1Q72H

Anti-cocaine antibody m82g2 complexed with cocaine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
223
structure length
220
Chain Sequence
EVTLQESGGGLVQPGGSMKLSCAASGFTFSDAWVDWVRQSPGKGLEWVAEIRNKANNHATKYTESVKGRFTISRDDSKSSVYLQMNSLRAEDTGIYYCTSVPQLGRGFAYWGQGTLVTVSAASTTPPSVYPLAPGSGGAGSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLNGDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTQVDKKIVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diversity in hapten recognition: structural study of an anti-cocaine antibody M82G2.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Fab M82G2, Light chain
total genus 41
structure length 220
sequence length 223
ec nomenclature
pdb deposition date 2003-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q72H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q72H02
1M6OB 3MYJB 4TRPH 4GS7B 3BIKA 4GT7A 2BERA 2EECA 3DOSA 5C70A 3ABZA 4MNGE 3IU3B 3K81A 3V95A 1FNGA 3ARUA 3KHQA 5E8PA 3R06A 1P9MC 3BAEL 3OJVC 3HB3D 1A6ZB 2KZ1B 4EOWH 4HK3N 1JPGB 5J0BA 3MPCA 3QIWB 1Q0YL 25C8H 4JLRB 2Z8RA 2V2WA 3KPNB 3KPSA 4UDTB 4QYOB 3SGDI 1T22B 2UZIL 1QFOA 3E2HC 3QNYA 3WLBA 1MRCL 1ZS8A 1S9WA 1RZKL 4NM8L 3JTTB 3SDAA 4MD0B 2EO1A 2PYFB 1QSVA 3DUSB 4V1DB 3TPUA 5L2KE 5FHBH 4J6RL 3VMOA 3DO3A 3H3BC 3NIGF 3IDGB 3ALWA 2QJDA 1YEFH 2WNGA 3RBSA 3SE3C 5C7XL 4F7MA 1CICC 4GW4B 1QVOB 3W11C 1U2CA 4MXQC 2EDFA 1KIQA 4D9LL 2DQIL 4DAGH 4NZUH 3ZKXB 4OD2B 2XWTB 1IC7H 3UTQB 4F8TA 1P5UA 5EU4B 1HEZB 5FA4A 3E3QE 2D0HA 1N3NA 4N8PA 3CFIC 3O3BA 4PS4H 5E1HB 1YMMB 4JY5H 3L5JA 5ID1A 4GKNB 2DD8L 1UT9A 4WIQA 1M05B 5I1JL 3DO7B 1UM6L 3HUJF 3WSQH 3HFMH 2VZ1A 2BDNL 2D7TL 1MVFA 3GBNH 4OF7A 5L8JB 1RSFA 2WAHA 5DVNA 1S7WB 3SJVB 2AI0H 1FC2D 3QI9D 1AI1H 4JG1H 5LVEA 4X4MA 1XEDA 3MRPB 4UNUA 3SJVE 3ARVA 1JZ5A 4XVTH 4XHJC 3OB8A 2UV3A 5SWQB 3GGWB 3ILPA 1JP5A 1I1RA 4RBPH 5GSRA 4AIZA 4OKVB 4Y89A 5GQBA 3CLEL 4PJCF 4HIHB 5FUOL 5J12C 3O6FB 4X4ZA 4XPTL 3T65B 1QLRB 3T3MF 4JGJA 1F11B 2HT4C 1QLRA 3UBXI 4MAYC 2VB5A 4UT7H 5DI8A 1RIHL 3ZTJG 3RHWF 3RJQB 4PJ7B 1DANT 2ERJC 2AJYL 3S36X 3HI5H 2C7UB 2K7PA 1BF2A 3QIUC 1NGYB 1HYSD 1IAMA 1YEGH 1L7TL 3KJ4B 1WCBA 3I75A 4X6CA 3D87B 4KI5F 3BMVA 1DFBH 1IM9D 1Q9LB 3IXAA 4MJ6B 5JIIA 1CT8B 3RZWA 2J6EA 1W72A 4QTHB 1LK2B 1R3IH 5AEAA 4RISL 4PUBL 4UTBH 3MRLB 4WEBH 1IC4L 1GYAA 3L3JA 2EH8L 4L4VD 4O58L 1SJEB 3DIFB 5GZND 4FTVD 4HEME 3BZFB 2Q3AA 1QHPA 2A6DB 5GISL 5GJTH 4P5MB 3Q6GH 3MV9D 2OCFD 2X40A 3VXSB 4Y4HA 4GBXA 1EEZB 1J86A 3NACH 2VC2H 2H2PD 3BQUA 2GTZA 4P2QA 5ICXA 1JZ6A 4PBVC 5ISZE 1IZJA 1YY8A 1JF1A 4HUKB 4YX2H 3RVUC 5LBSL 5J6HA 4HWZB 5A40E 2QSTA 5E2TL 3HS0A 4PD4J 5JW4N 1TTUA 3CDYA 4Y19A 4Y4HD 3CXHK 1C08A 2X7LB 3BPNC 3MUJA 2F19H 4PP1C 4R7DA 4OLZL 5CKGA 1J0KA 4HWUA 4TNVF 4MD5B 4PJ9C 4QT5B 2V5MA 1A6UL 5HPMA 5CD3A 5CBEB 1KEMH 1ZE3C 3HMXH 4ALAL 2JCCA 1K9TA 4Y16A 1X5GA 4EUPA 4U3HA 3AC0A 1U92A 3L3HB 1FP5A 2AXHA 2HJLA 4JPWL 2Q76B 4Y5YC 4BFEA 3WKML 3RNKA 1BQLH 2XYCA 1HIML 4Q97A 1HQ4B 4TSBH 4ZO9A 1B0WA 4NNYB 1TETH 3NN8A 4DVBB 1FG2B 2AEPL 2Z31A 2AI0L 2L7UA 4NKDA 5CEYB 4TPRL 1JZ7A 5F7EL 5CEYA 3W81A 3IU3A 3G08B 2OP4L 5TH2B 1G7IA 4QRPD 4YDVB 5T3XH 3VD9A 3RX5A 3NABH 4CRPA 5LWYH 3CLEH 4YXHL 5CJOH 5CWSB 5DHXB 4MX7B 1TVHB 1EXUB 4PJBB 5JDJA 1JYVA 4WFHD 4XPAH 2C3GA 3S4SB 3CFEA 3D3VD 3FFDB 1MWAB 1BMGA 1OB1B 5CEXA 3SDCB 5KOVC 3HC0A 5JLZB 1IAII 4P4KC 5IOPB 1RJZA 4I0CC 2APBA 3O2DA 4JZOA 3PHOB 4NC1C 5IMOA 4HIXL 1IAKB 1MCPH 4XP4H 5ESVB 1ACYL 2HT3D 3DX9A 3MCLL 4OT1L 1NAMA 3I6GB 2EYTA 3TM6A 3AM8C 1CU4L 4GSDL 3VGHA 4W4OA 1PYWA 2YKLH 2Q7NA 3ZO0A 1N6VA 1ZT7A 5F93C 1IAOB 1KJ2A 1QLEL 2CDFA 4RA3A 2FYYB 1OP5K 3BKYH 2FD6L 1IAOA 1KJ2B 3B9VA 5HGAB 1A6PA 3O6KL 4TULL 4KVNH 4LSPH 5H8DA 2OJZL 1TJGH 4HIEB 1BJ1J 4NQEB 1VGEH 5D7SH 2PO6D 2OZ4L 1OTSC 5I1IH 4P9ML 3RTQD 2XQBL 4Z7QE 2AGJL 5B3JE 5I1LB 3F65A 1I3GL 1XGQA 4XCEB 4XWGH 1BVLB 4PRBA 3TN0B 4BKLB 2WLZA 2EDEA 3W39B 2DAVA 2EDBA 3MLZL 3IJHB 1CG9A 2VAJA 4KROD 1G7JA 5EUOF 2UWEB 5F9WB 3MA7B 1I75A 2JCCF 3U4BH 3EYVB 4PJFA 4UB0L 4Z0BL 1J87A 2DMBA 4K3JH 5ESQA 1LK3H 5KSAC 1AQDB 2CIIA 4KKLD 1FDLL 4JHWL 4PJIF 3FOMB 3SE4A 1F00I 1UB6A 3O9WA 2ICWB 4P99A 2HLFD 3L3GB 4HS6B 2EDRA 4UV4H 3H7BB 3MNZB 4YK4C 1NAML 1HK6A 4J3OC 4OCMC 3ARFD 3DRQB 3F7RA 4LF3B 5BS0B 4WCYL 4HCRH 3IDYB 3MOAH 4KZDH 4N1EA 5D7JB 5GS2H 1NL0L 3ILQD 2BSRB 1N64L 2NX5A 1NCDL 5FAAA 1FYTA 3X3GL 1ZGLM 4XXDB 5C0AD 3KPSE 1Y6MR 4AIZB 2VE6A 4GBXD 5MP6H 4FFZL 2Z91A 4YDKH 5I71C 2H2SD 3FHAA 1DBKL 3MO1B 1FJ1B 3T0XA 3JXAA 2ZCHL 4YHNA 4WI7A 1IEAA 1CFQA 5TFSL 4F7TA 1BP3B 4PRID 9CGTA 5D96B 4KMTH 5EUOA 1AKJA 1JUFB 5IBTH 1Z9OA 3LS5L 4GW1B 4NFDA 3VRLE 3I3BA 4L3CA 4X7FC 4R96B 3NA4A 1N6QL 3DXAA 3P9LA 1ZSDB 2CD0A 3QZWB 3IFOA 4PJHF 2JTDA 4LASL 3EO0B 4X5WB 4XP6H 4EKXA 1DJSA 3CXDL 4HS3A 4M6OH 1SJEA 2DQHL 2DB8A 2AK4B 1G7LA 5F6IC 3O4OB 5EA0H 1NCAL 1T2QL 4U2YA 3QA3B 4JFFE 1V3KA 3VD5A 3LPWA 1U6AH 5ACMA 2PNDA 3MBED 1BQSA 1VGEL 4LHUB 4Y8DC 5EULV 3WUZA 3AB0C 2AABH 4O02L 5C0GB 1Y18A 1NGQL 1Q72H 4PR5A 3ZHLA 1YA5A 5ALCL 3JWOL 2P5WA 1X44A 5FGBA 5FGBC 5DJ0A 2VLLA 1RJZB 5DRZA 5J1TC 2OR7A 2Z31B 1MF2L 4NDMB 4NQTA 1BZ7B 4AT6A 1QR1A 2W0FA 1IKFH 1JGDA 