2W8CA

Plastocyanin variant with n-terminal methionine - closed structure
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
106
Chain Sequence
METFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title Metal-Mediated Self-Assembly of a Beta-Sandwich Protein.
pubmed doi rcsb
source organism Phormidium laminosum
molecule tags Electron transport
total genus 24
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2w8cA00
1OOWA 2FQEA 3CVBA 2X87A 3FYIB 3NJJA 1AIZA 4G72B 4A2HA 3OMAB 2P80A 4X4KA 1CC3A 3GXUB 2WSDA 3FYEB 1OE1A 1MG2C 2YXVA 2R7EA 3T71A 1BAWA 1GSKA 4BWUA 1NIFA 4G7QB 4P5SA 3RYMA 3QPKA 1AS7A 1FWXA 2HXAA 3NSFA 5FC9A 2LLNA 1NICA 3FPYA 4KNUA 1JVOA 4GP5B 1BQ5A 2JKWA 4KO9A 2UXGA 1CURA 1AZBA 4A68A 3NJMA 3UGEA 3WI9A 3EHBB 4GYBA 1ET5A 3AY2A 2ZXWB 1RKRA 1NDTA 2GC7C 1WA2X 1AZNA 2H5UA 3QJTB 3NJGA 2VN3A 1JZJA 2FT7A 4KNSA 1AZUA 1NZRA 5B1AB 2EILB 2I7SA 3EH5B 4YSOA 1JZHA 3NYKA 3PPSA 1V10A 3WNIA 4CSPA 1GY2A 2XYBA 2GIMA 3S8GB 2AFNA 2NRDA 2W8CA 1NIDA 1PNDA 2DWTA 1AR1B 2UXFA 1A4BA 4E9VA 1ASQA 2J55A 1B3IA 3ZIYA 4UF7C 4KNTA 1YLBB 1OCRB 3N55A 2VSMB 1HFUA 2PP9A 4A67A 1BQKA 1PLAA 1XB6A 2FWLB 4W9ZA 2N0MA 7PCYA 3X1EA 4BWWA 2AVFA 3X2QB 3OQRA 3QQXA 1VLXA 4AX3A 2DY2A 4G71B 3IBOA 5TK2A 4N8UA 2RACA 2A3TA 2YARA 2BZ7A 4DP4X 8PAZA 2PPDA 4NB7A 4E9TA 3S8FB 1SNRA 2H47C 2UX6A 4YSPA 4F2FA 1AG0A 1L9QA 1ADWA 3S3BB 3UAAA 3EH4B 4YSAA 1F56A 1WS7A 4E9XA 1A3ZA 5AKRA 5IY5B 3HB3B 1OF0A 2R7EB 4HIPA 2BW5A 4A2EA 3N2JA 1W6LA 1PNCA 1PZAA 1A4CA 4KOCA 2JFCA 1FA4A 1AAJA 1IKOP 1SJMA 3IN2A 4AKPA 5I6MA 2BP0A 4DP5X 1CUOA 2AANA 2BWIA 1ASOA 1NIEA 1JXGA 1OE2A 1E67A 3MX0B 3H4HA 5I5MA 5I26A 3TA4D 3OMNB 2YAOA 2YAEA 3NSDA 4F7KA 2HRHA 4QLWA 1J9SA 2FT6A 5I6NA 1BXVA 3IEAA 4HHGA 3MBWB 2OV0A 5F7BA 4AKOA 1WA1X 2XV3A 3NT0A 2IDUA 3PLYA 4NAJA 1L9OA 3FSWA 4A66A 2I7OA 1QLEB 2IWFA 2CJ3A 3FSVA 1ETJA 1NWPA 1NIBA 3DKHA 5B1JA 5I5JA 2XXFA 1IC0A 2QT6A 2X88A 4N4YB 5B7EA 2VW6A 1RZQA 5F7AA 2IDQA 2QPDB 3X1FA 1HAUA 3V9EA 5D4IA 1NPJA 2Y1AA 1AS8A 3FQ1A 4M4RB 3UAEA 4DP9X 2W88A 2GBAA 1SHXA 1JOIA 3X1GA 2FNWA 2WO3B 3UACA 3BQVA 1KBVA 2HX7A 6PCYA 2E86A 1SF5A 2IDFA 3PAUA 2UXTA 2GB2A 4HCIA 3NJKA 2YAQA 4DPAX 2XXGA 1AOZA 2EIJB 3NJHA 4BWTA 1X9UA 3AG4B 2PCFA 1OV8A 4BK5C 2H3XC 2PPEA 1AZRA 4KO6A 2P80D 2IH8A 1JZFA 1J5DA 3SQRA 1BEXA 1N68A 4YSQA 3DIVA 1ASPA 1ET7A 3H56A 1EHKB 2JXMA 5B1JC 4DP7X 3ABGA 2YQBA 1AANA 4DP1X 2TSBA 3UADA 3SBPA 3ABLB 1ZDQA 2BO0A 4KOBA 2DYSB 1IBZA 4HAKA 2PPFA 3NP3A 3V9CA 4F2EA 3ASOB 4YVUA 2VM3A 2BP8A 3TBCA 1JZEA 2HRGA 2CALA 3JT2A 3WNJA 1ZDSA 3IN0A 1ILUA 3DTUB 2XWZA 1WA0X 2BP0B 2FT8A 3GDCA 5TK4A 4YVNA 2AZAA 3T6WA 3CDZA 2FQDA 4E9QA 3TU6A 1GR7A 1M56B 3JTBA 2QPEB 4YSEA 3QJUB 3CVCA 2FQGA 1A65A 1QNIA 3KW7A 3H4FA 3TBBA 2WO2B 1L9SA 5E9NA 5PAZA 3T6ZA 3SBQA 1URIA 3KW8A 4QKTA 4JHVA 1MZZA 1L9TA 1R1CA 1KBWA 1RZPA 3WIAA 3ZX1A 2DYRB 3PCYA 4HALA 3PXLA 4Q8BA 1V54B 4BXVA 1PCSA 2IWKA 1JZIA 1J5CA 3NSYA 2BW4A 4JHUA 3QJSB 4YL4A 5B1KA 1OE3A 3S3DB 2HZHA 4P5RA 1A4AA 1XB3A 4G7RB 1RCYA 1TU2A 2AZUA 3X1NA 4PCYA 3PAZA 1CYXA 4DPCX 2IDSA 4GY4A 3WG7B 3G5WA 3SBRA 4YSRA 1ILSA 2IAAC 2XX0A 3L45A 4FAAB 2CBPA 2EIKB 2XUWA 1SDDA 3NJNA 2QDVA 2TSAA 1BYOA 3GYRA 4TXVB 5B3SB 5I6OA 2UXVA 4BXSV 2XX1A 3CG8A 1EZLA 4W1TA 1KDJA 2I85A 3FU7A 5B7FA 1L9PA 4DP0X 1HAWA 4YSTA 1PMYA 4KO5A 2B3IA 4RH4A 2YAFA 2VM4A 1TKWA 1KGYE 5B1BB 1BYPA 1E65A 2IDTA 1ZIBA 1OCOB 4DPBX 3AG2B 2UX7A 2XLLA 3FS9A 4GXFA 1OCCB 3ERXA 3WKPA 2XU9A 4A2DA 4AI7A 1BXUA 4KO7A 4BDVA 4GP8B 4YSCA 2XV0A 2ZONA 2BP8B 5AFAA 4HHWA 4G7SB 1ID2A 3TASA 3EH3B 4PAZA 2BHFA 2XV2A 1GY1A 1J9TA 1UATA 3C75A 5I5IA 2OCCB 2GSMB 5EHFA 3CDZB 3AZUA 3ZBMA 4ENZA 1ZIAA 1GS8A 3CZUB 3FSZA 4DP2X 3S3CB 2CCWA 3FSAA 1WAEA 4E9RA 3BVDB 1MG3C 1X9RA 5I6LA 1DYZA 2PLTA 1DZ0A 4AKQA 2PPAA 4M3HA 1A8ZA 1J9RA 4MFHA 3NP4A 1JERA 3FQYA 3X1BA 3NSCA 1PZBA 4DP8X 5B7MA 5AZUA 1PY0A 2YAMA 4JKNA 4A2FA 3FU8A 5D4HA 1PF3A 1TEGA 3QJRB 1GYCA 1WS8A 1BXAA 1GS6X 1J9QA 4YSSA 2Y69B 1N70A 5PCYA 4NERA 1JXDA 2VMJA 4K9JA 2Q9OA 2PPCA 4CSZA 1SHWA 1V55B 5A7EA 1GW0A 3QJVB 1FFTB 3QJQB 2CAKA 2FTAA 4EF3A 1PAZA 1SDDB 1SFHA 5LDUA 1PLBA 3NJIA 1KCBA 3AW5A 4GP4B 2VW7A 1NTDA 3ABKB 1KDIA 3NJLA 2J57A 2BWDA 2DWSA 3PAVA 2YXWA 5D4JA 1PZCA 3FPXA 2PP8A 2DV6A 1NWOA 1MDAA 1ZPUA 4A2GA 1E5ZA 2B08A 1E5YA 4YSUA 1TEFA 2HX8A 1SFDA 2GC4C 2Q5BA 3FU7B 3UABA 2GHZA 1OCZB 3U25A 3FU9A 3OM3B 4E9SA 5I28A 4UANA 2XVBA 4ZK8A 1I53A 2PP7A 1M9WA 2QDWA 3T6XA 6PAZA 4WKXA 1JVLA 1L9RA 1AACA 4YSDA 9PCYA 1AG6A 3T9WA 3AG1B 3OD3A 4E9WA 4HZ1A 2ZOOA 7PAZA 3AG3B 2EIMB 4AZUA 4HCFA 2BZCA 3T6VA 3IE9A 3WKQA 2EINB 5I6PA 3HEIB 5I6KA 1CYWA 1IBYA 2FQFA 1PLCA 3ASNB 4FA7B 4BDVB 1M57B 4HCGA 2OJ1A 1AQ8A 2ZWNA 1KYAA 3D12B 2YAHA 1JZGA 1IUZA 1ZV2A 4G70B 1XB8A 2IWEA 3FQ2A 1W6WA 1KV7A 2CUAA 2HLEB 4L0PB 1GS7A 4UAHA 1QHQA 1AS6A 1NINA 2J5WA 3OMIB 4Q89A 2MRYA 2VSKB 1T5KA 4WTQA 2MTAA 3CVDA 1SF3A 3ABMB 4DP6X 1KCWA 1NPNA 1XMEB 1JXFA 3EF4A 1AZCA 2J56A 2HX9A 2YAPA 2IH9A 3NJFA 2PCYA 1E30A 5ANHA 3FT0A 1ET8A 1BQRA 3ZDWA 1MZYA 1W8EA 2FJSA 2GI0A 2VW4A 4E9YA 1NIAA
chains in the Genus database with same CATH superfamily
