4KRPD

Nanobody/vhh domain 9g8 in complex with the extracellular region of egfr
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
218
structure length
213
Chain Sequence
b'QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSKTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epidermal growth factor receptor
publication title Structural Evaluation of EGFR Inhibition Mechanisms for Nanobodies/VHH Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/immune system
total genus 37
structure length 213
sequence length 218
ec nomenclature
pdb deposition date 2013-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4krpD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4krpD01
4PRHA 4HGKC 4OGXH 1IQDA 1UB5A 4O2CB 5FM5M 3BO8A 5D7SL 1YJDH 1ZGLA 1DBAL 4MQXD 4ZFOL 2KZWA 1OB1B 4FABL 4J4PA 5I6XB 4PUBL 4OB5H 3SDCD 2XG5A 4PPTA 3RWHB 2OTUA 4F58L 4GMTH 4OD3L 3L3GA 3C9NA 2EZ0D 4P5KA 5F9JA 3D9AL 1IAIL 4XCCH 4ONHA 3DMMD 1KIQB 3LDBC 5J9PB 3W9DA 3IXAB 1MPAL 2K7PA 1XGPB 3H7BB 1FVEA 1U41A 4M3JA 4NNPH 3D85D 3IU4L 4XC3L 4UDUA 3PQYE 3AREB 3TIDB 3GGWB 4Y5XB 2XN9E 3DVNA 1FO0A 3BZFB 2E9JA 3MCKA 1WCBA 1A9EB 2ERJC 4QRRA 2XXCB 3PIQB 3O81A 2GJZA 4QRQB 1K5NB 3QQ4B 2EDFA 5JR1L 4I9WD 3HCVB 4QHLA 4HAFA 4XXDB 5FHAH 1LEKB 3U9UA 1W2KT 1J10A 1IVLA 1OAKL 4F7CA 2BDNL 5F88B 3Q48A 1H5BA 3D39A 2YUZA 3U7AA 5C0CA 1OSZB 4XVTH 3L5XL 3MV7A 4MNHA 4P9HL 1G7HB 4DW2H 3AM8A 1V5JA 5GHWH 4YDJB 5GZOC 1UYWL 3GFUA 3WS6A 1N2RB 3OB0K 1Q9LB 2ED7A 2R56H 5C0BE 4GAGH 5FAAA 3HAEH 1GGIL 3SDXF 3G6AA 1IC1A 2JJTC 2BOCB 4LDLB 4LSPH 5DD1H 5TF1L 4XNQA 1A4JB 1INQB 3PL6C 3W82A 4XCNB 4U6HA 3WXWH 4CGTA 2XICA 3HZMA 1JPFB 5B8CA 2IEPA 1T89A 2E5EA 3QG6B 2JB6A 1KELH 4HBCL 4Q6IB 4YC2B 4Z8FL 1T22A 5IB4A 3PGCB 2AV7B 2VDQL 4OTXL 2FO4A 4L5FL 5ANME 1YEEL 3WNPA 1K9TA 4OCWL 3MBXH 4TN9A 2ZG2A 4FFVC 4LLMB 1M7IB 1CDJA 3RVUC 4OBRA 1UC6A 4M4PA 2YWYA 3WIFB 3RVWD 1AC6A 1FG9C 4Y19D 4JY6B 4J3XA 5GIRB 2N4IA 3KYKH 2XTJC 3O3AA 5HHXH 3ZKQD 2HFFA 1VGKB 2XWJA 5T5FH 1KV3A 4JZNB 1EHLL 5L2KD 1ND0B 3L6FB 4M6NH 1MNUL 4YEEA 1YY9C 3FFDA 1WZ1H 4UAOC 4H1LH 1NBZA 2J8UA 5JW4Q 3KPSE 1A6VL 2J6EL 2AK1L 1A47A 1KFAL 1J9CT 2R2BB 4YK4C 2W0LA 2QJDA 1A0QH 3C2SA 2O61B 2ZUYA 1ZHBB 1RJCA 5D93B 5I66A 1OLLA 4POZD 1T6WA 4MD5A 1DBKH 3RWJA 2HMID 1S7SB 1SYVA 5KSBF 5L7XL 1FAIL 3H42H 2UUDK 3TBSB 1HZHL 2X89A 3ARUA 4DZ8A 3MV8D 1CGUA 3CC5B 2W07A 3ARGD 3PWJA 8FABA 2AW2A 4OZFB 1CYGA 4W6WB 2J1KA 5C3TA 2YEZB 4GW1B 1KJVB 3LH2H 2Z35A 2AJVL 2YMXH 4V1DB 3CVIH 3C60B 4LVEA 5SX4I 3KPPA 1BFTA 5DJ8B 3RA7H 2XTJE 2YD4A 2D7PA 1SBSH 1ONQB 2GAZA 3V95A 5DRWB 1DEEB 1CLOH 1FC1A 1ZV5A 1VERA 1DQLL 4UNTA 4KJQD 1FH5H 4YDIL 2G9HA 3VD4A 2HLAB 3QHTC 5GSRA 4IBLT 3VWKA 4JCMA 5C0JB 1RPQA 1AR1D 4ZXBA 2QADC 4Q9BA 4JVPA 3QXTA 5EOCJ 5IMLB 3QI9C 5H8DA 2PTTB 1T2XA 4PJ5B 2HTKD 4KZEL 3LQAL 2V9TA 3B9KB 3DNKA 5C6TL 4PG2A 4UV4L 4QHKJ 4MJIE 5IP4A 4MMXC 2J5LB 3WYRA 3INUH 4U1GC 3GK8L 2R0KL 4BK5A 1JIBA 1JPGB 1U8OB 4FFZH 1B90A 1T80A 1WBZA 2V5TA 1PVHA 3EYFB 4X7DC 3LB6C 15C8L 4O58H 4PY8J 1A14L 5GGTH 1U8NB 3GMRB 4U33A 5L9DL 4HH9A 1XF5B 2AQ2A 3OXSA 5IFAH 3FQUA 2Z91B 2O5ZH 1KCRL 2A6JB 1E4WH 1N7MH 3U0TA 1S5HB 1DL7H 1FPTL 4P4KD 3MOBH 5GS1B 3CSYB 4AIZA 3O2WL 2VZOA 4NKOB 4YDVB 2NR6C 3MUGB 3BZEB 5F3BA 3PHOB 2IPTL 5EBLA 4LU5L 2YA1A 4DFIA 4DK3A 4PGDA 1FZJB 5DJDB 4BSWB 4LVOB 5F8RC 5GGUA 3W11C 4LNVA 2X7LB 5C0EB 1FSKB 4NO0A 1HQRA 2Y5TB 3FKUS 3QNYB 1BM3H 1CICB 1J0HA 1A6AB 1I1YA 1MWAB 1F90H 2ICCA 3NIFF 3LQAC 5HGHB 2DTSA 4K9EC 2WIIB 4M3KB 1SY6H 3OGCB 4JKPL 4JFYB 4MNQE 4MB4A 5IESH 5JW5A 5TFSL 1AQKL 5GRJL 4EBQH 4PJFB 2GIYA 4D0DA 2DF3A 2VRAA 4RDQG 5IF0B 4YHYC 1YPZE 2ZP0T 1RUAH 1HYSD 4P46D 1HEZB 1SJHA 3ZE2E 5INDB 1FL6B 1S7WB 4P2QB 1HOCB 1KB5B 4NQSA 5CZXC 4JRYD 1RUQH 2Q8BL 1DN2A 3KS0J 4QRTB 3EOTL 2FR4B 4Y4KB 4GG8B 1I75A 3RWDB 2X4UA 4JFPB 2UWEB 2HKHH 3MRJA 5KBNC 1CVSC 5LBSL 5EBGA 4G9DB 2DMCA 3TVMD 5CZVH 5MEPA 5C0GA 4L3ED 2Z31A 1RZIB 4RGNB 3P0YH 2W9LA 3DGCR 4DKAA 4KAQH 1Q38A 3JTSA 1JTOA 5IR1A 4P5MB 1F6FB 4JR9H 4XRCB 3UDWC 2YPLB 4PJCB 3U0WL 3BQUD 5BOPA 3TF7C 4PYHA 1CK0L 3QEQD 2QHLA 1HYRC 4RMVA 4G43A 4P99A 5CMAA 4R8WH 5CJQL 5BS0B 3C09B 4B53A 2ENSA 3FO2B 4HLZG 3RGVC 3ILPA 4LLYB 1PY4A 4OFVA 4I8DA 3IFOB 1F3JB 3FN3A 4PRBB 3VXUE 1RUPL 1CXHA 5EO1A 2Y4SA 4Z7WA 2K9UA 2P5WD 5DD3L 5K9OB 4IMLA 5TGBA 1V7ML 4HF5L 3G6JE 5ALBL 2E7LA 5IVXB 1KPVB 5I1JH 1YNKL 5B39B 1QZ1A 5TPWH 4JFQA 4NHUB 3DV4A 4OQ1A 1F5WA 1OGAE 1TXKA 1U8MB 4WU7B 2XKNB 4FRWA 4U1HA 3VFTA 5EBWA 2CXKA 2O26U 4Y2DA 4M93C 5D70L 2F53A 3UTSE 4J6RL 5JDSB 2FZ3B 2F54B 5CFHA 2AJUH 2Z4QA 3KPTA 4MQ7B 5C9KA 4X6FB 3OG6B 1I3VA 1JWMA 2H41A 3HUJA 3QZWB 4OD2A 3RVXC 3K7UA 5H2BA 3VXMA 4PRAA 3IDMA 2I5YH 5HYSA 4KTDH 1LO4L 1LO3L 3WNKA 4HDIA 1MLBB 4JFEE 5FKAB 4XP1L 5C2BH 3QCUH 1MELA 1E4XH 2EC8A 2ZCHL 3PJSB 2ARJQ 2ADIB 4WRLA 4XPAL 4KK9D 4XVJH 2BSED 3GSWB 5HVHC 2OQJA 3S97C 1X5ZA 3UBXI 4LCCC 3QDMB 1BIHA 3SKUD 1S7QB 4HUUA 4YUEH 3G5YB 1KIRA 3V5HA 1BZ7A 2JK5B 1UCBH 4XAWL 5GXBB 4M61B 5D7JD 4ZSOB 5DJZB 3ARXA 2CUMA 5I75B 2HVKB 5KZCB 3ALXA 3FT3A 4PJ8A 5T3XH 1G7PB 1XGUB 4JG1H 4Y4HD 3H9YA 4MWFA 5F9OH 1MCIA 1U8HA 2GK0B 3MJ6A 4FTVA 