2HVJB 1U91B 1YECL 1DE4A 3O6FC 3RGVB 2GK0A 5HI3D 3MV7A 2V7NA 1IT9L 3FB7A 1U92B 5C0BA 3KPLB 3PF2A 1S8DA 4DW2L 1DBBH 4NFBA 2VQ1B 4E41E 1GGIL 5FUZH 4LSTL 3BIKB 2DLTA 4HC1L 5BO1H 2EYRA 2B4CL 4BUHA 2IAMB 3GI9L 3RUGE 3FT3B 5EO0B 4WFFE 4ZAKA 4GAGL 2IPTL 5JW5B 1EO5A 3FCTA 1V8HA 4PRPB 1ZA3B 3OAUL 2OI9B 3H9YA 3MRGB 5C3TA 2WQRA 5CHNB 4ELMB 3VXRA 1WICA 3TA3C 1E28B 1CVRA 1OLLA 1LO5B 5CLTA 4QNPF 2APTA 3B9KA 3D69A 5C0CE 2WUCL 4ZPVA 1FL5B 1IBGL 1Q9KB 3MUY1 1XF4B 3V7MA 3QULB 4XMPH 5B4MC 3BJLA 4NRYA 4K07A 1YMHB 5JQ6H 3FOLA 1GPOH 1NMBH 5KVGH 5DSCA 1BM3L 1E4XL 2R9HC 5I1HH 3IVKA 2X44D 1I9IL 3LQZB 4N1HB 2R8SH 1JPFB 3K46A 3C09C 1XF3B 2F19L 5GGSB 1SJHB 5D2LB 1U3HC 1I1FA 2BMKB 2MPAH 3AXLB 1IQDA 1J18A 5MERB 3FRPG 3TIDA 4OFYA 2NX5B 1NANH 5D2LE 3TIDB 4LKXA 4JKPL 4NCC2 5CIPB 4U2ZA 1WFNA 5SX4I 4G6JH 3H0TA 3VXOA 1F6AA 3U79A 4E42A 3GMMA 5HGHA 5EIIA 5J8OA 1A4KB 4LKCB 2HTKD 2IAMC 2IPKB 4R7NA 2PYEE 4LVEA 5ICZA 3EOBA 3IF1B 2D7TH 3VXTA 1YEJL 4JRXD 3IF1A 2HG5A 4EN3B 2HKFH 4I3SH 4GS7C 4K7PL 3EYUH 4ONHB 1SYSA 3OKKB 1WLHA 3O4LB 3S5LA 3WFCH 3O4LA 4ERSL 4GRWE 1B2WH 4EOWL 1YN7B 4XNUL 2HJFA 4Z7UB 4KJWC 4BSWB 3G5XA 4FZEH 1V05A 1BHGA 3D3VA 4IHOB 4ODWB 2H3NA 4HLZG 4LNRA 5DQ9A 5CEZD 2IFFH 2PXYC 2FATL 3FB6B 4X99A 4HPYH 4WU7B 5IB3A 3GRWH 3ARFC 1W72L 3FB8A 1YMMD 3EDJA 3P9WB 4NZTH 3G5ZA 3FO2A 5GGTH 1OTTD 3L3OA 1AY1L 3S3PA 2PW1B 2ADGA 4JVPA 1UCTA 3VFPB 3ZE2E 2LU7A 3B2VL 1R5VB 2PW1A 4X9FA 1ONQA 3SKNA 1E4KC 2YPLB 4NDMA 3V7AG 3GIVA 1JPST 3MLYH 1HHJB 5FFLA 1JJUA 2X5PA 1D6EB 1KIUA 4F33A 3TJHC 2NTFA 3WS6C 4X7CC 1AKJB 2IH3A 4KK6D 3LEYL 4Y4FB 1P6FA 1MWAH 3ZKMC 2H9GB 2VXUL 3I85A 1MJJA 2X4UB 4LSUH 2ZSVA 3MV8A 3BXNA 4L8SA 4ENEC 1XF2B 1V3MA 1BOGB 2EYRB 1KB9K 5J1SC 5EZIL 5EOTB 2R4SH 4P3CL 3C8KB 3QO0A 4HIJB 2PO6A 3PQYA 1CI5A 1KTKE 3MRDB 5T1MB 1NBQA 4HKBB 4P2CG 1G7PB 3RIFF 3S35H 3V0WL 1JIBA 1FNSH 4XP9H 1ETZB 4L29B 5IJVB 4YFDB 4P3DA 4O2CA 4G6FB 3NZHL 2IGFL 3VXSE 5GGSY 4G6JL 5EU6A 5MENA 1TZHB 5GGUA 5D5MB 2VWEC 3DARA 2W91A 1FQ9C 2HJLB 4OAWA 5EORL 1A14L 1RUML 5DJYA 5D5ME 3WKMH 5BJTB 1HIMH 4K55A 5I18L 2EKJA 1KPUB 5BJTA 4X7DC 4RAUA 4UAOC 4NQDA 4WJ5B 4OLUL 3G5VA 3KYKH 4NQDB 1RY7B 4OM0H 5DJAB 1DBKH 5IB4B 4BFIB 4XNXL 2X42A 4QHNA 4X9IA 4YFLI 4IIQB 1DE4B 2IQ9L 1FIGH 2LTQC 4LVNC 3BP5A 1I8IB 5AZEH 5CMAA 3UPRB 3REWB 3QDJD 1ZK9A 1DQLH 3T0BA 4BH8A 4OZGA 1H3TA 3O41B 4QF1B 4XVTL 4XP1H 5FYLD 3T4YA 3VG9C 4HJ0D 4WENB 3RVXC 3VWJA 4EDWH 1BF8A 1A7OL 2FX7H 2AEWA 1GOGA 3QUMA 1JFQH 3W2DL 5IBLD 2BVUA 3KPPB 3FFCE 5CD5C 2IPKA 5IWLA 2Q8AH 4PJ5A 4XCNA 2M26A 5SX4H 4NO2B 1RK0B 1VFBB 2F53B 2MNUA 4HK3J 1ZHLB 3CLFL 5EBWB 1ZHLA 2EYTB 3B2VH 2NY4B 3MLXL 5FF6A 5D6DA 2APFA 2K9UA 5EU5A 4ZDHB 4YHIA 4QOKB 2VXUH 2F58L 1YYLH 5EU5B 4ZDHA 2NW3B 4M6MH 5ITBH 4GRLC 2P8MB 2P7TA 4LVOB 3L3DB 3JVGA 3OB0K 4JFZL 4NM4L 1NMAH 2G9HB 3T08A 1NC2A 1ZS8B 4M7LT 4RIRA 1ZA6A 4NZUL 3ORJA 4CW1A 1H15A 4ZD3H 3M17B 4GW5A 1PKQE 2VLKD 4QRPB 1E27A 5IHBA 2ICEA 2OTPA 3NVQA 1H5BC 5IFHL 3QQ4A 1OGAB 3IRPX 1CDCA 5AD0B 3MOQA 1Z2KA 3N06B 4F7CB 3H7LA 4O9HH 3D48R 3ARBD 3MCG1 5GS3A 4YHLL 2LTQB 1CFBA 2A0LD 4IOIB 5DVLA 5DMIH 1P7QA 4GKZA 5L0QB 3WCYA 1N8ZA 3E6HB 1EX0A 4TYUA 5C07E 35C8H 4P57A 1CLZL 4JFED 5C08A 2P5ED 2YA2A 3B6SA 2PW2B 4KDVA 4MQXC 2R9HD 1J1PH 4HUUB 4FNLH 4R0LB 3GSXA 3MQIA 4KWUA 3LKQB 3VH8G 4P2OA 4G8EB 2QQQA 2GK2A 1JHTB 1AHWB 1ZHNA 1CXEA 2EZ0D 4M61B 3M1BA 3BD3A 2UVFA 2OQJB 3QEHA 1CDBA 4HH9A 3QUKB 4MCYB 1A7PL 4XP1L 3T09A 1IGJB 2EDLA 1KG0A 4AEIL 5HVWA 4PTTB 4U1KA 3WFBH 3Q1SH 4GMSH 4YDJB 1PKQB 5IV2A 4WTXA 4MNQE 3N1GC 1C5CH 1MIEH 1H3VA 1YPZB 4NBYB 5FECA 4GSDH 4OZFB 5SWZA 1YEFL 1INQA 4JM4L 3QEQE 4UT6H 4JR9L 1OTUC 2FEEL 3MV7E 2ARWA 1LP9A 5JO5B 4HIIB 3SGKC 1GXEA 1BVLA 4KROB 2DLIA 4WEBL 2G75A 3L3KB 1IGMH 3VH8A 4HBCH 3KLAB 3GSQB 5IM7B 3IJHA 3KLAA 5CINL 4H8WC 1CGSH 2GFBB 3C2AH 1O7VA 2EDTA 3W9DA 5A16A 3IFNL 3LDBC 1BBDH 1TCRA 3MRJB 1I85C 3LQAL 3EHBC 4M4RA 1D5MA 1K4CB 1IL1B 1VPOL 3DUUA 4G80A 4L8CA 3QDME 1VA9A 5IB4A 3WNKA 5DUPH 5DYOB 3VFNA 4M5ZH 1OAKH 2EDXA 3OGCA 4Z0XA 3I2CH 2JK5B 4AEHL 1NGWA 3WUWB 2NXZD 4OUUA 1NGWB 4LGSB 3VFVA 2HLFC 1CS6A 2D03H 4LLYB 4WY7H 4NO0B 4NRXB 4QHKJ 4FABL 1NFIA 5FHAL 1PSKL 5JIPA 3QRFM 4HPOH 3KPQA 2RCSL 4MAYB 5IEKA 3TESA 3E8UH 1WTLA 4F9LA 3BH9A 3NCYP 4NT6B 4QY8B 4Y0GA 1EHXA 3CX5J 4FQIL 5F3HA 4LSQL 5JZ7D 5DD0H 2OXGA 4ZSOE 3TVMD 3ULVL 3BESR 2W0FB 1CGVA 4KZDL 5DJZA 3RWJB 4O2CB 4R4BA 2IPUG 1MI5A 1Y0LA 2A6IB 2JB5L 1BAFL 2A6IA 5E2JA 1A6TB 4PG9A 4JM2B 5I8OH 1KTLB 3BGMA 1MFCH 5HYSG 3ZHKA 3VFOB 4X6CE 5EBGA 4P2YA 2R1YB 3DHJA 3QPQD 4YHZL 4K3JL 1NPUA 3ARFA 1INDL 5GRZA 3EO0A 4X5WA 1LO4H 1FL6B 1NDMA 2QQNL 1PEWA 4N68A 3TT1L 1AHWC 1UM4H 3L6FB 4UT6L 1B6DA 2PR4H 5EU6E 3HKFA 2HFGL 4G9DB 3UJIH 1T4KB 5C8JA 3MXWL 3M07A 3G6JA 1G7MA 4H1LB 4QHMA 3QUZA 5TDPB 2ENYA 4LHUA 5FF6B 3C5ZA 4I4WA 1P7QB 2QHRL 1W0WB 4OBSA 3U6RA 1IARB 1ACYH 1LE9B 2F74A 2BZDA 3IGAB 5I1GL 4FQPA 5IBUB 1NCAH 1T2QH 4Y19E 4NGHL 1MFAL 4K3DH 1WZKA 5ALBH 3DUSA 2A9NH 3H3PH 4YIQA 4Y19B 2PYEB 5CINH 3BN9C 2NMSA 4P9HH 4ZAKD 4XPHH 1Q94A 3LQMA 3MRHA 1Q94B 3BKCH 1ZANL 2VISA 4PREB 5AD0A 3PWUB 1R5WA 1M71A 2WW8A 4PJBF 2XTJC 3I02A 1NBYB 1J0YA 4FQXD 3VXUD 4Z7UF 2XG4A 3VXSD 