 4WHTB 4KAQL 3MUJA 1N5YL 4Y88A 4JFXB 1PG7X 2BNQB 1VSCA 5EU5A 4Q9BA 4M93B 3QPQD 2GT9B 2BOCB 2GUOA 4HJJL 5D7LA 4D2NA 5A43C 3O3DB 5CZKA 4ZFFA 5DSCA 5DJ2B 2IAMA 4GG6E 3TBWB 4PP1C 2ZSVB 4MJID 3QIWB 4TNVF 5GPRA 4EXPX 1XIWA 1MSPA 1PG7L 1F6AA 1IC4L 1OT1A 2EH8H 4AEEA 3DRTA 4PJBE 5GISL 5LAXA 4MAUL 1H9VA 3T77B 1H3WM 2GKIA 2HT4C 3ARSA 4HH9B 2B39A 4RRPG 1YMMB 3OSKA 4B41A 2DQJL 3LB6C 1CDIA 2R1YB 3NA9L 4XPTH 5DD3L 5AD0B 5FO8B 4JRXE 3GMMB 1LVEA 2AV1B 1MIEL 3WL9A 4ALAH 4WDIB 2R1WB 4Y2OA 2JCCA 2XOTA 5BZWA 1OARL 5DJCA 4PV8A 3LRSA 5FF6B 4LSVH 1U8LB 5H37H 2DI8A 1NUFA 3U9PH 3QQ9D 3DETC 2WUBL 4BKLA 3C9NB 4XMPH 4FQHB 1C5BL 3S3SA 4NCC2 3QH3B 4ACPA 1I9RL 2X4SA 3P9WB 1TTUA 2BY1A 2UVFA 3UBXB 5HGHB 2AKRA 3ARQA 2P5EB 3QHZL 3THML 1OARH 5DO2D 1WAAA 3QIWA 3QULA 2R56H 2X42A 4LASL 4MX7B 2A6DA 2DLEA 3RGVD 1P2CB 5DSCB 4DAGH 3G08B 4FP8H 4L3AA 4HS8L 3CK0H 1AO7A 1U8IA 3S4SA 3RGVC 4JN2A 3P11L 3O9WA 3N9GH 2J12B 2D2OA 3EDJA 4LVHC 2R8SH 1MVUA 2X9YA 3RAJH 4PP1D 2P4AB 1OB1B 4WFFE 1N3NB 1YMMD 1F90H 4ONGH 3RWJB 4KI5F 5ALBL 1FFNA 1XIWC 2Q86B 1N7MH 1U8JB 3SBWC 4QRQB 4WFFD 1CK0L 2X41A 3VXUD 2W38A 1Z6JT 3QPXH 4XPGL 2FLRT 5JIKA 4LU5H 2XWJA 3GJFH 5F1NB 4A6YA 3PQYE 4ZSOA 3VMPA 5JR1H 1EO8L 2GJ6A 5IW6B 4R9HA 5HDQH 2A6KB 1JE6A 1YEDA 4K8RC 5E9DB 1RUMH 2FX8L 1GGTA 4OF5A 2HVKB 2YOCA 4BSVB 5ACMA 5FOJA 3DBXA 4JO1H 1CXHA 3IFOB 2XNAA 1WVZA 5JOPE 5E08L 1GPOL 4OAWB 4YHZH 3G6JE 5C0AE 4ZPTB 3SDCA 2GQHA 4XPBH 5A3ID 3A0OA 3PQYB 1N2RA 2XA3A 2Y1VA 2ED9A 3ZT6A 1A7BA 1FAIH 4XP9L 1FPTH 4HMDA 3T2PA 3FRUB 1T1ZA 1CDUA 2NY4B 4Z7UA 3D9AL 2X4TA 1ZSDA 3UTZA 5DR5L 3VFMA 4DN4H 2VE6B 5E08H 1P5VA 4N0YH 5F7NC 4R4FL 4P5TA 1ED3A 1OM3H 4GRMA 1TZHB 3PIQB 4O00A 4NZTH 3QXAB 2UV3A 5EU5B 3TM6A 4OGXH 2GCYB 1GGCL 5F7EH 2ARJB 4HWBH 2JKXA 5KSAC 3TP4A 2EKJA 1XGRA 3D9AH 3VFUB 2DYPD 4E41D 1PZUB 5AWNL 1DBJH 1CFTA 2ORBL 1ETZB 2Z31C 1A14L 5E2VL 1JNHA 5EIIB 3VXUA 4JM4L 4NKMB 5IV2B 1KCLA 1IM9D 2MCPL 3IDJB 5GRXG 3BD3A 2CKBL 1G7HB 3IDMB 4HIIA 1G7IB 1I4FA 3TBTA 4HKXA 3UX9B 1FG2B 1DQQB 2IQAB 2DDQH 2CXGA 2G60L 2OQJB 3T09A 5T5FH 4F37F 2FGWL 2IALA 5BO1H 2K7QA 4AL8L 1F11A 2AJVH 3FRPG 5TGBB 1Q8MA 1JWUB 5F96L 4JN1H 2XTJE 5F7KC 3SDAA 2BNRE 2GITA 1R3JA 5FYKD 1H8OA 4LSSL 3BT2L 1DN0A 1B2WL 4FZEH 5D70H 2E7BA 4XX1E 2OI9B 3LKOA 5DK2A 2I26N 5HVFB 5EO1B 4WI5A 2R39A 1EUTA 2BCKB 5EC2B 4RMTA 3VD9A 2VABB 2R56L 3WXVL 2X10A 2HH0H 1V3LA 3O6KH 4G9DB 4RGND 3TNMA 1UGNA 2YD2A 4M1CC 3QIBA 1C5DA 1KJ2H 1NDMA 5I30H 1HHIA 2DLGA 2YD6A 4L8SA 3QQ4A 3T4AA 1A1NA 1B0GA 3KJ6H 3DARA 3P4NB 4UTBL 4KKLD 1H8SA 4ONHB 4RA3A 5HGAA 4E41A 4OLZH 2X4OA 4G5ZH 4N0FA 3IS1X 4KTDL 4QWWC 4GRWF 3BWAB 5GS0L 2GTWB 2F19L 4IOFD 5L2JA 2XWTB 1KELH 4NWTL 1G7MA 43CAB 3RU8H 3KYNB 3D3VA 1INQB 5L0QB 4P4KD 5ALBH 5C1MB 2VSCA 