2WJ7A 1NFAA 1QAWA 1S7QA 4YO0B 3UTPE 3KPSE 2PWHA 5CILH 4A2HA 1H3VA 2Y4SA 3B34A 4ABVA 1GZPA 1FBIL 3ZQ9A 1OP5H 5JR1L 1IJNA 4E42A 4IHOA 1U3HB 2W80C 3FO1A 4XI5C 5DUBA 5IMMB 2W0KA 4KMLB 1DBAL 4Y4HB 2L7JA 3U46A 5D7LE 5I1GH 2GG1A 4EEEA 5F7UA 4WEBH 3FO9A 1B4RA 5GZOC 3MCLH 3RFRA 3N0PB 5EOQH 5E00A 4LQFL 1CXIA 2J43A 4TOYL 5C07B 4A68A 3WI9A 3VXSE 3FTSA 1LE9B 1G0DA 2N7BA 3LD8B 1R3JA 1DBBL 4LCCA 1RKRA 1NDTA 4FOMA 2NYKA 5F3HB 1KENL 2C7UA 4L29A 2EILB 1HKLH 2NQDA 4M9OA 4W6YB 4ECNA 4PRNA 1KTKE 1O6SB 5KSAC 5T1DL 1TTAA 1FLRL 1KCUL 2DQCH 2PTVA 4WNQA 2P8LA 2GITA 4GIOA 3KLHC 2LABA 3IT8D 3QQ4A 5E6IA 3D9AL 1UWXK 1UZ6F 1Y1DA 2DJMA 3CBJB 3HB3C 4NKOA 4F27A 1B3IA 5CINH 3GMOA 3ULSA 4YPGA 2A6DB 3CPLB 2O5XL 5BO0D 2Z8VC 4CADB 3HN8A 1HE7A 4EXPX 3DX8A 4PVBA 2X7LB 4ONFH 5E24E 5C0RL 1KPUB 1YYLL 4UNIA 4Y4FC 1Z0MA 3VXPB 3TH3T 5JXAL 3I3DA 2CR3A 1AMXA 1BZDA 1MH5A 3ZYJA 2ROYA 3RVTC 3NIFF 4J12A 3QYMA 2ZWSA 4OGQC 2DDQL 1HZHH 1MCWW 4YEEA 5IB5A 3QSKB 2EIZB 5AUMB 5FYJD 4BRJA 3LRKA 3KGUA 4H25B 3HZVB 4NIKB 2EDRA 4ZUWA 3IDIA 1XZ0A 5GZND 3DHMA 2M83A 1T03H 3ZW3A 3OHXC 3GMLA 1ADWA 1I9IL 3U6XS 3W57A 1S5IH 4QAMB 4TLSA 1HSAA 1C8QA 4FA8A 3MRRA 4OLYL 1VJSA 1AXIB 3WIIH 4OD3L 4NRZB 4R90H 2DL9A 3GF8A 2WYHA 1A5FL 3HE6D 3S35H 2APBA 5JHDA 1IGIL 4NNYB 3QUXD 5EZIH 5I8KL 3UZVB 4YDLB 4HZLB 1F00I 5GRJH 1FCCA 2E27L 4NUGH 4C4KO 4Q9RH 1SYVB 3BI9X 3ES6B 4IRJB 1A1OB 4ZODA 5LN8A 5I24A 4NKMB 2WYTA 5T3ZD 4Y5XB 4E2OA 5LG6A 4UIKH 3OC8A 3QEUA 1D5BB 4MA1C 1BF5A 1RZJC 1OLLA 5TGBB 2V5MA 5L8JB 4NQQA 3O6FC 1HI6B 1G7JB 1OQXA 1C5CL 2YPVL 4LOUC 3GXIA 4FXGA 5HGAA 1F90H 5GJSL 4LLDA 3LSOB 2PF6A 4PR5A 2OZ4H 4KKNA 2GFBA 1JWMA 1FH5H 1TZIA 3MODH 2IANE 1ZSHA 1CD9B 2OMTA 5B1JA 3T0WA 3NEEA 2CUMA 2ITDA 3WL9A 3TH2T 4PJAF 5ANME 5TTRA 2XKSA 2IJ0C 3T3MB 4TL5A 4JFEA 4OSUL 1JPEA 1WAAF 5C08B 3JWOL 4BGDA 2DQTL 3JUZA 3RGVA 1NEZG 3BH8A 1XGTA 3OKLA 3H2WA 5D4IA 4X9BA 3WSQL 4XNMB 1Q72L 4P2CG 3FQ1A 3V0JA 4YHZH 3X3GH 1N59B 4W9FC 4PLJC 3BUYB 2WVVB 2XZCL 3CX5J 3QXTA 1Z9SA 4JMNA 3BQVA 2HX7A 3GMQB 2E86A 1G84A 1HILA 2WANA 2I5YH 3SGJA 5CP7B 3MV7D 4NFCA 2C3VA 4JS7A 1D5RA 2IAMD 4MB1A 5HHMB 5EPMA 2EIJB 2YPLB 1G5AA 1JGUL 1T0NA 3EBGA 1YEDB 5DJXB 1YNKH 4FI8A 2AK1L 5DSCA 4I77L 3BZ5A 4XCYA 2MOVA 1UXSA 1J10A 3VXOB 1MFNA 2AQNA 4YSQA 3MGTA 1RK1B 1AQHA 4M48H 1FC1A 4Y16A 3H9SB 1A7PH 4O2EB 1UHVA 5IEHB 3UADA 5B8CC 1OT2A 4PJ7A 3FC8A 3HPLA 1U95A 4UOQA 4JM4H 4OF7A 4L5FL 3CZJA 3AS3A 2EUZA 1J86A 3WXVL 1OB0A 2W92A 4ENEC 2QELA 2RTTA 4N0FB 3WAJA 1V27A 3MNZA 4YHMH 2BLFA 3HC3H 3R0NA 5BUGA 2D4DA 3LZFH 3S4SA 4Q9CA 3UYOD 3GSUB 1MCOH 1X5LA 3T5WA 4NKIH 3BH4A 3ZQWA 1NBZA 4OIBA 5MENA 2XBTA 2F53A 1T83C 3AREA 3ECQA 1IGJB 3S3JA 1OGAB 1CK0H 4XCNA 4CW1B 4WNJA 1DN0B 3TBWB 2I07A 3IFLH 3GEFA 4J3WA 3QCUL 1R6VA 1XR8B 4NBZB 5DLLA 1KBWA 3SY0A 3TIEB 1KULA 1NBYA 4FG6C 4QRRA 4UUJB 2EJ1A 1ZS8B 2ICWA 3HR5B 3RIAK 2XIIA 3DURB 4FQHB 1I31A 1XIWC 3ZKND 5GS0H 4N2GA 2KI6A 1AHWA 4I1NB 2JKLA 3H53A 3IMWA 1F6AB 2J3SA 4N2MA 5ISZE 4FMVA 3G5XA 4P07A 1DVUA 3IXAA 4WNSA 4A7TA 2X4UB 3IU4L 2V2TA 4I2XA 2CRIA 3GMNA 2PKDA 2CIKA 1B88A 8FABA 4X5WB 2ZSWA 1FRGH 5C09D 4BFKA 2AEPL 5AZEH 3B7UX 3CG8A 5T1KA 1J1XH 2WUCL 4L9LA 4W1TA 4URKA 5A2JH 2J8UA 4F7TB 2W94A 5E23A 1IU1A 4LCWD 1A66A 3N50A 1CIDA 3BP4B 3P3RA 3BRFA 4JREC 4PJIE 2CO4A 4XBPA 2G75A 3DHPA 1IEAA 1KTCA 5C0BB 1XHHA 4RFEB 1E65A 3QORA 3NTCH 4JUSA 3FT3B 4NHCH 2H32B 1XGYL 4DPBX 1CTOA 4QHMA 4YIQA 1MRCL 4RBPH 1NBCA 3MRIB 5AVYB 3MLTB 3EFOB 1L6XA 4D9LL 1J1OH 5LDSA 1SJHB 3IB4A 3B2XA 3QEHB 1BXUA 4FXLA 2BSDA 4KO7A 5EBWA 4L3FA 4PV1C 1AD0A 2G30A 3OKNA 1KCVH 4LLAA 1YPZE 4XCCL 4S10A 3BGFB 2JE8A 2P47B 1SDAB 2NDGA 4JPKH 5AVWB 1P84K 3DDFA 1UATA 3SKNA 4FTVB 1EHLL 3AACA 1UM4L 1OAZH 1TZOA 2JJSA 2R0WH 5JW3H 1G1OA 1WYJA 4GG6E 3QRBA 5L4IA 1HH6B 1RIVH 3M8OL 4JDTH 3HCVB 4M5YH 4OGYH 2IH1A 2Q3AA 2X1XR 4PRHA 1DUZB 1DZ0A 2OMXB 3ARBC 4HJJH 5F3BA 5L9DL 5GJTL 4QRUB 3G6JF 4OT1L 2CM5A 2AJSL 2CDFA 3BN9C 4CDGC 4ALAH 3BXNA 3O6MH 5AAPA 5D1ZA 1R9FA 4PY7A 4QGTA 2L7UA 1I9EA 3CN3A 2X4QB 5F1NA 1PF3A 2BCKA 2CO6A 2WXFA 3ZMRA 2VXUH 3ZR6A 1LO2L 5PCYA 2NXZC 4I48B 2UYLB 2R69L 2DM3A 4MMZA 4BV1A 1UD5A 1FO0B 5CEZL 3ZPDA 1KF9B 1TCRB 1O9VA 3ZE2B 3ISYA 3QJVB 4HOMA 5JW4N 2OI9C 2Z7ZA 2DJUA 2WVTA 1J8HE 3JWOC 1KN4H 4KY1L 4LF3B 5HDOA 4D8PB 1PZCA 1T7VA 2PP8A 2JJTA 3FT9A 4ZUSA 4NN5C 1MDAA 3ZTDC 5I5RA 3VE0B 5A3ID 1F11A 2GHZA 3D39D 3GXDA 3JWDL 3OKOB 3U25A 3RZCC 3EYFA 3X17A 1FZKA 2XA3A 1PKOA 1KIUA 4UANA 4X4XA 3VJ6B 4EOWH 2Q76A 5CBAA 5CEXB 3EYUL 4ZXBA 3WHE0 1EEYB 1Q1JH 4O02B 2X4OA 3GLZA 5EEWA 1CVSC 4AV5A 1YNTF 3H55A 3ALXA 4PTUA 3TO4D 2B4CC 4WO4C 5CU9A 3D0LA 4ZYKB 4MWFB 4OTXH 2YBRB 2ZOUA 2W9DH 4X8JB 1JHTA 3ZHKA 1IAOB 2Z1KA 3P77A 2QKSA 3MJ9L 1CF8H 2ZCHL 3NIDE 2EH8L 3OWEA 3RJQB 3VGBA 4U2YA 1Q0XH 3FQTB 3UJJL 4PJGA 2WQUA 2Z34A 3BJ91 4HMDA 3RTQD 2G0KA 1CPUA 1EFXD 1S7TB 2XWEA 2IXQB 4FD0A 1UADC 2ZWNA 1KYAA 3MZGB 1TQWA 4TNVK 3TWYA 4YE4L 1QPPA 4R0LA 5IG7B 5J12C 3SPHA 2H4EA 2XICA 5CZXD 1ZV2A 4RGMC 1JTPA 5EOCJ 4DKAA 4HJSA 1OL0A 1U8NB 3PWPA 4G6FD 4DK3A 2B0SL 2XHNA 1NDMB 3PFUA 2W91A 