3DLQR 3QFDB 5J1AB 1D5IH 2RCSH 3QCVH 2GI7A 5J1AA 4PJFE 2G60L 1UZ6F 1GGCH 1I85A 3UC0L 4RAVB 3KWWA 4PJXF 1D6VH 1EFXD 5EOCL 5F44A 2XA8L 2RJMA 4XMLH 4NQCA 4GKNA 3R4DA 4KTDL 3WXWH 4JFXB 4JPKH 1UB5B 3I84A 5ICZB 2HRLA 3MBEA 3C60D 1UYWL 1KACB 2X4NA 5I17A 1HOCB 1JHTA 1ZHNB 5H2BB 2SEBA 4PP1D 2JELH 5I2IA 4ZNEA 3P0VH 3ULVE 1EO8L 5JW4M 3CUPA 1JL8A 2DWEB 2V2WB 3KPNA 1QFUL 3WIIH 2EEDA 2QSCL 2CRMA 3HE6C 2BNQB 1AFVH 1TQCB 3ILPB 1YQVH 3VU2A 1UCBH 1S3KL 4P2RA 5DT1L 1MCCA 4GAJL 3MNWB 3TBYA 1ZGLP 4EI5A 5FYJE 4QXUH 2Y5EA 5HGGS 1KEGH 3IVKB 3WUWA 3AB0B 5EO1A 4KHXH 4JQVA 4TN9A 2RQ8A 4WDIA 4HJGA 4UT9L 5D1XB 43CAB 5EDXA 5D9SB 1ZT1B 3MRPA 3FN0H 1C16A 3N85L 3TO4C 1SJVA 5I1EL 1C16B 5JHDD 1FFNB 4FQ1H 4NQXB 4TVPE 4Q6IA 3MCKA 1XGYL 1AXIB 1UJ3C 3UEZA 3BWAB 4PJIA 3UJIL 1TVBA 2DM4A 1IM3A 4YHKH 1NC4A 1CXKA 2KL6A 1WEJH 4NM4H 3QDGE 5I1CL 3T4AB 3PWPD 4BELD 5IVOA 5CSZB 2EC8A 3LN4B 1P69B 3EZ8A 4R97C 1HCFX 3DVGB 1KLUA 5DK2B 3ZDYE 1JPSL 3HC4H 2ARJA 5F1SA 1U95B 1UXSB 3TBWB 3O3DB 5D96C 3ZT5A 2BSED 1WBZB 3O3DA 3E3QC 3PV6A 3ALPA 4F58L 1KSRA 4P2QB 1OWWA 4NKIL 4GXVH 4Q7DA 2A77L 3QXDA 2W59A 1CL7H 4YC2C 1FFRA 4ZPTB 1YEDB 3KS0H 4AG4L 2DIAA 3SQBA 3ET9F 1UM5L 1XCQB 3QI9C 4Z5RB 1MJ8L 3LD8B 2FJHB 4GG6F 1A7NL 4G7VH 3NCYS 2WBJA 1H0DA 3H7BA 1WZMA 1EEZA 2J5LB 1E6OL 4KJYB 1PDKA 4YK4B 2CK0L 3DROB 3R8QA 2XPGA 1RJCA 3RTQA 1QFUH 3PHSA 1CICA 3ZL4L 3VWKC 2ORBH 4YEEA 1T03L 3SDYH 4BJLA 5GRJL 4HGKC 1F4WL 1S78C 4ISVA 4PRNB 2Z35B 2HT2D 3EJZC 4ZQKB 4X6CF 3QG6B 4G42B 5T3XL 1KXVC 3V0VA 1XGPA 1J0IA 5F9WC 3GBMH 3P40A 3FQTB 1KJ3H 5HD8C 4JG1L 1CICD 1QSFB 5DUML 1M7DB 4HC1H 5BO1L 1UEYA 3NAAH 1YJDL 1R5WB 1UZ8A 2BOBB 1OAZH 4QHUA 4RFEA 5GGTL 4QRQB 1SMAA 4ZFZB 5L9DL 5I1EH 3MLSL 2IH3B 4KDTC 4XRCB 4OZIF 3GSOB 4IDLA 1GGTA 4Y2DC 4MWFA 4QXUL 5I9QB 1CLOL 1VACA 1JNHB 5BRZA 3FL7A 2J8HA 3FQUA 4YHOL 1EFQA 2XWJA 3FO9A 2BY3A 3KHOA 2VC2L 3OKLB 4U0RB 1K2DB 4IBLT 2DJUA 4MAYD 1BFVH 5CJBA 3IGAA 2NY5L 4OLXL 1YNTA 1JPTH 1SVZA 3A0OA 3VXPA 4HDIA 1G9MH 4JO2L 3QRGH 3A67H 2C1PB 3QDGA 1N2RB 4FZEL 4EVNB 4NO2A 5ICYA 2DTSA 2MCPH 4C56A 1I9RL 3QPQC 4X6DF 4DN3H 3HC4L 3ARXA 3MRHB 4JFFD 2XN9E 1IAIL 1RUPL 3O81A 2R69H 3H2WA 5LGHH 2CUIA 4KVNL 2RFXA 2XTJB 1YEHH 4S10A 2W9DL 4NSKB 3QNYB 3N50A 5H35B 5EFIA 3VXUE 3CFEB 4G6ML 3VG9B 2R0WH 5HYSA 4KH2A 1MRFH 4W68A 2WIMA 5HHPB 5HYIA 1T1WA 1J0HA 3MREB 1BJMA 4JY4B 1RURH 1DDHB 2VDLL 4GKSB 1MHEB 4L8BA 4F7CA 5H37G 4OBRA 4OIAA 4P2OD 3UX9B 3MV9B 4G8GD 2XRAL 2NY6D 2SEBB 4HFWA 2DWDA 1OF2B 3VD7A 5ACZA 4X9GA 3BWAA 4PJIB 5TDNA 5F7LB 5JQHC 1NFDA 3KGRA 5IROA 3SE9L 5DEFA 5F7YC 1ZGLA 3QNZA 4RA0C 2X05A 4ZXBB 4U6TA 3F7QA 5EIIB 1KYOJ 3RWFB 3EYUL 2AW2A 4ZUSA 4HUVA 1FNSL 4V2BA 4KJWD 1TZGH 5EO1B 1QNZH 5HHNB 1OAZL 5MEPB 3DRQA 2HFGH 3DVFA 12E8H 4KKCD 1JVKA 1U8LA 3VXUB 5D70H 4J4PA 4OB5H 4L4VA 4J3XA 1UXWB 4YXLH 1XAUA 5LXGL 5D7IF 4FMFA 1S7UA 3U0PA 1NUDA 1OP5H 1EFXA 4NWTL 4GAYB 2QTEA 3QDMB 1UWEL 4OCYH 2E7LC 4NQVA 4HPYL 4GLRI 1IM9A 2FO4B 4H1LH 1RK1A 5FECB 3O6FA 4LPWA 2HH0L 3O2VH 4JM4H 1O5DT 5IHLB 2W9EH 3U83A 3T0EC 5F3BB 2ESVE 5GRVL 2G75B 4EI5D 3J7HA 5E8EB 3UJJL 4YO0B 1RJYA 4TTGA 4MQ7B 5C07D 2A6JA 3MRRB 1MCKA 2P5WE 4F7EA 4ONGH 5CKAA 1TLKA 4YBQD 3FB8B 2Z35A 2IWGA 2Z91B 1TVBB 4YDLC 3MRFB 5GGQH 4LCYA 1LK2A 1DQDL 3MRFA 1KJMA 1U8IB 3ECBB 3U36B 1KJMB 1U8IA 1V7MH 3DUUB 3ECBA 5E8NA 3UYOD 2B1HL 3VFNB 4R4ND 5DRXB 5KVMC 2BOCA 2YXFA 3WFDH 5A3IC 2ZG3A 3RI5K 1QYGL 2V9RA 4B7LA 2I5YL 5T1LA 4X7SH 4JANB 3LHPH 4U05A 1B6UA 1MJ7L 1CE1L 2NY0D 5L0QC 1N5YH 5GS0D 5GS1A 2VDQH 1QBBA 3HAEH 4WO4C 5JXED 3LS4L 3GGWA 5JORA 4KV5F 3QHTC 4Z7OF 1FNFA 1BZ9A 2OK0L 5SWSA 2ATPB 4C59B 3D18A 4MXWH 5CJXC 3VFMB 4XCFH 5TF1H 1YEKH 1BQHB 1AD0A 4OZFA 1LEKB 4Z78B 1QG3A 2JB5H 5J06A 3S36L 1U93B 3GMOB 1DBJH 4PJHA 5FYJU 3U0TA 3DETD 2XZQL 4OLUH 1U8KA 1LEIB 1IC4H 1NGZA 4E9LA 5I16A 5IHUL 3INUL 3IDMA 1U8OA 2VXQH 4NZTL 3MUZ1 2EDWA 1G9NC 4YEFA 2H45A 2RGSA 1JI2A 3UBXB 4KFZC 1X7QA 4HMCA 3QG7H 5IBTL 3NN8B 3VWKA 1KEML 3HMXL 4KHTL 4LHUD 2DM3A 4ZG1A 3MODH 1YNTB 4WUUD 2EIZA 2VIRB 1JWMA 4HZLB 1I7TA 4Z0XB 4U0RC 4U1SB 3WNNA 1N2RA 5TE7L 3ARQA 4U1SA 2Q86A 3IB4A 4H1LA 5DS8A 1UWEH 3HRZA 5KS9B 4MLSA 4F2MB 4B7IA 2PF6A 3RIAF 3MV8E 3AAZB 3REWA 4EJ1C 4HG4K 3MRIB 2NPLX 1FFPB 4P3CH 3QULA 3EDEA 2QBWA 2ZKHL 3BXNB 1AO7D 3MV8B 5BVJB 3ROLB 3OAZH 4LEOA 4HWZA 1MCSA 3FOLB 4IOFC 1KCKA 4YXHH 1R5IA 4YBQC 3HG1B 2VDPL 4IIQC 5D7LD 1MJUL 2YRLA 5ICYB 1CXIA 5T5NF 3TLRA 1HXYA 2ZSWA 1WZLA 5IVZB 5C0IA 2AQ2A 1BLNB 4M6NL 1MQ8A 5CS7A 4WW2A 5DEZA 1N5YL 2Z92B 2O5YL 4NYLB 5D5MA 4LCIL 1ZHBA 3KPLA 3DHMA 1T04B 4NYLA 5IMLB 2CDFB 3WFDL 3IAGC 4WHTA 1HQ4A 3LD8C 4MD0A 3S4SG 1LO0H 4L5FL 1F4WH 3O6LL 2IAMA 1BBJA 1YNKL 3RY4A 3JTSA 5DMKB 2BNRB 3UTZA 3LMJH 3WJJC 1PFCA 3QCUH 3WLWC 2YWZA 4Y2DB 2HTLD 5IIEB 1P5VA 5LQBL 1GOFA 3AROA 2AS5M 4UILH 4ENED 2BVEA 4ODVL 4P4KB 4F9PA 2DQFB 3FN3A 5HVHC 4U1NB 3WS3B 3VFRA 2DQFA 3TJEL 3AMLA 1E4WL 5DMGD 4OZHA 2DWDB 4XCFL 3RKDD 2NY7H 4OZHB 3UYPA 1B2WL 3OXSB 4HUWB 3RVXD 2UWEA 2CQVA 4FZ8H 3N1QC 5FYKE 1CLOH 2NY1B 3PWVB 4JRYB 4AENA 3WFHB 5D1QA 2W65B 3BN9D 2F54E 4QO1A 3TNMB 3BRFA 1FG9C 4YHYC 1B0RA 4A2LA 1FC1A 4K7PY 1K8IA 1F3DH 1G6RB 4LDEB 4OV5A 2B39A 1EGJH 5I19L 1INEH 