2W8CA

Plastocyanin variant with n-terminal methionine - closed structure
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
106
Chain Sequence
METFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal-Mediated Self-Assembly of a Beta-Sandwich Protein.
pubmed doi rcsb
source organism Phormidium laminosum
molecule tags Electron transport
molecule keywords PLASTOCYANIN
total genus 24
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2w8cA00
2I7SA 1L9RA 1ASOA 1AS8A 1ET7A 1JERA 5B1KA 4KO5A 5PAZA 1E65A 2VSKB 2HZHA 4W1TA 1BQRA 1KBVA 1AAJA 1NIAA 1NTDA 1PY0A 3X1BA 4P5RA 4DPAX 1E67A 2I85A 4HHGA 3ABGA 4G70B 3PAUA 1DYZA 1MG3C 1BXVA 1QHQA 1A4BA 4NERA 1TEGA 3C75A 4KOCA 2XU9A 1NZRA 1ILUA 1AZNA 4CSZA 5I5IA 4E9YA 1OF0A 1J5CA 2ZXWB 3FU7B 4TXVB 3HB3B 3IN2A 1NIDA 1YLBB 2MTAA 1PZCA 2VMJA 2BWDA 4BXSV 3NJJA 2FT7A 3AW5A 1SHWA 1GSKA 2BP8B 2FQFA 2AANA 1A4CA 1OE2A 4DP8X 1MDAA 4A2FA 1N68A 1HAUA 3PLYA 1NPNA 4YSUA 3ZX1A 2ZONA 3CG8A 1CC3A 1WA2X 5EHFA 4YSOA 4YSQA 4YSAA 1AANA 4A68A 3TA4D 2VSMB 2WSDA 2VW4A 4YL4A 4YSSA 1GY1A 1AG0A 2GB2A 5I6KA 2DWTA 1NINA 4L0PB 2Y69B 4YSCA 4YSTA 1KV7A 4N8UA 1X9UA 2EIKB 2IDUA 3S3DB 1JOIA 1KDJA 5IY5B 1SJMA 2QT6A 1AZUA 1ETJA 2VM4A 1OCZB 1AACA 4Q89A 4YVUA 1M9WA 1AR1B 1WAEA 2TSAA 3CVCA 4A2GA 2GHZA 3NSFA 3JTBA 4WKXA 1AQ8A 2FQDA 4KOBA 4JHUA 3IE9A 4AI7A 4DPBX 2GBAA 1ZV2A 1OV8A 1AZCA 1PF3A 1SFDA 1W8EA 4UF7C 1NICA 3EH4B 4FAAB 1L9QA 2FQEA 4HHWA 5B1AB 1WS8A 2BW5A 1A65A 2X88A 1ID2A 3FQ2A 3EF4A 3ERXA 4AKQA 1KDIA 2JXMA 5ANHA 2YQBA 2XLLA 1PNCA 2FJSA 3S8GB 3NJNA 3MBWB 3TU6A 4ENZA 2HXAA 3NJGA 4A2HA 1HAWA 1PZAA 2FT8A 3FPYA 3FU7A 5TK4A 3FSAA 3X1GA 4HCFA 2XX0A 2UXGA 9PCYA 2J5WA 2IDTA 4KNUA 2IDFA 3T9WA 3NSCA 2AZAA 4GY4A 3T6ZA 5FC9A 4E9SA 1NIEA 3NP3A 4KNSA 3NSDA 1GR7A 3L45A 2NRDA 4M3HA 1RZQA 2R7EB 4ZK8A 3AG4B 3SQRA 5I26A 4HZ1A 3S3BB 3U25A 4HIPA 1IBYA 3PPSA 1GS6X 2Q9OA 2HRGA 4YSRA 3ZBMA 3H4FA 1EZLA 1XB6A 6PCYA 5I6NA 4BWUA 2IH9A 1WA0X 3FS9A 1BAWA 1GY2A 3ASNB 4E9WA 1R1CA 3ZDWA 3WIAA 1ZIBA 5AKRA 3TBCA 2IAAC 2N0MA 2EILB 2BHFA 3ABMB 6PAZA 3ABLB 3T6VA 4AKPA 2TSBA 4A67A 4N4YB 1FWXA 1JZJA 2XV2A 1X9RA 3OMIB 1DZ0A 3CDZB 3ZIYA 1IBZA 3NYKA 2Y1AA 4BDVB 3OMAB 3WG7B 4A66A 2ZOOA 2BO0A 4X4KA 1RCYA 3SBPA 4G7QB 5I6MA 2J55A 1ILSA 4DPCX 4A2DA 4G71B 3GYRA 8PAZA 4DP5X 2W88A 1E5ZA 3RYMA 2PCFA 2IDQA 1NIFA 3D12B 4BWWA 7PCYA 2A3TA 3QJTB 3CZUB 2HX8A 2EIMB 5D4JA 1NPJA 3UACA 3TASA 5B7MA 2UX6A 2HX7A 2H5UA 2B08A 3IN0A 2VM3A 1J9TA 3HEIB 4E9QA 1KCWA 3GDCA 5I6PA 1ZDSA 2XX1A 4G7SB 3FYEB 2PCYA 3PCYA 4K9JA 3WKPA 2DWSA 4NB7A 1JXFA 3T71A 2ZWNA 3NJIA 2IWKA 4BXVA 7PAZA 1AZBA 2CALA 2BP0B 4DP2X 1SDDB 3PAZA 3WKQA 4MFHA 3KW8A 5D4HA 3AZUA 3X1FA 1NWPA 3QJVB 4W9ZA 2YAOA 2XV0A 3NSYA 4EF3A 1V10A 2HX9A 4F7KA 2BZCA 1AIZA 3NJMA 3N2JA 5B7EA 2QDVA 1V54B 1L9PA 1OCRB 1ASQA 4HCIA 1SNRA 1OE3A 3AG2B 1ET8A 1HFUA 1MZZA 2CBPA 5AZUA 3DTUB 3SBQA 1CUOA 3DIVA 1N70A 2PP8A 2XV3A 1BEXA 4A2EA 1JVLA 4BDVA 1PLAA 1M56B 1TEFA 2LLNA 3H56A 5B1BB 2PP9A 2P80D 1KYAA 2B3IA 3AG1B 2QPEB 2XUWA 2DV6A 5F7AA 4RH4A 3FPXA 4E9VA 4E9TA 3BVDB 4BWTA 4DP9X 1PCSA 2XVBA 3FSZA 4QLWA 1MZYA 1WS7A 4YSPA 2FNWA 1TU2A 1XB3A 2YAEA 4AX3A 2OV0A 1KCBA 4DP6X 3T6WA 1JXGA 2HRHA 4YSEA 1RZPA 3AY2A 4E9XA 1E5YA 1J9QA 2PLTA 2Q5BA 1JZIA 2BZ7A 2CCWA 2FTAA 3BQVA 3NJKA 4KO7A 2PPCA 2PPDA 3X2QB 2VW7A 2YAQA 2IDSA 3CVDA 3UAEA 4F2EA 1GYCA 3PXLA 1ADWA 5I28A 2JKWA 5I6LA 3WNIA 1J5DA 3DKHA 4M4RB 2PP7A 2IH8A 1NDTA 1GW0A 3JT2A 3WI9A 1KGYE 2BWIA 3G5WA 3KW7A 3UAAA 1PLCA 2QPDB 3V9EA 3FQYA 1PAZA 1I53A 1PZBA 1A3ZA 1L9TA 1ZPUA 3GXUB 3QPKA 2FQGA 1JZEA 2H3XC 2PPAA 3MX0B 3WNJA 3QJQB 2VN3A 4QKTA 1JZFA 1XB8A 5AFAA 2YXWA 2AZUA 5I6OA 2JFCA 2MRYA 2GI0A 5D4IA 2WO2B 2CJ3A 3PAVA 3EH3B 1BXAA 1IKOP 2PPEA 3OMNB 1XMEB 4YSDA 1SF5A 2R7EA 3NJFA 4DP0X 2YAMA 3FT0A 3S3CB 1J9RA 1EHKB 2W8CA 2DYSB 1W6LA 4KO6A 2DY2A 2GC7C 4KNTA 4Q8BA 3X1EA 1WA1X 1F56A 2FT6A 1ZIAA 2E86A 3H4HA 1RKRA 2GC4C 4UANA 1A4AA 4PCYA 1JVOA 1JZHA 1OE1A 1IC0A 4GP8B 2WO3B 2I7OA 2QDWA 1NWOA 3IEAA 1BQKA 1W6WA 2RACA 4E9RA 1AS6A 1ASPA 4YVNA 3QQXA 1MG2C 3QJUB 4JHVA 3UADA 1L9SA 2FWLB 3FSWA 1OCOB 2EIJB 3NT0A 3V9CA 1VLXA 4UAHA 1PLBA 3OM3B 1QNIA 2UXVA 2H47C 1QLEB 4GXFA 5B1JA 3S8FB 5B3SB 2UX7A 4F2FA 5I5JA 4PAZA 2XYBA 1A8ZA 4KO9A 3EHBB 1FFTB 1BQ5A 1UATA 2XWZA 1BXUA 2GIMA 2IWEA 3FU8A 3CVBA 5A7EA 3QJRB 1T5KA 1PNDA 4WTQA 2YAHA 1CYXA 1CURA 4AZUA 5F7BA 1OOWA 2GSMB 1GS7A 1B3IA 4FA7B 1SFHA 2YAPA 1AOZA 4CSPA 1KBWA 1V55B 4GP5B 1ZDQA 4JKNA 1JXDA 5LDUA 1OCCB 2IWFA 1M57B 4DP7X 1URIA 2VW6A 3X1NA 3NJLA 1FA4A 1BYOA 2BP0A 2DYRB 4HCGA 1SDDA 1TKWA 3EH5B 2J57A 3UGEA 2BW4A 2BP8A 1NIBA 3FU9A 5I5MA 1AG6A 1AZRA 3CDZA 5B7FA 2OJ1A 3ABKB 4G72B 1ET5A 4GP4B 3FQ1A 1L9OA 1GS8A 2OCCB 3UABA 1CYWA 4P5SA 2J56A 4HALA 1IUZA 1E30A 3QJSB 2AFNA 1SF3A 1AS7A 3FYIB 3T6XA 2AVFA 2X87A 3SBRA 1JZGA 2HLEB 3ASOB 3FSVA 3NP4A 3NJHA 2UXTA 2XXFA 3OD3A 4BK5C 3OQRA 3IBOA 3N55A 2YAFA 2P80A 2PPFA 1J9SA 4DP4X 4GYBA 2YARA 4NAJA 2CUAA 5TK2A 2XXGA 5E9NA 5B1JC 2UXFA 1BYPA 1SHXA 2CAKA 3AG3B 1PMYA 3TBBA 4DP1X 4AKOA 2EINB 4HAKA 2YXVA 5PCYA 4G7RB
chains in the Genus database with same CATH superfamily
