1Q72H

Anti-cocaine antibody m82g2 complexed with cocaine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
223
structure length
220
Chain Sequence
EVTLQESGGGLVQPGGSMKLSCAASGFTFSDAWVDWVRQSPGKGLEWVAEIRNKANNHATKYTESVKGRFTISRDDSKSSVYLQMNSLRAEDTGIYYCTSVPQLGRGFAYWGQGTLVTVSAASTTPPSVYPLAPGSGGAGSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLNGDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTQVDKKIVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab M82G2, Light chain
publication title Diversity in hapten recognition: structural study of an anti-cocaine antibody M82G2.
pubmed doi rcsb
total genus 41
structure length 220
sequence length 223
ec nomenclature
pdb deposition date 2003-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q72H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q72H02
1QG3A 2FGWL 2JTDA 3D39B 3RWIB 1JZ6A 4TUJA 1F58L 1N2RB 5GJTL 4AEIH 3B5GA 4NQCA 3QFJD 2Y72A 2RQ8A 3CVHB 2G5BA 4XMLH 3MRHA 4P46B 3C2AH 1JTTA 4JGUA 1YEJL 5JHDD 5EUKA 4L5FL 2WBJB 4ZSOB 5FYLL 1UWXK 3Q3GA 5EH1A 5F7EL 4KTDH 5TDPB 1LO2L 1W2KT 2X89D 4XP1H 2E6JA 1N7ML 4PJEA 4JANB 1F3DH 2QSCL 5ID1B 3HRZB 1FV1A 3MMEB 1JPSH 2V2XA 3NN8B 4OCRH 4U1LA 4M7LT 4PLNC 12E8H 2J8HA 4H8WH 4JGMA 2AJYH 3T2PA 2EDRA 2IH3B 1OAKH 1CVRA 4TSAL 1FLRL 5ADOL 4G6ML 2APXA 3HZYB 4WTZG 3PWPD 1EO8H 3I6KA 3E6FA 3M8OL 4H0IA 5FAAA 1I3VA 4NKDA 5KSBB 1S7UB 5C0RH 1ED3B 5ILTL 4KROD 4XXCC 1AR1D 3FQWB 2QHRL 3X3FL 5DQ9A 3VCLB 1HIML 3CU7A 5FGBC 1ES0B 1D6EA 3IAPA 2DLFL 4P4RB 3SJVE 2CGRH 3WFDH 1GGIL 1AQKL 3Q48A 3U0PB 3O4LB 5E94B 2PN5A 2XZAH 5ECJE 1EO7A 1HINL 1KGCE 3O9WC 3ULUH 4BQ8A 3G6DH 4JZOA 5FYLE 2FL5A 1ONQB 1A7BA 4XB7A 2HFFA 3ARPA 3V4UH 1MRDL 4UOW1 2AJVH 5HGDB 3NAAH 5BMFH 2DTMH 1TETH 3D18A 2VWEC 3C8DA 4U1SB 1WBYB 3G5ZB 1TDQA 3I75B 1BQHA 1OSPL 4NZUL 2EDYA 4DJMA 5E4EC 1J8HB 1GPOH 1EEQA 1XGTB 3TCLA 4MSWA 1DVFA 1KCVH 1SEBA 2ERJC 4TUKH 1I7UB 3VWJC 4I5BB 4XAWH 1N6VA 3LRHA 3KJ4C 2N4IA 3WSQL 1ZSDA 1WFOA 5HHXL 1QQDB 4NYLA 4RX4A 5JQHC 3S34H 1RUKH 3NIFE 2EIEA 4L9DA 1EV2E 1OD9A 3QBTB 5CEZD 5HHVL 3T1WA 3DRQA 4I0PA 4OLZL 4LOUC 4TUOA 3AB0C 1YEIH 1C5BH 3TZVB 3BH9B 5GS0L 4L3ED 2G60L 3S37H 4OGZA 1YEHL 2CLRB 2M26A 1DUZB 1JP5A 3N06B 4PJFF 4J1UA 5J0BA 1KULA 5DD3L 2YKLL 2OI9B 1I9JL 3IJYA 5EZOH 2IH1B 4MNGE 3S88L 3O6FC 4ODSL 4J3SA 1RZGA 2YZ1A 5KBNC 5J1AA 2VDRL 4R7NA 3UZVB 4Y5YC 3U0TB 1BQUA 3O6KH 1X9QA 1ZLSH 4EI5B 1CGSH 3EYSL 4DN4H 1GGTA 3NFSL 2V9QA 4K23H 3FQTA 2RFXB 4S2SA 2HLAB 1MI5D 5CAYB 3L7EA 4LHUA 5F1NB 1KJMA 1WWBX 3AU1B 2BNQB 5LWYL 4PBWD 3RTQB 1DLHB 1X6NA 2AXFA 4FXKA 1OB1B 2V5MA 2H2SD 2EE3A 2ZPKL 3RVUC 3EYOA 5F7UA 2NXYB 2Y07L 3GMLB 3QUZA 3ZZ1A 4PV9B 3PGCA 1H8NA 1ZA6A 4PRAB 5IM7B 3WE6B 3KGRA 4PJHB 5HI5D 4KKLC 3EGSA 2XXCB 4R96B 4BSVA 1IKFL 4NHUA 4YDLB 4GQ9L 2WMPA 4LLYB 2HLFD 3CCHA 4F8TA 5ID0A 3QEQE 2VAJA 4FTVB 4JFEA 1BX2B 1IGJA 3WDJA 4YXKL 5IQ7H 2C3GA 2AJUH 3G6AB 3GUTA 4Q6IB 1FVCB 4H1LB 5E03A 1NCBH 1NANH 2I5YH 25C8H 3S5LG 4NQED 3LKSB 3PL6B 3A6BH 4X6DB 4AIZB 5AZ2H 1A9BB 1KLUA 2WK2A 4MD4A 2Q76B 2GITB 4X0KB 5T5FL 1FJ1B 2E8ZA 4R4BA 2IG2H 1ZT4A 3EO1B 5IMKB 1T3FA 3QIBD 4KI5E 4PJGE 5F96L 2APTA 2NW3B 3SE8H 3P40A 4EQ2A 3VXMD 3ECBA 2DQFB 3T3PE 4JN2A 5D1ZB 2BOBA 3TJHC 3VXSD 1T89C 4WCYH 4LAQH 2I9TB 5KSBF 3P9LB 2BMKB 3CXHK 3WNPA 1SEQL 2X9XA 1FL6A 5IKCA 4Q2ZA 4XC1L 4AYFA 4M3JA 4G8GD 1PVHA 5B8CC 2EZ0C 5F7NC 4PTUA 1NLBH 3SCMB 2LE9A 1U92B 5ISZE 2GJ6D 3F5WA 4G3YH 2CIKA 4U1HA 3H7LA 4B41A 4LASL 1F8TL 1AHWB 1VACA 1EJ6A 3BW9B 2DWDB 3ZKQD 2IALB 3ARXA 4R8WL 1KTKE 3HC0A 2D9CA 5BCAA 1OTTC 3V6OA 3PDOA 1B0GB 2APBA 2XKSA 2X2YA 5KVFL 1CD9B 4P3CH 3WUWB 4XPAH 5GSRB 5T5NF 5FHAL 4PLKC 1S78C 2C1PA 4H8WC 3EHBD 1RK1B 5FCSH 3TA3D 2P43B 2XA8H 1IGYB 2XRAH 1UG9A 4C56E 2BP3A 1LDPH 3FQNA 3QUXD 4ZO9A 1F45A 1OL0A 3GMMA 1FO0L 3PGFH 1PBYA 1E28B 3H9HA 3OKYA 1F5WA 3OJVC 5DHVH 4UAOB 4XCFL 4OLYH 3KPSA 2OTPA 4TVPH 2ICCA 1QBLH 1WZLA 2DJUA 2P5EA 1S7SA 4JDZA 3VXPB 2ADJA 2JJVA 3G5VA 2Z9TA 3T65B 1E6OH 4P23D 1MCIA 3PGDB 2Q6WB 1IARB 2H1PL 3CFJB 4P3DB 4A2LA 1A6WL 4UQ3A 4JPWL 3ULUC 3BQUC 3VJ6A 3HZVB 5F89A 1IQDB 2XZQH 2H9GB 3DO7B 4PJ9B 2BFVH 1W0YT 2B1AH 5JHDA 2ZCKH 2R0LL 3TNMA 1ZHLB 3BYYA 4PRPD 4XCCH 3VRLF 5BJTA 2W1NA 4XBPA 4DOHB 1XGPA 2X89A 1FBIL 1TJIL 4MB4A 5EU6E 5JW4R 1M71B 3GSRB 3N9GH 4KPHH 5CEXA 4Y5XA 3P9MB 4R3SA 4NNXA 2ZUVA 1FORL 2VQ1B 2A77L 4CNIB 5I1AB 4IDJH 4HLJA 4RZCA 5IP4A 2N56A 3V79C 1EVUA 4Z0BL 1MH5B 3C6LD 4LU5H 2FH6A 4PRDB 5IB2A 3ZO0A 3L7FB 4JG0H 4CVZA 3T1FA 3IDGB 5FIEA 4OKVB 1TTUA 3QWRD 5GS1A 1EFXB 3VG0L 4AT6B 4M62H 2HKFH 4UT6L 4AEFA 1PW3A 1Q9OA 4M48H 3UTPD 3U79A 3TWCH 1U8PB 3TH2T 4UU9A 4JKPH 4PJHF 3SKNB 5KZCD 1U41A 4GUPA 1XR8B 4M1GL 3VA6A 3KNBB 3I2CL 4HPYH 4XP4L 3L1OH 3BGFC 3DO3A 4NO2B 1Q1JH 5I1HL 5KS9E 4FS0A 1N6QH 2WNGA 2YS4A 1MCWW 3VDCA 3IFNH 2DRUA 4I18A 2EDTA 5J12B 1R3KB 3WLWD 4JY6A 3KYMB 3UAJC 3WNLA 4QRPD 1T0MA 3TO2A 4KXZH 1OT2A 3B8YA 3EDEA 3U30B 5IEKB 2PXYD 4MA3A 1JPTH 4TSBH 5B39B 4X6DF 4ZUVA 4NZJA 3NIGE 1NCCL 1OAYH 1S9WA 4IRZH 4XNUL 3ARFC 1TENA 1EXUA 3WS6A 1MQKH 4Y1AE 1S7TB 4EVNB 3MRBB 1DVFC 1KIPB 3SDXE 1NC2D 5FV2A 5F3BA 3WCYA 5E08L 1AO7E 2ZWLT 4OD3L 4CJ1A 3VH8A 5KVEL 