2NLJB 4F2MA 2OCFD 4YHPB 4WCYL 2IH1B 1J1XH 4NKMA 3BGMA 3DWTA 1DQJA 3EOAB 5C71A 2DIJA 2CLZA 4AIXA 3BH8B 1E27A 4R3SB 2NY2C 2BSSB 1A1NA 4ODUA 4X9BA 5EDXA 3SO3C 4G8IB 2D7OA 1A1OA 2AJ3A 2DD8L 5GS2H 4F7TA 2GCYB 2VWEE 5C9JB 2UYLA 2C3HA 1YN6A 4N8VA 4G6JH 2VZSA 1DE4B 4LBEA 1MCJA 3DI2B 2DQUL 5F7EL 3VWJC 4OF3A 4NKIH 5DSCA 2D9QB 4S1RH 1S7VA 3QHFH 5I73C 2GK2A 5C0IB 5JPMB 2VABB 4YLQT 4CVZA 4WTZA 3NCYS 1ETZA 1E4KA 3HB3D 4HS8H 2WQRA 4P2RB 4XI5C 2FL5B 4GAJH 4KRPD 2P24B 1GJIA 4R90L 5CAYB 4FP8H 3RZCD 3QCVH 4JVWA 3RTQA 3CZFB 5HHOD 4E41B 1UXWA 1NGYB 3I6LD 3L7EA 3P77B 3VFOB 4LKCA 1S7UA 2O5YH 4I1NB 3ZDZE 4RFOH 1GZQB 1UJTA 2D7TL 1RUMH 2HJFA 5E9DA 4CMMB 3SDDA 5K59E 1ZT1B 1HHIB 4XMLL 4JVUA 5AYUH 2X44D 25C8H 3TJEL 1Y0LB 4OJFL 3U4AA 5ISZD 3QIUB 4NQCE 5ILTL 1AE6L 2YN3A 4YHZH 3QDAA 3WNOA 4DN3L 3TCXA 3ILQC 4Z7VE 3MGTA 5I1LA 5DD5H 5IFHH 5EUOA 3E3QE 4HUXB 4M7KL 3BW9A 4NBZB 3TZVC 5ALCL 2MPAL 5KAQF 3LKQB 4MDIB 1DR9A 4D0CA 2R8SL 2E7BA 2Z8VC 3K2UH 3RDTD 3VGGA 3ZKMC 2PYEB 5ADPH 4JZJA 1YECH 1DVFB 4YAQA 1UZ6E 1MJUL 5I8CA 2MTPA 1Y6NR 4CN6A 5IB2B 5GRUL 1RZ8A 3H0TA 3W0WA 3B83A 4V2CB 2FHBA 1OP5K 3RL2B 1TVHB 1IT9L 1JGVL 1QLEH 2VO5A 2IFGA 3KHOA 2WUBH 3WIIL 1BD2D 3SDYH 2VDLH 4PJEF 3PV7A 4IS6A 3UO1H 1J8HA 3MMEB 3KXFB 5T1KD 4JHZA 2IANE 4QXGL 1ZEAH 1FFQA 3HE7B 4KJWC 2DQFA 2EDQA 4MA7L 4PRIE 4NYLA 1QRNA 4NO5A 3T0ED 1HXYA 4J8RA 3TYGH 3BXNB 5FGBA 3X12A 3U6RB 3KPOA 1U95B 4L4JA 4PRHD 5IMMA 1KBGH 5DFVC 2OJZH 2WBJA 5IUSA 1NAKL 1H8OA 5BVPH 3B2UD 2DOCA 5DHYB 1AKJA 4OSUH 4MAYA 3GIZL 4FQXD 4PJ7A 1XGRB 1PY9A 5FB8B 3LPGA 4DQOL 1IEAA 5BZWA 5T3XD 4HUVB 1AGFA 1HH9A 5I1KL 5TE7H 5ITFA 1N3NB 3Q1SL 4XNXH 2ADJA 1JYVA 3ARFA 3WD5L 2PXYA 4KMLB 5I1GH 3QIBA 1EPFA 1ZXQA 2G2RB 4HKBA 4F9LC 1YYLH 1U58B 4RMRA 1LD9B 4JANB 5F1SA 2Y23A 1QA9B 1MEXL 4G6MH 3BPCA 5GS2D 3HE6A 4QRRD 3PABB 1UM6L 1QBLH 3Q0HA 1YPZF 1DTUA 1T2QH 5J3HC 3SDXB 3ZE2F 1HI6B 3D0LB 4HKXB 2OS7A 3MLVL 4O9HL 3P0VL 3RIAF 5F7HA 1IFHH 1DLHA 2PR4L 1FZOA 4M7ZB 2VDML 4MYWB 4MXQD 4NNXA 4OGAC 1B4RA 4PG9A 3O45A 3LS5H 3BRDA 4R97B 3DUHA 5C0CD 1LDPH 1QFUL 3WS3A 4ODTL 3MV7D 4JM2A 4GG6B 4XB7A 1IM3A 2AGJL 2GT9B 1PX4A 2HH0L 5H94B 5I0ZA 5CD3A 3LQMA 1BFVH 3VXRB 5HHMB 3GI9H 5D6CB 2A6IB 5GJSL 4BSVB 1YNLL 3FO9A 1K4CB 2AERT 2V5RA 1T0NA 2F8XC 4O5LH 3B43A 2AEQL 3NZ8B 2LAGB 4X99A 3ECBA 3IYLW 4LQFL 1Q1JL 2NCMA 5A16B 5A2JH 4G8EB 3P73A 1A4KB 2XPGB 3GDBA 5JIPA 1C5CL 3GZKA 2OXHA 1A9BA 3QSKB 1KC5L 4PGBA 5GGRA 3L3IB 3OKLB 4YXLH 4XT1C 3VCLB 2HAZA 4KJPD 5KANI 2X70B 2YD3A 4X6DE 3N1FC 4S2SB 5CIPB 5KSBB 4JKMA 4P48A 3V7MA 2EXWC 1M05B 4LFHG 3KS0H 2XG4A 4OLWL 3VFMA 2CIKA 4YHKH 5JA9A 5D96B 4NC0B 3C5ZA 4RDQF 1I7RB 4R0LB 4N9GB 1I1AA 4RGOH 1I7UA 3MNVA 4RA3A 2HFEA 2P45B 5GJTH 3EYOB 3H2WA 2R1YA 3BP6B 3O9WD 5E03A 3SDAD 1XF4B 1KJMA 1JHKL 3AROA 3UTZB 3IDGA 2DYPB 3PP4H 4MNGA 3ULSA 3O8XC 4Z78B 5KW9H 5IFJA 4PS4H 2IFFH 3O3EB 3ESVF 2YD2A 3CLFH 3MLTA 1JNNH 1GRWA 2R69L 5C09A 5HY9B 1JK8B 4JRXB 4JFXB 3V6FA 3O2DA 1HSAB 3MRIB 5C0AD 1KJ3H 4DN4L 4EEEA 4IRZL 1HILB 3O4OB 4WV1B 5DYOB 1YEJL 2OX5A 3VXNA 4ZODA 3C6SB 3SBWC 2H1PL 2IJ0C 4I0KA 3TGXA 4CADB 4P2OC 5I16A 3K3QA 1A6WH 1ZS8A 2ITCA 2MFNA 2R0LL 3MLUL 4I5BA 3V4UH 4DTGL 1Q0YH 4J3SA 5C0DA 2D31A 1G1CA 4RBPK 5E24E 2VLMD 3VJ6B 4R26H 3P9WB 4AEIL 1YN7A 1WC7A 4EI5B 2H2PC 3ZSTA 1RHHA 2BY2A 1JPSL 2VAAA 3N85L 1NH6A 3ZKND 1U3HA 1DBBL 5BMFL 4ZXBD 1TQBB 1I8IA 1HN1A 2UZIH 5DJ2A 3VRJA 1CXFA 1FZMA 1MRFH 2E7CA 2FECL 3TT3L 5T1DL 4KI5D 3PWPE 3WIHL 1D5ZA 1DN0B 1PQZA 2NZIA 1KCLA 2PN5A 1BLNA 2VYRE 4Q2ZB 2EKJA 3GSUA 5EIQA 2A6KB 1UKSA 3UJIH 1FRGH 1KT2A 5C7XL 5J7CC 1TZGL 1AIFB 3JVGA 4WJ5A 4AM0A 7FABL 1I3UA 5FA3A 5HI4C 5CD5D 5T1LA 1WEJH 2HT3D 3REWA 3KYMB 1CXIA 3STZA 4WY7H 5F93C 4L8CB 5DLMH 3BISA 2XFXB 3C2AL 2Q8AH 3ZDZF 1CBVH 3IFNL 1KLGA 3EAKA 3PP3K 4PP2B 1X44A 3WFHB 4L8DB 5I8OL 5K59F 2X6MA 2B4CL 3MLYL 3X13A 2PTUA 3T04D 4AENB 5GSVB 2AS5M 4YQXH 2FO1A 3TBTB 1H15A 4ALAH 1JUFB 5DWUH 5E2UH 1OGTA 1FORL 4ZO9A 2EDLA 1NJ9B 1WAAA 4ESKA 1IC7H 2ZSWB 4X5WA 1ZHNA 2B2XL 4JY4A 3M17A 4NO0D 5EC2A 4GBXA 3OJ2C 1OF2B 3UJTH 5D72L 5KSVB 3EGSB 4WFHE 1M71B 4YFEA 1IEBB 3IRPX 1C5BL 1JZ8A 1ZANL 4KMQA 3MRFA 5C07D 4DK6A 1S7XA 4HMEA 4KTEL 4XBGB 1A7BA 1U3ZA 1UZ6F 1YMHB 4R2GD 1AXSB 4NO3A 4JDZB 4Y5YB 4L4TD 2JCCE 1EUTA 3GNML 4FZEH 4HC1A 4XVSL 2OK0L 1K6QH 4BUGA 5DUML 3DYOA 3QWOB 5DGQA 1F58L 4UIMB 4ZUSA 3GJEB 4JDTH 4FXGB 4HWZA 4PRPA 4HX1A 3ZHDA 4QWWC 2XNAA 2DBLH 4GQPH 4HKZB 4RISL 2BY3A 5I1IL 4LPUA 1KEMH 2VQ1A 5HPMA 1EERB 3DX8B 3BVNA 5FO7A 4GO6B 3OAZH 3PQYB 4M9OA 1K4DA 4WO4A 1S9WB 2XN9B 5FO8A 4RNRB 5I76A 2I9TA 4WW2F 1S9YB 3RKDC 4C56A 5EULV 3RI5F 4GRWE 4I3SL 5FDWA 2Y9RT 4GW5B 2I07B 4Y89A 5J1AB 4DZBA 1MF2H 3OAYH 5SX5H 3O0RH 3IDXL 2Z31D 2FLBT 3HLAB 5CWSB 4M43H 4Z7UA 5CP7B 5FYJE 4P5TB 5SWQB 2AXHA 2C1PA 4F3FB 1CS6A 4ORGA 4PJAF 3V6ZA 4NN6C 4NWTH 2CRYA 2LU7A 1MFBH 1X4ZA 4K3HA 3MTRA 3PGDB 4U1NA 2W65B 4UQ3A 1J1PH 3QEGL 2YKLL 3BYYA 3ULUC 1QVOB 3JV4A 2EZ0C 4M5ZL 3EKCA 4PRNA 3BDXA 3IDJA 4RWYL 3DMMC 4DGIH 1T21A 5E6IA 2SEBA 1HE7A 5FM4A 1H0DA 3CMGA 1EGJL 2ZUXA 5C0BB 4QF1B 2D4FA 3BKYH 3HNSL 1T7WA 3HI1B 3LDBB 5DA0B 1NEZA 3WN5C 4RRPA 3SKJH 5DS8B 4N8PA 1JL8A 4WNQB 