1UZ6E 1P1VA 1MJ7L 5FUZH 3SDDB 1EEYB 4LHQB 5D2NE 3TBSB 4KO5A 1FBIL 2F58L 4PJ9B 3BISA 4O00A 4HLZG 3TTYA 4H8HA 2EYTB 5IW1B 4AUJA 4ZX6A 4KGLA 1DSYA 1T20A 3ZRCC 3NFNB 4BQBA 2O5NA 2Z8WC 1NM9A 3GSNH 2BSCA 3K91A 3BFOA 3CIAA 3L3GB 2CHDA 3U4BH 3EIFA 3N9GL 3EYOA 3QIWB 1BVNP 4KJPC 4CJ1A 2ZWYA 4BBWA 4PGCA 2GFBB 1SGKA 4GIOA 1NZRA 4PI0A 5JW4N 4KK5C 5IWLA 4D0CB 4Y9GA 1Z66A 5JLZA 4XWOC 4NI3A 1JGVL 4ZQTA 1BD2A 2D9QB 5C0GB 4FXTA 2ZXBA 4YUEH 3TYFB 4BXSV 3NJJA 4ZFFA 1ZPLA 3CZLA 4KDVA 2XTLA 4CVWA 4P5TD 4GAGH 4LZKA 3VW3L 4PRAA 1AXSA 2CGYA 1HESA 3UYPA 4KJWD 3HRZC 4JO2L 4ZO7A 3L4VA 2CBTA 5LGHH 4PRNB 2HWZH 5HPMA 1G7QB 2VN5A 4J12A 1NBVH 4YLQT 3OAYH 2PYEB 1MAML 4R97B 3NCEB 3NSXA 3ULUD 1I9JL 4IU3B 4EO5A 4GUOA 2IPTL 4OF8A 1CE6B 5G4OA 1KF9B 3HBZA 1VKXA 1FE8H 1JVKA 2XA8L 4OJEH 1JWUB 2MEJB 4GMSL 5FR3A 1CDUA 2RQ8A 2ENQA 5GISH 4CSTA 3U7WL 2EKSB 3NJVA 4XXDA 4I77L 5E6YA 1XDTT 3ZPDA 2GHZA 3LRSA 1TXKA 3OJVC 5LN4A 5TD4A 5D71H 5EPMB 1T6BX 2NSXA 3FCGA 1IVLA 1CICD 5F9JB 5DZOA 1N67A 4JRXD 5D1XD 1BFSA 1EDHA 1XXDC 1EMTL 1NC2D 3MLVL 3PRZA 4BSWB 1SBSH 2C4FT 5B1AB 1YEEL 1I9IL 4E5XG 1FO0L 1XF4B 2ZCLH 2ZG1A 1K5WA 1SM3H 5HYJB 4AQ1B 1OEZW 3CNKA 5HI3D 5KVGH 1NGZA 1PZAA 4B9YA 3HN3A 3QDMA 1Y0LB 5EBGA 2JCCF 1C12B 3UGXA 4N2BA 3U4EA 4GRWF 2NUPA 4MZ2A 2P48B 3QUYC 2D7MA 3OZKA 3ZTCC 2P5EB 4HWNA 5AW0B 5L7XL 2EXYC 1QLFA 1WBZB 2YMXL 1T0NA 4FQXB 3INOA 1Y07A 3HC4L 4C4KT 5BV7B 2OJEA 5C0CA 4F7PB 2WKOF 2WBJB 2XN9D 5I8KH 5F7YC 3HNTH 5IHZB 2ENYA 2YC1B 3O6KL 1H0DB 4HJSA 3HAEA 4YPJA 1XB6A 3AM8C 3M07A 3VG9C 3CXFA 1EZSA 1NL0H 1JFQH 3OSVA 2ICWB 3TZVD 1WCQA 1HHHB 5F7UA 3VXMB 3MBXL 1YMME 1EO8L 4X4MA 4DVBB 1YNKH 4A7VA 5CSZB 5KSAB 3W5MA 4GUCA 3P9MA 2EIZB 4GO9A 3HN8A 4OF0A 3IYLW 4UTAL 2ZXEB 3DXAB 1N6UA 5LUMA 4MB4A 1MRDL 5DHYA 2ED7A 5DD3L 2VUYA 4XPAH 3OF6D 1F90L 1W72H 4MB5A 3WS3B 3LKRB 4JG0H 3E7JA 1M42A 4AJ0A 4LP5A 4G7QB 1SYVA 3MRQA 1RJLA 1TZGH 3LS5L 4HPHA 4A2DA 4XGZA 1ICTA 3E80A 2RCSH 4AITA 4P07A 2W88A 4K7FA 3FB6A 3L3IA 3QDJE 1XAKA 5FO8A 5HJ3B 4L1TA 5FHAL 4FLRA 4R96B 2W9DL 1EANA 4G8EA 4LP4A 1F5WA 3IMUA 4MXQD 1JK8A 1A7PH 2WNKA 4Y4KD 3VA6A 4GRWE 5FDYA 2OMZA 3GXIA 3DARA 3OJDA 3UACA 5B7MA 4YGVA 2WGNB 4NO5B 1TMCB 1EGJA 5EIIG 4H0HB 1J9TA 1KLFA 1YNTF 4WHDA 1BFOA 3UBFA 4X0KA 3QWOA 2A6KB 5BS0A 1O0VA 2APFA 1GRWA 1KBPA 1CFTA 3IGUA 3JYCA 3M1BA 5EORL 4XP5H 5BZWA 1NCBL 4LSPH 3LRLA 3OF6A 3LIZH 2D2CC 5I1CH 5IR1A 4KZEH 3IMVA 1RIHH 2APXA 5DJXA 4YHLL 2C5DC 4UTBA 3ZKMC 4YHOH 1JHTA 2YLHA 4MBRA 1T5XA 5ISZA 1XTLA 5AVQB 4O02L 4Z7OE 3WKYA 3ORJA 1AD9A 1HL8A 2XIDA 1X7QB 4YX2H 1V54B 4QIRA 4IK7A 3OR6B 1ZWIA 3BLPX 3AWEA 3V52H 3DX9B 3NVQA 3GJFB 3VDBA 3QQ9C 4G80A 3ZE0F 4UQBA 1VADA 3NGBB 5M95B 1N70A 3BAXA 3QFJB 1N7ML 1QLRB 4N0YH 1XHHA 1KGCD 1UWGL 1INEL 1G94A 2Z91A 3FMGL 1DFBH 4DVRH 1E7VA 4W93A 5D8JH 5DZVA 4M7ZC 3U79A 1E2VA 1JG9A 4RH4A 5H8DA 1KC5L 3RQ3A 1AGDA 1A8JH 5GS0H 1LK3H 4U6VH 5FA4B 1LEIB 4KJQC 1SEQL 4MNQA 1R17A 2FNWA 2K8QA 4MA1B 5IQ9A 4WI2A 1G7LA 2Q3ZA 4ZUUA 1U6AH 1OTUC 3QIBC 4YSEA 2XA8H 2VAAA 3IJEA 1FL5A 4A38A 1KBKA 1JYNA 4AV0A 2BLFA 4ATTA 2N1TE 3KNBA 4ZO6A 1BBDH 1WD9A 4NRXA 4JFEB 2CCWA 4YEFA 3TJEL 4GBXB 1XGZA 4Y2OA 2R1WA 4WWKA 4Z7OB 1DBML 2IV9A 5C6TH 5GXBB 3HC0A 3RVXD 2OX5A 2PP7A 2XZAH 4N5UA 1BD2B 4M5ZH 4L4TE 4QOKD 4GQQA 4A1RA 4FJ6A 3T0XA 2X2IA 4ZFFB 1CFSB 4KQ4H 5SWQA 5GRXG 3V9EA 1XBRA 4TQ8A 1ES0B 5KN5B 1LO3H 4N6RA 4XO9A 2FUQA 3WNJA 1I9RH 3TT1H 2F7PA 4A39A 4HJ0C 2AZUA 3QR0A 3IGKA 3MR9B 2MRYA 5D4IA 2LOEA 2WO2B 2GJJA 3RWIA 5K9QI 5ESQA 3LEVH 5L9DL 1AXIB 3BAEH 1IIIA 2ICCA 3B5TA 2XG4A 3OKNA 3SDYL 3WE1A 1BF8A 4XN8A 3Q05A 2JV6A 2WLMA 3CQFA 3N1PC 5HYJD 4HKZA 1VKXB 2ADYA 4OQTH 2DOCA 2DYSB 5CHNB 3BXNA 3GMPB 2B15A 5TH2A 4WFHD 5L6YH 1ZE3C 4U1KB 1RXLA 4F7CB 4B9KC 1RZIB 2A9NL 4GRWH 5I74C 3MJ8A 1PCXA 2DYPD 1COBA 1HE7A 2AV7A 3KMDA 2HVJB 4JREB 1NPUA 2MCMA 3U2SA 4DTGL 2I7OA 2VLRB 4X7EC 2G3NA 5EPMA 5F0PB 5H2BA 1IARB 4MHHI 1U0QA 4B9FA 4UQCA 1JZ7A 1I9JH 3MFFB 4K3EH 3RJQB 2EO9A 3VGHA 2YPLA 4EI6A 1RJYB 2VUKA 2OYPA 2XIIA 4ACPA 4LSRH 1ZHLB 3WNOA 2YOAA 3WEOA 3K72A 1R5WA 3FF8A 4AL8L 3ARFB 3KYOA 3VX0A 1NMCB 1MCPL 3CHXA 5D1QE 4K73A 1H3VA 4WWKC 3K6FA 4NZDA 3V4VH 2VO5A 4W6WB 4GAFB 4YHYB 1DO5A 4P46B 1FFNA 2F58H 1UATA 5KVFH 4FD0A 4HZLA 4PGBA 4R84A 2DQJH 4OZHA 1CDHA 5GGUA 1JGVH 3BUTA 5EO9B 2BHZA 2P5EA 4JMXA 5CJ8A 2Q20A 3W56A 2E7LA 4XRCA 1S7SB 3AWGA 5T3ZL 3QWNA 2AMUA 3DX1A 4LLUB 3WELA 1MHCB 2O5ZL 2VQUA 2YC1A 3X11B 1DBAL 3NCCB 3JWDC 1BQLL 2GSGA 5I18L 1ZDQA 3VU1A 3IDMB 2IOMA 2EICA 2ICWA 4NNPH 1DTUA 3ECQA 1DQDH 5DU7A 2A6JA 3BKCH 3I6LD 3BPNC 5BV7C 5E6IC 3U0TA 2GIXA 4W9CC 3CQQA 1MY7A 1YMMB 5KSAA 1L0XA 3N42B 1M71A 1Q9WA 3BQUB 2YUWA 2VDNL 1TITA 4OD3H 3I85A 2Y2YA 1PIFA 4LPXA 1BLNB 4U1JA 4Y8DC 1RUPL 4XHJD 4JFFB 1WGOA 1CICA 1E30A 1V05A 1R5VB 2COVD 1VEMA 3T6XA 4MXWL 2R29L 3TH4T 2BXYA 3FC8A 3AROA 2P42B 4YE4H 1ZAGA 2HLEB 5TQ0H 1HWGB 2BFVL 5JHDA 1XH1A 3N55A 2PCPA 1NJ9B 2X70B 2UZXB 2P80A 1F4AA 5G55A 1N4XH 5HYSA 1NCJA 1K5NA 1MFDL 1NCIA 3BZ4A 4DETA 1W9XA 4FG6D 3AC0A 2GBTA 4J3OC 4N0FA 4HEMA 2WINA 4OSUH 3TBYB 2H0EA 4OCRL 1KIPB 5AWNL 3QDJD 4LBAA 4H0IA 1JPGB 2IGFL 1RURH 3MNMA 