3MRKB 4Z76B 2HVKB 2XTJB 3BGAA 5D7JA 5JXED 1TZGL 1HQ4A 3IDJB 1JN6B 2AJSL 1XR9A 5SWZD 1UA6L 2Q7NA 3E0GA 4I0PC 4TTDD 1FNGA 1H3PH 1CQKA 3R06A 4RGOH 4YHKH 5SWQB 3BRFA 1I8MB 4KK5C 4FG6C 2VLKB 3FB5B 1ZS8A 1MQ8A 1X5HA 4ZUUA 1GGCH 3AMLA 5IHZB 5FO7A 2VLRE 2AK1L 3GMRA 1JK8A 1G6RB 5J06A 5JA8B 1RJYA 2GUOB 5CJXA 4FQ1H 4X7SL 3VU2A 3LD8B 3TT1H 5L2JB 3OGCB 4NUJA 3LN4B 5HGAA 3MRGA 2NTSP 3ILQD 4XI5D 3HI1A 1BFOA 5EPMB 4ZAKB 3K0WA 4M03A 5F1SA 2APWA 2BHZA 1CE1L 4YHMH 3VFVB 2O5XL 1A21A 3FFDA 4NQXA 2P8LA 2EXWC 4GH7B 4DKFL 5J89A 1ORQB 5ACZB 3MUGA 4LHJB 5DR5H 1NBQA 3BN9C 4ENED 1EAPB 1SJHB 3ULSB 5CEZH 2W92A 2IPKB 2F58H 2Y06L 4HZLA 2V9TA 3QUZC 3INUH 4D3CL 4EIZC 1DQLL 4CU6A 3T77A 3AXLB 2ICEA 3O8XA 1ZLVK 1SYVB 1Q9KB 1JNLH 2C3VB 3KPLA 1RUQH 1CD8A 5C92A 1NMBH 1V7MH 3QEHB 1M7XA 2ARJB 1EMTH 4LVOC 1WAAE 4MQ7A 5IHUH 1WT5A 4MQXD 3FO0L 3X3GL 3QYCA 4RFEB 3LKOB 1FFQA 2ADFH 1WSST 1CZ8H 1NGPH 2XWBA 3BKJL 3NACH 4JHWL 1HDMA 3EO0B 1QLFA 5ANMB 3ZE1F 4N0YL 4NQEA 4EI6A 3GMPB 2AI0L 2WINB 1UB5A 1O7VA 4A6YB 4OCYH 1YYML 1Q38A 5DD1L 1CK0H 2E9BA 4Q9RL 2VXTH 1CDHA 5FOBB 4WJ5A 2HFGL 3QA3B 5EOQH 4C59B 3VXMA 5CEYB 1BAFL 1OTSC 3QEUB 1UKSA 4PB0L 3KYNB 4NQUA 4LCYB 4M7LH 2DLIA 4YDIH 3MOBH 3VXSA 1C5DB 4LSSL 3OG4B 5K9OA 4NC1E 5HYJE 1A6ZA 3HE7D 5CCKH 3JZ7A 4V2BA 4K2UL 1FIEA 3X12B 5C0BE 3QI9B 1KIQA 4JJ5B 3MLUH 1FE8H 1P1ZA 4DGIL 4LVNB 4OFPA 1U93A 5I1LA 3VGGA 4WI2A 1Q9WB 3CMOH 3D0VA 3GRWA 5EU4B 3DVGA 1T20B 2OK0L 3P9WB 5C0AE 2NTFA 1LILA 2A1WH 4BQ6A 5EDXA 3DUSB 1YJDL 3S8WA 3UXFA 2EICA 3FT4A 1CGYA 3HAEG 2FX8L 4X7CC 3OSKA 3U0WL 5ESAA 4ELKA 4MMZC 4YPJA 4XVUC 4U1JA 5HYFA 4QWWD 3RWEB 2NX5B 4MA8L 3KYOA 2A6DA 2HKHH 3KWWA 4APQD 3GIVA 3UTSE 2X10A 3BSZL 4LKCA 1LO0H 43C9B 1C8PA 4X6CE 5C08E 3UPRB 3U2SB 3BFOA 4B7LA 1NBVL 1KENH 1WBZA 4YR6B 4KQ3L 5AUMB 3ARTA 3BRGC 4K94H 4FXLA 1CICA 2M1KA 3H9SB 3V6ZB 5FO8B 3X11B 1CFTA 5JW5B 3MJ9A 4YXHL 4KC3B 1S9YA 2VLME 3QG6A 5KS9F 4P23A 3O41A 3CH1A 2R2EB 2J7LA 3QDHA 1DDHB 4QHMA 1QEWB 2E7BA 1LEGB 1MWAH 4YE4H 4K07A 3H42H 4LCWB 4PGEA 3KPPB 3WNKA 3GRWH 3ARBB 4Z0XA 5HDBE 5D1QD 4HHAB 5I17A 5JOFB 3PIQA 2BVEA 5IQ9A 1SM3H 1M7IB 1P4LA 3NIGF 5GGUB 4R90H 4DVRH 1UYWL 3VMPA 2FECI 5AD0B 1XGRB 4NGHH 2NZ9D 1TJHH 1I4FA 3U9UB 4L8CA 4PG9A 3FFCB 3BIKB 2F19L 5K9QG 2FD6L 2D7PA 3V9FA 3O0RL 1KLGA 2XQYG 4HCRA 4AY0A 5LCVL 3IKKA 1ZANH 3Q5TA 3VD9A 2HTKD 3ZDXE 1BQLH 4MCZB 1C5CH 4WY7L 2CDGB 4C83A 5CGMA 5DTFA 3VXRA 4WRLA 5ESVB 1MREH 5DJ2B 1HI6A 1YECL 4P9HL 5GS1C 3S5LB 1I7ZA 3WIFB 1AJ7L 3GBNL 4F7CB 1UFUA 4KROC 5I8OL 1AR1C 4NO5B 3VA2C 2W9EH 2GT9B 5FA3A 3GHBL 1OAXH 3TT3L 3LRGA 2W07A 4P59L 1AGFA 2W59A 2AXGB 5HHMB 4M7ZB 4DZBA 5T1LB 1A6PA 4L4VB 3T0XA 3ARQA 4UILH 4ZS6D 4Y5VB 1LGVA 1DQQA 2AXJA 1NLDH 3U9PH 5DVOA 1JBJA 4TYUA 4H5SB 3QCVL 3DXAB 2D7MA 1FZJB 4HX1B 4LVHC 1NSNL 4QRPA 1QO3A 5DMIL 3TBWB 3D3VE 4GAGH 4KUZL 1JWUB 4HUUA 4CMHC 4ETQA 5C0JA 3TH3T 4JQIH 3WS6C 1NDMA 5J13C 3BGMB 4D0CA 3HMXL 4CN4A 5KG9B 1ZGLB 4HCRH 1NC2A 3NZHH 4M02A 2ATKA 1LHZA 1D5ZB 5JXEA 4IOFD 1IGTB 1LEIA 1N4XL 5D7JC 5L88H 2QQLH 3W2DH 8FABB 3ULVH 4G9FD 2QQNL 1KLFA 5MEND 2F8VA 3BP4B 3HN3A 5D2LE 4PTTA 4U6HA 3C5ZD 1KJVB 4QLRA 4KK9C 3WHXB 1ZLWK 4JFOA 4PJ7E 3PQYB 3WFEH 4LBEB 1WWAX 4FNLL 2EYSA 4O5LH 4YZFE 1BFSA 5BV7H 1CE6A 4WENB 2DQUL 5CJXC 3STZB 3M1BA 2EDHA 5C0DA 2HT4C 3LN9A 3OAZK 4I9WD 3VFSA 2F5AH 5DSCA 1K6QH 4JRXE 5DMYA 2E7CA 5IJKC 4P2QD 5IB3A 3T09A 4YDJB 4MAYA 4RAUA 3NTCH 4DCQB 3IXTA 1K4DA 4S10A 1K3ZA 1X5YA 4ZD3L 3S4SB 5SWSB 5GGVH 1HHJB 5I1IH 3KLDA 3MROB 4ZODA 2IBGA 4LP4A 3GI9H 4HS3B 2JF1A 2R0KL 1BZ9A 1XGUA 3CPLA 3ZLQC 1HQRA 5FEBA 5CUSH 2V5YA 1MCDA 3MODL 1IC7H 4JREC 4GW5B 2H2SC 1MHEB 3OQ3B 4RIRB 5DWUL 3UTTB 1NCAH 4J3OC 5HI5C 3UX9B 4XH2B 2B20A 2M8XA 4MHHG 3D25B 3HMWH 1DSFL 1OARL 2NXZC 2UVFA 1MJ8H 2ZOKA 2EIBA 1A7QH 3NZ8B 3O8XC 3CC5B 3BEVB 1IGCL 4P99A 4HH9B 5MI0C 3MXVL 5F6IB 4HXAH 5E2UL 3S96B 3KPMA 2FYYB 4MZ3A 1BVLB 3BX7C 4FHBD 3IDYC 1YY8B 1WT5C 2OJEB 3QULB 3CXHJ 1IQWL 4U1IA 3P3YA 4X6CF 3RWFA 1X4YA 3ARGD 4MA1B 4MVBD 2IAND 3IVKA 2CUIA 1KNOA 1B2WL 5FUOH 3THMH 5L0QB 3U4AA 3QIBC 3FB7A 3DURA 1A4JB 1YMMD 3PP4H 5ITBH 2VDNL 4P9ML 5I18H 4HWBA 4K94C 4S1QH 3MV7A 3B5HA 5CD5D 3O3BB 3NFPB 4OV5A 4S1RH 2VDKL 4B7IA 2MQ3A 1HYRC 4X4ZA 2ATPB 1KJ2B 5F8QC 5TE6L 1UACL 5HDBF 1VB9A 3QQ4A 4GRMA 4LIQE 1VGKA 2CRMA 1DEEA 2EIZA 4PJ8D 5C0IB 4JFDE 1WC7B 3LB6D 3QUML 5AZEL 4D0BB 3TIDB 1PEZA 2EXYD 4JM2F 2FJFA 4XZUA 3E8UL 3LHPL 2RB8A 3UBXB 2C1OB 4ODXB 1ZHKB 1BFVL 5KW9H 1X5ZA 2MFNA 1J1OL 3WXWL 4HKJA 1MFEL 3VGAC 5DURD 1FFNA 3UZQA 3I84A 3LV3A 4TOYH 4G8FA 1A6AB 4XGZB 1CF8H 5EOCH 5I76B 2X4NB 1UJTA 5CIPA 4WFGD 2JB6A 1MSPA 3QJFA 3A67H 3CU1A 4NRYA 1QNZL 2YPKA 3LN5B 4U1MB 4QXGH 1KCLA 3EHBC 4OD2B 3TA3C 2BRRL 3QPQD 1A3LL 2YUWA 1JZ8A 2EYTA 3O3AA 2ITCA 1MIMH 4BELD 3NCMA 3QUXC 1A6TA 2YBRB 4ORGA 5CLTA 3ZKMD 4XX1G 5D72H 5LGHH 5TJWK 3OKEB 5CZVH 5E8DH 4FA8A 4BSWB 1VFAA 4HWBH 5I75B 5BS0D 5GRXG 4NWUL 5E9DA 1ZGLM 3QG7H 5BQ7A 1PYWB 2H6PB 1I9IL 2VC2H 1B88A 5IGXL 1S7WA 3KLAA 2BOCA 3R0NA 2DF3A 3MC0A 1MLCA 5KSAD 1ZVSA 2I9LA 1DL7H 4ZG1A 3PNWB 4P23C 5D5MA 1DANT 3QWOB 4KY1L 4F3FB 4KVCH 4NDMB 5J57B 2OZ4A 5C6PB 1RY7B 4TN9A 2RCSH 1EVTC 3LKPB 3V95A 4J2XA 1L6XA 