1G7PB 3QEQA 3K46A 2ZG3A 4FNLH 5E94B 2AJXL 4R2GB 5GS1B 4M1GH 2OZ4L 1D9KC 2HKFH 3VU2A 1CD0A 2P8LB 2W0KA 1CFQA 3SDAD 1PY4A 3CFKA 3NBNA 2JF1A 1AC6A 4CU8A 1KELL 1NAMA 4NWTH 5DYOB 5GRVK 3NFPB 3HRZA 4E9LA 5GGVL 3UBXI 1BFVH 2J6EL 3BZDA 2J8UA 4JFZH 5GGQL 2FX9H 4FQ1H 2QSCH 3OKDA 1NGXB 1IC7H 3KDMB 5F9JB 1LNUB 2J5LC 2GJZA 3U9UB 3B2UD 2BJMH 2NY6B 4XXCC 5HYSG 3LS4H 2BHYA 4L4TE 5EUKB 1I9IH 4LPYA 1JHKH 4GMSH 3GI8H 1IZJA 1QSFD 1ZHBB 3OKKB 3S5LB 4P9ML 4H0HB 5D1ZB 1CR9H 4QY8A 4OI9A 4IMKC 1S9XA 4HCRA 2G5BB 1QSFE 1UFUA 1DE4B 3DV6B 5LBSH 1C7TA 4PD4J 3WHE0 3QUXC 1T5WA 1A6ZB 3O4OB 1A3RL 5SWQA 3L3DA 3SE3C 4PRDA 1T3FB 1UB5B 1I9IL 2OR7A 5FIEA 1M71B 3HPLA 3KPQA 1I3GL 3A6CL 1LMKA 3OX8B 4OCXH 1WZMA 3STBA 5ISZD 5AYUL 5C7XL 4NZUH 3M17B 2R29H 3FB5B 4MGXA 3TN0A 5CUSH 5IOPB 4UOW0 4U33A 1ZLVK 1JYXA 4KRNA 3QFJE 4I18A 4X5XB 5H2BA 5IKCB 2QLVB 1BAFH 5HYJE 4OZHE 1ADQL 3PE9A 3D39A 1FVCA 4NC0B 1ZLUH 3LHPH 4MQ7B 2WM0A 1KB5A 3VXUB 5IV2A 4LHJB 2YPKB 4YFLF 1XCTA 1JCKA 1T21A 1NGPL 3UJIH 2A83A 4WY7H 3FN0L 3WV0A 1CXIA 1EIBA 4HG4K 5I9QC 4QRTB 3R06A 1I8LC 1LO2H 1NCAH 1FYTB 4M48H 5GSVA 1ZWIB 2HJKB 1UEYA 5DVMA 5J7CC 4NBXB 3F58L 5ERWA 2NY2B 4X7EC 2BC4A 3IRZA 5HJ3A 4NO5A 3VFMB 1AE6H 1HDMB 1VFAA 3UTZB 4YDKH 3SDDC 2I25N 2AJUL 4X8JB 1O0VA 4XTRD 2N1KA 5ILTH 2OP4L 4UB0L 4MCZB 3PV6A 2Z4QB 4L3EA 4HF5H 1QBLL 4JRYA 2R23A 4Q6IA 4EI5C 4K8RL 3VWJA 2CR3A 2ADFH 5DMKB 1DZBA 3DX9B 3FT2B 1F4WL 3UYRL 2OK0H 3H8NA 1MCDA 5HVGB 5C0NC 4OZIB 1MI5E 25C8H 1CDBA 3OAYK 2WINB 5I8CA 1P7HL 2DWDB 4M6AA 3O2DL 1BGXL 4O51A 3WO3B 5KZCB 2CIKA 2Q8AL 1QLRA 2XWJB 1INEL 1FC1A 4N9GA 2B0SH 1SM3L 4XCCH 43C9A 1UWEH 2Y5EA 5F6IB 4WFGE 4YC2B 3P0GB 1MLBA 4RGNC 1VGEL 5JW4M 1KPVA 4GRMB 3OF6A 2CKBB 4QKXB 4QRPD 3PWPA 4PRIE 1JFQL 3SGJA 3G6JF 5TE4L 1TVDA 4UAOB 5DQDH 3RWJA 4X80L 3QG6A 3HS0A 1GZPA 4X99A 5DMIH 3MV8A 3CZJA 3B2UC 4GMSL 5JW5A 4BYHA 2OTPA 1DLHA 4PRHE 1JGDB 1KIPA 4P5MA 1RAMA 4FTVE 4KH2A 5EO9B 4KK6C 5ELIA 1OTTC 3BPCB 1L7IL 1BLNB 4JANA 3I3EA 1MHCB 5JLZB 5LGJA 1P2CA 4LVHB 3SE9H 4NZDA 2W60A 5M95B 1I7ZA 2WBKA 3MXWL 2O5ZL 3LD8B 4RFOH 4UDTB 5JMRA 2AEPL 3P40A 3PWVB 3MREB 4RIRA 2R0WL 3BZFA 1F45A 4M7JH 3ZE0F 3FFCD 1MWAA 4DAGL 1CICD 5EZLA 5EU4A 3Q6GH 5JW4Q 3RHWF 3ZL4H 1JZ2A 2Z0BA 1FDLH 4Q6IC 3UJTH 4BZ2L 3F7VB 1ES0A 4YUEH 5IR1A 2GW5A 4IOFC 4P2QA 4PG2A 4CMMA 1FL5B 2XTLA 1DQLL 4XVUC 4DK3A 1ODAA 3FTGB 4LVNC 4AIOA 4YHPB 1T7ZA 1RK1A 3AAZA 5DJDA 3MRLB 2R0WH 1CGYA 1EVUA 5ESAB 1AY1H 2O61A 4TNVK 5IB5B 3JXAA 5TF1L 1PKQB 4JZJC 3TIEA 1ZT4A 5D7IA 2YRPA 3O45A 4JAMA 4D94A 4G80A 3CX5J 1W0VB 3QPXL 2IANB 4YK4B 5JQ6L 2XTJC 4JREC 5CHNA 4OD2B 5BOPA 4ZOBA 1OT2A 1BD2B 2EEBA 5I73C 1CFVL 3O6FD 4HUXA 1AKJA 4N0FB 4P2OA 1CZ8H 4DKEL 2NMSA 2GJ6E 2FJHB 5F3BA 4JKWA 1V8HA 2W1NA 2RHEA 4KI1A 1A6WL 