4HWEL 4RDQF 3TCXA 2EH8H 5D9SA 2VR4A 4AJ0A 3RIFK 3SO5A 1AY1H 1I9IH 4FXKB 3QEUB 1HCVA 3FB6A 4FXKA 4X99B 5JOPD 4Y5YB 5TJWK 3FQWA 4GG6B 1EFXB 3CZFA 4X80L 3VMNA 4MVBD 1W0YT 1U8JB 4DKAA 5BZDB 1GGYA 2OR9L 1K4DA 5DC9B 3WD5H 5BV7C 2B20A 4K7PX 8CGTA 4XNYH 2XKSA 3HB3C 4UIKH 4RWYL 3MSPA 1QSEA 1I1AC 4XBGB 2M2DA 2G60H 2FRGP 4N8CL 5I2IB 2E27H 3OKMA 4M5ZL 4YE4H 3BT2H 3FT2B 4LFHD 2DIBA 4U3CA 2H9GA 3UBXA 3GO1H 1RUKH 5FYJD 5C0CA 4GXVL 3QWOA 1S9YB 1QUNA 2EC9U 3UDWC 1G9EA 3VFPA 1CL7L 5C07A 5JIKA 4ODTL 1T1YA 3IDYC 2NQCA 4EN3C 1DQJB 2ZG1A 4P57B 1MOEA 2CDGB 2HRPL 4DQOL 4MXVE 1XIWC 1EGJA 2IBBA 1FZOA 1XR8B 3MOBL 5EU7E 1PY4A 1TITA 5E99H 3TO4B 1CIUA 4JB9H 4G7VL 1RJLA 4P5MA 1A9EA 1CTOA 4P9HC 5D1XC 4XAWH 3DUHA 3TNNB 1ZLSL 3QPXH 3R1GH 2DTML 2VLKA 4PJHB 2JJVA 1PAMA 4P46A 3OKEB 2X89D 4UQ2A 4TRPL 5DQ9B 5C9JB 1H3XA 1U3HA 2AJVH 3CJJA 5TQ2H 2VR9A 1LO3H 4DW2H 5DGRA 4M7KH 3IETB 2CKBH 3DX8A 4XP5L 1FFOA 2DLHA 4HKBA 3HMWL 5A2JH 1FIGL 4JCLA 4U6YB 3STZA 5AWNH 2XA8H 3SGKA 3HZMB 5BQ7B 3FN0L 2OL3A 5C0FB 2ITDB 2R1XB 1A6WH 4JFEB 1Q0YH 25C8L 5B4MD 4CBPA 3MLTB 2VSCA 1IQWL 3MTRA 1J8HA 4M6AA 2YUVA 3RL2A 4FG6C 1DLFL 2A6KA 4JHAL 4APQA 1NH6A 2YPVH 2GUOB 5KS9A 5E2VL 3GSUB 3M8OL 1U58A 3LKSA 3MXVH 2CO6B 1XF5A 2QSCH 5C0AB 5CP3A 3HI5L 2ZUYA 4IEFB 4LAQH 4YX2L 1XMWA 1TCRB 5HDQL 2JIXD 4LP5A 3VFSB 5IMKB 1WCQA 3QHFH 3ZKSD 1FL6A 3VFSA 1A64A 1KF9B 1IL1A 1AD9B 3AS1A 1MRDH 4QCIB 4POYA 4KHXL 4Y16D 1KB9J 4ZTOH 2WBJB 3HNTH 4J4PD 4JM2F 4N0YH 3BPCB 1TJIH 3ZT6A 3DVNB 4NQDD 3SDCC 1E0OB 2CIKB 3RZCC 5FKPB 3IDNA 4EQ2A 2GSIB 4RFOL 1MCIA 4OD1H 4RMSA 3C09B 1JE6A 1OVZA 3VI4E 1F4AA 1A7NH 2EKSB 2YUXA 1RFDH 1J5OL 3MBXL 5JW4R 4L8DA 5F70A 1K8DA 4KKAC 2JJTC 3S88L 1CD9B 2AJ3B 1K8DB 4N8CH 4WO4B 5I1JH 4PJGE 1XGPB 4KI5E 4X4YA 4NWUH 3MX0A 4NJ9L 1CBVH 3MNVB 2XN9B 4J6RH 3Q5TA 4M7LL 4JFDA 2NY2D 2AJSH 5BZWB 2KDGA 3BP4B 1LD9B 3NPZB 4XX1G 2Y7QA 5BRZD 5I8KH 5FEBA 5EIVA 5AAMA 2GTWB 4H20H 1P4BH 3EUUA 5TDNB 2BRQA 3VDCA 5HGAA 4RIRB 1FN4A 4MLIA 2DQJH 4Z76B 4L1HA 1N8ZB 3MOAL 3TEUA 3NCMA 5C08E 4JQIL 1DQQB 3CGTA 4LGPB 4W6XB 1FCGA 5D7JD 5IK3B 3VA2C 3ZTNL 1LGVA 2JJUA 3MFFB 1VEMA 3HUJB 3HA0A 3G9VA 2HFTA 4DUVA 4HMDA 2QQKL 2CKBL 3HUJE 2BSSA 5EC2B 1HQRB 3ZKNC 2E7LA 3X11A 1CG9B 3Q1SL 5DK0B 4OLXH 4HK0B 3SPVB 3RGVC 4RISH 3L7FB 5H35A 4PRIB 1T0PB 3O0RL 3MLVH 1D9KA 5F1IB 1HXMA 5CJOL 1YN7A 3B5HA 1PKQA 3CXHJ 2B1AL 1CFTA 2BHYA 3HC0B 5I66A 3ROOB 3DBXB 5IG7B 4P3WA 4FQ1L 4PJDE 3T04D 4MNGA 1LE5B 4PBWD 4KTYA 4QTIH 1WFUA 1T0NB 4AQOA 4LASH 1QPPA 4JY6A 2ED7A 1LO2L 1RZGA 1U0QA 3C2AL 4PRDA 2H32A 2MQ3A 4PP2B 1U8PA 5TGBA 3FO0H 3LKPB 1VENA 3CVIL 1EV2E 5E9DB 1C1EL 2DMCA 4CU7A 1RURL 4LP4A 3FQWB 1ODAA 1CT8A 2M8XA 1LNUA 2WLYA 4DTGL 5E0QA 5D1ZD 1ZGLB 1MNUH 1UVQA 3DECA 3ZE1E 3W11D 1JK8B 3E6HA 4UQ3A 2YUWA 3CFCL 3UROR 4X6FA 3CLFH 4E5XA 3GIVB 2YN3A 3HI1A 4NJ9H 4PGDA 1NAMH 3F7VA 3ALXA 3BWUC 5KSAA 4CU6A 1U95A 2L0DA 1OWRM 3KYMB 1MLCA 1FAIL 1FVDA 1WBYA 4XB7A 1NEZB 3PGCB 1NL0H 2Z31D 3REVB 3EYVA 4L8SC 4D9QD 3UJTL 4K3HA 3BAEH 4KJQC 1FRGH 1HI6A 4WI9A 1J9CT 2IG2L 5ESQB 2VAAA 2OYPA 4EI6A 5KS9F 4KK9C 4OKVA 5IF0A 1S7TB 3TN0C 4X5LA 1KCSH 5IV2B 4MZ2A 4OGXH 4U1HB 1KOAA 5FYKU 4BH7B 3P73A 4KK9D 5KVFH 3GMRA 4J8RB 3ARZA 3OR7A 5DI8B 3PNWA 5GJSH 4TSCL 4WV1B 3CFJA 5MEOB 2OLDA 4GRLB 4BQ6A 4F57H 4LLUB 5E9DE 2AERT 3CFDB 3ZT7A 5FCUH 3VDAA 3GBML 1AJ7H 3BGMB 3V8CA 3MRMB 2R0ZL 1MHHA 2ADIB 1FZMB 2KKQA 1SYVA 3D39B 4HKZB 2PR4L 5HHMB 2DQIH 4DAGL 4ZUVB 1F45A 3ZKXC 4WI5A 4UZGA 5ANMB 4EDXB 3PABA 5INCB 4EXPX 1N64H 5HHME 4TOYH 2VIRA 2GEEA 4KAQH 5EZJB 1K6QH 2CGRH 1BGXL 4V1DD 3EO9L 1SEBB 1F2QA 4KVCH 2BOBA 1SEBA 1OLZA 3RL2B 3K4AA 3SGEH 3VD4A 2FD6H 3HE6A 3QRGL 1EXUA 4PJBA 4GMSL 2Y36H 4LRNH 4I4WB 4NJAL 3U2SA 1KUMA 2NTSP 3B2UC 3X3FH 1HSAB 5T5FH 5KANI 4HXBH 1I3RA 1VEPA 4K71C 5F1KC 4Q9RH 1RK0A 1VFBA 1BQHA 4L4TD 3C5SA 2R2CA 4C56B 3HZVA 5FM5O 1AKJD 1U8QB 5K59F 5F8QC 4OZHE 5E00B 4WFEE 1BBDL 5D6DC 1A3LL 3RA7L 5HY9B 4LPUA 3A6CH 3JV0A 3DROA 4PRIA 4LPCA 3OKDA 1DBBL 4I77H 3SJVD 2V17H 5ENWA 5LKNA 5AZ2H 3K7UA 1G84A 5HHOD 2VUYA 4PJAF 3WEXA 2QQLH 3DBXA 1J1XH 2X9WA 5I74C 1I1AB 2AJ3A 3KPMB 3QJFA 1KNOB 2EXYC 1X5LA 4JQXC 4KY1L 5DUMH 2XACC 1TJGL 3EYOA 3P2TA 4UV7L 2XWBA 1JGDB 3IDGA 5BV7B 3QXAA 4HD9A 3VFRB 3VE0A 5LG1A 1T5XA 2GT9B 4ZD3L 4IOFD 3CNKA 2VLRD 1AO7B 1FL3A 5IHZA 2IQAB 5I15L 5HD8D 3MRKB 4GQ9H 1DVFB 4WW1B 1MFEL 1CTNA 2XTLA 1VB9A 4A6YH 3U4BL 4RAVA 3OTTA 1GZPB 4J23A 4KTEL 4H88L 1B4JL 4E5XB 1GZPA 3MLXH 3BW9B 3GSXB 1R5IB 3WIHA 1C5CL 2DLGA 4N9GA 1YEKL 4G8GB 4C54A 3TVMB 4V1DE 4PRAA 1FBIH 1G6RA 3EO9H 1FORL 3VWKD 2W38A 1EEYA 3C08H 4AMKH 4HJGB 4NCC1 5T33H 2Q6WA 35C8L 3HC3L 2VDNH 5IQ9A 5DK0A 1T1ZB 5GZOC 4QOKA 4JM2D 2F5BH 4Q6YA 1IEHA 2AXFA 4M3JA 3LKPA 1WVZA 5HHQB 1OT1A 1PG7W 5JA8B 3O2DH 2FYYA 3FAXA 5ISZD 2D0GA 4EI6B 2GJZA 3V6FA 3W0WE 1UZ6E 4ETYA 2ZWLT 4ZFOB 3MO1A 4YHLH 2BHUA 4OLWL 3OPZH 1JPSH 4FFVD 4IJ3C 3T4AA 4BQCA 1YMME 2ICEB 4B50A 3T65A 1LE5A 1A7PH 4FFYL 5K9QI 4LPXA 5I75C 4CU8A 1F97A 1A1NA 3HPLB 4MQSB 4X6EA 4NWUL 4Z9KB 5HVFB 2Q8BH 1UACH 3KDMB 4U1NA 1KTRL 1H8NA 2Y6SD 3S35L 3L3KA 3VJ6A 3EFDH 4MA8L 4UDUB 4URTB 2F5AH 3MRMA 4KPHL 3EGSA 4NC0B 4HG4J 4NZDA 4PY7B 3P4NB 1FCCA 4QHLB 