4KRPD

Nanobody/vhh domain 9g8 in complex with the extracellular region of egfr
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
218
structure length
213
Chain Sequence
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSKTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/immune system
molecule keywords Epidermal growth factor receptor
publication title Structural Evaluation of EGFR Inhibition Mechanisms for Nanobodies/VHH Domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 213
sequence length 218
ec nomenclature
pdb deposition date 2013-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4krpD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4krpD01
4Y4KC 2GITA 2F9BT 4UMGA 4HWNA 3M07A 3VG9B 3F8UB 5DJXB 4QRQA 3G9AB 5IBUG 1AR2A 3BEVA 1LWRA 4POZD 4GG6B 3OKLA 5T1KD 5KAQG 2YC1A 3REVB 2R2BB 1XT5A 3VGDA 4NHCL 1ZKAA 1WF5A 3HS0B 3G5XB 4N5UA 1FG2B 4M7LH 4GRLC 1G9NH 3ES6A 2IANA 1OAYH 4BKLB 2YD2A 2EXYC 2VXTL 3GB7A 2YN3A 4V2CB 4ZQKA 2J7LA 3HAEB 4ODVH 5B22A 3VG0L 4K8RH 4WI6A 3SDAB 3QNYB 3M17B 4OV5B 3L9RB 1J0HA 1CLOH 1IGML 2A6JA 4K8RC 2X4UA 4KWUA 1ZGLB 5JPMA 4KZEL 4PJGE 4ZPVB 4ZUWA 5TE7H 2Q20A 1IBGL 4R2GB 4LARL 1K8DB 4YC2C 1NAMA 1WFOA 2EKSA 4YWGH 3F7YB 2VR4A 3CFEA 4ODWB 5C0CA 4XNYH 4F15C 4RZCA 2NY4C 4OBRA 1UJ3B 5IT2L 4XT1C 3VD5A 2VZTA 4J7RA 4QCIA 2G2RB 4JREC 3C6LA 3T1FA 1QNZH 1F58L 1XIWB 3MOAL 5CUSL 4JFHD 1E4WL 4JZJB 3MFFA 4KDTC 1EJOH 1FFQA 3LD8B 4FQ1H 4OM0H 5IMKA 4X5XA 4X4YA 4ENED 2WANA 3QXVA 3SQOH 1NAMH 1ZVYA 4Y2OA 4F7MA 4L4TB 5T1DH 2I60H 1UM6H 1A6WL 3I50L 4YHOL 5CZKA 4EJ1C 2HH0L 1MCHA 3S88H 3QHZL 3FMGH 2AJZA 1PDKA 4NQVB 5FUCE 1IEBB 1D5IL 4LFHD 4GLRI 4Y4HD 5EOCL 2W9LA 4CJ1A 4JN2B 2R2EB 1KULA 3C6LC 3RVWC 5J11C 2I27N 2ZSWA 4PTTA 4EI5A 3WLBA 4UU9B 5JOFB 1HKLH 4MA7L 5HD8C 2VDNL 5IFHL 2K9UA 4KDWA 1R3LA 4BFGA 2VYRE 4N0UA 3BRFA 2AEWA 1LP9F 4G6MH 1J88A 2AGJH 5DRNB 4XNXL 1YMME 1H9VA 1ACYH 4H20H 4YPJA 2IGFH 5D1XD 4FZ8H 5I76B 1XF2B 1G7HA 1OF2B 3I2CH 3QEHB 1K3IA 3CAFA 3SE8L 3KPRE 2F58L 3TPUA 3HG1A 3GGWA 5BZWB 2EYRA 1GGTA 3P30L 1L4IA 1F90H 1KN2H 4KGJA 1P53A 4HH9A 2VB5A 4XP9L 3K2UL 2X42A 4UNVA 4WUKL 1S9YB 4OTXL 5CJOL 3V9FA 1Q1JH 1KNOA 1F6LL 1NGQL 2QSCL 2WLYA 1EHNA 5A1AA 2NY6C 4PJXF 3NA4A 4K3JH 1MFBH 3WXWL 2OQJA 3L3GB 3OJDA 4XCFH 4S1QL 5FYKL 2C1OB 1G7LB 3NGBB 4D3CH 3BPNB 4JFQB 5DJYA 3UYPA 3QIBD 2B8OT 1KEGH 4KV5E 3B83A 3BHBA 3LZFL 3OPZH 4XVUD 4OGXH 1RHHA 5JHLL 4K9EH 1OP5H 3ARDA 3IFOA 5DFVD 5GRJL 2EDWA 1ROWA 2LQRA 4R26L 4K9EC 5DUPL 1S9WA 2FEDD 1A2YB 1SY6H 4K94H 4EUPG 5F1KC 5M7QA 4E41D 2XTJB 3AS0A 1QBMH 1RHFA 4OFVA 2XXMB 4U1GC 1G9EA 2DQTL 2WWKO 2CKBA 1RZ8B 3T09A 5CWSB 3ZKXC 5GXBB 3DTXB 4G9FA 5BW7A 3W39A 1CL7I 4LLMB 4QRSB 5C6TL 3CFCH 1S7QA 5J6HA 1BFSA 2Y7QB 4M1DL 3IKCA 1I75A 2RFXB 3ARDC 4F37F 1LDPL 4P4KD 5HHQA 2FHBA 3IETB 1PKQB 3VDAA 1ORSB 3UTZA 2VXQL 4I18C 4GH7B 4L3ED 1G7IB 3R06A 2CKBH 5CIPB 1I8MA 3MV8A 5HPMA 1HSBA 2UWEF 1HH9A 1HHHA 3IAGC 3IDIA 3TBVA 3DXAE 3U48A 4J3OC 4M48H 5AD0A 4DEPC 3KPSA 4WWKB 5CP7A 5HPOA 1IM9B 1MUJB 1BD2E 5IGXH 1JHKL 3B9KA 1MCRA 3TT3L 4TSCL 1XCQA 4QEGA 2AJUH 4WTXA 3VFWA 5BZDA 3LKNB 1M6OB 4OGZA 1Q94A 3LAFA 4OM1H 3SDDB 3FB8A 3O6FD 1QBBA 1QSFD 3WN5C 2BHZA 3MA7A 1T5XA 2FJFA 2V5SA 4UT6H 4X6CF 4YLQT 4PP2B 1UG9A 4QXTB 3HAEG 5KS9F 4UT7H 5C0BE 4QRPB 3RVTD 1X5AA 1VFBA 4D0CA 1TVBA 5CCKL 4YO0B 2VLJD 5E8DL 2P8LA 3QUYD 2VDQL 4JDTH 4YBQC 1V3LA 4RGNB 1VPOH 1MFAH 1NGXB 3OX8A 4M4PA 3O4OC 3MX0A 2IPUG 3V52L 1T2QL 3RU8H 2NY3D 5I1DB 4I9WE 4FG6C 4X8XA 4PJ5E 3EYSH 1F6AA 5F7LB 3VFSB 1QBLH 4KKBC 1R3HA 1YEEL 4TPRH 3QDJB 2EIBA 4LEXH 1RZKH 3C2SA 3DYMA 4KI1A 3BZ4A 4MAUH 3AFLA 3QQ3A 3L3HA 3EHBC 3D85B 3PWUA 4MX7B 1KB9J 1IEHA 1HHGB 1A6TB 3WSQH 5T5FL 4YQXL 3MRPA 4UV7L 1OPGL 4NHUA 1PG7W 2NXYB 3CC5B 5EO1A 2B4CC 3V4VH 1GYAA 1ZANL 4HC1L 2GAZB 5IIEA 2MPAH 1JNNH 3GBLA 5FYKD 5ALBL 2NY1D 4NKOA 3UYOD 5F9JB 1XGPB 1LE5B 2AI0L 2ATPA 1LP9A 3E6HA 1MQ8A 2BOBA 2LAAA 4X4MA 25C8H 4JFZL 4YFLF 1S7VA 4YAQA 1KCSL 3F5WB 4FTVE 3TVMD 1OAKH 5DQJA 4XMLL 4NOBA 4EXPX 4NP4L 3TBTA 5I1HL 4Y88A 3MRNA 5HI3D 4OCLC 2OTWB 2AXFB 2DF3A 5BCAA 2YWYA 5DURB 2K7QA 4LF3B 4MJIB 4OLYH 4OKDA 4RMSA 1CVRA 3CXHJ 4PREA 4LNVA 1A7RL 4XRCB 2VQ1B 1QRNB 1PQZB 4HV8B 1CDIA 3P4NA 5FO9B 3VDBA 3OKEB 5B8CC 4AG4L 4PPTA 3DETC 2BC4B 3HN3A 4M7ZB 2DBLL 2DS4A 2FB4L 5F7DB 3KYAA 5C0FB 1NKOA 4L4VE 4NBYB 3TESA 4R90L 5DWUL 5EU6E 3GMNB 2YD8A 4GBXD 3T2NL 4HIXL 1F4AA 3DVGB 1IAMA 1YNKL 2CRMA 5INDA 2CLZB 4PJXA 2HP4A 5EFIB 1RJCA 5CZXD 5L2KB 3BZFB 3QNZA 5IVXE 1YEDB 5KBNC 4M5YL 4NRZB 5E99L 1YECL 2BNRD 2JKXA 4I0PD 4LSRL 5K9OB 5FGCB 2VISB 3KPLB 1CD8A 1S7UA 3DURB 4XP6H 3B8SA 1GAFL 3U9PH 4G8FA 5ACMA 2Q87A 3UJJH 1U8KA 3L5WB 4WW1A 4XI5C 1QSEA 5IQ7L 4YDVA 3L3KB 1S78C 3BVNA 1G7MA 1JWMB 1P1ZB 3G08B 3WJJA 3R0MA 4R0LC 2GJ6D 5AZ2H 3RL1B 3IU3B 3MLZL 4OQTA 3ZLQC 3RWDA 3IJYB 5CMAB 1DANT 1T89A 1CICB 1MCDA 2BCKA 2HT4D 2MQ3A 4NZUH 4QT5A 4HWZB 1EAJA 4AENB 3ZYZA 3MNWB 1IC7L 3ULUF 3OAZH 4RX4A 3KXFB 1AKJD 1GOFA 4F3FB 2OL3A 1TJHL 2QHRL 2IPTL 1B0GB 1T1YA 5EB9A 3PWNA 1J8HD 4ELME 2ADFH 2KZ1B 3L5JA 2PTUA 3O0RL 4PRPD 5GZND 2B5IB 3VXRE 43C9A 2ID5A 1QA9B 2ZG3A 3C9NB 3W2DH 