4CU8A 4LSTH 1IGMH 3NZHH 4LDOB 4PY7A 2F53D 2EO1A 1WIUA 3ARPA 3LEXB 3MLZL 3STLA 3TBYB 3IDYC 2CDFA 2ICWB 4G7YH 4QYOA 3TPUA 2ERJB 1T3FA 5ERWB 1NC4B 1N0LA 3QUMA 4XHJD 3CAFA 3KNBA 5EBMB 2WNGA 1ED3B 3MODH 2W59A 4OCSL 4F8TA 3OKKB 2CJUH 4XXCC 4R7DA 4FQLH 3VXMD 5ANMB 4NT6A 3D25B 1YYML 2YXMA 4FQIH 1T1YB 5DQ9A 1IL1B 4OZIE 4LSVL 1QPXA 1XCTB 3Q3GB 3KLSA 4G9FB 2VL4A 4EDWL 3MUY1 2ILLA 4GAYB 3HI6H 4O2EB 2AJSH 1K3IA 2A77H 4IOSD 4ZFOB 2CQVA 1I4FA 4YHLH 5H37H 4I3GA 2CLRB 3L3DA 2C7UA 2LAAA 1NGXB 2H9GB 2PW2A 4HUWA 2G5BA 4JJ5B 4KQ3H 4WI3A 4PJ8D 1YJDL 2VZUA 4ZS6D 3KYOB 4HGWA 3WLWD 2XZCH 5D4QA 3NPSB 2NW2A 1K3ZA 4OB5L 3JXAA 4YBLC 5EPMB 5I15H 2FWOA 4I9WE 4GMTL 2EYSA 3VA2C 4LNRA 3HS0A 4XCCL 5HYQA 2P42B 5C08B 1PX3A 5D7IE 1JVKA 4BH8A 4QOKA 3RWEA 5IROA 1O0VA 1UM4H 2HP4A 5ITBL 1QACA 4IRJB 2NXZC 1OT2A 1WWAX 1ZT4A 1CGSH 1ZWIA 5DHXB 4PJIE 1SMOA 3BWAA 4YDKL 2Y7QB 4QTIL 3FTGA 4YXKL 1MCDA 1DQQA 4HKJA 5D9SB 4PJBE 2NW3B 2XTJB 3BPLC 3TO2B 4K8RL 4LEXH 5F9WC 1T0MB 3AY4C 1U92A 1IM9A 5LCVH 4M1DH 4MJ2A 4U3HA 2YPVH 4UAOB 3QWQB 3G5ZA 4KRLB 3RTQD 1CD8A 4LAQL 4POZC 1S9VB 3TBVB 1VA9A 4J1UB 1BFOA 5EU6A 1HDMA 1JPTH 2X4RB 2HMIC 4YK4B 1CXEA 1DBMH 1EAPB 4XVTL 1UKQA 2ZKHH 3C8KB 4JDVB 1OAZH 4OV5A 4PTUA 3WLBB 4DW2L 1YJDC 3SDDD 2CKBL 1DEDA 4MJIB 1KJ2L 2WV3A 3T08A 4G80A 3ARGC 5C6WH 2A74A 3MBEA 2EKSA 2XWTB 3MLSH 3RVTD 2R56L 4LIQH 3B9EA 4GAGL 1MJ7L 3BZ4B 2W0FB 3Q5YA 1JRHI 3RIFK 1B88A 4LSPL 1D9KC 5DD1L 3P4OA 1YEDA 2KBGA 3IDUA 1C08A 4Y19E 5DTFA 1QSEA 4M6AA 1WBXB 3D2UA 4D9QD 4X4MA 4KQ4H 3NVQA 1U8PA 4L1HA 1CCZA 5BQ7B 1HINH 3WXWL 1EXUB 4ZMAT 5KVFH 1Z9MA 2GY7B 2GJ6A 3OQ3B 1N6VA 1KELL 5L2KE 2COQA 5CGTA 2ZOLA 5AUMA 3T4AB 4OLYL 1VB9A 3L3OA 4EUPB 3W0WD 4K8RC 5KS9E 4MCYB 2DDQH 1FVDA 1PYWA 4YHIB 3B3IB 1A6TA 1RJZB 3HAEG 3MRHA 4ZUWA 1DDHB 1D7FA 5F9DC 1T5WA 43C9A 4Z9KB 3IVKB 1H3WM 5CZKA 5CJ5A 1J8HD 4NQEA 1X5LA 5JOFB 3KYKL 5F7MC 5HHXL 4O2CA 3I02A 3FCTB 3MV8E 5A2LH 5T5FL 1QRND 5IIEA 2X1OA 4M6NL 4MNQB 1WZ1L 2XZZA 5GGSA 1EJ6A 1WFTA 1CR9H 5ID0A 3RWHA 3ROLB 2JKXA 4HW6A 1RJYB 1KB9J 1A0QL 4HPOH 4JPVH 4JQVA 1H3VA 2WBJD 3K4DA 3TH4T 1YPZB 1MCEA 1I3RA 1IAKA 1DBKL 4P4KC 1AKJD 4MAYD 1C12B 1HHKB 1WQVT 1QBBA 3FONB 3IXAA 3H42L 1MFCH 1RIHH 1ZHKA 4KV5E 1XGPA 5D1XA 3H7BA 4PJDE 3ARBA 4U1LB 3WDIA 1NLDL 5TJWK 1R6VA 4Y5XA 4UIKL 3MCLH 1CFBA 3BZFA 4TYUA 1S7RB 4OI7A 3ARFD 4PLKC 2PXYD 4JKLA 1TQCC 4H88H 3QIBD 1K5NA 3IFPB 2BC4A 2A38A 3QQ4A 4OM1H 2JCCF 4UNUA 1BPVA 3KYNB 3LH2L 2E6QA 3HCVA 2EDEA 1U93A 1YY8B 4C83A 2YMXL 2J3SA 3CVIL 3S34L 2J12B 3RA7L 3HE6D 2N1KA 5DK2A 4IIQA 3P4NB 5IBLC 1DUZA 5CEYA 1SBSL 1OSZA 3P2TA 3MJ7B 5DJXB 3CXDL 2ZG3A 3FO0H 4KHXH 4A6YL 1G7HA 4APQB 3WMSA 4YDJA 3X11A 1N2RA 1IGCH 3DUSB 4GRWF 3G6JB 4LSSH 2K1MA 3IKKA 4JM2D 3SJVD 1TJIH 5IM7B 3O41A 2YPKA 3VGHA 5EZJB 2RJMA 1OGAB 1ACZA 3INUL 1NCNA 3R0MA 3WEXB 1FE8L 3NGBB 4JY5H 4MA8H 5DJ6B 1LQSR 3FFCD 4FFZL 1QP1A 1MI5A 3UTSB 4XX1E 1P84K 2HG5A 2ICES 1TTUA 3AC0A 3QG6A 1C5DA 4FQPA 4MJ6B 4O58L 5CKAA 2WUCH 3OHXA 2QR0B 1TNNA 3PGCA 3T09A 5GGTL 2AV7A 4HV8A 3BQUC 4P23A 5FHBH 3I6KB 1XCQB 2ADGA 2DQIH 4N5ED 1L0QA 2BRRH 1F42A 3MLPA 1NQBA 1E4WL 1N7ML 3UXFA 1IGYB 1OTSD 4JPWH 1DL7L 1UEMA 4LLMA 1M7IA 1C16B 3MOBL 2AKRA 2OR9H 3SN6N 4JFEB 1V3KA 2X9YA 3I50H 5GIRA 3RGVB 3GMLB 3ULVH 1YMME 4YGVB 1VGKA 3B5TA 5I9QC 3UROR 1A6PA 3GSQB 1ND0A 4PJXE 5J1TC 3DTXB 5FM8A 3IETB 4JRYE 1BM3L 3RNKB 4HC1H 4MSWA 3UZQA 1F90L 4KZDL 3C5ZD 2O61A 3OPZH 4D9LH 4MS8C 1ZVSB 2X9XA 1ZHBA 1HWGB 3PGFH 1I1AD 1P7KA 2ATPB 4U3XA 4YX2H 1SY6L 1FFPA 5IESL 1OAQH 1I8LC 1S7SA 5FKPB 1OPGH 4L3EE 1JYNA 4M93B 4EBQL 4DKFH 4OZIF 1RJLB 2R23B 5IEKB 2DRUA 1HIMH 4JFHD 5CS7A 4H8WC 3TBSA 5KVMC 4NQTA 4U7MA 1BGXH 5IMKB 1RUAL 5J56B 5F6IB 1OQOA 2IBZY 3CC5A 5F7UA 1J0ZA 3CJJA 5EN2B 2E6JA 3QEQE 3W5NA 5K9QI 4OZFA 1RUQL 3QO1A 2YEZA 3CDFA 3NN8B 3VD3A 1CGXA 5GRVK 2X4PB 4X8XA 1QFWH 5C09D 3CCHB 3RY6A 3F7YB 3GB7B 4V1DA 4U2YA 4KK9C 4H0GA 1FIEA 2H26B 5DJ8A 1CLCA 4TSAH 3GIVA 4KRMB 1ZHLB 2P5WE 5CZVL 1I7ZB 4AL8H 1ONQA 2CIIB 3P0YL 5DRWA 2WMPA 2XKSA 3JWDL 1FJ1B 5TE4H 1AO7A 2C3VA 4ACPA 4JR9L 3K8LA 1NBQA 2WANA 3P9MB 3G5VA 4HIJB 3NCYP 2FHCA 3AU1A 4RCAA 2ZJSH 4R8WL 3AS3A 5DJ0B 1SJEB 4TNWK 1UZ8B 5D7IF 2NY1B 3JTTB 3LN5B 2X4TA 5KG9B 4ISVB 1U3HD 3D18B 5DMKB 4KDTA 3ZE0E 1FLTX 1II4E 1CDHA 4NUJB 4X4YB 5IW6B 1JPGA 4NQCB 4LCYB 2NY2B 2FATL 4PJBF 5I1JL 3HC4L 1IQWH 1RZFH 3IJSA 2OP4L 2X09A 5EO0B 3QQNA 2F5BH 4LCIL 4Z7VB 5T1LD 3ARWA 1U8NA 5D2NC 4KROD 4PR5A 3V6OC 4OM0H 1SBBA 3VFSA 2I9LB 5EFIB 5HGDA 3VWJB 4EVNB 3E6HB 4QO1A 3U4EA 1G7LB 1T4KB 3CSYA 2AJUL 4KRPC 5HD8D 1E0OB 1FVCB 4OZHA 3P30H 1KTDB 1HCFX 5HHQA 2DLFH 4F33B 3BZEA 3JWDC 4X5XA 1F3DJ 3MQIA 1ZA3B 4QRUB 1X4XA 5C0EA 3AB0B 5TH2A 4DVRH 4TUJB 2EE6A 2W9EH 2VH5H 3BT2H 5C2BL 3QCUL 1FC2D 5L6YL 1NDMB 3HRZB 3QIWD 5AWNL 1E4XL 5KVEH 1A6AA 4HIHA 1MWAA 5HI5C 3T2PA 2IANB 5DEZA 3X14A 4XVJL 4PRIB 2WIIA 4F15C 5DZNA 1Y18B 3OGCA 5DD0H 4LL9A 2MCG1 1KLUB 2J7LA 4YUEL 4GBXD 1DANT 4R7NB 4NSKA 1UCBL 3ULVD 2WWKT 1KCVH 5FA4B 4N0CD 3QJFB 3LKPA 2ZOKB 4WW2B 3W2DH 3CVHH 4ZFGL 5T3XL 4JG1L 3QYCA 4Q9QL 1GHFL 1JN6B 3VXQB 5F9OL 5KS9F 5INDA 3V6OE 5KN5A 1HOCA 4PLJD 3TZVB 1WISA 4L8SC 3IAGC 5E4EB 