5DJCA 2W38A 2YXVA 2VMCA 1GOFA 2I7SA 4PCSA 4X83A 2CRYA 4H8PA 3Q8FA 1PZDA 3THML 3BKYL 1CXFA 3MKGA 4X0KB 1FIEA 5BS0B 4WEEA 4X7FC 5HHMD 3LVTA 4RSYA 1VPOH 4MWFB 4Y2DC 3RVXC 2DQFB 2EC9T 3FQUA 5C2UB 5BZWB 3FO0L 4Q2ZA 4OZIB 1YUHB 2I85A 1N8ZA 3S37H 2VM9A 3OC5A 2JJVA 4NN6B 1XH3B 3FFCD 3COOA 5DWUL 5F0JB 1QUNA 3K0WA 1MVUA 3VFOA 2RBLA 3SQOH 2X1WL 1P69B 4QRSB 3DRQA 1BD2D 4MJ5A 4ODVH 3EDEA 1KLGA 1WFUA 4AH2B 1XGQA 3CN3A 1VEOA 4PJDE 4TXVB 1X7QA 3B2UD 3BPOB 3BEWA 4D3CH 5BXFA 2NY6D 4XN4A 3MC0A 4MNGE 5J6SA 1XGTA 4LCYB 4Y16A 4OKVA 1UT2A 1FL3A 2JJTC 3G6JB 1AE6H 4U0RC 1I8MB 2FJGB 1VADB 2W80C 5I19H 4L4VE 3L5WA 4OZHF 1AGFA 4TUJB 3EO0B 5DD1H 3BSZH 5AAPA 1RK0A 2YD8A 2IH3A 2I5YH 1MRCH 1MCWM 3ARXA 3RWEA 4HHAB 1ZMYA 1B2WL 5D55A 1L5GB 3QCTL 3MXWL 2ITFA 5I0DA 4YSQA 1JFQL 2D03H 2V9RA 5ADOL 5IFAH 4GW5B 4YSSA 5D93B 3J7HA 3LKSB 1MFBH 1X4YA 4YSTA 3X13B 4QHMA 3UO8B 4R7XA 1JOIA 4LVHB 2YR3A 1H3PH 2NY7H 1OCZB 2C4FU 3AREC 2XRAL 1E6OH 2X4NB 3VM7A 1I1AD 3MUHL 4K2UL 1UB6B 1YAIA 5G5DA 1PAMA 3L7EA 3KNBB 1QA9B 12E8L 5GZNA 1A9EB 4KRMB 1WHOA 4OFPA 4XZUA 5ABDE 2F5AL 4QCIB 4WKXA 3FH8A 3G04A 4GS7C 2VZTA 4CBZA 4WSKA 2ZP0T 2ROYA 4PP2A 4CVXB 1UCTA 1OV8A 5J11C 4APQC 1T83C 4F93B 3QIBB 3BD5A 2AAVA 2OA9A 3GMMA 3NUKA 1O7DE 1UZ8A 4IEFB 5KANG 4HPOL 5J6HA 2A0LC 4AQ8A 1EFXD 3Q3GB 2X88A 5ERWB 4MCZA 3RDTD 3NTCH 2J2ZB 5HYQB 5CLTA 1X5GA 2YFOA 1JZ5A 3DI3B 3DDGA 3DPBA 5DJAA 4ZZFA 4QNPF 2E47A 2VRKA 5KN5A 1HAWA 3ARWA 3B56A 4QDGA 5I75C 4CW1A 1JPTH 1LHZA 1BGXL 2BNRB 4JY4B 5IV2B 1YNTA 4Q9BA 4M7LT 2VLKE 2PTTA 3NZUA 5C71A 3AU1A 5E2WH 1VGKB 4FABL 3GMLA 4N0RA 4AGQA 4NFDA 1FN4B 4NO2A 3GO1H 5FC9A 2HRPH 1NIEA 1TO5A 4LFHD 4ZK8A 3IFNH 4PV1C 2IQ9L 5F7EL 3US9A 5F3BA 1KG0B 3FQ4A 5CHNA 5I71C 1F6LL 2XWXA 3QPQC 4N0YL 2F6AA 4LLMA 1IM9A 5HDBF 3IGFA 4KI1A 4AQ1C 6PCYA 4K9EC 1DQLL 3FS9A 4WU7A 2X4QA 4W9LC 4OZFG 5KVEL 1K3ZA 1OSEA 1SHMA 3WIAA 4LHUG 1CXLA 5HJBA 2DN7A 4CGUB 4WHTA 3GUFA 4F8LA 4KKCC 5AW2B 2ODHA 4BH7A 5IB2B 3QUYB 3ISRA 5I1HL 2G0LA 3ESVF 4I13B 2WCSA 3CC5A 3RVTD 1A4JA 1FWXA 4ZXBD 3AQYA 2JKTM 3NEXA 3REVA 4Z7QB 1YEWA 5EZJB 5TF1H 2YGVA 5JMOC 2QADC 2J8UA 4HJGB 4JZNB 4HK3N 2A1WL 2OL3B 3GGWA 1HQ4A 3MNZA 4NOBA 5ID0A 4A66A 5ENWA 3VQ1C 4PD4J 3MLWH 4AZ8B 2XFXB 2BJMH 1QEXA 3OKDA 2IWGA 4CMMB 1D6VL 4NPYB 4P3CL 4PJHB 2N7BA 3Q1EA 4ZRGA 1NEZB 4TUKH 5EZIH 1R3JB 3RTLA 5CEZH 2YD3A 1GGBH 5DJYB 4HZLB 4PGBB 4AJWA 7PCYA 2C7UB 3GMQA 4G42B 3MV8E 3LQAC 3QAZC 2YS4A 3P0VL 43C9B 1CGVA 2Y7QB 3FRPA 3K5SA 5C0DA 5D1QD 4GAYB 2BOLA 5JO5A 1UB5B 1ZLDA 3MFGB 4IBTA 4RVBA 3DIFB 3OKKA 4UM8B 5TE4H 3CH1B 3VSUA 1INDL 4WI6A 1I8LA 1MCQA 1A2YB 4ONHB 2K4AA 3K71B 4N8CL 4ELKB 2GAZA 4KBPA 2BSDA 2K8MA 1DEEA 3GRWL 2GIYA 1TNNA 3TT3L 3UBXG 4UAOC 1J8RA 4I9XA 4ICWA 4OFVA 3TWCH 3K6IA 1WRFA 4OF7A 2B0SH 4ALAL 2DYPA 2IAMD 4PJAE 4BE6A 3N9GH 2H3KA 4NC0B 4JPIB 2CALA 3K2KA 4IGBA 3KW8A 2ED6A 3OKMB 3UBXI 4ELDA 3CFEA 2HLFD 3ARYA 1MRDH 3C5JA 1MHEA 5E1HB 1AGBA 3TFBA 4RISH 1R9FA 4BEIA 4AEIH 4D3CL 2ITDB 4HSAC 4LAQL 2JKSA 2FO8A 2C9SA 3HHSB 5EZPA 1TDQA 4JKPH 1OAUH 4NQCD 5DD0H 1J5IA 4HD5A 3CCHB 4UT9A 1UOLA 3F3HA 4DQAA 1B0RA 4QY8B 1M56B 4G6FB 5BQ7B 3MLPA 2Y5TA 1D9KD 5B1BB 5L6YL 3VFNA 4N0FB 1FZOA 2XWTA 4PG9A 1J1XH 2WIIA 5DK0A 3ZL4L 2QPEB 1L7TH 4GT0A 1U8QA 2NY0C 4PR5B 4E9VA 1IAKA 3O4OB 1GL4B 3KJ6L 3P0GB 3P9WB 4XTRC 3VXQA 4BWTA 5KSAC 2MIZA 3L48A 2L7UA 2P8LA 1CXEA 3H7LA 4U31A 1IO4C 5JW4Q 1SJEA 1KXTB 4WWKD 2VTFA 1RZPA 1YEHH 3AY2A 3CU7A 1CZ8H 4X6CB 1U30A 1CK0L 1LLAA 2PLTA 2J4WH 2VB5A 2FTAA 3HNTL 5SWSB 1QUNB 2CK2A 1XIWA 1VFAB 3MLSH 4LOUD 4M1GH 4MJ6B 4MMYA 4PJGB 4N2DA 4TKWA 4KO7A 4HOWA 1T21B 2AQ2A 2PPDA 4QRSA 4QXGL 1OT1A 5EOQL 1PBYA 4F2EA 2AJYL 6CGTA 1IL1B 1KTKE 4BKLA 1HOCA 4KI5C 4WI0A 3DKHA 4FTDA 4ZUTA 2A9ML 1G7JA 1N19A 3IE4A 3ILEA 3W2DL 1T03L 2KZWA 3L4CA 3RTQD 3KM1A 3UAAA 3WN5B 4DH2A 1XGTB 5DD5L 2NQ3A 2NY1B 4YHKL 3ULVF 2QPDB 1BD2E 2JTDA 2P7TB 3KXFD 3C60B 3LS4H 1PEWA 1A3ZA 1T2QL 5GS0C 4JFDA 5C7XH 3QIUA 5IVNA 1SLXA 1ZLWK 1BZ7B 3RY6C 4AYMC 2PPAA 1NKGA 2IH3B 2DDQL 4KZ0A 5CP7A 2YXWA 4OSUL 3W37A 1ORQB 4B95C 5LJYH 1FVEA 3AMLA 4Y88A 1DUYA 1EVTC 4I88A 5F96H 1C5BL 1GH7A 1DQDL 1XR8B 2XN2A 2PTVA 3KPQA 3R7RA 2VE6A 2V9TA 1H3WM 2Q8BL 5KYYB 4G6KH 2EC8A 4PN6A 2VLKD 3L17A 2O30A 3D52A 1AQMA 4XMLH 1BV8A 2JMRA 4J27A 1S7WB 1YYLH 2QMJA 1R34A 2W8CA 2BFVH 2D3LA 3WCYA 3KEDA 4K3JL 2A74B 2P8PA 5F7NC 4Q8BA 1ONQB 2OMVB 3D9AL 1HWWA 3D7PA 3SDAA 2DQCH 2CLVB 3SZ6A 3A67L 3CN0A 4PWHA 2YEZB 3BQUC 3S2AA 4IRSB 2H8PA 4GP8B 4G9FD 3J2PA 1IE5A 1JF6A 3QSKB 5H4YA 2QDWA 1RURL 2RFXB 5BMFL 2KHAA 4PJ5A 2BVUA 1DVTA 2XG5A 4LEXL 4P48A 1VZIA 4NQTA 5CEYB 3F58H 2QFRA 1MF2L 3UADA 4FNRA 5D1ZB 2J12B 1VENA 2VCOA 5JHBA 4HLJA 1VAHA 4ZDHB 2FEEL 4QRQB 3EW3B 3GSNA 2QHRH 4P9HH 1QLEB 1C9SA 1R3HA 4RESB 3MACL 4CW1B 3C5SB 1SYSA 5SX4H 1NAMH 3WEXA 3TESA 4M3KB 1HILB 5IK3A 3P30H 4EOWL 5FUZL 4QRTB 1XF2A 4ODTL 1KPVB 4ONGL 2HUHA 5K59E 2EXTA 3LNIA 3NEOA 2V17H 1CDCA 1CDYA 1CURA 2WZPD 5C6PB 4ZOCA 4P06A 4P4KD 5AYUH 1NKOA 1INDH 5L88L 1ZS8B 4PWJA 3VYNA 5DK3A 1MHHA 2WXFA 1IM9B 5HI4C 4GO8A 1KBWA 2WVSA 3NCBB 3T09A 2VXVH 3GJFH 4FZ8H 4OZFH 3EHBD 5ANMB 3U36A 1B9ZA 3HFMH 