2AK4E 2YA2A 5D1QA 5I73C 5ENWA 5FCUH 5GGRB 2DMKA 1AR2A 4M8QB 4N0UB 4JLRB 2ITDA 1MLBB 2EC9U 3N85L 5IMOB 1OP5K 3QDMA 4QY8A 1JWSB 2O5ZL 1NJ9B 1YMHA 3HFML 4N8VB 1D9KD 5MERA 1W72L 4AL8L 5CIPH 1M7DB 2IJ0C 1TVHA 3VXUD 4DQOH 1NMAH 1MHHB 2NY2D 3HI5L 3D2UD 5FGCB 3G5YA 1BJMA 4FQPA 5IJVA 4GKOA 4GMTL 2IPTH 3ULVC 3EDKA 3ARZA 5FK9B 3RZWA 3C9NB 4XWOD 4U6XB 4RAHA 3L3OB 4GXVL 1T1XA 2UY6A 4WUKL 4YEEA 3LAFA 2YN5A 3L5XH 1GOGA 4CJ0A 1CL7I 5KVDL 4IEFB 2DWEA 2EEBA 4HIHA 2HWZL 5K33A 5BV7C 3EJZC 2F54E 1BEYH 3T0AA 2ZG1A 2X4UB 3TPUB 2JJWA 3A6CH 3WLWC 5JIHA 5K9QI 1ETZA 3MRPA 4XVSL 4GQPH 4KRNA 3JWOH 3UTZB 4MMXC 5FHBH 2X4TB 2PXYC 4XPGL 3FOLA 3P4LA 1OQOA 5DMGD 1AIFA 5I9QC 3ELAT 1MHCB 4Y19E 3FQRA 4JY5H 2J5LC 4CADA 4XP9H 4OQTL 4M1DH 3JV4A 4L1HA 5T3XH 3ZYOA 1WV7T 3EW3B 3SKJH 4NC2B 4F80A 4ZYKA 2FX7L 3CUPB 4OLVL 1NFDB 4QXUL 4HWNA 1NFKA 4UV4L 2P46B 3MLZL 3MYJA 4WI3A 4L4TA 1YNKL 3ES6B 3PDGA 3L3GB 3C8HA 1X4ZA 5JXEC 3KXFE 1S5HA 4Y2DA 5DJ6A 3RUGE 5MENA 1RZFL 4TTDC 1H3XA 2BVYA 2VWEE 1L9MA 5C0ND 1T1ZB 4ZFOL 4JHAL 4LQ1A 3C5ZA 3O6MH 4FP8H 2NW2A 3CDYA 2VXSH 1CG9A 4O9HL 2EH7L 2L7JA 1IJ9A 2DTSA 4L8DA 4UOW0 3OKMB 1PG7W 3WS3A 1L7IL 3MV8D 3GB7B 1MCKA 5JHLH 5DEGA 3GIZH 3TH4T 1RZKL 4LLVB 2WZPD 4MXWL 1KGCD 2O61B 1IAIH 2YRZA 2AEWA 4EDXA 5FYLD 3MR9A 3BO8A 5DJXA 2PO6A 1FAIH 2BNRE 4LCIL 3J7HA 1AXSA 1UWGH 2IAMD 3ILQC 4UV7L 4XI5C 4M6MH 1RD6A 3O9WB 1J9CT 5HYQB 1P5VA 2FBOJ 2YPLE 5F72S 1DLFL 2X1XR 3HG1A 3ZDYE 2DYPD 1KEGH 1PKQB 1F4WL 3QRGL 1OAZH 1IKNA 4R6UA 4ZPTA 1NKRA 3H7BB 2ESVE 1BLNA 1J05B 1WCBB 1P7QD 5E2TL 5E4EB 3IFLL 4ENEC 5H94A 5DEFA 5M95B 3FAWA 5HGGS 4Y4FA 1KYOK 4KMTH 2AS5M 1N59A 1S7RB 4FXGA 2ERJB 4CGTA 5HVFB 3VWJB 4PRIA 1MVUB 4OCMC 1J0IA 1IAMA 3BDYL 3KJ4B 2W65A 3MUZ1 3DJ9A 3ZHLA 1H3WM 3AMKA 5K9JL 1PX4A 5I71C 2LU3A 3QO0B 4WV1A 1JMZA 2G75B 1IGMH 1NBYA 4LHQB 4S0SD 1G7IA 4MQXC 3AB0B 1CGWA 2IMNA 1DANU 3PWVA 3BT2H 2Z93A 1JZ2A 1HH9B 1QKZH 1QP1A 4P0DA 1NL0H 4RNRA 4P5KB 4WEUD 3VD5A 2GSIA 1U8QA 2Y36H 1KG0B 1GSMA 2VERN 3ARGA 1KN2L 3HE6D 3MRMA 4XMKL 2IANA 4G6KH 4K7FB 4Q9QL 5CJQL 4JJHA 2P8PB 3JSSA 3O6FB 5HHQA 1PDKA 3AM8A 3V52L 4HEME 4GAYA 1EBAA 2F53E 4I13B 1FFOA 2OJZL 2VKWA 4Y5YB 3W0WE 4G6FB 2RIKA 1MFDH 4LRNL 4MYWB 3X17A 3DI3B 3HE7C 4KJYA 4MHHI 4DTGL 3DX8B 4OLWH 5EO9A 4Z95H 3G6JB 2KZ1B 3FRUB 1G9ML 4ZQKA 1NFIB 1WEJL 2FDBP 2ORBH 5FA4A 3Q5OA 1NCDL 4LDLB 4WDIB 1MFAL 5CS7A 4GG6E 2DKUA 5GS0D 5L2KB 5B22A 1JGEB 1TJGL 3RAJH 1OP3H 2VDLL 3W5NA 2X1QA 4M61B 1HILB 5C0CA 1LE5A 4AIOA 2CD0A 2Z31D 1SMOA 3RDTB 1Z9MA 1U8HB 3C5JA 3IJHB 5DHYB 1CD1A 1GGUA 1K8DB 1T0PB 4GJTB 4M8VA 4G7VL 5IHLB 4G7YH 5J7CC 5LGJB 4KMQA 1WVZA 3RNKA 4APQC 3SGJA 3IJSA 3OX8A 1Z3GH 1JFQL 2Q8BH 4JFFB 4G6JH 4HJJH 2VLJB 4RFNC 3E6HB 1FCGA 2VQTA 4JAMB 4WUUD 1CDIA 2IPUG 2WW8A 4R97C 1S7VB 4OCXL 5BS0A 4TVSa 4JFPB 2R2BB 3EOTH 1DBAH 4ZTPL 2P1YA 2P48B 5JO5B 1YEEH 3RZCD 5JOPE 4NQDE 3IDNA 2DIAA 4UT9L 4W81A 2JCCE 5IB1B 3BPOB 1T22B 5F44A 4J6RH 3N50A 2DLHA 3VE0A 3BAEL 5KAQG 4JN1L 3W82A 1TVBA 1J8KA 1PLGH 1I3GH 3I85A 5D1QC 5J1SC 4E41B 2QSVA 4ZOEA 1RUPL 4Q9CA 4P2RA 4M3KB 4I2XB 3LPGA 5BVJB 2NZ9C 2R1WB 4PV8A 3WFBL 3UC0H 3CFKB 3KPRB 4N68A 2EDLA 4BH8B 2OL3A 5D2NA 3EJYD 1GZQB 4POUB 4NQVA 1KPVB 3V5HA 4GKSA 1CXKA 1IAOA 3QH3A 3OKDB 1FPTH 5IF0B 1JYVA 4H0HB 1XF4A 3VH8G 1DQDL 1Y6MR 1A1MB 4K3JL 2VSDA 5C09D 1REIA 5F9AC 1YN6B 1E4KA 3MRQA 3F6IA 1NPUA 5C9JB 1I1YB 1KCUL 4XPBL 4BUHA 2APFA 1EUUA 4RGND 4S1DD 3F6LA 1JNHA 3HA0A 3NCYS 3U46A 1CFSB 4PRNA 4Q0XL 1P7KB 1ZVYA 4I77L 1QFUL 5EA0H 4CDHA 2DD8H 4MXQD 4LPCA 3QNZA 2UWEE 3PWNA 3RHWK 4ZXBB 4ZS6C 4EBQL 1RPQA 4BKLB 4BFEA 1QVOB 2VH5H 1KIRB 2GAZA 3QAZC 5IFHL 4XPFH 4HFUH 4NNYB 1QFWM 1T2QH 2WM0A 1J18A 2A0LD 4MD5B 1EHLL 1J5OH 4XX1E 1KCRH 1O0VA 4TUJB 1G1YA 2XN9E 1F4XL 1ZOXA 3K8KA 2GHWB 3QIUD 4YNYA 4NQCB 2OL3H 1H9VA 4RGMB 2G5BB 5DEZA 3MRHB 1CDCA 5EUKB 4FABH 2CXGA 5DLML 3Q3GB 1T03L 5E5MA 5T1DH 1CQYA 3UPAA 3CMGA 4IOFC 2K7QA 1INQA 3MV01 4PJEB 3MNZA 3EBAA 3WFZA 3V2AR 2XXMB 1G6RL 3QCUH 4MLSA 5C7XH 3G6JF 1MRCH 1FV1B 3DOSA 2V2XB 4U1LB 1D6VH 3C5ZC 5C6WH 3TGXA 3M07A 1F4AA 4X4YA 2DQEL 3HKFA 5IMMA 1QZ1A 5IVXE 3X13A 2EYRA 5D71H 5F8RC 1NANI 5KSUA 3SJVA 3I6KB 3E6FB 2R4RH 3V6FA 1JF1A 1PG7H 2J12B 1NCWL 2Y9RT 1F6AA 3LS4L 4NKDB 1QFPA 1DN2A 1A6VH 4WFFD 2BC4A 5DQ9B 2DKMA 4AG4H 1JYNA 1D6EB 5E8PA 3HI6H 3OKKA 4B5EA 3BP6A 2OR7A 5IG7A 4UT7L 4K3GA 4JZOB 2FL5B 1A7OL 2HFFB 5L6YH 2CK0H 5GISL 4Y1AD 4QTIH 3REWA 4TNWK 3D18B 1IKNC 1R5IA 3TBSA 3DGCR 5E7BA 3S3PA 1BQHB 3P4NA 5TQ0L 1AO7D 4ONFL 2VB5A 4O58H 4Y4FC 4OF5A 4LSPL 3TCLB 3S36H 2VITA 4MSWB 1DVFB 2VDOL 2CJUL 1SEBB 3KLHD 4J3VA 2NY1D 2FGWH 3UDWC 1ZSDB 2J2ZA 1F58H 2LFGA 4NYLB 5GJTH 3WDIA 3VW3H 2X09A 4WV1C 2VLRD 3DRQB 1YEKL 4I0PB 4TUOB 1JL8A 4MNGA 3T4YA 4LCCA 1YEJH 4NCC2 4L5FH 3SDAD 5FYLH 5F7EH 3G04A 1NKOA 4J1UB 4ORZC 4YHOH 3D9AL 3HE6A 1N7MH 3ARGC 2DS4A 3DUHA 4MVBC 3IF1A 2FR4A 3IJYB 3K1DA 3AM8C 2QSCH 1RZGB 1W0WA 3D1MC 3QHTC 5J1AB 4G43A 2IC2A 4PP1D 4R7NB 4NOBA 1OOAA 2RGSA 2ZUSA 2JCCF 2OX5A 4QOKD 4TSAH 1NAMA 1T1YA 3QFDA 4G6MH 5CD5C 5ADOH 2H41A 1BVKA 1T7VA 1IBGH 3M8OH 3QISA 4OF0A 4U6YA 5DGQA 1Q8MA 1HNFA 2CO7B 3MACL 4UNUA 3FQTB 4POZD 2C5DC 1FIGL 4S2SB 4Q6YA 5ILTH 3L7EB 