3W0WA 1A02N 4JREB 4R90H 3WFCL 3QJHB 5L2KB 2YPLA 1N6QH 3CC5B 1IKNA 2VDQL 4R0LA 4JFEE 5LGJB 1EHNA 4I5BB 4AQ1B 4U1HA 5DJDA 1QNZL 5DYOA 1P6AB 3MNZA 3GMRB 3ARBB 3QA3A 5F9OH 4GAJH 1R3LB 4PD4K 4QRRA 2P8PA 2OQJA 3SKUD 4PJ7E 4Q0XH 1NCBL 5F6HI 4GJTB 5IVXE 5EPMA 3QZWG 4S1RH 3DV4B 4XPAL 4A6YL 2VLJD 4Y7MA 2D31B 4XNQB 3BH9B 5E24E 1BD2B 1A7QH 3D1MC 1G7HA 4ZQKA 5IEKB 3BO8B 5HDBF 1G7PA 3PP3K 4HIHA 4KZEH 1IC5H 1LO4L 2HVKA 2COQA 1IEAB 1M7XA 1INQB 3HZVB 4LHQB 1IGYA 1S9VA 3F6IA 1AIFA 3WXVL 2FBOJ 2FWOB 4KDTA 4LHUG 3UCRA 5E00A 2DYPA 4QTIL 3VXNB 4LLUA 1U8NA 4FA8A 4PB9H 1SMOA 2ATKB 3LEVH 4P5TA 1WJ3A 3RZCB 5GIRA 1YEGL 2IF7A 2OR9H 5DD0L 1U8OB 5FV1L 4Q6IC 3GKWL 3O45A 3O11B 2ADIA 6FABL 3KS0J 4BZ2L 1QHOA 2D7OA 2IMNA 3L3OB 5JDSB 3QZWA 4IRSD 3QDJE 3CD4A 3L3JB 4DVBA 5FUCE 3FCTB 3M45A 3MRLA 1IGCL 1TZIA 4L8CB 5F9AC 3L95A 5DEGB 2AEQH 3PWPA 1YC8A 4AM0B 1MCEA 3S3SA 2EC9T 3TZVD 5IR1B 4M5YL 1INEL 3T0AA 1NC4D 4OUOA 3V4UL 2D3VA 4I18A 4K2UL 3TH3T 5EN2B 2X2YA 4WTZA 2VABA 3CCHB 4OZGB 4LLDA 2DD8H 3CU7A 4NNPL 3O41A 1LE9A 1KT2B 1CICB 2CLRB 1EJOL 1U3YA 4WHYG 4MCZA 4N0UE 4XI5C 1I4FA 1NJ9B 4OFIA 1R3JA 2EDOA 5F96H 2DQDL 4HKXA 3KPOA 4BSJA 4XWOC 5KSAD 3LOWA 2R4SL 4R4FL 1HSBB 4G6AC 4Y4FD 1CFNA 3NIDE 1CBVL 3SCMD 1QSFA 1U8QA 1AGFA 2EEAA 1HHKB 2ZCHH 4NHCH 2P5EB 1KTLA 3QCUL 1MHPH 5C2BH 3RKDC 5B39G 1MH5A 3BP6B 2P8MA 3BRDA 1NLBH 1FVEB 5D1ZC 3TP4A 1KB5L 3C6SB 3HNSH 2ZOLA 3MLSH 1FVEA 2FECL 3BUYB 4JREC 4JRWA 2ZNWA 4JPVH 4S1DD 3LDBB 3UTTA 1NCNA 3TH2T 1I1YA 5FYJL 1OTUD 3X12A 1NC2D 3JWDL 1BFOB 2ZUVA 4P46D 5TE4L 2BDNH 3QI9B 5DUBB 4RCAA 2VKWA 5HI4D 3QI9A 1XFPA 1P2CB 4FRWA 2DN7A 3FRPA 2ADFL 4GAFB 4JFQB 1RI8A 2DQHH 3IDNB 3ZE1F 3VXUA 1WISA 2HKFL 1UXWA 1NAKL 1NFDF 4OCSH 2Y36L 4GKOA 3S5LB 1XR9A 4E41A 4RFNB 3U4AA 3BE1H 2VH5L 3G5YB 3HNTL 3Q3GA 2JELL 3IKKA 3OZ9H 4JFYB 4L8DB 4HBQA 5DFWH 5CCKH 1EO8H 4HUVB 2OJEB 3DX6A 3BPOB 5C3LD 2XN9D 5D6CB 3GJFA 3QUXA 1S7XB 4KI5C 4Q9RL 1A6WL 3QNXB 3QFJA 2A1WL 4R8WL 4MQXD 5E8OA 4WWKB 2VDLH 1EPFA 1M71B 5EBWA 1KBGH 5D1QC 5D7JC 3UC0H 3ULUF 4YGVA 1WAAE 1H3GA 2YD6A 4YHIB 4WU7A 5IB3B 1G6VK 3D25A 1MREL 1UJ3B 1ZAGA 4J1UB 4F7EB 5IEHA 4X9BA 4XGZB 5IW1B 5DXWA 1FYTB 3MXVL 1EHLL 3VRJA 3BKYL 4GO6B 2DL9A 4FP8L 3JWOH 4LCUA 5D93B 3VCLB 4RQQA 3QH3B 3ZDXE 5KANG 3BEWA 1ONQB 3SKNB 4YHYB 5FK9B 4OTXL 5CJXA 5EB9A 2PYED 3NFNA 4DZBA 5DRWB 2IGFH 4QRPE 4ZUTA 3MGTA 5CUSL 1XCTA 4JFHD 1EEQA 4HIIA 5C0BE 5GGVL 1CXFA 2EDDA 2RB8A 5GS1C 3TA3D 5HHNA 2VXSL 3TN0A 4QRRB 1LQSR 4P59L 1UXSA 1S5HA 1QQDA 2XTJE 3K4DA 3H8NA 4PJ7F 4BA8A 3WNPA 2BNQA 2I9TA 4YFLF 4G9FB 5FO8B 2QSVA 4NZRH 4XXCA 5SWQA 1A1OB 1NANI 5J9PB 4ZTPL 2ARJQ 3JZ7A 1F4YH 5LGJA 3BOVA 3MA9L 4HCRA 3VXMA 1CD0A 4L3AA 4CVXA 3V5HB 1PD6A 4L3EE 5IGXH 5JR1H 2A77H 4WV1A 5FYLE 4R0LC 1AHWA 2X1XR 3UO1H 2IFGA 4HZAA 5JHDA 3IFLL 4JO3H 3P0GB 1J0ZA 1JWUB 1OARH 32C2B 4UIMB 3SE9H 3VA6A 1FV1B 5I1DA 1RZFH 4X80H 5HPOA 4OCRL 5EBLA 1E6JH 2ED9A 3S96B 5I8EB 1WIPA 4N9OB 3SO3B 3RU8L 4JDVB 3OSKA 5AAWA 3UTSB 3LSOB 5L88L 1U8JA 4C4KO 1VPOH 2FGZA 1RQ5A 1KCUL 2OP4H 3L3IB 1M7DA 2XKNA 3MGAA 3QUYC 1KLUB 5DK2A 1TCMA 3WNLA 4PJ7A 4KRPB 3BP5B 4ZFZA 1AGCA 3UYRL 1JNJA 2B0SH 5GIRB 3MRCA 4JFZH 4NWTH 3VFOA 5T3ZD 5E08L 5FB8B 3SDCD 4G9FE 5BOZG 2W9DH 3T0ED 5F1NB 4LBEA 2OMBA 4XBEL 5JDSA 1HI6B 4J4PC 3OKLA 5D8JH 5C0RH 1E6OH 1URLA 5E99L 4D0CB 2N1KA 4HZLA 5E03A 5B21A 3KNBA 4HS3B 1FAIH 4CDHA 1P7KB 1UA6L 5K9QG 3P73B 5CGYC 4MHHI 5ECJE 1PGRB 1A6ZA 4LMQI 4ZS6D 1ND0B 3KR3L 4NZJA 4MXWL 2Q8AL 3UJTH 4Y1AE 2W0KA 3L5WA 3MRNB 1WWCA 4OTXH 4NKOB 3BPLC 1FH5H 1T5WB 3D2UB 5GGQL 2VZUA 4MHHG 4DGVH 4YHZH 3O6KH 2CJUH 2Q76A 4XVUC 4YDIL 1NGXB 1F6LL 4GXUN 4QXTA 2ZOLB 1QOKA 4ZUVA 1DDHA 1CLYH 1UC6A 4NT6A 4ODVH 4QY8A 3D85A 4RNRB 3O9WC 1BZ7A 4AT6B 1T1WB 1YEEL 5J57B 2AGJH 3SCMC 3FQTA 1A7BA 4KHTH 3SKJL 2BRRH 5DJZB 3RWJA 3HR6A 4O58H 4BFIA 4F7MB 3QXAB 1Y0LB 4BK4A 5K9KA 4DK3A 4M00A 2BJML 3ARGB 4PGEA 3L5IA 3MV7B 3MUHL 5BZWA 5M7QA 1PLGL 5FDYA 3W9EB 1E6JL 1FLRH 5F7FA 3FRUB 3LEVL 3MC0A 5D70L 1F4HA 2IPUK 3T3PE 4KJPD 1ZT4B 4ZUUA 2ZUTA 1H3PL 4DN4H 4XZUA 1K3IA 1RZIB 3LEYH 2V5RA 5D1QB 3OJMB 5EO9B 3V0AC 4DJMA 2LAGB 3G5YA 1TTFA 4N9GB 3TBSB 3BP7B 2FR4A 3TZVC 4HHAA 1NCWH 4KC3B 4OV5B 3OQ3B 3ZYJA 2G2RA 4TUJB 4AIOA 4FQHB 2VDPH 3F62A 5ESAB 3VD3A 2WQ8A 4HXBL 3MA7A 5ELIA 3IFNH 2EE6A 1R3KB 5C09D 1TQBB 5KVDL 5EFIB 3WD5L 1HNGA 2GITA 3BKML 2JJTA 4JPWH 3FFDA 5IW1A 3K8MA 2ZG2A 5DSCB 2BP3A 1HXMB 2VQTA 4OV6F 4RMRA 5KSVA 3CVIH 4DGIL 1P1ZB 4PJDF 4QEGA 5D2LF 4KAQL 1EAPB 5IJKA 4R2GC 3S34H 3ZDXF 3LMJL 5D1XA 43CAA 3P4MB 1X5YA 4L4TA 4LQ1A 5C0BD 3BZEA 3TPKA 2QQLL 3OJ2C 3PV7A 1ZT7B 5DLML 3P3YA 1SBBA 4E41D 1EZVY 2CLVA 2GTWA 4U33A 1BIIB 3AS3A 5BCAA 3OXSA 2IQ9H 4LCYB 5CIPA 5SV4A 2NCMA 3QJHA 4LSRL 2VMFA 3BD4A 4OZFG 4HWBL 3BVNB 3NPSC 2ORBL 4AENB 4DKFL 2VN7A 1OTTC 3R1GL 3JUYA 4IDJL 5IVXF 3SKJH 5D7LB 4MJ5B 2D7NA 4PGCA 4YHPA 2VQUA 4PRBB 3V52H 2HKHL 4F9PC 2CDEB 2J8UF 4EIGB 2YD3A 5I1AA 1FGNH 5C6WH 1LO3L 3BJ91 4JHBA 3VFTA 1Q72L 1WBYB 5ADOH 1X5FA 3MLUH 2AXJA 5L6YL 4TSCH 3RWIB 5DQDH 3LRSA 1Q9WA 5FYKH 4ZXBD 4Z7VB 2R29L 4AMKL 1C08B 5JPNB 4PJCB 3GJEB 1G6RH 2P46B 4ZOEA 4O4YH 2ZPKL 3MODL 1NLDH 4PJCE 4NIKB 1I7UA 3LV3B 3RBGA 1U9KA 