5A16A 1KPRA 4F7CA 4YR6A 1KJ2L 2A9ML 1UCBL 4KTDH 3WJJC 4GUPB 4MNGE 5HYIA 4LCWD 1C5CH 1A22B 4JVWA 2UWEA 2XQBL 1JWUB 5JQ6L 4JY5L 5MHSD 4HWBL 4HXBL 5D7JB 4GMSL 3KNBB 5ICZB 4KJPC 1T89C 5MI0B 1KB5A 5DRZB 2VDOH 5F70A 1AXSB 3NCYS 1KBGL 4JKPH 1LDSA 3RHWF 2WSKA 3ZSSA 5ITBH 3RI5K 7CGTA 4I5BA 3U6RA 3AAZB 3KPOA 4DN3H 2Z31B 5MENA 4OGYL 3T3PF 4YFEA 4OD3H 4HIJA 1BJ1J 2DYPA 2C3WA 2J1KA 1C7SA 4IJ3B 2X1OA 3N1FC 4R8WH 1UXWA 4PY7B 4U1SA 4NC0B 3BKMH 3RY5A 1HCVA 1KB5H 2APWA 2VUOA 5FKPA 5EWIH 3AROA 4FMFA 3GMRB 3ZL4L 5KS9A 4XPBH 4Z7WF 3EO0A 5C92A 1VEOA 4LASH 5E9DB 1Z5LB 2A83B 2VLKB 5FYLE 5TGBB 5JW4Q 4GRWH 4GW5B 3S6CA 2DJSA 5IEHB 1W72H 1A6UL 4YBLC 1CGSL 5T1LB 3LIZL 3U7WH 2A6DB 3D87B 4JLRA 1E6JL 4JRXB 4YXKL 2DICA 4NKDA 1NFDE 2DOCA 4X6EB 4HPYH 3D3VB 4MWFB 4HPOH 4MXVF 1OSZB 4ORGB 1KLUA 2PF6A 5I1KL 1U91B 4QHUA 2KH2B 1UYWH 3T0WA 3LEXB 2R15A 3NZ8B 5CEXB 2YR3A 2ORBL 1FLRL 4WY7H 3BKYL 4F80A 5K59E 4OFYA 1TJGH 4D0BB 1U2HA 1OWRM 1A1MA 2VDLL 1MCKA 3H3PH 3QI9C 5KJRL 1X6LA 4AEIL 3GHEL 3H8NA 2EEAA 1J5OL 5DYOB 4J3WA 2X4QB 1SEQH 2ZJSL 4PJIE 1DQLH 1N4XH 3MRRB 4WUUA 2E6JA 3GMPB 4NQXA 5A2FA 1RZIB 2ZUQC 1RVFH 2RCSL 3RUGB 1S7WA 2HLFC 3OKNB 5KVEL 1T6VN 4M3KB 1FYTD 5IJVA 2VSDA 2WWKT 1PY4A 2BSSB 2FD6H 4UTAH 4KJWC 2XKNA 2YPLE 2HN7B 4U7KA 3V6FA 4D8PB 4JJ5A 4ZSOB 4PP1C 1FBIH 5FHAL 3K8LA 3WD5H 3I02A 3BWAA 5T1MB 5F9OH 4O9HH 4QTHA 5IM7B 1XCTB 3BH8A 3OJ2C 5FYJH 4Z9KB 3IXAB 4LHJB 5MP6H 1KIRA 1EEQA 3MXWL 1NGPL 4LLQA 1T22B 1DR9A 3DI3B 4X4XB 4CN4A 4YGAB 4KZDL 4W70A 4DVRL 2DLTA 3GKWL 5HI5C 4CVZB 1AGBB 1F3RB 4Y1AE 3MV7D 3C2AH 2CXKA 3GBNH 5IVOA 2UYLB 2AKRA 4F58L 4O51B 2ESVE 3BRDA 3B3IB 4FOMA 3TN0D 3P3YA 1EEZB 2FBJH 1GZPB 3FHQA 5E8EA 1RJLB 1CLZL 3SCMA 5E6YA 3WUZA 3KYMA 1QHPA 5GGQH 1WFUA 4ZFGH 5L9DL 3FFCB 4ZTPL 4HIIB 2VKWA 1DTUA 2VDKH 4KDVA 2UZYB 3S34H 1JP5A 4CUCA 1MRDL 1ULVA 5DD6B 2C3VB 3QH3A 4PJGB 4NBZB 2EH7H 4X9BA 1EXUB 4CW1A 1L9NA 4H25A 5T3XH 1PKOA 1CGVA 1SEBA 3FTGB 1H3TA 2EDFA 3P9MA 3AB0C 2CLVA 2IANE 3I75B 5ALCH 4BM7A 5HGBA 5GRVK 3GSQB 5DRWA 4FQHA 4KKLD 2W9DH 3VFTA 1DBBH 1VB9A 2R1XB 4LPVA 2ICES 1MF2L 5FV2A 1I8IB 2BNQD 1JRHH 1N3NB 1SYSB 2W0KA 3AM8C 1QSZA 1UWEH 4FZEH 4X80L 4HUKB 1E28B 4A6YA 4LVNB 3MODL 2HJFB 5BVPL 3NCCB 3WCYA 3CFBA 3UX9B 1CXIA 2W0PA 3U79A 1S9XB 4HXAL 2YD1A 3EFDL 5C0CE 4I2XE 3GSVA 5C3LD 4NYLA 4IS6A 4P2QA 4YE4H 1SM3H 3VH8A 4GO6B 4PGBB 3N85H 1D3CA 2AP2A 4HUUB 1BQLL 1J87A 2BVPA 3TBYA 3ULUC 5ITFB 3CCHA 5TF1H 2ICWI 4F7EA 2ZUVA 5DJ0B 4A6YH 1MPAL 2O5XL 3RWCB 4WFFD 4X9GA 3QBTB 4KRPB 1TQCC 4NN5C 4ONFL 5E6ZA 3S37L 3HI6H 5E8NA 3H0TB 1Q0XH 3DSFH 1SJHB 4IRJA 4UNTA 2HFEB 2Z93A 1D6VL 4TUOB 2DL9A 4PR5B 4Z7WA 5E5UB 5ICXA 4KAQH 5KVDL 5DMYA 4N0FA 1WIUA 3OKYA 2QADD 4PRAA 4GJTB 5F6IB 5BVJB 2GUOA 3D25B 2D03H 4LSUH 1JFQH 4DCQA 3HE6A 2VLLB 4N0UE 4NRXB 4EDWL 1CTNA 4N1EA 3RGHA 1C12A 5BQ7B 4Z95H 3QFJB 1YA5A 2DQDH 3MCG1 5IW6B 4PJEF 4JFED 3BXNA 1PG7X 3SO3C 5EZJA 1I3GH 1RUPH 3ARBA 4IRJC 4RDQG 3B9EA 4PLJC 4BELD 3PHQB 2I9LB 3QCVL 1XGUA 4GW1A 4TUKL 5F89A 3V4UL 2I07A 1DBML 2YD4A 5GSRB 5IEKB 3E8UH 3L6FB 1CG9A 1Z9SA 4NRYA 3L7EA 3HE6C 4MZ3A 3BISA 3E0GA 2X7LA 3LV3A 5D5MF 1EK3A 3WDIA 3OR7A 4RISL 3B2VL 3SDXF 2Q8BH 4F57L 1MVFA 5TE4L 5HBBA 4U3XA 2Y72A 3ARBC 1J0YA 3U4EB 2VLRB 3WIHA 2JK5A 1JGVH 5IB4A 4X7FC 1HHIB 4MD5B 1AIFA 4W6WB 5L7XL 3V6OC 1EFXD 4R7DB 5F7EL 1EJ6A 1IGCL 4TVPL 4NKIL 2NY0C 1NBZB 1GC1C 4IRSC 2X4TA 3K1KC 1J1PH 5GGVH 3FB6A 2H1PL 4PTUB 5J6GB 4MA3B 3PL6D 4OCWL 3FQXB 4NJ9L 4LGRB 3WIHH 3O41B 5BV7H 4M9OA 2ZUWA 3PP3K 4HZLA 4G9DA 2QQKH 1CI5A 3DXAB 3P0VH 5BV7C 1T7YA 1WZ1H 1WFTA 2CIKB 2D0GA 2KUTA 3MV9A 3RY4A 2V9TA 3LN5A 2XWBB 2R39A 3W11D 1KEML 4ZO8A 3LHPH 1LQSR 1JZ2A 4JG1H 1NFKA 2PUQT 3U7YH 1OTUC 2ZOLA 4LVOB 1H5BA 3L3JB 4BQCA 3ZTNL 3QJHB 3B5HA 2ARJA 3QRGH 3BPLB 1FZOA 1MWAA 3OXRA 3MV8E 3DGGB 1NAKL 2EO9A 1JNLL 4UDTA 5GRYA 5E08L 5F7WC 3N06B 2G60H 2ZCLL 3KPSE 1UZ8B 3LQMA 4HFWB 3RX8A 4WI7A 2D9QB 4GS7B 2DI9A 4E9LA 3QNXA 3O8XB 4XAWH 3RWHB 3G5VA 4JY4B 4HS6B 1S9KC 1F97A 1MWAH 3Q6GL 1H5BC 4Q6IB 3VMOA 5I19L 3RJQB 1ZEAH 2Y6SD 2HLAB 4PJ5B 1KPVB 3IKKA 1SBBA 4TOYH 1X5FA 2L7UA 5I1LA 3HNTL 4JPVL 2VJXA 2FBOJ 1WBXB 3BPOC 5FDYA 5I6XB 4EDXB 1V3KA 4RFEA 1E4KA 3LRSB 1S7XB 1XIWD 4YIQA 4IHOB 1D5XB 2YPKB 2FLRT 3R1GL 3S36L 1V8HA 3WNOA 2OTUB 1P4BH 2R0LL 4LQ1A 4S2SB 4UV4L 1UZ6F 4C55A 4OFPA 2SEBA 4M1CD 3CFJA 1EERB 2CJUL 1NCAH 3IU4L 1Y6KR 1IBGH 2A6IB 3NAAL 3VGGA 3AY4C 5C07A 4E0RA 1R5WA 3ARUA 1KT2B 2XQYK 1RIVL 5ADPL 4NO2A 3IDJB 5CEYA 4GKOA 4JPIA 1WICA 3QULB 3T8XA 2DJ4A 3G5YA 5I75B 3ILQD 3D6GA 3BO8A 1ZWIB 1E4WH 4FTVB 4OLUH 4D9RE 3UP1A 3ZYIA 3BIKA 2KKQA 4JQIL 3WKML 2MHAB 3HZYB 1R5VB 2FSEA 1T1WA 2QEJA 4U0RC 1F3DH 1U3HD 3WLWC 2E27L 3I50H 1S7SA 4YHOH 3AREB 4N9GB 2EIZA 3HKFA 1KIPA 1ZGLM 4KRNA 4G7VH 4CADA 4QGTA 5SWSA 3CSGA 3MJ7A 3DRTA 3QSKB 2NY2C 4UT9L 3S96B 5EOCH 3S3SA 4RGOH 4TVPD 1LP9E 4LCYB 4NSKB 1JV5A 4L4VB 4X4ME 3U4BL 5J1TC 5FO8A 5J0BA 2VZOA 4LPTA 3NN8A 4KROB 5E4EB 2VDNH 4HJGB 2DM3A 5BS0A 4PJEA 3NA9L 3Q0HA 4WO4B 4YGVB 3FONA 3QEQA 2CLRB 5C3TA 4P0DA 2IPKA 5HHNA 3RI5F 2IF7A 1ITCA 3DX6A 4P2OA 2DBJA 3C5ZA 3PQYB 4FQXB 3TA3A 3FQWA 1ED3B 1HDMB 4LRNL 5CJ5A 1P7HL 2HFFA 1NL0L 