4IIQC 1XGPA 4IHOA 3T0DA 1CLOH 2VQ1A 5BUPA 4PRPA 5IM7B 1E6OL 2MQCA 3CFJA 3RWCA 2BP0A 2VWEC 3EH5B 2VZVA 1KPRA 3NZ8B 1FE8L 2K6ZA 5CZKA 3SODB 5GGQH 5IB5B 3TFKC 2R23B 3QS2A 4EMZA 3DTXA 4N90E 2I60L 4YFLF 1CG9B 4C4UA 2AXGB 2MQ0A 4HJGA 4J3SA 1AI1H 5GGVH 3KZ8A 2J1YA 3PL6A 1IEAB 4G72B 5I73C 5EUKB 2NSQA 1O6SA 2ROXA 3KLQA 3ZJAA 4Q9CA 2XTJB 4NZ8A 3UABA 4AZ8A 1AHKA 5ADOH 5FCUH 5IHUH 5IFAL 1ZLVK 3DETD 3MLTB 4KROC 4JKMA 5CCGE 5EU6B 4ZS6D 2DMKA 3BH9A 2HTLC 4WO4C 4HIXH 3FSVA 2J8UE 3NP4A 5BCAA 4U1LB 3FQTB 3ECBB 3QA3A 3D33A 4JHZA 4LDEB 1HJBC 1WEJL 3C60D 4JFYA 3BUYA 2DLGA 3GSQA 1N59A 5FGRA 3LPWA 3SPJA 3SPVA 4Y5VB 1FNSH 4L23A 2K78A 4XPFL 4KH9A 4MXQC 3EYQD 1LJMA 2I27N 3L1OL 1XT5A 1MLCA 3QDME 3SDXE 2DTML 1M05A 1MFNA 4WDIB 5B1KA 3V4PH 5GS1A 4H8QA 2Z4QB 3HI5L 4W1TA 1CFQB 5CEXB 5K59F 4YHZL 4HWBH 4MA7H 3C08L 1QBMH 4L8BA 3LN4A 5CR1A 2OZNA 3NJXA 3P4OA 2L7EA 3QGVA 3UGUA 2D4FA 4IGBB 4M48H 1P7QD 5AAWC 3AUWB 4KVCH 3VGBA 4NERA 2BSED 4JG5A 2MHAB 1UCBH 5I6XB 5IIEA 3DMMA 4XOBA 1AZNA 5ES4B 5E8DL 5AVRB 4H20L 5EA0L 4DZ8B 1VACA 2K6YA 3L4YA 3TT3H 3GHPA 1YRKA 3HE6A 3KAAA 1FFPB 4X6CE 3DX0A 5D7IE 2GK0A 4G9DB 4DN3H 2YK1L 3H3KA 2OW6A 3QDGB 4ZNCD 1QLEH 3L3HA 1DJYA 4A7UA 3DVFA 4DKDC 5CN3A 3K7UA 1Z5HA 3SCMB 4KMLB 1YHPA 3AS3A 3SQBA 1ZA6A 3QNFA 4UTBH 2X4PA 4DK3A 4DP8X 4HOZA 3EXLA 2AJUH 1G0XA 1OGAB 3CFBA 4J4PA 3QHTC 4P04A 5FYKH 1CC3A 2K70A 3HG5A 3NRPA 2AQTA 4NSKA 1E4XL 1DANT 5K9QG 1VHPA 4TQEL 4Q7DA 3TA4D 2ZG2A 1AD0A 2JE8A 1U8QB 2GB2A 1U93B 2FX7L 2JH2A 5C0AB 1KNOB 5E6IB 1H8LA 3HJ0A 3MV9B 3VXQB 1SXBA 4WLCA 1X9UA 1H6TA 1NC4B 2QBWA 4WO4A 2AXJA 4RNRB 1AOHA 1EH9A 4RSVA 3CMOH 4YVUA 2TAAA 4OLVL 5F89B 3AQXA 1IAIL 3S88L 5HGDB 5JHDD 5KSBB 3KLDA 2A9AA 3L4WA 3FBQA 2ZKWA 3BPLB 3UTZB 4C56B 1MUJA 1W2KT 1OK0A 1BQLH 1T21A 3RKDD 2WQRA 4X6DF 3OL2A 2OQJB 2YGPA 5CFAA 4Y2LA 2K3TA 1IL1A 1N2RB 2JKNA 2KQNA 2WHVA 2FSEA 3QUZB 4HIIB 4XMWA 2H2SC 4IBSA 2ZUTA 1GIGH 2QVKA 3F7KA 2BW5A 4GRLD 1AZVA 1I85C 3MROA 1OPGH 2ATPB 1OOAA 3TU6A 4BZYA 5T5FL 3V8CA 3P0YL 1LD9A 4RISL 2DBLL 2DIBA 3P4MB 5GGVY 3MRKA 3QZNA 1KTRL 4FN0A 4DEWA 3TL5A 1A5FL 2ARJA 1M7XA 3AAZA 4MA3B 4XI5D 3IDYC 4EPSA 1YNKL 5KJ4A 1HEZA 1QSEB 4DOHB 3V6OE 1K8IB 3R8BB 3T6ZA 3V4UL 1WDAA 4ZAKD 2TRYA 2P26A 2R7EB 5LXVA 2EUVA 4JN1H 2I9TB 4NQEA 3MJ7A 4ZSOB 4LLWB 4ZMQA 1ZT7B 1W91A 2B1AL 2MNJB 4F8OA 4YK4B 5E5MA 1ONQA 4YSRA 1URZA 3KJ4B 4HC1H 1LEGB 1QMUA 2WQVA 3GBDA 1RJZA 5CP3A 1TZGL 1U92B 4NNXB 3RWGA 1IFRA 5FYLE 2MCG1 3CJJA 3GJEB 5D7LA 5B3NA 4L3FA 4G1EB 1PGRB 1NM4A 3PJNA 4M6NH 4ZUVA 2HLAB 5TFSH 3MTRA 2RFXA 1Q9KA 4JY5H 4AG4L 3D39A 4QRRA 4HG4J 5BO0D 4YDMA 4A6YL 3KDPB 4JM4H 2GSIA 2W9EL 4KK5D 5IREA 4QEGA 3F8UB 5FLVA 2VL5A 5JZ7C 1GTFA 4KKBD 2OXHB 2YPLD 4X4XA 3WFDH 5EU7E 2EQDA 2BS9A 3VFTB 3O2DH 4K5OA 5HDBE 4OZGA 3HRPA 5HBBA 1UOWA 3PHOB 3GYRA 1BHGA 3PIQA 4XVSL 1J0ZA 3D4ZA 4P2YA 4LEOA 3BRDA 3NIFF 4ANKA 1MFCH 4LVHC 2IDQA 4BWWA 3A6BH 2DIJA 1H3GA 3BZFA 3MV01 4QKXB 4UYQA 4N8PA 4ZUWA 4AVIA 1CFMA 2BH0A 2EACA 1JPFB 1VERA 3O9WC 1IFHL 1XF4A 3CZKA 3OB8A 4HIJA 4PLOB 5KTEH 1M3IA 2HX8A 3DVNA 2FD6H 5F9WC 3H3BC 2PWDA 1U8MB 2J25A 3L3DB 2CBOA 1RMFL 1NGPL 2X6CA 4OLWL 5HHVL 1UXMA 4ZYKB 2YPKA 4U3SB 3ARPA 1U3HC 4JDVB 3UJIL 3TOPA 3WIFB 2H5UA 5EU7C 2EH7L 4E9QA 5DHVB 4O4YH 5BPPA 4QJ5B 5KVGL 2DQHL 4MD4B 5FYKE 2P5WB 3PL6C 2PW1B 4WZ9A 2EYTA 5IW1A 4PB9L 5C08B 2OR9L 4XMKL 3LPOA 2KDGA 4HU2A 4KX8A 5FW7A 1QZNA 3P1VA 1EZUA 2BSEA 4FMFA 2X6AA 5C3LD 1GJWA 1A1NB 2DQGH 2WY3B 3JXAA 2D7PA 4B3EA 1WTGT 2GFBA 2AXGA 5DZPA 4CBPA 1MWAH 3PWPB 2EVIA 4FERA 3FH5A 3D3VA 1J86A 2NNXA 1Z9SA 4L4TD 3C6LD 5I5RA 2HJLA 3RI5K 3QXDB 2EO7A 3F12A 3OB0H 3VWJA 2NYYC 4JKWA 2GBVA 4PGDA 2BRQA 2F1EA 2XN1A 3KDMB 2X6BA 1G7MB 2F53D 3AG2B 3MRDA 5DLLA 3QRGL 1SN2A 4IKLA 2NX5B 3PQYE 1CBVH 4D0DA 3H6AA 1OVZA 4WTZA 4HV8A 4XVUD 4NDMB 4S1DC 3FQTA 2CJUL 3NZHH 2ZYHA 1BEXA 4A2EA 3D08A 4NUJA 4IDJL 5E4EC 5T5NF 1TEFA 2DTSA 3LKRA 2HJKB 4JZJB 4JVPA 2DQEL 3GPSA 1NLBL 5HHNA 4F5CE 4MNQD 1ACYL 3QXAB 1IAIM 1P7HL 3LKNA 4FQCH 1X44A 4M62H 5LDSA 3DUUA 3Q5TA 4Z9KB 3CVIL 5ECGA 2HJFB 1ZHNB 4E9TA 5F7MC 1EXUA 3N44B 3OLDA 3WKMH 4QRUA 3VGGA 5FO7B 3GSRA 4YSPA 3ARSA 3ILQD 4R96A 4BZ1L 1CE6A 3E2HB 4YLCA 1OO2A 4TSBL 5CN1A 4KZDH 3D6GA 4Z3EA 1UXSB 3BIBX 1BAFH 1E5YA 1H9VA 4MLSA 4X9FA 2WYZA 1SBBA 3REWA 3VB9A 3VWKD 1WZAA 3FCSA 1AIFA 3BQVA 3PWNA 4N68A 3OKOB 3V0GA 3V5KA 4OIIL 5JYLA 2YAQA 3BIKA 3CVDA 4I3RH 1KJ2B 1YY8A 5I6LA 3WNIA 1KENL 3G08B 1UFGA 4PGEB 3TBTA 2IH8A 2QSVA 3AACA 4LIQL 3HE6B 3NMEA 1FFPA 1LWJA 2AS5M 4X7CC 1HH9A 5H35B 2ZUQB 3NABL 2EP6A 3OC8A 3QEQE 4JQVA 4Z7AA 4X5XA 1JPTL 3RG1C 2RB8A 1J8HE 5L88H 3MOBH 2D31B 4GUQA 2R4RL 1B0GA 1DQTA 1MI5E 3BUDA 4KXAA 1Y0LA 3IF1B 4PJIA 5D70H 4UAOB 5EUOF 5GJTL 4PRDB 1VFMA 3KBPA 1FG9C 4JREC 5GGVL 1BVLA 4MNHA 3ZL1A 1S46A 3UTPE 1JHKL 2ZOKB 4RQQA 3IJHB 3G3LA 3RL2A 4XBGA 1SY6L 3GJFA 1QLFB 1WBZA 3GXFA 4PIBA 3RX9A 5BQDA 2V5SA 3RUGB 4N8VG 1ZVHA 3NJFA 4NKQB 3VMNA 1T4KB 3RA7L 1EHKB 25C8H 3I9GL 2LTQC 1YEIL 2KUTA 1QASA 3UYRL 3BFWA 2OMNA 4PS3A 1CLYL 4KKZA 2HT3D 2W0FA 3RVUD 2GC4C 3MLZH 1UWGH 2VXTH 1GTNA 3ZVVA 3Q06A 2EXSA 4ODVL 1WUZA 5FA4A 3T0AA 2VITA 3WD5L 