4LHUB 4LSVL 3X3FH 1KJMB 1HIMH 4HDIA 1T5WA 3LB6C 4XNZC 4JDTL 3HZKA 2EXYC 3L3HA 4PJCE 1FNEA 1GGIH 4LVEA 1AQKH 2AXFB 4FXKB 5C2UB 4JO2L 2Z31A 3QEQA 5DI8A 1HINH 1UJ3A 5IV2A 3EYOB 3HC3L 5E8EA 3QUZB 3PGCB 1ZA6B 5MHSD 3N0PB 1MRDH 3EDDA 3EGSB 3C2SA 4XP5L 5TPWH 5ALCL 4BSVB 5AG8A 4QHNA 3PHOA 1JPGB 2BRQA 4NHUB 3OKLA 1OSPH 5CP7A 4C4KT 1JGUL 4NZUH 3CCHB 2D4DA 5ID0B 3GJFA 4JFEB 1ZKAA 5T1MA 3SGJC 1IGJB 3QPQC 4XRCA 3ZTNH 2ZUUA 4GAJL 2BERA 5E2JA 3GUTB 4OD1L 3B3IA 2JIXD 3ZKMC 4PJGA 3I3DA 2X40A 5HGBA 1LEKA 1XMWA 2EDNA 5L9DL 3JWNC 3TVMD 3WSQH 1PQZA 5HHXH 1NAMH 1KLUB 4MD4B 5HHVH 5HYJD 5KSAC 1QSFE 4Q7DA 4R4BB 2ZUXA 4QRTA 1ZT4B 5CBEA 3ZDZE 4OLZH 1T3FB 5HGHA 1BIIA 5KVMC 1HHKA 8CGTA 5GS0H 2G60H 5D70L 3ECBB 1BD2E 1YEHH 4WI7A 2R0WL 4KXZI 4JN2B 2BOBB 2Q86A 2D2OA 4NRZA 5ISZA 4QGYA 2YKLH 4QCIA 1I9JH 3PP3H 4KTYA 5C0AD 4P5TD 1AKJA 5IBLD 2GTZA 3S88H 5ITFA 4YFEA 4ODSH 3V4VH 5C1MB 1FL6B 5IKCB 3K2UL 4BQ9A 4Q2ZB 2VDRH 1HKLL 1RZIA 1RVFL 1D9KC 2PR4L 4MJIE 5DMJB 4PTUB 5DD5L 5HD8D 5HHOD 4N90E 5D2NC 3RL1A 3F5WB 1T5XA 1Z9LA 2CIKB 3RIFF 4U1HB 1KEML 1KPUA 2ZSWA 35C8L 3EYSH 3MRIA 4PJDE 3NFSH 2NY2C 1J12A 2GI7A 1VACB 1R24A 3ARYA 1V5JA 3HC0B 4NM4L 3PDOB 4C56A 3QFJE 5C08D 2DICA 3GKZA 1E4KC 4GW1A 5LWYH 2FGZA 5GIRA 2DJSA 1OLLA 1WZKA 4XWOC 4AQOA 4EN3A 2C1PB 3CAFA 2ZPKH 5FYJL 4WTWA 4O2CA 2Y07H 3FQNB 1TQCC 4LNRA 3LKNA 5BO1L 1HWGB 1QLRA 3GMMB 5DA4A 3H9HB 1MCSA 3W39A 5K59E 3KPSB 1IKFH 4GQ9H 2EDBA 5ESQA 2P5EB 1R5VA 4YXKH 1V3JA 1S7SB 4JDZB 2ADJB 3G5VB 2CH8A 3PWPE 4NKMA 1ZVHA 5FM5M 1YY9D 2O26U 3ZHKA 1OCWL 1FZKA 4UQ3B 3QIUA 5EU6A 4FQJL 1CXLA 4NO0D 3VJ6B 5F89B 4MX7A 2HAZA 4OFKA 4XAKE 3MRNA 5JHDB 5T5FH 3TNMB 3H6JA 1H3VA 5AYUL 1NAKL 4PJIE 1IZJA 5BJTB 4XBPB 1JGDA 3BN3B 3DVNA 5GXBB 1XGPB 2GJJA 1JE6A 5F96H 3TO4D 3ZT6A 1FO0A 5GZND 5DHXB 5J4MA 3K81A 3C60D 5A2KH 3BD3A 5CEXB 2EDWA 4Y5XB 5C0NC 1SJVA 4NNXB 4R3SB 4XNMA 2E6PA 3BD4A 3T8XA 4F57L 4RZCB 1SEQH 1OLZA 3F7VA 1J0KA 2XG4A 1HCVA 2D03H 3TF7C 3KG5A 4XC1H 5IB2B 4CVZB 3CFIC 3T1FB 3UTQA 5I6XB 3P11H 2H26A 1G7LA 1TVDA 5JQ6L 5GS1B 2RBLA 4LLQA 5KS9A 4HPOL 1Q9OB 1KELH 1SBBA 4LASH 1F8TH 2CR6A 4IBLT 1KYOJ 4UU9B 2R29L 3MUY1 5E99L 4OFYD 4N1HB 1IVLA 4R8WH 3RY5A 4GUPB 4UBDC 1D5IH 2IAMC 3EOBA 4Z7VE 3ZSSA 5KVFH 2DN7A 3D3VD 4L3EE 3P4MA 3KLSA 5FHAH 1F13A 1FH5L 2R1XA 1LWRA 3MCLL 4I18B 4Y1AA 2K1MA 4LVHB 2AJZA 1MCPL 4JY6B 2HH0L 3S35X 4N1CA 3SDXA 1T0MB 3TO2B 1CU4L 1QSED 5J6HA 4MA3B 1FO0H 3STLA 4ZUVB 4CMHB 4E5XA 3EAKA 5LJYH 3SGDH 4XCFH 1S9WB 4KRMB 1FYHB 3CD4A 1EXUB 1I7TA 4PGCA 3MJ8A 5DJAA 3OHXA 1FNFA 5F3BB 1TIUA 2UZIL 3MBED 3VH8B 1RK0A 2H1PH 1A6WH 4Y4KD 3GSXA 3BKCL 1MI5E 4JPWH 2VLRA 5D7JB 2H2PD 5C3LD 1PZUB 2QLVB 2VXUL 3SGKA 1X4XA 1HQ4B 1XR9B 4OBSA 1WTLA 1FNGB 4WFEE 3R06B 1G0DA 3B9VA 4LCCC 2R0LH 1A22B 3PHSA 3V5DA 5EN2A 1FBIH 3NMEA 1TJIH 4R7DA 1ZS8B 2ICWI 3B9EA 4UNTA 3MXWL 3HE6C 4WTZA 4ZUUB 5JW3H 3IDXL 5FO7B 5F71A 4C58B 4POYA 3GMRB 1JK8B 5CWSA 4HAFA 4ZDHA 5E56A 5ACLA 3HZMA 1RJYB 1FORH 2A77H 5T1KD 2QBWA 2NR6D 1L0YA 4Z0BH 4NUJB 1UZ6E 5HGAB 1FSKC 3MRGB 4Z7UE 1RURH 3CLFL 5F6HI 2J8UE 2Z8SA 3SDCD 1Y6NR 3HI1B 1BFOB 5I0DA 1YQ2A 3BOVA 2BY1A 3VG0H 3T2OA 2DQIL 3GKWL 4UT6H 1U3HA 4PB9L 4N8CH 5GS0C 2Z8RA 4Y16D 5D1XA 2CLVA 4WO4D 4RMSA 3FFDB 4NQXB 5FKPA 2P8LB 1DQTA 3MLTA 4M1GH 2WANA 4YPGA 3DWTA 3I2CH 4XP4H 2Z31C 2Y5EA 1DBML 5I1HH 1UJ3C 2D0FA 3BI9X 4HZLB 1AY1L 3B9KA 3UYPA 4PJ5D 1II4E 2NXZB 3T77B 2ICEB 5A16A 3O8XB 4RMQA 43CAA 3BZDA 3KPLB 4ZO8A 5MI0B 4NOFA 1NCCH 4XNUH 3IDYB 4G8GE 4MQ7B 2GYSA 2I24N 5CSBA 4MJ6A 4KI5C 2GJ6E 5FYKL 2XWBB 1Y6KR 2XZZA 5TF1L 2YSSA 1HDMB 4FZ8L 1QLFB 1CYGA 2YWZA 3WIHL 3VXNA 4NQEB 5GRWA 2CRIA 3RI5F 4EI6B 5E08H 4OD3H 5A2IH 1KF9B 3I6LD 5E6IA 1UB5B 4ERSL 5KVEH 2NY3D 5HYJA 6FABL 2JK5A 1ITCA 1TZGH 3RIFK 2AJSH 4WJ5B 1UA6H 5C0BA 3FT3A 3QQ3A 1X5KA 4WW2A 4ELME 3DGGA 3VXMB 3HUJE 4BZ1L 1ZV5A 1PGRB 1SY6A 3VXSB 2N7BA 3EDJA 1HH6A 5K9OB 2V2WA 1A6ZB 3DVIA 2VN7A 2AK1H 5C0AA 2CLZA 5TE4H 2YK1L 1KIQB 4R0LC 1P1ZB 2GW5A 4X7SH 3BE1L 3LEVL 1U93B 2CRYA 5I1LB 4Y8DC 5C86A 4HS6A 1XF2A 3R4DA 3L3JA 3D0VB 3Q2CA 1LP9E 5KJRL 3DVGB 2P5WE 3EJYC 3D5OF 2OS7A 3G08A 2NTFB 4YFLI 3FT4B 4F33A 1VHPA 4ODUA 3UTSA 3MO1A 4WI5A 4LLMA 1CE1H 4X6CA 5C08A 1BF2A 1YC8A 4GAFB 4JPIA 4NQSA 3EKCA 1MJ7L 5ESAB 2O5XH 1RFDL 4GKZA 4ELKB 1B4RA 2JELL 4U1JB 1J0JA 3MLRL 4K55A 4PRPE 2FATL 4RGNC 3C8KA 3NCFB 4S1DC 3KYOB 2A6DB 3KWWB 3OR7A 3GIVB 4EN3C 1BECA 1AI1L 1UCBL 4LKCB 3OPZL 4CVUA 2Y06H 4FZEL 4MXQC 4KTEL 3DX6A 5TF0A 1J0YA 4D3CH 1WBZB 1ULVA 1DQLH 2ZKHL 3Q6FA 1MPAL 1VGEL 3OAUL 2P49B 2QSQA 4WNQA 4DK6A 4JKWA 5BW7A 1CICB 5CMAA 5IUSA 1CFTB 4L9LC 3PHQA 5I66A 1S9YB 3QG6B 2A0LC 3GK8L 4RQQA 1MCLA 3FO0H 3O41B 3CH1B 3EZ8A 4P23B 3SGEH 1WITA 3GSNL 5DVLA 4QHMB 5H37H 3BKJH 3JUYA 2I07A 4JHWH 5EUOE 2R1YA 4JM2A 4N0YH 5GGTL 3QIUC 3P0VL 4PGEB 2AI0H 2YRLA 4OKDA 5F9JA 4Z0XB 5I17B 2OQJA 3F58L 1YYMH 3PIQB 4M5ZL 4X7TA 5IQ9B 3KR3H 1P4LB 3QUYA 5T3ZD 2A9NH 1GGYA 5DJDA 2HFGH 3D39D 1ZEAL 4MNQE 3DARA 1BAFH 1I4FB 4L8CB 4PG9B 5TQ2H 4PB0H 2EDEA 3SDDD 4W6WB 4LSSH 2EH8L 1KLGB 3MOAL 4P46D 3DI2B 4K2UH 4X80L 4NIKB 3FN0L 2EO9A 1YNTA 3PABA 3UPCA 2LU7A 4WEMB 4LEOA 4C83B 4OZ4A 5DTFB 3VXRB 4M4RA 5EORL 4JG1L 