1CICA 1P53A 4LF3A 1I7TB 4G7YH 4KJQD 3DVGA 2QQKH 4WHTA 4C56B 2P48B 2PTVA 3DUSB 5EB9A 5T1MB 4NO3B 4J8RA 4CKVX 5T3ZH 5F7WC 4WUKH 3GB7B 1ORSB 3CU7A 2V17L 2W9EL 5IGXH 1Q0XH 4MVBC 2PYEB 2CUIA 4I8DA 4PLKC 5F21B 3EAKA 1FYTE 1OW0A 1YYMH 2BNUA 3MGOA 5EA0L 5IG7A 3U7YL 1Q0YL 3B9KB 4HIEB 4L9LC 1OAYH 3MYJA 5FA4B 4M43L 4HCRH 3O8XA 2QQKL 1Q9WA 2LU4A 4PJDB 3SKJH 4CL7A 2R0LL 3GMLA 4BQCA 4KHTL 1FFOB 3C08L 3L3OA 3TBTB 3SOBH 3FT4B 1N64L 1RJLB 1OAZL 3DXAE 5HI4D 3CC5A 1YYML 2ZPKH 2Q76A 4HFUH 2BSED 3L3IA 2V9QA 3VFSB 1U8OB 2NXZC 3QAZB 4HJGA 4PG2C 1E27B 4L4VB 2OL3B 3ARUA 5EOCL 4Z77B 5KZCD 5I18L 4MB4A 5I1EH 3HB3C 4JQIL 2UY7A 4HXAL 4KQ3L 5DMIL 2E9IA 4Z7VA 3GUTB 3NN8A 4Y19B 3SOBL 4JLRB 3T8XA 1JNLH 5J0BA 2AXFB 3DX6B 4U0RC 5D4QA 1RU9H 2EYRA 1U8KA 1GOHA 2YXFA 1KB9J 1AXIB 3VXOA 2P5ED 4OB5H 4F7MB 1T89C 2C1OA 3D39B 2X1QA 2UUDH 2WV3A 5FEBA 2VXSL 2NPLX 3GJEB 5SWZD 4OBSA 1LEGB 4YNYB 3C5SB 5DRZA 1FLRH 3INUL 3D25A 2FJFA 5E8OA 1CGVA 4NJAL 2B8OT 4Y19D 3REVA 4RGOH 3VXRE 1XMWA 3MYJB 5FA4A 1SY6H 5ENWB 4AEIH 5IJVA 4I3SH 3QI9D 5BMFH 4L3CB 2IH1A 5DRNA 1YEDB 3RWDA 4NYLA 1OCWH 4G9FD 1MQKL 2DQUH 1R3HA 4X98B 4CU6A 2B7DT 2AJ3B 5E2WH 1OGAD 3BH8B 2X1WL 2C7UA 2LVEA 2BX5A 5C09B 1WSST 4RBPH 2OZ4H 2YBRB 3GMQB 1XGUB 4ZG1A 2KPNA 1A9EB 3U82B 3MJ7B 1J1XH 2PCPB 3V6ZA 4UMGA 2Q86A 5DRXB 5HHOB 2KQNA 4JFPA 4PTTA 2AK4E 4IMLB 5KOMC 4XI5C 2QSQA 2EEDA 1YDPB 1CFVH 2W65B 4GAYB 3FCTB 3GSWA 4U3XA 4GG6B 1CE6B 3VXSE 2DL2A 2X4PB 1K2DB 2FBJH 3QEHA 1HHHB 3O4LB 1QEWA 4XXDB 1EX0A 2IEPA 2YUWA 4MJ6A 2QQQA 2I9TB 4GXUM 4N8VG 3UZVB 1WZ1L 1XF4A 4KJQC 4GLRI 5I1CH 4LEOA 1KCRL 5C2BL 2Z8VC 1JPFA 4CVWA 1VGKA 5HHXH 4TVPD 3O11B 1V3MA 1ZEAH 4BSWA 2AP2A 1OTTD 4MXQD 3RVTD 5C07D 1MRFL 5KTEL 4N1CA 3WUWA 3PJSB 4YJZL 3N1QC 5KSAB 1ES0B 2OMNA 1WT5C 4PJIE 4U6XA 4ENEC 3VXQA 4LLUB 1FG9C 4NZRH 3UAJD 1J8HB 5KANI 1AKJD 3VDBA 2EO9A 4M7LH 1OAYL 4X6BB 1V7NH 3MLWL 3MPCA 3BPOC 4YHIA 3QISA 1SYVA 5ICYA 2YD9A 3C08H 4HS6B 1M4KA 3NCJL 5DJCB 4HQQL 2ICEB 3O6ML 1ZT7B 4FG6C 3WSQL 5GZND 5D5MA 4PRNA 2YRZA 2J8HA 3R8QA 3CFJB 3LY6A 3L3HA 5C0IB 3QIBB 4TSCH 1AQKH 1WT5A 3WIHH 1QLEL 4NM4H 3CZFB 1RUPH 4LOUD 1R24B 2Z8WC 5ECJE 3VXRB 2XYCA 1QR1A 3QO0A 2Z91A 4OGXL 1QKZH 3RVWD 1NDGA 2PYFB 4BFIB 4EDXB 4WWKB 4TYUA 4XNMB 5FGCB 5FYJH 5E6ZA 1BQHG 4PJBB 1EJOH 3D39E 2BXYA 1KPVB 1FH5L 2PXYC 1F42A 3GGWB 4KI5D 2GT9A 5E4EC 2E7LC 3MX0A 3I6KB 1MCRA 1FNLA 1K8IA 3MJ6A 5KVEL 2C3WA 3WLBB 4MSWA 4HLZG 1MF2L 4WW1A 3DO7A 3HUJE 4Y5XA 4J12A 3BIKA 4OCSH 4JKLA 4EIGB 1FZMB 3PGFL 3SGEH 5CGYD 3MLXH 1AJ7L 4CAGA 1P4BH 3C5ZD 1U36A 5DHVH 1NCDH 2P46B 4HUVB 2DQDH 3EFFB 5E8OB 1EDQA 1RV6X 4DGIL 4W4OA 5GIRA 4R90L 5TQ0L 4FS0A 5HVWA 1MF2H 2BZDA 4CW1A 5TFSL 3D87B 2EIZB 3NAAL 2UY6A 4HK3J 2Z93A 4FABH 3RDTC 1BFTA 5KSUB 2ITDB 1P4BL 