1NWOA 3TA3C 2F61A 4HS8H 1D5IL 2NNAB 1I3UA 4PU2A 5KYNA 2B1HL 3LNDA 1N4XL 4QO1A 1SN5A 3ZE0E 1UC6A 1OAZH 1XEDA 3AS1A 4XXCC 4QR7A 5FYJD 3FB8B 1AC0A 2YUXA 1UFUA 5CCKH 5KVEE 1ACZA 3PQYA 1AR1D 3DUSB 3O6LH 2C1PB 4IKNA 4Y4HC 4F80A 4O5LH 3CWGA 3EJQA 3RNQB 3UTSB 1GPOL 1MCHA 2C1OB 4M7LH 3EADA 3C9NA 3CLFH 4XP9L 3THMH 1GKEA 2LTQB 1W8OA 4GXFA 4P49A 3S5ZA 5B3SB 3CVIH 1GYVA 2TRHA 1UWEL 2ZZUT 4PAZA 2IGFH 4JQIA 4XN9A 1P1ZB 1VFOA 2VXQL 1BQ5A 4PCTA 3TV3H 1BXUA 5KYUB 2CNZA 4TUOB 4Q6IC 1ACXA 4FG2A 3WU1A 1Y6NR 1T5WB 2PO6D 3MUJA 5HHXL 3BD4A 5DVLA 3QS3A 5K9OB 4GKNA 3QIUD 1S6NA 1YEGH 3TO4C 2VH5H 4NHUB 2JIXB 5F7BA 3V0WL 4ZZKA 3BKJL 4LSSH 4QWWD 4BV1A 1OOWA 3MCKA 1TVHA 4J6RH 4OU3A 2WLHA 4LRNL 4NQDB 5EO1A 1B3IA 3OKLA 4MVBC 4M5SA 5IP4A 1RK1B 3UMTA 4IMLB 1VIWA 3OR7B 1T89C 1OCCB 1MCFA 1OKEA 1JGUL 3VD4A 4XH2B 2VW6A 4Y5XB 3OLEA 5AW1B 4PJAF 3CMOL 3TNNA 4AXWB 4DW2H 4EI0A 5EOCL 1KGWA 3S3JA 1AZRA 4PGZA 3SDDC 4OZ4B 4DGVL 2RMNA 4JFXA 1AHWB 1MREH 4X99A 4ORGB 4JRXA 4BFIA 2K7PA 1UM5L 4NN5B 5KAQF 3DUHA 4QRPB 1TIUA 3ARVA 5BRPA 1MEXH 1MXGA 1UYWL 2X87A 5IMMA 4PW9A 2HPTA 4TRPH 4IIQB 4TLTA 4APQB 1K85A 3MNWA 4IU2A 3QFJA 3SKJL 5F97E 5EFIA 3WKNA 3L1GA 1VJSA 3QBTB 4OCXL 2Z91B 1IB5A 3ZL4H 1U36A 2EUWA 4K94H 3IFPB 1ND0A 4NZFA 4UWQB 3G5XA 5T3XL 1JRHI 2VSDA 3D25A 3QUHA 4HJUA 4WW2A 4DFHA 5JPMB 3EOBB 4H44C 2R8SL 4ALAC 4J23A 4RDQG 3IPBA 3LAFA 1AS8A 5ABAA 1FNEA 1UJ3A 2CHWA 3WXWH 4PJCF 4WUUD 5BVJA 2AHIA 1GZHC 3EDDA 2Z7UA 3EUDA 1A6ZB 1L0PA 3NABH 3HG1A 5CBAA 4ERSH 1J9CT 1LO0H 4HHGA 3LIUA 4RMUA 5KS9B 3EYFA 1PG7L 4EN3C 4H8UA 4MA8H 1MG3C 3NPSB 1GZPA 3OAZK 4O2FA 1OTTC 3KEHA 4BFEA 3NIGF 5JQIB 2OKMA 3HI1A 4OIIH 4LPUA 3HC0B 4XNBA 2AABH 4LOEA 1J5CA 1BFTA 5ESVB 2HVKA 4HS3B 5C2BH 4LSDA 3O9WA 4PYHA 3TM6A 2Y4SA 4NM8H 1A6VH 3H0TA 4AIXA 5FFLA 1JYXA 5EOCJ 1YPZF 1OLZA 1R24B 1I1YB 5IJKC 3PV6B 2DD8H 2V6HA 3IDYB 5FUOH 1ES0A 3ZE2B 1U4FA 3LKOA 3DV4A 2XQ0A 3APDA 4HXBL 4OQTA 1RLWA 4YHNB 1T1WB 3ZX1A 4P5MB 1K8DA 1EEQA 3CG8A 5IVZA 4Z76A 4QXUH 2FYYB 4YSOA 1J10A 1NL0L 1QWUA 5FYKU 5IBTH 3TYGL 1GY1A 5IHWA 2DWTA 1ZHNA 3VRLF 4P2AA 4YDVB 5I82A 5CEZL 3JV6B 4EOWH 4PS4H 2J21A 3L95B 2EIKB 2IDUA 3ES6A 3HR5A 3BP6B 4EIZC 5ACLA 3KPMB 3X3FL 1TJIL 5FYJL 5TH2B 1AACA 4DGUA 3DX6A 1AR1B 4F91B 2NXZC 3T4YA 2TSAA 1CO1A 3RDTB 3REWB 5MERB 3L3OC 2PXYA 4Z7OF 1F6AB 1JF1B 1UWFA 3GZKA 1CL7L 3I74A 3NACH 4MD0A 4GKSB 2LVEA 1P4UA 1TZAA 4FQCL 1FJ1B 4KTEL 4XMXA 3O3BB 5EC2A 1JNHB 1ZV2A 4LCIL 1MFCL 3BRFA 4ZJ9A 1JTTA 4BA0A 4JFHD 3TWCL 3QEQA 2WW8A 3LQMA 1WS8A 1BX2A 4I5BA 5CJQH 1F13A 1ID2A 1OWWA 2X4RA 2IQ9H 4TLKA 1BQHB 2FJSA 4NLHA 4YR6B 4AYGA 3KYOB 2HXAA 4BFGA 3RTQC 4A2HA 4YHMH 4QRBA 1FP5A 2FT8A 4OJDH 2FYVA 4RETB 3ULAB 5C0FB 1LE5B 2GJ6E 3FH7A 2JLPA 1FFNB 4WW2F 3VFMA 4U1HB 1A7RH 2M8XA 4BFKA 1JL8A 3QZLA 5I1HH 1QW9A 4OKVB 3Q2CA 3PP4H 5AALA 3IU3A 4C4BA 2ZX9A 4LKCB 2ZP8A 3IMTA 4M93B 3WN6A 2CHNA 4F3FB 5T1KD 1KWGA 4YHPA 1RK0B 2BX5A 1JXJA 1QNZH 2YKLL 1JGEA 4RAUA 2Q9OA 3CHSA 1C08B 3UTPD 5A2CA 3ZBMA 3H4FA 1EZLA 3K4DA 5IKCA 4O4YL 5KSAD 1BM3L 1PX3A 2ALAA 4L9DA 1F3RB 1PG7X 3DK0A 1CF8L 3L2MA 3K3QA 2A6JB 5DJDA 5EWIL 1K72A 4CDHA 3ABMB 4IBZA 2A9MH 2CE6A 3HKFA 5FK9A 2NNAA 4FL4C 3AB0B 2DM3A 1N0XH 2D0GA 5F9AC 4N4YB 1K4CB 1Q9WB 3MV11 2YXMA 3CDZB 2WBJD 3ZIYA 3H55A 3WNNA 4V2BA 4Z0XA 2ZOOA 1OPGL 1RZJL 2EDNA 4NRZB 2YUVA 4CKQA 2WLKA 1YN7B 4AGNA 2O93L 5HHQA 5EEZA 4CC1A 4MJIB 4R4FH 4BH8A 3BP4B 1TETL 4GXVH 3GMMB 1PG7W 3CVHB 4C55A 5FFOA 3T8VA 1PG7H 4WJ5B 3T77B 4W9IC 1FVCA 1PZ3A 2BOBB 3VAEA 1NGWA 1DQJB 1CCZA 4JANA 4MRBA 3ZSTA 1J1OL 1O6VA 1P53A 3IMWA 3TEUA 3ULUC 3EYVB 4WGVB 2NNFA 1F00I 2DMCA 1RVFH 4JY4A 5IV2A 3EO9H 2B08A 5HD8D 1BPVA 1E42A 2R8SH 2QL1A 3G6DL 4QTHB 2UZYB 1F3DH 1IC7H 1X7SA 3QULB 3QR1A 5I6PA 1IAII 2H26B 3EJZC 3FSOA 2YD7A 3PCYA 4X7TA 4MWFA 4OVUA 2K6WA 2CKBL 2MCAA 3W9EA 3BW9A 3II1A 1A1MA 1N8ZB 4FFZA 4UQIM 4UCFA 7PAZA 5LNGA 3FFCA 4MXVE 3VFOB 4HXAL 5J56B 4L3EB 4OZ4A 1MHPH 2X4QB 3S97C 1DZBA 3FCTB 2J7LA 1I3RA 3FF7A 3SE4C 1XGQB 5F7DA 4PJEB 4NQUA 4HCIA 1OTTD 1A25A 3MBXH 3MO1B 4O58H 3TO4A 3IAQA 1WUNT 1I1RA 2I9LA 4MTMA 2AJXH 3G6JA 2OXGB 4IIQA 4H8WH 4J1UB 3P40A 5JW4R 4TNFA 1JBJA 2AKRB 3QG7L 3UC0L 1MY5A 1GZHA 4YBLC 5L7XH 3EFFB 2CUIA 3MRIA 3G5VA 2VR9A 3H56A 4X80H 1L5GA 4NYLA 1F90H 1T89A 1W72L 1XGUA 5DF0A 1KYAA 1T66D 2WLJA 1BWWA 1LP9E 1A3LL 4PJHA 4EDWL 4MD5A 5E9AA 2DIEA 3GSQB 3M17A 4WTXA 5HY9B 2XVBA 5IEHB 3LH9A 2R69H 2I69A 4F9PA 1JNNL 2O5YH 1UYWH 4HKJB 5C7ZA 5BVJB 1KLUA 4U1SA 2OV0A 3FRPB 4LCWD 3NCWA 3EBHA 3X3FH 1IAIH 3ZIMA 2EDMA 2ICEB 2FL5A 2DH2A 1EHNA 3QIWD 2AVGA 3QNXB 4G9FE 3PFUA 5G5DB 1T2XA 2XICA 2VDPH 2MQ3A 1A2YA 4ONHA 3TCTA 2WJ7A 2YUZA 1YJDL 3V8OA 3OGCB 4HGWB 1CTOA 3MGOA 3SKNA 5C09A 4XOAA 2R0KL 3JSSA 1M1SA 3BDBA 2JKWA 4N8CH 5E2TL 4ETQA 5HGHB 4QTIL 3O9WB 3B9KD 5E6RB 5IBLD 3E8UL 1ZLSL 5KS9E 2UWEB 4NQSA 1AO7E 3SKOB 4MCZB 4A2LA 1YJDC 3HS0A 4GG8A 1H15A 3OZ9L 3PV6A 4RDBA 1PAZA 4JFHE 2Q8AH 1Q9LA 4OLYL 1T0PB 4KK6D 2MPAH 4FFWC 4N2CA 4ZS6C 3FO9A 3JTTA 1Z0NA 1UWEH 3OAWA 1ZJBA 4FKEA 3QB7C 1G7QA 4JHAH 2O6CA 3ARGB 2IOIA 3JV4A 4L8SC 4XNUH 5C0IB 4EN3A 1R3IL 1N9PA 4AVJA 3IMRA 5D7IF 3V7MA 4MA7L 