4IOSD 1HI6B 1OAUL 1MFCL 4X5LA 5LG1A 2OK0H 1I7ZB 1TZHA 1RIUL 3WN5A 4BQCA 4YBHA 1YJDH 4OLXL 5DRZA 3VXTA 4DKDC 5FA3B 3T0EE 4HFWA 3MJGX 1AGFB 2FX8H 3HC4L 5E70A 4DZBB 5CJOL 5CZXD 3U0WH 5SWZE 1HNGA 3QEGL 1QRKA 1AGCA 3D3VA 3EOAA 1DQQB 4Z7UF 4OJFL 4MA8H 4DGYL 1Z0MA 5B3JF 2UUDH 3DIFA 3BSZH 4RWYL 4QRPB 3QDGE 1QO3B 5LKNA 1LDSA 4JVWA 1NBVH 1QFWL 1N3NA 4U1GC 4HUUB 3H3PL 4ETQB 5C0JB 5GSVA 4ZFZA 2J5LB 1U2CA 4ALAL 1N26A 5FB8A 1NDMB 4D0CB 3GSWA 3KLHC 3L5WA 4YXHH 5D2LA 1NC2B 2NY1C 2JJTA 1VENA 2ATKB 1Q0YL 4Y4KA 4PJ7A 3FO9A 4X8JA 4PJBE 3MJ6A 3DTXA 1LEIB 4LQFL 1J8HD 3SGKC 3U7WL 1PKQE 3SOBH 2HG5A 4PTTB 4U6HB 2FLBT 1UM5L 4KZEL 3SDAC 2ZNWA 5IW3A 5HVWA 2AEIT 1OAQL 4JFOB 5CKGA 5IW1A 5K93A 4GRWH 4JRXA 1UYWH 1GOFA 2V5RA 1BP3B 2BNRD 2EYSB 4XTRC 2F19H 1HCFX 2FD6H 1CE6B 2J6EL 4DFHA 3O0RH 1NCTA 1RZ8A 2V9RA 3M1BB 5C0DB 4XP6L 4RISL 3VFSB 4PP1C 3LIZL 3JV6A 2J4WL 5LCVH 5DSCB 2C26A 2DJ4A 2VJXA 5I2IA 4M6OL 4WY7H 5IB3B 4MAYB 1CLZL 4RAUB 4ELMF 5MEOA 3HUJF 2ESVD 2VZ1A 3IXTB 1K4DB 2FEDD 3NCJH 1YECH 4PJXE 4P9HH 2LVEA 3LQZA 4POZC 1OQXA 1AJ7H 3GBNH 4FQCL 3AUVA 1U3HC 4OF8A 4XPHL 1YQVL 1BZ9B 3GHBH 1XGUB 1AXTL 3TT3H 4P59H 1RU9L 3CPLB 4RFOL 1JCKA 1HQRB 1KN4L 4JFHE 5IESL 2OCFD 3WEXA 2FIKA 4Y4HD 1LP9F 4CMMA 4Z7NE 1XGQA 2D3VA 2OR9L 3QCVH 4RMUA 4OI8A 4Y0GA 3TP4A 5GGQL 1MUJA 1EIBA 2BJML 3SQOL 4XPTL 5JR1H 1NSNH 5DMIH 2ZOKB 1VERA 4HT1L 2YN3A 1ZHNB 4KUZH 1CDYA 1KTLA 3KPMB 4HLZG 2BK8A 5I8EA 4M43L 1U8JA 5I15L 5C07E 3HMXH 3VFNA 4U1IB 3T2NL 3U7YL 2BVOA 2F53D 5D96C 2IWGA 1OGAE 3BXNA 3GFUA 3RWFB 4JZNA 3TVMC 1DBJL 5D6CA 3EUUA 4ZTOL 5E6IC 3DECA 3W0WD 3IVKB 1KNOB 4NC1C 3WFCL 1N4XH 2YA1A 2BXZA 1N64L 3ABZA 5HVHB 2QQNH 4UTBL 3FB7B 3DURB 3JV0A 1EA9C 2NQCA 2UV3A 1IC4L 4KI1A 3GSVA 1MRFL 4WW2C 4K7PH 3HRPA 4JFDA 4YQXL 2W0KA 3PL6D 3MV7B 4YFLF 3ULVF 4OV5B 1FG9C 4LAJH 1IGIL 4FNLH 5IBUG 2AGJL 2ZP0T 2OTUA 5IBLC 5ACMA 2BVTA 1A7NL 2DQUH 1F2QA 3QQ4B 3O2DL 4GRMB 4OZHE 2C4XA 4G42A 4U6VL 2LTQC 1VGKB 1DEEB 2EIZB 1Z0NA 1WZ1L 5HD8C 1CCZA 2AV7A 3DX7A 4ETYA 4X83A 2IEPA 4P2OD 2FJFB 4XZUB 3EJJX 1P5UA 1A7RL 2FX9L 2A38A 4ZD3H 2YD2A 4YBLC 5IEHA 4UTAH 1T7YA 4HKJB 5I8KL 1DQJA 1XIWA 1FFNB 4M9PA 2R0KH 5GRVK 3LV3B 5H2BA 5C0EA 4G8FB 5JLZA 4EEEA 2AV1A 5HYIA 5I16A 4ZPVA 4R2GD 5CIPB 2L0DA 2JB6B 3QJFB 4NRYB 2YPKB 3MREA 2E7LA 1FZMA 3U6RA 1XGYL 3MODH 4RFNB 4KRLB 2PUQT 2EYTB 3O3AB 5DWUH 2ITCB 3GJEA 1IAII 1A6TB 4ORGB 4NQDD 4R97B 3WFDL 2VQUA 4FQ2L 1CXHA 1DSFH 1OARH 3QUMA 4WHYH 1SJEA 4LIQH 1VFAB 3ULUL 5E9DB 1IGCH 6CGTA 3MXVH 5BQ7B 5BW7C 1YJDC 2AK4A 5E2UH 1S7WB 3KLAB 3UYRL 2NYYD 2BOCB 1MLCB 1ZVSB 2I9LB 1YY9C 1U9KA 5D5MB 5GS2D 1PFCA 1IQWH 4HSQA 2ILLA 3OJMB 4JM2C 1EJOL 1QPPA 2HFEA 3QJHA 5GPRA 3QHFL 5D1QB 1UB6A 5F1IA 5ENWB 1QPXA 3QUYC 2OXHA 3RKPA 4O2FA 2ITDB 3TO4C 5KTEH 3QDMB 4QY8B 5GZNC 4HV8A 5EU3A 2VDNH 1QR1A 4JR9L 1K85A 1YMHB 3CNKA 3U4EA 3SDDA 3C60C 1Y18A 4LSRL 3WO4C 5MERB 3UO1L 4WI6A 2VDKH 1TVHB 3HAEA 3MLYL 3G5YB 1UACH 5E2VL 3SY0A 3I6GA 5IJVB 4EXPX 1ND0A 3T4AA 3JTSA 2HFTA 3QUMH 2ZZUT 1XEDA 2KQNA 2VL4A 3FB6A 4JKKA 3EZJB 2F54A 3MGOA 1S9XA 3E8UH 1UENA 3LHPH 3U4BL 1BF8A 1T1XB 1BFVH 1O5DT 32C2A 3L3IA 2DDQH 3DSNA 1J1OH 3WXWH 3ZE2E 1MFEH 1I9RL 3QNYA 4G9FE 5EU5A 2DWEB 4HIHB 1E6JL 1BGXL 1W72A 4F9PC 4M6NH 1FYTE 5CHNA 5DO2D 5DT1L 4K23L 1QNZH 3QAZB 1W8OA 4Y19A 2Z0BA 5FGBA 2BRRH 1A3LH 1F3DJ 3BESR 1ETZB 3MRPB 4MQSB 1E27A 3BKML 5KVGL 3DUUA 4GOSA 5HI4D 3FOLB 1FHGA 4HJGA 4IJ3C 1AIFB 4P9HC 5EFIA 3W11D 4NWUH 3KXFA 3FQRB 3RUGA 1B6UA 3JV4B 1I9IH 3CXDL 5IGXH 4P2QE 4QF1A 4ZYKB 3VFRA 3HAEH 3MBEC 4KY1H 4LRIA 3MYJB 2CDFA 1F02I 4Y4KC 4L4TB 4KJQC 3CSGA 4XWGL 1S5HB 2H2PC 4Y2DB 5DJ6B 3RU8L 4JO1L 5MENB 2AJUL 3RJDA 5FFLA 3NIDF 1LK3L 3C5ZB 3O11A 3JBG7 2NW2B 1CG9B 2I5YL 3FL7A 3MBXH 4L8DB 3WS3B 1F3RB 3N85H 5HJ3A 4LKXA 1FL3A 2O5ZH 2BNRA 3SDYL 3HFMH 5DEGB 3PE9A 5I74B 2XTJD 1W72H 4OQTA 4KHXL 4AL8H 2YPLA 1C08A 4MD0A 4EDXB 2NR6C 3MR9B 3BO8B 3HI5H 5DJXB 2PO6B 3ROOA 4YWGL 4HBCL 4FRWA 3TBVA 1DFBL 4O02L 4QHKI 1U36A 4GMTH 1JZ4A 1X5JA 4QXWA 1AXSB 2ESVA 2QL1A 3SDCC 1G1CA 5BRZE 1ROWA 3F7RA 4ZFOA 3HG1B 4HGMA 3DRTA 4DGVL 3ROLA 3BPLB 4XHQA 1MCBA 4GXVH 4Y16C 4WUKH 2FEEL 2UYLA 4WO4C 3QXDA 4ZPTB 4YUEL 1NLBL 4ZS7L 4FQXD 1BLNB 2FO4A 2VIRA 1U8NA 5KVDH 3MRCA 3IKCA 1UEYA 1CGTA 1YMME 2HWZH 4Y4HA 5H94B 1Z2KA 5DEFB 3HNVL 4ZAKD 4Y4FB 1N59B 4PREA 4FXGB 1GXEA 2AQ3A 2WUCL 1A8JH 4PRIB 5EO1A 3EFFA 3QT2A 4J4PD 4XVSH 4UMGA 2W65B 4XCYA 4JGJA 4OGAD 4EQ3A 4NNPH 4OUUA 3TYFA 4XPGH 4F37K 4WV1B 2E7HA 5I1EL 3MNWA 1H5BC 1NBYB 4UUJA 5EB9A 1G7IB 4NJ9L 4K9EL 3NABL 4OQTH 1FN4A 2EKJA 4NZTL 3PWVB 4M1CD 2Z93B 2F53A 4DUVA 2F8OA 4RNRB 2FX7H 2GSIB 4OLVH 1U8QB 3R8QA 1G0YR 2ZUYA 3CIQA 3MLZH 1QLEL 4EOWL 3ARGB 3MRMB 3W0WA 4HKZA 3P0GB 2IANB 2NY3C 5JPMA 3MJ7A 5HHQB 1YPZE 1RZFH 4GAYB 4JHAH 1FFOB 4WFGE 4GG6A 4O9HH 2EH7H 5E8OA 1SMAA 4YHNA 2YD9A 3S3SA 1CTNA 1L7IH 2QQQA 4KJYB 2B1AL 5EO9B 4LPXA 4XCCL 4JFZL 1AC0A 4ZQKB 1V3LA 1RZKH 4BFBD 3WIIL 5FA4B 4PBVC 1YEDA 4MXWH 5GJSL 2GIYA 4I48A 5EIVA 2COQA 1M05A 4HKXA 1T89A 4XNZB 3N9GL 1ZXQA 5DA0B 1C16A 3RIAF 4P2OA 4LCIH 1B4JL 4UV7H 3PJSA 4U1NA 5C0CB 4JO3L 4AENA 1LE5B 4OI9A 2X41A 3A6OA 3QZWG 1DLFH 1U0QA 1XT5A 3C5JB 4LU5L 4LDEB 1J86A 