1M05A 3MRMA 2MSPA 4R97B 4AM0B 5DURD 4S1QH 2BNQE 4PRHD 3BKYH 1MREH 4KZDH 3SDAC 4JRXD 2OXHA 5F70A 1NJ9B 3RVXD 5DA0B 4DEPC 2NY1D 2ZZUT 3MA9L 4KK5D 3KPRD 4QHKI 4QRTA 2XNAB 3VFSA 1I8IA 1S78C 3TYFA 3QEUB 1NGQH 3RIAF 5EBMA 1CT8A 2HP4A 3RVUD 4DQOL 1P69B 4IRZH 1J5OL 2HKFL 1I3RB 5TE4H 4EVNA 5DMYA 3BYYA 4LPUA 1C12B 4HX1B 2Z31D 2UZXB 5KSVB 2NYYC 1EK3A 1JJUA 3N1PC 5MEND 2P1YA 3NIDF 1OP3K 3HMXH 5H2BB 4EBQH 5IKCA 5KW9L 1NLBH 1Q9WB 1MLCA 1Z3GL 1JWMA 5F3HB 3DSFH 4Y4FA 4MD5B 1VKXB 2NY2D 5E2TL 5IB1A 5DFTA 1FN4B 2FHCA 4PJHE 3KYKH 3MBEA 1UCBH 3PXHA 3WN5C 4P4KA 1XR9B 4Q0XL 3QUMH 4E5XA 3IFPA 5J3HD 1E6OH 4MD4A 4X6FA 2NY5L 4KJWD 4NC1C 2FEDD 3E6FB 5KAQG 2H41A 2A2QT 3ZKXC 2R69H 2HRPL 5A40E 5E8PA 4EKXA 2X89A 5CSZA 4LF3B 3BHBA 1Q94A 3D69B 3LIZL 4GRWB 4OLXL 4QHNB 3BZ4B 3P73A 3I02B 1X5KA 3BP4B 3F5WB 5INDB 1NBVH 4ZS7L 2DJ4A 5JXEC 4KHXL 4AIZB 3C60A 3M07A 3L9RA 5H94B 2X1PA 2NX5A 1RZ8A 1LO5B 2AKRB 1IAMA 3QIWC 1IGTA 3QXDA 1KCKA 3FFCB 3KR3H 1RURH 1NAML 1LDPL 2EZ0D 3RZCC 1ZGLM 2DQFA 5IMMB 4C83B 5ITFA 5JO5B 2E7MA 3U9UA 4YHLH 1A2YA 3JUZA 3HNVL 3LPGA 1TVBA 2JE8A 4Y16A 4PJAF 2W0PA 2BVYA 4U3CA 5C0EA 1I1AB 1QLFB 2VDQL 4XI5D 3RY5A 4KHXH 5IJKA 2PUQT 5GGTA 3MRBA 5GZOD 1DANT 2VC2L 5JQHC 1JZ6A 3UO1L 3O2VH 2Q87A 1U3ZA 3CH1A 4PP2B 3MTRA 4X6DE 4KKCD 2IBBA 1OTSC 3FQNB 1X5AA 2MHAA 4UQ3B 5T1DH 3RFZC 1NCUA 3MRBB 3PWPE 1GYAA 4JFYA 1OAQH 4WHYG 3S34H 1AGDA 3SO5A 1SMAA 5IBTH 1CZ8L 3MQIA 5JA8B 2F5AH 3PGFH 1FIGH 4D8PA 3FN0H 5MENB 5E94A 4OZIE 4JDTL 4LNRA 1KN4L 2ESVD 1GXEA 1EEZB 4WW2A 5I8EB 1MCSA 2QV2A 2X9WA 3MFFA 5T3ZL 3I9GL 2XA8H 4NO2B 3SDXA 3NVQA 1A4KA 1F5WA 4KXZH 3WMSA 4DFIA 1MHEB 4QXUL 4PJFF 3MC0A 4EUPG 1WLHA 5L7XH 2OXGA 3RZCB 4JRXA 3O4OC 4IIQA 5HYIA 1GAFL 1JPTH 4PLJD 3NZ8A 5D71L 3KXFD 3KXFB 2VXQH 3NCFB 4QRSA 3N85L 3SQOH 1G6RH 3C09B 5FXCH 1MCEA 1DUZB 3UXFA 2B4CL 4RMWA 2J8OA 4XBGB 3H3KA 4P4KC 3WBDA 4Z76B 4GBXA 5A2IH 1UKTA 1EERB 5IHUL 3TBYA 5L7XL 2NY3C 3JWOC 4ISVA 1JUFB 4YE4H 3BYTA 3LMJH 3P30L 4GQ9H 1O7SA 4HUUA 1NGWB 1AD0A 1CG9B 1IEAA 1PVHA 4R4NC 4MJIB 1KIRA 1TTGA 4HIHB 1JGUH 4JY5H 1KJMA 5E8PB 4GKSA 5SX5H 3VG9B 4LQ1A 3KLSA 3TBSB 3TCXA 3TIDB 5E6IC 3SDXF 2BRRL 2MPAL 5GQBA 3R8BB 3FB6B 1A7QH 1HQ4A 2ZNXA 4M61A 4JDVB 4Y4KD 5DHYB 5BRZB 4YE4L 3FQXB 1WFUA 1NBQA 1S3KH 2LTQB 4Q6IB 4N0UB 1E4KA 1R3IL 4N8CL 3MNVB 3QNZA 2NY5H 3CX5K 1T0MA 4PJ7F 1WBXA 3IVKB 5E24E 3U1SL 1MLCB 4G7VH 2G9HA 4W6WB 2NY6C 3PABA 4MAYB 3RTQD 3PIQA 1JRHI 2AEQL 1WUNT 3SDYL 4D0BB 4G8IB 2R9HC 3RVVD 1TJIH 3QJFA 1A4JA 2WWMC 2F54D 1TDQA 4K3HA 5EOCJ 5IBUB 5KSUA 1L7IH 3BESR 3QRGL 3ZZ1A 2D7QA 5BMFL 4ODVH 2BC4B 3VRJB 3REWA 1DDHA 3T1FB 1T1ZB 4WW2C 3IXAA 3CFDB 4R96A 3L3GB 1WFOA 4KK8C 1FYTA 3KAAA 4MYWB 2VR5A 2HFGH 4POYA 4FN0A 3V5KA 4K7PY 3CMGA 4UV4L 5IW3A 5IVZA 