2XQBH 3PNWB 3TWCH 4YAQA 1NGZB 5I16B 1BX2A 3TA3B 4U6VL 3P30L 1E4XH 2XQYK 1RIVL 4X6DA 3GSQA 1F3DJ 1DCLA 3MRCB 3PDGA 5GXBB 1W72H 6FABH 3MCKB 5C9KA 3N1FC 4OLVL 5ADPH 1LNUB 5E2UL 1PZ5B 2EYSB 1YYML 4HS8L 4ODUB 5IMKA 5E94A 4N0YL 1CF8H 4X4XB 3NFPB 4JFEA 4WI6A 1Z6JT 4X9HA 5EBMA 2LVEA 2YA0A 4OZIA 4M8VA 1BQHG 3DVGA 4GRWF 1P4LB 5E95B 3F7VB 2F53E 1HYRC 3E1F1 1HHIA 3ESVF 3BPCA 4F2MA 1KLFA 3OX8A 4JB9L 4FQQB 3H42H 1VFUA 5JMOC 1J5OH 2ZSVB 1XF2A 4NNPH 1NBVL 4K23H 5JMRA 2OM5A 2EE2A 3JV6A 4HCRL 4QF1A 3T8XA 4QGTA 5JORB 5F71A 5AG9A 4PJBE 1I8LA 1N59A 1KFAH 1QLFB 5E7BA 1FZKB 2FO1A 3PWJA 4TVPL 5DK3A 1J10A 1EMTH 4WFFD 2VXVL 1JI1A 3CPLB 2ZOKB 3ARBC 2FZ3B 3IAQA 4P5KB 4ELMA 4ZTPH 4NP4H 1DR9A 3LN9A 3RZCD 5HYEA 1MAMH 5DDHA 3BDXA 2BX5A 3GO1L 5IVZA 4JN1H 4UAOB 5KJRL 2P45B 3DPBA 5C92A 2DQJL 1RHHA 3ARGA 4PGEB 3FB7B 5T1DH 1FPTL 4S1QH 1JN6A 1A0QH 3HNSL 4KI5D 5I76A 5DD1L 2NR6D 5FYKL 43C9B 5F21B 2ZUQB 2AEIT 4OCWL 1D3CA 1FG2A 3U30C 2FL5B 4PJXA 4QRPA 4GKSA 1ZLSH 1BGXH 3GKZA 5ADOL 4M3KB 3EYOB 3FFCB 1CE6B 3H3KA 1JNLH 2XN9A 4JR9H 3TWCL 2X4NB 1FE8H 1I1FB 1UZ8B 2ADJB 4EUPG 2NYYD 2P5EE 2D4DA 4M7KL 3UTQA 2AXGB 1ULVA 5TDPA 4XP5H 4JQXA 1L0QA 3VFWA 4G43A 4ZFGH 1R3KA 2R0WL 4YH6A 1W0WA 4ACPA 4QRUA 2PCPA 2UWEE 1FVCA 3LEXA 4G6AD 4Y4FC 1RIHH 4MMZC 3RX7A 2OTWA 3AS2A 4RRPA 2XY2A 4EDWL 4MNHB 1VCAA 2EIEA 5IG7A 3VXME 3T0EE 4M4PA 3O4OC 5EUKB 1RFDL 1OAKL 1JZ4A 3VXRE 3PGDA 3PWNB 5GISH 5GJTL 3WO3B 4FZ8L 2Q7YB 5BS0A 1EHAA 4OM1L 5IVXA 4MNQD 2Z93A 3NCFB 1EIBA 3QQ3A 4Y88A 4F58H 1SJHA 4JRXE 1RAMA 5F9JA 1FFNA 3KLDA 4H25A 1MHCB 1DVFC 4A6YB 2Y25A 2CH8A 5DJCB 5E4EC 1MRDL 3QDMA 4XAKE 3VFUA 3GJEA 2M1KA 5I8OL 3IDIA 4PJ8B 3UAJD 2MHAB 3SOBL 3X14B 4UNVA 3H9SA 4J2XA 1OW0A 2X4PA 5DGQA 2IPTH 2NY0B 3H9SB 1WEJL 4OCXL 1A4KA 1I9JL 4R90L 1YEEH 4L8BB 2IBGA 5I18H 1MELA 4RDQG 1AXSB 4KGLA 2ICES 3WS3A 3D3VE 1C5DB 1T83A 4OJFL 2DDQL 3HLAB 5F7DB 4JDZB 3EGSB 4BK5A 1PBYA 2BY0A 7FABL 2E6QA 5IFJB 5B8CB 1AGEB 5LXGH 4LVOC 1LDPL 3DV6A 5FO8A 1JK8A 4ZOBA 4ZPTA 1A6UH 2ICCA 3LIZH 4J3UA 4Q0XL 5FHBL 1UWXK 3PQYE 4PLJC 1D5MB 2CMRH 5GRVK 4Z5RA 1D5ZB 3HMWH 3LKQA 3BZFA 4I5BA 3V2AR 1FO0A 4BH7A 1WIUA 3BSZL 3BDYL 1RJLB 4Q9QL 2YSSA 1NAKH 4OCSL 3BX7C 1PQZA 4WDIB 1FNEA 4PYHA 3KYMA 4F8QA 4KJYA 1RZGB 1CFVL 5FO7B 4G6KL 2AAVA 4YHOH 3TO2A 3GMLB 4AL8H 2DICA 2QHRH 5CJ8A 3ZMRA 4RGNE 3QUYA 1QBMH 3DX8B 5DRNA 4Z7NF 4JRYD 3LSOA 3HS0B 2YD5A 2YPKA 4HC1A 4G42A 3AM8A 1YPZA 2EYSA 4MA3B 1UVQB 2QQKH 3PABB 5INCA 4LVNB 5F97E 3F58L 3DWTA 5HYQB 3EHBD 3UXFA 2DI8A 4IRJB 1UACL 1B0GA 3LV3A 4HIXH 4HFUL 4Q2ZB 3U7YH 1U93A 3V7AE 2MMXA 3G6JF 4X6DE 5E2WH 4WFGD 4XC3H 1Q0XH 4BZYA 1Z3GL 4M48L 4X6DB 3PGFH 3KPRE 3HAEB 3LB6D 1FZMA 1UH3A 3DGGB 3O11A 3G5ZB 4O9HL 1QFHA 2OK0H 4CJ0A 2J12B 1GGBL 1NFKA 1K4CA 3KXFA 2XZZA 4KRMB 1QR4A 4PRPE 3QDAA 4G8GE 4M93B 5IF0B 3FFCA 3CPLA 2HWZL 2OI9C 1I3VA 1E28A 1KB5A 3BD5A 2OZ4A 3ESUF 3KR3H 2ADJA 2HYMA 3LCYA 5HHMD 4NUJB 4MQTB 5C09A 5DS8B 5HSFA 5KVEL 4PJ9B 5DVOA 2F58H 5B22A 2Y5TB 3T4YB 3FZUD 1RZ8B 1GC1L 2Y5TA 4UI2A 4FABH 1QKZL 3OAZK 3QG7L 2DQEH 2UUDK 1MHPL 2LQRA 2RR3A 3EYFA 5KSUB 3BHBA 2DDQH 3VGFA 3RNQA 3TO4D 2A73B 3KG5A 5DMYA 3IFPA 1CFNB 5EU6B 1JF5A 4JPVL 1S78D 2BCKB 4WW2B 3THML 5TF1L 2A0LC 1RZKH 2VXTL 5CJQH 3DYPA 4NQSA 2P1YA 2P49B 1RZKC 1U58B 3LKSB 4I0KA 1CDUA 3ARFB 4D3CH 4O2FB 5L2JA 1MI5D 4NZRL 1K2DA 4U6XA 3IDIB 3FONB 3O2VL 3IDJB 2ZJSH 4D8PA 4NJAH 5BXFA 2VLJB 3QUMB 4HDIB 1KN4H 3CZJA 5KZCB 4YPJA 3WE6B 1NUNB 2VNCA 2VLJE 3PWPB 2BVPA 1PY9A 4LLMA 5IGXL 4WNQB 1JZ3A 3BPNB 1XGRA 2YEZA 4XBPA 4FOMA 3BE1L 4XBPB 2ZP0T 4GRLD 5ESAA 3DVNA 3AU1A 3UPRA 5IVXB 4LPTA 4QGYA 4MJIE 2YZ1A 4ONHA 5MENE 1EJOH 2EDNA 5DUPL 2AXFB 3MV11 2E7CA 1QP1A 2F74B 2NW3A 3U4EB 4QHKI 4WUUB 3L3DA 2UWEF 3EOTH 5ABDE 4L1DA 3GHEH 5LGKA 2R23B 3QIBB 4MA1C 4OQTA 4MB5A 3HI6L 1AGBB 3IU4L 1ORQB 1OAXH 2A38A 4TVPH 1QYGH 5JXEC 5EUKA 5K9OA 1VFAB 5LQBH 4YBLB 2E9IA 1PQZB 3M1BB 5EZOH 1JF6A 4XNXH 1NBYA 4I0PA 4I0PC 1AH1A 1JGEB 1KG0B 3DI3B 4FQ2L 1L7IL 4JDZA 1IZKA 1QKZH 1FAKT 1ZEAL 3QFDA 4ZO8A 1SQ2N 3DV6B 1F6AB 3RKPA 1FRGL 3FQRB 3VGAC 1XH3B 4GRMA 2AJVL 1FLTX 1NQBA 3FHQA 2C4XA 2FJGB 5DRWA 2AABL 4S11A 2HJKB 3S7GA 4E0RB 1XCTB 1NCUA 1C7TA 2C4FU 5FGCE 1QSEB 3CFBB 5J12B 2OS7A 1HOCA 5KSAB 4M03A 3CDGB 2FATH 3N9GH 1WBZA 3A67L 2VKXA 4NPYB 4R2GD 4XX1E 3REVA 3PGCA 3QHZL 5T33L 4PJFB 1YYLL 3WFEL 4HEPG 2GJ6A 3IFLH 3GFUA 4JO3L 2BXZA 1H5BB 4UUJB 3CDFA 1R0AH 3MJGX 5E2VH 1JV5B 1IT9H 1G6RL 1D5XB 1D5ZA 4AK1A 1I3GH 2B2XL 3DMMA 4V1DA 1XCQA 2GAZA 2OJEA 5DD5H 4POZD 2R2EA 3WMSA 5GSVB 1GAFL 3QHFL 4XNYL 4KKCC 5GSVA 1BX2B 1MFEH 5GGUB 4BZ2H 2O5XL 5A2IH 5HTSA 1CR9L 4KK6C 1R24A 4P23A 4L4VE 4F7PA 3C5JB 3S96A 3F6LA 4X7TB 4ISVB 5F72S 4NQDE 2YPLE 2F8VA 5SWZE 5J3HD 1U8HB 3G5VB 3AS0A 3STZB 4D9LH 5SWZB 2R2BA 5CUSH 1QR1B 2VDNL 5EBMB 2HN7B 2YRZA 1B9ZA 5JW4Q 1X9QA 1N0XL 3HZKB 3S88H 3WUWG 4EBQH 2V7NB 1R3LA 1RZJL 5JQ6L 2QL1A 1KJ2L 4ZUWA 5EORH 2VUOA 3WHE0 4LRIC 3FMGL 3RWDB 4D0BB 5KVDH 3QFJD 4R3SA 1UQSA 5D72H 1HN1A 1NCBH 5IB2A 3FT3A 4JFOB 5FGSA 1NCCH 1MFDL 5TPWH 2NLJA 12E8L 5IB2B 2I25N 5GSRB 5DMGC 1HILA 1IKNC 3NABL 3BT2L 3ULUC 1DP0A 1W0VB 2CDGA 4DFIA 1MCWM 4Y5VB 2VYRE 1A7QL 1G7LB 3WIHL 5F6IB 2J5LC 