1UQSA 3QQ9D 5B8CA 1KTDA 2Q1EA 3QRGH 1D5XA 1XIWC 4V1DE 3SQBA 1CD1B 4YHZL 5FGRA 4HGWA 1OWRM 1IAIM 3RRQA 2R39A 5DD6A 4M62L 1PEWA 3RNKB 2BHUA 3IFLH 2E7LC 3IJSB 3OX8B 5SX5H 4P2CG 4XB8A 4H26A 4OZIE 2XYCA 1QSFD 1LO5A 2FJHA 4NQDA 3B2VL 2JCCA 5GGRY 3HR5A 3ARRA 1UM4L 3CGTA 3BDYH 1RJZA 5BS0B 3VXUE 4HPYL 3ZE2F 2EE6A 1AGEA 1BD2D 5K9JH 4U1KA 3FOMA 4ZNCD 4JPVL 2OBGA 2B8OT 2JB5L 1PKOA 3IDNB 2BY3A 4JKLA 1KCSL 2A6IA 3Q0HA 1JZ5A 3VE0B 5GS3A 1OAYL 4OB5L 1TVBB 4MJID 5FXCH 1NBZA 4OLEA 3MLXH 5KANG 1KN2H 4XMKH 2AAVA 1MAJA 1MELA 2V17H 4N90D 4Q9QH 5CJQH 3TBYA 3H9SD 3GMQA 4JKMA 3V52H 3MRLA 5JTWA 1U3ZA 4MA7L 4P2RB 4QXTA 1QBBA 1F00I 2EKSA 4ODHH 1WJ3A 3BP5A 4NT6A 5JPNA 3MV9E 4PV8B 2OJZH 2P42B 4QNPE 1IC5L 2W91A 3BQUA 2AEPL 5HY9A 3SDDC 5CILL 2OL3B 3GSQA 5D2NB 5TH2A 5GGSA 4LCWD 1NGYA 4YHPA 4NQVB 3V5HB 4GKSB 4YHKL 3WLBA 2XV6B 4DTGH 1IAOB 3QH3B 2NY2B 2PYEE 3RWCA 1G9MH 4AEHH 1MCEA 4OZGE 5HHPA 5FUCE 5AEAA 1WEJH 2XNAA 1UWEL 1XF4B 3CX2A 1MFAH 4KVNL 2MKLC 3FCTA 3MRQB 1D5MA 2UWEA 2VDLH 3FFCD 3S37X 1JHTA 2G2RA 1A2YA 2GK2A 1JNHB 5D93C 3U46B 3D69A 4PRNB 1R0AL 4D94A 5GS2H 3QNZB 2VSCA 3PWNB 1WTGT 4HIXL 3CVIH 1IILE 2XN9A 4G7VH 5JORA 5IOPA 4OT1L 2VLLA 3MZGB 1RULL 2GAZB 5LXGL 3CDGA 1GJIA 4H25A 3MV8E 4XHJD 4XAKD 4N5ED 5T1LD 4L4VD 3RY6C 3RJQB 4OCXH 4HQQL 4YNYB 3BMVA 3L5JA 4UQ2A 5F88A 1KB5L 3QDAA 4Z7QF 3ZE0F 3DXAD 4LP5A 4ZTPH 3KDMA 5FYJD 1R3IL 4UT9H 4WHCA 4NM8L 5E5MB 4LRIC 1IFHL 2C3XA 2H3NA 5IVXA 2D7NA 5DDHA 3D85A 3ARFA 1INQB 2O93L 3BAEH 4JN1H 3MNZB 4UI2A 4M93B 1SYSA 1EEYA 3MA9L 3B8SA 1GZPA 2BY2A 4X4YB 1RUPH 5IMMB 3RWDA 3X13B 2EYRB 5I1JL 5ETUA 5KSUB 2BSRA 3WFBH 1E4WL 1G7JA 3SJVB 3V6FB 1JF1B 4Z7WE 3FQUA 1F6AB 2R0ZL 2VDPL 3QB7C 1ACYL 3PWJA 2BC4B 2WWMD 1B0RA 1KV3A 3MLWL 5E8PB 4LLAA 4M7LL 4LGRB 4Z77A 1DQDH 1JHKL 4OF7A 4D9LL 4YAQA 2X6MA 4K3JH 3OKKB 3BP6B 3KPQA 3RGHA 4OTXL 5IG7B 1DR9A 2FEDC 1KCUH 3NPZB 4XPBH 2CKBA 3MLUL 3SO3C 2HVJA 1UM6L 5D7KD 4L1DA 4YGAB 5FF6A 5IIEA 2Y6SC 2A73A 2X44D 3REWB 3TBSB 1R5IB 4Q0XH 2AJXL 4I77H 3VI3E 1QFUH 4FQXA 5GHWL 5JUEL 4LDOB 2W0LA 3F62A 1RIHL 3EIFA 3P4NB 3E1F1 3U7AA 1AGDA 3WXVL 4HMCA 5FYJU 2GY7B 4EBQH 1HHGA 4Y4HC 1RZKC 5SWSD 2OMBA 5H37G 2VITB 2YHGA 5IFHH 3BP7A 4NHCL 3FTGA 5C2BL 4WFED 2W38A 4X9GA 5F9OL 1U8OA 1EHLH 3B9AA 1NUDA 3IFPA 2LU4A 3ARWA 1YA5A 2CK2A 1F4XH 2FHBA 4MXVE 3RVWD 2VYRE 4WI4A 4MNGB 3T4YB 3ILPA 2VUOA 4LCCB 3OF6D 1U6AL 4KQ4L 5DFTA 5E6YA 2AQ2A 4MDIA 5DLMH 5EZLA 2A6KA 3G04B 1T03H 3HE6B 2VE6A 4YDLC 3FKUS 3IF1B 2FR4B 4AZ8A 2WLYA 5CSZA 4ZOAA 3RIAK 3BZFA 1W0WB 3LZFL 3W9EA 1Q72H 2CKBH 3OGOE 3QXWA 4G43B 4OIBA 4Q6IC 2EDFA 1T2XA 2DQEH 4NWTL 4OFVA 1FSKB 3GRWL 1NAMB 1T1YB 3PL6C 3QFDB 4NP4L 1BVKB 3CDFA 3IGAA 4HK3N 1CFNA 4PJCA 4U6YB 4WUUE 5ABDE 1SM3L 5AYQA 4PLJC 4UDUA 3REVA 4O2EA 5IMLA 4KDTA 5DHVA 4LSUL 2E7MA 4HDIB 1T5WB 3I3EA 3HZKB 5DUPL 2D7QA 4P2OC 2YRPA 3L3HB 1FNEB 4K3EL 4PJAE 4GMSH 4I0CC 2Z31B 5C70A 3QEQB 4MS8D 5DI8B 1UJ3B 5DQDL 3RNQA 5IV2B 3AROA 3IXAA 4UT7H 4YBQD 5E8EB 5HI3D 1A7OH 4G8EA 5GISH 1XH3A 2XFXA 5DJYA 3P30L 3VFWA 4QHNB 3PHOB 4R2GC 3OKLB 2GKIA 4PR5A 5CP7B 5TQ0H 1SVZA 2Z4QA 4AH2A 1JGVL 1J11A 1DQMH 4FQQA 3GJFB 4ONFH 5T1MB 3IDUA 3MQIA 1G9MC 2YD5A 2ADIA 4XRCB 1U42A 3MJ9L 1QSFA 4IRJA 4LSPH 3SKMA 1BWMA 3B3IB 3LDBC 5DRNA 4U05A 2CJUH 4PJGB 4DW2L 4J12A 2PW2A 5HGBB 1T83A 1LEKB 2D0HA 2ZUWA 4TTGA 1BD2A 3S97C 2AXHA 1PQZB 3LKQA 5CJBA 3KPOA 3BZEA 1R3JA 1BMGA 1WIOA 2NYYC 4QRTB 5C09E 5CBEB 1YEKH 4PBXA 2BXYA 5FM8A 5HGHB 1BIIB 1HHKB 1YEGL 1BZQK 2HYMA 4RGNE 1WQVT 3RBSA 5FECA 4MJIA 2Q86B 3D9AH 3HS0A 2F9BT 2NY6B 3IFOA 4NRZB 3T04D 1K8IA 5ISZB 3SGDI 2L7UA 2P5WD 3M45A 4QCIB 4ZUWA 1U8LA 3B9DA 4MJ5A 1AKJB 2DI8A 4LLUA 2GTZB 4PFEA 5ITFB 1YZZA 4PJDA 1BWWA 2BVQA 4JFQA 3K4AA 4WHDA 5FYKD 1RZIB 4UB0L 3DYOA 3QFJA 1OP3K 5EZIL 5C6TL 2QQLL 2OP4L 3RL1B 5IBTL 5BXFA 1T5XB 1KPUB 2ZSWB 3MRIB 3MACH 1R24B 1INDL 1FIGH 2AABH 3MRDA 4C56B 4LSVH 3V5KA 3BPCA 1CIDA 3IU3A 4GW1B 5I1CL 4G5ZL 2PCPA 1HZHL 4JDTH 5GIRB 4RBPH 2IQAA 1T80A 3CLEL 3IETA 3RKDD 1N8ZA 4EUPA 2R9HD 3NIFF 5F6HJ 4EN3B 4JO2H 2EO1A 1K6QL 3M17A 2Y7QA 3HC3H 4O2CB 5F9WB 5KANI 1VFBA 3PWPA 1JF6A 4LNRB 2FSEA 2EDKA 3LKNB 1QLRB 2ZJSL 4XP5H 5ALCH 5EU7C 3W39B 2GEEA 3ARUA 5DO2C 1OM3L 5ESQB 3MFFA 1JGUH 1R5VB 2CSPA 2EE9A 4GAJH 4C4KO 4FN0A 4NKMB 4IHOA 4OD1H 4PJIA 1FZKB 5HI4C 3FZUD 2ZCHL 2PTUA 2X5PA 3QIUB 5EU6B 4MNQD 1QRNE 3W11C 4WFFE 5L9DH 1T4KA 3AY4A 4MX7B 2X70A 3VFGL 5FYKU 2VNCA 3MRNB 4GBXD 1UKQA 4OGYL 1X5XA 1WK0A 5ICYA 3F12A 1JGDB 3N1FC 4R4FL 4DFIA 3DVNB 4KRPB 4PRBB 1OVZA 4I3GA 1FO0B 4NJAL 3U30C 5D70H 1JYWA 2BSTA 3LEYL 4F9LA 2R0WH 4HXAL 4P2YA 2QR0A 4PD4J 4XNMB 4EUPH 3WD5H 3B6SA 3D6GA 3T8XB 3QHZL 4CVWA 5E7FA 3F7VB 3JXAA 3K2UH 3T0ED 1HE7A 1HKLH 1RVFH 4CRPA 3UTQB 1SJXA 2PR4H 2H26B 4Z7VA 1DBKL 5DD5H 3PWLA 1G7LB 2XTJC 4LLWA 4WGWB 4LLQB 5KS9B 1NGXA 4L3EA 3DYPA 1MFNA 4FFVD 4XC3H 35C8H 3TYGL 5ITBL 1E4XL 4OI7A 1WGOA 1GGBH 4RRPA 1HXYA 3MRRA 4NM4H 3RWJA 2AJ3A 3QDGD 1FDLH 3EOBB 4QRSA 4ZMAT 1A3RL 3OB0H 1FNHA 3P4MB 5GRUH 2R1XB 2V7NA 2YC1A 4WHYG 1OSZA 3LD8C 4Y1AB 5TDNA 2AJZB 5FYJH 4KI5F 4PJGF 5IJKA 3U82B 3SDXB 4FQXC 2HJKA 1AH1A 5BO1H 4YHIA 5J6HB 4Z7OE 3STLB 3T3PF 4E5XB 1JWMA 4ZAKC 4OFIA 3K74B 