5FECB 1OTTC 1CE6A 5DEGB 5LXGL 4HUXB 2C3GA 3C09B 4OIBA 5TE6L 3HC0A 1T21A 5I1GH 3BOVA 3SE8H 2A9NL 4BH8B 2F58H 4FFWC 5D5MA 5DSCB 4RA0C 3KYKH 5ANME 2CO6B 5ESAA 1HXMB 3V95A 5EN2B 1JPGB 3SDXA 2WUCL 4PJDB 4XP9H 4JO4L 1X3DA 3WS6A 3OGCA 1FAIL 1YYLH 2MOVA 3ZKMC 3BAEL 2E8ZA 1RULL 1NGQH 1BFOB 4P2OC 1ZXQA 2G9HB 5F8RC 3QIUA 2JJWA 1IRAY 4DKDC 5J12C 1HILB 2XTJD 4HT1L 3TIDA 4S1QH 5FYKH 3AMKA 5JW3L 1B4JL 3O3BA 3ROOB 3UEZA 1MHEB 3L3DA 3K7UA 2XZCL 3QRFM 1FZMA 2PO6A 3TH4T 5H35B 3PV6B 3LZFH 4O2FA 5JHLH 5JXAL 2ITCB 3A6OA 2ATKB 4HHAA 1MJ8H 3LKQA 5IFJB 5I71C 4MNGB 2R0ZL 2FEEI 2FIKB 4NQCB 4QHKI 1PG7H 1HWGB 1P7KA 3WS6C 1QFWL 2WK2A 4U6XA 5KSBF 3NMEA 4OUUB 1I9EA 3X11A 2GT9A 4AH2B 5SV3A 1NMCC 3QIUC 5BMFL 2DQTH 1T1XA 3GK8H 3FOLA 3Q6FA 1MFNA 5IMOA 5CSZB 4PRNB 4JAMB 2PO6C 3EDJA 4YUEH 1IM9D 2VERN 1UJTA 3HLAB 4M1DH 4LKXB 1DFBL 4M61A 4KK8C 1A1NB 1LDPH 4DKAA 2ZWLT 1NBVH 2VZVA 2UWEE 2VL4A 2ZUTA 2VXQH 3SDDD 4JR9H 4JM4L 2AV7B 4KXZH 3VI3F 1X7QB 5GRZA 4M7JL 5IBLD 5K33A 3VXSB 3RVVD 3UPAA 4M6ML 2EYSA 4FQQA 5ID0B 3DECA 3CJJA 1KXQE 1JHKH 3TT3H 4TSCH 2W07A 3MLRL 1IARB 1ZA3B 2H3NA 2WNGA 3V0AC 2OLDA 5C0RL 2C3XA 2AEQH 5I15L 3QQ4A 1JTTA 3MRDB 3PWVB 2AK1L 2IFGA 4X6CE 5L8JB 4ZDHA 4FMKA 1U41A 5KS9E 3CH8A 1F8TL 4KVCL 1BVLB 5CP3A 1TIUA 5E8OA 5C0GB 2R2CA 2N7BA 1J05A 3HB3C 3HUJF 1IAKB 5HHPA 4KQ4H 2NW2B 3T0AA 3G6DL 4LLDA 4JG0L 3FT2B 3RKDD 4PRDA 1QHOA 3IJHB 3QDJD 4M9PA 1JZ7A 5CCKH 1A4KB 1RUKL 2HFTA 4IDJL 4JZOB 4RNRA 4XMKH 4RA3A 4Q9BA 3D85D 1NGYB 3PGFH 4ZFOB 5D70L 5M95B 1O0VA 5K9KB 1G7PA 4U4BA 3D2UD 1T2QH 4L9LA 5CHNA 5E5MA 2R0KH 1U42A 2NXYD 4WCYL 2FYYA 1VSCA 4KVNL 5SWZB 4Y5XB 4JZNB 1K8IB 1P6FA 3MR9A 2IMNA 1RJZA 1NDMA 4YDJA 1YEEH 2YPLB 3HI5L 5DT1L 1CFSB 3P0YL 3TH2T 3JV6B 3CVHB 1R0AL 4EN3A 4Y4FD 3WHE1 4KMLB 1XZ0A 3QO0A 3QUZD 4G43B 5AWNL 4WUUE 4LP4A 2Y06H 2D4DA 4ZXBB 2YD9A 1XGTA 4XPHL 3FHAA 5T5FH 4XHJD 1BPVA 4UV7H 3LH2L 2FJHA 3EFFB 1MCEA 4PUBL 2DQEL 5DURD 1ZANH 4MJID 4HC1H 1LE9A 5CBEA 3ULVD 4H26B 1A9BB 3HR5A 1FRGL 2AJSH 1QRND 2RHEA 1DE4A 5HYSA 1IM3B 1CL7L 5HY9B 4Y1AB 3IFPB 1IKFL 2AI0H 3UBXB 2DTMH 4JB9L 4ODTL 1SHMA 1ZMYA 4JFZH 1N7MH 4EN3C 1T5WB 3W5MA 2ESVB 2GJZB 4Z0XA 2DQUL 1K5NA 2AQ2A 2RR3A 4NP4H 3ZDXF 5I1HH 4P49A 4DVBA 4D0DA 3VXMB 1T7WA 4KI5F 4XNZC 1LEGB 3U0PB 5J6HB 4W68A 4YHML 4QRQB 3BEVB 3QR2A 3FRPA 1FCCA 5C0NC 1TTUA 4HX1B 1TVHA 3PP4H 3O81A 1KCUH 4TTDD 1DDHA 4YC2B 1MCBA 4AG4H 3G6JF 4L8BB 5DQDH 5IK3A 3T3MF 4O5LL 2FB4H 3U7AA 4F15B 2NY4B 4M1GL 4P99A 3ES6B 4QRTA 2IANB 3VFVB 2L7JA 5T3XE 5D93C 3QDGE 2A77L 1BLNA 5DWUH 5C71A 1LVEA 5FA4A 4MXQC 1BQHA 4ZQKB 3MLYH 1YNKH 4JO2L 3BDXA 3WUWA 2C1PA 2PN5A 1N5AB 4LLWA 4Z6AT 4C54A 2V5MA 1MEXH 2A6JB 2YA2A 2X4UB 1CICD 3CPLA 4ZPTA 5DD1H 1P4LB 5JPMB 1BEYL 2YMXL 1YECH 3HPLA 2W1NA 1NAMB 3RAJL 2EKSB 2X4NA 2MCG1 1MJ7L 4RZCB 1Q38A 1WSST 3S37X 3ALPA 5HXMA 2G75B 3T1FB 1XGYL 1RU9H 4S1SL 3MFFB 3ULUE 3MLZH 1KENL 3TN0A 4X4YB 5IMKB 4X5XB 2YRPA 3TZVB 1QFWM 3EGSA 4JFFE 5DJCA 4M7KL 2XWJA 3RVXC 3HA0A 5D1ZC 1IC7H 2GSIB 4F7MB 1TJHH 2IPTH 3QIWA 1F4WL 4WFGE 1L6ZA 4NO3A 4Q97A 3MC0A 1OVZA 2AJZB 4JHAH 2Z31D 4P2QE 4PRHA 2CDFA 1ZT4A 4KQ3H 5FM4A 1I3RA 5F44A 1OARL 1BQSA 4HQQL 4KK6D 5SX5H 3IDXH 1UCBH 2ZSWB 4PTTB 4EI5B 3WLBB 3VGEA 4DKEL 1JNHA 2XQBH 5JQ6H 3MLUL 4JY5H 3MRQA 4HWBH 5EORH 1R3LB 4GMSH 4N0UB 5EULV 3B2UD 5I9QC 1QACA 1ZLVK 2DKSA 5E9DD 4MNQD 1X5GA 3KR3L 2BNQA 5GJSH 3EOTL 2IADB 4R4BB 1P4IL 2NW3A 3QIWC 1OAQH 3ESVF 1FIGL 5FO7A 4OGYH 3I6GA 1G7HB 4WJ5B 3B9DA 4XPAL 4Z7WE 3D3VD 1HE7A 1YYMH 3TPUB 3HG1B 5ESQB 1KYOK 3GGWB 3HUJA 2EYRB 1FCGA 4C56D 3UTSA 4MQXD 1K3ZA 3TFKC 1P6AB 3PNWA 4WW2F 4OCYH 3MCLL 1F3JA 4ETQA 4HBCL 3J8F7 4HJ0D 1EO8L 5F3BB 5MEPB 1KNOB 1F13A 2VITA 1A6UH 3O2VL 3O6LL 4MXVE 1CGSH 1YPZF 2W38A 1KFAL 4PJ7E 4YXKH 4HKBA 1WLHA 2APXA 1CLCA 4F8TA 5F97E 5E2WL 3OJDB 4KUCF 3OB0K 2P8PA 3STBA 3MJ6A 5LVEA 3V6OE 2LU7A 5IMMA 5I1KH 5DQ9A 2D9CA 3BHBB 1NDGA 3O3AB 4PJ8C 2A1WL 1M7DA 2D31B 2C5DC 3IFOB 1NGWA 3OSKA 5KSAD 1WTGT 5I8CA 5A3IC 2ORBH 2XA8L 3BKYH 3T4AA 3KDMB 1S9WB 1TTGA 4ODXA 3NTCL 1DBJL 2YBRB 3WE6A 1OM3L 1A21A 3QWOB 1J5OH 1BFTA 4G6KH 5D7IF 2CKBB 4KKCD 4P5TA 2Z92A 4G9FB 3GM0A 3W39B 3S97C 1M05A 1UWXK 3BKCH 1J1OL 3JWDL 3V5KA 1S7QB 3CMGA 1INEL 2HG5A 2XN9A 2XICA 3CDCA 3IKCB 2RCSH 5J1AA 1T6WA 1FIEA 4R6UA 2YA0A 4UINL 5HHQB 3QO1B 3DMMA 5DA4A 2F8XC 2HVJB 5D6CB 5DJAA 1CU4H 4P9MH 2BNUB 4QLRA 5J4MA 4NO0D 3UTZB 2C3HA 3R06B 1T03L 3BP7A 1BMGA 4IRZL 2ZCHH 1HSBB 5EG6C 4GAGL 3O2DA 1F5WA 1HH9B 5D7LA 1AGFA 3TBVB 4M6AA 4P5TC 5AD0B 3FQNA 5CP7B 4YFLI 3DX8A 2X89A 3B9KB 3FFDA 1MHHA 1RPQA 1QLFA 4CU7A 5JDSA 1A14L 3G6JA 4JGUA 3VFWB 3VD9A 1U3ZA 1Q94B 5D7SL 3VXTB 4PRBA 1RMFH 3DMMC 3FB8B 1E6OL 4XPGL 3S36X 3O2DH 3V5DB 5DEFA 4DVRH 3GKWH 1RIHL 1T5XB 3PWJA 5TPWH 5IHLB 4OLZL 4ALAL 5DGRA 1MAMH 2Q8AL 1KPUA 2V7HA 5C6WH 1JJUA 2BRRL 4F58H 5JNYA 3T0EA 1TVDA 3F7RA 2HT2D 3BH9A 4TQEL 4ZFZA 1CGTA 4EUPH 1M71A 5KW9L 3G04A 4D0CB 3VRJB 5JXED 3PDOA 1TVBB 3JWOC 2A6KA 4ZUTB 5GSVA 5L9DH 4F7TA 2P8LB 4OCSL 5HVFB 3OX8B 4P46D 1QOKA 3N9GH 1FO0A 4U6YA 2IJ0C 5CD5C 2XYCA 1HEZA 5EIVA 1ZLSH 3T2OA 1R3KB 4FFVC 5FHBH 4Q6YA 2N56A 1A1OA 1R3HB 3T0EC 2YOCA 5HGAA 1P5UA 4LCIL 