4Y2DD 4FE9A 4QO1A 5EZOL 2LLLA 4HJGA 4KK5D 1AGFA 3IDMB 1N2RA 4X5QA 4X6EA 4RMTA 5DEZA 4P2YA 4M56A 4EZMA 3SKMB 3HZYA 2V4LA 2XVKA 3PV6B 3ZDXE 1SF3A 2XPGB 3FQRA 5DD1L 1AZCA 1QFUH 1TYRA 5FOJA 4RGNC 2AJ3A 1IC4L 4OZ4B 1OW0C 1S3KH 2D73A 3FRUB 4L4TE 1KFAH 4ZMYA 3GB7B 2K8QA 3ARXA 5SWQA 1MEXH 1CZ8L 5KS9F 3E8VA 4KDTC 4JFOA 3WEAA 4PG2C 1A6VH 2XTLA 3OMAB 1DQJA 1SDYA 2EDQA 4O4YL 3V55A 2P1YA 2PO6B 3EG9A 3LMJH 5EC1A 1MG2C 4FQPA 3OBAA 4G8AC 2NY2D 1I8KB 3FQXA 5FK9A 5HTSA 2AEOA 1T4KA 2V9QA 5FB8A 4JZOA 1R0AL 4DN4H 2A83B 3QRGL 3VFVA 1K8IB 3P2TA 5IMOB 3SYOA 4JRFA 1LGVA 5I17A 3GSNH 3O2VL 3HE6B 1H3PL 3QIBD 4OLXL 4X98B 3QUXB 2PXYA 1W8NA 4DUWA 1TZHA 2ZXWB 5FF6B 4C8XA 3L1GA 2FSDA 3IJEB 2KYIA 5T33L 4M6NH 1AZNA 3MNWA 3M1OA 4MD5A 1YEWA 2G2NA 5MEPB 1CDJA 2HVJA 2WNWA 1BQHB 1KEML 4J27A 4M43H 3MV9D 3B7RL 4H7VA 5E2WL 4HS6B 3AWGA 4EMZA 4G7YH 1RZ8B 1BZQK 3QUKB 2B1AH 4XP9L 5L7XL 3DUHA 5DWPA 3DRTA 2KDYA 1U3ZA 3B1UA 3B9KC 2CD0A 4WI3A 3TP4A 3G3LA 1GL4B 2AEQL 1D7CA 4HUCA 4WK0B 4DO4A 1O7DC 3DX7A 4LCYA 4QDGA 5DD6B 3SPVA 1NFDB 1GGCL 3HJ0A 3NA9L 2A9DA 4JN2A 4Z5RB 3C5JA 4QLRA 2Z93A 4OCWH 2F7PA 4YXKL 1FHNA 1LNUB 1FFRA 2N0MA 4IDJL 2AJVH 4M7KH 1FNEA 1QBMH 4P4RA 4M1CD 2IH3B 5I76A 1LEGA 2VR8A 3FW6A 3MV7B 4YHKL 3MUZ1 2NNCA 2IAMB 4IDLA 4NZTL 3DROB 1ZANL 1M6OB 3RI5F 4LE8A 4Y2NA 1NCHA 3T2LA 4BFIA 3SQBB 3LRHA 5F7MC 5JPNC 3BZ4B 1QNZH 4MA7L 1SNRA 3T3PB 3OKKA 4QTFA 1UH4A 3CMOH 2J6WA 1LD9A 4HK0A 4DQOH 2ZT9C 3FO0H 5ERWB 4M03A 1N5YH 4FABL 1BBJA 2AK4E 32C2B 4NO3A 5G4NA 2ZTBA 2WWOA 1NGYB 1IBGH 4OQTH 5EU5A 2R1YB 2PYEA 3B83A 4OI9A 4WI8A 1U8HA 5I0VA 4XCFL 1IZKA 1F3DH 3UC0L 5E5MB 5JPMB 3CDGB 1T5XA 3VFMB 1EIBA 3W2DL 4HUVA 2L04A 3L1EA 3ATBA 4DKFL 2DTMH 2X53A 2CJUH 3UCQA 2GJJA 5C0DA 5GXBB 2OL3H 2O4EA 3GIZH 3GSNA 3VB9A 1FYTD 3JWDC 4XP1H 2FT6A 2O30A 5I6NA 3G5YA 4JKMA 1GGIH 1I7UA 2Z64C 1OOAA 3T0EC 4L3CA 1L0XA 4JY5H 1DVSA 1PKQB 3K8KA 3QWRA 4HV8A 1UEMA 4QXUH 3RNKB 4PV8A 5HVFB 2Y06L 3VXME 5F7EH 3K91A 1KEGH 4BK8A 3US9A 3GZOA 4G9FE 4Z7UA 5EIVA 5ID0A 4XXWC 2AJXH 1JSYA 1TNMA 3RWCA 1TETH 1D5ZA 4ODUA 4WKZB 1VHPA 2XZQL 3TURA 1OSPL 4XBGA 1UZ8B 4YOKA 3LAFA 1J0ZA 5EO9A 3SQOH 1DLFH 1OD9A 1F1GA 3F7PC 3IVKB 2QSCH 3ECBA 5DZPA 4YNYA 5I75B 2QSTA 4MMXA 3QZPA 5C0JB 1IGFL 4OGXH 2F5BH 4JBSA 4WUUA 1QACA 1O9WA 2EDMA 3PXHA 1FORH 1XCQB 2ZKHH 4HPYH 3VFUB 3WY3A 1A7OH 3NESA 2B2XH 1S7SB 1MVYA 1TVDA 5C09B 3NFPB 3I9GL 2YEVB 4YHNA 4BWTA 2A9AA 4NM8H 5BRZE 5C3IA 4OV5B 3WFDH 4CL7A 1OVZA 4JZJA 3QFJA 4LCWB 4MJID 4OCXL 1AMYA 1BFOA 1JZFA 4N2NA 1FJ1B 4X9HA 3HBZA 1WT5A 3VCLA 4WWKA 5KWYC 1BEXA 1UUSA 4DN3H 5FDWA 5AOZA 3KNBB 4MJHA 4XNQA 2OTWA 1T7XA 2YQBA 1CU4H 5F1KC 1CFQA 1GGTA 2VZTA 3ABLB 4JGUA 4ZTOL 5T3XE 3H3KA 4HAKA 5AALA 1A7NH 1GRWA 4HFUL 4MAYA 4QOKD 2QVMA 4M1DH 1A4KB 4FL4B 5EO0A 4JAMB 4F91B 4IOIB 1JBJA 5K39B 4NHUB 3PGCB 4KV5F 3EXJA 2NT0A 4RRPA 5DJCA 4JKLA 2ITCA 4M61A 3E6HA 2R1WB 3L3OA 1RPKA 4JANB 3ATDA 1U33A 3KLAA 3GT6A 4NO5B 1UACH 3BFOA 3W81A 4K8RL 4WSKA 1VIWA 3L4WA 4HKBA 1FFNA 1R3KB 1EZSA 2QGCA 3DX4A 5BS0D 4M1GH 3W0WD 2OMZA 4BSVA 1LE5A 1VEMA 1KACB 1XXDC 3VD4A 2H26A 3E2HC 3ZO9A 1NCBH 1S46A 3HE7D 4ZPVB 5E9NA 1F4WH 2PABA 1OM3H 1IGYB 1URIA 1UCBL 4H8WH 4R96A 5IOPA 4RISH 1KBBA 1RZPA 2DYRB 2IALA 1QZNA 1QSFA 4NZFA 3FFCE 3LN4A 3QJSB 1S78D 3DV4B 4OLWL 2A0LD 2VDOL 3ZGHA 2IADA 2EVIA 2YA2A 1WO2A 2YD8A 3X1NA 4G6ML 1CYXA 4U6TA 3EDFA 3GK8H 4S0HA 1FL6B 4Z95H 2DWEA 4GSDL 2CXGA 3SBRA 4DNLA 2IAAC 2QQLH 2VLKD 4AQEB 3FB5A 3HUJB 1HL4A 1Z9NA 4S1QL 2H8PA 4U0RB 5E8EA 5SWZD 3WHE1 2WXOA 3TLRA 4NQSB 4F92B 1E9PB 3RGBA 4H1LB 1JZ6A 1EZLA 1CE1L 1NL0H 3S0PA 3ECVA 1YMMD 5CMAB 4PJDB 3V9FA 4WI0A 2BSCA 4U6XA 4ZFQA 3DGCR 3DBSA 1PY4A 3TM6A 5FO7A 1DO6A 1FNAA 4KO5A 4FLOA 3V5HB 4RCAA 4UM8A 2OP4L 4MD4A 2IDTA 5AG8A 1ZK5A 3D39B 1FVCB 3S96B 4FZ8H 1PEWA 4TVPL 2EICA 2VLJE 3Q8FA 4BH7B 2Q2EB 4IQHA 5DFAA 4BSWB 4QHKI 2BSSB 2FUQA 4PGBB 4WSJA 3HS0C 4OF6A 3NRQA 2E6JA 4PYGA 3TO4B 5JQHC 4MXVE 2A6KA 2PWGA 3AJ7A 4X4MA 3BRDA 2CH8A 3BKYH 2KHAA 2Z7YA 4HBCL 4OFIA 2QFRA 4UAOC 4FNPA 4G7SB 4QUOA 1N26A 1QQDB 4JG5A 5DFVC 4GPVA 4ZZKA 5DS8A 3QDGE 4S0TD 3RHWK 2ZYIA 1M6UA 3RTQB 3R1GH 2W9LA 3PPEA 4P5TC 1SJXA 4W9IC 3VFRA 2O61B 1EFXB 1TOXA 3QIUC 3CDZB 4MS8C 4JKWA 2DI7A 4LLQA 5KW9H 4PWHA 3TBSA 1K4CB 1V3JA 1YEFH 2XWTB 2WQAA 3WD5H 3S36H 4F37K 2GTWA 5AVRB 3ROLB 3DLQR 2X0VA 4RIRA 4EO5A 1A8ZA 3I02A 3UZQB 4MAZA 3KLKA 5I8EA 5I8CA 4KQ3H 5FA3A 4Y2DB 3GSRA 1MY5A 4QHPA 4X6DE 4DWHA 4KRPC 4X9IA 1X5XA 3B56A 4MTMA 5EU7C 5DT1L 2CDGA 1JV5A 2NY6B 4J4PD 1TZAA 1E6JH 4B50A 3LB6D 3AFLA 3IYLW 2JMRA 4H8PA 1JCKA 2X9XA 4JRYD 3AAZA 4JQIH 1Q90A 3EO0B 5F6HI 1SN2A 3K4ZA 3NZUA 4NENB 2EVGA 4EI6B 5B3JF 1AO7A 3H6AA 5KOVC 3BAJA 3MXVL 5DEGA 5EFIA 4BUHA 3ATFA 2DICA 2WINA 2WSPA 5IMKB 4AQ1B 5JLZB 1PAZA 5CN1A 3JWNH 4DOHE 4TQ8A 5LDUA 1NGQL 5E4OA 3IFNH 1QTYT 3A3YB 5DZJA 2ENSA 5D4JA 5IVZB 2LTQB 2XG4B 3U2JA 2NY2B 2Q87A 2A6IB 1AH1A 1MI5A 3OXRA 4I18A 4LIQL 3D85A 1OP4A 4NQCA 1PZ5A 3TN0A 3PFQA 5D1QA 4WEEA 4WENB 5D1XA 1INEL 1WEJL 3NUKA 3MKKA 1TKWB 4RVBA 1AP2A 3QIBB 4A37A 7PAZA 3HHSA 5GRVK 1JTOA 1TLMA 4DSYA 3MFGB 5FWRA 2XTJC 