4D3CL 2MNUA 5KS9F 4NJ9L 1I8MB 1UACH 4HT1H 5C0BD 5EU7C 5TPWL 1OP9A 3LRGA 4RMQA 2YZ8A 4DFHA 1ZMYA 3BIKB 1M7IB 4NUJA 1KT2B 2ZOLA 1NLDH 4XBPA 5J3HC 4NBZB 3MRDA 3DXAD 4FQJL 4YWGL 4C54A 4NFBA 4MXWL 5CBAB 2VLJE 2AK1L 3DJ9A 5E8EA 1JRHL 1EGJA 2NY3D 5IOPA 1G7JB 5DJZA 1OD9A 4L8BA 2VLLA 5D1XC 1UACL 4HT1L 3WNMA 1IFHL 3O0RL 2DQEH 1YN6B 1YY8A 5FCSH 3DIFA 2Z31B 3D18B 2ZOKB 4JFQB 1ADQA 4R0LB 4BFIA 3MZTA 3QDHA 2PYFA 2BVQA 1W8NA 3IDYB 1EPFA 4HULB 3PWJA 1YJDC 4LP5A 3S3JA 4U1HB 3UPRB 3NIDE 3KHQA 4XVJL 2Z35B 3MROB 4Q6YA 4JKMA 5DXWA 3O4LD 2QQNH 1NPUA 3EOTL 4HIXH 3KJ4B 3DV6A 4M03A 3TT3H 2HAZA 4X6DB 3SDCD 4L29B 3VFTB 4QYOA 5EN2B 4LLWB 4XNXH 2LE9A 5C0DA 4X83A 1CE1H 5C6TL 4O2CA 4JO3L 3RRQA 2GFBB 1TJHL 4XCNA 3JTTB 1PKOA 3ECBB 5HGBB 3U2SB 2XTJD 4XVTH 1SYVB 4Y1AD 3W5MA 2RCSL 3GSNB 4HQQH 5C8JA 5ADOL 3HG1A 4BUGA 4H25A 2QQLL 5IBLC 1ZVSA 3M1BA 5JXAL 2XICA 3PUCA 3TT3L 3VD7A 1IM3A 3TGXA 5L8JB 2Z8SA 3CZFA 6FABL 2J7LA 3MJ8A 3T1WA 2HJLA 5T1KD 2A9NH 1Z5LA 5CBEA 4PJFB 5TH2A 1Q1JL 1VADA 4D0DA 4JO3H 4XGZA 4C59B 1P7QA 5ACZA 1JHLH 2R0LH 1U2CA 3C6SA 2DLFH 1S9KC 4Q7DA 2VXTH 1T4KB 3C5ZA 2DTSA 3WD5H 4PJ5A 3QPQC 2FRGP 1S7UB 4E0RB 3ULUL 3IRPX 3HI5L 3DROA 4YXKH 5B39B 5KVDH 3FL7A 4R26L 5DFWH 1S9YB 5F8QC 4Z7WA 1MCPH 4FQIH 3RKPA 1FAKT 2ERJC 4P23D 2X1XR 2X7LB 1KULA 1T1WA 2H8PA 2ZUQB 2H2PD 1YA5A 3QQ3A 3DRTB 4M3JA 4UOJA 4NQVA 3G5ZA 3LSOA 4JFPB 4PTTB 3ILQD 1FZJB 1N0XH 4G6FD 5IVOA 2ZCLH 4Z0BH 1RJYA 2IPUG 3QXUA 3IKCA 1WWWX 4JKPH 1MNUL 3QO1A 1SQ2N 5FHAL 1VB9A 3GMPA 3T4AB 3MOBH 1UM4L 5C0DB 5HYEA 5K9OA 3MLYL 1LK3H 1R5IB 4YX2L 1AHWC 3EYOB 4HMEA 4NKDB 1EEQA 1CCZA 4YO0A 5K9JL 1RZJC 3OR7B 1KLUA 3QUMB 3MA7B 4GT7A 2IGFH 1B90A 3IETB 1N0XL 2KL6A 3BP5A 2BSSB 3O41B 5DZOA 2BVQB 3DV4B 4HKZB 2FBOJ 4D9RE 3G5VB 5GGUA 4LLDB 4YDJA 4X8XA 2RQ8A 3MLYH 4JM2C 1LK3L 1RSFA 5HDLA 4I3SL 4F3FA 3BGMB 4WJ5B 3FQTB 2FL5B 1LO3L 3IJYA 4GW5B 4BQBA 1I8KA 4EOWH 4PJ9D 5HYJB 4BQ8A 1QNZL 4MMZC 2YS4A 3RL1A 4JFOA 2C1OB 3T2NH 3AROA 5DEGA 1M7IA 5C0FA 2ARJQ 4ODXB 5JZ7C 1JN6A 3EDFA 3S6CA 1JF6A 3QAZC 3CVIL 5EUOE 1KBGH 1A5FH 3OPZH 4U1NA 5ICZA 3FOMB 2OM5A 1SVZA 5D9SB 4G6JH 4XMLH 4F7EA 1U3HD 2ICES 3D25B 2KH2B 3PXJA 5HSFA 1UQSB 3M8OH 4P5TB 1GVIA 4EI5D 1B3JA 4K23L 2Q8BL 5DWUL 1DUYB 4LDLB 5E5UB 3TZVC 1A7NH 1HH6B 4DN3H 4LIQH 3TV3L 5F89B 3V52H 4LCUA 3SY0B 2VQ1A 2I07B 3GMRA 5JW4N 1ZA6A 2VLJB 2UWEB 4PJXA 1HINH 3EYVB 3ZE2F 4UUJB 3QIBC 1OAUL 4AENA 4PRAB 3D85A 1KCRH 5C2BH 1ZS8A 3DNKA 3QUXD 4PFEA 2FIKB 5ANMB 4YBQC 2YUVA 2RCSH 1A3LH 5C0BB 2IC2A 2Q6WA 4UQ2A 5GS2D 4YHNA 5KTEH 4N0UA 2Q7NA 1RFDH 4WEBL 5IHLB 4JPIB 4UNUA 3MRHA 3V4VL 3LS5H 4YQXL 3ARBA 4H88H 3UTTD 4KK9C 3TJEH 1I1YA 5KN5B 4UU9B 2GTZA 4JFOB 5C9JA 1CTOA 3VFOA 3LEXB 5T1MA 4X7SL 1OOAA 2I5YH 4MJ5A 3EYFA 4KWUA 3KR3L 4P23A 