1BOYA 3BZ4B 3QQ3B 2DMCA 1MF2H 3L3HB 4NKQB 3PWUB 1FO0H 2K7PA 1K2DB 3O45A 2VC2H 4LAQL 3LQZA 2PW1B 4KTEH 1F4YL 4EZMA 3RIFF 3MODH 2M2DA 4NHUB 2JTDA 4DOHB 1QKZL 4ZOCA 5EO1B 1YMMD 4QXGL 1I7ZA 1C08A 5C07E 4B53A 1DVFD 5IIEB 3LS4H 3E6FA 3MCKB 4JEGB 4M5ZH 4ERSH 4XB7A 1N8ZA 5C1MB 2HRPH 5D96C 1FORL 3JTTA 1LP9B 1EAPA 2BOBB 1A5FH 2D3VA 1S7VB 2JIXA 1X4ZA 3KPRD 4YAQB 2D7MA 4MMXC 4DUWA 1WZMA 1BQLH 5D1QA 5DQJB 3TBTB 1MCSA 4OZFA 4UB0H 2IBZX 4Q2ZB 4H0GA 3RGVB 1G84A 4OF0A 1IC5L 2FATL 1I4FB 1RI8A 3QHTC 4ONFH 4QHKJ 3S37H 1EGJL 3QFJD 3EDKA 3TJHD 3I6LD 4PREB 1PBYA 3K3QA 3C60A 3MV11 3P4NB 5SWSE 3R8QA 4ZOAA 1ONQB 5KVDH 4JKKA 1LILA 5KZCB 3U2SA 1NCBH 3BEWA 3GDBA 3NPSC 3B9AA 9CGTA 5I17B 5DK2A 5D1QC 1YPZA 3GJEA 3IDMA 5BS0E 1AY1L 4PJEE 5INDB 3NCMA 5AYUH 4K3HA 4PJXB 1G6VK 2DWDA 1CFQA 3QXAB 1NUFA 1LK2A 5F6HJ 3QNZB 4Z7OF 3DHMA 1FNFA 3HE7D 1ZVSA 3KVQA 3DVNA 4LLAA 2YPVL 3C60C 3SDCD 1G6RA 1IGTA 1XF4A 3OWEA 2VABB 3ECBA 3FB5A 4EOWL 4WW2C 4B41A 3IAQA 1FYHB 1WITA 2X41A 4TUKH 3V4UH 2OTPA 1U8KB 4WW1B 5D5ME 5BO1H 1A0QL 1HQ4A 1QSEB 3LEVL 5DTFA 4HK3N 3D39A 1G7MB 3B6SB 2L4OA 4XBGA 5TH2B 1LMKA 3QAZC 4HMEA 3WNKA 5D7IA 4UOJA 1N64L 4RISH 1P69B 5IESL 3B2VH 2BCKB 2Q76A 1I1AA 4QOKA 4ONGL 4OF8A 4HDIA 5E4IA 3X12A 5LQBL 1ZSDA 4S0TD 5B39B 2CXGA 3VXQB 1T1YB 3DXAD 3PWNB 5F7EH 5T3ZE 2DM7A 2NMSA 1AD9A 5T33L 4JFDA 43C9B 4Q74A 5K93A 5KTEL 5A16B 1LNUA 1MI5A 1KPRB 4F7CB 2P44B 1B3JA 2EXWD 1IQWL 3CNKA 1JZ8A 4PS4H 3WXVH 4JM2F 4Q9RH 5E56A 2ERJC 3TGXA 1I1RA 1GJIA 4NJ9H 1KB5B 4MS8D 1I1AC 5CJ8A 3BD4A 1QFPA 1D9KA 1ZTXH 4HS8L 1ZLUH 4YBLB 3WDHA 5E70A 1JN6A 4GRWB 4I5BB 3U6RB 1W72B 3KPOB 1UCTA 5C0BD 5MENB 1BIIA 4HIJB 2DYPB 1KGCE 5EUOB 3NCBB 1AFVL 1UXWB 1E4XI 4DTGL 3RL2A 2VXUL 2O26U 5FKPB 3O8XD 4X5LA 3WHE0 3GMLA 4DAGL 3EOBB 3ZTNH 1CE1L 4K23H 4K7PL 4JQXA 3EO0B 4JRYA 3IDGA 1JUFA 4I9WD 3MUY1 3FT4A 4X6DF 5DK0B 1D9KC 3AS2A 4PJ5D 1JNLH 3SDYL 2A0LC 5ESVA 3OAYK 4JLRB 4PJHF 2HT3C 1PGRB 4NKDB 3Q1SL 1RY7B 4YXHL 2ZOKA 1WISA 1G0XA 5CAYB 3STZA 1JYVA 2V17L 4DFIA 1KLUB 3TIEA 3VXOA 4QHUB 4S1RL 1AHWA 2ZUQB 2B1AL 3FKUS 5ETUA 3Q6GH 3NIDF 4JQXC 5I19H 3CDYA 5DO2C 2WAHA 4LLYA 2VZ3A 5EZOL 2J8UB 3ARPA 3Q5TA 2EKJA 5FYLL 1A1MB 3VXUE 5L2JA 1GZQB 4JPVH 1ADQA 1P9MC 5FUZH 3HMXA 1UZ6E 1CLYH 4PJFF 4NOFA 4FTVD 4CJ0A 3R1GH 4WUUB 3MRHA 1DBAL 3S36H 1S9VB 4NQXB 1PSKL 1Q0YL 2NR6D 2R0LH 3EYQD 4UV4H 1AHWC 1MFCL 4CN1A 1X5KA 3U0WL 1S7WB 1PLGH 4URTB 3U1SH 3IU4H 2J6EA 3RA7L 1EHLH 3NAAH 2NQCA 4L8SA 5IJVB 2F54B 3ARED 1ADQH 2BVOA 1RIVH 3QZWG 2BSRA 3NCJL 4LCCA 5FKAA 3U82B 2DQFA 2ADIA 3UYRL 1BAFH 1BJMA 3V6FB 4JJ5B 5ADOL 4L4VD 4N5EC 1BVZA 5I2IA 1S7TA 5EU6D 1XH3A 5E6IA 4JQIH 4WTZA 5LBSL 3BH8B 2DD8L 3RWIA 4RFOL 5HSFA 1KIRB 2C7UB 4L8SC 3OV6A 1I8KA 4FQXD 4CRPA 2B20A 5DUML 1HYSC 5CD3A 1CDYA 4UT9H 4YHYC 4YFDB 3U4BH 4NQSA 2YN5A 2OXGA 4N90E 5MERA 4L3CA 3CVHL 1B88A 4YHZL 2WUBL 3NA9H 3RZCB 3SCMB 3KYMB 5E6IC 1JWSB 1PX4A 2FO1A 1NSNL 3ROLA 1FFNB 3GSNA 5DD5L 2WLZA 3LS5H 1NANH 4OV6F 3MACL 2MSPA 4LRNH 5F9DC 2X05A 3QH3B 1NL0H 1HHKA 4U3CA 4CW1B 4OF5A 4WEBL 1SVZA 4H25B 5TE6H 1N26A 4PJBF 4HUWB 3HTLX 3P9MB 1F4XH 3DVFA 1D5MB 5HGBB 3QQNA 1JYWA 3BT2L 3GSNH 4FQHB 4NBXB 4P2RA 4PV9A 3VXRD 3GIZL 2XKSA 5I1CH 4JO4H 2NYYC 1FAIH 3W0WA 2GJJA 5FXCH 5FGRA 2BSTB 1OAYL 3BAEH 1XEDA 2YKLH 3QWRD 5C9JA 1X5XA 2VQUA 1I7RA 2WBKA 4B7IA 4R4NC 5DHXB 3QB7C 4ODVL 4A6YB 3DUSA 4LOUC 2FWOA 4K8RL 4HT1H 4YPGA 4DUXA 3O3UN 3CFBB 5JW3H 1B4JH 4N8VA 4BQ8A 3NIFF 1NCNA 2CUMA 5F9WC 1EEUA 2XZCH 3GSVB 2D2OA 4NYLB 3H9HA 4ZNCD 4IS6B 5D1XC 2DB8A 4JM2A 4P2QB 3GRWA 5JXAH 2J3SA 3OG6B 5KSBE 2YRLA 3AS3A 1LK3H 1NCWL 5GGSA 1HI6A 2X4RA 1AQDA 5CILL 5IJKA 1H0DB 1LGVA 2UZIL 3DNKA 4IOFD 3CCHB 3GNML 5E1HB 3RWEB 5T5NF 3LB6D 1UH3A 4Y5VA 2MTPA 1CDJA 1MCFA 3OR6A 5C0AA 1QNZL 1F4HA 3UJIL 5DMIL 5FYLD 1B0WA 5BMFH 1HHJA 3U30B 1EJOL 5E8NB 4FQ1L 3SO3B 2CK2A 2LTQB 2Z93B 3WO4C 4X6BA 4PRHE 1U8MB 4JM2C 5EBWA 4Z7WB 5T1DL 1QEWB 2NTSP 2I60L 1UM6L 3BIBX 1DFBH 4XCYA 4P3DA 4N0FB 3VI3E 3WFZA 1S7RA 5KANI 4PRAB 3TBSA 2E7MA 4AM0A 4X6DA 3S88L 4KXZI 4HW6A 2GUOB 3MLXL 4DCQB 3HE6B 1RUAL 4PJHA 3DOSA 4WVRA 4Y5VC 1AO7A 5DFVC 5JMRA 1SJEA 4W81A 1D5BA 4TNWK 1MIEH 1V05A 4HBQA 2MWCA 4KH2A 2BK8A 4GLRH 1J0KA 1HKLL 1UM4H 3T04D 1RZFL 3BXNB 1RIUH 1MVUA 5EZJB 5I1JL 2QQNL 3UTPE 2FH8A 4G7YL 3VFPA 3HC4L 3MLRH 2BHYA 5I15H 1WZKA 1V5JA 4GW1B 5E94A 5F89B 5ILTH 2I07B 2I9TA 2IGFL 4IBLT 3M8OH 1NCTA 2BVUA 1RK0A 2NY0B 2P5WA 3HUJE 2AK1H 4QRRE 1CG9B 4PGCA 4NRYB 4RAUA 4G80B 3H42L 1PEZA 3L7EB 1MRCH 2AEIT 2X7LB 2XKUA 2OMBA 4YHIA 4PJFA 5AUMA 4H8WH 5IVZA 3OR7B 2FR4A 4D9QE 3TNMB 1KN2L 3D69A 4JG0H 5JLZA 4M4RA 2YPLD 4H8WC 5B38A 4ZAKD 1KJVB 3CK0H 5DD0H 4HIEA 5BV7B 3CXHK 5IB4B 3RQ3A 2X9YA 4MNHA 4UILH 1AIFB 4IDJH 2X1XR 1F42A 4FXKB 4YH6A 5DS8A 4K3JL 5D70H 1MFBL 5DC4B 3CDGB 2AW2A 4XCFL 4WGVB 2X4TB 4Y4KD 1FNLA 1YY9C 4D3CL 3FB6B 4WCYH 3GEWB 2CRIA 4FFYH 3WBDA 1KEGL 4YDIL 4KVNH 4OGXL 1CXKA 3O6FC 4K9EL 5IW3A 3CSBA 1VCAA 5DT1H 3P0YH 1UVQA 4F7PA 4X0KA 3HC3L 4HZLB 4Y1AD 4CVUA 3BZEB 1R0AH 4G9DB 2PXYA 4GRLD 1CZ8L 2VDML 4OT1H 1RZ7H 3MV9B 2FEEL 2ESVD 4KY1H 5AWNH 1BM3L 1WC7A 1QPXA 3VXMD 5HYJA 2XN9E 1NFIB 4NN6B 5KG9A 3LH2H 2OJZL 