1OKEA 4UOJA 4F5CA 4JM2D 1CDHA 3O8XD 2BDNL 2X4PA 5LGHH 4U7KA 3QR1A 1M57B 2VDLB 4BDVB 3NABL 4ODTH 1KCKA 3BPOB 3GEWB 1G87A 1F42A 4O5LL 3RBSA 4U1LA 1Y6NR 3AC0A 4PJ6A 3MV9B 4Z7OF 2MQ3A 2DMGA 4WFEE 4PP2B 4PLKD 5KVMC 1MWAH 2DLEA 1JZGA 3LRMA 2J6EH 1H5BA 2GJ6A 3PWLB 4YDVA 3TV3H 4DGIH 1SLVA 3VTTA 1ZTXH 1KV7A 3ETSA 3MRKA 2ADGB 2F74A 1FPTH 2P9RA 5DUMH 3GSQA 3VB8A 2WW8A 4K8RC 4I9XA 2KT6A 2BNRD 2YR3A 5E99H 3DXAE 2F15A 4QT5A 3BEVA 2B9BA 3AT8A 5DJDB 2C3XA 5CJ8A 3EHBC 4ZMXA 1JK8B 3BP6A 5ICXB 3B6SA 2H6UA 3CU1A 3MA7B 2E9BA 3MA9L 4KKZA 5ALBH 1MIEH 4GW4B 4LRNH 4LOEA 1IM9D 3RAJL 3VWKC 2HWZH 3L4ZA 3SDAD 3WYRA 2ZPKH 2FGZA 2AMUA 5JOEA 2NYYD 1OB1A 4ATWA 1T04B 2WWKT 1HCZA 1VF5C 4X9FA 2YS4A 2R29A 4JQIA 4FNRA 1I1YB 4PRDA 4HLEA 2JJWA 4J3UA 5C3LD 5I1KH 2Z91A 1EHNA 1NBVH 2RQ8A 1TVBB 4Q6IA 4X5RA 1TSRA 4FG0A 2Y5TB 2HP4A 3RYMA 1GMIA 3ESMA 5FGBC 3KYOB 2ZZUT 5DRWB 2WTRB 3GLEA 4KNUA 4MSWB 3VSTA 2ESVA 3DJZA 2C9QA 3ARDC 4EIGB 3VDBA 2O72A 2BOBB 4KMTL 4APXA 1R24A 2EDYA 5DA0B 1PQZA 4AQ8A 1SVBA 3AY2A 2W65A 1P9MC 2NQ3A 4PRPA 2JCCB 3M1BA 3BDBA 3WUWB 4JO8A 1WA2X 4ZQTA 3TJEL 5GSVA 3MLZH 1G0YR 1YYMH 1FYTB 4NOBA 1Y6KR 4AOFA 5TDNA 1G6RL 3L95A 3U7WL 3ZE0B 4XNZB 3QNXB 1FL5B 4XVOA 4FA6A 1MHEA 4XGZB 4XAWH 4XNXH 2M8XA 1X5IA 4GUCA 3PPSA 4JMXA 1UQSB 3WS3A 5JTWA 5GRVL 5FA4B 2PR4L 3V8CA 1YEKH 1TJIL 3QQ9D 4QRPE 1E90A 1KT2A 1P7QD 1A4BA 2NPLX 2UXFA 3KPMA 4FHKA 5D6DA 1MWAA 4KJQD 3S35L 3G5ZB 2HVKB 2J6EA 4MJ6A 5EZIL 4N6RB 1OCRB 5DRNB 3A6OA 3ALPA 5DHVH 1F13A 3KMDA 5GRJL 4G59C 4ODSH 5LBGA 4B27A 1QSED 3UP1A 3RFZA 1T1YB 1T1WB 1JPTH 3QG6A 4DK6A 3LIUA 3B2PA 3V6OA 5I1AB 2NNAB 4NKQB 3GM0A 3OLGA 4GKOA 3EO1A 1RP9A 3L3HB 1HHKB 3LKRB 4AQZA 3B2VH 4LCCC 3ZDYB 3LNGA 2OQJB 3X2QB 3TJPA 4HT1H 1FCGA 2LHAA 2DY2A 5CHNA 1E3ZA 4JVWA 1GC1H 4RFOL 1MCJA 2UZYB 2A3TA 5FHBL 2YARA 1JGIA 3UPRA 4AC2A 3B7YA 3NACL 4AENB 4PPTA 2B5IB 2QZQA 1XGQB 2Y72A 2Y2TA 3TPUA 4MJIB 5D7SH 3L9RA 1U92B 5E6IC 3MXWH 4TN9A 3C60D 3AITA 4HWBH 3AROA 1Q1PA 1TQSA 1W6LA 3MYJB 1J11A 1D6VH 4X6BB 4R5VA 3HW7A 1CTNA 1ETA1 4PTTB 4ZFFB 1SJMA 2J1ZA 4YHZL 4LHUA 4OH2A 4QOKB 3GMRB 3RKDC 2VJ0A 2FRGP 4N2AA 1T2QL 3T65B 2CHDA 2WV3A 1P6WA 1VRSA 1MDTA 2CGRH 2VAAA 1PU0A 3A4DA 3UEZA 3EJYD 3RPIB 1TJHH 5KSBB 3C6SA 1Q9WA 4QRBA 1XCWA 4O58H 2G4EA 3ECWA 3PU7A 4M5SA 3QJZA 4PJEE 5I82A 3V95A 1KLGB 1G94A 5BS0B 2CLVA 1EV2E 2XN9E 3W0WB 4XZUA 3FSWA 3HG1A 4HGWA 4LEOA 3FU0A 3FSVA 5SWSD 5D2LA 4KKQA 1SHMA 5FO8B 1F58H 4PJ7F 3HE7B 2VQTA 5HHOA 4WWOA 3MBED 3BJLA 1ZK9A 3MLXL 4DCQA 1IEBB 4AGQA 1HEHC 1SXBA 2VB5A 4JM4L 2GVYA 4ELMB 2C3HA 2HFFA 2VWEC 1U93B 5GGSB 1WD8A 4L3EA 3CZNA 3OB0K 4AY0A 4FF9A 4D3CL 5FYKE 1WC7A 2VDQB 1LEIB 5IHHA 4JX0A 5DHVA 3LZFL 4FJ6A 4WDIB 2VLKB 2WO3B 3KVQA 1MCOL 4NO2B 2VXVH 1VCAA 2OR8A 4HJ0C 5SWZB 1QX1A 4JN1L 4H5SA 4RZCA 4ZUVA 3HMXH 5TDOB 5HHVL 1NGWA 1KSRA 3L1FA 1O6VA 3U36A 1EHAA 2XWBB 5FV2A 3PP4H 1HHGA 3WFHA 3GHPA 4M7ZB 1YMMB 3K6IA 4JFFD 2H3XC 3QULA 1IQWL 4BFEA 4KO6A 4LAQH 3WNLA 3EADA 5D7JD 1EEZA 5CJBA 3SQRA 3DIVA 1N4XH 1BQHG 3I6KA 4M4PA 4ODBD 3H56A 1EHKB 2JXMA 2VR5A 5B1JC 2VC2B 4DP7X 3BT0A 4JFZL 4NQDE 2FB4L 4DP1X 3LPWA 1S8DA 5C07E 1YO4A 4F7CB 3O3DA 1UUNA 3NP3A 2ADFL 5F7NC 5IWLA 3BZFB 4BBWA 1RUKL 2AXGB 4G8FB 3Q43A 4Y9BA 3RGVC 3UAJA 3JT2A 3EOTH 4W9DC 5CP3A 1DBKL 5E4EC 3W39B 3DOHA 3MOBH 3IKKA 5KTEL 4HMEA 1I8AA 4JFPB 4Z3FA 2APSA 1J05B 3BWZA 3L13A 4C56D 2J8UF 4X42A 2I27N 1J1XL 4N0YL 3BAWA 4YSEA 4YBLC 4WW2B 1S9VA 3UPAA 1DO5A 5I2IA 1WBZB 1EAJA 2R8SH 3D08A 3BO8A 2VLRD 3KZ8A 4TULH 3ZYIA 4MS6A 4N8VA 5A16A 2JNZA 1HJBC 1JDCA 1A6WL 3TBBA 5T1JA 2OTUA 3VXQB 1QR1A 5FYLH 5ITFB 2OTPA 5DVMA 3QUYD 2RHEA 1KTBA 4K9EL 3QH3A 1J1OL 2P24A 3Q5OA 1J5CA 3SKJH 3SPCA 1A9BA 1JZ5A 2R1XA 1RLBA 3BWAA 3FTUA 4LBEA 3PGFL 1YNLH 4OF3A 1F8TH 5IB2B 4PCYA 1ACYL 1EJ8A 3IFPB 3OAZH 4GAYA 1AD9A 2XBZA 2ILLA 3IJSB 4CMMA 4JRYB 1JWUB 4IS6B 1MNUH 1SMAA 3UDWA 4PD4K 2BNQE 3NJNA 1NGZA 1XGZA 5E8OA 3QS2A 3V0DA 1LO5B 2H2PC 1JRHH 4UT6H 3CSTA 3V4VH 5CZRA 1BZ9B 2R0WL 4JRXE 3GSVA 4JO4H 3RUGE 4WVRA 4LLMA 4F57L 5A6MA 2MWCA 3F83A 4XPAL 4LHQB 1MOEA 3HNVH 3INOA 1DJSA 1JV2B 3UGXA 1L9PA 5IVXE 2MHAB 4XPFL 1E28A 4HJJL 3HMXA 3AREC 1IGCH 4IJ3B 4EIZC 3BYTA 1O5PA 3FOMB 3L3JA 4ALAL 3O6ML 3B7SA 1DL7H 4P0DA 1ZHKA 5DU7A 3SGDH 2ALAA 1RZFL 3DO4A 4M6OL 4XRCB 4YPJA 4BE6A 4NM4H 4DH2A 1EJFA 3LYRA 3QXAA 4K4KA 5BV7L 5IJCC 4JRLA 1GIGH 4RESB 4UB0H 4WHTB 1XF2A 4PJFB 5EIQA 4A2DA 4ANKA 2Q7AA 1P84J 4AH2B 1AHWC 2GKIA 3VI3A 4UZUA 3G7TA 3BP7B 4DUXA 1C1EH 1KJMB 5T1MB 4X6CE 3WEXB 1NCUA 2X42A 5GS3A 3F8UB 4JDEA 4WTZG 3C5XA 2WLIA 3AZUA 1IJ9A 2A4CA 5A2BA 3MJ8A 4R7VA 4L9LC 3I6GA 4Z76B 3BVDB 5GRYA 1VAHA 4YXHL 2FHBA 4P46A 3CVHB 2VLLA 4MFHA 3J7HA 4ZW7A 3QB7C 1JERA 1Q1JL 3FQYA 3X1BA 5KYNA 1VB9A 3KJ4C 4LSVH 1U9KA 5FO9B 1JPFA 2BNRB 3PWJA 2IG2H 4NUQA 1PY0A 1WSST 2FYYA 2XRAH 3KS0J 2QADC 5GGRY 2X4NA 4FADA 5EV7A 4AYMC 1XCTA 3DVGB 3DJ9A 3FTZA 2WZ5A 4OY9A 2XY1A 1EXGA 5IJVA 1RZGA 3O11A 3BSHA 1SBSL 3HNTH 4PJGF 2HJKB 2UUDK 4YC2C 2RFXA 2WXGA 4HKJA 1IM9B 1N6VA 5L88L 5KYUB 3ULUE 1OAYH 3SDAB 1T0MA 2DQJH 4JFDE 1MQKL 5FLUA 3OKEA 2QKIA 1CXEA 2VRQA 