3IDNB 3O4LE 4U7KA 1B0RB 4XMPL 5ECJE 4Y5XC 1W6LA 2B14A 3UO1H 2NY6C 3SEPA 1JWUA 1WAPA 3SIKA 4A7TA 2FT6A 4UINH 3ZHLA 2R2HA 4LRNH 1MCSA 5T3ZH 4YFEA 4XXDB 1OQXA 3W11C 4UIMA 4PY8I 2FEDD 3EYSH 1IC0A 1KCUH 4UILL 1KCVH 1AHMA 4LAJH 3ARUA 1GGIH 1OB1A 1AC6A 5F9JA 2RACA 3ZKXB 2NNCA 5IGXH 3A6CH 5FHBH 4JDTL 1O7DC 5DJ6B 3P9LA 2IIJA 1HOEA 1FFRA 4YXLH 1ZXQA 4K5LA 2Y06L 4UAHA 4NKMB 3SDCD 2DI7A 2GJ6A 2BVEA 4JEGB 2ITEA 3OKDB 4AQ1A 5HYJA 1PSKH 1WITA 1E5UI 5IF0A 3MMEA 4YDKL 4YDZA 4WI0B 4OGQC 5F2FA 3ZU8A 2BVPB 3CZNA 3FKUS 2D2OA 4RZKA 4B0MB 3LZOA 3V6OC 3FU8A 5A7EA 3SE8H 3QJRB 5KSVA 4OM1H 4OCSL 1SXCA 3QJOA 1MWAB 3KD4A 3BOVA 3GT6A 3UFIA 4QXUL 3HBPA 2J72A 4TNEA 3VTAA 4HCRL 2VJXA 4YGAB 2HG5B 1R5IB 2YAPA 4KFMA 2VAJA 4M43H 2VMFA 3P69A 1V55B 3I50H 1YG9A 5TQ2H 3NPSC 1BQUA 2VE6B 4YH6A 5EZLA 5HDLA 3WUZA 5HYJE 1RIUL 1ZA3A 5DMGC 4TVPD 2IBGA 2D8KA 4FFTA 4Y19D 4WFHE 2A73B 2PWGA 3IJSA 1DBBL 4G1MA 3QORA 3SE9H 1YPZA 1P7QB 2FJFA 4RWYL 2Z34A 3P9MB 3JWDL 2BW4A 2BP8A 1M4KA 2RH0A 2A77H 1A0QH 5GSRA 4LL9A 4UT6H 3O2WL 5LNEA 3QQNA 5JOEA 4IRSA 4FNUA 2UYLA 4Z7VA 3TNMA 3UZEC 5DEZA 2XI9A 1IUZA 4N9GB 3ARFC 4CUCA 2DQCL 2JI2A 4BSVA 4M5ZL 1AS7A 3KPRE 4KU1A 1S7XA 2VDQH 2OCFD 3VWKC 3GPEA 4DUWA 2HMIC 2OL3L 3U6XS 3QUZC 1JGDB 3M1OA 1J9SA 2WPGA 4LEXH 3UTTA 1D5MA 2R0WL 4NAJA 2DJ4A 2E9IA 4LU5L 4Y5VC 4GEJA 3SGDH 2Z92B 1SHXA 2D7NA 4NZTH 4RIRA 2ZG3A 3ALWA 4MB3A 2ADIA 5FFGA 3IXAB 1S8DA 2N4IA 1KCVL 3H9HB 4H8VA 2UZYA 3QULA 1W0YT 2F7IA 4MKMA 1FZMB 3MRRB 4QRTA 2AW2A 2QSTA 3E3QC 3S2CA 2HZHA 4N6QA 3VNYA 2V9QA 3NOIA 3RLSA 1AAJA 2Q6WA 3X1BA 5I24A 3AFLA 3D85B 4XMLL 4I85A 3VI3F 1QR1A 1E4WH 3KYMA 3LMJL 4Z95L 4X6CA 5KSUA 3VWKB 2O5XH 3BH8A 5FGCB 4DCQA 3NSJA 4Q6KA 5MI0B 4Z7QF 2PR4L 4OW6A 4UIKH 1QTYT 5E24E 1TEGA 2XU9A 5TGBB 2ED9A 1RUKL 1F2QA 2C9VA 4YIQB 3UTTE 5JOPE 2YZ8A 5DJZB 3S98A 2Z7YA 1HOCB 1S7QB 4WTWA 1PD6A 3P2BA 1M7IA 1E27A 2VDMB 5KBNC 4Q14A 4OKDA 3PHQB 1YAZA 1PZCA 4MX7A 8FABB 2P5PA 5IFHH 1BVNT 3APFA 2IF7A 3AW5A 3OVUB 1SHWA 5CS7A 4FA8A 3LXUX 2OXGA 2HVBA 1NFAA 2XN9B 4UV7H 4AYSA 1NCWH 4XOCA 1N68A 2DRUA 1CVRA 1HAUA 1HI6B 3D0LA 4HP5A 3HNVH 1RU9L 4FQXD 2JCCE 4NYLB 2Q7AA 5GZOD 4YJZL 2NX5D 3GSXA 4MASA 2ZXGA 1CXHA 4W9JC 1I8UA 4LK4A 4JO5A 2VW4A 1V3KA 1VCAA 1D2OA 1AG0A 3KPQB 1OD7A 5AVVB 3RDJA 2I25N 5HVGB 5HY9A 1RPQA 3C6LB 4OZFB 4MNQB 3L4UA 4XX1E 1KIRB 1C1EH 4X6CF 4BD4A 2QT6A 1XR9B 2VM4A 1EXGA 2GTWA 3VXSB 1P4BH 1P4IH 2A6IB 3VG9B 4Y2DB 2OMVA 2QVIA 3WO4C 2W9EH 4JX0A 2N3JA 3B5HA 1YEDB 4XNQA 4OLXL 4XPGH 4IRJD 3B7UX 2P45B 4HXAH 5GIRB 2MOQA 2W59A 4GBXA 2FQDA 5E1QA 3OWEA 4AUYA 4A55A 4JHBA 2D0HA 1MHPL 4ZMNA 2O61B 5C09B 4G8GE 2N1KA 4Z18A 3FO2B 2P5WD 1TETH 3UPAA 1N12A 3EH4B 1RHFA 4U6YA 1F18A 1FPTL 3RILA 1MCJA 1FO0H 5F1OB 1WSST 4HHWA 3FT2B 4ENEC 4N0UA 3BPOC 3FQ2A 1KDIA 5ANHA 2B59B 1R33A 5DFVC 3HS0B 1NFIA 3ELAT 1B4JH 4NKIL 3FFOA 1B6DA 1RPKA 3AM8A 2FK9A 3GRGA 4D9RE 3WEXB 3MR9A 2ARWA 3S4SG 3JTTB 2WNWA 3MV8A 4YNYB 4NBYB 3UDWA 4YHIA 3MREB 4FE9A 3ARGA 2GK0B 4FLQA 2CQVA 3ALPA 1UURA 3VXUA 2BIQA 4OGXH 2EO1A 2WUCH 3GQFA 4HUUA 2ALWA 4PJ7A 5DLML 2NRDA 5ICZB 3PABB 4PJFF 2WXNA 3DX8B 3VNZA 3S3BB 1PKQE 5HDBB 4GG6F 3O8XA 4DO5A 3MOAH 1VCBC 1NCDH 1S9YB 2KH2B 4BWUA 2D9CA 3TCXA 2CIKB 4F5CA 4MSWA 3U6RA 1G1KA 5I73B 5EOTB 1JDDA 4Z7UE 4WNQA 1DBJL 5ABZA 1HH6B 2IAAC 4NOFA 4H1LB 3WL9A 2VR8A 1LMIA 4U49A 1M1XA 4PLKC 3CX2A 4RMVA 3UXFA 1DN0B 5M94B 2YPLB 2FDBP 4EI6B 1W15A 2XZQH 1BW8A 2X4UA 1TJXA 3H7BA 4WWID 3V9FA 4EBQH 2B0SL 3OV6A 4ALAH 2QSQA 5B3JE 1L7IH 1WFOA 5EUKA 4M6OH 3FUJA 2BO0A 5D7SH 1RZ7H 4IDJH 4N2FA 5E8DH 4B96A 5FGBC 4L4VD 2RD0A 3Q8CA 1VFBB 5IHLB 2VDKH 3GBML 4OH2A 2C26A 3QORC 3NIDE 1XZWA 2WN2A 1KJ2L 3LYRA 5FOBB 3B6SA 3OZ9H 3VFVA 3O6FB 1D9KB 2R2BA 3OZLA 4GI9A 3PP4L 1MIMH 1YEFL 4J4PD 4OUOA 4C83A 4XRCB 1USZA 5FM5O 1CDIA 4ODHL 3HG4A 3HMWH 5SX4I 1S7SA 5KSBF 5GISL 4M03A 3UAFA 2OI9C 2V4LA 4DVRL 1HHIA 1QG3A 3J27A 4P2OA 3Q2LA 4JRYD 4APQD 3CZSA 3C6SA 2VLLB 3O81A 4NQCE 4X5RA 5B3JF 5FECB 5JR1L 3KL5A 3ZE1F 1A4KA 3I6SA 4JQIH 3Q5OA 1GA2A 4NO0B 3H85A 3KWTA 3TJHC 2JQZA 4PS4L 3BGMA 4X4YA 5E08H 4Q58C 4AIEA 2BSTB 1XCQA 2HRPL 2IWKA 4MAYD 3IJ9A 1E5BA 4B7IA 1PZSA 2WP3T 3QCVH 4PEEA 2Q3AA 1HHGA 2A4EA 4G7VL 3NSYA 1BJMA 5GSRB 4UU9A 4QYOB 4EF3A 3VW3H 2O72A 2WKGA 2DBJA 4F7KA 2BZCA 4K0OA 4K2UH 3RWGB 3JBG7 3D39D 2DQTL 3GJEA 2JKXA 2F54A 4ODUB 2WLLA 3BT2H 3QRBA 3BEVB 3A6CL 5D7LD 5FO2A 1OE3A 4EDXB 4L05A 2F8OA 5DUPH 4DEPB 4JB9L 5AZUA 5JHDB 2XNAB 2HTKC 3SQBB 3FQNB 1FGNL 2VKXA 4K7PY 4NUQA 4JRXE 1T1ZB 5HYSB 1PLAA 2FH6A 3MV9E 4QRAA 5E03A 4X7DC 3BZ4B 4XPBL 1WWBX 3ZUCA 1FDLL 5TDOA 2XUWA 1PL3A 2DV6A 2H0PA 3OJ2C 4ELMB 3MLYL 1TZIB 1RHHA 3NQIA 5IMLA 3MV8D 3M8OH 4AK2A 2XBTA 4LPWA 4Y2NA 1BGXH 3L4XA 2Y6TE 4PRID 5B39A 1AQKH 3VRJA 1W16A 3IJ8A 4PMFA 3QC5X 1TU2A 3KGTA 4DP6X 3P73A 4F7MB 4B97A 2ZYRA 2Y36H 4V1DD 3T6WA 5M7QA 1P84K 3D85A 3NIDF 4DN4H 1F86A 1DE4B 3FJTA 5DRZB 3VD9A 5T1JA 3S0PA 4DK5A 1CFNB 5FF6B 2Q5BA 3EOTH 4XPAL 3PNWB 3LNHA 2BNQA 1HSBB 3GHEH 2UZIH 3HI6H 1KN2H 4OLZL 3STLA 2Y72A 4P4RA 2P5WA 5GRYA 5A2LH 1CTMA 3B7YA 1D5XA 4HFWB 2ED8A 1GW0A 3QI9A 1LTXA 4CC4A 3F64A 2EDEA 4WWNA 1KFGA 4F1SA 