1MI5A 3O9WD 1XF3A 1I7TB 5CINL 4PGCB 1IM9D 3MJ8B 4J3XA 1A6UL 4QOKE 5DJAB 3OHXB 2W9DH 2NY1B 4M4PA 1KFAL 4AM0A 4OGAC 1JPFA 1MHPL 3ZSTA 5TDOA 3ARSA 3T3ME 1OCWH 1RK0B 4F7PA 5M7QA 3GSXB 2VLRB 1INEL 4L8SA 4FQJH 3RWHA 1F11A 4B53A 3DETD 5HYSA 4M1CC 3SPVA 2D9QB 5AYUH 1NAKH 4ZFFA 4PP2A 4LEXL 1CR9L 3V5DB 5EN2B 1D5BA 5E8DL 4R7DB 3QNXA 3GGWA 2PTVA 4HWEL 1RJLA 4PYGA 5HDQH 2DKSA 4Z7UA 4R26L 1KIUA 2VC2L 1FFRA 2J8UA 5CWSB 4ZDHB 4XMPL 5MHSE 3HZMB 5H8DA 4RDQG 1BVZA 4F57H 4NSKA 4DVBA 3SGEI 1PAMA 2QKIA 5F70A 2WAHA 3BZ4A 2RCSL 3UMTA 2EDXA 4N0CC 4PG2C 4Q97A 1KXVC 4JFHD 4A2MA 3QIBA 5JQ6H 4DUWA 4ONOA 4OZFG 2ICWA 4HPOH 1U3HB 4GFTB 4KDTC 3U48A 4EDWL 1B0WA 5D1XB 2CLVB 5DYOA 2R29H 5E99H 5FKPB 3QSKB 5E00A 1OGTA 4G6FD 3MLTB 5E2WL 3V8OA 4YPGB 4U0RC 1PY9A 1MWAA 1FH5H 4G8GA 1H15A 3MCLH 3QQ9C 3B9KB 1JNJA 1F6LL 2RR3A 5C07D 5L2KD 1MY7A 2HH0H 2GJ6A 3QIWD 1FG2A 2PNDA 3EYFA 5A16B 4KK8C 43CAB 1CU4H 4H20H 1OGAD 3ZYIA 2VDQL 4OIIL 3RVUD 1LQSR 5F3HA 3QO1A 4X7DC 2R2CA 3RDTD 4IRJC 5D6DC 3STBA 4N8PA 4MJ6B 1JRHL 5HHOE 4BQBA 3FT2A 4FFZL 4PRHE 1PSKL 3GM0A 15C8L 2OZ4L 4ELMA 1T83C 3VXNB 3HUJA 2DL9A 4IMLA 4YGVA 3H0TA 1T66C 2ED8A 5E6IB 3TA3A 4CU8A 2QTEA 3BKCH 5HYJB 1EEZA 4KKBD 5DJ0A 2JK5B 2VXUH 4JFFD 2VLJD 3QUXA 4WU7A 5C0BB 1K4CA 2GK0A 3FT3B 3JWOL 3QQ3B 4WW2B 3DGGB 1JF5A 1F3JA 2AKRA 3JVGC 3VXQA 3AC0A 4YX2H 3V0AC 5A43C 1LP9A 1HH6B 2XWJA 2V2WB 2D31A 2P5WA 3IDXH 5EOCJ 5C0AB 2CLZB 4IOIA 4L8BA 2E9JA 1A5FL 1OW0C 3OJDA 3PUCA 3Q1SL 1MAKA 5IFAL 3C09C 4MQTB 4NKOA 3TESA 3EO9L 2FH8A 3WIHA 1H3GA 4HS6B 1XF2B 3BDXA 3L3JB 2NY4B 1T1WA 3J8F7 1A7PL 4X4XA 3V7MA 3CLFH 4PYHA 3KYKL 3G08B 1U3JA 4PRPA 1KT2A 1AGBA 1T7XA 4E41D 3NPSB 4F33B 4ODUB 3UTSB 4CUCA 3MO1B 4F7EA 1ZLUK 3IS0X 2DQIH 3GKWH 4LLMB 1UH4A 4X6CB 5C08B 2GFBA 4JPIB 3SDXF 4NQSB 1ZE3C 2EZ0D 3KPRD 4GKZB 3VWKD 1IAKA 1I8KA 1MAML 2YD8A 2YR3A 3C8KB 4JRYE 3OR7B 3U1SL 1Z5LA 4KGJA 3C6LA 1VCAA 1DBMH 4L29A 3C6SA 2UVEA 3HPJA 1AY1H 3DX6B 1V7NL 4W4NA 3IRPX 4DN3L 3QWRA 5J3HD 3Q6FB 2W0PA 5EUOA 2YMXL 3SE9L 2BNUA 4WNQB 4P5MA 1QD0A 4ONHB 5CMAB 1JJUA 2XTLA 2DB8A 1S78D 4XHJC 2PKDA 3DROA 3PHQB 5A1AA 5I66B 3EOYG 4N5EC 4RQQB 3L5IA 1FC2D 5TE7L 3E2HC 2I07B 3GHEL 2R1YB 4FZ8H 4HIIA 4JM2B 4MNQA 4ZXBD 3WIHH 4UOJA 3CFBA 2J1KA 2MQCA 4LGSB 5F9JB 4YH6A 4KZDL 3AY4C 4QHLA 4ERSH 5IW6A 4GRWE 4GBXA 1ITBB 2OQJB 3PP3K 4X7TB 6FABH 2YD6A 3QUYB 3JWDL 2KH2B 5DJDB 2PXYA 2FLRT 4KH2A 1ORSA 1UXWA 2JJSA 4BZ1H 4F9LC 3ARDD 3VXOA 3WO4B 1H8SA 3ULUD 1A47A 5BVPL 1DCLA 4K3DL 4HH8A 3X14A 2YK1H 3GJFK 3QDJE 4TULL 1QSEE 1QA9A 3GSNA 4OF3A 3OAYK 3T0EA 2J88H 1YNTB 3PABB 1BZ7A 1JGLL 3BE1H 2GTWA 3LEVH 2LQRA 4LEOB 4OZ4B 5GGTA 2DLEA 5D7IE 5SWZA 3TC9A 5KJRH 1CTOA 1TZHB 3WN5B 1FYTD 4HXBL 5DRZB 2WWMC 4LSTL 3VXTB 1WAAF 2EC9T 4HFWB 2DLGA 5D9SA 3WHE0 2WBWB 3IS1X 3QDGA 5J9PA 5ADPL 1VFOA 4PY8J 4HUKB 1MJ7H 3HCVA 1RFDH 4JQVA 1N0XL 3VFMA 1AGCB 3D3VB 2JELH 1MCFA 3EOAB 3MLRH 2VOTA 2FATH 4LNVA 5DC4B 2ORBL 3ZYZA 4GRLD 4JO4L 4KKAD 1MF2L 3RWGA 1BJ1H 1AI1H 1UCBH 3ETBF 4QO1A 3DIFB 3OPZH 4FZEH 4KTEH 2RAMA 5DS8A 1A3QA 1A14L 1YDPA 2Y4SA 1N3NB 1I85A 2ZKHH 4IJ3B 1MPAH 3ZYJA 3O45A 1VGEH 3EYVA 3MSPA 3OAUH 4PJBA 4IRSD 5DK0A 5GSVB 4ZFZB 2EECA 1IM9A 5FB8B 3GSWB 3ZKND 3L5WB 5D2LB 4CAGA 5AWNL 1ZA3A 3GK8H 4YK4B 4WW2F 5DF0A 3VGFA 3QXAA 3GSNH 3RPIA 4XNXH 4QGTA 4Y4KB 4PJ7B 3FO9B 5L7XL 4X8JB 3DTXB 1Z3GL 3BH8A 2I60H 5GGTH 3P0VH 4L8SC 3RVWC 5T33L 1JHLL 1NC4D 3HLAA 2XQBL 4QYOA 1FGNL 5D7LB 2HG5B 4NCDA 1K5NA 3F58H 4M5ZH 1DVFD 2ENYA 1QTYT 3EYUL 1XZ0A 5CGYD 5IW1B 2RHEA 3OKOA 4JRXB 2HLFC 4J23A 2DQTL 3EOTL 4Q58C 5F6IC 4RX4D 1B90A 1EFQA 5JNYA 3QXUA 4PJ5E 2DQJH 5DMKA 3LVEA 2EH8H 3MOAH 1RZ8B 4I0PD 1T0NA 4PJXA 5BRZD 3JV6B 4X80H 4E42A 3WUWG 3FN0H 4FOMA 3SKOA 4OM1L 5I2IB 4DEPC 1EERB 5MEOB 5EORH 1OAUH 1YNLL 4JE4B 1MFCH 3LQZB 2DQCL 1RIUH 2FB4L 4WEBH 4OLXH 3I6LE 1MNUL 2WUBL 3HE7A 3HC4H 1CGVA 1FGVL 5CJOH 5CJ8A 3QEGH 3DPBA 3TM6A 3WEXB 2J6EA 3QCTL 4MS8C 2FIKB 4CMMB 5ICZA 1XGQB 2FWOA 4OJFH 3NGBC 1MUJB 4LHUD 4JFYA 4HIJA 5C07A 2XKNA 3QIWA 4RWYH 3K3QA 5HBBA 3QPXL 1OGAA 1QFWH 1FNSH 4PGBA 3N1PC 1KTLB 2APVA 2XZCL 3H3PH 1RHHA 3VDBA 4QRUA 5I8EB 4ALAH 1JNNL 1U8JB 1KJ3H 4B0MM 2DD8L 2F74A 4C55A 2AVGA 1X6LA 4XNQA 2H45A 3VFNB 1XF5A 3ARED 2BVOB 1EPFA 2HT2D 4TPRL 5I1GL 3ZDXF 2KBGA 3QP3A 3BXNB 1Q0YH 4JZNB 4APQA 5D6CB 2SEBA 4BYHA 4HUWA 2DM2A 3F7YA 3K80A 4JFED 2VAAA 4LQFH 5T3ZL 4ZNEE 4HJ0D 4IIQA 4BFIA 4PJFE 3U7WH 3B2UD 5DJZA 1G9NL 3GSVB 1UM5H 1VKXA 4ODVL 4OZHA 1OAQH 1AD9A 4NN6C 4JFDB 5CP3A 5I8CA 4F58H 3CVHL 1FVDA 3AS1A 1OP9A 2OTUB 3OR6A 4R9HA 2C4FU 2J6EH 3IAQA 4X9IA 2VR4A 4Z8FL 2H32A 4XP6H 4RISH 4GRWF 3LIZH 2J4WH 4G42B 3LEXA 5LBSL 4X98A 2DOCA 5HTSA 2BCKA 4TVPD 1EO5A 4V1DD 4BJLA 2AV7B 3DX7B 3QCUL 1CLZH 1MRCL 2W60A 3IU4L 4IS6A 4QRRE 2QSTA 4FQCH 4WTXA 5IEHB 3H3BC 1DQJB 4XPHH 1H8OA 1XIWB 1RUAL 1CDUA 5GRZA 1YQVH 3VWKA 5H2BB 5C0EB 4GW4A 5JLZB 2R4RL 3NFNA 2AV1B 5I16B 1TFHA 4ZPVB 3V7AE 4RFOH 4QTHA 3RKDC 5T3ZE 1KN4H 2R9HC 3TV3L 1AD0A 3MREB 1FZMB 5E5RB 3G5XA 5E8NA 5IESH 2VUYA 3U6RB 3OWEA 3D39E 3C6LC 5D7IF 4AG4L 3GJEB 4WHTA 3TBTA 5D2LF 1ADQL 2DLTA 4HMDA 4U4BA 4P57A 1A64A 3L9RA 4F7TA 2BJMH 2ARWA 3SQOH 4X5XA 4XPTH 3QUMB 1SJEB 4PJ7F 