1E6OL 1BEYH 1JNLH 3FQWA 2WQRA 4YDIH 4EF3A 4PCKA 5GISH 1MFAH 4HWZA 4N9OB 4DZ8A 4FQXD 3ABKB 3KPQA 3TO2A 3M17A 2BS8A 4P3DB 1M71A 4UT6A 1Q4NX 5BUPA 2JJSC 3U6RB 3L54A 3CZFA 2ZOKA 3GZKA 3TFBA 1S7WB 2P8MA 4GS7C 2WLJA 4LSRH 5SX5K 3FU7B 4UOW1 3LY6A 1D5XB 4HW6A 4J1UB 3P4NB 5ITBH 2ENQA 1PL3A 3Q9QA 2ICEA 2DQDH 5LHDA 3RU8L 2AKRA 3K2UH 3K8MA 3AMKA 4UQBA 5L2KE 5EUOE 1QFUL 1UYWH 5D1ZC 2EDNA 2FEDD 3KDPB 1MJUH 4GNKB 1DQLH 2JIXA 3V0EA 2KDGA 5JW4Q 5IBTH 1I8MB 1JGEA 1C8PA 2X89A 5KVDH 2OA9A 4FXKA 4Z3TA 5HYFA 1KFAL 3P0YH 1DTUA 1MHHB 1CYWA 4X5XA 4ZX6A 3RVUD 1E2WA 2JK5A 4XNUL 5GS0C 1G7MA 1I7RA 4MMZC 4NYLB 4QTHA 1A6VL 5DJ0A 5HVGB 3KXFE 1TXKA 5HPMB 2VISB 5LXGL 4GRWE 4Q2ZA 2AJZB 3OAYK 1TQCC 5AVZB 1L3NA 3MUGA 3U7YL 2F1EA 4F7EA 1FVDA 1LDSA 3T1FB 5G4MA 3AY4A 2EKSA 5DF0A 2JJTC 2OSXA 3FO1B 1CI5A 1JD7A 3U46B 2YEZB 1QHQA 2A74B 4NSKB 3L6FA 5B39A 4YBQC 4RFNC 3QJFA 4MJJA 1XDTT 4M8UA 3U0WL 1QA9A 1QSEB 4LEBA 4ZXBC 3IDGB 1AGEA 1CLZL 4N0RA 5D8JH 5FM5M 3VXUD 3JV4A 2RJMA 3DVNB 5LWYL 1HHJA 1AE6L 1WBYA 3ULAB 3P3UA 1I9JH 3COOA 3Q6GH 4E9YA 5ELIA 1LEKA 4G7YL 3CE1A 3MRGB 2B1AL 1CC3A 2UZIH 4OB5L 2YC1B 5C0FA 2XYCA 3FQ4A 4AQAB 3QQ4B 4R0LC 2IPTH 2LOEA 2W60A 2BJMH 3O3UN 5JA8B 3O41B 5ICYA 1JGLH 3FDWA 5FC9A 4KHTL 3C8KB 1UFGA 1KIQB 3C60B 1JVOA 5BZDA 4JFXA 2AQRA 4BUGA 4PS8A 5M7QA 2Y7QB 4GP5B 4KKCD 2JKWA 4OU3A 4HULB 3DUSA 3QXUA 3E6FB 1WWBX 1TDQA 2ZKYA 5EULV 4EDWH 2YPKA 4IEFA 4UDTA 2OK0L 1T89A 4ZUTA 3US1A 3TL5A 3UTTD 4M7KL 2PMZA 1EAPB 3IRZA 4PREA 3MLSL 5CWSB 5IBLC 4AYSA 3QARA 5DWUH 3WN6A 3U4BH 1NC4D 2DL2A 1CQKA 4I85A 4ALAC 1IE4A 3GJEB 3ZO0A 5G5DB 3ARGA 4KAQH 5KBDA 2JWYA 5BV7C 4QI3A 1JHLH 2KKQA 2I9LA 3PYCA 4ZUWB 5CLTA 1DUYB 2V5YA 3IDIB 4DQOL 1E8WA 5SWSB 1IKNA 3CIQA 2W8CA 4BKLB 3Q2WA 5I66A 5DC9B 1G9ML 3MBEB 4XCEA 1KJVA 1PDKB 5C71A 4XN7A 3OZ9H 4P5MB 4P05A 4Q4IA 5D71H 2EXSA 3E9UA 4L8CB 4XHJD 1MJJB 3NEOA 1FAIL 1F4AA 1LYQA 4QXVA 4L18A 4HEMA 5MEQA 4B9CA 2YD6A 3BSZH 2Q0ZX 4TYUA 2G0LA 1INQA 2DLFH 4HH9B 4GMTL 2WZPA 1R5WA 3SGKA 2PXYC 1NAMH 4F15C 2F8VA 1A14H 3DHUA 7PCYA 5MERA 1FZJB 1GGIL 2BVOB 1QI3A 5INDB 3KGSA 1QLEH 3F04A 3FTWA 1CG9B 3QEUB 4P06A 3CK0L 4DETA 2GJZA 1E3FA 4PVNA 5TK2A 1GJIA 2XNAB 2O26U 5TPWH 4FXGB 4Z7UF 1AGCA 1DEEB 4ZPTA 1XH1A 1KEGL 5EB9A 4OFYD 1DQQB 4PJ9A 4LLDB 2DQ6A 1OAKH 2UVEA 2E8ZA 4JFFB 4GAGH 1UJ3A 1MAKA 2OMTB 5D7JB 4PRID 5L4MA 1WS7A 3FRPB 3O3EB 4KUCD 3D1MC 4EN3A 3P0VL 2EQDA 2H6PB 5ES4B 2BW5A 1E4JA 5T5NG 3SQOL 1DLFL 2OR9H 3HNSH 3UFIA 3DPBB 3PWUB 2QSCL 3C9NA 3V6ZB 5KYXB 1AAJA 2XDHA 3NEXA 1SOSA 2XKUA 1NEUA 2FX7L 3Q48A 2BP0A 5JYMA 1YECH 2DMKA 4GSUA 1HNGA 2NY7L 3H6JA 1OE2A 1BVKB 2V9RA 5CLZA 1FORL 3H4HA 2K0RA 2FWOB 3TA4D 4N26A 4C83B 4NXSA 1GYAA 2P8PB 4YHIA 2B2XL 4PS4L 1Z9SB 4Y19D 2BRRH 4C56B 4YEFA 2AV1B 5HD8D 3TVMA 4IRZH 4L2YA 2C3VB 1CDCA 2P52A 1CGWA 3L4UA 3MTRA 1RJZB 2G2RA 2VLRB 4PI2A 3OKDA 1KLFB 5FFLA 3VFGL 1NCOA 3H0TA 2D7QA 4B96A 1BLIA 3SBWA 5J7CC 3BH9A 3D3VE 3SYQA 2X70B 4CBZA 3BVNB 4Q9QH 3WO4B 2WSKA 3QUYB 1Y18B 5HYSA 1HIMH 1PZSA 1RZQA 2ZKMX 1QBAA 4M1DL 2V5RA 3LN9A 1F3JB 5IW1A 4P9MH 2F8XC 1W9XA 4X99B 4W4NA 3V9EA 1MCLA 5T1LA 3F7YB 3L4XA 1CGXA 4RA0C 4LSQH 2ED7A 4NQXA 2EDOA 1BQLL 5E9DA 1JOIA 3BQUA 1UACL 1HQ4A 3FQNB 3BSZA 5KVGE 3DI3B 3QDMA 4ILDA 3MROA 3V6FA 4QRFA 1U8IA 1NAMA 2FATH 5MP6H 3W56A 3MUY1 3NJHA 1FGVL 3CTTA 4QYOA 1NCAH 5E08H 4OZIB 2QVTA 1BSIA 3WUWG 1F4WL 2X4TB 1OANA 3II3A 2ZYHA 3V2AR 4CC4A 1I3RA 4DEWA 3D33A 1SN0A 2I07B 3MOAH 2CKNA 5JZ7C 4G2AA 3TWCL 4N2EA 3CQQA 5D9SB 1KPVA 1UT1A 1W0VB 4GAJL 2OAAA 1C08B 3GK8L 5ACLA 3K80A 1TQBB 1VADA 4KHXH 4QR7A 4ZMNA 4M93B 3G5XB 4J3OD 4DJMA 1SOXA 3FH7A 3IXAB 3LKNB 2V2TB 2C9PA 3GGWA 4F9LA 4MMXC 3MRBA 3QHFH 5AVUB 2FQDA 2HFEB 2HT3C 3KPNA 2E6PA 3PHQB 8FABB 1N6QH 2ZICA 3KCWA 3QQ3A 3CHQA 1T20B 3KPOA 3RNQA 2DQIH 1JWSB 5BRQA 2NX5E 5DJYA 2EO1A 2YLHA 3ZRCC 1FL3B 3PIQA 5DO2D 3HG2A 1G7HB 1QNIA 4UYPA 3V0VA 3P11H 4K3EH 4P2QE 3H4FA 3TT1H 1T5WA 2J8UB 3UZEA 4DEUA 4GO6B 4IRZA 3Q01A 3UO1L 4H8UA 5TQ2H 5AWNH 1WWCA 3DBXA 1DBMH 5IHUL 4PH8A 3B8SA 2KUTA 4JZJC 2IMNA 3T2OA 2CSPA 1LP9B 1IEAB 1S9WB 4L8SA 4DF9A 4MB3A 3MV01 5AG9A 1DJXA 1IZJA 1UZ6E 3PJNA 4IBLT 3L4TA 4WWKC 4MZ3A 3PXLA 4Q0XH 2K4AA 1N0XH 4NUJA 4UTAH 3BEWA 4RQQA 5CJOL 1A4AA 3BKCL 4G7RB 4RETB 4XHQA 3MRFA 5DRXA 5ENWA 2J71A 3TA3D 3ZMEA 1SM3L 1QHOA 5B38G 4XMZA 4XP4H 1MVUA 4MAYC 1D5MA 2J25A 4LARH 1Q0YH 4Z7QB 7FABL 5ID1A 3QWOB 1V8HA 1G9MC 4LPUA 4G8IA 2AAAA 2OMUB 1NDGA 1TEYA 4N86A 3C87A 3R1GL 4E9LA 3HTLX 4JPIB 5BOZG 1R5IB 3L3OC 1T22A 3KAAA 1NMAH 3T2PA 3MCKB 4D0BB 2GEQA 4L23A 3NIFE 4P2OA 4DFHA 3GKZA 2FHCA 3ZN6A 2MJWA 3T77B 2N56A 4Q4EA 4YDZA 3WD5L 3S36L 1DZBA 3QK0A 4FQXB 4ZD3H 5KUKA 3BZEB 5CGTA 4DP0X 3K72A 3MLWL 1VGEH 3MJ7A 2MCAA 3QI9D 5CJQL 2X10A 3BVXA 4G8GD 4JEGB 2H3NB 4AZ8A 2XKNB 4KGJA 1IILE 5DVOA 1G4MA 3HG3A 3KLLA 2OLDA 1CICA 3MRMA 1OCOB 3OHXB 4XPHH 4GFXA 4ZO7A 3CBKB 2OXHA 3WGUB 2CDFB 1X4XA 2ZAIA 5JDSB 2HTKD 1TTFA 1NJ9B 1ZT7A 2B39A 3FS9A 2ZOLA 5KYWA 5I74C 4PY7B 2OSWA 2FJGA 2R29L 3PABA 2XQYG 3JYBA 4WAFA 2J1YA 4WTWA 2CO6B 4PWEA 4B3EA 3UIZA 1PIGA 1MJ7L 5GS2H 2ZONA 3NFNA 2CDEA 