1Q72H

Anti-cocaine antibody m82g2 complexed with cocaine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
223
structure length
220
Chain Sequence
EVTLQESGGGLVQPGGSMKLSCAASGFTFSDAWVDWVRQSPGKGLEWVAEIRNKANNHATKYTESVKGRFTISRDDSKSSVYLQMNSLRAEDTGIYYCTSVPQLGRGFAYWGQGTLVTVSAASTTPPSVYPLAPGSGGAGSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLNGDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTQVDKKIVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab M82G2, Light chain
publication title Diversity in hapten recognition: structural study of an anti-cocaine antibody M82G2.
pubmed doi rcsb
molecule tags Immune system
total genus 41
structure length 220
sequence length 223
ec nomenclature
pdb deposition date 2003-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q72H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q72H02
3QA3A 2YPLE 5DDHB 5TF0A 2XKSA 2BNRE 2XWJB 1AKJD 4NKIL 2ZCLH 3CCHA 3M17B 4Y2OA 4GRWH 2ZJSL 4O58L 3PWVB 3RVTD 3DSFL 4YK4C 4R8WL 2AEIT 4JGJA 4KDWA 3QIWB 5TDPA 1OAKL 4QRUB 2NTFB 1QA9B 2GJ6E 5DYOA 4I8DA 3WFBL 2E8ZA 4TNWK 1K3ZA 1HSBB 3RIFK 5D1ZD 1V7ML 4H1LA 4MYWB 3B5TA 43CAB 5BMFH 4F9LC 1HXMB 2NY1C 2O61B 4YK4B 4ODWB 3D2UA 4ZOEA 3FQTA 2CUIA 2X1PA 2J6EH 4KTDH 4NO5A 3U0TA 4EUPG 2NLJA 5EOQH 2X7LB 4EXPX 3UTOA 1INEH 2VLJB 4LU5H 1B88A 4BFGA 2Q20A 5FDWB 2XA8H 1E0OB 2B2XL 4IOIA 1UWEH 4CVXA 1TJIH 4R4ND 3VD9A 5I8EA 2NZ9C 1U8PB 1MH5B 2X4OA 4MQXC 4XHJC 4M6NH 2I07A 1I7RB 3DI2B 1FVDB 4EQ3A 3MBXH 1JGEB 4B7LA 3O6MH 5I1IH 1A6TA 4L29B 2FIKA 5F7EL 3T65B 4UT9H 1QFOA 3MLYL 1N59B 2G75A 2FJGB 3GHEL 5I1HL 5ALCL 1FV1B 3C8KA 4N68A 5HHMB 4ELME 1DDHA 3QUMA 5TH2A 4PY8I 1QBML 1CF8H 1U93B 1BEYH 5I1GH 3HNVL 3IDXL 4N0YL 5E1AA 1PEZA 3PWJB 1RUKL 3BZ4A 4KMTL 1A7NH 4NFDA 3EBAA 3K80A 2CKBA 3DVGB 4Y4FA 1RZJC 3SKNB 4DVRL 3KYKH 5C08A 3QFJA 2YKLL 5DEFA 3OL2A 3MV8A 2BSSB 5IQ7L 1MJUH 4XNQB 1G7LA 1HKLH 3HG1B 3C5JA 2ERJC 4MHHI 4PP2B 3RUGE 1JHTB 3RIAF 5KS9B 1MSPA 3B9KC 4ERSH 2UZXB 5D1QA 2O5XH 2Q8BH 3MACH 2HRLA 4Q6IC 1J9CT 3H9HB 3L7FB 1IC5H 1TXKA 2YS4A 1OGAD 1IGYA 2BVYA 1UM6H 4OT1L 4OBRA 3LKQB 4S1SH 1YMME 1ZA3B 1X5IA 5E1HB 5HI3D 4FA8A 3B9KB 1MY7A 4PJ5B 2C1PB 2BRQA 4LEXH 4LQFH 5C0DA 3W9DB 5DHXB 4Q6IB 1HH6A 4J8RA 3F6IA 2W60A 5HDOA 3CLFL 1MPAH 4LLYB 4M1GH 4Y19A 5D1XA 1EGJL 1I9EA 4OIBA 3BWUC 5T1MA 1E27A 3KPMA 4I2XE 3TFKD 4HD9A 2Y7QB 4P59L 4OF0A 5I1LB 1J1OL 2ZKHH 3PABB 4X5WA 5HVHB 3RWFA 4D9RD 1ORSB 1D9KA 2WWKT 3L3JA 3ZE0F 3UBXI 4YDJB 1SBBA 5C0BB 4MVBC 3NCBB 2R2CA 4JKMA 4LASL 2N4IA 5GGRB 5KVFH 3CFDA 4WVRA 1T3FA 3SGJC 3SKMA 5E4EC 1K8IA 3BE1H 3QFDB 3BKMH 1HE7A 4WFED 3C60D 4YDVA 1T2QL 3GHBL 1IC4H 5ID0A 32C2A 2VISB 4XCFL 3X17A 2YWZA 1AP2B 2ADIA 2XRAH 1UJ3A 1CR9H 3Q3GA 5C0GB 3TT1H 3PWPA 3SGEH 5D1ZC 4G43A 1CD0A 1CK0H 3T2NL 4KROD 5MEOA 1CCZA 1LK2A 5FV1L 2ICCA 1A47A 3QEQA 4LGPB 4HFWA 3KLAA 5J6HB 4GMSH 1SYVA 4TTDD 3O3EA 2BY0A 1MHEA 1IGCL 3HNSH 1N8ZB 3MCLL 4HXAL 4XP1L 5DLML 4R4NC 3KNBB 4WUKL 1F42A 1M7IA 2HTKC 3IKCA 3K7UA 3LSOA 4KI5F 2OLDA 2BNQB 5B8CC 1U3HA 4RWHA 4K9EH 2BX5A 2CGRL 3D0VA 4TSBH 1U42A 1YEJL 1CL7L 2XV6B 1R5VB 4QHKI 1QD0A 3IRPX 1FORH 3L3OB 3TJHD 3WS3B 3U4EB 1P7HL 4E5XB 4JFEE 5F9AC 3VCLB 1S7SA 2ARJA 5F6HJ 4MQSB 4EVNB 1ITCA 5BOZG 2QKIB 2NY4D 4G7YL 4X6EA 1U92B 2YUXA 3WXWH 4KAQH 1CT8B 3ZKQD 5TQ0L 1MRFH 2Z9TA 1MIEL 3O6FC 3SQBA 5EU6E 1FGNL 2F58H 4QHMA 1U8HA 2AEPL 1CXEA 3C9NA 5C0AA 4S1QH 5CEZH 3AUVA 1VADB 3H7BB 5D2LA 1LE5A 3KXFD 3AGVA 3O4LE 3QO1B 1S7WB 1BIHA 5EOCH 5J9PA 3P40A 1BQLL 4NO0A 3N1QC 1T5XB 3F12A 2P4AB 4NQDB 2GK0A 3OB0K 3TESA 5GRUL 4RIRA 4U1HA 1NDMA 3O6FB 7CGTA 3UC0H 3TPKA 4DFHA 3I02B 4PRBA 4BM7A 2VSDA 4ODVL 1G7QB 3CVHA 2HTLC 1MRCL 4LMQI 2J8OA 4PLNC 4FP8H 1GJIA 2NW2A 1CD1A 1JHKH 2YD3A 5HI3C 1A4KA 2CJUL 4OIAA 1I1AA 3KPOB 1BX2A 2MPAH 1TLKA 3A6CL 1NEZG 4FQHB 3VGEA 5DI8A 1I9IL 4OF6A 2RBLA 3FB5B 2WWKO 3G5YB 4LF3B 1G7IA 5KOVC 3RIAK 2ICWI 3SE9L 3RWHB 1QFHA 5IW3A 4HBCH 4TVPE 5D7JC 5GGRY 4ZQKA 3TFKC 4ODSH 3SQOL 1LE9A 4OD2A 1OD9A 1VEMA 1MUJA 3AAZB 3MSPA 5JO5A 3MLRL 1QRND 2XQBL 4U1NB 3EO1B 4I18A 2O5ZL 5F7UA 1NFKA 3DNKA 4AG4H 1UT9A 5ISZB 1T7ZA 1LO5A 1X6NA 4P2RA 5GXBB 3ARFC 2W65A 3P9WB 3NCEB 4XNXH 3AY4C 3DV4A 1T21A 1BD2B 5D7JB 1FC1A 2VR9A 2CK0L 2B1AH 2H8PB 3BP4A 3SDYL 3I75B 1AGDA 2MNUA 3T1FB 5IF0A 5E6YA 5DJDB 4ZNCD 5CHNA 3WCYA 1NC2D 3EO9H 1ES0A 3GK8L 4HJGB 5HI5D 3KPPA 1ADQL 1ZVYA 5I8CB 5CKAA 3L7EA 3ARFB 5DQJA 4LLVA 1S7RA 2C4XA 4Q0XH 4AIZB 1FE8L 5EZJB 2ID5A 3V7AE 3AU1A 4GLRH 1KPVB 3G5XB 4L9LC 3M1BB 3TYFB 5IJVA 3P9LB 4L8CB 5EUOF 2ADGB 3UYRL 4MD0A 1XGTA 1M1SA 4ODUB 1A6ZA 4HWBA 1TCRB 5FYKE 2H1PL 4F7PB 1B0GA 4XMPH 1F00I 4U1LB 3D18B 3RZWA 4WWKC 1RVFH 1MVUB 1DQTA 3SDXA 5LG1A 5C9JA 3IFOB 3BYTA 4L9LB 4R97B 3CUPB 4GQ9H 3N1MC 5KSBF 5D5MB 2DBLH 3VXPA 4LHUB 1LD9A 3I2CL 3DJ9A 1VFBA 4WWKB 2XZQH 3BZEB 1RUPH 4O2EB 2VNCA 4YEFA 1RULH 4YE4L 2F8VA 5KG9B 3QUMH 4LSSH 3THMH 4P3WA 4LGSB 4NGHL 2NY4C 5GRVL 3VXOB 3MA7B 3MPCA 5SWQA 2AKRB 4IM8A 3NIDE 3VXUB 1U8IA 2D7TH 2DQUL 2BOCB 1CU4L 4YDIH 1ODAA 3ARGC 1VFMA 2DI9A 5FUOL 1RHFA 1WIUA 3S6CA 1MI5D 1AHWA 5FHAL 1FVCB 3VGGA 4LHQB 5H94B 4JPWH 1JNLL 3LHPL 1DBMH 5F7WC 5ELIA 1DZBA 1QBLL 4OSUH 