1EZVX 4MNGB 1WV7T 5IMKB 4Q9QH 3OBAA 4LKCB 3ARGD 1NBYB 5F71A 3HR6A 3HNVH 3X3FH 1QSEA 4YH6A 3VGEA 1F13A 3K3QA 4KU1A 3GO1L 5B8CB 1AGEA 1QA9B 2BNUB 3OTTA 1U95A 5E5MA 2YWZA 2JJTA 4Z7WF 1Y6KR 4CUCA 1UH2A 1UJ3C 3U7WL 3HPJB 4P2RD 4Z7UF 3I6GA 4UIMB 1JPGB 2FO1A 5IBTL 5IQ9B 1AXTH 1DR9A 5JMOC 1U8MA 1U8IB 2R4SH 5CZXD 5DJ6B 4G43B 3MGAA 3UYOD 3FO2A 5GRUH 2HT2D 5FHAH 5EIVA 4Z5RA 3HZKB 1FH5H 5J8OA 1DBBL 5I1DB 5J1AB 3OAUH 1UADC 1RK1B 3W9DB 4NO2A 4XAKE 2IFGA 3UBXA 1KCUH 3VFRA 2AXHA 1DLFH 3T0AA 3H9HB 3SKOB 5L2KB 4KRLB 4XPAH 1QFWM 3QYCA 3OXSA 2Y25A 1FGVL 5JDSB 3QR2A 5HDOA 1UZ6F 4L9DA 1Z0NA 5I73B 2JJVA 5FYLE 4HBQA 1P6AB 3ARFC 2Y5TA 3SPVA 1I7ZB 4RZCA 1RJZA 2DIBA 3S5LG 4J4PA 5EH1A 3FFDB 4QOKD 2V2XA 2NX5E 4K3GA 1MRCL 2VUYA 1HHKB 4K3DH 2ZKHH 1A5FL 1AHWB 3G5XA 3SBWA 3UTSD 5EZLB 4H25B 4PB9L 3RWFB 3GSOB 2ESVB 3HS0B 4TVPL 4UZGA 1PSKL 3RX5A 1KENH 1CBVL 4L4VE 3SCMC 2GFBA 4OUUB 2WBWB 1L0XA 4I9WE 5I1AA 4OF0A 1NGQL 3D85D 3PGCB 3V79C 4YBQD 2R4RL 1CQYA 4ORZC 4P2QE 3TV3H 1MHCA 3DXAB 3NOIA 3MRPB 5LCVH 3RPIA 3EO1A 1IGJB 4I4WB 3MJ9A 2ZUYA 4Y5VB 5IMOB 3LKNB 2XXMB 4IOIA 5D1XD 5CSZB 1C5CH 2ZNWA 2NW3A 3H0TA 3IF1B 2CD0A 1OAKH 2AEQH 3ZKMC 4XAWH 1Z3GH 4OZIA 1HYSC 4YGVB 5MEOA 2EH8L 3GSUA 4KDVA 4O02L 4K3EH 2XXCB 5JW4R 4PTUB 1NCWH 4X6CA 1GPOH 4YHZL 1N0LA 4PJ5D 4Y16C 3WEXB 4AG4H 4EUPH 1ZAGA 4EI5A 2DQHL 2VLJD 4HGKC 3QUML 4HHAA 3I84A 2GHWB 1TPXB 3ROLA 2B1AH 3ARGA 3DYPA 4TQEH 4R3SB 3QDGE 2AK4D 2F15A 2MFNA 1F3DH 5ISZB 3WDHA 3EYSL 1LE9B 3MUGA 3Q6FA 2QSTA 1YZZA 4LSUH 4U1KA 2WUBH 4EVNB 5C9JB 4JFDB 4OLYH 5EU6B 2W0FA 1BJ1H 1K8DB 4L9LB 1KTLA 1X6LA 3B9KC 4Z78B 3QEUA 4LEXL 5GRZA 3WNLA 1T7VA 5L2KE 3MRHB 3HLAA 4P49A 1U8QB 4I2XA 4U6HB 1F97A 3MV01 5J12C 4KRPD 3C6LC 4JZNB 3TH2T 2MQCA 1X7QB 1EMTH 1A14H 4UI2A 1B0RB 4K2UL 5I1JH 3FQRB 2MCPH 2XZZA 2VLJA 4NM8H 4YXHH 2V7HA 4BQ9A 4DZBB 2RAMA 3CGTA 5FYKH 3UAJC 5CEXB 2EIZA 1AO7D 2YEZB 2KZWA 1K85A 3X13A 3QI9A 2R8SL 1CTNA 4M62H 5EPMA 4U3HA 4ODUA 1ZWIA 2HJKA 3CVHA 4ZD3H 2YK1L 3IDNA 3KG5A 3EGSA 4XWOD 3L5JA 5I8OL 4NO0D 1FC2D 3LN5A 4JPVL 1ZK9A 5EOTA 1B2WH 1T22B 4YZFE 4OD1L 3O3UN 1KN4H 1DFBH 3OX8A 4QXGH 4ODXA 1AQDB 3W0WE 3ZKXB 3VW3L 2WP3T 1ZLWK 3WFBL 1WFNA 3GRWH 5L9DL 3TA3C 1BFOA 4HGWB 4PLKD 1T3FA 1IE5A 3LKNA 4IOIB 5DZNA 3ARWA 5HD8C 1A6UL 2F74A 4I18B 3E1F1 3WFZA 2XQBH 3G6JA 2EDXA 3MRJB 3UTSA 5C0AA 3L3KB 1D5ZB 2XZCH 3HI1A 5LJYH 1TCMA 5DDHB 4WHCA 5HHNB 3L7FB 1RZFH 1OAXL 2O5YL 4OZ4B 5F9OH 5ETUA 4P46A 3WFBH 2X05A 2ATKA 1UM6L 3W0WB 3P3YA 2BSSA 5MEPB 4BH7A 4Y5YB 4PREA 5HI4C 5K59F 1HWGB 1YEEL 1OGTA 1AHWA 3B83A 1NANH 3G5XB 5E6ID 5KVDL 3VH8B 3LKSB 5SWSA 2AABH 1BJMA 4WTZA 3WUZA 5D2NC 1T83A 1TMCB 4JG1L 3K4AA 4S1DC 1HH9A 4FXKA 5BVJA 5C0IA 1RY7B 2D03L 2ED8A 1RJZB 5KG9B 2VO5A 4DK6A 1RI8A 4J4PD 2JB5H 