3TASA 2O6FA 1TNNA 4X2UA 4QIRA 4OJAA 4HEPA 5LGKA 5K9QG 1CGVA 1J9TA 3LNEA 4FEMA 1H3TA 4GW5A 1KB9K 3IFNL 3IKCA 4NT6A 5DJ6A 5DFTA 4GMSH 3V5DA 1MCPH 2V33A 1E9OB 1MFVA 2GUOB 4N1CA 3FSZA 4DUVA 4G6AC 5DC2A 1HKFA 1AQDA 4OLVH 3KPRD 1TQUA 4Z77B 3MLUH 1P4LB 2QPFA 1DVYA 1BP3B 4C4UA 3O3AA 2R2HA 5DDHA 3ZTJH 2HN7A 2GY7B 3SO5A 3C6LA 1J9RA 4Z7VA 5IF0A 1XBRA 4FQ1H 1F11B 3A6CH 3EYFB 1FZKB 4NCC2 1CFNB 5LCVH 1S2EA 2VKXA 4PJAE 3CFJB 1PG7H 3GWJA 4PVLA 3FU8A 4AEHL 4D7BA 3KYMA 4PTUB 4X83A 1WAAE 2AABH 2Y69B 3LDBC 3QHZH 1MJ8H 5CCHE 4K3HA 4UTAA 3VXUB 3FU3A 1CJYA 1S9XA 4YO0A 2ZOTA 3P77B 4J3TA 5F96H 2DIEA 3PNWB 1DE4A 4ZFZB 1N64H 3OZKA 1MWAL 5IREA 1SHSA 4HETA 1SDDB 2UZXB 3L48A 2HTLD 1U3HA 3UG4A 1XTMA 1D7DA 5IMMA 2ZX9A 1A9VA 5FM5O 3EZ8A 1H8LA 1FPTL 4I3SH 4ATTA 1SFDA 2EEDA 5E99L 5H37H 1XAKA 5JOFB 4O9HH 5I28A 2VXSL 4EJ1C 5FECB 1LE9A 3VG9C 1AGFB 2J2ZB 4X6EB 3LH2L 3U6XA 5F3HA 1MIEL 4AZUA 3GQFA 4H8WC 1J9CT 4MZRA 5D5MB 3UTTB 3MLYL 1DSYA 3ROOB 4BQCA 4EIBA 4KZEL 4TLTA 3HEIB 3CCHB 5HDRA 1F86A 1NC4B 1O6SA 3IDUA 3DYPA 3WTTA 4K7PH 3OSVA 1HOCB 4OCRL 4OI8A 4E36A 3OAYH 1NBVL 5FUCC 1U8JB 4YK4B 5CGBA 1BMGA 2ZOWA 5FUOH 3FJTA 1J8SA 1MW1A 3VTAA 3FQXB 3FQ2A 2ID5A 4PY8I 4R3SB 3W5MA 2EUVA 1ZXKA 2A6DA 3TEXA 4A7UA 5LGJB 5FB8B 2JLLA 2EYSB 4N22A 1CF1A 1ZRUA 2WOYA 4GSQA 4I18C 2YGPA 1WH0A 2X7LA 5DQJB 4R2GD 3EGXB 5I30L 1G7PB 1CLYH 1KPUA 3VXPA 3MNMA 3TN0C 4A7GA 1VKXB 5D1QC 1G5GA 3CN4A 5D1XC 3OSKA 3TCLB 3DJRA 1ITCA 2VR3A 3POHA 4ETYA 1EH9A 2QLVB 3VXRD 4JFQB 5LCVA 4Z7NF 2EDBA 1UM5H 5AUMA 1OK0A 2C3WA 4H25A 2H2SC 2J8HA 3HZVA 5AYUH 1MFBH 1W8EA 2FJSA 4XAWL 1LDPH 4XNXL 1FG9C 1Z0NA 5AOJA 5A2CA 1OOWA 1YY9C 3NH7H 4Z0BH 2FQEA 4TPRH 1P7BA 3TXAA 4PHXA 4AMKH 3W11C 5HDQH 1UVQB 3RY5A 1YEKL 4G6JH 2BS71 2WSDA 4Y7MA 3T4AB 2GJ6D 4BRVA 2ZF9A 4PGEB 1XBDA 3VW3H 1T4WA 1S7UB 1H5BC 4CVXB 2GJRA 3DJTA 4NRZA 1HS6A 4PRIB 2LLNA 3FUJA 3WJJA 3UZVA 2OMWB 4NNYA 4HZLA 4UMGA 1JPTL 3DX7B 3A4FA 4KO9A 1T80A 1SYVA 2WK2A 3ES6A 4IRJA 1A1OA 1W2KT 4B53A 5H37A 4NKMA 2J4WH 1TQTA 3FUIA 2ZWKA 4LVHB 4XH2B 4Y5XA 1VGKB 4Z0XB 4YDNA 1ET5A 1D5BA 2N59A 3LV3B 2ZXCA 5TGBA 1LQSR 5IUSA 1HI6A 1G7JA 3NJXA 5BO1H 1GC1L 1FNEB 3GXNA 4V1DE 5I1EH 2WWNA 2Z8WC 4Y19B 4L5FE 3F12B 3N1MC 5K69A 2OM5A 4NZUH 4ZS7H 4TTDD 4YDKH 5J57B 2PW2B 3IJHB 1WAPA 3ZL4H 4TMPA 3MXWL 5CUSH 4F2ME 5D6CB 5GSRB 2GI7A 1ZEAL 1OWWA 3Q5TA 1XF5B 2BVQA 4Q14A 4Q6IC 4UTBH 1FF5A 4HK0B 5I23A 3WFCL 1FQ9C 1M2OA 5C08A 1D6VL 5SX4H 2ALWA 3JWNC 4LEXL 4R4NC 5DK0B 3NRPA 3T2NL 4XNMA 1V3KA 1EUUA 1BGXL 1GJWA 3KYNB 4NGHH 2QV4A 1E2VA 1N59A 3NCMA 5IQ7L 2R2BB 1U8HB 3LCYA 4P4KD 3G6JE 2VT0A 1DVZA 2WVVA 2ZE0A 4RGNE 3G08B 5IM7B 1NCWL 3GMQA 3WTYA 3WKNA 4IK7A 5GRUH 5FYJU 5EF3A 4AQ8C 2R9HC 4FI7A 5DQDH 5C0DB 1K85A 1JZ7A 2VXQA 4MA8H 1JGDA 3GBDA 4MMYB 1KZQA 3U1SL 1CGYA 3O2WL 4G71B 2WXNA 3VRLF 2NR6D 2KLSA 5D2LF 5DMJB 2H32H 1J7VR 2BZ7A 3QISA 2WQSA 4JZNB 4JO1H 3VXOA 3SDDD 2Z92A 4HV8B 1UM6H 1JG9A 25C8L 4PV8B 2H47C 1RK1A 3IMBA 1RAMA 1L6ZA 3H9SA 1UA7A 2WO4A 4XVTL 2RMNA 5IEHA 1MVFA 2ORBH 3MRQB 4U1SB 5CSZB 5TE7L 1SQMA 2V2WB 4I89A 1F5WA 3P30H 4XVUD 4XX1G 1C9SA 4NFBA 2FVNA 1HINL 5IY5B 4OUUA 4MD0B 3QEQE 5D6DC 2LQRA 2FAUA 1PZAA 1PNCA 4NZRH 1A4CA 1BQUA 1RUPH 2WZAA 2NQCA 4N0FA 3HN3A 1SY6A 1FA4A 4FFZH 3RIKA 1TTRA 2F08A 4JDVA 5EO9B 2NZ1A 1K9TA 5GGQH 3ECBB 5KANG 1HJCA 5KJRH 1JXGA 4YNYB 1FNFA 2FX9L 4Y1AD 2VXVL 2VTFA 4FP8H 3V6OC 3VXTB 3HMXL 2GAZB 4WO0A 3FXIC 1KCRH 3HI1B 1IGJA 1LO3H 5F70A 3OL2A 1OGAA 4RZKA 4AKOA 4Z7AA 1VFBB 1DN0A 1UOKA 3TBWA 3TYFB 1AOHA 3SO3B 4YHNB 1W72B 4N2HA 5I9QB 3PLYA 5EU6E 4APQC 5F93C 2Y5EA 2NZ9C 5CZVH 1XR8A 1N4XL 2WKLA 3TIEA 4QJ3B 2GY5A 1O7DE 4UUJA 1GOHA 1ZS8A 2EC9T 3HR5A 3DURA 3ETBJ 4FQHA 1OP3K 1HZLA 4ACPA 4F93B 1F6AA 1AGDB 2BIPA 5AB1A 4PGDB 4UTBA 3X1FA 1HAUA 2X4UA 4Q58C 4NRYB 2F6AA 2V8LA 3EOTL 2ZSVB 4PJXA 3TA3B 1DN2A 1W0WB 4QAWA 4X5WA 5BZZA 2F54D 4CGUB 5E6YA 3GSOB 4W9GC 4LB8A 2CCVA 1AQKL 5J3HD 4I9WE 5DHYB 1B0GB 2R8SL 2NOYA 2Y7SA 4HCIA 4F7TA 1D6EB 5GGVY 4TULL 3FHQA 3MUJA 5E8PB 3BP4A 2FBJH 1FFNB 4DTGL 1T0PB 1KY7A 4O02H 1KYFA 2OL3B 3RIFK 4DKEH 4IBSA 4P2RD 3WDIA 4EUPB 5JW4R 1JZ8A 2L8AA 4Y9CA 5C0BA 5D7IA 5CEZE 2E7BA 3N42F 3L3GB 1ZY9A 2R2EA 4RFEA 2H26B 3RVXC 5KS9E 3FT3A 2H32A 3QI9B 4ELDA 3RTLA 4G8GB 1J48A 1DJIA 1ASPA 3MLTA 1UWEH 3EFOA 4NI3A 5J13C 5T5FA 4R96B 1SJHA 3SKJL 1LVEA 1NLDH 2W1NA 3QEHA 3SBPA 2YKLL 3LN4B 2WNGA 3ASOB 1V05A 4KRMB 3UBFA 2QHLA 3U0TB 1FIGL 2IGFH 4M6ML 4JNXA 2VDKB 1PYWB 3VG0H 4MDIB 5DEJA 1LWRA 4POYA 1XD0A 2EEXA 4NQVB 4FTVA 2YXMA 1C16B 2FT8A 3T0EE 1UKTA 1R33A 1N12A 5AW1B 5BXFB 4JO4L 2AI0L 2XTJD 3IDXH 2BVTA 4HCRA 1HH6A 2FH8A 2Y07L 5LLIC 3HCVA 3DX6B 3EYVB 3QJUB 3F01A 3ZDZF 5T3XL 4E41E 1DUZA 1QFWI 1N9PA 2OMXA 4HF5L 1A65A 4Z3GA 4B41A 3CFEB 3REVB 1P4IH 5LNEA 4BQBA 1JN6B 2A5UA 1BVNP 3KPRB 4QRUA 2LU4A 4K2UL 2F1AA 5C70A 2BSTB 3LH8A 4CVUA 1GC1C 3OKMB 3F7KA 1MZZA 4ZAKD 1T66D 1FNSH 4OJCA 4QF1B 4UU9B 2X4QA 3AXLA 4Q8BA 2C1PB 2WXQA 5DD5H 1OAXL 1PCSA 4N5EC 4UB0L 4X7EC 3ZTNH 2KS0A 4MDJB 3VI3F 1AYOA 1OE3A 4PD4J 1RQ5A 2UYLA 3WN5A 3ZYZA 4K8RD 1SEQH 2EDFA 2F19H 4MCNA 5EC2B 5IWLC 