1J12A 1LEGB 1J1XL 5D7LA 2X42A 3BN9C 4GG8A 3RWDA 3VH8G 3GMQA 4JFPA 1L7IL 1MHEB 1PG7H 4PRPD 1QFOA 1NAML 5ID1A 5IOPB 5HHOE 1KF9B 1L6XA 4G9DA 1TJGH 3I6LE 2WK2A 4HWEH 1EEUA 5HYIA 3PWVB 4G6JL 3UZEA 5JUEH 4RAHA 3AUVA 5JTWA 5LGKA 2GITB 3K2MC 3LMJH 1VKXB 4WO4D 2YPLA 4PJCA 1CTNA 2ZZUT 4NKIL 1JV5A 1DJSA 4C56D 4S1RL 5ENWB 4DCQB 1CD0A 3T0EC 1X5HA 2O5XH 3BGFC 3ZSSA 5E56A 2AXFB 4HS8L 5ISZE 1MREH 1CFQB 4URTB 5FV2A 6CGTA 1KPRB 3FO2A 3CPLB 4KV5F 4D0BB 3BP4A 1RULH 4FP8L 1IKNC 4PJDF 5GQBA 3QCVL 4PRBA 1H3TA 4GFTB 3QEUB 2EC9U 4GJTB 4Z0XB 5K9OA 12E8H 1DQMH 4OUUB 2O5YL 4FQXC 4MD4A 1MHHA 2EE9A 3QFDA 4RFEB 1VFAB 4RFOL 1G0DA 3I3BA 2P7TB 1CE1H 3QUXB 1NC2D 1RUML 3GBNH 5B39A 4XMKH 1LE5B 4NHUA 4RZCA 4HULB 1U8MA 3IXTB 5AYUL 25C8L 2XKNA 3S5LA 1XH3B 3F5WA 3GSXB 4XMPH 4LGRB 4NDMA 3U30B 4YHZL 3LV3A 2FZ3A 4CVWA 4L8BB 1U42A 3QO0B 1A5FH 1SYSA 1VFBB 3F65A 1BD2E 4MQ7A 3HZKB 2HKFL 5CJOH 3QZWA 1T6VN 3TC9A 1AI1H 2E9BA 4M02A 3U7WH 3DO7A 5TF0A 5D1ZB 5KTEH 4U1SA 3X17A 1CIDA 3VG9C 3T0EE 5I1DA 5ADPL 4F9PA 1YECL 4FQHB 2NTFA 2VXQL 4ZNEE 2EDHA 5FO9B 1H5BC 4YWGH 3BFOA 4PRHE 5F96H 3D87B 2DWEB 3TCLA 1YEKH 1UT9A 3GSWA 3HZVA 1IAII 1NBYB 1QLEL 4OCXH 1P5VA 3QDMA 1S7QA 5FUOH 4LARH 1D5MA 2Z92A 4XNZC 2VDLL 5BW7C 1S8DA 2CSPA 3FB5A 3UO1L 3CD4A 2P44B 4ZSOA 2ZCKH 4U1IB 5T3XE 1ZEAL 2ZPKH 2CK0H 2HVKA 5AD0B 1XGUA 1W72H 3V0AC 2E27H 1RI8A 4W68A 4XAKD 2GK0A 2NLJA 4NZTH 1V3JA 4TNWF 1NDGB 3OX8A 2IAMA 3TYGL 1CFSB 2IH1A 5FYJU 3QDJD 1D5XB 3SE3C 2DL2A 5I1CH 5BVPL 5JXEA 5B8CC 5T3ZH 1T89C 4XH2B 1SVZA 4G8IA 2V6HA 2G75A 1SJXA 4NQDB 4QRRE 5EOQH 1H8SA 3HG1A 2VUYA 5C9JA 3EFFB 3SCMA 1DZBA 4NRYB 4PJXF 3RQ3A 1DE4A 2OR7A 4QNPE 4ZD3L 4JN2B 5EIIA 4XNXL 2GYSA 4KJPC 1CGYA 4ETYA 3MRDB 5J6HB 1UH2A 3GSOB 4ODSH 5I1GL 4TVPH 3GSVA 3FQWB 5C0CE 4QOKD 1W0WB 1A7RH 4P2RA 1BMGA 3MV7E 2FL5A 2GFBB 2A6DA 4PBVC 2P24A 2G60H 1EO7A 2YRPA 4G6ML 3CFDB 2RBLA 3CZFA 3LKSA 5DZLA 3TIEA 3QNZA 1T2QL 1NGYA 5CINL 3O9WC 3GEWB 1U91A 1L0YA 4MLSA 1GZQA 5E2WH 5I6XC 1IFHL 4LLUA 3SDAC 4XBEH 5C92A 5AG9A 1S78C 1JJUA 4TSBH 1ZE3C 2BNQA 1ZT1A 2VUOA 1HHIA 3LS5L 5EU6D 4M5YH 3PWPB 1QFWM 1WV7T 2VLJA 4WDIA 4YXHH 1I85A 1LDPL 3L5WB 4Y5VC 3QA3A 1QR4A 2HFGH 3HFML 3O8XB 2BCKA 2R2EB 4LCUA 2OR8A 1BFVL 3GI9L 4L9DA 3AREC 4PJGA 1CDGA 1RIVH 2XZAH 1P2CA 3RX8A 4O5LL 4NZUL 4X80H 3DI3B 1UADC 2PYEA 3TJHC 3ARDA 1BQUA 1FLRH 2H6PB 1G6RH 4P2OB 2GSGA 1RURH 3MO1B 4M00A 1JNHB 2BVUA 2YA0A 3MA9H 4JO3H 3ZE0F 4P3DB 1H3XA 1ZLUH 2E8YA 2GJ6D 4MA3A 3C6LB 4JHBA 1BX2A 1TVHA 2YRLA 2BNUA 3GMPB 4QRSB 1RZKH 2J8UE 2MQ0A 1OHQA 1QLFA 2FNBA 3IJYB 3MMEA 1TITA 4YXLL 4KI5C 3U1SH 4FXKB 1JI2A 1LK3H 3DRQB 4Z95H 3QJHA 1MCQA 1CI5A 4V2BA 3RNQB 3TA3D 4UU9B 4X6BB 5CD5C 5IQ7H 4R4FL 4QHUB 5CLWA 2HT3C 3BXNA 3PDOB 4LPXA 4YHKL 4YEFA 4NQED 5FK9B 5GS0H 4HJGA 2OZ4A 3U6RA 5A2IH 5I1AB 4TUKH 4G42B 1WF5A 1UXSB 2VDRH 2VERN 5ESVB 1VADB 1QO3B 2IGFH 4JGJA 4Q9RL 4MD0A 1ZTXH 2FRGP 1G9ML 2JCCB 5GJTL 4HQQL 2IPKB 4Z5RB 2QBWA 3AVEA 5AAWA 4OZFH 2VB5A 3PE9A 3MRNB 4G3YL 2WWMD 3DLQR 1N3NA 5FCUH 4X6CF 2CR6A 5KW9L 2VLME 4PS4L 2IFFL 4HPYH 1DCLA 4JAMA 4BZ2H 2IPUG 4EN3D 3CLFL 4YDLB 3OF6A 2G2RA 1G7QA 5D1XD 1U58A 3ARBD 3HMXA 1LD9A 5JW4R 1J86A 2RAMA 5K9KA 1QA9A 5I18L 4L3CB 5T3ZD 2WAHA 4ONOA 4ZPTB 1KJ3L 4JFFA 5D5MA 4GRWB 3PABA 2FJGB 3CFEA 3QAZC 4KI5E 3CFJA 3GJFB 4PJHE 5DEFB 3I3EA 5F7YC 3SDXA 1HI6A 4HKXA 1AP2B 1QBML 1BQSA 1F13A 3B6SB 4WEUD 3VGFA 1J5OH 1F4YH 3CZJA 3V4UL 5JHDA 5E2JA 5I1HH 1WWBX 2R4SH 4TVPD 4NIKB 4KK6D 2OMNA 4BYHA 3QUYB 3CX5J 4UT9L 4OZ4B 4PJ9C 4ZAKD 4S1QH 1I9RH 4G8FB 4GQ9L 3V4VH 2YD5A 5EORH 1IGTA 1R3HA 4DAGH 3BH9A 2IALB 4Y4FB 5H94A 3SHSA 4K3EH 1R24B 1FN4B 2UZIL 4Z6AT 1A02N 3WKML 3VXRA 1G9MC 4TPRH 4N0UA 2ZUTA 4UT6H 4HFUH 5FXCH 3IB4A 3CFBB 5FM5O 5DHVB 1J05B 2Y07H 3UJIL 5MENA 5MHSD 2D2OA 4P3WA 1K2DB 3QQ3B 1AR2A 1T04A 4LGPB 1BQLH 1HNFA 4POYA 1KNOA 2APVA 2NY3B 1AY1L 4FQ1H 3UAJD 4ZQKA 3VFNB 2HFTA 4G8EA 2DWDB 1TENA 5INCA 2XPGA 2Z31C 4NBXB 5I1EH 4WWKB 5ACMA 1MI5D 5DLML 3BEWA 1U8IA 2Q8AL 4TTDD 4GKZA 2QSQA 1UACH 4IDJL 4HK0B 4P23D 3L3IA 1DQDH 2FJHB 4NC2B 4IOFC 2F8VA 3JUYA 4S2SA 4ALAL 4NN6B 3BIBX 5DWUL 5KSBA 4L4TE 5E2UL 3CDGB 1RZGB 3G5XB 4OZIB 1PEZA 2A83A 3EJYC 3B2VH 5J6GB 1TTFA 3GRWA 5F9AC 2OI9B 1IC7L 4JO2L 3SDCB 4JN1H 3P4MB 4TTGA 5D8JH 4ZDHA 1QEWA 1TVBA 2VE6B 4N9GA 2VLLA 5HYSG 3GMMA 4HXBL 3FMGH 2FJFB 4PGCA 3EYOA 3DMMB 2JJUA 3UJTL 2GTZB 3MACH 1MVFA 1RMFH 4TNVK 3U0PA 1F4XH 5JOPD 1M7XA 1OP5H 1XF4A 1BQHB 1U8LA 3D85B 2QQNH 3UTZA 3WN5B 2M2DA 3MLXH 4G8GA 1MAJA 1PZ5A 2DYPA 5IB3B 4FZEL 2FDBP 1X5YA 1I9IH 1K6QL 3GO1L 5GS0D 3WUZA 1E6JH 5CEXB 2HJKB 5GS1C 3IDYB 4Q0XH 4BELD 4G5ZH 2V5MA 3TWCL 4JDTL 4OIBA 1NMAH 4JFXA 4AG4H 1HSAA 2WM0A 3H8NA 4BKLA 4WV1A 1QR1B 5DYOA 4XWOD 2DBLL 5D7IB 3C6SA 1IGJB 1G9EA 1KEML 1ODAA 1FSKC 4CADA 3BGAA 3TLRA 4XB8A 5IHUL 3DUUB 1A7OL 1CICC 2YC1A 5DQDH 4OLUH 4N8CH 2E9IA 4JZOB 5BO1H 4X8JA 2FGZA 4Z7WE 3VJ6A 2CUIA 4TVSa 3O0RL 4PJBB 3M07A 3SKMB 3MJ9A 4X98A 1FIGH 1TZHA 2NPLX 1KENH 1XF3B 1AO7D 2BFVH 4N8VG 4ELME 1E4JA 5HHVH 3BP7B 1M4KA 4JO1H 1FAKT 4ZFFB 4ZS6C 4NWTL 1HH6B 1V3LA 3WLWC 1DN0A 1LO5A 4LPTA 1I1FA 1MFBL 2F53E 1ZT7A 4RIRB 1AH1A 1OD9A 4KK5D 2A6KA 4WTZG 