4DOHB 4I3RH 2K3TA 2J4WL 4HS6A 1CGTA 1LK2B 3VI3E 1U9KA 5AG8A 1UENA 3DYOA 1G84A 3WLWD 4Q9RL 3UZEA 4HWBL 1IC7L 2OTWB 1N6QL 1YQVH 4GKZA 4JR9L 4LCWA 4LPVA 5IB2A 1YEHL 3QUYD 3QQ9C 3VFGH 1YECH 1JV5B 5SWZA 2HYMA 1BFOB 3CSGA 5D2LF 1U8NA 4GSDL 5B39A 4PGBA 4PJHB 3B9AA 5E6YA 4E41B 5KVGH 1K5NB 5BW7A 3TA3D 4P46D 4BFBD 4ZPVB 5IK3B 4AJ0A 4LEOB 3VD4A 3KPRE 3QWRD 4X6CF 3O3AA 4LSUL 1U91B 1TETL 3AXLA 2QR0B 1PYWA 3IDNB 3IAGC 5D1QA 3VFWB 4K9EL 5IQ9A 2D7TH 5ESVB 1VPOH 3DTXA 5DS8A 3BT2H 1I9JL 1MJUL 4LHUB 1I3GH 2CK0L 1GIGL 5DD6B 5IFAL 5D7JB 1WFTA 3MRCA 1HXYB 3RQ3A 3GIZH 4KRMB 1FIEA 3C6LD 4MNGE 1MAJA 2KDGA 1V7ML 4HW6A 4ZXBD 4LCIH 4RDQF 4O2CB 2X4RA 3L95B 2C3VA 4WTZG 1XGPA 5I9QB 1QSEB 2A38A 2VRAA 4NFCA 2AV7A 3CU1A 1QRNA 3MLVL 3NCBB 3MRJA 4PJXF 3UTSB 2PXYB 1II4E 4PD4K 2FHBA 1RK0B 1P7QD 32C2B 4XPFL 5FYJU 4MA7L 2BY3A 4N5EC 1AR1D 4PJ8B 3MCLH 2PTUA 1ZLVH 3VFPA 3E0GA 1A6TB 4ZNEA 2EIBA 4CDHA 1SBBA 2V9TA 3CFEA 1RZJL 4HKBA 1NMAH 2N4IA 3MNZA 5DI8B 5A2LH 2XY1A 3AREC 2ZOKA 4ZO6A 3T04D 2FB4L 3BP6B 3QIUB 5C0ND 3QUYC 4I13B 1F4XL 3QUYB 4J23A 5TGBA 2JTDA 3L5XH 4O5LL 1E4KC 2FIRT 1DBMH 1RUKH 1MHPL 4QTIH 4OTXH 1NMBL 2IQAA 5MHSD 1QFWH 4QHKJ 4JB9L 3VMOA 1U3YA 4I48A 5C07E 2ZOLB 3EO9H 1CLOL 1PJ9A 1P7KB 3X14A 3QWRA 4KROC 4HDIA 1E4WL 4WWKC 4C56E 3GSVA 4P2OC 3TJEL 4QTHA 4H0GA 3IF1A 4HEPG 5JIPA 3L5XL 4NHCL 2Q7YB 1WC7B 1YNLH 3ZE0E 3ZO0A 3LN4A 1HYSD 3PP4L 5IESL 3U0TA 3MBXH 1UM6H 3LQZB 4I4WA 3VD5A 3EO1B 4LCCB 4J1UA 3Q3GB 2NY2C 2VLKD 4GMTH 3DX8A 1QFWL 2ARWA 2OL3A 1WCBB 2XPGB 5DVOA 4R4ND 3DRQA 4GUPB 4JEGB 3GIVB 2X5PA 3GO1H 4AT6B 3CC5B 2DQCH 5T5NG 2X44D 1Z9MA 1LQSR 2VUOA 4HPYL 1RMFL 4MCYA 1J10A 1INEH 3QIUC 3TC9A 1YNLL 3ZTJH 2E8YA 5TQ2L 3KPSB 2DKMA 3BQUA 4H8WC 2HFEA 4YHYC 1MIMH 5I15H 3STZB 3HFML 2V2XB 2VDKL 3ARGB 3GM8A 4XNQB 3JWOH 1YC8A 2VLKB 3ARFD 1MQ8A 3FOLB 4I77H 5FDYA 2VQTA 2VAAA 3KLAA 4G6MH 5TE6L 3ZT7A 4Y5XB 3CPLA 4M3KB 4YGAB 4FFZH 3T4YA 5IFHH 1PGRB 3O9WB 4ODHH 4HIHA 1J7VR 1FNFA 5KVGL 4A6YB 3OZ9H 1BZQK 1IGJA 1OSPL 1IGMH 1UC6A 3ARXA 4S1SL 4F9PA 1HIMH 2YMXH 1AKJB 3LEVL 4P2CG 3K4DA 4XBGA 5ALCL 3DOSA 5GJTH 5HGHA 1B4RA 4LPTA 2YA0A 4OM0L 2VL5A 3ZL4L 3FAWA 1YMHB 4URTB 3QUZC 2BSTB 3VCLB 1FRGL 4O2FA 3VFNB 3PHQA 1PEZA 4LCIL 1D5BA 1BBDH 3A67H 1T80A 3U36A 5HBBA 1LEKA 1WITA 4U1IB 4S1SH 1QP1A 3WFCL 5K9QG 3VXTA 1S7UA 3U83A 4JFFD 5CP3A 4FQXA 4KJYA 2V2TB 2D4FA 5C92A 2PTTA 2V7NB 3P9LA 4TVPH 5CJOH 3WNNA 1SVCP 5TF1H 1A4KB 1J11A 3W11D 1JPSL 3MFFB 3F12A 3ZHLA 1JTPA 1OP3H 3RWGB 5LXGL 4XP4H 3QHFH 4R7NB 1PQZB 4LAQL 1I7UB 2FZ3B 2FEDC 1S7RB 3WUWB 4LLYA 2P5EE 1T2JA 1JZ5A 3C09C 2OL3H 2IWGA 1U8LA 1OTUC 4LMQE 4AEFA 1JF1B 2R2CA 5I17B 4KDWA 5DJ2A 4F7PA 4Y2DC 4CVXA 5D7LE 4MZ2A 4XP6H 3PDOB 2UVEA 3DMMC 3QCUL 3BPNB 2Q6WB 1KEGL 4KUZH 4W4OC 