4ODSL 3PHQA 5IMKA 1IX2A 3LKPA 4XNMB 3SDXB 4R26L 3U6RB 5JIPA 4KHXL 1I53A 1G6RA 4I2XA 1OP9A 4XCNA 1T0MB 1AGFB 5DMGD 3E6HB 5AYUL 4XWGH 1SQ2N 2H3XC 3VFSA 2VH5L 1G5AA 2AI0H 5H37A 1JZFA 3WIIH 4OV5A 3PE9A 5EN3A 1RUAL 4P5TC 5CJXC 2CDFA 1WBXA 2FATL 3WGUB 2F8VA 2VO8A 4YBQC 3MACH 3V4VB 1I7RA 5E5UB 4ZX4A 5JHMA 3OMNB 4YAQB 2BNRD 3LVEA 2KZBA 4YLBA 2MCPL 3F6LA 3N41F 2JKJA 5TE6L 2QSCL 4HJIA 5EU6E 2I9TA 2WXRA 3MYJB 4KDTA 4G11A 2IADB 4KNTA 2A6IA 3BPNB 2Z93A 3S9DB 4S1SH 1UB6A 1AQDA 1RKRA 4UANA 1UM5H 4XN2A 4NNXA 3VA2C 3FB7B 1PKQA 2YA1A 2XN0A 4DKEH 2Z4TA 1V27A 1YEKL 1YJDH 1RUKH 4UV4H 5KW9H 3OXRA 1JZ8A 1TZOA 5EV7A 1ETZA 2RQEA 2WC7A 5T1MB 4E9RA 1AS6A 2AEWA 3BKCL 4HK3J 3WYRA 4D9QE 4WWOA 4DKAA 3U46A 3RGVC 3V0VB 2ISDA 1JPST 1MDTA 1WAAE 2OMYA 3BSZA 4PWEA 3C8DA 1MCPH 1BOGA 1FH5L 4GSUA 4AJYV 1OP3K 3WIHL 4M6ML 3MBWA 2NLJA 4FNLH 5D7JD 3VD5A 3RZCB 1FUNA 1GYWA 4FQ1H 4QJ3B 3TV8A 3FRUB 4A37A 3QJZA 3PWPE 1DDTA 4H1LH 2BS71 4K07A 3ROOA 2CR0A 3W1ZA 1S9WA 1IBGL 4NP4L 5ACZA 2E76C 1ITBB 1XX9C 1T0OA 1GMEA 4ZUWB 1Q0YL 3ML9A 3MREA 4X5LA 1HZLA 5GGQL 1DVXA 4WK0B 2F74B 2G5UA 2APTA 2V3EA 2E27L 4EUPG 3R0MA 1PNDA 4JG9A 4R5VA 5GJSH 2UY6B 4Z6AT 4PJ7B 3C5XA 4AM0A 1XSIA 1E3XA 2ZYSA 2QGBA 3KXFA 1Q4NX 4TLUA 5FM4A 4I3GA 4AENA 2BY2A 1IEHA 2ZUSA 3HLAA 5DHVA 4PP1D 2AK4E 3EG9A 4ZD3L 1DSWA 1QRND 3V4VL 4LLQA 3GSUB 2ZOKA 4HIXL 3GXTA 1P5UB 4N25A 1EEUA 4D0CA 3LH8A 1A6VL 5DHEA 5JLZB 2X0UA 2GYSA 1CB4A 1GW6A 2QZQA 4IM8A 5D7JC 4H1LA 1ETA1 5E8OA 4WHTB 2EH8L 1KBBA 2IC2A 3A0OA 4G6KL 2AXFB 3V4PL 4PHXA 1H6FA 4HKXB 1SDDA 4KUCF 4KWUA 1KOAA 2C9UA 3JUZA 2WQAA 2CHZA 3IFLL 1II4E 2G2NA 3MLSL 1HE8A 1AG6A 3WLWD 1GSMA 3H7BB 1GAFH 1SHSA 4ZTEA 4W6XB 3QORD 1ZTMA 1HQ4B 2JCWA 1TYEB 2YRLA 1T2QH 4JZJC 1MCWW 4PGDB 2QR0B 3EYUH 1A21A 3KXFE 3VYPA 1IKNA 1KB9K 1QABA 1U8PB 3EO1B 3H9YA 5BZXA 2A4ZA 4M29A 5MEQA 1HTYA 2DQUL 4M7KH 3V5DB 3B2MA 4X6FA 4Y5YC 5E9DA 5AZ2H 3GMQB 2V2TA 3B6SB 5IW6A 2C1PA 2C4XA 2PPFA 2ATAA 1D9KA 3N0AA 1ZOXA 3DO4A 3RU8L 5TK2A 1FI8C 4UM9A 5HGGS 3MVSA 1KIUB 2H7WA 3UOAB 4GAYA 5K9KB 1GYAA 2XT1B 2C1OA 5D70L 3B1TA 5D2LB 1XH2A 1CTNA 3LKNB 3FB5A 3CH1A 4GXUN 3KPRA 3SGDI 4N8VA 2XWBB 4NBZB 2IGTA 3RTQB 2AABL 1X5KA 4ONFH 5D7KE 5EO0A 1J7VR 1KTBA 3FAXA 4YQXL 5I1LA 3RGVD 4LNRA 3L9YA 5FEBA 1BBJA 2QEJA 1JPSH 1XAUA 2VDRB 3C5ZD 5K9OA 1A7NH 3BGMB 4X4YB 5DS1A 2FO4A 3ZQWA 3RA7H 4NHUA 5KZCD 4JRYE 3ABGA 4KUCD 4YHML 3MCKB 1DFBL 2WUBL 4NQDA 5EO1B 1ZLUK 5LNDA 3ATEA 5B1CA 1QW8A 5DA4A 4U6XA 3D87B 1YY8B 1DSFL 1FG2B 3JZ7A 3LRGA 4UILH 3VXSE 4PJGF 1AKJD 5CEZD 5E9DE 3A67H 1IC5H 1KYUA 2DQMA 1CF1A 3EJRA 2FWSA 2WTOA 3ZE0B 4NC1E 2K7QA 2BWDA 1SOKA 1JWMA 3AU0A 4G8GA 1ZE3H 3K8KA 5SWSD 5F8RC 4H2AA 2AANA 2QQNL 3CCHA 2MQGA 3FQNA 1RZGA 1E8YA 2AXHA 4JFXB 4PJIB 5KVFE 1T7ZA 4MJIE 1E28B 1M2VB 1I82A 1E4KC 3MRMA 4HWBA 1WA2X 3VFNB 3G9AB 3QUMH 4JM2B 5HHPA 5L2JB 5T1LD 3OQ3B 4TQPA 4XNZB 4H26A 5EBLA 4IGBC 5C6TL 1R3IH 4XBGB 1MREL 4P46D 4KXZI 1HHHA 5IFJA 3TO2A 1T7WA 3RUGA 2VDLH 3NA4A 2UZPA 3O3DA 4MRCA 2YOCA 3SGEI 3T04D 5GRVL 1SJMA 1AZUA 3DJ9A 3DX4A 35C8H 1M9WA 2Z64C 1DLFH 5BUGA 3HG3A 5BO1L 4WTZG 2IAMB 1BFVL 4ADIA 1M7DB 5AD0B 3NSFA 1AQ8A 1L3WA 4MJ6A 1FFQA 1XQ4A 4PJGA 1T7VA 4QXWA 4DPBX 1DBJH 4N90D 5FGCE 3L13A 4S1RL 3TPUA 2FHFA 2JJWA 1NICA 3W9DB 3E9TA 4IQHA 3PWVA 4FAAB 3VD2A 4KX7A 2ZX7A 3KG5A 1A64A 1T3FA 2ZSWA 5IB1B 2IJ0C 4G8EB 2G2RA 3ISWA 1EV2E 3S5LG 4QUOA 1SOSA 2VZOA 2WV3A 2OMZB 3SD5A 4Y19A 2FH8A 4LCWA 4YZFF 1KB5B 4WHYG 1F8TH 3D4YA 4P9ML 1NSNH 4JFSA 2MH4A 4XE0A 4EDWH 2WZAA 4HCFA 5F9OL 3G5YA 5FUCE 2CDFB 4XAWL 3H53A 4TF4A 4YFDB 1Z32X 9PCYA 4UDTB 5DR5L 2WNXA 3H0TB 1U58A 3T9WA 2DPKA 3M1BB 2E6PA 3LX9A 3V0DA 1CT8A 1IVTA 4RCAA 1ZK9A 5EDXA 3TS8A 3NSDA 1CL7I 1CR9H 4M3HA 3UYPB 3NTCL 1FDLH 4HZ1A 1WBYB 5BJTA 4XT1C 2XTSA 4PFEA 2B1AH 1CD9B 3LY6A 4BHUI 2V7NB 3O6FD 4Y0GA 4FFZH 4HQQH 4E0RA 3KR3L 4IMLA 1GY2A 3V0AC 1OGSA 2CLVA 3D2TA 5EU4A 3HMXH 3ZDWA 3AADB 1YSOA 2CKBB 2PWEA 5HVWA 4DSYA 3T1FB 2AGJH 3L95A 1QRNE 5JQHC 2CGZA 3HR5B 5KANI 4P59H 3HAEG 3SDCA 2CO7A 3VMPA 4XPTL 3WY4A 3WY1A 4L5FE 1LO0L 1EVUA 5L4JA 1WT5C 2COQA 3MBEB 5IEKA 4BINA 1TOXA 5HHME 2GUOB 4ADGA 1AHWA 1D5BB 1UT1A 3OMAB 4U1MB 4L9LC 5I71B 1RCYA 3QUYD 4D7BA 3D69A 1Y1DA 1MFEL 4YL9A 1FNGA 1T1YB 4XVTL 2CRIA 4Z7IA 5ACZB 3FHEA 4D94A 1OAKL 3BE1L 3QVAA 4L18A 4KMTH 2OYLA 4UQ3A 3MNWB 4IU2B 5K33A 3DGDA 3WTXA 3ILPB 5GRWA 3UROR 3FFDB 1KCRH 1ACYH 1ND0B 1EJOH 2CO3A 5D1QA 1XSJA 1J5OH 2BNRE 1LWHA 4GS7B 4IKKA 3FBKA 3EOBA 1B0IA 4Y16D 1C12A 4DGYH 2Y25A 1S7VB 4ABUA 1UGNA 3WDJA 3QIBD 2NUPB 4POYA 3M1CA 3BKML 4M1CC 2EE6A 4PLKD 4I0KA 1A6ZA 3C2AL 5CBAB 2W94A 3QNYB 4KITB 4UI2A 4P2QA 3VI3E 4JFQB 1JHLL 3D4GA 2X6MA 2E8YA 4APXA 2BP0B 2UWEE 1BVKA 2WTPA 2BVTA 2XXCB 2WBJA 4TSBH 1JGEB 4RAUB 4O2FB 4JAMB 5LXGL 2IBZX 2AJUL 2YAOA 2J5LC 2R56H 1XD1A 3CFNA 1X6NA 3HI1B 4ES8A 4N6RB 5IWLC 5E7FA 1G7IB 1S78C 3QAQA 4RGNC 4KTEH 1S9KC 4KUZH 4HS3A 3DTDA 4TLSA 3VXMA 1CDJA 4N0CC 4DVBA 1F2XK 1CGWA 1ORSB 5FK9B 2HT4D 4LVNC 3HPJB 4HJEA 1BCIA 1CF8H 3PS6A 1E4HA 1MZZA 4GRMA 2BIIA 3ZTEA 3ZO9A 5BVPH 4XI5C 4AYDC 1EIBA 2Y5QA 1YEJH 3EGDA 3VD1A 3QA3B 3WS3A 3GIVA 1MAKA 3TCLB 1R0AH 1WV7T 