3SPJA 2XFXB 1TCRA 3JT0A 3VQLA 4ZOAA 5AKSA 4PSPA 2HLFC 3J2PA 2A6KB 2D03H 1WIPA 4FAAB 3UAJC 4OFQA 3Q3GA 3T08A 1UFUA 3DX9B 1TITA 4TXVB 5DS8B 3NCFB 3S3PA 4F20A 5ESAB 4H26B 5BNXD 5I6OA 4XTRC 2Z8RA 2Y22A 3PDOB 4AUUA 3SD2A 3IDYB 4LLQB 3VE0A 5AAWA 4NQED 1MF2L 1MRFH 2OZNA 5EZLB 3OKOA 4HU2A 4D9QD 1T6VN 3HI6H 1YEHH 3VJ6A 5CEXA 1VZGA 4K5PA 5D7KD 2VGLM 1DFBL 1EEYA 4O02A 4RIRB 3SE9L 1W15A 2IG2L 1K8DB 2FIKB 1EPFA 1DQDL 4KROD 5J0BA 4HJUA 2HH0H 4LSTH 5HDLA 4ZYKA 4MWFA 2YBRA 1UWGH 4X8JA 1TR7A 2ERJC 1IAOA 2VMDA 3D0VA 3QDJD 4A1RA 1A1MB 2L7QA 3LKQB 3PHAA 4U2ZA 2X38A 2J5LB 1ORQB 3ARDD 1OAYL 3FQTA 4L05A 5D93C 3VMOA 3V7AG 2XJLA 4U1MB 1S7TA 2IXQA 3JTSB 1GOFA 4XOBA 5DHDA 3UDWC 3RWDB 1PEZA 2X1PA 5IG7A 2DQEH 4G9DB 4JG0H 3C75A 3KWXA 5DEGB 2FR4B 2OYPA 2X3CA 2WINB 1LM8V 2YQ2A 5I19H 3BC9A 5JUEL 3OLEA 3A4EA 1U8NA 3BAYA 1NDMA 1DSFH 4M5ZH 1MG3C 1X9RA 1ZLWK 3OGCB 2EIDA 3KL3A 4OF5A 5AOIA 3S4SG 4OGZA 3IDMA 4B9KC 1HESA 1AYRA 1BDYA 1DVXA 3SKMA 1KELL 1J5IA 3PV6A 3AB0B 2XPGA 3LPFA 4Q97A 4R2GB 5MHSD 1MJUL 2VDNH 3QPXL 4OZHB 3RA7H 2V6HA 3FRUA 1INDL 3II1A 4FI6A 3S98A 4HOXA 5KYYB 3VXRB 3GB7A 2VM9A 1TJXA 2OMYA 1HXMB 2XZAH 5DJ2B 5I1CH 3EGSB 2V5SA 3L8QA 3UTQB 5I1JH 2VMJA 3HZMB 5GPRA 2E4TA 2IPUG 2Q9OA 2X4PB 1WFOA 2RCSL 5EORH 5I6XC 5GGVH 4LMQE 5GZNA 3WGVB 5AW9B 1I8KA 2BFGA 1QKZL 1XEDA 4JVUA 3P3TA 3A6BL 4R8WL 4OCSH 4R6UA 2Z0UA 5IQNA 4F37F 3BX7C 2A83A 2GJ6B 2AF2A 1K8IA 4OFDA 5IMOA 4HSAC 1G1YA 4YSUA 1SUHA 2LFEA 4GKZA 2C8NA 5HPOA 2N1TE 4YWGH 3HE6A 1QSZA 4P46C 4X98A 1TPXB 3V4PL 1OQOA 3GSQB 3QUXA 3R06B 3HI5H 5FF6A 4J3XA 1M9WA 5A2IH 4QT5B 5DMIL 3PXJA 3IJEA 3K5RA 1JVLA 4NZ8A 5FYLD 5DD3L 5DK3A 1LXMA 4E9WA 3B6SB 3AG3B 1JF5A 4HCFA 4CN4A 3VYPA 4F1SA 1HDMB 5MEPA 1THAA 4LSSL 4M6AA 4W9CC 3FCGA 4FNLL 2AQQA 1CQYA 5KJ7E 4LESA 4L0YA 2A6JB 4C47A 3H7BB 3Q6GL 2W9EL 5J89A 2EDTA 3GBMH 1YAZA 3Q2LA 3U30B 4HS6A 1YA5A 4KV5E 1PG7W 3SJVD 3UAFA 3K1DA 3K6DA 4BJLA 5JXED 3OF6D 2UZIL 3LS4H 5J11B 3QUKA 1RULH 4F8LA 1RPUA 4U1JB 4HIJA 4IK6A 3BUTA 4N0UB 3D12B 1Z9MA 5K9JH 2Q7YB 1QBBA 2G3NA 4G70B 3FN9A 1T2XA 4XOCA 1WBXB 3RWIB 1JGLL 1YAIA 1GPOH 5J6HB 3CDFA 4JGMA 1SXZA 3HA0A 5DD6A 2CLRA 1NFDA 3MMEA 4OZGB 3QIWD 3IRCA 2HLEB 5EU7E 2VH5H 4Z5RA 3IBEA 12E8L 2J5WA 4LLUB 2ESVB 3QGVA 2EXWD 1LNUA 2ICEC 4NNPH 1E5UI 1BZEA 1RK7A 1QZ1A 4P4KB 3TFKC 1H8OA 4PP1C 3QC6X 5DWUL 3FONB 1NOLA 2VSCA 2IH3A 1C5BH 5E5RB 4PI0A 1GJUA 35C8H 3AU1B 3B8YA 3LRSB 3M1BB 3GXTA 2IAMA 3MV7A 4HJIA 3DROA 1QP1A 1M6OA 4FXKC 3U9WA 2YSTA 4URTB 4KAQL 3BLBA 3SQBA 3N04A 4KQ4H 4PJCB 3BZ4A 1BG9A 1JHLL 4ONGH 1NMCC 2BHZA 2HMID 4Z7NB 2X87A 3CX2A 1HQRA 3FYIB 3O0RH 2EE9A 3B2DC 3SIKA 3ISWA 5JHLL 5F9OL 5SV3A 5BJTB 1YC8A 3SDDB 5ERWA 3HBGA 4FC3E 2CKBH 2YXVA 4MNQD 3OZ9L 4LMQI 32C2A 3F6JA 4JY4B 1TQVA 2E9JA 3BW9B 3LPOA 1Z5YD 1QRND 2R1YA 2BERA 5JIPA 2HXAA 3IU3B 4PG9A 1KT2B 4ZW5A 3AY4C 2MCG1 4C57C 3UTSD 4CN6A 3UIYA 5E5MA 5JPMA 3CDGA 4YE0A 3BSZL 4Y4KD 3VFMA 2LGNA 3EUUA 1EJOH 1AHKA 1UD8A 2DLFL 2X4RB 4POZD 4TRPL 3RFZB 3ZKXB 3QUHA 3FB8B 2NY0C 5HSFA 3ZT5A 4YLQT 4H8VA 4KTYA 4JUTA 3LKSB 3QJTB 2BIMA 3CX5K 5E1HB 2FT7A 4GIPD 3NMEA 1PKQA 3RNKA 4MDRA 1U4FA 3GKWL 4P04A 4OCYH 4ZS6D 1FZOB 3GC3A 4XVJL 3U4AA 3ZTEA 5BVJB 2ZJSH 2CK2A 4GAGL 4JQVA 5D70L 1HZKA 3INUH 4MNGE 2A7BA 1PX3A 4ANUA 5FEBA 1U8KB 4N2LA 4WKZA 3WFBL 2CO1A 1ZKAA 2YMTA 4RDBA 1UZ8A 1BVLB 1NCCH 4J2XA 4DW2L 4FFVC 5C0EB 5HVHC 1AXTL 3FCBA 4PJ5D 3IVKA 3O4LE 4A04A 1QMUA 4H8HA 1B9KA 1YECL 4GI9A 3RVWD 2B1HH 5DR5H 3QG7H 4H1LH 5C0JA 1TTBA 5IFAL 1BQKA 4LHUB 1XCQA 1U41A 3VFUA 2JI3A 4KK9C 2GJPA 4ZSOE 3CFCH 3P3YA 1S7SA 2F54B 5C09A 2EUWA 5DFWH 3L9EA 3NFPA 4FXTA 2MPAL 3B5GA 2DI9A 2E9GA 4YJZL 4OV5A 1TUPA 1BD2E 1B0WA 4POUB 1TF4A 1CGSH 1FVEB 3ARZA 4JB9H 4L9DA 4L3AA 3C6SB 2P5EE 1A3RH 1UGKA 1RFDL 4LCWA 4LL4A 3BIBX 4KKAC 5B3JE 2P5WE 1FJ1A 4FERA 3ARGC 3QJXA 2H2PD 5E6RB 4P2RB 5GS1B 3KNBA 3Q8AA 3X13A 5IKCB 1DBJH 1GYWA 2Y1VA 2FLRT 3ULVL 1HIML 1IKNC 3A23A 4E9XA 3DMMC 2Y36H 1UEYA 2EACA 4YBHA 1LO4L 1A4KA 2R7EB 5DLMH 4P9ML 4DCQB 4JAMA 2Q8BH 3VUAA 4IOIA 2EXTA 5K39A 3KLSA 2JFCA 1HWWA 2MSPA 3PGCA 3ZSSA 3ILQD 1IKOP 5DVPA 5K5YA 1B4LA 1D3CA 3DYMA 4JQXA 4JANA 1CUOA 4XWGL 3Q8EA 4NO5A 1U8QB 3BPLB 1PD0A 2WIMA 3OMNB 3OXSA 4O2FA 4TVPE 3SGKC 2VITB 3ZE1B 1UT9A 1MFEH 2FATL 5IQ9B 5KBKA 3CLEH 4Z23A 3BT2H 3H85A 4UV4L 1K5WA 3SOTA 1NCAL 1WA1X 1AKJD 1M2VB 1OARH 2YJQA 1NGWB 5IFHH 5IQMA 5E08L 1JI1A 3U36B 1F6FB 1TFPA 4ZPVA 2CK0H 3M45A 4NCDA 2DZEA 1IGYA 4A66A 1IC7L 3A67L 4Z7OE 1QO3B 1TMQA 3DSFL 4PJ9C 1DQTA 2BRQA 5I5JA 3DV4A 3I6KB 5CD5C 3D07A 2VN4A 4ZAKB 5E1AB 4N4YB 4KTDH 2WJ5A 3O9WD 2ITFA 2UY6B 4EN3C 1FL6A 3G9VA 1W80A 4MA3B 1OPOA 5F7FA 4N8PA 2WBJA 4KXBA 3HUJA 5FCSH 5SV4A 3FUKA 4RAHA 3FCUB 1WLHA 3ILPB 4S1SH 3QHFL 4NQSA 4WZ9A 4M3JA 2FGWL 4KKLD 3KBFA 1E9PA 1N6QL 3D4YA 3EJZD 4H1LA 4ZRGA 1SF5A 2W0FB 1DHKA 5CMAA 3TVMD 4PJDA 5GGTL 1HCVA 1E0OB 2XXGA 5EBLB 2ADJA 3GLDA 3GSXB 4K3EL 5I2IB 1S9VB 1JGVH 4I1RA 5AENA 1WFJA 4A6YL 1AIFB 3AG4B 4H40A 3V5HA 4N8VB 1A6TB 5F6IC 4NQEB 3GMMB 2JTDA 4GXUN 3UL4A 3D39A 4M62L 5FYKL 1FVCA 2OTUB 2BFVH 4LCUB 5AOMA 4BH7A 3BN3B 2FNBA 