1VGKA 2W65A 4PUBH 3QUYC 2FX9H 1CBVL 1KV3A 3WEXA 1SMOA 2HJLA 1PJ9A 4K8RD 4C58B 1H5BB 1FFPB 1FRGH 3O4LA 4RQQA 1JTOA 5F7NC 4XBEL 1H3VA 1ZS8A 1DQTA 2ARJB 1CL7H 2NY3C 3ZDXE 1FZOB 2QKIA 5C09A 1MWAB 3OXRB 2NY7H 1FL6A 4JB9H 4ODTH 4UDTB 4Y19A 5D7LE 1C5BH 2PXYC 2APTA 2NY4D 2IAND 4Z8FL 3SJVA 1OP3H 2DQUH 4E41B 5JMOC 1DCLA 2CKBL 5JHDA 3FO0H 1PD6A 1DZBA 3VW3L 3TV3L 5I73C 1OAZL 3ZDZF 1UXSA 3ZE2F 4YHMH 3QNXB 4M48L 3G6JE 4I3RL 2EH8L 4QTIH 4PJBA 5IQ9A 3SOBL 3T3ME 4L8CA 3G5VB 4ODSH 4K3EL 1ZLVH 1X44A 5IGXL 5GRXG 2DI8A 3WNMA 1DN0A 2AJUL 4P4KB 4O5LH 5HDOA 3W9EA 4M1GH 2VMFA 1NJ9A 5C0CD 3T0EE 3NFPA 4P9HC 2A77H 1PEWA 4P4RA 1R3IL 3F58L 4FNLL 4FHBD 3C6LD 4UT6L 4OCXL 1HOCA 3RVWD 5EO0A 5HD8D 3T2QA 5EZLB 5LGJA 2DLIA 1L0YA 1MQKH 2SEBB 3CFJB 4HIHB 4U0RB 3BW9A 1QSVA 1BEYH 2YMXH 5IW1B 4XP1H 2C4FU 1QYGH 3RAJH 4JDTL 3VH8G 1R5WB 1VPOL 1MJ7H 7FABL 4NO2B 1QSFB 1KCRL 4JPIB 4OI9A 1W2KT 3T8XB 4PB0L 3G5YB 5ENWA 3BO8B 3SKMA 4S1SH 2FL5A 5B21A 3QXDA 1KENH 4EI5D 4UI2A 1YMHA 3E2HB 4XNMA 4TPRL 4MB3A 1EPFA 2FSEB 4LEXL 5FM5M 3W9DA 1RJYA 3I6KA 4MAUL 4YHKH 2AXJA 1S7SB 2OSLA 1YEKL 1U6AH 2EIZB 3VFGH 4AYFA 1KIPB 5SWSB 3WSQL 2HYMA 3MJ7B 3LRHA 4WEUD 4HQQH 1W0VA 1UWXH 1JV5B 1LO5B 4FS0A 1JNNL 3HG1D 5LAXA 5C08A 4DKEH 2NNAA 3MLUH 3NCEB 1YC8A 5DHVA 1ZV5A 4PJEB 1YDPA 1OGAE 1TETH 1BZ7B 4QNPF 3KPQA 3FONB 3QEQB 3LKPA 1RURL 5HHNB 2IPKB 4OZ4A 3MJGX 3DX6B 1CDHA 3EOTH 3C5ZB 5DFWH 3X3GH 2CUHA 3QDHA 3TA3B 1P4IH 4LLVA 2HT4C 2HFFB 1FIGH 1CE6B 3OKMB 3OKKB 3IDNA 5EC2A 4XPAH 3HC0B 4UQ2A 4OLYL 3MFGB 5DHVH 2UZXB 5D5MB 1KIQB 1AR1D 2NY1B 5DJ2A 1G0YR 2IWGA 3SDXB 5I71B 2HJKA 3MCLH 1U36A 2R29L 2V7NA 3ARDD 3FJTA 3TO4A 3VFUA 1HIML 5C0JA 1EO8H 3TVMB 2VRAA 4XGZA 3QWQB 4XH2A 1TENA 3O6LH 3Q5OA 4M8VA 1ZHLA 2EDOA 3EYFA 3QIUB 4Y89A 4AL8H 5E2WH 3TIDB 4BUHA 4WDIA 3O3BB 5CINL 4HG4J 1CGXA 1FZMB 3LEYL 2PO6B 4FQJH 2X5PA 4G9FD 2IAMA 4OLXL 4O2FB 4JFOB 1JPFA 3CXDL 2W59A 1I1FB 4HHAB 3D39E 3FZUD 3LKQB 3EAKA 5DVKA 5JIKA 1P7KB 3TO4C 2XA8H 5D7IE 1NUGA 2CSPA 2XXCB 3P4MA 2Q7YA 2GT9B 3L5IA 4QOKE 5DVOA 1A3RL 2P4AB 3MV8D 4K7PX 4QF1A 4BFIB 3FOLB 3Q6FB 5IMOB 4J3VA 5HVHC 1T0PB 4K3DH 2IBBA 3MNVA 2A74A 4NZUL 4DJMA 3KPSD 5CGYC 2BNRB 3JWDH 5F93C 2IAMC 3OXSA 1AJ7L 4QRUA 1INEH 1D6EA 3B9KD 1MI5E 2DL2A 2X4OA 1NMAH 2O61A 1PX3A 2ZG1A 5DJZA 3WL9A 4ZYKB 2B39A 5IUSA 4BZ1L 4OQTL 5GS2H 4F9PA 4KTDL 4OGAD 1LEKB 5HJ3A 4IRZH 2H6PA 3QG6A 1OD7A 3TCXA 1KTDB 5C7XL 3MRGA 4KKBD 2HTKC 1B0RA 3QUKA 4FQQB 3WHXA 2OL3L 3TNNA 3ZT6A 4OLWL 4JKPL 2BJMH 3IJSB 3VD7A 3EHBD 3QQ4B 5F88B 3V0WL 1KJMA 1GVIA 1BD2A 5CJXA 1E6OH 1F3DJ 3CLFH 3JTSA 1VENA 4BSVA 4PJCF 2Z8VC 2M1KA 4BH7B 4R8WL 2AK4E 5E8OB 3FO1B 3BKML 1WBZB 4F9PC 4ALAH 2VAAA 1J05B 2MMXA 4YNYA 3BPCA 3MREA 2Q8AH 2F53A 1KB5L 3GSWA 5HHPB 3KLHC 5EWIL 4NQDE 4XPBL 5EOCJ 2EE2A 4LK4A 4LLDB 4TQEH 3MSPA 5KW9H 3VRLF 5JA9A 4PRDB 1QLRB 3EYOA 3O9WA 4QHNA 3Q2CA 5K9JL 4MA1C 4D9RD 2GK2A 4NCC1 2X4PA 2R69H 4OCSH 4O4YH 1VADA 4LBEB 1J12A 5TDOA 3U0TA 5CJXC 1U58A 5J13B 4HPYL 5IBTH 5IB2A 4WU5A 4HK3J 4L9LB 5CHNB 5E5MB 5EOQH 4C57C 1FGVH 4QHLA 5EU7C 4H88H 4RBPK 4XC3L 2P5EA 3VFMA 1UYWL 3PIQA 3MR9B 1RJZB 1NDMB 4GRMA 3LDBC 1WIPA 2EICA 4X9IA 5I8EB 4EN3B 4IIQC 4WY7L 4U1NA 1TJGL 2X1QA 3O9WC 4ZO7A 1XZ0B 1IFHH 3F6IA 3AMLA 5F1NA 3FOMA 4XNZB 1WWCA 4LAQH 3RVUC 1AD0A 1F4YH 3GMMA 1G7JA 5DMKA 5E8PB 1N4XL 4XP5H 2FJHB 5DD3L 4H1LA 1B6DA 1U92B 3MO1A 4KJQC 4QXGH 2P45B 5EIIB 5CBEB 3RWFA 4XP4H 3HR5B 5CLWA 1TFHA 4TULH 1DE4B 4XWGH 5HYSB 1RVFL 4M3JA 4Y5YA 1L7TL 5AZEL 1FORH 3MMEB 4LHUA 2DMKA 2FHFA 5D93B 2YRZA 4XI5D 4Z0XB 2FD6L 1K5NB 1S78D 4BQ6A 4DVBB 1EIBA 2BXYA 5DJDB 2LVEA 5GGRA 1FBIL 4JFHE 1IC5H 2FATH 4L3AA 5IF0A 2E7CA 1ZT7B 3WD5L 4EXKA 3SBWA 1QLEH 2ADGA 1I8LA 4O9HL 3ALWA 3H9SA 2JF1A 3N1PC 1G1YA 3F12A 2E7BA 1YN6A 2LV4A 4MQ7B 5ISZA 3NABH 1BZQK 5IK3B 3REWA 4WENB 4QRTB 2JJUA 1A4JA 2L0DA 1A6PA 4Z7OE 5KVGH 1BLNB 1QSED 5FA4B 4TNWF 4GAJL 1AY1H 4XNQA 3C2AL 3GBNL 3WUWB 1CFNA 2YUVA 3BUYB 4LLWB 1CR9L 2AJXL 3SBWC 4KJPD 1I8LC 2CQVA 1JF1A 4G8GA 2ICCA 5L0QB 3CPLB 4ZPTB 1FZKB 3P9LA 1A7PL 1ITBB 1YN7A 4RX4D 4X5WA 2GK0A 4EOWH 5A2KH 3X13A 3T0DA 5L6YH 1Q9OA 3RZWA 3OKOB 3S34L 1A0QH 1HZHH 3LEVH 1CXHA 5IBUB 5FAAA 3MJ8A 1OSPL 3UJTL 4P2RE 5T3XL 2IFFL 3P4LA 4G8IA 4RAHA 5CKAA 5ALCL 3TN0B 1N64H 5DJCB 1I1CA 5KANG 2EECA 2GCYA 4U1LA 2XWJB 2Z8WC 4HUMB 5GRWA 4U1JA 1DBBL 5IB3A 5LQBH 3ABZA 1F45A 3ARXA 4OI7A 3DYOA 2Z91A 3JSSA 4MJ5A 1K4CA 4NO3B 3C6SA 3CU1A 1UWEL 4FZEL 4Q58C 4KRLB 4PRHB 5MEND 2C4XA 3CFKA 1I3RB 3TC9A 2DN7A 2PYEA 2DYPD 5KTEH 3HZKA 2ICWA 3SE9L 1EZVY 3MRLB 4R97B 1MLCA 1XMWA 3QEUA 3K0WA 2CO7B 3MRQB 4YE4L 2JB6A 1SM3L 3EOAA 3ULUL 4M02A 5E5RB 4QXUL 4CDGC 4BJLA 4ZD3H 3GO1L 1V7ML 5C0AE 4Y16A 43CAA 2BNQB 2NX5A 5TF1L 4WI8A 4A6YL 2NW3B 4PBVC 5MEQA 2WBJA 1NBYB 4MAYA 3I6GB 1J1XL 3OJVC 1VKXA 3MRMA 4PJCA 2P24A 1WCBA 3HI6L 3O3DA 1AFVH 2YD3A 3ME0A 4HKXA 1Q0XL 2X4SB 3DSFL 3OKDA 1TPXC 1QFUH 4RGMC 4X6DE 4JANA 1MCWW 3UTSB 5IB5A 3NH7L 4MCYA 4DAGH 1T7VA 2VE6A 1HQRA 4PJHE 3PNWB 2AERT 1Z0MA 2HLFD 1FG9C 1AO7E 1F3JB 5DJXA 4KK5C 4QHMA 5D8JH 4Y16C 4OFYD 3P11H 2R2BA 4D2NA 3Q1SH 4KJWD 2P8MA 5F7UA 1T2XA 2Z35A 2WBJC 3HS0A 3MRIB 4MAYC 1FG2A 1YQ2A 4PP1D 