4N0YH 2IPUK 3MV01 5D1QD 5E8NB 4C58B 1IMHC 1K8DA 4EZMA 2HWZH 2GI7A 3BKMH 2EEAA 3UPCA 4YBLB 2LVCA 4Y4KC 2V7NB 4RAUA 3HUJE 5GGVH 2DKSA 3REVB 1T20B 2EDTA 2E6PA 4U1JB 4DGIL 3VXME 1VSCA 1JYWA 2P8MB 2OSLB 4HHAB 2XA3A 1FQ9C 3BKYL 4NBYB 4R4BA 3SKJL 1A2YB 4XP4H 4Y19B 4M6OH 3WFHA 2ZSVB 4LSTL 3NZHL 4FQCH 5J13C 1FL5B 3PHSA 1CLZH 2I26N 1QSZA 2R0WH 3TBTA 3KPQB 4G7YL 3K1DA 1MH5B 3EOBB 2VZVA 5L2KB 2NY7H 3BPLB 1M6OB 3TO4A 5F9WB 1RUKH 4J23A 2ZSWA 3MODL 5C3LD 3W39B 2CJUL 3X3FL 4LMQE 4FQLL 5AZEH 5T5NG 4CDGC 2LTQC 5KS9B 4GOSA 4W4OC 4FQIL 5FUZL 3LCYA 3GMNB 5KSVA 1KG0B 1M71A 1NL0H 2XT1B 5JLZB 3P11H 4XBGA 2XXMB 1YMHA 4HZLA 1AXSA 3BKJH 3FZUC 4YHLL 3I6GB 5DVOA 3O4LA 3ARGB 4WHYH 2MHAB 3VFWA 2EIEA 4JGUA 4KKLC 4D3CH 3WBDA 5GRZA 5DQJA 3DRTA 5BZDB 1CG9B 1NCDH 2J8UF 4UIMA 4K55A 1R0AH 4MJ4A 4KQ3L 1D6EA 4BQCA 4MCZB 3ARYA 3WHXB 5JMRA 1BVKA 2BERA 2XZCL 3DVGA 5EU3A 3WDHA 1MRCL 3NACH 4UT7H 1FP5A 2BSTA 5E08L 3SGKA 5D7LD 4ENEC 3DX8A 4PJDB 2QQLH 4Z7OE 5I15L 3MLRH 3RHWK 4XBPA 4RQQB 4QTHB 2DQGL 5J12C 1J0JA 5H37G 1S9YA 5HYFA 1I1RA 1G7MB 1LP9E 2ZUSA 5J1AA 4F57H 3VD9A 4RGND 1R3IH 3HLAA 5CWSA 4ORZC 2RR3A 2ATKB 4A2LA 1UM4L 4GKNB 3KPNB 3RWGB 1I9EA 1CGVA 4NCDA 1OW0A 5GGRY 4F3FA 2OLDA 5J4MA 1CGSL 1ZVYA 2H45A 2Q76A 2XTLA 5I75C 5D6DA 5J0BA 1FFRA 4Y16A 5E8PA 1ORSA 3EHBD 3L5HA 4GRLC 4X4ZA 4LEXL 1XIWD 2X41A 2DJ4A 3WFBH 3LVEA 2NQCA 2W65A 4MQSB 4AEEA 5LCVL 4M1DL 3EO0A 2YPVL 4M4RA 1KJ2B 1SEQH 1XF1A 3ROOA 4D9QE 1DBML 2J2ZA 4MAYC 2IQAB 1U8KB 1ITCA 2ZKHL 3HAEB 1OAZL 4KI5F 4PJHF 3VI3E 3KYAA 4P4KB 4XCYB 4DGYL 3E8UH 4HWNA 3HI1A 1OARH 1T7XA 2RFXB 4JB9L 4HCRL 5DS8A 3LKRA 3T0XA 4LPVA 1RZ7H 4QT5A 3W0WE 2PXYC 2VL5B 4J2XA 4Z7QE 3QIBC 3LEXA 2YS4A 1P4BH 3OKMA 3F7QA 2UZYB 3UP1A 5DUPH 5A3ID 5FV1L 4XWGH 1JRHH 3FO1B 2EDYA 5EBMA 1ED3A 5ESQA 3OKKA 1J8HE 4KQ4L 5DMGD 4CW1B 4JFZH 5ICZB 5KVFL 3D25A 2ED9A 4QCIB 2V2TB 1QRNE 2NY6D 4XP5H 2P48B 5LGHH 2EDOA 1X7QA 2UVEA 3UCRA 4G9FA 4FQQB 1NGWB 4WUUA 4L4VA 1MVUA 1FG2B 3C5SA 5TDNA 3OAZK 5DJCA 4GAYA 2VISA 4O2EA 4HS3A 5DJAA 4OKVB 1L9MA 3CSPA 4ZFOA 2OZ4H 2IH3A 5BCAA 1VFUA 3OAYK 5SX5K 4P46B 4H1LB 4ODVH 1CXLA 3QIUC 4QKXB 4PJXB 2X4QA 3HNVH 4PJ7E 3NAAL 3VXTB 4JRYB 4B0MM 4PRDB 3RBGA 5IB5B 3Q6FA 3GHEL 5DJYB 4CBPA 4AT6A 4MZ3A 2QV2A 2JJTA 1VFMA 5IT2H 1ZSDA 3MRBB 3PL6A 4OIIH 5E00B 2PW1B 3QUKB 1CR9L 3MRMB 4L3EB 2IAMD 3NIDE 3LOWA 1BFSA 1VFOA 5EPMA 1DVFC 5JW4M 4HPOL 4JPVL 4N5EC 5IMOA 3HMXH 2X9WA 2I60H 2MCPH 4MVBD 3DJ9A 3V0VA 1EEYB 1OTSC 5JXED 4RFNB 5C08A 3BQUB 3V5DB 1OTUD 1JWSB 1OAUH 3QEQB 5LG1A 1FYHB 3HG1D 3NABH 1MFCL 3SCMD 2DQTH 3TN0D 5IEHA 1UFUA 5L0QB 2VDKH 1T1ZA 5B3JF 3EDEA 3QDGD 3S96A 2BXYA 3MCLL 3GBML 4LOUD 2AV1B 4OGYL 1KTRL 3WNNA 1VCAA 3B9VA 4LLQB 3MRGA 4HUNB 5IW1A 2P5WB 3CUPB 3CX2A 4A6YB 5I9QB 4OM1L 1T0MA 3BPNC 2ITDB 1UWGH 1I7TB 3SJVE 3ISWA 4LRNH 4EJ1C 3LY6A 2CLVA 3C5ZC 1JBJA 5B21A 1INDH 1BWMA 4LHQB 3NCFB 1I1AC 5M7QA 5DRXB 3FB6B 3TBVA 5J11B 2X4RA 3QPXH 2Q6WB 3FFCE 4JG0H 1LEIA 9CGTA 4HMCA 4S1DD 3WFDH 3O6LH 4GUPB 1HHHB 2C4FU 2BNQD 1WITA 1F3RB 4HBQA 1B2WH 2HRPH 3U2SA 5F7LB 1IGCL 2VLJD 4LIQE 3SKNB 1D5IL 1JPST 4LSSL 3GI8L 3BZ4A 4PJEA 5F6HI 1NPUA 4K3GA 4GMSH 5AEAA 3VRIB 4ELMF 3RAJL 5CJBA 1AGBB 1MHPH 3LD8B 5DK0B 4MA8L 2UV3A 3NFSH 2Y6SD 4UBDD 1IGFH 2OJEB 3ALPA 3MPCA 2W0PA 3FN9A 3T4AA 3ARDD 3SQBA 1MY5A 5DA4A 3RHWF 2DB8A 2VOTA 5FHBL 3GRWH 2DQIL 4EUPA 5MEOB 5D7JB 2BRRL 4JE4B 2ICEB 4MCYA 5KSAD 3RUGA 2EYTB 4OZGE 3B3IA 4JPWL 5JA8B 4E42B 1ZMYA 3QI9A 5DC9B 1RJZA 4Y4HB 1DDHA 1U3HC 2J6EA 1PSKL 3VXOA 1N4XH 4GT7A 2ZUVA 3I50L 2P5EA 3BIKB 3IVKA 1G7IB 1HQ4B 3L3HA 3GBLA 3WUWA 4BZ1H 4C4KO 4JFHE 5E2TH 3ULVL 2UY6A 2FH6A 5IQ9A 5IWLC 4GRMB 3N0PB 3BAEH 4LGSB 1FL3A 5C8JA 2CDEB 4EI6B 3ROLA 5C09E 1A6ZA 4GS7C 4PBXA 1DQTA 4YX2L 2YUVA 3LRSA 1OAQL 1Q9OB 3DARA 2R1WB 2ZG1A 1HHKA 1OPGL 1S9XB 4LF3B 3FONA 5SWZA 5JPNA 2VR4A 4XVUD 5EA0H 3NH7H 5F7NC 3SE4C 4U1LA 1HIML 3F7VB 5IG7A 2GTWB 1A64A 2A0LD 2FEEL 4KRPB 2A73B 3MOAH 1BGXL 5IB1A 3RZCB 2FECI 3SY0A 5HHOB 3IKCB 3H9HA 4JPIA 3LS4H 3IFPA 3OF6D 4RMWA 3H7LA 1QFWL 2AQ1A 4PGZA 3QIWC 5EZLB 3F6LA 1YQVH 4KUZH 4JFFD 1JZ7A 5D96C 3KLHC 4OQTL 4TSAL 5K93A 4R0LC 4AL8L 3ZTNL 4LLWA 3MJ7A 5DJXA 5ISZB 1QD0A 3LQZB 4F15B 3ULVC 5TE4L 4N0CC 4HLJA 1I3GH 2JLLA 5JHDD 5CSBA 1AGDB 5FYKH 1EEZB 1OCWH 2HN7A 4WHDA 3DHMA 2ZJSL 3OJDA 2Z93A 4LSRH 1RD6A 5F7KC 3KR3L 2F5AL 2MKWA 3BD3A 3OXRB 1LP9F 2Q1EA 1Y6MR 4NQXA 4HWBL 5IM7A 1FNFA 1YEGL 3RDTB 2XACC 1IARB 2D03H 4BQ9A 1IJ9A 3VXRD 2PF6A 1T03L 5AG8A 2NY0D 1EBAA 3QNXB 1J0KA 3WEXA 3EJZD 4BQ6A 1I8MB 1JGEA 2ZNWA 4AYFA 3O4OC 4R4ND 3UTSA 3L7FB 1AGEB 1XGQB 5MEND 4WI6A 4WO4C 1R3LA 2QR0A 1SEBB 1LE9B 1BD2B 1YUHB 4O02H 4OM0L 3I2CH 3I6KA 3IF1B 1CWVA 5T1KB 1T66D 3WJJC 3UDWA 4OLEA 1EX0A 1BBJA 1NFDA 3FB8A 3PUCA 3DURB 1A6UH 3FRPA 3T0EB 1FZKA 3BGFB 3P30L 2BJMH 3VI3F 1T1XB 3HNTH 1NANI 3ULVE 1NEZG 1IC5H 4RRPG 2DLFL 3V5KB 1TQBC 3VH8B 3RGVA 4PRHB 1RIUH 4P3CH 3NTCH 1RK1B 1IQDB 1UB5B 4YGVA 3JWOH 3BO8B 4RMQA 4DVRL 4KHTH 2VH5L 3BT2L 1JF6A 3IETA 4FQXB 4B7LA 4Y1AA 2OTPA 3LIZH 4KFZC 2OTUB 5KVEL 3DVFA 2Y06H 1UWEH 5KVDL 3C9NB 4PRPE 4HJJH 5IHLB 1NGPH 3IGAB 4ONHB 3BOVA 4CAGA 4W4NA 1MLCA 2R23A 1KCVL 3AXLB 1MOEA 