1BJ8A 4R4BB 3KR3L 3MV11 3T77A 3IVKB 3L5XH 5F21B 4P9ML 4XGZA 3ARGB 3C8DA 1N2RB 4TSCL 4ZOCA 4XWOD 3WLWD 3TWCL 5SWZA 1AGCB 2HP4A 4O9HH 4NKMA 4LVNC 3RWDB 3MRLB 1C5CL 1I7ZA 3QWRD 4JQVA 1WCBB 4G80A 3QIUC 5FCSH 3SKJL 1LO3L 2AXFB 2DWEA 1EFXD 4PLKD 3DVNA 1RIVH 4JJ5B 4CUCA 1BFSA 4E41D 3MREB 4IIQA 5F88A 5HDQL 5L0QB 3OF6D 1R5WA 5FA3B 1EO5A 3VXTB 1EO7A 3ECBA 4HH8A 3RGVA 1ZHLB 3F62A 3NZHL 5CSZA 2Y5EA 3ZL4H 2EH7L 5HHPA 5F72S 3SDDB 1K9TA 3QIUB 4D8PB 1NFDE 4HWNA 3ROLB 4JQIH 3K2UL 1MHCB 4FQ2L 2DDQH 1YZZA 3LPGA 3QO0A 1NCBL 4PRPB 4RX4D 5IHZA 4HGMA 5ITBL 3QZWB 1Q9WA 1RZFL 4ZUSB 1D7FA 1HIML 2OK0L 3D85A 2A6KA 5IVXA 4OIIH 1QHPA 1DP0A 2VLME 4V1DA 3EJJX 4CMMB 1DQLL 3ZTNL 3D25A 2C7UA 2YUVA 3CGTA 1DQML 1L9NA 5E2JA 4FXKA 3HMXA 4HS8L 2EIZA 1BFOB 5ICZB 5JR1L 4IRSD 3ULVF 5DRWA 4G9FE 3BAEL 1WC7B 2F53E 3IDMB 5MENE 1AGEB 3T3PE 3SDAB 2HJLA 5IMOB 2ZG1A 1J0HA 1JFQH 5HHQB 3TF7C 5DD3L 4HH9B 4JFDA 1X7QA 3A6BH 4C56E 1MY5A 1ZLUK 1DQJA 1NANI 4XZUA 5KVGL 3IJYB 4OAWA 2D7OA 2VQ1B 4U4BA 4JG0H 4NN7B 2FSEA 3VRLE 2EZ0C 4W6YB 4IOFD 3VGFA 3W9EA 2MQ0A 3WUWA 4LEOB 2MFNA 1OTUD 5DJ8B 4N90E 2EYTB 3QUYD 5KVDL 4MAYA 1ZLWK 2IALB 1IE5A 1ZANH 3SJVB 1UXSA 3S35L 1N4XL 1FNLA 1GPOH 4KDTA 2PYED 4QRSB 1IMHC 2B5IC 2YPLB 4M3JA 4HWEH 2A9NL 5H37G 1HI6A 2BNRB 2XOTA 4PRIE 1HN1A 1QEWA 3HPLA 1MLCB 4UNTA 4A2MA 5CLTA 4BQBA 5GGTL 4NP4H 1K4DA 1HOCA 1XIWA 5HYSA 1ZTXH 4E9LA 5ICXB 5GZOD 5CD3A 5FGBC 1NCUA 3VWJA 5CCKL 2GJ6B 3U1SH 2P8LB 3OAUL 3VJ6A 5E6IB 5SV4A 4OZFA 1FZJB 1Q9LB 2B5IB 3EDFA 3MV7A 2JELH 4HKXA 3EYOB 4HAFA 5C07D 1FL5A 1GH7A 3MNWA 3TN0A 2V2WA 3MJ9A 5E00A 5I2IA 5IK3B 4Z76B 4FQPA 1XZ0A 3DLQR 5IROA 1J1PH 1UM4H 4KZEH 4AEIH 5C2UB 3BXNA 4GBXD 3GRWL 5BZWA 5E99L 5F7HA 2QQLL 4HPYL 1EPFA 3WLWC 1AJ7H 5IMKA 5I1CL 3ROOA 5F93C 3TIEB 2CDFA 4NYLB 1YJDC 3TH3T 1EEZA 4I5BB 5TDOA 1XGYL 3STZA 3ZLQC 1VDGA 4YPJA 3DUUA 3WSQL 5B38A 1MREH 4PLKC 1EH9A 1DLHB 2YMXH 2Z8VC 2VLKD 2OL3B 2W07A 4FG6D 4OLWL 2W9EH 2X1QA 2X9WA 1UXWA 3JWOL 4ELMB 5IVZA 3O9WC 3NN8B 4HUXA 1S7UA 4K23H 3LN4A 1H15A 5HHOA 3U9UB 1SBSL 3QIBC 3MJGX 2ZNXA 1LEKA 2R0KH 3PGDA 4B53A 1C5BH 1EZVY 2CRIA 4QHLB 3MUGB 4M7LL 3DGGB 1CLOH 2DLGA 4PS4L 4YWGH 1YEKL 5DRXA 4W70A 3VFNA 5CJ8A 1EFQA 4PJGF 4WI5A 3F6LA 3O9WB 4KRPD 4HIJA 3HNTL 2AV1B 3PWLB 4PJFA 3QIBB 5FM5M 3RUGB 5GZND 3KVQA 5C0CD 5JLZA 3BDBA 3NFPA 5FO9A 1FG9C 1XGPB 3SDCB 1ZHKA 3PXJA 4IRSC 4U6HB 3UJIL 1ZV5A 1T5WA 4YGVA 3D39A 4LVOB 1FYTD 1WCQA 4DKDC 3GB7A 1E6OL 1T1ZB 5LCVH 5T5FH 1BVKA 2HFGL 1YMMB 1OY3B 5AYUH 1MCNA 2DM2A 1Q9KB 1YNKL 2BDNL 4LCCA 1PDKA 1L0XA 4I3RL 1IQDB 1AIFB 4PBVC 1ZHNA 3VD3A 1N7MH 1H3UA 3HS0A 4U1GB 3BPCB 4G8EA 4OZFG 4KXZI 5HGAB 2X10A 1IVLA 4I2XB 2NY2D 3TVMA 4NUGL 3LN9A 4OLUH 4NDMB 5I17B 3QUYC 4X80H 1UM5H 1YNLH 1INDH 4L5FL 3RL1A 5ID1A 3X11A 5JNYA 4PJ9B 5CMAA 3VFRB 4R26L 4BZ1H 1A5FL 3MFFB 2R29L 4WW2A 5K9OB 3CZJA 4X8JA 2HLFD 3SE4A 5CEXA 1AO7A 3Q6GL 4EN3A 4K7PH 4HG4J 3V52L 3M17A 4UINH 1RFDH 5EO9B 2VWEE 1PZ5B 3X3FH 2AAVA 3UYOD 4GH7B 5DJ2A 1I1RA 5FM8A 4X8XA 3QIWA 5E94B 4QRUA 5B38G 2NX5A 1ZS8B 1QA9A 4U1SB 1TZIB 1FNHA 4L3EB 2J8UE 4JHZA 4OGYH 1HSBA 2YN5A 1KCVH 4QOKA 3SKUD 1MCHA 3QSKB 43CAA 1HXMA 4G8FB 1A1NB 1DQDL 3NIGE 4M7KL 5CJ5A 1MCCA 4YHML 1EVTC 4RZCB 2DJSA 4F7EB 3I50L 4U2YA 1JZ6A 3PQYA 1UYWH 5H37H 1RJZA 1NCDL 2FATH 5FDWA 4GRLC 2E9BA 3H3BC 4OQTL 4C59B 2VZOA 3IDJA 4TPRL 5D9SA 5FAAA 2XQYK 5GISL 2VZSA 1UQSB 1T03L 4WFFD 1I7RA 4XP9H 1OP9A 5IBLD 4NCDA 4JZOA 1EHLL 4J1UB 4YHPA 1KTDA 3VFVA 4OCRL 4X4ZA 3DECA 4G5ZL 3T65A 1F3RB 1I8LA 1RZGB 1WBYA 2FJGA 1OW0C 2QSQA 3X13A 4GRLB 1KF9B 3UBXB 4JFEB 4U6YB 1CXKA 4WUUE 1ERNA 4R0LC 5J3HD 4BELD 4B5EA 1U93A 2NYYD 4PJXF 4D0CA 2HVKB 3HR6A 2R0LH 3WMSA 3PWJA 4KVCL 4XNMB 9CGTA 5D7IF 5EU6B 1V3KA 4RFNB 1KB5L 4N8CH 1V3JA 2BVUA 5D72L 1GZPB 3ILQC 2GSGB 4OFYD 4XNQA 4X9IA 4R0LB 4KRPC 3HG1A 2VDOH 3O4LB 3HAEG 5D4QA 1J0JA 3GEWB 1JHTA 1F02I 2DLFL 2D31A 4YH6A 3HMXH 1PD6A 2B1HL 5AZEH 5KVEH 1CFBA 1WAAE 3QNZA 1QLFB 1MF2L 3U0WH 3WJLA 3WEXA 3ZHDA 3MLZL 1CG9B 4JRXD 4K3DL 5FK9A 3MODL 4YAQA 1JGLH 1F58L 1A6UL 5LBSH 1ZA3A 2HT3C 3TNNB 4F2MB 2LVCA 3DUHA 2DOCA 2M1KA 3T2OA 3S88L 5ILTH 2AERT 1XGQB 4HMCA 3T0EE 3W9DA 1FNSL 2E3VA 2Q76A 3CVIH 1QSVA 2PN5A 1DN2A 5I0ZA 5HXMA 3EJYD 4KMLB 4QWWC 1ZSDB 2NY3C 5CAYB 1GC1H 2WIIA 4FQXC 2UWEF 2VKWA 4HPOL 1MHPH 5IV2B 2Y7QA 1TNNA 5I1LA 4NNXA 1WF5A 3G6JE 3DX7B 3PABA 2YEZB 5BW7A 2E7LC 3U2SB 4EIGB 1ORSA 3WXVL 2F5AH 2ATPB 3P4MB 3UPCA 2P5EE 6FABH 1QFWH 4YDJA 5BVJA 2DQDL 2NY3B 1U8KA 5K33A 4FQXB 4HKJA 5ENWB 1KPUA 1GGCL 3MFGB 2VERN 3QFDA 3E6FB 4JHAL 1FRGH 3E8UL 5BS0A 2ZCKL 1I4FB 1OAUH 2VISA 1MHHB 4FZEH 5D71H 3JWDC 4FQ1L 3GMPB 1W72L 4OZFH 4XPFH 2AK1L 2W0PA 5HYJE 4QHUA 2Q8AL 5HVWA 1KELL 4BUGA 1ACYL 4MQTB 4H0HB 5HVGB 3RPKA 4OLYH 1GGTA 1MFDL 3MJ9H 4LFHG 2DQEL 5F9OH 4H88H 1A6WL 5A1AA 1EAPB 5FEBA 4QRTA 1JTPA 5EWIL 1LEIA 2AJVH 3VGBA 3VFUA 2QHLA 4LPVA 1Q0YH 3BJLA 4Y16B 4X7SH 3VGAC 2X41A 1DBKL 1IGFL 1N8ZA 3U46A 4JHWH 5BVPL 2ICWB 2XKUA 1R3IL 4JB9L 5T5NG 4QRRA 5GRJL 1A9BA 2ITDA 4TYUA 1A4JA 4KKAC 3X12B 4M7LT 4ZFOL 5DRZA 5ANME 4KY1H 4PV9A 3WD5L 1G7MA 1RZKH 3D0LB 3U4EA 4RGOH 3SOBH 3VGAB 1TJHL 3LH2L 2VDKH 3GI8H 1ZKAA 4FQIH 3TPUB 4EVNA 3U79A 5JQ6H 