1MCPL 4Z95L 4AJ0A 4PYHA 2P8PB 3ZYOA 4AIOA 3NIDE 2DIAA 2DQDL 2F5BL 4BKLA 3A0OA 3UO1H 2BRQA 4WUUD 5DQ9B 3ARYA 4S1RH 4IMLA 2P5WE 2NTFA 1A8JH 1M7DB 4NNYA 3SDAA 1MH5B 2RB8A 2QADB 5I8CB 3VG9C 4PJFE 4OCRH 3IS0X 5FYLH 5FA3A 1EUTA 3RNKB 3QUMA 1RSFA 1FVCA 5HI5D 1DLFH 3MA9L 5F71A 4WFEE 4P5TB 2Z92B 4JFEB 1TZHA 1NC2A 4XHQA 2Q8BL 4WU7A 4KPHH 1PSKH 3O11A 1Q0YH 2IG2L 3V5KB 2GSGA 5CBAB 5IHUH 2ZPKL 5J1AB 4JZJA 4YX2L 1MJJA 4UQ3A 3SDAC 4YHNA 1GC1L 1G7QA 3TPKA 3QUMH 1N5YL 3RY6A 5HYSG 2BVEA 5DJAB 4PIRF 1MJUH 1F6FB 1T83A 3K4AA 1NLBH 2ENYA 4L4TA 5DHYA 1J86A 1IAOA 2HKFL 3H3BC 5F7YC 2Y6SC 4R2GC 1MIML 1P2CB 1T04A 2H2PD 1AGFB 3U9UA 5T3XD 3FQNB 4CMMA 3KGRA 1UJ3C 5BV7L 1MCWM 4LP5A 3EO1A 3DX8B 3FFDB 1MHHB 3EO9L 3SCMD 1MCNA 5HYJE 2R2EA 3DSNA 4EUPB 3FRPG 5TDNA 2DD8H 1XIWC 3P0VL 5EU4B 1WZ1L 4JZJC 4RFOH 4PRBB 2Y9RT 4ZOEA 1NC4A 3GSOA 4GT7A 3RY6C 5DUMH 3O4LE 1RUMH 2VIRA 5GGRY 5DEFB 3PWJB 4H0IA 2IALA 2V7HB 1BQHG 1DLHA 3GMOA 1E4XL 3LQAC 3BH9B 4BK5A 1XF2A 3SJVE 3K8MA 4ZFZB 3QRGL 3CVIL 3WUWG 4NUJA 3PDOB 4L8DA 5JHDE 3ULVF 1NSNH 1C1EL 4MA8L 2A6KB 5DD5H 3ULUD 5GSVB 4F7TB 3C5JA 3BESR 1QVOA 2G60L 3EDEA 35C8L 4PJBE 3EJZC 3MACH 2ARWA 1WK0A 3KYNA 1FO0B 4U6YB 1HEZB 1S9YA 3PABA 4XAWL 4ZUVA 1CGUA 3J7HA 1L7IH 4FP8H 4HGMA 1DQJB 4C4KO 1MWAL 3BP4A 1A1OB 4LSTH 2XY1A 3BT2H 3ARWA 5HGAB 4E5XA 4TNVK 4P2QD 5HYEA 1PFCA 2C1OA 3GIZH 1ZEAL 5EBMA 1E27A 4TOYL 4LPXA 4NDMA 3BGFC 2QQQA 4KHTL 5CGMA 3NIFE 4PGZA 3O45B 2OK0H 3LQZB 3QCUH 1HH6B 5EOTA 5ID1A 4M03A 4KDTA 5K9QI 2R23B 4HUVB 3UZVB 1QR1A 1ZT1B 4UNUA 3E6FB 4OJFH 1P4BL 4LDOB 5GS1A 4IRJD 3SPVA 4N0YH 1ETZA 1N8ZB 1NCAL 4LCUA 3GUTA 3QPQC 4N1HB 15C8H 3JTTB 1EAPB 5JZ7D 1NCWH 2JIXB 5CILH 5J3HC 4I2XA 2UZIH 3NGBC 3BPNC 5D1QB 3GNMH 3LKRB 3H6JA 3WKNA 2BY3A 4OZFB 2Y7QA 3P77A 3HE6D 4MHHI 4YEFA 2F74B 5IR1A 1JZ5A 2R4SL 2RFXA 3UJIH 5DMIH 4OLUL 1DSFH 2XZQL 4V2BA 3IETA 4P3WA 1CFTA 5ELIA 4Z78A 1GGBL 1I7UA 1ORSA 3H3KA 3C60B 3MZGB 1G7IA 5AYQA 3BDYH 3VXNA 3GMQA 5GS1C 3ARBD 4XNUL 5C0EA 3MLSL 3DBXB 3R4DA 3ZSTA 4C59B 4EVNB 2XTLA 5DLMH 3U2SB 1MCLA 1NGZB 4WWKA 3T0XA 4G7VL 1OB1A 4ZOBA 3R0NA 5DK2B 2NY0D 4KK9C 3MLXH 1YPZB 3GJEB 3IDMB 5C08E 1RUAH 4HWEH 3QAZB 2EIEA 4RGOL 2DWDB 1CFQB 3EKCA 1LK2B 3OGOE 2GYSA 3CX5J 2BMKA 1RZFH 5EIQA 3DVNB 5KOVC 5I1JH 2QQNH 4OZGF 3IS1X 1IGTB 1RZGA 4HJJL 1XF4B 4G7YH 1U3HB 3ZMRA 3HC4H 5JIIA 1NCUA 2BOCA 3PE9A 4NO5B 5EC1A 5HHME 5BJTB 4QXTA 1CGYA 3FO2A 3NZHH 4QRPA 1N6UA 4JDZA 4WWKC 5DTFB 3S5LG 4OCMC 4ZODA 2BY0A 3H42H 1ZOXA 4XBGB 4YO0A 2NY5C 3NBNA 5I1GL 3BKJH 1N2RB 1OTUD 3KYKL 4HUNB 4B50A 2LE9A 4K71B 3SDDC 3FRUA 5SX4I 4QOKB 5I1DA 2Z9TA 4HDIB 4RCAA 3X12B 1ZSDB 2PCPB 3BWUC 4DGYL 1XGQB 1YYLL 1UA6L 3MBXL 3RVVC 2F5AL 3MV9D 1CTOA 1TQBB 2FDBP 3UXFA 3QXWA 3VFOB 4JFDB 1FL3A 1LNUB 2M8XA 3PGDA 3MNZB 2XFXB 4YDIH 2CIIB 4KKNA 4RGNC 4XBPA 1HHGA 1A6TA 3BJLA 1MJ8L 1ZK9A 3AUVA 2R1YA 1PG7L 3HC3H 3INUL 4TSAL 4ZS7L 2GAZA 1CZ8H 1JN6B 2VDMH 2E9BA 4I18A 1G9MC 3WIFB 5GS0C 3FQUB 1BM3H 3RUGF 3HRPA 5IG7A 1MCJA 3MXVL 3L7FB 4BQ9A 2H32A 3T77A 3GK8L 4ZG1A 5L8LB 2OJZH 1JHTA 3B4NA 1CBVH 2P47B 3KJ6L 4YUEL 1CD0A 2VLME 3GMLB 1ZLWK 4N9OB 2AXFA 1KCLA 4JQVC 1EA9C 4JRYB 2DQGL 4XBEH 1VEPA 4XWOD 3IDGB 1JUFB 2EDHA 3O3EB 2HKHL 5IHBA 2W60B 4IOIA 1NBVL 4I8DA 5ESVB 1PQZA 3ZDZE 4R4FL 3ZE2E 4Z8FH 3L3OA 4JR9L 32C2B 2H32H 3WN5A 4PY8I 3MUJA 4I3GA 3OHXA 3STZB 2R0WL 3VW3H 1UENA 3TV3H 2Z8RA 1OAZH 1YEHH 2B1HH 1GGCH 1MNUL 4I3RH 3TIEB 2EH8H 3VXOB 3LKSA 3SOBH 4K3EH 1BWWA 3DVGA 3RX5A 3CLEH 5ETUB 4XTRC 3KPMB 5L2KA 3WLWD 2AEQL 4LLYB 3HPJB 3RNQA 3VMPA 1YEDA 5EU7E 2H8PA 3IF1A 5C07D 1TZGL 4YJZL 2F53E 3ULVC 4RMWA 3UTTA 4JKLA 5L2JB 5KOMC 3KPLA 3O2WH 1ORQA 1R3IH 3F58H 3MV7E 5J56B 3PJSB 4FNLH 4X6FB 4OCXH 3WNLA 3VJ6B 1IGFL 1LO3L 2WM0A 3MRHB 4KQ4L 5IB1B 2VDRL 3L3KA 3GHBH 1FZJA 2JJSA 5GGTA 3ZE1F 4JHZA 2ITDA 3KHQA 2WMPA 4S11A 4L8SB 3QHFL 4XMKL 5CMAA 1ZHKA 1YNLL 4JO1H 6FABH 3PGFL 2Y5TA 1M7IA 5FK9B 5TQ0L 7FABH 2P5EE 2XA3A 2BSRB 4LCCB 5FKAB 1KCRH 2VL5A 5SWSD 2ADIB 3KXFA 4TTDC 4YHYB 2ZKHH 2R0KL 4PB0H 1ACZA 4MLSA 4KUZH 4FFWD 4OZFG 2DQHH 4NQTA 2VAJA 4ESKA 1JZ4A 1S7TB 2AAVA 1XH3B 2BVQA 5GGTH 5E6IB 2KDGA 5BS0D 2LAGB 2EDDA 3V6BR 2KL6A 2V6HA 3QEQD 2JJSC 3ZKMD 1YEKH 5LG1A 3MV01 4P2OD 5D7JA 3C5ZD 2Y06L 1BX2A 3Q48A 3D2UB 2B4CH 3TA3D 1CICC 2EDEA 1MY5A 2FZ3A 1TLKA 1U9KA 3CMOH 5CD3B 2CKNA 3PV7A 1X5LA 4QNPE 4NQSB 4LRIC 1UQSA 3AAZA 5MERB 2AJSL 4CL7A 5B8CA 3CFDA 4WRLA 5JORA 2B5IC 4PBXA 2DTML 4GKSA 4Y4FB 2FGZA 4NN7C 4OZGA 3ROLB 3QZWA 4G42A 1NUDA 3GSNB 1RURH 1N7ML 3QUZB 5FOBA 3V6ZA 3VFNA 3FN9A 3GMRA 3H9SE 1TNMA 2DWEB 3MZTA 4N1CA 1QFHA 5CZVL 5D7JC 1INDH 1MRFH 1Z5LA 2A83A 2VLKA 5MI0C 3QIUD 4UZGA 3V7MA 5IEHA 5ISZE 5A2JH 1J0ZA 2WIIB 4K3GA 3HHRB 5F9WB 1EX0A 5T1LA 4JRXA 2PO6D 4UUJA 3PP4L 1DQMH 1KCUL 4MQSB 4X6EA 3DUUB 5DQDL 4KK8D 2R29H 3TP4A 4IJ3C 2FECI 1K4DB 4HCRL 4O02L 1HIMH 3W0WB 1KCVL 4UBDC 5ANMA 1EBPA 5C9JB 5FB8A 5DDHA 2J8OA 4M6OL 3LEXA 5HGHA 3MLYL 4XCEB 4G8GE 4R0LA 3UPRA 4U05A 3DUSB 2FWOB 2DTSA 2XQYG 1UGNA 2XWTA 4D0BA 1MEXL 5CINH 2OI9B 2MFNA 1HN1A 3LEYH 4Y0GA 3K8KA 3H9HB 4OLXH 2QJDA 1T3FA 5DD1L 3VE0B 3S4SG 3CXDH 4TSBH 1KGCD 3B43A 3MRRA 3P4OB 5GGSB 2X4RB 1AQDB 