3W2DL 3S9DB 2V9QA 3CVHL 3IU3A 1NAMB 1OWWA 4G8GD 3UC0L 5EU7C 1CDYA 4N0RA 4C56E 1MAKA 3MCKB 1WCBB 2VITB 3MXVH 4QRRB 4CDHA 1GSMA 2GJZB 2LVEA 3NN8A 4Z7UE 3QXAA 2X4PA 4PJ7F 4KXZH 1SQ2N 2VDPL 3F7YA 4QHLB 3U9UB 1PG7L 1N5YH 1MFEH 2H26A 4XTRD 4F7CB 1A3QA 2GUOA 1H5BB 5E8EB 1TNMA 4RGMB 1TJGL 1I7ZA 5HYJA 4G7VH 4UTAH 5C0CB 4PLNC 1CVRA 1C7TA 5IK3A 1B6DA 3MV7B 3LMJL 4LCCA 4NNYB 5DURD 3WFCH 3P9MA 3PF2A 5ADOH 4HIIA 1MHCA 5IKCB 4I2XA 2O5XL 4M8QA 1HK6A 3UMTA 4Y5YC 1S7TB 1V8HA 3S4SA 1C7SA 1SJEA 5E8DH 3OAUL 1UZ8A 3F58H 1UA6H 4FQ2H 3LN5A 5KG9A 4ISVA 5DC0A 1CIUA 3OV6A 3G6AB 1WBYA 3IDIA 1RULL 3D18A 5DMKA 1OQXA 3MXWH 4PYGA 4NO2B 3DXAA 2WSKA 4NUJA 5ACZA 12E8L 3O6KH 1DQML 4U6HB 1EUUA 5EU7E 3CMOL 5FGCE 2P47B 1VACA 4LCYA 3HZMB 3ORJA 3EDKA 5B8CB 1CE1L 3GBNL 4XMKL 5FYKD 2HJLB 2JB6B 3HZYA 2P8PB 1T22B 3QP3A 5IB4B 4MZ2A 4Y88A 5TQ2L 1XGTA 2BNRD 5EZIH 1LNUA 3BX7C 2I9LA 2FO4B 5EFIA 2VXUH 4I48A 5CILH 2APFA 2DTMH 3OMZA 1UQSA 2EDDA 2Q3AA 3KJ4C 3Q6GL 4I0CC 4P0DA 1LGVA 2KKQA 1U8QA 3O6MH 4OCMC 4P5TC 4HT1H 4YHNB 4LVNC 3WKNA 3FT4A 2VDOH 4F33A 1AI1L 4F80A 2BP3A 3PWUB 4JQXA 2QKIA 2HFFB 3H9SD 4NQVB 5KTEL 3K8KA 3FHQA 1QFPA 4XAKE 5MP6L 4YFDB 5LJYH 3FFDB 3UYRH 1NBZB 2J8UB 3O9WB 3TO4D 5IHZB 1CZ8H 4YWGL 5CBEB 3SDAB 5F96L 4F58H 2VN4A 3QDJE 3DSFL 2IANA 4OD3H 5IHBA 1YEKL 4JGMA 2JELH 4KGLA 1EZVX 4HG4J 2PCPB 5I66B 1Y18A 2KZ1B 3D9AH 4MD5B 1IAIH 5IV2B 3KAAA 4L9LC 3RWJB 5FUOL 1SYVB 3S36H 1P4LA 4Y5VB 4R7NA 3BRFA 1MPAH 3RWFB 1JCKA 3QJFA 4M7LH 5E94B 2ZCKL 4NJAH 4XC3H 2ZPKL 3HN3A 2C1OB 1L9NA 3QRGH 4DZ8B 1W72L 1MIEL 4NP4H 5C0AB 2E27L 1JN6A 3O4LD 4JEGB 3PWJB 3T65B 8FABB 4NZTL 3TZVA 5CP3A 4OZGF 3GSNA 4CVXA 4NHCH 3QB7C 3DX9A 4QOKE 4AZ8A 4JLRA 4PJAA 5I8EA 3ZDYE 5F3HA 3ZT7A 43CAB 2VC2H 3WL9B 5I1CL 1A7NH 4YR6A 1OAKH 1F11B 3KPPB 5IOPA 4ZOBA 5EOQL 3V8CA 2DKUA 2FSEB 1J1OL 4O00A 2FYYB 2GAZB 3PXJA 3FOMA 3TBWB 3BHBA 2CK2A 4C4KT 1VKXA 4RMSA 5GSRB 5CJXA 3B8YA 4ZXBB 1OP3K 1MIMH 3N1QC 4X7SH 5ENWA 5C0RL 3WO3B 1UYWH 3FN0H 5EU6E 3HHRB 4CNIA 3TA3C 4K7PH 4PJHB 3VFGH 1ZLSH 1A7RL 4H5SB 3FOLA 1OAXH 1KPRA 5FYLH 3BWUC 2G60L 2IG2H 4ODHH 2XQBL 2JIXD 5DRNB 4P57B 1PKOA 4Y16D 3ZO0A 4U6YA 1JGUH 1IAOA 1VFAA 5E2WL 3L5IA 3NPSC 2P7TA 1WBZB 1LE5A 1JTTA 4HBCH 4K3DH 1EO5A 2WWMC 4DWHA 3SE8L 1AD9A 1QSEE 2EDBA 2J8HA 2VDQH 4M5YL 3K81A 4HH9B 4GG6F 3OXSB 1XH3A 1N6UA 1AFVH 3GSXA 3FQUB 4OTXH 4EN3C 1YEEH 3DGGA 2GJ6E 2HFGL 5D1XC 3U0TB 1URLA 3ARBC 2OL3A 1WZLA 1VFBA 2WINA 3QISA 4IRJC 1FBIH 1RIVL 2XZAL 2I27N 5F3BB 1R5VB 2UZXB 3GUTA 2KL6A 5GGUB 5IGXH 5IJVA 4NO0B 3QAZB 4NPYA 1HQRB 2Z8RA 1CN4A 4P9HC 1FLRL 4FQHA 1G6RL 3K4AA 1A6VH 1RURL 2AK1H 2BY0A 2J6EH 5FO9A 1HNGA 4NQEE 4NRZA 2NYYC 3UPRA 1KFAH 5C07B 3N1MC 3MA9L 4JO3L 1I1YB 2YK1L 2WIMA 1B0GA 4R2GB 4ZAKC 4ZYKA 4M48H 2BOBA 5JNYB 1NBYA 4L4TB 2MQCA 3AMKA 1RZKL 4G9FD 4QRPA 4WUUD 4L4VD 4PJ9B 5L7XH 3C08L 1CL7H 4LEOA 4D0DB 3U1SL 3CFIC 2YN5A 2D0HA 4U1IA 2IADB 1GZPA 1LK3L 4Z95L 2Y72A 2W60B 1B0RA 3KDMA 2D7NA 5B38A 2EDNA 1SJHB 4MXWL 5IQ7L 5HDBE 3BIAX 1CFSA 4HEME 4JKKA 1YNTA 4NC1C 4Q7DA 3UAJC 4TUKL 3F12A 3BP5A 2VDRL 2X4UB 5T3ZE 3ULVF 5FUCE 2AJVH 1BF2A 4ZNCD 3PL6D 2IGFL 3DROB 1KTLB 5T33H 1ZTXL 1PG7W 4ZO7A 4NQDA 4RAVA 4ODWA 2C4XA 3PWNB 5MEPB 4XP9H 3EFFA 1GCFA 2Z31B 4NRYA 1L0XA 4TULH 3NFPA 3SKOA 4DUXA 3JTSB 4OV6F 1JHTA 3RU8H 3OKEB 4JN2A 4I4WA 1BZ9A 3D3VD 3FQTB 3QUZA 4LP4A 4TVPE 5C08D 3G08A 1R5WA 3NA4A 4HPYL 4BFIA 2AVGA 5HDQH 5HI3D 1FYTA 2AP2A 3FQWA 5CMAB 1W0WA 2VXSH 5DI8A 5TDPA 1M1SA 2B1AH 3RFZC 3THMH 4BH7B 3RVUD 4PD4J 4K9EH 3ILPB 5C6TH 4AY0A 1AXTH 3CFDA 5I71C 4UV4H 2XI9A 3T0AA 3P9LA 1RZKC 4Z7WB 2BVEA 3VD5A 3K80A 2R0KH 4PIRF 3VFVB 4IMLB 2XWBB 4WI5A 5TGBB 4OZFG 1CU4H 5I19H 5MHSE 3QBTB 5SWSA 1J5OL 4ELMB 4JFQB 3DV4B 1MY7A 4K23H 1CT8A 4NC1E 4U1HB 3VFTB 1ZA6B 3SE9L 1SM3H 3JV0A 5EBWB 5FYLD 1EIBA 4ZOEA 3OJVC 2F53B 4S1QL 3QG7H 4ERSH 1I9RL 1MI5E 3V4VL 3U4BH 5I2IA 5EORL 4DAGL 1BEYH 4K3EL 2Z4QB 5EC1A 4BUHA 1AQDB 3O2WH 2GEEA 1JWMB 4XWOC 3MYZA 4OD2B 4UT6L 2YR3A 4HFUL 1LILA 5H2BB 3VXMB 4PRAB 5I30H 3W9EA 2IQ9H 2Y07L 1FDLH 4QXUH 1TCMA 1MFAL 3SBWA 2BMKB 4HDIB 4S11A 3HR5A 2AABL 2Q86A 3G9AB 5KSUB 4FQ1L 2WZPD 3FAWA 2VZTA 4MX7A 3MFFB 1D5BB 4P59L 5I1EL 3D48R 5HXMA 5HBBA 4YPJA 2I24N 1X5XA 5DC4B 1UACL 1KIRB 4NUGH 1BZ7B 5JOPE 2EXYD 3IJYA 1DQDL 4W6XB 3VE0B 4FXKA 1KN2L 4APQC 3CU7A 3DRQA 1G7JA 2QADD 4M1GH 3FT3B 4PJ8B 3QI9D 1P5UA 1GGBH 3OGOE 1YMMD 5D1QC 1G84A 4F2MB 2P5ED 2Q8BH 5F6HJ 4JN1L 4NKMB 4LHJB 3BGMB 1DQJB 2APWA 5I1AA 2CLZB 5ESVA 4F7EA 5K9JL 1E27B 5D71H 1VADA 3GHBH 3NGBC 3T8XA 3FMGL 1A1NB 4ODUB 2JCCA 4RSVA 3UZVB 2AJ3B 2IPKA 4PP1D 3MACL 4OFDA 4Z5RA 1RMFL 2UYLB 1F4XL 5TQ0L 2VLKD 2WP3O 3LKOB 3MNWA 5E1AA 4RX4D 2QQNL 4LBEB 4XCEA 4S1SH 4QEGA 3K8MA 3T2NH 1CK0H 1I9IL 3N06B 5J13B 5SWZD 4LSDA 1E6JL 5CJQH 1ETZB 3MV11 3EO1A 5GGVY 3KLAA 4G5ZL 1WTLA 1AO7E 4QGTA 1NMAL 4AG4L 4ZPTA 3T3ME 6FABH 1EFXA 1RUPH 2QSCH 3RTQB 3VDAA 5EU5A 5JW4N 2NR6D 1LP9B 3GJFA 2QSTA 4QXWA 5DD3H 2LTQB 2AJXH 4FHBD 4U6XA 3L7EB 1ZOXA 4LKCB 1S7UB 1AP2A 2VIRA 3EZJB 3W11D 1TETH 3O2VH 4M9PA 2HJFB 3SDDB 3M8OH 3ZDYF 3PWLB 2R0ZL 4N8CL 1WFOA 4OLUL 3S36X 1BOGA 3MGAA 5BO1L 3TV3L 1ZLUK 2RCSL 3ABZA 4NZRH 1FIGL 