2QKIA 3ARVA 1H3GA 2SEBB 3QDJB 3PGFL 3UJJL 5F8QC 4ZOBA 3QHFL 3CXDL 3QWQB 3P2TA 2WQRA 4I77H 1NPUA 3MLTB 3BGAA 3QHZH 3IFNL 4GKNA 1NAMB 2FO1A 5F6IB 2EDKA 1PBYA 1TMCB 1S7WA 5DMGD 1KXQE 4L1DA 4P23C 2P5WD 2R8SH 3O2VL 4NQDA 1YN7B 1JI2A 2H26B 3VMPA 3TZVC 1KXVC 3VWKA 1DVFB 1OL0A 2AGJL 1K8DB 1FGVH 3MBED 5LJYH 5D8JH 3MGTB 5FYLE 1GXEA 3OSKA 4QTHB 3JVGC 3I85A 3KHQA 3FT2A 4XWGH 4P23B 5DFTA 2BY2A 3DV6B 5F44A 1LGVA 3TZVB 2FEEI 3KPOA 4UOW1 2FNBA 1MIML 4X83A 1BJ1H 4E42B 4GMTL 1U8NA 4PV8B 2UV3A 2XZCL 4KHTH 3EJYC 4ODHL 1NFDB 3RWHA 4WI3A 4TULL 5TDNB 3LEYH 4DK3A 5KS9F 2R1YB 2J4WH 1BWMA 5DUPL 1IBGL 1BFVH 1OCWL 1UH4A 5T3ZE 3SE3C 2A9ML 3AAZA 3ZE1E 3RDTA 4XNZB 3TNMB 5DGRA 2JB5L 1UFUA 5CILL 5C6TH 4UTBL 2RIKA 3TO4D 5ISZA 2YSSB 3JTTB 4KMQA 2G5RA 4K07A 3SGEI 5LGJB 3L3GA 1Z0MA 1R0AH 4LNVA 4GKZB 5GPRA 1BD2A 5A3ID 5D96B 3MV9E 3B2VL 4OZIA 3O3DB 5CWSB 5L2KA 2HT4D 1NC4D 3TA3D 3PL6C 3ZT7A 3RZCD 4X6DA 4G9FB 2BVPB 2WMPA 2F53B 3RY6A 3MJ7B 5MENB 3C09B 4I13B 4P2OA 2EDDA 3EFDH 4ETQB 1KN4H 5KAQG 3X3GH 1I1FB 5I8CA 4LGRB 5EA0L 3RTQA 4DFIA 3KPRD 4L4TD 4JFQA 4AIZA 2DQCH 4C56B 3IYLW 3MCKA 3QPQD 4JFFD 4PJBE 4D0DA 2PXYB 5F7FA 3EAKA 3PL6B 1KV3A 4UBDD 3M1BA 4JDZA 3TYFA 3P9LA 2ADGA 1UJTA 3ZT6A 1SY6L 5GQBA 4F7PA 4I48A 1OTSD 1U41A 2IAMD 1S9KC 4U1LA 2A83A 4DN3L 2PO6D 3W0WE 1I7UB 2R69L 1J88A 1KC5H 2VDRL 2DKUA 3EJZD 5J57B 3IFOA 1T1WB 4MXQD 2B0SL 3LEVL 2MHAB 1NSNH 1KJ3L 2D03L 2WBJA 4M7JL 3F7YB 5EU4A 1WIPA 5CP7B 3FOMA 2XWBA 3K8KA 4LHUA 3MRDB 2QSVA 4XP5L 1EERB 2O5YH 2DL9A 4LLUB 1GOFA 4PRIB 3V6ZB 4UQ2B 1C1EH 5JXEA 1CBVL 2XZZA 3ULUE 2W9DL 5KG9A 3V0WL 5GS1A 4Q9RH 1IM9A 1F4XH 3T4YA 4CN6A 4MA7H 5C71A 1F90L 1KT2B 2XACC 4QNPF 2AKRA 3IT8D 5LGHL 3VXUA 4BSWA 3FB7A 2BOCA 3MJ6A 4Z77A 3CC5B 3EOAB 3QJHB 5HY9B 1T80A 3T0BA 3BKCH 3TH4T 5D7SH 3GO1L 2IMNA 2WANA 1UWXK 5H94A 1NCWH 2EH8H 1EDQA 4K8RD 2Y9RT 1NLBH 1NGQL 5DMGC 4KJWC 4OKVB 4BQCA 3BH9A 2BCKB 3IVKA 5IEKA 1QSFD 25C8H 1PKQE 4P5KA 2I9TA 3QUZD 4E0RB 4KV5F 2CK2A 2DQTL 5T1KD 5E24E 2JCCA 4M62H 4XAWH 4RBPH 3CH1B 1ZT1A 2AXFA 2VXVH 5J89A 3CH8A 1T0PB 1BP3B 4N0UE 1P4LA 2APBA 4DUVA 3NH7L 4JG1L 3VD7A 4OZHE 4MMZC 1QPXA 4MZ3A 5FA3A 1F3DJ 3VXSA 3VXTA 5JHDD 1F8TH 4XXCA 4MJIE 5D93C 1X44A 4NQXB 4EQ2A 3VXRE 2J3SA 5K59F 3PIQB 4X7TB 3SDDA 3VXQA 5J6GA 3JV6A 3OKOB 5C86A 1QSEE 2E8YA 1JYNA 3GSWA 4HUUA 4M6MH 1S9VB 5TE7H 1H8NA 1YEDA 1KNOB 4H5SB 1TZGL 3LMJL 3NIFF 4AQ1B 5D93B 1YDPB 1IGIH 3BW9B 5DS8B 1EO8H 3FB6A 4Y2DA 4YR6A 3O0RL 3WKML 4PRHA 1OB1B 4JFHE 4CMMA 3TO4C 3QJFB 3KDMB 4AK1A 1JZ8A 1HNFA 3QUXA 3N9GL 2YPKA 2AJZB 3MRPB 1I7TA 2EE6A 4GLRI 4M9OA 3FHAA 4LCYA 2BY3A 5ICZA 3SGKC 3B8SA 1CIUA 2HT4C 4NRXB 1JNHB 3TA3C 5MHSE 1WC7A 4Z6AT 1DUZB 5CIPB 2AV7B 2VDNL 4ZNEE 3SDAA 5IMOA 5IFAL 5IJKA 1S7TB 1WJ3A 4HC1L 4LHUG 5IM7B 3JWNC 3BJ91 4HH9A 1MEXL 2EDLA 3UTSD 4YQXL 1BF8A 2X42A 1JRHL 3BWAB 2XY1A 1YYMH 1ZT4B 1R3HB 1KIPB 1YYLH 2VQ1A 4KK8D 2IEPA 3ARDB 4XTRD 3FT4B 1FNGB 1U95A 3QQ3B 2FLBT 4WO4D 3LKSB 2Y06L 4MAUH 5KSAD 3QCUH 1MQ8A 1CVSC 1U8OB 3VFOB 1AE6H 1UA6L 1UKSA 3N06B 4D9LL 4ZO6A 2EYTA 1S9XB 1BOGA 4YPGB 3MLUL 4CADB 2VWEC 1MCJA 2IALA 4JM2B 1AD0B 4P9HL 5KW9L 3EJZC 3SJVA 1QRKA 2NNAB 1WIOA 3FN0L 4MXQC 5IFHH 1L0YA 3IS1X 4LIQL 2PKDA 5I30H 1X5YA 5FM5O 2J12B 4XMKH 2EIBA 4QRSA 3LIZH 3QI9D 2YPLA 2HMID 5C0ND 5DURB 4YHLL 2BNRA 5IQ9A 3TBTB 2A6IB 4XXDB 1EJ6A 2JK5A 3FO2B 4YHOL 3KPSA 3EYFB 2GHWB 4EOWH 4JO1H 4HG4K 4EI5C 1AY1H 3UTTE 3IXTB 4U33A 5ICXA 5FO7B 3RY4A 1FJ1B 4NQCD 1FFQA 2F74A 4PGCB 4G3YL 5E03A 2J8UB 2P8LA 4U7SA 3K2MC 1EXUA 2GJZB 2Z93B 5E6IA 1Q9LA 4FQLH 4HX1A 4EI5B 1KLUB 1NBYA 5IK3A 1IGML 2QQKL 4Z76A 4WY7L 2EDFA 2OQJB 4YFLF 4K8RC 3BDYL 2DIBA 5D5MF 2VIRB 1XF2B 1A64A 3U4AA 3QZWG 4BA8A 4LLMB 3KPTA 2ZCLL 3QUZC 1Q9OB 4W4OC 3TIEA 4D94A 4ALAH 2BHZA 5I1JH 3MRCB 3R06B 1AXTH 3GNMH 1QQDA 4I5BA 5JW4R 3GSNL 4HAGA 2C3VA 2VQTA 3LD8C 2UYLB 3OAYK 1DLHA 3P0VH 1HXYB 3E6HA 3G08B 4PJIF 1MAKA 2OL3A 3ZYOA 5GJSH 5DK0A 5F9WB 5BMFL 2ENYA 4P4KB 1UENA 1IAIH 4QRPD 4PGDB 4WUUB 4KK9D 4TRPH 3U9UA 3U6RA 5C08E 2OX5A 3LD8B 3BOVA 5LGKA 1KOAA 3MV8E 4QHLA 5BZDA 1U6AH 3MUGA 1IAMA 5EOQL 4X7DC 2NY6D 4HS3B 4P46D 4LU5L 3QDMA 5DGQA 4NBXB 5T3XE 2CXGA 2XA8L 2EXWD 2FL5B 4GG6A 5E56A 1TJIL 3PDOB 1B4JH 4CAGA 4WCYH 2AV1A 1S9YB 3FFDA 4M6NL 4OV6F 2WV3A 2VLRB 5IMMA 3V6FB 3MBXL 4JPVH 5I73C 5C09A 3O6ML 2EIEA 5GGUA 5I1IL 1XGPA 4OCNC 3T0EC 3SDCA 4UT9L 1SYSB 1FFPB 2DTMH 3CFEA 1CF8L 1BEYL 4AIXA 4WI6A 5I1GL 3RY5A 4DK6A 4Y19E 1Q9KA 5K93A 3MV01 5I73B 3BD3A 4JRYD 4NNPH 1A1OB 1A7NL 2YD9A 3B2UC 4ZOAA 3T0EB 1IQDA 4P9HC 4XTRC 1RSFA 1AIFA 1KJ2B 2WAHA 4HWUA 5HGGS 2FDBP 3KYKL 3PV6B 4P5TD 4NQED 5KSAC 5HGAA 2IGFH 1MJUL 4ZS7H 4I2XA 5FA4B 4G8GE 5DT1H 4A6YL 5I17A 4NDMA 1MELA 2GUOA 5CD5D 3T0DA 4J4PD 4LLAA 3V4VH 2Y6SC 3G6JB 5GGQH 2O5XL 3KPLA 2Q8BL 2H3NB 3VW3L 3MACL 5MERB 4PJ9A 4H0GA 1T83C 4U6XB 3VFRA 2P5EB 3MFFA 4ZFFB 5K9OA 3WHE1 3FQXB 3N1GC 2HT2D 5ACZB 2HMIC 5C0NC 1UM6L 4IRZH 1JWSB 5TGBA 1MWAA 1TQBC 5EO9A 3MOQA 3HTLX 1PZ5A 4RA3A 3IKKA 2XN9A 1ZGLM 4Y4HD 4TN9A 2ARWA 5LAXB 3S3PA 3CDYA 4LEXL 1AFVH 4LQFL 1ZS8A 5IFJB 3BP7A 4L3EA 2E6JA 3L3IB 1FFOB 1PG7X 1GZQB 4M1GL 3LS5H 5CZXD 5HYJB 2IPUK 2O26U 5J12C 2YD8A 1NGZA 1WICA 1TQBB 4HUWA 