4DQOH 1LHZA 4MQXC 4MGXA 2J88L 4DZ8A 4EIGB 3VI4F 3OR6B 5C0AB 3PWPA 2N4IA 5KVMC 1UEMA 3A6CH 1A3RH 1RU9L 3HB3D 1FFRA 1OAXH 1JBJA 4LEOA 1B2WL 2VNCA 3BMWA 3EDFA 2F15A 4X6BB 1AJ7H 5EBWB 1N59A 4F33B 3BGMB 1TZIB 1CGWA 2PYEE 4P3DB 4N0CC 4MQTB 1S7RB 3GI8L 5T1MA 2NXZC 3TBSB 4AM0B 4X6DB 3EBAA 2IBZY 4N8CH 1W0YT 4JHAL 3IGAA 4MLIA 4LAJH 4BZ1H 4PLKD 4KQ3L 2WQ8A 3CFIC 4WTWA 2JLLA 4OQTH 1SJEB 1EVTC 3IDXL 1D5BB 1MREL 3MQIA 4JVPA 5ACZA 4L1DA 4NUGL 5D9SB 4POYA 3NCFB 1CCZA 2NX5E 4OFKA 3MLVL 4BZYA 4OZHB 3RDTA 5C7XH 2V2WA 5EORL 3VXUD 4X4XA 1MVUB 2OL3H 3WJLA 4OLWH 4CVZA 5ERWB 1AGBA 3QDMA 4GKNA 4XX1E 4PJCE 1JGEA 5GJSL 4K07A 1KTKE 1EO5A 2EE3A 1W0WB 2I9TB 3V0WH 1OAQL 1RK0B 2HVKA 2P5WB 4KMTL 4HFUH 1H15B 1RJLA 2FJGB 4RMUA 5IKCA 4PGCB 4RAUB 3GZKA 1FPTH 1P5VA 2QQLL 3G6AA 3ETBF 1WZLA 2ARJQ 2EDRA 5JOEA 3VRLE 1OP5K 4YHIB 5CFHA 3FFCA 1YYML 1S5HA 4K7FA 4HIIA 5E2VH 5HTSA 5AUMB 4NQEA 1FVDA 4X6CA 5IVZB 3KS0H 3RDTC 3D69B 5JLZB 4OCYL 5SV4A 4MNQB 2Y5EA 3WJLC 4GOSA 5D4QA 4HIEB 3ZTJG 4EN3D 3QI9A 5K9JH 4P57B 4TUJA 3RJDA 5DS8B 5C8JA 3JUYA 5I74B 2F19L 4MZ2A 3SE4A 2R1XA 3BN9D 2EDXA 4PJ7F 1N3NA 4C56B 4XC3H 4S1DC 1UT9A 1FHGA 4TNVF 5C0ND 3B5GA 1LO2H 2JELH 1VFMA 1UVQB 2Q7NA 4RMQA 4X0KB 4F7PB 2Z0BA 3EOYG 4UIMB 5E2TL 4WTZG 3PWLA 5DI8A 3MYJA 1WC7B 4J23A 3RP1A 5DJ6B 1AQKL 2GTZB 5DRXB 5E00A 5HYJB 5I73B 4G6KL 5GRVL 1DUZA 1YQVH 3SE4C 5KG9B 3DV4B 5DD3H 1VGKB 2W65B 5IOPA 2IEPA 4NQUA 3SGKA 3BKCL 1URLA 2HJLB 3K74B 3O4LB 3DARA 4RQQB 4X8JB 1ZS8B 1RUQH 3RWJB 1DJSA 5KSAB 4L4TE 1H8NA 1L7TH 5AZEH 5C09B 4U2ZA 4LFHG 1FL6B 5E1AA 4Y19B 1CU4L 4P9ML 2ZNWA 2I5YL 3SJVB 1U8JB 4KFZC 4TUOA 4NKMB 5F9AC 2G5BB 4OAWA 5JHDB 3CUPB 2ZCHL 4XMPH 4MCZB 4RMVA 3JWNC 4AEHH 1UXSB 1KLFA 4L8CB 5IQ9B 5BVJA 4U0QB 2EDNA 3VGFA 3SGKC 3TF7C 4NRXA 1H3WM 3RVXD 4M6NH 3PGCA 1MFDL 1DN0B 4KRPC 1T66D 3W9EB 2F8VA 1RMFL 3O6ML 5K9QG 4NO0B 1NJ9B 2EEDA 1U8LB 3O2DL 4GAJH 2V9QA 3KWWA 2AQ1A 1WQVT 2E9IA 5TPWL 2UUDH 3K2MC 5FIEA 1MAML 1HOCB 1BF8A 3P0GB 5CEZE 5GSRA 1CR9H 2AJXH 3QDGA 3JWOL 2EZ0D 5F6IC 3AU1A 4Z77B 5LGJB 4J4PA 4N8VG 1A7PH 3BW9B 3MRFA 5M94B 2N7AA 4MHHG 4P5MA 1T4KB 3AM8A 5LWYL 3TYFA 3QIWD 4TVSa 4FQCL 4JPKH 3RRQA 3BX7C 3N9GL 4PJDF 2VOTA 2EDQA 3U4EA 2VLRA 4PRHD 2W91A 4DKFL 1OSPH 2ZUYA 3C87A 1ZLSL 3UJTH 1HXYA 2IFFH 5ENWB 4MD5A 1U8PB 3SKMB 4X99B 3BN3B 4R7DA 2FL5B 5L8KB 3QXDB 5FHBL 3OJMB 3TFKD 1YMHB 1SYVA 3BQUA 1EHAA 4XNMB 1FQ9C 4J4PC 1PW3A 2COQA 4NZDA 1RJYB 3I6KB 2H9GA 3MUHL 2NZ9C 2OSLB 1IMHC 4L5FH 4PTUA 4JFFA 1FO0L 2J8HA 4PV8A 4P46B 1K85A 4RIRA 2VC2L 2DMBA 5FFLA 1GRWA 3FAWA 1EVUA 4HK0A 4KTEL 1BVKB 1NCCH 3IRPX 1J0IA 1CWVA 4PD4J 1BOGA 3SE9H 1CXLA 1SQ2N 3LS4L 5JUEH 4M5ZL 4ERSL 3JZ7A 5LAXB 1KTRL 2E6PA 3OZ9L 5DHVB 3HNSL 3GJFA 3UTSD 2HRPL 1YDPB 3ULUH 1WAAF 3BQUC 1GGIL 4QXUH 4N0RA 3GO1H 1V7MH 3KPQB 1A5FL 3LKPB 1QBAA 3ZKNC 5A3ID 4OZ4B 4NJAH 4NZJA 1O5DT 3QYCA 1PKQE 1BBDH 1VESA 4LLVB 4UB0L 2DLGA 4HLZG 1IEAA 4D9QD 1JYNA 4GAYA 1J1XH 3DGGA 1YMMB 3MPCA 3N50A 4UQ2B 1DVFB 2DIJA 3GJFH 1U8IA 2Z4QB 2Q6WA 5IFAH 3NH7H 4X7SH 1XF1A 2I25N 2YSSA 4U31A 2VTFA 2HJKB 2CGRL 3FT3A 3KPRB 3TO4B 3QFDA 3VFUB 1Q9KB 2EXWC 5C0JB 1NCBL 2OP4H 4JY4A 1CDBA 4XH2B 2DLFL 5B38G 3ZHDA 4LPCA 3WS3B 3EYFB 5AYUL 2CDEB 3BPLC 1BGXH 1MCPH 3OAZK 4PRIA 4P5TD 3TO2B 2F5BH 4PJ7A 1FV1B 4QRPE 4JKWA 1JPFB 1WBXA 4YDKH 3BD5A 4PY8J 4EDXA 1FC2D 2HFGL 2XN9D 1S7XA 3LRSA 3V6OA 1LO0H 1VGEL 4GS7C 1ZHBB 3DO7A 3D0VB 5BO1L 3DMMD 3HZMA 4RGNE 4IRSA 2YEZB 1EDQA 4J6RH 1PYWA 5J89A 3L3IA 2DLEA 5E2UH 3MA9H 4KI5D 4F37K 1CD1A 4QF1B 1A6ZA 3HE7B 2AEPL 5D7LD 4J3UA 1G6RL 3NIGE 1GIGL 2A74B 1KYOJ 4OCNC 4ODHL 3UTQA 3F7VA 3SDCB 1FGNH 3OXSB 2IG2H 4FQLL 4QRUB 1D6EB 5DJ8A 2X89D 2H2SC 3HNVH 5SWQA 5I6XC 2ZPKH 4YX2H 2WINB 4ZUUA 2ILLA 2X4OB 1GC1H 3PHOA 1B6UA 1KG0A 2O61B 3V2AR 1GXEA 5DJZB 4OLVL 1N5YH 2R1WB 3JVGA 3IFNH 2VDPL 2MHAA 5CD5D 4XPFH 5HJ3B 2HKFH 2H6PB 3X14A 2OR9L 1MIMH 4PS4L 2C26A 3WXVL 4FFVD 4Q9RL 3MRGB 1B0RB 3T0ED 3QUKB 3MOBH 3WHXB 3TNNB 3S96A 3EO9H 5EZIL 1ZTXL 1AGDA 5I75C 4MSWB 2JJTA 1N0XH 1YY8A 4CMHC 2EC9T 5IWLC 1BD2B 2NR6C 3JVGC 3JTSB 4WO4A 4YGVA 3HFML 2CLRA 3VWKA 3EJYD 5I18H 3SKNA 2VAAB 4YNYB 4MJIE 3MREB 2F53B 3ULVE 3PQYA 4LHQB 3AXLA 3EW3B 1E4XH 4K23L 4KMQA 4NPYA 4HUXA 1ZHNA 3CVIH 3D18A 5C0IA 4YEEA 3U46A 3EYOB 3O9WB 2OBGA 1C1EH 4MA8H 3NCYP 5DSCA 4LVEA 2JJTC 3IDYB 5C0BB 1HXMA 35C8H 4KROC 5E4EC 1IC4H 5TDOB 3U0TB 1U58B 2UVEA 1JIBA 4PJDA 1QQDA 4WO4C 1C7TA 1U8OB 3VWKC 1BZ9B 4L9DA 4TN9A 5T5NG 5L2KE 4UTBH 2P5EB 4FQXC 3VFMB 3PIQB 3UTTE 2MCPH 4GRMB 2FO4A 5DA0B 1OOAA 1P7QA 3AY4A 4LMQE 3DRQB 3ROOA 3I3BA 4XAKE 3RWGA 1MHEA 3BGAA 1AGCA 4TRPL 3LN9A 2JIXD 4KHTH 3C8KB 3KPNA 3PV6A 3U36B 4TTGA 2VR9A 5D1QD 5F1NB 1XFPA 4P23A 2YA1A 3PF2A 5KSUB 2X1PA 4G6JH 5FUZL 4LU5H 1AD0B 5I8KH 1CLYL 1G7JB 1I9JL 1Z3GH 3V0VB 4NQCA 5DUBA 2F8OA 3MO1B 3UPCA 2D0HA 4BYHA 5A43C 2QSQA 1ZA6B 3RWFB 4U1HA 3C60D 1H8OA 2Q3AA 3DX9B 1QPPA 1PLGL 4Y5YB 1C16B 3U1SL 3KXFE 1EHLL 1NMBL 3SGEI 3SHSA 1ADQL 4JAMA 1VHPA 2DDQH 3HMXL 2ZG2A 4R7NB 4M8QA 1FL5B 4P23C 1BAFL 1WV7T 3DPBA 3MRBA 5GGRB 2R4SH 4NT6A 1HCFX 4PGDA 5IF0B 2XZQH 2ADGB 2HMID 4KUCD 1GGBH 3F7PC 2XOTA 2J6EL 1YN6B 1A02N 4XNUH 3CSYA 1TITA 