1BOGA 3PWUA 1ZGLP 4D0DA 2ZNXA 5CP3H 3EDFA 4ZSOE 2WIIA 4YZFF 2LAAA 2AK4B 5BOPA 1KACB 4HG4K 4M43H 5I15H 2OYPA 3E3QE 1MEXL 2H32H 3U7YH 3FZUC 3T2NH 4M7KL 3V6BR 3MV9D 1A1OA 2HFEB 3KPSD 3QJHB 5IROC 2CIIA 1DBJH 4ZTOH 4QRQA 1UB6B 2P5ED 5F1IB 4GBXC 4TQEL 3WFCH 1N64H 1W8NA 2NZIA 4O2FB 4UTBH 2PYED 3ZKXC 2WP3O 1IC4H 4HV8B 5EU3B 1MRFH 2MJWA 2JJSC 5KSBE 1QR1B 1FCCA 3ARDA 3C5SA 3U4EB 3SDDB 3HNTL 2NNAA 3VW3L 1Y18B 4LLDA 4YQXH 1XCTA 5DK2A 5E4IA 1F4HA 2KKQA 1IGIH 4UIKL 4XCNA 2AGJH 1A7NH 1S7XA 2HJLA 3HAEB 2Y25A 3SY0B 3I6GB 3O4LE 3T0EC 4YHOL 4HWUA 3RA7L 3O2DH 4U6VH 1ND0B 3T4AB 3JTSB 1WZ1H 2V2TA 1SBSL 4G9FA 4DAGL 3FB6B 1RJCA 2F54B 4F7MA 3MGOB 1FYTA 4KK6D 4OLUL 1S9XB 4FFVC 3VD4A 1ZTXH 1A7RH 2Z91A 4HIEA 5D93B 4YXLH 5FDWA 2FX9H 4JZJA 3UJIL 1AE6L 1HKFA 2PF6A 5GGVY 2MCPL 32C2B 3L3IB 5CD3A 1I9EA 2WWKT 5I8KH 1J8HE 3QNYB 1IBGL 5EU5B 4S1SL 4JQVC 1W72B 4YHYC 5CHNB 4GRLA 2CMRL 1U8MA 1X5GA 1DBBL 4Y19B 1I3RA 1XGYH 5IB4A 1T6VN 4I3RL 1R3LA 5LAXA 1Z9OA 1VEOA 4P2QA 1OY3B 1U58A 3L3DA 2HN7A 1E27B 3DUUB 3WL9A 2LVCA 4RMWA 3MCKA 3CK0L 4FQ2H 2EEDA 1I85C 4HJGB 3DHMA 4IRSA 4AJ0A 3MLVH 5EFIB 5IWLA 3KXFB 1U95A 3RUGB 2B1HL 2VABA 3O6LL 4DUXA 3UYRH 1AFVL 4QF1B 5EOTA 3VFRB 5TPWL 4HK3J 1HK6A 1P4BL 1A4KA 2CDFB 3KAAA 5FM5O 1EJOH 5F1OB 3ZTNL 1NC4A 3VRLE 2ICES 3QHFH 4HK0A 3DETC 3BIBX 3O11B 1IGFL 1D7FA 4O51A 5CGTA 3V4PL 3UDWA 3LH2L 4LGPB 1P9MA 3VD3A 3JTTA 3RX8A 5DFVD 5HJ3B 1NAML 4LKXB 1FL3B 1U8KA 4DKEL 2BNRB 4JR9H 1WIPA 1CDJA 5D7JD 4LSRH 5EBGA 3DX9A 3BPNC 3UO1H 2IGFL 4JM4L 5BRZA 1MY5A 4CVXA 2BNQE 2YPLB 5FDYA 1C08B 2VZVA 1I1FA 5DJCA 4MD0B 4KK9D 2FJGA 3MLYH 1EX0A 3ROOB 5E2VH 1I8IA 3TBVB 3KS0J 4AEEA 3GMOA 1TITA 1RZJL 3R1GH 2ESVB 4GS7C 1YMMA 4PJHE 3SO3B 3V4VL 1OT1A 4ZFOB 3RGVD 2OLDA 2AEQL 3DRTB 2HT4D 3ROLB 4LPYA 3U4BH 2UUDK 2AP2A 2UYLB 3QXDB 4U3XA 1F97A 4RDQF 1LD9A 3TN0D 4FTVE 2YD7A 2FO4B 4E0RA 1I9RH 2VIRB 2EDDA 1U8NB 3MRCB 4HUMB 1HSBA 4PIRF 3IKCB 5SX4H 1E6JH 4Y4HB 1BGXH 5D7SL 1HXMA 1UVQA 2X7LA 5DT1H 1RV6X 3GBML 3OG6B 5JIIA 4PJ8A 4PREB 1QUNA 4KUCD 1NEZA 1ZT7A 1CGUA 5EO1B 3EFFB 4X6DE 3QIWC 1C12A 2W9LA 3DHJA 1T6WA 2R56L 3VFPA 3IT8D 4XCYB 3BKMH 5KVGH 4OUUB 3TYFB 3UZEA 3P0YL 1JV5A 4G9DA 2FCBA 3MNWB 4UUJB 3RDTC 1YPZA 5DZNA 1FN4B 3CXDH 5I1KL 4CL7A 3AREA 3L6FA 2F53B 2IADA 2NXZD 4QWWC 1BBDL 4FQLL 3BWAA 1CBVL 2CUMA 4EUPG 1JPGA 3O8XD 3H3KA 1JUFA 1Z9SA 3W0WB 4HKZB 1GH7A 2F5BL 5JPMB 1QSZA 4NBZB 4XWGH 3F7QA 4KKBC 5CFHA 3MJ7B 4Y88A 3RU8H 4JO1H 4IIQC 4JHZA 1VPOL 3MCG1 1LK3H 4GG6B 5E8OB 4YHNB 4BK4A 4ODBD 1ZWIA 4KV5E 1MIEL 5KSAA 3SDYH 1HHHA 3GI8L 1KPRA 5A2FA 2DQHL 1G7QA 4KHXH 1YEDB 4I48B 3BPOC 1I1RA 3C08L 1M05B 4HKXB 4V1DA 1S3KL 4HBCH 4YWGH 1DFBH 4O02H 5EC1A 1C16B 4P2OB 1U3YA 1FAKT 3PJSB 4U1NB 4AENB 1K9TA 3CFDA 4X6BA 1OF2A 3KPNA 4X6EA 1HEZA 3HHRB 4W70A 4WVRA 2D03L 1UQSB 4OZIA 5DZOA 4Q74A 4DGVH 3OXSA 5B8CB 1D9KA 1KTDB 1D5XB 4OFDA 3RL2A 5H35A 3LMJL 1UXSA 4X9BA 3VWKC 3P11L 4HGWB 4MZ2A 4YUEH 1G7HA 3GM8A 4ZS7H 4R2GB 2B0SL 5EG6C 2B2XL 3VXUA 5DD6B 2VXQH 1KELL 5EIIA 3D2UA 3RUGF 2WQRA 2PYFA 1NCUA 2HTKC 3HNVH 4H26B 1CXIA 5F97E 3LDBB 1PG7X 1LO5B 2FJHB 4NQDB 4BFGA 2WUCH 2JCCB 1D5IL 5F7YC 3HR5B 5J3HC 4M7JL 1RJZB 2GQHA 1S9VA 1AGEB 4U1KB 4X4ME 3FOMB 5DUML 4DOHE 1I1AD 1CDBA 4HS8H 1J1XL 5I1EH 3DV4A 3LQAL 4RRPG 3ZE1E 4NJ9H 4K9EH 3NABH 2D0GA 3O3DA 1UZ8A 2E27L 1EHXA 4NZTH 3LRSA 1NGQL 2A6IB 3DVFA 2HP4A 4ZXBC 3MV9A 4C54A 4JPKL 4WU5A 1T04A 4UINL 2A9ML 1QLEH 4EOWH 1NBZB 5EC2A 3TFKD 3GMNA 1CICD 3DBXA 3TBYB 2V7HA 3GMQB 2D4FA 3EFDH 5B3NA 3W9DA 3MRLB 4QXTB 2PYEA 1LO3L 5JW4N 2EKSB 4Z9KB 3UJJL 4OZGA 3ZDYF 2R8SL 2DQGL 5EU7E 3BP5B 1CXFA 3HB3D 1QACA 4NT6B 5JPNB 3S36X 1F6FB 3BQUB 2R69L 3ARDC 4YO0A 5HY9B 3S4SG 3GSQB 3V0WL 5TH2B 5LQBL 5GGSB 3PV6A 1NGYB 4YHPB 3RX7A 3H8NA 4RGMC 3WLBB 4Z5RA 1CLOL 2E5EA 4JFZH 3RWCB 5HHPB 3WIIH 4HLZH 2XNAB 3OXRA 5GJSH 2WIMA 5D8JL 1DE4A 5JW3L 3FCTB 4CBPA 4RCAA 2HT3D 1D5MB 2UWEB 5HXMA 3AGVA 4MCYA 4NUGL 3BHBA 3O2WL 1JHTB 5HYSG 2OTWA 1B4JH 3WKNA 5JW4M 5FOJA 2ZG2A 3MGTA 2G2RB 4JO3H 4UDTA 1S5IL 1TCRA 1A2YB 1ZAGA 3D69B 1XAUA 4JZJC 4N0FA 3MV8A 1P53A 3AAZA 4I3SL 1JI1A 1RURL 3BVNA 3SN6N 2D7TH 2Z8VC 4G80A 4YHZH 3IYLW 2Y5TA 3VXRD 2XN9B 1EGJL 3ULVD 5JORB 2E9WA 2H8PA 5IOPB 2BSSA 2VLLB 5FKAA 4KAQL 1QRND 4GRLC 4KKAC 4N8CL 2VXVL 3CDGB 3WBDA 5HVGB 4H25B 4TSCL 4AIXA 1VSCA 2IAMA 3B2VH 2B4CL 2XTJE 4OAWA 3S35L 4OCWL 1UM4H 3RY4A 2EEAA 3BGFB 4GKNA 3EJZD 4IRSC 3R8BB 3CZJA 5IWLC 2DYPA 4N1EA 5EBWA 3S3JA 4UQ2B 5F88B 2YD3A 2VLKE 1LNUA 3ZKNC 4JPVH 3KDMB 4UIMA 2JB5H 2ZUQC 3VGHA 5JDSA 4X9HA 1KCSH 1P7QA 4GG6F 3C87A 5IVXB 2H3NB 3MYZA 1IEBA 5DDHB 3MA7A 3D85B 3ARFB 5IB5A 5JMRA 3ALWA 4OB5H 4URTB 1SYSB 1T21A 4Z7WA 3TPKA 2JKXA 1EEYB 4AQ1B 1GZPB 2Q7YA 2UY7A 1YEFL 3U36A 3H2WA 5ERWA 5CGYC 4MA7H 2YOCA 1IM3A 3RWDB 3OL2A 1P9MC 2Y1VA 5ETUB 3N1GC 2BSRB 3UBXG 1G7JB 3PG2A 4A6YL 1IC5H 4M6AA 2AEPH 1C1EL 5CILH 3FQUB 1XFPA 1KB5A 3PWJB 5M94B 1B0RB 1LO2H 3BWUC 2MCG1 1UWEH 4Z77B 4PLOB 4KVNH 4ODTL 5JZ7D 4YAQB 1DN0A 4NO3A 2MWCA 4OGXL 3KPQB 1WBXA 2R4SL 4BSJA 5TE4L 3VFOA 1F90L 3GSOA 2ZCLL 1NUFA 4E9LA 3RGVA 4UNVA 2CKBB 2HVJB 3FQXA 2FZ3A 4KV5F 3K1KC 2MHAA 5FF6B 3OMZA 4U3HA 5IIEB 2A73B 3TNNA 3TN0A 1FLRH 4P49A