4X6CF 1MJ7L 1A1NA 2IFFH 3OX8B 4EBQH 4HW6A 1S9WB 3B5GA 3VH8A 3NPSB 4RZCA 4PJ7F 4TSAL 1TENA 2DYPD 3MYJB 4XP4L 2RB8A 1WT5C 4PGEB 5DC9B 3RWJA 2A6JB 1NBQA 2AJ3A 2APFA 5J12B 2DJ4A 4PB9L 4LPWA 5KVFL 4QXUL 1R5IA 1A1MB 1A22B 1NUNB 3BE1L 3I84A 3BKML 4BK4A 2RJMA 4YDKH 4MNHB 5ETUB 3S35X 4FTVB 1IC4L 2NTSP 4HCRA 2VDQH 5DJXA 5ANMB 3P0GB 3KAAA 2LAAA 1I8MB 4UDUA 1CR9L 1RZGA 3IETA 3TT1L 5TE6H 1T89C 3EO0A 4LSVL 3KJ6L 5F3HB 1FL6B 4P99A 3NCYP 3CSYB 3QCTH 5CP3H 2VKXA 3NOIA 2VDPH 1JF6A 4ONFL 1E4KC 4P4RB 5JZ7D 2YC1A 3PWUB 4AYFA 4F37F 3G5VA 4JVWA 5EZOL 5L6YH 1NL0L 1F6LL 4I0PD 3QQ4A 5FYKU 2PCPB 1JTTA 2R1WB 5C6WH 3S96B 2ZUYA 1REIA 2H6PA 1TVHB 3NFNB 1FN4B 3C8HA 2OTPA 1FNEB 3HPJB 1GZPA 1DANT 2GSGA 1BAFH 1JYVA 3DXAD 2EICA 4R4FH 4QF1B 1G1CA 1H3TA 1QR1B 2JIXB 4W6WB 1OAZH 4K9EL 4L8DB 4GRMB 4TSBL 3WHXA 1S7VA 5FO8A 5IW6B 4X0KB 4YHKH 3G6AA 4OJFH 2P7TB 3AS3A 2DWDB 5J1TC 5CJXA 1FORL 3VXRD 1TETH 4ELMF 4X6BB 1HHHB 5KSUB 2BHUA 1CG9A 1QSED 1ONQB 5I18L 2HFEB 3FQWB 5CEZD 2VR4A 5H2BA 3WXWL 1N6QH 4KAQL 2V17H 1FC2D 4U3XA 1NFIB 4I9WD 3FQRA 1MRFL 1BVLB 3H9YA 5E2VL 4MHHG 2F58L 4QGYA 1MJ8H 1FLRL 3B8YA 5CEZL 1ZSDA 4JLRA 3OJDB 1UZ6E 2H32B 3VXMA 3OWEA 5EOCL 3RUGF 4PD4J 4JO3L 5DO2C 4IDJL 4R90L 4P2RE 3IDYC 4PJXA 3DX7A 2WWMC 5MHSD 2YEZA 3U2SA 1N3NB 1FFNA 4KKLD 3ILPA 1F4YH 3P4MA 4CN4A 4G6FB 5BXFA 3ARED 4LDEB 4M4PA 4DCQB 3LS4H 1JGVL 4GUPB 4NZRL 3VU2A 2E27H 2V7HA 4PGBB 4AL8H 3Q1SH 4FP8L 3MV9B 2OMNA 3O8XA 5F7NC 4YXLH 4HDIA 3IDYB 3O41B 1RV6X 1I4FA 4Y4HC 1VERA 2MPAL 4JO2H 2NXYB 3UZQA 4F58H 4KZDH 3W39B 2CLRA 4XVSH 4PJ8D 5CSGA 3UTZB 2GCYB 2F9BT 3UBXG 4HBCL 1NGPH 4ONHA 2VXUL 4LSQH 3PNWB 4PJBB 4ODSL 1IJ9A 3EDDA 1J10A 1G9NH 3SDXE 1EAPA 3MRGB 4HWZB 2G2RA 4OM1H 4KI5D 1P9MC 3KWWB 4U1MA 4NO3A 4AG4L 4LRNH 2LTQB 2A73B 1NCNA 2H41A 4Y16A 2H2PC 4XPBH 1LDPH 3W0WB 5E9DD 3DMMC 4I3SH 3ULUC 2P8MB 4IHOB 2B1AL 2R9HC 4UNUA 5C0RH 5DEGB 1A6VH 4U1JB 3RWGB 1PGRB 1EEQA 2HWZH 4L4VD 3D2UD 5BQ7B 4YXKH 3X12A 1CLYH 3EO9L 3ZHLA 5ESQB 4RMTA 4CW1A 5GSRB 2OL3H 1YNTB 2OMBA 4URTB 3FO0H 4Z78B 3DMMB 4Q0XL 1F3JA 4M1CD 3TPUA 3RI5K 1YJDH 2CRYA 3BPNC 3JV4B 4XVJL 3QCVH 3S3JA 3QDJA 4L1HA 2J5LC 5JZ7C 3GFUA 3TGXA 3LB6D 1VACA 1NMCC 4I0PC 5DJ6B 1Z9MA 4LKCB 4Y0GA 1CI5A 1G0YR 1RVFL 3VFMA 2CDEB 1W0WB 4WHTA 5SWZE 1AI1H 5A2KH 3GM8A 1FL3B 5DJ0B 5GRVK 1SEBA 2J5LB 4ZPVA 3CFCH 5I8OL 1MFBH 1YN7A 2H26A 1NMCB 2DBLL 5L88H 2E9JA 1N26A 1DVFA 1PKQB 4NKOB 3DI3B 3HE6B 5JPMB 1TQCB 5JA9A 2XZQL 2BZDA 4Y4FD 1RUPL 1JZ7A 4NHCH 4F37K 2XNAA 5IR1A 1RULL 3QFJD 3QUML 4LSSL 3THML 3QDGD 3V4PH 1U8LB 4XCNA 3DARA 4N0UB 1U8MB 2OTWB 4OFVA 3DV6A 3KLDA 3EYUH 4OZHB 3L3DB 4O4YH 3OV6A 5IBTH 1NGXB 2GKIA 1WZ1H 4MJIB 2AK4D 4HUVA 5GGSB 4PV8A 4Z95H 4MDIB 3CSGA 5DJZB 1U3ZA 4UV4H 3OKNA 4JPWL 5DZOA 4CMHC 1V3LA 4HBQA 4DKFH 1DBML 5IVXE 4OSUL 1U91B 1TFHA 4IRJB 2ESVD 2GT9A 4ELKB 3L5XL 4YEEA 3VDCA 1RK1A 4YC2C 4O9HL 3H42H 5K9JL 2NMSA 1MFCL 5F7YC 2BMKA 2YSSA 2BY1A 3AREC 5FV2A 5LGJA 2R4SL 4M6AA 2AXJA 4XC3H 1CXHA 1HCFX 4GKZA 4PJAA 1MWAH 3VA6A 1RIVL 1DBBH 1FYHB 3LVEA 4XNYH 2ZUQC 3MJ7A 1U58A 4ETQA 3GSQB 2DF3A 4HK0B 3KGRA 3ZDYE 4HKZB 4O51B 3RPIB 3P0YH 1F6AB 4JQIL 1E28B 4LNRA 4C56A 4NRZA 4RISL 2DDQL 3GGWB 3KJ4B 3NFSH 5HHXH 43C9B 2PW1B 2PXYA 4ZO8A 1RUMH 4WRLA 1ZLSH 3ES6A 4OD3H 3K4ZA 3EFFB 3O6KH 4JM4H 2ZUQB 3U82B 3RNKB 4M61A 3I6LD 3TBWB 2A1WH 2DRUA 1L7IH 3HUJA 4OIIL 1XT5A 1LO4H 1HHJA 1I7UA 2WIMA 3IDUA 2AEWA 3PWPD 1FG2B 3HE7A 4MNQE 1CS6A 1J1XH 1T1WA 3Q6FA 4JEGB 5JUEH 2MHAA 4LSDA 1KB9J 5ADOL 3F7YA 4HCRH 3LRHA 1Q94B 3QEQD 4KRNA 3MRDA 4NQSB 5TDPB 4LLUA 3QAZB 1P4IH 1P7QD 2HJFB 5DYOB 2Q7NA 4PRIA 1IEAA 3A6BL 5F1NB 4G7VH 2X70A 4H1LB 3FHQA 3MV7E 3RBGA 3UTTB 4OM0H 5I1DB 1CN4A 4Y1AD 4JG0L 2NY0C 3UZVB 4QXTB 1CLZH 5JMRA 2IPTH 3LB6C 3V5DA 4NO5B 3U0TB 2EC8A 4K71C 3BUYB 4MB5A 1T0NA 1BM3H 1ZANL 4IOIB 4LCUA 4F8TA 4I4WB 4CVXB 1A02N 3Q5YA 3C2SA 3QHTC 2NY0B 5FYJH 4LLWB 2I07B 4I0KA 3BEVA 4HWEL 5GS3A 4ONGL 4MA3B 4LIQE 4K71B 1A6TB 1NAKL 5GGSY 4S2SA 2G75B 2ARJQ 4Y4FC 3BO8B 5C0AD 1IARB 4NP4L 4PLJD 2GTZA 3C8KB 3MRHB 1ZTXL 1G6RL 4JR9H 4XBPA 3LOWA 3NIDF 5TH2B 3UTPE 3TCLA 2BP3A 4NO0D 3SEPA 3UDWA 3EOTH 3DBXA 5E1AB 2JELL 1Y6NR 2PF6A 3BZ4B 3WJJA 1JPSH 2FX9H 3PIQA 4XCCH 1LVEA 5D1QC 2DAVA 3DHJA 2CKBB 4PJEE 3MUZ1 4PTUA 3L1OH 5C08B 1AKJA 1YEHH 1GIGL 4UILH 12E8H 4TVPH 5DEFB 1RZIB 4JGMA 3MV8B 3F7RA 4PP1D 1KNOA 3UMTA 1G7LB 5J7CC 4J3SA 3OKDA 4H5SA 1JE6A 2BRRH 3C5JB 4PJFE 2R2EA 4UAOC 1P4BH 2IH1B 3BW9A 1AJ7L 5CS7A 1KG0B 3NABL 5D1QB 1DBAH 1OB1A 4K2UH 3QJFA 3E2HC 3KDMA 2R4RH 4BZ2H 3BP5B 1MREL 2AJZA 2Q86A 3MRPA 5D1XC 1IGYB 4UIKL 1Z3GH 3A67H 2YMXL 4NRXA 1JNHA 3VMNA 1DUZA 5CIPA 2AV7A 2W9EL 4YZFE 2QL1A 3SGDI 5I74C 5C0DB 4TVSa 1E4XH 3IS0X 1NFDF 3SE8H 1D9KC 3E2HB 1YECH 3H2WA 2R0KL 4Y19B 5D1XB 2G9HB 3RBSA 3BWAA 3EZ8A 1R3HA 5T1MB 3KPMB 3ARDA 3FT4A 4YWGL 1FNGA 2NXZB 3HFMH 3JWDH 5FYKH 4X5WB 4X4MA 4LPUA 3VFOA 3GIZH 1D9KB 1ORQA 3W11D 5IKCB 4JKKA 2YZ8A 4G8GB 3Q48A 5I8KH 1UJ3C 2G5BA 1AO7E 4JM2A 4CGTA 4UQ3B 1OT1A 3CFDB 1T3FB 3SKMB 5E8PB 1K8IB 4X99B 3T3PF 1JUFB 4YDVB 2VLLB 4WTWA 1WK0A 2X89D 2NX5E 32C2B 3NA9H 5FKPB 3BKYL 5JHLH 3CMOH 3NCJH 5LCVL 5T5FL 1T2JA 3EYFA 2ADIB 4LP4A 1UJ3B 2E9WA 4QOKE 3Q3GB 