3MLSH 5ISZB 3QPXH 3VXSA 4J12A 1RZJC 4HZAA 2XNAA 1P84J 2OM5A 1A4JB 5ID0A 1FP5A 1MHPL 3H7BA 3MRJB 3L95A 4X7TA 2XRAH 3D39D 1ZA3A 1TJIL 4EI6B 1QUNA 3QDAA 5AEAA 1CXFA 4PJ9A 4OZGE 3RTQA 2CR3A 3PWVA 4FXGA 4CVXA 4IOFC 3FCTA 5EU6B 1JF1B 4YHPA 3P9LB 4B0MM 1IAIH 1I1AD 1YN7B 2LABA 2VLKE 2BVTA 4QOKD 4Z7NF 4HJJH 1OLLA 5C0GA 5IVXB 5B3JF 4X5WB 3LS5L 2HTLC 4XVJH 1I7TA 1Q9OB 1YEIH 2NW2A 2E3VA 4JRXE 4MD0A 3FT2A 4WFHE 3ISWA 5FOJA 3IJHA 4OSUL 3MJ8B 4JFDD 3NFNA 1QG3A 1VFUA 5TDPA 1A4KA 2QLVB 1MI5D 4G8IB 1YJDH 3RTQC 4HGWA 4PJ9C 1UEYA 1F4XL 1S5IH 5I30L 1NGYA 4ZFOA 3ARGA 1I85A 2AABH 5K9KA 3GSNL 4UAOB 4U1LB 1EBAA 1RFDL 1YJDC 5JPNB 4C83B 4J3TA 4U1JB 5IB3B 5I1CL 4DGYH 1AP2B 3DV6B 2JJVA 1D9KD 2Z91B 5SWZA 1UA6H 2YKLL 4Y5XA 3MBXH 4JZNA 4MJ5B 2HT3D 2F5AH 3C6SB 1IQDB 2VWEC 5F1SA 5AAWA 4W4NA 1ZVHA 2PYEB 2PW2A 4BUGA 2ICWB 3DROA 3MUGB 1TPXB 4RGMB 4G43A 4ELMB 2OZ4A 1MLCB 3KLAB 3QEUB 4ZXBA 2JB6B 3ARGC 3VXRB 1I85C 3RUGE 2GEEA 1LK3L 3ILPA 3PWPE 4JRYD 5DO2D 1M7XA 4Y16B 3QP3A 3INUH 43CAB 2NX5B 4TSAH 4ZS7H 1A9EB 2JB5L 1DN2A 3FL7A 1OLZA 4Y5XC 4KKAC 5MEQB 1BFVL 1IM3A 1MLBA 4MAYB 5FDWB 3IFPA 3MXVH 1IZKA 5C86A 2P24B 4ZSOE 1WCBB 2XIDA 4YZFF 2OZ4H 5T3ZH 3SE3A 4HKXB 1T5WA 4O2EA 3GRWL 2XPGB 2FIRT 5H37H 2CRZA 3KJ6H 4JANB 5IB5B 4MCYB 1UB6A 2VE6B 1HQRB 1LEGA 4ZXBC 3OF6A 2DQGH 3U0PA 4OKVA 2E8YA 1XR8A 4U1KA 5MEOA 2HKHH 2YUZA 4QHMB 3LSOB 2GW5A 4CNIB 4HX1A 4R4FH 4OIIH 1EEYB 3ZDYF 2OS7A 1FH5L 2P8MB 1CFVL 4CDHA 2Z35B 2ZZUT 1IGYA 2P46B 4L8BA 1MIEL 3QDME 3KJ4B 2XZAH 2R0WH 3ZHLA 3DO3A 1UM4L 4N5ED 3VFVA 1DQQB 3SE3C 2P42B 1MNUH 3FB7A 1RIUL 1NFDB 3T1WA 4IMLB 2WIMA 2NTFB 1G9NC 4CVWA 1OY3B 5ICYA 1UB5B 4NNYB 1N5AA 1WEJH 5ILTL 1VFAA 3FFCE 3M8OL 1TZGH 2D7QA 4R9HA 4NQEE 5FA3B 1P4LA 3QUMB 1VA9A 1HYSD 4NM8L 1FVCB 1QFWI 1MRCL 2AJ3A 3VDCA 4QYOA 5GIRA 1WVZA 2YXFA 3ZE1E 4H8WL 1TZHB 3VXUA 1NC2B 1IGFH 1LO3H 2VDRH 4WU7B 1U8QA 4FN0A 4PJAF 3O11B 2G75A 1IGJB 3AVEA 4GAFB 1G1CA 4H1LG 5E6ID 5IV2A 3S9DB 3DJ9A 3CK0L 5DD0L 4I4WA 2GSGB 4PJIB 4RSVA 2APFA 4MDJA 2X40A 1MJJB 4UQ3B 2Y36L 4LMQI 4UILL 4YHNB 1G7QB 4BFBD 3TZVA 3QHFH 1YNLH 2BFVL 5GJTH 1Z9LA 5TQ0H 4LHUG 3HZVB 5J9PB 5CP3H 3GSXA 4LVHC 2GSIA 4K7PY 5DHYB 1IAOB 3UTOA 4WV1B 5JIPA 1T04B 4FFYL 3V79C 4NM4L 5KSVA 3U9UB 3TEUA 3JXAA 5D2NA 4CMMB 3CX2A 2NZIA 3NPZB 4FFZH 3EO1B 1AGEB 4ZAKB 3SKJL 5LGHL 3BRGC 4HG4K 4JFPA 2NYYD 5TDNB 3V8CA 2DRUA 4OT1L 4YK4B 1RZ7L 4NNPL 4KY1L 1KOAA 1NC4B 3GSOB 3TZVC 3N0PB 4R4ND 2UY6A 1EH9A 4LOUD 2VIRB 4Y4KB 4Y8DC 2PYFA 3D9AH 2IADA 2IALB 2FX9L 3SKUD 4R4BA 1DLHB 5D7KD 3GMOB 4MD4A 5LCVH 2B0SL 3PUCA 1FN4B 4WJ5A 5D2NC 4DZBA 2GFBA 1EHXA 1I3UA 1GOGA 5B4MC 4MVBC 2NY7L 4NUJB 4P2RD 4L8DB 3S3JA 4GRLB 1YUHA 3BGFB 2D7TL 5ESQA 4WHDA 1C5BL 3W0WD 3C5JB 4EI5C 1QVOB 3GIVA 1JPST 4HCRA 4EEEA 2D4FA 5CZVH 4OD2B 4RRPA 3KYNB 3FO0L 4GKZA 1WGOA 4U1IA 5F3BA 3BP5A 3F65A 3QFJE 2GITB 1L6XA 3PABB 4U6VL 5MEPA 4QTIL 3I6LE 8CGTA 3QT2A 4ODSL 4ZUVB 2ICWJ 3OKLB 2YC1B 1V3MA 5F96L 1Y0LA 3BP4B 4E5XB 4JM2D 1SY6A 4P9HL 4Z7UF 5EBMB 4HCRH 4O02H 1E27B 2OX5A 1KCVH 4NDMB 5DR5L 3O3AA 5HHXH 1U8HA 4JREB 4M6OH 2D31A 3GB7B 5EOTB 5ID1B 5C0AD 1YNTA 3A67H 3NVQA 1QR1B 3KDMA 3DX7A 3VD3A 2YBRA 2MNUA 1VACA 1MQKL 3DGCR 5D1ZA 3SPVB 3ZO0A 4GG8A 5GS1B 1Z2KA 1ETZB 3QWOA 1RK1A 4LCUB 3H2WA 3GUTB 5D71L 4ZUWB 2VLRE 4CNIA 3IFLL 4K94C 3VI4E 4XP1L 4X98A 4LSPL 1QYGL 1VDGA 3CFEB 3HI1A 4I2XB 5C0CB 1EFQA 3GI9H 1AR1C 1JTPA 4J1UA 3T4YA 4E42A 2J88H 5KSBA 3P77B 5GGUA 4QCIB 1J0JA 5IR1B 3C6LB 3ALXA 3Q3GA 5EA0H 5J11B 4NC1C 1AO7D 4D9LH 3QO1A 2HVJA 5D6CA 3PXJA 1CFTB 4XX1G 1KTLA 2BNUA 4Z78B 1I7UB 1B2WH 3THML 2QHLA 4NZTH 3VXNB 3GMQB 5C0EB 1TDQA 3WIIL 3C5SA 4YHKL 1JK8A 1U6AL 3VFGL 3GI8H 4R3SA 4BQBA 1OB1B 5BW7C 2B7DT 1INQA 2P5WD 1AI1H 3FZUC 4JN1H 5EU3A 2DQIL 1YY9D 1MREH 5CJBA 2YHGA 4GRWF 2CMRH 3VXTA 4NUGH 5DZNA 2BMKB 4G6FD 2P49B 1AC6A 3MLVH 1T0NA 5HVWA 5EUOF 3X3FL 3TYGL 1TETL 3V5DA 3EIFA 1Q8MA 1RZGB 4YXLL 3F7QA 2BOCB 4WFED 3X3GL 5EC1B 2DQCH 3FO2B 5JW4M 2P48B 2NY6B 4Y2DA 4JDZB 4KMTH 3VRJA 2FHCA 3B9KC 2QQLH 5DEZA 4ZUTA 4GXUM 3K4ZA 3I85A 5DFTA 1NCDL 5C70A 5IP4A 1NEUA 2BY1A 1BHGA 2W0FA 3RBSA 4PJ8A 4QRRA 1JGLH 1GH7A 1JI2A 4FQPA 3FRUB 2V2XA 2CK0H 4PJAA 5HHOA 5C2UB 3JV4A 3MBEA 5FM5O 4HH9B 4OGAC 1R3KA 3SGDI 2PXYD 4PRIE 1R24A 2FECL 4NNXA 4DN4L 3MROA 5GS3A 4Y2DC 3OTTA 4U1GB 1FL3B 2OQJB 4AL8L 4Z76A 2F19H 1KLGA 2J8UF 3ZKXB 6CGTA 5HYJD 4U6HA 1DEEA 3L1OH 2GTWA 3PGDB 5DJYB 4FQJL 1RZKC 4Z0BH 1BQUA 4JFXA 1K2DA 4LSSH 1RHHB 4XBPB 4KJYA 2PW1A 3O4LD 4EBQH 3ARDB 2H26A 5AG9A 2R1YB 3S3PA 3S5LA 1S8DA 3MBEC 5C09D 1T1ZA 3MCKA 4Y19D 5E2TH 4I18B 3VWJA 5FYJU 3SJVD 1T7ZA 5IG7B 1AQKH 4O00A 1B4RA 2QV2A 2H32B 4U1MA 5E2JA 5JHDD 5CS7A 3T77B 5FF6A 4ZS6C 4DEPB 1JHTB 5F7MC 3V8OA 4K3DL 4Q2ZA 3RGVA 2DAVA 4ZO9A 2R9HD 4ACPA 5GRUL 2BHUA 1I4FA 3C8HA 3DHJA 3VXPA 1NMAL 4IOIB 2IQ9H 3O6KH 2I5YH 3L3OB 3VWJC 1MFEH 3WN5B 4F2MA 4JY6A 1ONQA 1I8MB 3OHXB 4O2CA 3MV8B 5HPMB 3QUXA 1YEGH 3ARTA 1HHHB 3SEPA 3IDIB 5I17A 1H3PH 3LKSB 3KPSB 1X5HA 2KBGA 1FSKC 4ZUSA 1W8NA 4WHTA 4APQA 1MFDH 3RGVC 3QXAA 4YHLH 1XCQB 2BJML 4P59L 3P2TA 1R3JA 4Z7UA 3RNQB 4A2MA 5BZDB 5JW5A 2H8PB 1HINL 3IF1B 3FN0H 3ARFA 3O4OB 3O6MH 3PQYE 5HHVL