1TCRA 3MUJA 4KZDH 4Z76A 1KENL 3EW3B 3L1OH 3VU2A 4B41A 1JZ3A 2PETA 1BVZA 2BFVL 5HHVL 4XZUA 2BVQA 5E2VH 1R24A 1FN4A 2JB5H 1JNLH 2P8LA 4JO1L 3MGTB 5I1LB 2H2SD 5JW3L 1GVIA 1DBJH 1GGUA 3BW9B 5F6IC 1Y6KR 4I77H 4QLRA 4NRXA 1TIUA 4D0CB 4ZPVB 2B5IB 3UPAA 3CFBA 5KVGH 4N0YL 5BV7L 1CFVL 1LO4H 2VWEC 1KULA 5CLTA 1K2DA 1I9JL 2HWZL 4OZHE 5FIEA 3BKML 4JZJB 4DGVH 4XP1H 3MRCA 4YAQB 2NY5L 5I8CB 5GGVL 1E4XI 2HVJB 3WV0A 1RZ8B 3H0TB 3W0WB 4GSDH 5J12B 1Z0NA 1INEL 3QFJB 1AGCA 1BIIB 5B39G 3UTTD 4K7PX 4FNLH 4HK0A 4XP4L 5F7WC 3U36B 3U46B 4H26A 3U7YL 4M6OL 4IS6B 3MNZA 1J8HB 1DSFL 4FQCL 3EHBC 5F7DA 3S5LG 2R0WL 1XIWC 2X4SB 4NYLB 3CDGA 1QRNB 3G5XA 4NO5B 4OZIA 3EYQD 2NY1C 4GRLB 1HXYB 4J8RB 4MLIA 3X12B 5AZEL 2PYFA 3KPOB 4KKBD 3QZWG 1EH9A 2EH8L 1OM3L 2WBJB 5LAXB 4YBHA 1PKQE 3O3BB 2FJFA 3OKDB 1JMXA 1AKJB 4MAYB 3DMMA 4KVNH 1NMCB 4PJ7B 5CP3H 3GSNH 4JPKH 1FO0H 3P11L 4Y1AD 1BQHA 5D7LE 2EECA 3VW3H 3E3QC 3WN5A 1HH9B 5E5MA 5BV7C 1TZIA 2DQUH 1N59B 3PV6A 3QEHA 5ITFB 5IB3A 1CDUA 3ARFB 5A3IC 2PXYB 3MV9D 3TH3T 3QIBB 4D3CL 2NY5C 4HMDA 4RGNE 4YHOH 3IAPA 1NCDL 1F97A 1KXQE 1MQ8A 5A40E 4WEBH 3QPQC 4PJCE 3QXDA 3BPCB 1IC4H 3HE6B 4U1MB 1UG9A 5GRYA 3RVXD 1EBPA 3NACL 4HGMA 4U3CA 1QSFA 3AB0C 2QQLL 1UH4A 1UVQA 1QG3A 1KCKA 2D7TH 4JFDA 1FZOB 4F37K 2EH7H 4FFYH 4WHYG 4PG9B 3O45B 2ORBH 4F57L 5HYJD 1R3IL 1PJ9A 3FQRB 5LQBH 1RK0B 3SJVB 4JM2B 1IM3B 1KN4H 2EDWA 5BRZD 4H0IA 3O6FC 1HXMB 4HXAH 3VRLE 2A9NH 3KPLA 4ZFFA 5CD3B 1Q9KA 4WU5A 4WW2C 1NCUA 2VMFA 1Z3GH 4K07A 1UM5H 5ALCH 5L8LB 3FFCB 1T0NB 3F6IA 4OLXH 3WFBL 1N6QL 3B5HA 3ZHLA 5E4EC 5CGYC 1SEQL 3H3KA 3VGDA 2OL3H 5JXEC 2GSIA 1MJUH 3DXAD 5F44A 1OTUC 1T20A 4I0PA 3I75A 4GKSA 2OTWA 3TNNB 5E8OA 3SCMC 3MA7A 3CFKA 2NY2D 4P4RB 3TN0C 2P8MA 4CJ1A 3LEVH 5ETUB 3LN4A 3E8UL 1A9BB 3VXSD 1JGVH 1U6AL 2G5RA 4AQOA 5EUKA 5GGRB 1RZ7L 3W81A 5C70A 1T1WA 1CQYA 3KPQA 4N5UA 2YD1A 1FFOA 1JHLH 5DUPL 5JORB 4XWGL 2FEDC 4DKEH 4I18C 5EO9B 5JHLL 4OLVH 3BPNB 1JYXA 3VFMB 3AY4A 4XPBH 3OL2A 5CJ8A 1QQDA 4WENB 5KS9A 3C5ZB 1Z5LA 4OZGB 1NAKH 1I1AB 1I7UB 3BE1L 4CU7A 2HFEB 1W8OA 4YHMH 3GMNA 1A3RH 2VNCA 2M26A 2R1YB 1KG0A 3QUXC 1W0VA 4J4PD 3TM6A 2BX5A 1TJHH 4NKQB 5HGGS 2Y36L 1I85C 2OZ4L 3CIQA 1V7NH 1J11A 3FB7A 3R0NA 1NGQH 3PNWA 1X4YA 5EOCH 3ULSB 3ARGA 4ODVL 2MHAA 2YD7A 3U30C 5L8JB 5IFJB 1T7ZA 3HNVL 3HG1E 3OKYA 3DETD 4ZFZB 3MLTB 5BZDA 3ARRA 1OWRM 2R9HD 3ILQD 5C09B 3CFCH 1D9KA 5IT2L 3NCEB 3EUUA 2YXFA 3QDGE 4UUJA 4OIIL 4UBDC 5SV3A 1U3JA 4EXPX 4U49A 4HIEB 4J3OC 2A9MH 1EZVY 5D1ZC 1GC1H 4JFOA 3KPRA 3NFNA 4IRSA 5I16B 4O9HH 5F1OB 1ZLVH 2NTSP 3EDDA 1ZS8B 2H32A 2ITCB 3HMXL 5CUSH 1ZVHA 5KSAC 2I60L 2MCPL 2VDMH 5FGRA 2D31B 2IMMA 4OKDA 4GXUN 1O5DT 4HH8A 1YN7B 3D39D 3DBXB 2DQTL 2ATKA 4GKNA 5H35A 5J57B 1NKOA 1XFPA 2VDKL 1U3HB 4WI4A 2BNQE 1I8IB 3VRJB 1FZMB 3MGOA 3ZDXE 5GJSH 1D5ZB 4OCYH 2VLJE 1OSPH 4NOBA 3WSQH 1PQZB 4KJWD 4NM8L 3Q5TA 1UWGL 1ZLWH 3WJLC 4MDJB 2CKBA 4LRNL 4X83A 2WP3T 1MCPL 1O7VA 1KT2B 1KJ2A 4AM0B 5FA3B 4L29A 2ZWLT 4HFWA 1INDL 1CLYH 4LQFH 5T1LB 1Q1JH 3REWB 3MRRA 4KROB 3QPXL 4PJGE 2BSRB 3T3MF 1R3KB 2IQAA 1U8KA 5DFVD 3BUYA 1GOHA 4GS7B 4JG0L 3STZB 4XVUC 3WFDL 5DMIH 1A21A 2X10A 3O6LL 4P4KA 4XCYA 1H3PH 2A0LC 5EZOH 3VFPA 3KPMB 5CSZB 2HRPL 1MUJA 3MJ8A 3G6JF 1JWUB 5HHNA 3X13B 1NCCL 4N0FA 1L7TL 1OGTB 1Q94A 2FX8H 3UX9B 4GMSL 4OLWH 1VESA 1WVZA 2X1WL 3TT1H 3WCYA 1P7QA 2LFGA 4XCFL 1MHPL 4CW1A 3QIWB 4EKXA 4Z77B 3NFSL 3O3DB 3IT8D 4QCIA 5CKGA 2V2TA 3RY4A 5EU4B 3EYUL 5EC2B 2CO6B 2Q20A 3I9GL 5J3HD 3FQNA 4FG6C 4GBXB 2M8XA 2DN7A 3ZL4H 1NUDA 4OZHF 3MRFB 3V2AR 1S7XB 1NBVH 2DI7A 3CLEL 2DIAA 4OGAD 2V2XA 4NO3B 1K8IA 1XGYH 4X6EB 4ETQA 1R3JB 2XIDA 4H1LA 5D2LA 3QXVA 4PJXA 1N4XL 4QRPD 4D8PA 3VXTA 4JRYA 1DFBH 2VXTH 3QULB 3ZYOA 1MFNA 4JQIH 5F1IB 1IBGH 5E2TL 2AEPL 2FX9L 4IM8A 4ZUSB 3QWRA 3MRLA 3FRUB 1KPUA 4HWZB 4PRPB 2X89D 4R4NC 3G04A 1ZGLM 3EO9H 5FGSA 2PW1A 4WFGD 1YEJH 1DLFL 1WICA 3BAEL 2H1PH 4GLRH 5HPMB 4ZUUA 3BVNB 1QYGH 5I17B 5FO7B 3FQXA 2R0LH 1Z6JT 4JCLA 1T66C 4WO4B 3LKNB 1WGOA 3MRQB 1EEYA 4JFFE 5D5ME 4DTGH 5I76B 2I9TB 1MFDH 4C56B 3BQUA 3QQ9C 1JWSA 4NQDD 3C6LC 1F4HA 2YD9A 4DZBB 4AEIH 3QT2A 1RZJL 5EA0L 4G6AD 2YBRA 4Z7UB 3MOAL 2K3TA 5JHDE 4EOWL 3RX5A 3V6ZB 3QUZD 4UQ2A 5FYJL 4LHUA 3VWKD 3TT3H 2AI0H 1FYTD 3LS4L 4P9MH 4A6YA 3L9RA 5FOBB 2ITDA 3D6GA 4U1NB 4UQ3B 2ID5A 4TQEH 4FMFA 2EXWD 1NC2B 4R96A 4KUZL 1YQVL 2FLRT 3VXRE 1A7QL 5EWIH 4N0UE 3IDJB 5I74C 4QXTA 3DX6A 2SEBB 1H0DB 3B9DA 2X1XR 1F6LL 5SWSD 1I3GL 1I8LA 5MENE 1Q0XL 3C2AH 5HGBA 3KVQA 1NEZB 5FYKL 5GGQL 1OCWL 2VR9A 4LSRL 3SKNA 4PY7B 3SPVA 1E6OL 4J3TA 3STLB 4LSQL 2CDFB 4QYOB 3V6BR 3TPUB 4YDLC 1QOKA 1T3FB 4YNYA 5I8KL 2D03L 4XPTL 3KNBB 2P43B 3VFRA 1AGBA 5B4MC 3VRLF 1RZJC 4IHOB 2ZUUA 2FIKA 3AS2A 2VSDA 2H3NB 4LMQI 2AK4A 4Z7VF 4NT6B 5KSBE 5IBTH 2OJEA 2YZ8A 5DQ9B 5F1KC 32C2A 4Q6YA 2B20A 3T0VA 4O02L 3I2CL 3D5OF 4UOJA 2ESVA 1C5BH 1CXKA 2ICEA 1TVDA 3GSRA 4KTEH 3CX5K 3V0WH 3QUYC 1FV1A 1H8NA 3ULUH 4UINH 2BJML 3WHE1 3L3DB 3TH2T 3HNTL 1QLRA 3VDBA 1IC5L 3ES6B 4Y4FC 1ZKAA 4P3CL 4X6CA 3QDJB 1JF1B 2X1PA 4G8GE 3JWOL 2G5BB 4HUWB 2CMRH 4LKXA 2D4DA 4M8VA 4KHTL 4RISH 4Q97A 3IS0X 1N64L 3K1KC 3LIZL 4XPFH 3CVHB 2FWOB 