4QRPE 3IRZA 2P80D 3NFSH 5F9DC 2VZUA 1ZHKA 4ODHH 5MP6L 1EAJA 1J1PH 4JPVL 3K5RA 3KCWA 4JKKA 5HHQB 3L5XL 1E43A 4NNYB 4M43L 3RDTC 2Z31B 3GLAA 12E8H 1UD5A 5GRVK 4ZMWA 5T3ZE 2ZUUA 1MLCB 2KZKA 3G6JE 3WY3A 4WJG3 1R47A 2FEJA 3FSZA 5I1LB 1AO7B 2WP3O 2AQQA 5IW3A 1UQSA 3AREA 3TBWB 3KS0J 4PJCA 3BSHA 4HD9A 4MMXC 3AY4A 2Y22A 3WSQL 1USQA 4RLDA 2CNYA 2EADA 4OCYH 1N3NA 5CCKL 3BN9C 1I9IH 3T2NL 2CBMA 3P2TA 4G8AC 2FO4B 3OJDB 3JTSA 2HKAA 3GINA 4CC4C 2O1AA 2OZ4H 1A0QL 3I9AA 3Q9QA 3NJKA 2ZF9A 1IKNC 5DQJB 2UUDK 3IPFA 5HVFB 3ARFA 4GKSA 3QIUC 3GMRB 4LESA 3VQLA 4Z23A 3X2QB 4AJVA 1JNHA 1TCRA 4MAUL 3QWOB 1V3LA 1XMWA 2YSSB 2VXTL 2ZICA 3ESUF 4D7PA 1UACH 4LXFA 4A2MA 1EX0A 5GS0D 3HZYA 3MZTA 1IKFH 1XF1A 5D9SA 2H1XA 3F6JA 2X3AA 4NZJA 4OZHB 1PLCA 2JKIS 5EO9A 5DTFA 4YR6A 3SCMA 1JHTB 2YSTA 3HBGA 1A7OL 3CXDL 5CEZE 4HYTB 2PCXA 1AD9B 1LO5B 2P5ED 1MHCA 5C3IA 3HRZA 1F1GA 2F53E 4PVMA 2YJLA 4JM2A 5CNHA 1LILA 1NBVL 1SJHA 2GI0A 3VXNB 2FAUA 2GY5A 4QNPE 2X2JA 2HKHL 3RY5A 4OFYD 3V4PA 4JFOB 5L2KD 4TTGA 3QW9A 1N26A 1WZLA 2ZXAA 3IDMA 1U8LA 3P30L 4FX5A 4QWWC 5E6IA 4FABH 2JB6B 1QYGL 4J1UA 5E5RB 4PJBF 2WXIA 1RIUH 3O3DB 1RSFA 4NC2B 2IG2L 4XBEL 3S3CB 1J9RA 5EBWB 1WZMA 2BMKA 4IBQA 1A7NL 3BQUA 2W1NA 4UNTA 2DL2A 2X9WA 1D7BA 1F02I 3FUFA 3UTQB 1U8KA 1IZJA 1KXVC 3BO8B 1A4AA 4NJAL 1D7DA 4R2GD 3S37X 2P1YA 4U1IB 3RPIB 3LQAH 1E6JH 5CLYA 3QXTA 1G43A 3O0RH 3CSBA 3VX1A 2OQJA 1W6WA 3GRWA 2EH8H 2VN7A 3MV7A 4FULA 1K4CA 5DWPA 4FNSA 1GKOA 2QV4A 3QQXA 1UG9A 1HZKA 1R6VA 2PCPB 4EI5C 1SDYA 4POZC 4KVPA 4S1QH 5IB1A 4LFHG 3UG3A 1BA9A 2HRLA 2Z8VC 3ARDB 3OM3B 1H8SA 1MPAH 1D6EA 4WWKB 4IOFC 1FVDB 3O4OC 2VOTA 1G1OA 2J6EA 2P47B 1KELH 1G0YR 1NMCC 2F1AA 4ES9A 4F2FA 4FKKA 2E6QA 3I75B 3VDCA 3OAUH 4BH8B 1HT6A 4K15A 1Z5LB 3WXWL 3AAZB 3IGLA 2EZ0D 4NQSB 1INQB 2H1PL 5LVEA 3SSGA 4BQ6A 1LDPL 5DMIL 5FKAA 2EEDA 4FNPA 1NLDH 1CGSL 2KERA 1Q9LB 1HL4A 3LPPA 1G1YA 4PTTA 1YCSA 3HHMA 4Z3FA 3OGOE 4L8CA 2ESVD 1J0IA 4OCXH 4R6UA 2CR6A 2VR4A 4WU5A 4HDIA 2WKOA 4QTHA 4P3WA 5DVOA 4G8FA 5DQ9B 2F8XC 2EDRA 5EIVA 2IH1A 3QFDB 3JV4B 2EUZA 4X7TB 3WE6B 3LCYA 2Z9TA 5IJKA 1KLGB 5EZOH 3L3KA 3OHXB 5GGTA 2F5BL 3RURA 3DBSA 3QEUA 2EECA 5AVYB 3W39B 1NGXA 4XCFL 1J0YA 2VR6A 1Q9KB 3FT9A 1XBDA 4RFNB 1DQQA 1IGIL 1A6UL 2DYRB 2F2HA 5E70A 5T5FA 1EERB 2GSIB 3WJMB 4XNYH 4LSPL 5JQ6H 1ZGLA 4F9LC 5IJDC 2H0JA 4TUJA 3ABKB 3KYKL 3NCFB 4I3SH 1FRGL 2YPVH 1RP8A 4ZFGH 2IGLA 2MMXA 4AW7A 4UB0L 1KXQE 4WUUB 3U4KA 5E1GA 3HG0A 1Q9OA 3EDKA 2HN7B 1VGEH 4V2CB 1UGKA 1ED3A 4WKZB 3LRMA 5CO1A 1JDCA 4YMPA 2XXFA 1RIHL 4YHLH 3CX5J 4WI8A 3ZZLA 3IBOA 4PG2A 4GB9A 3PXJA 4JJHA 1YEJL 4GYBA 5JNYB 4GXUM 5D8JL 1FIGH 4XCEA 4QT5A 1XGUB 1YUKB 3MU3A 2PO6A 2FHCA 4ZYKA 1HCVA 3B2PA 2ILLA 4FCHA 4AUUA 5E6SB 3W57A 3ETBF 3LSOA 5PCYA 3TIDA 2VDOL 5J89A 1S7VA 4YWGL 4GG6E 2ZUYA 5GJTH 4BFFA 2Q7YA 4ABWA 1M7UA 2PN5A 4MD4A 4TSAH 2G3XA 2VXQH 2N7AA 5GGUB 1JF5A 1DVFC 2E7MA 1PY0A 4ZTPH 1SXZA 1P7KA 3II3A 3QO1A 4I48B 4K9EL 3UYRH 4DPAX 1E67A 4KHTH 1WIUA 2DJSA 2OMUA 1NDGA 1OAZL 3QPXL 3PAUA 1PQZB 4G8GD 3PJLA 4UQAA 5HYQA 2R27A 2WBKA 3Q0HA 3DURA 3HPLB 2WKLA 3MGOB 3GSOA 1R46A 3MRCA 5F96L 1J0HA 2B1HH 3LEXA 4JFEE 2BRRL 4JPKL 4PY7A 3HB3B 1YLBB 2UWEA 4R4BA 3U0TB 2HT2D 1FORL 1E9QB 3C8KB 1YMMA 3V95A 4OT1L 4TSCL 4GG8B 1GSKA 1UOVA 2NX5A 3K6NA 2CLRA 3ZOAA 4O02A 1AH1A 1CLYH 4Z77B 4WW1A 3QJXA 1FLRH 4AYID 1KEMH 3JT0A 5EU3A 4U6TA 4XNXL 3LEVL 1AANA 3B3BA 3W0WE 4ZPVB 4F37K 4GMTL 2R4SH 2NNRA 3SDYH 3N1FC 3CDCA 4G43B 5IB4A 5KJRL 4LQFL 1XTMA 5IJVB 3T5WA 1HU8A 5D6CB 4R5XA 3S3DB 2BIPA 3UIYA 1UD3A 5L2KE 1BMWA 1ETJA 4LBEA 4PJEE 4KKRA 4L29B 2Z1PA 2AJZB 1N3NB 1PW3A 2FSDA 2XTJC 4IOIA 5I75B 4QHKJ 1ZVSA 4HEPA 4AL8H 5ITBL 4H13C 1AIFB 1MRFL 4JO8A 5DS8B 1HZHL 5HDWA 4PV9B 5EWIH 2DQTH 2NW3B 5A2BA 1DQML 3HUJB 3WFCH 4AI7A 3GI8H 2GBAA 3EZJB 1TCRB 4MMXB 1U8HA 2XZAL 2WBXA 3HZMB 2YSSA 9CGTA 5GS2H 2DQFA 1RZ8A 2Z7ZA 4R7VA 1IC5L 2LU7A 1NAKL 4P2CG 4L3ED 1L9QA 3U9PH 4KKNA 3ERXA 3D09A 4MNGB 1FGNH 1THCA 3ZDYF 2VYRE 1IGFH 3QWRA 4JK0D 4Q6YA 4MJHA 2ZD0A 3T0EC 3NJGA 3SJVE 4ZW5A 5TGBA 3MMEB 4LL4A 3ZTJG 1B0GB 1GHFH 4BE5A 3PHAA 1UA3A 3SBWC 4EI5D 3JQOB 1E27B 5E4AA 3BT2L 1DEEB 2J1ZA 3QUML 4ZUSA 2XX0A 4JPVH 5JOFB 1YECL 3HJEA 3GF8A 3VMOA 1VFUA 1FGVL 1DFXA 2YGNA 4KNUA 1QFWM 4EI5A 1V3MA 3RFZB 2R0ZH 2AZAA 5HDRA 1MWAA 4LOVA 1YQ2A 2PKDA 1ZVNA 1MF2H 4LL1A 3MGTA 4R7DB 3VFGH 3P02A 4IRJC 4GLRI 4JPIA 5ADPH 2EVJA 1T4KA 5EBWA 1INEH 2C3VA 5JXED 3ZR6A 5A3IC 3UTQA 3DECA 3GSXB 2ZP9A 3QG6A 4HG4K 3KBFA 1TNMA 3MJGX 3F5WB 1UM4L 4CMHB 3ASNB 4PWFA 1NEPA 4NENA 3TEYA 1F4WL 2GTQA 4BKTC 2NT0A 5DZNA 3PWLB 2L04A 1NFDE 1CGTA 3NDYE 1TTUA 5FUCC 4GW1B 5FDWB 1EHXA 1SEQH 1KIRA 4AKPA 4WRLA 4TN9A 5CAYB 4MJ4A 2X2UA 2SEBA 1HHJA 2EYRA 2GJZB 4XMUA 3OMIB 1KPUB 2F8IA 1QATA 3D07A 4NX0A 3ZW3A 1KUMA 4XBPB 1DQLH 5AVUB 5KOVC 3U82B 1ULVA 1N6QL 5AOMA 1SDAB 2ENSA 1Z6JT 3LKQB 3VXTB 1FVDA 1BZ9A 5D1QC 1RUAH 4GMTH 1FNSL 1YY9C 3ZDYE 1ACCA 1SVCP 4MZRA 1T6VN 3F83A 4LQFH 4FJYA 3ULSA 5C1MB 5MEND 1CYGA 3RU8H 4EZLA 2B8OT 3WAKA 2XZCL 2FVNA 3Q1SH 3RUGE 4HUCA 4WK4B 5C6WH 3MA9H 3QAZB 3A4DA 5D7IB 5C92A 4GKNB 1J5HA 1BWMA 4KK8D 3VJ6B 3BSZL 4X98A