4OZFB 1TLKA 1YMMA 2Y06H 1M7DA 2VITA 5BRZE 4HH9A 4FXGB 5GHWL 1JPGA 3MOAL 3CSYB 4MHHI 2Z92A 1RZGB 3OKEB 4KAQH 3GMOB 4M5ZH 5CGTA 3X14B 1BQSA 4R4BA 1JVKA 4JO1L 4UV7H 4WEBH 1Q0YH 2JJWA 1Q72H 4YQXH 1W0YT 5C09A 5DO2C 1EEUA 2GUOB 1C08A 4I3GA 1URLA 5GGSB 1NFIA 1T1XA 4F7EB 3D39D 3EIFA 5CKAA 1NBYA 1KJ3H 4Z8FH 1F3DJ 3RBSA 4NQDA 5K93A 4M5ZL 4LSRH 5TQ2H 2OTUA 4YEFA 1EO7A 2OR8A 5GRJH 2DRUA 3O6LH 5HHQB 4O51B 3BO8B 4GXUN 4V1DD 2DQJH 5BW7C 1LE5B 5F97E 1MCOL 3J7HA 4F58H 5HGDA 4N0YL 3SN6N 3QXVA 3RWCA 3RNKB 3BKCL 4WI7A 2OI9C 1X4YA 3WO4C 4KROB 3P4LA 5DMKA 4JHBA 1CL7H 4ZUVA 4L4VD 4JPWL 3D0VB 5DQJB 5I1EL 4GKNA 1BZ9A 1I3UA 1QVOB 4V2CB 4OI8A 4YHNB 2NXZD 4W4NA 5JORB 3GKWL 1G9NC 1Y6NR 1Y6MR 4U31A 4LLAA 2VDPH 5FO9A 5IWLA 3U79A 1F90L 5KS9A 1HYRC 1L9MA 3U7AA 2A1WL 3NGBB 3GKZA 1I3RA 3HC0B 3B6SB 7FABL 3U30B 4O2EA 2AXFA 3DX6A 1RHHB 4KROD 3UTQB 3W39B 2P8PA 5EBMB 2GAZB 3IXTB 5A3IC 2FYYA 3MOQA 4GXVL 1GGBL 4MAYA 2FGWH 3FQWB 4M6MH 1FZOA 2J8UF 2VIRB 4FQCH 2HTKD 5BO1L 5LG1A 2X4QA 3EYOA 2WLZA 3AMKA 3LQAL 5T1LD 3BD5A 2HVJA 1A3QA 4PJIF 3N50A 3ULVE 1UT9A 4NO0B 3IDXH 1JP5A 2HJFA 3IU3B 1LD9B 1XH3B 3FB7B 1KACB 1AGFA 3N06B 2FH6A 2ZCKL 1UB6B 5GRYA 1ZGLP 3IJHB 2XFXA 4X0KB 4NPYB 1K4DA 2Y6SC 4JJHA 5E99L 3ARDB 3QDGA 3VWKC 1RJLA 1KTKE 4P3CH 5F9DC 2WUCH 3RA7L 5I1KH 3N1GC 4M6ML 4FQCL 4XNUL 1BVKB 4X5LA 5CJXA 2AI0H 1FZKB 4LBEB 1BREA 2ATPB 3CMOH 3MLRL 3GM0A 4Z7WB 3IJYB 2E5EA 4UT7H 5IVXB 3IU4L 1T03H 4O4YL 1IQWH 1CK0H 3B2VL 3VGBA 5KJRH 3LAFA 2I9LA 3UTTB 5DR5H 3S35H 1MCIA 2GYSA 4ZTPH 4G8FB 3RPKA 5I6XB 5E1AB 4IHOA 4HCRL 1U0QA 1QFOA 4YDIL 4TOYL 4D9QE 3MLSL 3DPBA 1Z5LB 4Q9RH 1XGYL 3MA7A 3AY4C 1TVHB 5EU6D 4XP9H 4MSWB 5DJ0A 4IDJL 1QHPA 2PXYA 2WW8A 3GDBA 4UDUB 1YEGL 1AGBB 2E7CA 4FFVD 3CDCA 1T6WA 1EEYB 3ALWA 3G9AB 4D0CB 4HGMA 5GGSA 2UZIL 4AMKL 4UT9L 4K7FA 2ORBH 3KS0J 3LKQA 4A6YL 3S7GA 3UJJH 1MELA 4EDXA 4YAQB 2FX9L 1YJDH 1QFUL 1PDKA 2UWEE 1F6LL 1K6QH 1CD8A 1M1SA 1F4YH 4C57C 4DN4L 5MP6L 1SYSA 3RL2A 4BK4A 4IRSB 1M7DB 2VITB 5CIPH 1AD9B 4JFEE 4RNRA 3TA3A 5F7DB 3OKDB 4DVBB 4WFEE 4JFYB 3KPRA 5BOZG 3AS2A 1JIBA 1FNEB 1R5WB 3NCJH 5BV7H 3UEZA 1ZTXH 3ZDXE 3U0WH 3OAYH 2Y07L 4G8EA 4GG8A 2F53E 1FNEA 1P6FA 1R5WA 1KUMA 5GRJL 1OLZA 2WIIB 2Y4SA 1AQKL 3QCVL 1X5XA 4PJAB 3EZ8A 4TVPE 3WXVH 2AJVL 3L5IA 5DJZB 5HHOD 1ERNA 4H26A 5EBWA 2AS5M 3MO1A 4L5FH 4L8SC 3CK0L 3FONB 3GHEL 3IT8D 3X13B 1E4XL 4P3WA 2UZYB 5F6IC 3BVNA 1IGTB 2GI7A 3DMMA 2A0LC 4L4TD 1VEOA 3BWUC 5DK0A 3KYNA 4YAQA 1X5GA 2V7HB 5EULV 3IDGA 1JMZA 2W9DH 2VKXA 3GKWH 3ME0A 5I66B 2NY7H 2F19H 3P4MB 1N6VA 4AIZA 2HH0L 2R29L 3WJLC 1Y0LB 3FO9A 3HMWL 1HHJB 1FORH 5CGMA 4Q2ZB 1T66C 2AK4A 3KJ6L 3FQUA 3OKNA 2FJGA 1C8PA 1D5BB 1GZQB 3CFBA 3LHPL 2GJJA 3UTTE 4HLZH 4G42B 1X5YA 1UWXH 4HWUA 2APFA 4GAYA 2NNAB