5DDHB 3IJYB 1J1OL 3RDTB 1A9EB 1YQVL 1MIML 1NBZB 5HGBA 1RU9L 1RUAH 2G5RA 3IS1X 5BV7L 3C8HA 5D1ZA 3KYOA 4LSDA 1ES0A 1V5JA 2CLRA 2CLZA 2P48B 1CZ8H 2O93L 4NRZA 1MQKL 2BSTB 3HZYB 4GXUM 5HYSB 4GQ9L 4K8RL 43C9A 4I3RL 2YBRB 1UH2A 4GMTL 2HTKC 4YC2B 4BFBD 3LVEA 4N0RA 4HT1H 3JWNC 5F3HB 3LZFL 4RSVA 4OF0A 5DJ8B 1L0YA 5E94B 4JPKL 1A3LH 4OZ4B 3HE7D 2Y6SC 4HWEH 3O6LH 4CN4A 2YKLL 3EO1A 4JHZA 4KK5D 5B38A 5BS0E 1KJ3L 2IANE 1OSPH 2P43B 4LPYA 1KYOK 3G6AA 3KLHD 4ERSH 4LL9A 4Y4HB 3UMTA 5ALCH 2QEJA 4R97B 2B2XH 4MDIA 1T1XB 5D7IB 3SCMA 3SDDC 5T3ZE 1KN2L 1FVCB 5FHAH 2DI7A 5L2JB 5BW7A 5IVNA 1QLFA 1GJIA 3GMMB 1UKSA 3R0NA 4LCWB 5IT2L 2VDOH 3JVGC 4RMWA 3ULSB 1UA6H 3M8OH 3B43A 4PRHD 3NFSH 1AD9A 4JO2H 3H9HA 3H42L 2QADC 4YIQB 2ZPKH 3PXHA 4G8GA 1FNGB 3U0WL 3SKMA 2EZ0C 2F8XC 3CSYB 3SDAD 1XGRB 2YEZB 1FYHB 3GMQB 1UGNA 5D5MF 4ZO6A 4UMGA 5GRYA 4AG4H 2MCG1 1LDSA 1S7RA 4N8VG 4X8JB 4HAGA 2HFEB 4MD4A 4X8JA 2BY2A 4PTTA 3ARTA 1TMCB 1OHQA 1MLBA 2H32H 2WUBH 3CVHB 1MFCL 4YHKL 4P5TC 3UTSE 1YY9D 3CSGA 1BWMA 4K3EH 4I9WE 4JZJB 5D4QA 2QLVB 1T83C 2EEBA 5GGVH 2ERJB 4FNLL 4JN1L 5DMKA 1MHEA 3QQ9D 15C8H 4LOUC 1XGUA 4X98B 3TT1H 1K5NB 2FJGA 2E9BA 5FKAA 3LPFA 1RIUL 4N0FA 3FZUC 1DANU 1ZT1A 4KK5C 4TSAH 4JRXB 4D2NA 4HJJL 4P2QD 3SBWC 3ARSA 4OLWH 5MP6L 2BMKA 4J3VA 2EXWD 2Y7QB 3EOAB 1CZ8L 3JWOC 4OZGE 2FBJH 4PY7A 2GHWB 4N8VA 1T7ZA 2OXHA 4R9HA 3O4LD 2ADGB 5FDWA 4M7LH 1MIMH 3SDAC 4IS6A 1P84K 2JKXA 1XT5A 4NN5C 5L2KA 4R26H 1FZOB 1A3RL 1N26A 1XR8A 4TQEH 1M05A 4U0QB 4OLYL 3VG0L 4RAHA 5TE7H 2K1MA 5CBAA 1J8KA 1T6VN 2O5ZL 3DX9B 1JPTL 5T1LB 4NO0A 4APQD 1UFUA 1BEYL 3TO2B 3MZGB 5CSGA 1U3HB 1Y6NR 4LAQL 1MCOL 2VLRA 4OB5L 4U49A 4WEMB 4XNZB 3C5JA 4PRIE 5K59E 1D5IL 3ZYOA 3ARDD 1LHZA 4XTRC 3PQYB 4ONOA 5DVKA 3F7PC 3QIUD 4PV8B 2YPLD 3AGVA 2F54A 2GAZB 2JB6B 4FN0A 2GY7B 2NZIA 1BECA 1QD0A 3OB0H 1AIFB 1A1MB 4D0DB 4ZSOB 2V5SA 5E8EA 5MEOA 4IHOA 4MQ7A 4DEPB 5KTEH 3QYCA 1FV1A 3C6LB 3U46B 3VJ6B 4YQXH 3VXNA 5DFVD 4X6CB 2MJWA 5DO2D 3HLAA 5F7DA 1HH6B 2GUOA 3JBG7 4KZEL 1OP9A 1QSZA 2O5YH 2R1YA 4PJAA 4L3CB 1WIOA 4BQBA 2WWKT 2YBRA 3P9MB 3RWHA 4BYHA 1NDMB 3QIWC 1R5VA 1YECH 3QBTB 3K1KC 1FIEA 2NZ9D 2NNAA 2G5BA 1HINH 4ZO7A 4MJ2A 3L7EA 3V4PL 2FNBA 3KJ6L 4FXLA 1IGTB 4YHPB 4I18B 2XTJD 3UZVB 4QHMB 2VLMD 4Y1AA 5E2TH 2CDEA 4LCCC 2CJUL 3MA9H 5CMAB 5TDOB 1I1AD 5FKPA 3LIZL 1IGCH 1LK3L 5I6XB 1TJIL 4N90E 5EC1B 2A74B 3LY6A 1BZ9B 5T5NG 2FHBA 3BGFC 4JFOA 4KJQD 4YWGL 2AKRA 3V4UH 4Z95L 5SX5K 5BVPL 5J6HB 5A2LH 2Z31C 2NY6C 4JG0H 4Y1AD 4MXQD 1R3JB 1R0AL 3SKMB 4OCXH 4JO1H 1DVFD 4PJXE 2ZCKL 4YR6B 3TBVB 2I26N 4CL7A 1HHKA 4Z78A 3TFKC 1B4JH 3L1OL 3I02B 5HPMB 5MENB 2FLRT 3EYSL 3BH8B 2Y23A 3CDCA 2BHZA 4KXZI 5EUOB 1CGTA 1NMBL 2XZCL 5SWSD 5KVGL 4KQ3H 4YDLB 2ZNXA 5ETUA 2FEEI 1FGVH 4MDIB 1VACB 1NGXA 3OHXA 2FLBT 1BD2D 3OKOB 2VLRE 3QIWD 4IRSC 1PW3A 4ELKA 4KMTL 2VDKL 4FXGB 3D39E 1AJ7L 4F15B 2EIZB 3K0WA 3HPJB 4WRLA 4I0PD 3NZHH 2BVOA 4XPHL 5HHOA 3GI8L 2VDRH 2JF1A 1UM5H 1AE6L 4LLMB 4OQTH 3A6BH 2DRUA 1ND0A 1J88A 4K94C 3K4ZA 4HX1B 3L9RA 5F7WC 1CFVH 3ARDA 1AR2A 2X4OA 2FEDC 4JLRA 4TPRH 4ZPVB 1R6VA 4FHBD 4I77L 3S4SA 4N0UA 4X8XA 2X4TA 4KUCD 4XZUB 3ZL4H 5I30H 4HULB 1QACA 5DHVA 3CIQA 1AI1L 4G5ZL 4AH2B 5EO9A 3KXFD 1G0YR 2I5YH 4DVRL 1Z0MA 3QDHA 1ZA3A 2CXKA 4RZCB 2AJUH 4RNRA 3ZKND 5CGYD 1AXTH 4HF5H 4KRLB 1X6LA 3W5NA 1ERNA 4OI8A 5JIHA 3DXAD 5B38G 5FKAB 1S7WA 3LKNA 2IAMD 2FX8H 1PYWB 4HH9B 3LN5B 5L9DH 4CNIB 4I3GA 4MA7H 4LDOB 5IMMA 2CK2A 4XVSH 2FGWL 4YHML 1HEZA 5DMJB 5FA4B 1OAYH 1TFHA 4XTRD 2WK2A 4XVJH 1L7TH 1CDHA 4KK8C 1DLFH 1P1ZA 5E5RB 4OGZA 5CZXC 1DBAL 2CR6A 2R0KL 1CU4H 5EO0A 4JY4A 3BEWB 4HIEA 4NQEA 3QUYD 1KULA 1O7SA 4HT1L 2MKWA 4RGMB 4MJ5A 2FSEB 2YD7A 4U1GC 5ID0B 1X5IA 3U1SH 5I17B 2I9LB 1I9RH 1EA9C 4HPOL 5JR1L 1WQVT 4ODXB 4DZ8B 4M6ML 3DI2B 1M7IA 2VH5H 2VZ3A 1ADQA 2R29H 3P4NA 1BIIA 4UOW1 1S7VB 1G7JB 1TNMA 3E2HB 2IBZY 3W9DB 1NFDB 3CAFA 1ZXQA 4WUUA 2I9TB 1H5BA 2VZTA 4JFYA 1P53A 1OP3H 2IEPA 4JGUA 1X5AA 3WS6A 3Q5OA 1IM9B 2FO4A 5DD5L 4CMHB 2A6DA 3ME0A 1QA9B 3IJSA 5FGCB 1I7UB 2J1KA 3VXRD 4LF3A 4NKQB 4PLKD 1A6VH 3FN9A 3Q2CA 4L9LA 4IRSB 5GRWA 3FFCD 1ZLWK 5TGBB 5E2UH 1INDH 3AREB 3FKUS 3BZDA 1NGYA 1CGXA 2R39A 1H9VA 5MHSE 3GMLA 2J4WH 3VGGA 1OSZA 5DURB 5E1AA 2VERN 2YR3A 1IFHH 3U0PB 5DRNB 1ZOXA 4WUKL 1Z0NA 1NC4B 2ZUWA 2AK4D 4M8QA 1F90H 2AJSL 2R0ZH 1AGDB 2CKNA 3O6MH 2YK1L 1AC0A 1I9JH 5DJ2B 1P7QD 1ZVSA 1HHJA 2NNAB 2MKLC 2H26A 5GS0C 4P0DA 5E5MA 2DQDH 2CKBB 1MCQA 2JCCE 4LPVA 3V6ZB 1N5AB 1T89A 4XCCL 5T1LD 2AV7A 1MFAH 4K3DL 1I8LC 4XC1H 1Z5LA 3SDYL 1FH5L 3NZ8B 5F1NA 3HE7C 3HE7A 5I6XC 4NNYA 1XIWA 5ITFB 5K9JL 1FZKA 1ZANH 4DKDC 4OZGF 4LCCB 2OBGA 1E4WH 4NHUA 4FQXB 5KSBE 2B5IC 3N9GL 2HJFB 4IMKA 4Z7UA 2FZ3A 2DIJA 3ULVF 3PL6C 3FB5B 4HBCL 3EDDA 4DUWA 2X10A 3QXTA 4QT5A 4HAFA 4FQQA 3OF6A 3AAZA 2VABB 1OT2A 4NSKA 4Y4KC 3VWJC 3LB6C 4H26B 4EI5C 2P24B 3T8XB 1BOGA 4H26A 4XMLL 3L3HA 3U6RB 1T20B 5I8EA 4LEXL 3KYNB 2R4RH 3K2UH 2PTTA 1OB1A 5CEXB 2QSQA 1N4XL 4NBXB 5CP3H 5LCVH 3UBXG 3RPIA 3U9PL 5CJQL 4DEPC 1QLEH 1G9ML 2HKHH 1NMCB 1KXTB 4N0CC 3QT2A 4UILL 5DZOA 4YR6A 4KY1H 4M9PA 4PUBH 1I7TB 5D7SL 4S1DC 3WN5A 3BH8A 3WN5C 4JFDB 5A1AA 2ATKA 3RZCA 4EXKA 4XNZC 2J4WL 