3BKCH 1UWEL 2EYSB 4LNRB 5HI4D 2NY3C 2B4CC 1NUGA 2FBOJ 1X5IA 4HJJL 5ECJE 3HS0B 1NGPL 3KGRA 5D2NA 1Q9OA 5JIHA 3MOQA 4WWKC 5F89B 1MCBA 3GKWH 1S5IH 3MR9A 4BH8B 2H8PA 4G6KH 1CFNB 2D0GA 3F7VA 3KJ4B 4F7PA 2GTWA 4YO0A 1P1ZA 2R2CA 3QH3A 4U31A 3GMOB 1ZT4B 2V2WA 1ZWIB 4LVNB 3FTGB 2XRAH 3MXVL 5HHOA 3V7AG 3IKCA 1DQQB 4HKJB 4GXVH 4MQXC 4PREA 1F6AA 1VEOA 4X9GA 1VHPA 3TO4C 2P46B 3T1WA 4K94H 1U92B 3M45A 5EZLA 3FHAA 2OI9C 4KY1H 2DJUA 3OR6A 3SDCC 3G5ZB 3I3DA 4NGHL 1E28A 1EFXD 2Q3ZA 4S0SD 4M5ZH 3PDGA 5EU6B 1BFOB 3SGDH 4B50A 2R1XA 2XY1A 2CGRH 4G7VL 4UTAL 1K85A 4QHNA 5DUBA 5ISZA 3LQZA 4OV5B 4PGEB 1N5AA 2NXYD 3JWOC 5FYKE 4L9LB 3WFCL 1IILE 3HNSH 4AH2A 5ADOL 3QHZL 1BBDH 2NX5A 1QNZH 1FFNA 1U9KA 4G80B 3CK0H 2A74B 2BNRE 3DV6B 4LLDA 1LO2H 2EKSB 5E8DL 1XR8B 3OXRA 1HKLL 4RWHA 5BXFB 1C1EH 3F58L 3MLZH 5J06A 1N8ZA 3U83A 4Y2DD 2HT2D 2DQHL 4L8SA 2C5DC 5TE6H 1YEDB 3MXWL 2FX7H 3DSNA 3RPIB 1A1MB 1C08B 5C1MB 2AQ3A 3O6KL 1ES0A 1I8MA 4IMKC 2XZQL 1OP9A 1UCTA 3WXVL 3H9SE 1I8KB 3L7FA 2GJ6B 3ZDXF 5JMOC 4E0RA 3SGKC 4XP6H 3HA0A 2VLRA 5DR5L 4LSVH 4UDTA 1NCWH 3KWWA 5AUMB 1XR9A 1LE9A 1FNAA 2PO6A 1J8KA 4EDWH 2MOVA 1KLFA 3L3OB 3IF1A 5EZIL 1WSST 3PG2A 4D2NA 2VXUL 2APTA 5CILL 1FVDB 1PYWB 2DTML 1A6TB 3FT2B 2IMNA 3MRHB 1T83C 3O6ML 4ZUWB 3TA3B 4HT1L 4XPHL 4PV9A 1GOGA 3SOBH 1EFQA 43C9B 3UEZA 3ZT5A 4YPGA 5D6DC 3VH8A 2FD6H 3T77A 3KPSB 1RK1A 1IKNA 3I02B 2MNUA 1MCRA 3V7AE 4OGXL 4S10A 3O4LE 3A0OA 3ESUF 5IIEB 3UYRL 5GGSB 4FQXA 3UBXA 3RWCA 4FTVD 5ID0B 5B3NA 1CZ8L 5FECA 4X6DF 4K7PY 1W72B 3ULUD 4LCWA 2JELL 1I3RB 4YJZL 1IAKB 3IGAA 5BVJB 3S36L 5EOTA 4EN3B 5A43C 2L7UA 4X9FA 1AHWC 1ZHKB 5D1XB 2C26A 3AXLA 4M7LL 3ARBB 4NJAL 1P69B 5ITBH 3QRGL 3RVWC 1NAMA 3AAZA 1Q9WA 4NNPL 4NP4L 3ZTJG 7CGTA 2H32H 5HGAA 4YDKH 4TSCH 2VITA 2WW8A 4QTIH 4YXKH 4ODBD 2ZUWA 4MHHI 4NHCL 4W6YB 2MMXA 4K8RH 1WIPA 2BC4B 2JJSA 3R4DA 4AEHH 2WBKA 1JZ5A 1U93B 3HPJB 4C83B 2VC2L 5BJTB 4NKDB 1M7DA 4YBQD 1A7NL 5FHAL 4MXVE 5DK2B 4KJYB 4LAQH 5E8EA 1F4AA 4IIQB 1HHGA 1DUZB 1MJJA 5CEYB 2EEDA 1UEYA 2QEJA 1QSFD 5E5UB 2RQ8A 4ZAKB 3VXPA 2VSCA 1H9VA 4O4YH 1BVLB 4D94A 4JFDD 4NNYA 2CKBH 1MIML 5BW7A 3MCG1 4X7SL 1QPPA 5E9DD 1X5AA 1KJ2H 2DICA 3FN0L 5IKCA 5GHWL 3X11B 1P6FA 3DX7B 4K7PL 5D5MF 1S7TA 2CDGB 3VFGL 4DVBB 1ZLSL 2F8OA 2DLTA 4MGXA 1OAXL 5FYLL 1Z0MA 1MJ7H 4OAWA 2IG2L 2X1QA 3O41B 4ODHL 2YPKB 1MCOH 3C8HA 2F15A 5GRVL 4NO2A 5MI0C 4NQUA 1NCBH 1JGUL 2LV4A 3SE3A 4X4XA 5DXWA 4C54A 5ICXB 1MI5B 5JQ6H 2HG5B 2R2HB 3LEYH 1C5DB 2HJLA 4K3DL 3RL1A 2P8PA 4OLYH 3OHXB 4KJQC 3AMLA 1FGNH 3SGJC 4HV8B 4P23B 5AAMA 5KAQG 1AFVL 1B4JH 1AR1C 2ADGB 4J7RA 4I0PD 5HI3C 1KIPA 2QTEA 2J88H 4OT1H 3DIFA 2ED8A 1RSFA 3IS1X 3MBXL 1G6RB 2AKRB 2HTKC 4G9FE 1HSBA 4WUUE 4L4VE 4YHNA 1FBIL 4B7IA 5DDHB 5E6YA 2CRZA 2NY4D 4DUWA 2D7QA 2NXZD 3PWUA 2EE2A 4NQVA 4PB9H 5I71B 3FAXA 4OF0A 4PV8B 3AS0A 5HVGB 4KUCD 5IGXL 1RU9H 2FCBA 3O9WA 1OB1A 1A7PH 2BHUA 5IHZA 4OFYA 5CBEA 3SDAA 1EHXA 5AZ2H 4MSWB 2QQQA 2VZ1A 3E6FB 4ZO6A 3MC0A 4M48L 1P7KB 4WHTB 2PCPA 1FFPB 1QFHA 5IV2A 4Y5VA 3O2DH 1CL7L 3RWFA 1KIQA 5J9PA 5DVKA 5E94A 5ICYB 4U6VH 3UJJH 2C1OA 1NLDH 4EUPG 2Q7YB 3D3VE 5C0AA 4UIKH 2B1HH 4WUKH 5C08E 3AREA 3T65A 1H3GA 3TIDA 3GGWA 3R1GH 2V17H 5JOEA 4L1DA 1A9EA 3QO1B 3PIQA 4QRQA 3WUWG 43CAA 1D9KD 3WL9A 5HYEA 3S34H 4XXDA 5CHNB 1F11A 5T33L 1LEKA 1L4IA 2FSEA 3GIVB 4XP9L 5F88A 5SX4H 2FYYA 3KPRD 3HR6A 4TULL 4IRSD 4X9HA 3CXDH 3TBWA 4A6YH 2EXYC 1AO7B 2C3VB 1CLOL 1OL0A 3RU8L 1FH5L 5GS3A 4CN1A 3G5VB 4QHMB 4K8RD 4L3AA 5HDQL 4CU6A 3AU1B 4PJHA 3VXUB 5FYLE 1HYSC 4P46C 2VXSL 4H5SA 2B1AL 3THML 1JGDB 2X40A 4K9EL 2X4TB 1Q9LA 2ADFH 5D1QB 1AXTL 3IRZA 5DRNA 4MB3A 1UJ3C 4P57A 3ME0A 1EHAA 2BOCA 4HJ0D 4WFFD 5CEZH 1W8NA 4Q58C 1A4JA 3NCCB 1INQA 1FE8H 2EDKA 4PP1C 5E7FA 1TFHA 1WZKA 4H8WH 1CU4L 4XCNA 4F7MB 5I19L 3TVMC 4PJEE 3IJSB 1JZ2A 1JPFA 4FQJH 3KJ6H 1ORQB 4K23L 3D0VB 1BAFH 4BZYA 4LSUH 4Q6IA 2CH8A 4PR5B 3LRGA 4ZS7H 1SM3L 3VFSB 4RFNC 5IBUG 2NNAB 3K0WA 3QG7L 4ERSL 5IFAL 5HGDB 3U4BL 2O5ZL 1SJVA 3U4EB 1BEYL 4OZHB 5L0QC 1ERNA 1RHFA 3A6OA 4M7JH 5HHQB 3WIFA 4X5XB 1R5VA 4JY6A 1Z9OA 4UV7H 3RUGE 5I30L 2IQ9L 4WI8A 1FDLL 4QXUL 4PLKD 5TH2B 4NFDA 1WIOA 3LSOB 2B7DT 4JZNA 2P5EE 3V4PH 3L6FA 1YEIH 1P7QD 1JFQH 2UVFA 5C07A 4HIHB 4U0RC 1FGVH 3TESA 3X14B 5J11C 3MZTA 3ARZA 5KJRH 3KHQA 1EO8H 2R2BA 4G6FD 4KK8D 5DVNA 5JNYA 5IBLD 4L4TA 2BVTA 4PJ9A 2F58H 2H2SC 4NUGL 2VLKE 4NSKB 2MQ3A 3C8DA 4Z7NE 3LKPB 4XNMB 2FEEI 2IADA 4M1GL 1GAFH 2W60A 4X7EC 4XNUH 4U0QB 1GGBL 1PKQB 5KN5B 2KQNA 3E2HC 5SWZE 5GRWA 3FRPG 2LU3A 1QFWI 3IJHB 5D7LB 5MERB 3QWRD 4GW1A 1KJVA 3GMQB 3RIFF 5D71L 3GHBL 3LD8C 3DROA 1KTLA 5ID1B 2HKHL 3C60A 4EIZC 4ZTOH 3PWNA 1IRAY 3R06B 3JWDH 1XAUA 3QRFM 1UB6B 4K3JH 1DEEA 3OKEA 1IE5A 4KAQL 2AJZB 4OFPA 1PD6A 3FQTA 4S1SL 2HLAA 5D7JC 1JV5B 1C8PA 1KACB 5C0JA 3T2NL 3GM0A 5JO5B 1WJ3A 3EYQC 5IMLA 4Y4HC 3ARTA 3WO4B 1XIWB 4ELKB 4O2FB 4BH7A 4ZO8A 2PTTA 4PJ5A 4KKBC 5JXAH 3MREB 6FABL 3BP4B 4GW4B 3B9KA 2QSCL 4LHUD 1P4IH 5DO2D 2AJXL 3VFVA 3OKNB 2XWBA 5JIKA 4MD4B 1MHHB 3QFDB 4PJIF 4BM7A 2FATH 1TETL 3O2VL 3HC4H 1U8OA 2OP4H 4ELMA 3M8OL 2OBGA 4RZCB 4LCIH 2V7HB 2EDXA 3EYFA 5TPWL 3U79A 3S5LB 1ZA6A 4NZRL 1QKZH