5AYUL 2YD6A 1IZJA 3GJFB 5FO7A 5I6XB 2F19H 2GFBB 4LCWE 3P3YA 2J8UA 4M8VA 1N7ML 4M43H 3EOYG 1U3HC 3KLAB 15C8H 1JCKA 4WI4A 1SYVB 3PQYE 4J3OC 3UPRA 1MHEB 4RFOL 1UM5L 1YNLL 1S5IH 4WNQB 3TH2T 1INDL 2QR0B 5I71C 1WTLA 2MTPA 1AGBB 5FOBB 1KULA 3L3KB 1FSKB 1QFWM 4BZ1L 4KQ4H 1VGKA 3C6LD 2VSCA 1U3HB 3IDGA 4HHAA 4K7PL 3D0VB 3NCMA 4MWFA 4X98B 5D2NA 2BVEA 2VRAA 2YD1A 2VZVA 2DICA 1PZUB 4RGMB 2IBZY 1RFDL 4MXWH 4UINL 1Q9OA 3X3FL 3O3AB 3HZVA 3R06A 3DWTA 3NMEA 1ZAGA 2OCFD 1UACH 4LVHC 4D9QD 5KZCD 4TUKH 4BQ8A 4FFVD 1HXYA 1W2KT 3G08A 5JIIA 2A74B 2COQA 4OGYL 1KCVL 1JPGA 1MNUH 3WDHA 4H8WC 4P4KA 1P84J 1V7NH 4KPHH 4PGDA 5CBAA 3REVB 1C12A 1U8HB 3X14B 3C9NB 2MCPH 4JKPH 2OI9C 1RU9H 4MA1B 1D5XA 4LVHB 5EORH 5F1SA 2F54D 1VKXB 4YNYA 2VITB 1LE5B 3C60A 1IL1A 2CIKB 4PP1C 2Y07H 5GS0C 1UYWL 4HS3A 3F12B 2FATL 2QHRH 2GK0B 4RIRB 4U1HB 2JJWA 1NDMB 1H8OA 3PHQB 1J0IA 1I1AC 2VR5A 4ZFGH 1XR9B 1J86A 4PRBB 2OI9B 1S9YA 5BO1H 3CVHB 4GAYB 3ZKND 2VLRA 3V6FA 1INQA 1SM3H 2HVJA 1RQ5A 4UT6H 1MOEA 2NW2B 4WV1B 2ZWLT 4Z7OF 5H35B 1CD1B 1OAYH 3ARZA 1A4KB 1FFPA 1SYSA 3JV0A 1I1AB 1DUYB 2N1KA 1F45A 3WIIL 1BX2B 1J7VR 4I18C 2WINA 4V1DD 3HB3D 1HQRA 1G7IB 4FQCH 3P4OA 4AM0A 1T66D 1JMZA 4XAKE 3RHWF 1AXSA 2OZ4L 4ZQKB 4EZMA 1KJ2A 5EN2A 4OD2B 4N0CC 1QLEH 2V2TB 4ODXA 3DVFA 3C5SA 1Y18B 4LLDA 5FA4A 4I18B 2VDOL 3W11C 4JFDD 4OZ4A 1DE4A 4P2RB 2W65B 3G6JA 1X5HA 5SWSE 2NY7H 5D7LD 1T21B 5KVEL 2H3NA 5MERA 3BP4B 5ICYA 3DROB 3U0WL 1LP9B 2P5EA 4ZFFA 1HEZB 5BS0E 4G6JH 5IF0B 4O5LH 5ACZA 5CHNB 2W0KA 1CXFA 4OCSL 1ZHBA 2LU3A 3KPPB 1JGLL 5IHUL 1KBGH 4HK3N 4LSPH 5LBSL 3L7EB 5DQJB 4MAYD 4LLVB 4KK6D 3QPXH 5ILTL 5LAXA 1S7RB 1CGWA 5IFJA 1DCLA 4HFUH 5ESVA 4A2LA 3CVIL 3D3VE 3G9VA 2HH0H 1SEQL 4JFZH 2X4NA 2D4DA 4HIXH 3S9DB 1DR9A 1GZQA 3CZFB 5IJVB 4PREA 2K1MA 3HC4H 5HYJA 2V5RA 1P2CA 1XGTB 2FWOB 1MHPL 1A6ZB 3MUJA 4DTGH 3KS0J 3OX8A 4LCIH 3BZDA 1CWVA 2D7PA 4GJTB 4M9PA 5TF1L 1S9WA 4QYOB 2ZUUA 5EBGA 1EJOH 3SDXB 4MA8H 3EHBC 1GGBL 1XIWD 5C9JB 1CGSH 4NC0B 3P11H 4UUJA 3ARRA 4QRRE 4PGEA 5KSVB 4WDIB 2A6JA 1QFWL 2W0FA 1YA5A 4R2GD 1L9MA 2FD6H 3FFCD 3RVXD 2Z0BA 2FGWH 1LD9B 1IAII 1A1MA 3MRIA 2PTTA 1KN2H 4FTVA 1FRGL 1AHWC 4NKIH 2FH8A 2VAAA 4FZEL 4X9BA 1AD9A 5D71L 5ANMA 3EDKA 4FFVC 1VENA 4R8WH 2X4QA 1KLFA 4XPFL 3U36A 3MNVA 3P9MB 4OLXH 1YEEH 5JW5A 3CIQA 5F3HA 1U8IB 4RCAA 5K9KB 3WFBH 4O2CB 3T0XA 2N56A 4OLYL 1WFNA 1ADQA 1V7MH 4H88L 5F9OL 3UTQA 1AHWB 1K2DA 4MJ2A 1HK6A 4JQVC 1KGCD 2PW2B 4BH7B 2PCPA 4RGND 2AJVL 1TVHA 3NFNA 3T77B 2X4UA 1FN4A 4IIQC 1Q0YL 1PY9A 4X7SL 1FNEA 1O7SA 1HWHB 3N0PB 4XGZB 4C58B 3RGVC 4WHYG 5SWZB 4YBQC 2BK8A 4AEHL 4NKMB 1QR1A 2JIXA 5HYIA 4X6CA 1I7ZB 5HHOD 3DO7A 4R96A 2WLZA 4G80B 4GRMA 3ZKNC 4X0KA 2DM3A 3V6OE 5CGYD 2DWEB 2P7TA 2XTJE 3FAWA 4PJ7A 5SX5H 5CIPH 5F88B 1IKFH 5TQ2H 1RZKL 4RGOL 5KSUA 4X6BA 1HHHA 4NRYB 1W8OA 1OP3H 3SOBL 1R5WB 3LV3A 2K3TA 3O11B 2VDKL 3GI8L 4MJ4A 3WLBA 1ONQA 4FQIL 2HFEA 3ECBB 3RGVB 4RMRA 3FQWA 5CSZB 3QB7C 3GSXA 5JQ6L 1SJEB 5I1HH 4GAFB 3G5ZA 4Q97A 1M05A 5ALCH 3I3BA 3GSVA 1XFPA 4I77L 1BVLA 4NJ9L 4WTZG 4G6KH 4OTXL 3QHZL 2BNUB 1RJLA 1UCBH 4OFDA 5IHZB 2HN7B 4CVZA 2EC9U 3OJDA 2YD2A 1AQDA 3Q2CA 3D85B 2A6KB 3T3ME 3D39D 5IVXB 5BRZD 4DKAA 1P6AB 3MTRA 2R8SL 2YOCA 3OKLA 4WI9A 3H9SE 1WAAF 1BD2E 2DLEA 5I76A 3MMEA 2OP4H 1DFBH 1N3NA 4FXKB 4Y5VA 5L2JB 4OZIE 4PR5A 4ZDHA 5L2KE 3DYMA 5EOCJ 1FGVL 4X6DE 4GUPA 1QVOB 4HKBB 5E08H 4M4RA 1PY4A 4PGBA 5DD0H 5EULV 3F58L 1WEJH 1IRAY 2HJLB 2W59A 1JF1B 2ORBL 2CUHA 4XWGL 4QHNB 1E6JH 3RHWK 2W38A 1GC1C 1JWUB 1XH3B 2Q1EA 1A21A 4Y5YA 3RWEA 2BXYA 1Z5LB 2CPCA 4XZUB 3AB0C 2OBGA 4OAWB 2CO6B 3SY0A 1YN6B 2IANB 1IAOA 2FSEB 4D2NA 4KHTL 2WZPD 3LCYA 4NC1E 3WUWB 4KDTC 3B9DA 3LEYL 5F96H 1MCFA 3K74B 3CLFH 3W2DH 2J4WL 4HSQA 3T0VA 1EFXA 4E41A 4HWZA 1UB6B 3KWWA 3QIWD 3AB0B 1OP5K 1UXSB 1XIWC 1YEFH 3ME0A 3VWJC 1MQKH 1MFEL 1R0AL 1IQWH 4MNQB 4Z0XB 3WFHA 4IHOA 3WNKA 2RAMA 1HI6B 4NCC2 5DEGA 3VE0A 4U1JA 1X5JA 4AT6B 4L8SA 3HPLB 3TN0C 3RAJH 3EFDL 1HOCB 5HYSB 1KN4L 1KB9K 3X3GL 3VWJB 2XXMB 3MLWL 5IROC 1DN0A 4PG2A 3RWIA 3VJ6B 4Z78A 2VLJD 5JDSB 2DQCL 4XCFH 3MV7B 4LK4A 1LK3H 3T04D 4HKXB 2Q6WA 5C6PB 1FL5B 1NMBH 3FONA 1CDBA 2XPGA 3ET9F 4I0CC 1BZQK 5E70A 3VI4E 1LDSA 3TN0B 4FHBD 2P46B 1A7BA 3BQUB 5I2IB 3P30H 5ABDE 3ZO0A 1XZ0B 4NM4H 3ZE2F 4LKCA 4RGNC 2FH6A 2CDEA 3D9AH 2X1WL 1W0WA 3QRGH 5K9QG 1KC5L 1G0DA 5HHMD 4N1CA 1F97A 5IMKB 4M48L 1NSNL 5DJ0A 2JCCE 3DHMA 2H9GB 4FFZL 4LFHD 4XHJD 1EEZB 5TDOB 3STZB 3MCLH 1HQ4B 4XP1H 4K3EL 1PKQA 5DLMH 2O5YL 3ZDXE 4WUKH 5CGYC 3B3IB 3GMQB 1MVFA 3HE6A 5JPMA 3EOBA 3VXSE 3NTCH 1NJ9A 5BCAA 4Q9RL 1U8LA 1F4XL 1TNMA 4NOFA 1U8MA 4MA7L 1JYXA 3HG1D 2GJJA 3LN4B 1H15B 4OZHA 4NN5C 3L3DA 1LEKB 5GGTA 3LY6A 4NWUH 1KJ2H 1SJHB 3BKCL 5DEZA 5GGSA 4DJMA 2PYEA 5D7SL 4MDIA 4X9GA 5KJRH 5DRXB 2R0ZL 2CIIA 4PJEB 1U3JA 4WHYH 5TQ0H 1ZLVK 1QO3B 5HTSA 2EH8L 1T1YA 5EO0A 1Z2KA 1KIQB 4PRHE 1NLBL 1U91A 4HIJB 4IRJA 1T4KB 4ESKA 2UY7A 3B9KD 3MOBH 4PJ5D 1RZJL 5JLZB 4LCCC 1KPRB 3NFPB 1P5UA 4LLQA 4M62L 3GI9H 5HJ3A 1AQKH 4MX7A 1V5JA 3GRWA 5C07A 1T5WB 2DI7A 4PJCF 1RAMA 2VXVL 4QCIA 4YGVB 5INDA 4ZFZB 4XAKD 2FO4B 3GB7B 4PJHF 4ZPTB 2FBOJ 3TVMC 1BVKB 2EDHA 4IJ3B 1TPXC 3GSNB 4LCCB 3GSQA 