1ZV5A 5IBUG 4JFDE 5IB1B 1ZT4A 4ZUUB 5KAQF 1X7QB 3NMEA 3EDFA 1F13A 3R8BB 5C0AA 3EDKA 3T1FA 2X4RA 1GCFA 1E4XI 2L4OA 5I0ZA 2E7MA 3ILQC 3O6ML 3KXFE 4PRPA 1J11A 2F53D 1R3HB 3QEQB 4NQCE 5DD3L 3ULVC 1C7SA 1SEQH 4Y19D 3O8XA 1U42A 4P23D 1QEWB 2IANB 3U0WH 2PXYB 4Y5XB 5FOBA 4CADB 5IMOB 1WITA 2F53A 2VXVH 3GUTA 1JWSB 5HHXH 5C8JB 1FBIL 1F3RB 5FXCH 3G6JB 1MFDH 3KJ4C 3V5DB 2CRZA 5FM5M 4Z6AT 1T5WA 3D2UA 1XF4A 4XPBH 3OJDB 2JJSC 1TQCC 5F9JB 5E8DL 2KQNA 5IB5B 1WK0A 4JFHE 1OM3L 4MB3A 3SOBH 3RVTC 1RZ8A 3ISWA 4JJHA 5DJYB 4NRYB 4XMKL 2QKIB 4WHTB 1S9KC 1BVKA 1MEXL 3UTZB 3PDOB 4ODHH 2I24N 5TE4H 4PRHA 2NZ9C 5K9KB 2VRAA 1ZHKA 4PGBB 2HP4A 1BLNA 2AEPH 5ID0A 2AJXL 5CLWA 1DL7H 4PRDB 5H94B 4PJ5D 4NNXA 1U2HA 4JFFA 1KJ2H 3AVEA 2CLVB 2MWCA 3TF7C 2IJ0C 1RV6X 1IILE 2V2TA 1WZ1L 4DFHA 1W8OA 1ZKAA 2NR6C 4KPHH 3QDGD 3TH4T 3DRTA 3MUGA 5F89B 3MMEB 5L6YH 5E6ID 2WV3A 4MNQB 4OD3L 4NP4L 5MI0B 1HWGB 4Q9QH 1MAML 3LN4A 4C83B 4Y2DA 1MVUA 1IRAY 3KPPA 3H9HB 4LIQE 5GPRA 3PL6A 3WIHH 3WE6A 2YWYA 2HJKA 4P4KA 5E6ZA 4P4RB 3QEGL 1ZVHA 2BSSB 2NY3B 5FM8A 1DSFH 1QBLH 1T1ZA 4CVZB 1PX3A 2HLAA 4OQ1A 5DD6B 4G8IA 2R2HA 2O61A 2VR5A 1BJ1H 3DX7A 4TVPD 3SQOL 2G9HA 2VE6B 4FQXA 4OGYL 2WMPA 3I3DA 1Q9WB 1E4KA 1GIGH 5FO9B 3T3ME 3Q3GB 1JGLL 2FIRT 2AK4A 5ANME 2I60L 4DVRH 3DMMB 3GIZL 1A1MA 1DQML 5J11C 4ZMAT 1HHHA 4J8RA 4L4TE 3OXRB 3GSNH 3QEHB 1J1XL 4L4TB 2OZ4H 2X1QA 1U8NB 4GRLA 4LNRB 3GMNB 4OF5A 4JRXA 1JNNL 2A6JB 1IKFL 4XCYB 3NTCL 1ZEAH 2J6EH 4XH2B 2PTTB 5EH1A 4J12A 2DKMA 1G7QA 3O3BB 3BQUC 3T2QA 1KFAL 4JM2C 3MROB 1G1YA 3HZMA 5A2FA 3MROA 3NFPA 1JWMB 1YN6B 1ZLWH 4F7TB 1ADQL 5D7LA 3KPSD 1JCKA 1J05B 1MUJA 5TF0A 2AK1H 4G8FB 4LOUD 4Y5VC 1YEIH 1J05A 1I7ZB 1T7VA 2NTFB 3HI1B 3TO4A 1L6XA 1WT5C 4YZFF 2NY2C 3CSPA 4JHWH 3TYFB 5CJ5A 5C0BB 1UEMA 1FVDB 1NUFA 4LLYA 3ARED 1YY9C 4HWNA 2VL4A 1S7SB 3OKEA 3PXJA 3MRQB 1A9BA 4UINL 1KGCD 5T3ZL 4OCRH 1AR1D 3MRQA 2H8PB 5C0GA 3T1FB 1ZTXH 3IDUA 3PWJB 3IFOB 1RU9H 3KPRD 1RUAL 2W07A 2WUCH 5JW5A 4WFED 2FECI 5M94B 3SBWA 2XRAH 1MY7A 5T1MA 1AD0B 1IGFL 1P7KA 1MY5A 4OUUB 3CSBA 5C0IB 3OKYA 1QBAA 3O0RH 3O2WH 5IJVA 4C57C 4I48B 4QRSB 1HNFA 3JV4A 1UG9A 1Q38A 4FTVA 4AEFA 1N0LA 4P48A 2GK0B 3OJDA 3U9UA 5INDB 3EYQD 4U1IA 3RVVD 3C8DA 4ZFFA 2JJWA 2A9NL 3B5TA 4FMKA 1FGVL 3KPQB 2FBJL 4NRZB 3I9GL 2QR0B 3K74B 2D0FA 5I73C 1NLBL 4CMHC 5DRZB 2OX5A 3SE8H 4PJ9D 3EFDL 1X4YA 3WIFA 3NH7H 1LWRA 1I1YB 5DF0A 1OOAA 3NGBB 3DSFL 2G5BB 4PJXB 3RRQA 4QHNB 3L3IA 2X9XA 3PDDA 5GGSA 3GSNL 5FV2A 5H94A 4FTVE 4HV8B 3DTXA 1DN2A 3GNML 5HHVH 1DUZB 4M6OL 4JFFB 2N7AA 4UOJA 2W60B 1JGLH 2A83B 4G43B 5FYLL 1UENA 3GSUA 3D69B 3HI6H 5A43C 3B2UD 3GHBL 4MZ3A 1UKTA 1I3RB 1DEEB 3CU1A 2XWJB 5DJXA 2W9EL 3QNZB 2BNUB 5I71B 3QISA 3KYAA 3LEXB 2R0LL 4XHJD 3HG1E 5IOPA 4EUPH 1DFBL 4JVUA 3PHOA 1DQLL 3RWEA 1YJDH 1QRKA 1AXTL 1MI5E 3QIUA 3VGEA 1MCBA 4U1JB 4D94A 4S2SB 5DJ6A 1YJDC 1FO0H 1MI5B 2X4QA 5SWZD 4UBDD 5CBEA 1LP9F 4P23C 2NW2B 3QIWA 2DQUL 3GM8A 1KENH 3V5DA 2E3VA 2YUZA 4XHQA 4UINH 4L4VB 3L7FA 4A6YA 4DTGH 4FQIH 4C55A 1JYWA 1HYSC 1CK0L 1T80A 1FE8L 2UYLB 4MJID 4GFTB 2XFXA 2XXMB 1QRNB 5C86A 3L1OH 4FXGA 3SDXE 3C60B 5DA0B 1HWHB 4NN6C 3TBTA 3EYSH 2C3VB 1DQTA 4P2RE 5D71H 5HGHB 4QXGL 4YBLC 4ZUTB 2A9MH 3L6FA 3SN6N 1EGJL 2E9JA 4P2OC 4M7ZC 4UV7H 4V2CB 4R7NB 3WV0A 4ELME 2A2QT 1MCDA 4BKLA 3EOBB 5J3HC 4ZTOL 4HKJA 4MA1B 1FFQA 1JRHL 2BVQB 1IGIL 4HX1A 2VXQL 1KCRH 3ULUL 1OF2A 2ZCLL 2VOTA 3BKMH 2NY4D 2AJZB 2NX5D 3O2WL 1EUTA 2C26A 5C6TH 3T2PA 1T3FB 5C0EA 4K2UH 4IMLB 3STLA 5DHYB 3U36A 3QDMD 1IBGH 2NY4C 3NIGE 4GBXC 1JV5A 3MNWA 1MPAL 4RZCA 3GJFB 2AEQL 1T7YA 1NDGA 3MV7D 2FR4B 4P4RA 3WFBL 3E6FA 4TNVK 3S37X 1IAIM 1V7NH 3TN0D 5I30L 5C7XH 2LABA 4MAUL 5JHDB 3U7YL 5DC0A 3QUML 3NH7L 5I1GH 2KQMA 5IQ9B 1JRHI 5F7EH 5L7XH 3GHBH 4LRIA 1RUKL 1IEBB 4M1CD 3WFZA 3UPCA 3OKKA 2ZUXA 3LS5H 1ROWA 5I8KL 5DJCA 4QYOA 1T0MB 1D9KB 1P4BL 5F1IA 5AYQA 5GGRA 4TSBL 2YN5A 1D5XA 2NXYD 3ARYA 3QO1A 4WW2C 2NXZB 3G6DL 3AUVA 2FX8L 4LVHC 1CFQB 1QFWH 4Z7WE 4IDJH 1K6QL 1M4KA 2CGRL 3HR5A 3PP4H 4JAMA 2R2EB 3WO4C 1CXLA 2KBGA 5EWIH 1KCVL 1MEXH 4PJGA 1LDPH 1H3WM 4ODWA 3MJ9L 1U8KB 4L3EA 2X09A 5E9DA 5C2BL 4ZUWB 1GHFL 2ID5A 1MLCB 3VWJD 4ZS7H 2HTLC 2WIIA 5C0CB 1NEZG 3W0WB 1B88A 1TJHL 4YZFE 5HYJA 3P9LB 4QTHA 1MCLA 1GL4B 2DQCH 3CFKB 3QIBD 1Z9LA 2C3WA 5KN5B 4PJ8D 4N0CD 4C56D 2DF3A 1YN6A 1FSKB 2PKDA 3CMOH 5JXAL 2ICWA 5I15H 2UVEA 1I8MA 4I2XA 2GJJA 5FGRA 1ETZA 1DUYB 5GRUL 5GGRY 2Q86B 3LQAH 4P46B 4H88H 5FCSH 3A6CL 1AFVL 3PV6B 3AFLA 4Y2DD 1CIDA 5I1DB 2VO5A 5D71L 1OSZB 3FO1A 4RGOH 4P4KD 5E6IA 5DJ0B 3PL6D 1NUGA 4XC3L 1JYXA 1FHGA 4NO5A 3GRWL 4LU5L 4CGTA 4QKXB 1VERA 2ZJSL 4P9MH 4OZ4A 1G0DA 3EYQC 1ZVSB 3QAZC 2DJ4A 5I0DA 5KTEL 2HT2C 3EJZD 2NY1D 4ZNEE 1CXHA 2YD2A 2CKBA 3OPZL 4WFGE 3T0DA 1F90L 4GW1A 2P7TB 3RY6C 3Q6FB 4K8RC 2VQ1A 3NTCH 3FQXB 3C9NB 2XFXB 2X4SB 3MV8D 5C0JA 3P30H 1ACZA 4ZAKB 2E6JA 1RIVH 2HFFA 3BUYA 3WJLC 5BXFB 2C3VA 2JLLA 1GAFH 1T66C 5IK3A 3HG1D 4ORGA 2XNAA 4KKBD 1BM3H 1G9MC 4OGXL 3ARRA 1CL7I 1KB5B 4JO4H 5DUBA 2V5TA 1U36A 3QIUB 3X13A 4FQHA 5EN2A 3X11B 3RFZC 4DUXA 1NCWL 1F4YL 2JE8A 3DYOA 4OKDA 1TVHA 4F57L 2H1PL 1M1SA 2Y72A 4LSRH 3NIFE 3MFGB 2HMID 1VHPA 2CUMA 4OJFH 2GKIA