4GBXA 4ACPA 1JL8A 1HCVA 1UEYA 1JHLH 2UY6A 4OD1L 4PRNA 4O51A 1ZHNB 4LBEB 3R8QA 3WN5A 1JV5A 4WW2C 3HS0B 5ECJE 5EIQA 3SE4C 5E8DH 4ETYA 1A3RH 2CR6A 1QFPA 4EN3C 5TE7L 3TVMB 4YBLC 3IDNB 3H0TA 3QULA 1KFAL 4CDGC 2OSLA 3HR5B 4AJ0A 3SKOB 1EO8L 3QIWC 4LPXA 1E4WH 3RL1B 5ID1B 2EYRA 2ZUSA 3X11B 3MLRH 1WITA 3GJEA 2XQBH 4WW2B 4GFTB 5CEXB 1FG2A 1AO7B 1VPOH 3AS2A 4EN3B 1NMAH 3DRTA 4ZO7A 4F15C 3LZFL 4YBLB 3KPSE 4U1KA 5DUBA 2YBRA 2ZUVA 1Q94A 4G8IA 5I75C 5DJ2B 3MRMA 4NQSA 1W0YT 3CX2A 2CK0H 2IQAB 3P77A 3SDYH 2NX5B 1B0WA 3AFLA 1G7HA 4M3KB 5E8NA 2HJFA 4WGWB 1MCWW 4XI5D 1T6VN 3ULVE 4LAJH 5F1NA 3TEUA 5KANI 4QOKB 4PJBF 2X4TA 3U7WL 5C0IB 4F15B 3UTTA 4F57L 1YYML 1ADQH 5I1DA 1YYLL 1Y6KR 3QXDA 1T2XA 3T0AA 4LCWB 4APQB 5C0CA 5I75B 3CAFA 4QXTA 5JTWA 2BNQD 4MAUL 2QADC 4CU8A 3QCUL 2OR7A 4M6OH 2X4RB 1NCAH 4ZUTA 1AE6L 5F6HI 3BUYA 2I60H 3PQYB 1I8LC 3TT3H 1CFNA 1RJZB 1MFAH 1GAFH 5T1LB 4I4WA 4HZLB 5IFHL 3MZGB 3QXAA 4M93C 3IDJB 4JHBA 4NN6B 2HTKD 4M5YL 5D9SB 1J05B 5I30L 2V5YA 3VXNA 2QADB 2UVEA 3QISA 4P3CH 4Z7VA 2ZCHH 4LLWA 1GVIA 4XMKL 3NZ8B 1WZLA 5T1DH 3N1PC 4JZOB 4MA3A 4YHPB 1KTDB 4HLZG 3VFVB 3VFTA 4N8VB 3ULUF 4EOWL 5FYLH 4JO1L 1WBYB 3ZTJG 3BO8A 1AY1L 5EBLB 3X13B 3MRHA 4M93B 4HT1H 3AM8A 2FEDC 1YUHB 1CE1L 4YE4H 4D0CB 5AD0A 4PYHA 5BJTB 4NQDD 5SX4I 3O6FD 4NGHH 5J1AA 3OG4B 2ZPKH 4FQLL 4OZGF 3ORJA 2DQUH 3QDME 2H32H 3WJLC 1P84K 3RKPA 1T1XB 4GG6E 1RZIA 3FO1A 3S98A 5T3ZH 4BK5A 5GIRA 2FBJL 1M6OA 4NHUA 5DMIH 2D31B 2IH1A 5HD8C 2R1XA 3CU1A 3KR3H 5C09E 1KG0A 2IPKA 1OWWA 2E7MA 3QNZB 4WFGE 2AS5M 3P4LA 3LRSA 5I1JL 1JF5A 3GNML 4P9MH 4HUKB 1KCRL 2A6DB 2HTLD 3WEXB 3BP5A 1F3DH 3P0VL 4OQTA 2YD7A 4OCYL 3UO1L 4U05A 2R56L 3PJSB 5FK9B 3SKJH 1I85A 4YAQB 1LO3H 2R23A 4JDVA 2AQ3A 3S34H 5GJSL 1FPTL 4N0RA 1M7DB 4PJDA 5EZLA 2EKSA 5BW7C 5HVHC 3UEZA 2Q76B 2Y1VA 4TRPL 3PP3H 4O02L 5GRXG 4YXHH 5ISZD 2P24A 4P2CG 4WHCA 5IB1A 3FT3A 4J3XA 2GY7B 4KFZC 2G9HA 4H1LG 2WIIB 1BD2D 5D7JD 1AR2A 1U6AL 4L8BA 2DI8A 2UUDH 3S4SA 4NNXB 3H7LA 5DVOA 1YQ2A 5CZKA 1B4JL 3HCVA 5IKCA 4WCYL 4G8GA 3EGSA 1BBDL 2J1KA 3L5WB 3ARFD 4DGYH 5BVJB 3LN5B 1U8KB 1UEMA 3AXLA 5FXCH 4UQ3A 4HKJB 4JPVL 5SWSB 3K4AA 1KPUB 5DFVD 5FM4A 1EEUA 2DD8H 2KH2B 5E8PA 4X99A 4F3FB 1JUFA 2XN9E 1DQMH 4KGLA 2VLLA 5BS0B 2DTML 3GMNA 3LAFA 4M02A 4HS8H 3ZYIA 2DN7A 3GBNH 4L3EE 4PUBH 5FKPA 2WK2A 2KQNA 4XI5C 4ORZC 2CSPA 4OFYA 3ULUH 3IJSA 4QHUB 4Q7DA 3GJFA 2UZIH 2GFBA 1L6ZA 3D3VB 1BQUA 2ZUTA 5FF6A 3SCMB 1FZMB 3QG7L 3PV7A 5KVGH 4LHUD 4ZS7L 4QRTB 4K3JH 4GAJH 2CR3A 1LEIB 2YRLA 3EUUA 5B4MD 4U31A 3VFUB 4WWKD 1YQVH 3V4VL 2LU4A 3EZJB 4L4JA 4WNQA 1MCIA 4XBEL 5GGQL 3U46B 2QR0A 1AGBA 5KVDH 5FOBA 1A7RH 3L3KA 4XVTL 2K7QA 4QRRB 3ARQA 1A9BB 1UVQA 2ITDB 1A4JB 3VXUD 4X98A 5GS2H 1ROWA 5DRZB 1OAXH 4JREC 1ZE3C 3MRBB 1VESA 3O3AA 4PV9B 3EKCA 1G7MB 1R3LB 3ARBB 3U83A 3UXFA 3CDCA 2A9NH 3C08H 1AFVL 3MA9H 3RU8L 4RAVB 3FO9B 2Q7YA 3CDGA 2A74A 4ZAKB 1XR8A 3C87A 4P5MA 2P49B 3LS5L 3QEUA 1ZGLB 3R4DA 1BLNB 4RQQA 3ARGD 4JREB 3OB8A 4TOYL 5CCKH 4EKXA 3VWKC 4PFEA 4U49A 2VL5B 2IFFL 3REVA 1J0KA 2RCSH 3UPAA 3X14A 3RVVD 4BSJA 5GJTH 1W72A 4EBQL 5B39A 4JCMA 5IT2L 4GKNB 5D7KD 1XF3B 3IAGC 1XF5A 1VKXA 2VITA 3BN3B 1HH9A 2CIKA 2GTWA 1BF2A 3KYNB 4DUXA 4HLZH 5FYJE 3PHQA 3VWKB 4CU6A 1E4XI 1XR9A 3ZTJH 1EHNA 4YDKL 2ZP0T 3GRWH 3SDDD 4Q9QL 5AUMB 3QIUD 5IW1A 5IHLB 4GAYA 1UB5A 2YD4A 5I1CH 2VDQL 3FT2B 3CMGA 2VXTH 2XTJB 4WV1A 1OQXA 1EAJA 5H35A 1JMXA 5AZ2H 5TE6L 4PRPD 3WSQH 1CGUA 4KVNL 5EFIA 5F3BB 1DUYA 4L9DA 3RDTC 3MLSH 1OHQA 3CX5K 3UP1A 5DD6A 1M71B 2VDPL 1U8NB 4QY8A 3G6DH 1CD8A 2AABL 1A7OH 3IDIA 3WNOA 2C3XA 4OV5B 3VXME 1H3XA 1UWGH 1ZEAH 3MRFA 1NUDA 4RA0C 4PJXE 4UTAL 3RDTB 2V2TA 2XI9A 1BAFL 4M7LH 3SDAD 3RY6C 1Y18A 4P2OC 1AXIB 4BZYA 1HHGA 2BFVL 5D7IE 4HK3J 3V5HB 3B9AA 2WW8A 3RTQC 3S7GA 3V0AC 4NO2A 3L3GB 2FB4H 3H9SB 4XB7A 3HNTH 1BPVA 2ZNWA 3M8OH 4OJFL 5DC0A 5T33L 3EDJA 5DFVC 4OZIB 5GRZA 3DROA 1LP9A 4NIKB 5L2KB 1TETL 1FBIH 1TITA 4Z7NE 1HEZA 2FJHA 2XWTA 4X6DB 4P2OB 4NC1C 2B39A 4GO6B 1N6QL 4H1LH 1UCTA 2V17L 3RTQB 1DQQB 1MCLA 1BFTA 4JFQB 4Z7UF 1E6OH 4OLEA 2P5WA 1GCFA 4DKEH 3SJVD 3MCKB 5IB2B 4D0DB 5EBMB 2HFGH 2EZ0D 4R97C 4JDZB 1LQSR 1MJ8L 2Z31B 3CZFA 2WBJC 2VUYA 4Z7WA 2H45A 2FWOA 2JJTA 2YPLD 1KCUH 4F33B 1J8HE 3MBEA 2BNRD 4I48B 3EYSL 5B4MC 2CLVB 2A83B 3FB8A 4MQ7A 4QYOA 4FMKA 5JXEC 2ZUWA 4PB0H 4ZMAT 1F4YL 5GS1C 2V5SA 4CNIA 5KSVA 4WDIA 3LS4L 2WBJB 4TNVF 3RVUC 2GJ6D 3WDJA 5IMLA 5EU4B 1HINL 1P5VA 3FOMB 3GBMH 2XWBB 5E6ID 3BIKA 1YPZA 4NZTH 2Y5TB 3Q1SL 5I0DA 4GG8A 1FO0L 1JBJA 2YPVH 1CTOA 2ADFH 4YXLL 2R29H 2DQJL 1D5IH 1XCQB 4OUOA 4MLIA 3OPZH 4JO2L 4LSTH 3BVNA 5GS1B 2YUWA 3HI6L 4KZDL 1IM9B 3T4YB 3QDJE 4XVSL 4ZSOA 4CVUA 3P9MA 1FZOB 1CICC 3GIVA 4BSWB 3FB7B 4Z77B 5K9KA 1NGPL 2CKBH 4LSQL 4O2CA 1TZHA 2VZ3A 2D2OA 3IF1A 1CZ8H 1G9NL 2HLAB 3RVVC 3FN3A 4ODTH 2PW2A 4BH7A 5EIVA 3TM6A 4OM1L 1NC4A 3RZCA 4Y89A 4LRNL 4YHMH 3SHSA 1CICB 5T3XH 3BH9B 4XPBL 2F5BH 1LDPL 5L0QC 5IEKB 5DHYA 3QEGL 5GGVY 2R15A 4P5KB 4I3SL 5HHVH 4XXCC 1SY6A 2I9TB 5C0RL 3KPRA 5IG7B 4L4TA 1FAIH 2P42B 2HWZL 1FDLH 3SDDC 1RUAL 1QZ1A 2JCCB 5GHWH 4N5UA 4MJ6A 4JFFA 5JOPE 4YXKL 4OQTH 4OGAC 1ZT1B 4K7PX 5DK2B 1OF2A 3S3SA 1A14H 4OCXH 2OL3L 1P4LB 2B7DT 4NRYA 2VXQH 3O11A 1KTLB 3FO0L 3V8OA 3VXSB 3QUKB 5HI4C 3ARPA 1DANU 1YJDL 2DQIH 4G5ZH 3O9WD 2BHYA 2PO6A 1SJEA 1ZOXA 3QCVL 3VXQB 4Y2DC 5J6GB 4J23A 3JV6B 5D2LF 3D69A 3QIBD 3WO4B 3RX5A 5BV7C 3GSWB 4HUUB 3QUXC 5FKAB 2AJYH 2C9AA 2BNUA 1YEDB 4P57B 5EPMA 1MLBB 1P53A 3SDCD 2HN7A 5CUSL 4ZS6C 4H0IA 2EO1A 5FDYA 3KLHC 3SDAC 4LOUD 4BFIB 3FB6B 4Y2DB 4YR6B 1D6EB 5IJKC 4PRHB 3CFCL 2VO5A 4DOHE 2GK2A 1URLA 3HMWH 1MFBL 5BV7B 1YMMD 5L88L 4PJAE 3QUXB 4OB5L 4JAMB 2YPKB 5L2JA 5AEAA 4HF5L 1I7TB 3LDBC 4B41A 4LCYB 1RMFH 2DLFH 1QVOA 4QLRA 4NN7C 4HKBA 2ZSVA 4KKCC 4NHCL 4HQQL 2CKNA 3PDGA 5LQBH 3S37H 3V4PL 1JF1A 1FCGA 4QHNA 4CU7A 4HULB 2DIJA 1EVUA 1JWUA 1XH3A 1PG7L 1G7PB 3GJFH 5JPNA 5IBTL 3W81A 1WZ1L 1Z5LA 3LDBB 1G6RB 5JIPA 2IBBA 1YN6A 3K8LA 2IANA 4PJ9D 1WBXA 1U95B 4MS8C 4DQOH 3S88H 4BKLA 5IWLA 3RFZC 5T1KA 1FNSH 4RFEB 3HUJE 1XEDA 3Q5OA 5LKNA 3U0PA 1IKNA 1GOHA 1BOGB 1BJ1J 1ZVSA 1F4WH 1XGRA 4EDXA 3D1MC 4HPOH 1I3GH 2OXGA 1YMHB 3T8XA 1UB6A 1I9JH 3H42L 5DTFA 1CGXA 5JHDA 4EEEA 1RI8A 4KUZH 4YDLB 3OKKA 4L3ED 4NNYA 3S36H 4AH2A 4AMKH 4XC3L 1A7QH 3ULVC 5E6IC 2V2XA 3WXVH 4MNQA 1J5OH 4Z0XA 1DBBL 2YRZA 1G9MC 4QTIH 5IQ9B 1G9EA 4AT6A 1H3PH 2JK5B 3KPSB 3NA4A 2RGSA 4FQQB 4XNYL 4FFYL 1F6FB 5CGTA 2VTFA 4PTTA 1G9NC 4JDTH 2ILLA 1QBBA 2D9CA 2F74B 4B50A 2Y36L 2ZCKH 2V9QA 5JDSA 1EXUB 3J8F7 4G6AD 3NFSL 4OGZA 1RUML 1ZLSL 3SDXF 5J13C 4TNVK 3DUSA 4HX1B 1JPTL 3BMWA 1WFOA 3WFZA 2GY5A 2OTUB 3BQUA 5EUKA 1NBYB 1D5ZB 3ZHKA 2MKLC 3K3QA 1L7IL 3MLXH 3N85L 5C2BH 1MFDH 1LO4L 3MRQB 3ZKXC 4H8WH 4P49A 2C4FT 4AY0A 3TP4A 4ZTOH 2ZZUT 4GRLD 4JFED 4UDTB 1RURH 1V05A 3FJTA 5JUEL 5J13B 1QOKA 3CVHH 2H9GA 1KCSH 4JFXB 5DR5L 2HKHL 4HCRL 1IGFH 1QQDB 5EU7E 1HQ4A 2C3VB 3OKEB 5GS0H 4FN0A 3B3IA 2LVEA 4WO4A 3GMQA 1R3IH 4N9GA 3ZKXB 4DGVL 2OJEA 3QDAA 3E6HB 5EU6D 1OSZB 2ZOLB 2XY2A 2X1OA 3FTGA 1WVZA 2CRMA 3RVWC 4G7VL 4AZ8A 2GYSA 3ETBF 5DK0B 1JYWA 3O4LD 3U6RB 2VXSH 1CLZL 2AVGA 2IPTL 1P6FA 5HDBE 2X2YA 1SJHA 3K4DA 5BZDB 3UJJH 3BZFB 3QHFH 1IC1A 1BM3L 2ITCA 3ALXA 4PJEA 3SDCC 1QO3A 3QDMB 3ILQD 2B8OT 4GW1B 3WUWG 4GG6B 2GAZA 3IFNH 1N0XH 1KIQA 5I19H 4LSUH 4LOUC 2LABA 4LVOC 2P8PA 1T4KA 3KPQA 3FFDB 4NQCA 1J18A 4JZJB 5IMMB 1KPRA 5C09B 4F7TB 5GGUB 3MRKA 3O2VH 1PKOA 1QFUL 4MB4A 5EIIA 1HYSC 1A2YA 2JJVA 2AGJH 4U1GC 5DUML 4JR9L 3CFEB 4ZFZA 4KV5E 2FO4A 4TVPD 3VRJB 4BSVA 4ZPTA 4KTEH 2KDGA 2HT3D 3CK0L 3GUTB 3GSNA 3EOTL 2K9UA 5JA8B 1CDGA 2J2ZA 1F2XK 1JPSL 4NWTL 2FX9L 1HHKA 5HYSG 5AAWA 3CFIC 1KENH 4PJ9C 2ENSA 4LBEA 1YEHL 4RRPA 4QWWD 5IVXF 4HWBH 2NY3D 4TVPL 4X4ME 4FQXD 1MIMH 4GMTH 2XFXA 4YO0B 5TJWK 5K59E 4R6UA 1RJCA 2XZCH 3IDNA 3T09A 4ODHH 1P4BL 2GUOB 3OAZH 2VE6A 1PX3A 3HR5A 5EZIH 2L0DA 3SKOA 2FX7H 5DUPH 1IBGH 3KPLB 1DBAL 4P2YA 4K2UL 3O6LL 2EECA 2DQFB 4QRPA 2FIRT 4BZ2L 4Y7MA 3V79C 4Y5XB 4KTYA 5CILH 1MCKA 2BJMH 1TTFA 4OGXH 1Z3GL 3A67L 5TGBB 1MWAB 2CUMA 5L8KB 1G1YA 4KJQD 1X6LA 4CN1A 5HGDB 1NLDH 2XN9B 3BFOA 3B6SA 3F5WA 4M03A 2IQAA 4P46A 5HVFB 5CJQH 3BP7B 1IFHH 5FYKD 4S1RH 2FYYA 2C26A 1YECL 5E2UL 1UKQA 3DGCR 1HZHL 4Y16D 5C0IA 5ACMA 2NR6C 4PJCA 1IM3A 4G6AC 1NGZB 4HUWB 5JORA 3HFML 4LCWA 4APQA 1CDIA 3JWDL 3VH8B 5I9QB 4RAUA 5FYKL 5MP6L 2X4RA 4JY6B 3GIZL 3RL2B 4Z5RB 3UAJD 1NKOA 3ZKSD 3KLSA 2DB8A 5DJYB 35C8H 3OR6A 3RWJB 3R0NA 4FQJH 2AJ3B 3WIFB 2AEQH 5D2NE 5E2TH 5T1LA 4HZLA 1R5IB 1LO0H 1H3WM 1J05A 4A6YA 4DZBB 2R69H 5C3LD 3QDJD 4JRYA 1CLCA 2ED9A 3MO1A 4KKAD 3NZ8A 1H3VA 2NY5H 3NA9L 3DETC 5DJXB 5JHLL 3CMOL 3NCJL 4N8VA 1VHPA 1C08A 2VDMH 4P5TA 5E5UB 4UDUB 3IETB 1F5WA 2VDLL 4RFNC 3FRPA 4D9RE 4DAGH 1NKRA 3EO0B 5EBLA 3NACH 5LWYH 2HRPH 4FRWA 3F7VB 1NUFA 4J4PA 5MEPA 3RNQB 3S5LB 1YUHA 1CBVH 3KYAA 1NDGB 4M43L 2YC1B 3V0WH 5BJTA 3G5VB 4YHIA 3QQ4B 15C8L 1CFSA 4WFEE 1DVFD 5DD5L 5DZLA 4BFBD 3KHOA 1FVEA 3FMGL 1NAML 2V5MA 2IF7A 4HS6B 1R6VA 2C3GA 2H6PB 2VH5H 5CJXC 4HJJH 1S5IL 1T1XA 3PHOA 3ESUF 5JW3H 3PWNA 2OJZL 4P23D 1LNUB 3BUTA 3VFGH 4JY4A 5D6CB 4JZNA 3CFBB 2D0FA 2VLRE 3TZVD 3WHXB 5JW4Q 3ABZA 1S7VB 5FO8B 1NGQH 3O2WL 3G6AB 5J0BA 3BP6A 2LE9A 3DTXA 1OTTD 2A6DA 4HEME 1UACL 1NBVH 2IJ0C 3BIAX 2DQTH 3O81A 2ADJB 3PJSA 1E4JA 5H2BB 2DYPA 1MNUL 1M7DA 2D4FA 3FQRB 3NH7H 4KPHL 2EDWA 1DLFH 4PJIE 2MCPL 4JKPL 1TJGL 2VLMD 1RU9L 4BFEA 5EORL 4NUJA 4JLRB 4CJ0A 4YFDB 4HV8A 5C3TA 3VXMB 4PJFF 3IU4H 4FS0A 1BVZA 2Y07L 1IAKA 4TTGA 3O8XC 2AQ1A 2QHRL 1II4E 4PJXB 4G9FD 2F53D 1RUQH 5MEND 1B3JA 4ZXBB 4ZFGL 1IGJA 2NCMA 5FHBL 1FFNB 4DN4H 1NUGA 3ILPB 3IU3B 5BXFB 1KTKE 3L5WA 5D7IB 5BO1L 5J11C 3C5ZC 3LN5A 2V7HB 2MJWA 3GSOA 3WKMH 3O0RH 4C56D 5SWSA 3NCCB 2XG4A 3NGBC 2PXYD 4UT6L 4YZFF 2OR9H 3O8XB 3PL6D 4F3FA 4HDIB 1YC8A 4KJQC 3KXFE 2O93L 1UH3A 2WP3T 2Y72A 8CGTA 4N90D 2CLRB 5J11B 4N8VG 3C2AL 3C5ZB 2VAJA 3PXHA 4FQCL 5HYEA 3CD4A 3O3BB 4Y16C 5ACLA 1GHFL 3C6SB 4AEEA 4NPYA 1RJYB 4EDWL 3NGBB 1D5MB 4ONHB 3D3VA 1DEDA 4YQXH 3SCMA 5JIHA 1FZMA 2K7PA 4EUPA 2YHGA 1QLEL 2G2RB 3FQNB 1KJVA 4WW2F 4U1MB 2CD0A 4NO3B 1J8HB 3QQNA 3UAJC 4IS6A 1J11A 4PRID 1WISA 4IMLA 2NY7L 1I9RH 3MLUH 4FTVE 3BT2H 4U0RC 4N1HB 4O5LL 2IQ9H 4J3WA 4LIQH 4U7MA 5HHNB 1MCDA 5K9QI 4CW1B 2X4PA 3MRBA 1KBGL 4LSPL 1QRNE 3OKYA 4MDJB 1R3LA 3ARBA 4NFBA 1SQ2N 3QPXL 2M8XA 4YHLH 1F3JB 5A43C 3PHSA 5F6IC 2ZG3A 1FFRA 4M5ZL 2VUOA 3PP4H 3FO9A 4HFUL 4RAVA 2HH0L 4JFZL 2KKQA 4KUCF 4ZAKA 4HIXL 3O2DA 4U0RB 1YY9D 1CFQA 3HC4L 1ZGLA 5EOTB 1BLNA 1VACB 4WW1A 5CLWA 2KL6A 1DVFC 4S11A 4DTGL 2VL5A 1HWGB 4YLQT 4I1NB 3VFMB 1XF3A 4LPCA 4UB0H 4WHTB 3RJQB 1CGSL 1EHXA 3P11L 1H9VA 4KJWD 1X5LA 2W92A 4J3UA 4LKXA 4X6CE 1SEBB 4ZPVB 4EI6A 3KYNA 2FD6L 2QQKH 4K7FB 4P2QB 4JGUA 1JPST 4GXVH 1AGFB 2FGWL 1W8NA 4PJ7E 1QHOA 1OAQH 1Q72H 3BMVA 3LQAC 5AUMA 1OTTC 2YA1A 3QH3A 1HHIA 2Z35A 2XNAB 5IR1B 3HN3A 1I8KA 3V6OA 5J06A 4XCNB 2KUTA 1YY8A 3GSNH 3LKRB 5FUZL 5L9DH 1VA9A 4OLXL 5DQDH 1YEEL 1A3LH 5F3BA 5I1KH 4ZUWB 4XNZC 4PG9A 1M71A 2B4CC 3OXRB 4HUVB 2QSCH 5E9DA 4LPYA 4U6TA 3UYPA 5T5NF 3OKNB 4OV5A 3U4BH 4GOSA 3TIDA 3GMLA 4L4VA 5EH1A 5D96C 5IIEA 4U6VH 2GIYA 5I1EH 2AJXL 2BSTB 2GT9B 3WFEH 1RK1B 2X09A 1QUNA 4N9OB 1CQYA 4I3GA 3ARSA 3C09C 3O45A 1I75A 1FZKA 3HLAA 3V5HA 2BMKB 2WP3O 4F7MB 4DOHB 1SMAA 2C3WA 3H9SA 2NY1B 4PJAB 3WBDA 5DVKA 5DA0B 1MI5E 1QLRB 1ACZA 2XXCB 5EU5A 3ARDD 1IKFL 2PXYC 5TQ2L 1B2WH 4XHQA 1WTGT 2YK1H 4R7DB 3P73B 1U58B 3MXWH 2EEBA 2RR3A 5JIKA 2VN7A 4ORGA 2EE3A 2WLYA 4KK5C 1C5DA 1X5AA 1DQQA 1Z9OA 4JM2D 3BSZH 2N7BA 2PUQT 4K3HA 2XYCA 4LNRB 5B3JF 1A3QA 4G6KL 4NRZB 1KJMA 3HE7C 5IB2A 4UOJA 5EBMA 3ES6B 3HRPA 1UCBL 2Z31A 3J7HA 4CL7A 3WNMA 5IEHB 4E41E 4M61B 2FZ3B 5DURD 4F33A 3SGDH 1JZ5A 2EO9A 3HUJB 4OF8A 4OLZL 3WFCL 4U1IB 2CLVA 1CFTA 2YZ1A 3BDXA 1HHJB 3QDGA 2VMFA 3HE7B 2OP4L 1DFBL 3ZSSA 4R7NB 4A6YH 5IB4B 2EDOA 3Q6FB 5F70A 5C0JA 1BZ9B 4WHDA 2BERA 5E08L 4GW4A 1MCRA 5DD0L 4OI8A 2AK4A 1K6QL 1WEJL 3CFKA 2Y5TA 3VW3H 1E6JL 1XCQA 4JFYB 3HZKB 1OM3L 4GSDH 4EI5D 1K4CB 2LU7A 3NCYS 4PPTA 1IEAB 4MLSA 5E8EB 4EIZC 2BVQB 2X70B 2ERJB 2ESVA 2I24N 2WUCH 4NBZB 4XPTH 4OCWL 5F1IB 3RA7L 4MCZB 3OMZA 1FZOA 5E7BA 5FB8A 1YY9C 4UZGA 3KS0H 2DM4A 4XPGH 4LL9A 5F96L 3W2DL 3MOAH 3V5DB 4X9HA 1YEGH 2HLAA 1A8JH 1T0NB 3V4UH 5CJOH 1YEIH 4Y8AA 4WENB 5EU7C 4LCUB 3L9RB 1MJ7H 4UMGA 4Z7UA 4JVUA 5I66A 1YEFL 4N5EC 3N50A 1MQKL 3WYRA 5KAQF 1CICA 3BGMB 3HZMB 4TSAH 1RIHH 1QR4A 3GSRA 5EUOA 4XP4H 1IQWL 2YUZA 1OT2A 3BEVB 2R2BA 3UDWC 4P4KD 5IG7A 1AH1A 3WJJC 4WUUD 1DL7H 2DKMA 4PB9H 2HJKB 4K8RL 4JY5L 4S2SB 4QXUH 5KVMC 4JCLA 3RAJL 5DK2A 2GTZB 2VQUA 4XBPB 1T7VA 3RVTC 2EDNA 5IB5B 5DD1H 1KTLA 2J7LA 3TCLB 1NEZA 2Z91A 3QUKA 4RAHA 3MR9A 3DBXB 5KSBA 3MUY1 1LK3L 3WDIA 1NMBL 2PYEE 1PLGH 3T08A 4AQOA 1IT9L 4LSVH 3KJ6H 3OB0H 2JJSA 4PTUB 4WIQA 3OZ9H 1AKJB 4OI9A 5E4EB 4MNGA 3P30L 4J3VA 4EXKA 2GSIA 1MAML 2X40A 2VLRD 1N5YH 5FKAA 2APVA 4NM4L 4ONFH 4GW5A 4WFHE 4P57A 2ATKA 5EZOH 1MLBA 1NL0H 4LAQH 3OKDB 3D9AL 3QRGL 3HRZB 2R2EB 1F4AA 2FJFB 5CZVH 4C83B 1P7QA 4HIHA 3EYVA 4BFIA 4MD4A 4CJ1A 1D6EA 1KXTB 5D1ZB 3MRJA 4JFPB 4N0FB 1GGUA 3SPVA 5DJCB 5C07E 4YUEH 4S10A 3V5KB 4JAMA 4Y1AA 4KHXH 2Q86B 3FAXA 5EBWB 3T0ED 1A9EB 3ARDC 3NTCL 1IGTB 1V3MA 5A40E 4G9DA 3HI1B 4JPKH 3SBWA 1Q38A 1G7PA 5I18H 2EDRA 5IGXH 5EG6C 1L7TH 4JM2C 1Z9SA 2BSED 4NWUL 4LSRL 1G6RA 1KJ2L 2R2HB 3IJHB 5B8CB 2CH8A 3B2UD 4F8QA 1H8SA 4EUPH 5KJRL 4IMKA 2P5ED 4RBPK 3T3MF 4QXGL 5E2VH 2EIDA 4NSKA 4RFEA 4XP6H 2VLKE 2EDBA 1I3RB 5AWNL 1ORQB 4Z8FH 4Z0BL 1FLRH 4U3CA 2AI0H 2V6HA 5MEQA 2AJSH 2G5BB 3MOBL 1YMHA 2Y6SD 4OZIF 4JO3H 4IDJH 4X6DF 4HMEA 4R90H 4X9FA 3GI9L 1EZVX 5M95B 1AQKL 2HG5A 4JO4H 4Q6YA 1FH5H 4PY8J 5C0FB 2EDEA 5HYJD 2G60H 4ZTPH 1IEBB 1LWRA 1YC7A 3DIFA 1JGVH 1GRWA 1Q1JH 4NZRH 3BHBA 2C3HA 4FQQA 4RWYH 3CSBA 1V8HA 4LARH 3O2DH 1MCBA 1I8IA 4DZ8B 1JHLL 1FIGH 4M1DH 2AW2A 2XZAH 5C0CE 3WIHA 5DHVB 4XC1H 2XKNA 5E8DL 5ALBL 1A3RL 4QXWA 1SJXA 1D6VH 3HC0A 5D2NC 3U7AA 3O4OC 4ZO9A 1RZ7H 1OGAB 1FYTE 3P4NA 4FTVD 1L6XA 3UPRB 2DS4A 2OTUA 2VXUH 3LRGA 1D5ZA 2HKFL 2ZOKB 4D3CH 1E4WL 3MJ8B 3MRQA 5AYQA 3OQ3B 3RRQA 4ONOA 3KYMA 4Z7VE 4NM8H 1PAMA 1VGKB 4NJAL 4HHAB 3IDGB 1H5BA 1VPOL 1NMAL 4UDTA 2FECI 4MWFB 5D2NB 5F9WC 3WE6B 3O4OB 1EBAA 4P4KC 4JFXA 3HZVB 2Z4QB 3T1WA 3OKEA 3VGDA 1EBPA 4NKDA 4J6RH 4YX2H 5GGVH 1KEGH 1R24B 1OSZA 2ZOLA 3C60C 2AP2A 1JPGB 4BH8A 5C70A 3MC0A 3VI4F 1A7PH 5CBAB 2JIXD 2MCG1 1C12B 4JKWA 4ZUUB 1ULVA 2J6EL 3KYOA 1D5XB 1JK8A 3BEWA 4HUMB 4KTDL 4LMQE 4M6OL 4KROC 4XVJH 1NCAL 4YNYB 2EDTA 3C60B 1IL1B 3BZFA 2I60L 3TT3L 2X89A 1INEL 1FNAA 2EYSA 2IG2H 4X4XA 5M7QA 1MFAL 5DRNA 1B6DA 1GAFL 5FYLD 1UWEL 4GW1A 2JCCF 4TTDC 3ALPA 2IADA 4IOSD 2VJXA 5IESH 2VC2H 4P3CL 2ZCHL 3ZDXF 4GKOA 4KROB 1KEMH 5T1DL 3VI3F 5EO1A 4JZJA 1INQB 4F7TA 2HVJB 5I8OH 5FYLL 2FR4B 4HIIB 4M8QA 4PJDE 1KLGA 1LO2H 3U7YH 5TFSH 8FABA 4HT1L 4MXVE 1A6AA 5E2WH 2FRGP 3TJHC 2D7QA 3VRJA 1ED3A 2WINB 3GUTA 1HQRB 1N5AB 5T3ZD 3WS6A 3P4OB 4AM0B 2I5YH 1JN6A 3QXWA 2ZPKL 4WFFE 3VFSB 3C6LA 5INCA 4G6FD 1AXSB 4PJIB 5EN2B 3LQMA 3K8MA 4W4NA 2ICEA 4GKSA 3TV3H 4ODXB 5FECA 3B83A 3C5SB 4LLDB 4YO0A 3MV9D 5DO2D 1HKLL 5T3ZL 4PYGA 4LRIA 1JJUA 4C54A 5DFWH 5C7XH 4OZ4B 1DE4B 1ETZA 2WWMD 4QHKJ 5FYJU 5DMIL 2DLIA 4ERSL 2NY4B 4XPHH 5IOPB 3H3PH 4P3DA 1CGTA 5B22A 2NXYD 2BSRB 2EDQA 1D5BA 1BGXH 1KCKA 2W9LA 1FIEA 5ICYB 1IC5L 2DQFA 3MGOA 5K9JH 3GKWH 1ZLUH 5DK3A 4Y5XA 4PJGA 1RIUH 1MFCH 1ZHBB 5HGBB 5B3NA 2RHEA 1SVCP 2R4SH 4S1SL 4JQXA 3R0MA 4FZ8H 2F54A 5HGDA 4Y4KA 3S34L 3ESVF 3KXFB 1QACA 4ZYKA 3NPSC 2IWGA 4Z7QF 2MQ3A 5ESVB 1ZLWH 4YXHL 2X4NB