4BSWA 3SBWC 5I71C 1N0XL 2BSSA 4PGBA 4NJAH 3IF1A 3ULVF 1IAIH 1MFUA 5CSGA 2TSBA 1NC2D 2BO0A 2CNZA 4KROB 1QUPA 2BVEA 3WEOA 4PB9L 3V9CA 5C0AD 2VM3A 4LARL 5HI3D 1Q0YL 4LIQE 1QQDA 1RJYB 2FZ3B 3QDJB 4JHZA 2NUTB 4TSCH 4X4YB 3ARDB 3RTQA 1IM3D 1QYGL 3TZVD 1NMAL 2AZAA 4GRMA 1EFXA 3K8LA 2O61A 3B3IB 3BQUC 3CDZA 4JFWA 1VFUA 1GR7A 1K4CA 5A6IA 2XWTA 2JI2A 2G2PA 4LLMB 5B1CA 5E2TL 5EO1A 3ROLA 1VGEL 4FFYH 2H9GB 3VA6A 3DOSB 5DUPH 1KIPB 4QRQB 3UZQA 4JHWL 1L9SA 2A4ZA 4Y2DA 1OCWL 4PLOB 3CFTA 2VWEE 3KW8A 4CC4C 4XPHL 5ICUA 5TF1H 2R0ZH 4H2CA 3ARUA 2DB8A 3PCYA 5F88A 1XH3A 5KANI 4B9FA 3JTTB 2HT2D 5CGYC 1JZIA 5JHDE 3WFEL 2BW4A 2IFFL 3NPSC 3H8NA 3BE1H 1SEBB 5BMFL 2XXCB 2AGJL 3EO0A 2JF1A 2QMJA 1D9KC 4DPCX 4NENA 3SE8L 4EI6A 2E7HA 4KI5F 2B15A 4P59L 4R4FH 3VI4B 4UIMB 1BZ8A 4NFDA 1CD8A 5IMKA 4AQ1A 5IMLB 4ZFOB 3ZUCA 5JLZA 2NUPB 5C9KA 4GMSL 4F9LC 4XB3A 3MV8D 3PDDA 3IGKA 1ZLSH 5IVZA 4HLZH 2A6IA 2MKWA 5C0NC 1AC0A 3GJFK 4Z7VF 1RU9L 3MRLB 2AJUH 3LNHA 3NGBB 2D7TH 4NIYE 3BPNB 3A6CL 4H0HB 4XVSL 2YAFA 4NQTA 4P23D 3MLVL 1TKWA 1H19A 2F1BA 4JFEE 5IK3B 3ARVA 1PG7L 4L8SC 2R0LH 3AG2B 1Y07A 3JXAA 2X09A 8CGTA 3OJDB 2AABL 1MJ8L 3CDYA 2Y6SC 1XCTB 4K3JL 3TX4A 2XU9A 1UJTA 2Y7NA 2WVSA 5IJVB 2QMKA 2TRYA 4HPOH 4BDVA 1KB9J 3ULVC 5F96L 4UQ3B 4IU2B 1TJGH 4GQQA 3MV9A 1D5IH 4PW3A 2UWEB 1N64L 3F3HA 3FTGB 3AT9A 2CRMA 4LLYB 4PP2A 4U0QB 5AVQB 3S7GA 3SKUD 2ZAHA 4JPWL 4ZMLA 2QKIB 1WIOA 3PJSB 4P2OD 2DWXA 3PWLA 4FNTA 4J6RH 3ZJAA 1T3FB 4GOSA 2NT1A 4HS8L 4XAKD 4I3SL 2ADGA 1ZLWH 3S5LB 4RRPG 3V4VB 5I6LA 4XMXA 1XF1A 4NXKA 1T6BX 4AYID 5CEYB 5DJDA 5ALCH 4BFOA 3QIWB 4FFYA 2HA1A 2YGNA 1JK8A 3NP4A 4PJ7E 4YHOL 1GHFL 1CICC 2NY1D 3MA7A 2ZUQC 4GW4A 4A39A 2V8MA 3RQ3A 5HI5C 1GYCA 2K3HA 3CFKB 5KSVB 2X2HA 3ALWA 1T04A 2XJKA 4NERA 5HHNA 1KGCE 1YN6B 4K7PL 1CD0A 1DVFD 3ZRFC 1A7RH 2F7OA 3V4UH 5HJBA 4PB0H 3EFDL 2CAKA 3H1ZA 5E5UB 4HUWB 1IVLA 2Q8AL 5MENE 1TVBA 4LSUL 2Y5TA 5I0XA 5HHXH 2F53E 1MCRA 4KI5C 4TQEL 2Q6WB 3TJHC 4HK3N 2AC0A 2ARJA 4HOWA 5FKPA 4AM0B 3VD7A 3KYOA 3MR9B 4KK8D 1EMTL 2L3BA 2YXWA 3OLDA 1RUML 1EEQA 2OMBA 5DRWA 2WTRA 4MSWA 3I9PA 4MNQB 4A2GA 4CA4A 2WWKO 3CDCA 4E5XB 4BQ6A 3BCFA 4A7GF 3AMLA 1QRNB 2BOLA 2DJ4A 5BW7A 5C6WH 1MFCH 4QRRE 3UTSB 2NY4C 1X44A 1LMIA 3FHAA 3SGEH 3C6LC 4J2QA 4MX7B 2VXQL 2XVBA 4IOFD 4Y4KB 3IRPX 5AW7B 3S37H 3ZT7A 3I84A 3P02A 6PAZA 1UC6A 2X2IA 5DEFB 2JCCA 5JOPD 3WUWA 2JQZA 3OD3A 4N90D 4HZ1A 2D7MA 5F2FA 5EH1A 2PR9A 1FYTA 3S5YA 1PJWA 4I2XE 2XPZA 2JQAA 2BVYA 5AYUL 3KCPB 1T7ZA 1LDPL 1FL5A 5JQ6L 5L6YH 4X4ZA 4XGZA 5C9JB 4TSBH 4AG4H 1A64A 2EO9A 1DCLA 3QHTC 4E68A 4MAUH 1UQSA 2CGZA 3LEVL 1YQ2A 1JPGB 1XSJA 2Z4QB 4TQIA 4PYHA 4BFRA 1HK6A 2J8UE 3U48A 4AJYV 4HIHB 1HXYB 4L1DA 1M7DB 1RSYA 1Y0LB 2A77H 3N40P 1YEJH 4ZNEA 2X1QA 1MHPH 1SY6L 1U3HC 5GIRA 1WPCA 3HC4H 2AV7B 3G5ZA 3KBPA 1SJVA 1VZHA 1PLGH 4N6RA 3EOAB 4OQ1A 4KX8A 4Y4HC 3IMSA 3RX8A 3PQYD 2Y3AA 5ICYB 4UT9A 4YQXH 1T1YA 1T1WA 4OD1L 1H15A 4PJ5B 4JFXB 3FOLB 1ETB1 5I1AA 2ZUVA 2NNAA 4LVOB 1CCZA 3L3HA 2FO4A 1HHKA 3LKRA 3LD8C 1G6RB 4IEFB 15C8H 4NAMA 4UDTB 3PAYA 4XMTA 4FULA 4UBDC 2EC9U 2EEFA 4ANXA 2UZYA 3ABZA 1PPIA 5ABAA 3SOBL 2XG5B 4AV4A 1WTLA 5DCCA 3KHQA 5KOMC 1AFVL 4AENA 4YDKL 3IGAB 1XGQA 2VC2H 3KR3L 1A6ZB 3N06B 3MRDB 4RWHA 3T3MF 1EBPA 1YHPA 3Q1SL 5AL8A 4KRNA 3ZL4L 3GBNH 1T0OA 4MJIA 4ZMPA 1U92A 4X80L 5C92A 5E4IA 3ZKMC 2CJTA 2OXGB 4GEJA 2NY5L 1ADQH 4IIZA 4PRHE 4YHPB 1KCSH 1BMZA 1CFTB 4Z8FH 2ZAGA 2B59B 3MYJA 2JLPA 4X6BA 3NZHH 3OJ2C 2GBUA 3NSFA 5HYJD 4PTTA 4ACTA 4ZFFA 1OALA 1ZLUK 4AEIL 4NGHL 4KH2A 4QOKA 3GMRA 5HI4D 5HYIA 1H3WM 4WUKL 4J8RB 4J8QA 3T65A 5DYFA 3TYGH 4OBSA 2HRLA 2UXGA 4NUMA 2ZWLT 4OZFB 1BXXA 5IEKB 2J7LA 2VAJA 4ODWB 1ZT1B 3ATEA 2ICWI 3RPIA 5KSBA 5C7XH 4H20L 4KFMA 1TTUA 1CXKA 2P45B 5IJDC 1KXTB 3EH1A 4MQXD 1KLGA 1UKQA 5BS0A 3FKUS 3F7QA 3L5XH 4FQCL 5B1AB 3W0WA 1I1FB 3MOQA 4UINL 2DQHH 2R23B 1JZHA 5KBNC 5T5FL 3GUFA 1V7NH 3NYKA 5FO8A 2DOCA 3QWNA 3HE7A 4HLJA 2G5BB 2PCPB 3RY6A 2R15A 4C59B 4CSPA 4MQTB 3P30L 3KJ6H 5IHWA 2AFNA 1IEBA 3UTPD 3KPSD 1UJ3B 2DWTA 3W9EB 3VDCA 2FK9A 4ELMA 1U93A 5DMYA 1GZQA 2H0FA 4FJYA 1A7QH 4NZRL 4NN7B 1D7BA 5H94B 4AXWB 3O9WB 3WJJC 5DVNA 1LEIA 1P7HL 3IS0X 4HCRL 4GXVL 4WDIA 2VLKA 3I3EA 1ZLEA 4IRJC 4ZO8A 5D7LD 3IJ8A 1I7ZB 2WZ0A 2FWLB 4BFFA 3B2UD 2D0GA 1RUQH 3WJMB 4Y5XC 5SWZA 4Q7DA 4Z6AT 2P46B 5TDOA 5EF1A 2YGQA 3EKCA 2MEJB 1U3NA 4PJHB 2GEEA 1LO3L 3VXSD 2AVGA 2YUZA 2XWBA 4PJGE 2HLAB 2E74C 2DKSA 4G3YL 5DMGC 4JGJA 1YMMA 3TVMB 4P57B 5CNHA 1QOKA 2JH2A 5HGHB 2ARWA 2BOCB 4V33A 2HSIA 1E5BA 1QEXA 3BLKA 1RP8A 1HH9A 3WXWL 4QHKJ 1MCSA 5EA0L 1RZKL 2JKJA 3UERA 3UO8B 4LASL 3LKPB 1K5NB 2FL5B 3PWPE 1ONQA 4NKDB 3UAAA 3FU5A 1FO0L 4F7CA 2MQ0A 3BAEL 3T0XA 4K3DH 4PJXF 4IU3B 1ADQA 2LU7A 5IVNA 3IPFA 3BZFA 3N9GH 4GQ9H 1ESOA 2AXGA 1NC2B 3ML8A 4G8FA 4KOCA 4XOEA 1CDGA 4OV6F 3V10A 3VGAB 5KVEH 5IW1B 1ITBB 3W39A 4AKPA 5C0AB 2Q3XA 3F65A 4PWGA 3D09A 4JFPA 4N8CH 1BX2B 1J05A 1I7TB 3J27A 3EAKA 3JWNG 5I5MA 1NCJA 4OIIH 5D1ZI 2XPYA 4HU8A 2YAOA 5GGRB 3TESA 4WW2A 1NCNA 1IM3B 1OAUL 5E7BA 3TZVB 3CVHH 5I0ZA 3MROB 2FBJL 1AC6A 2ZXEB 5D7IF 2CGYA 2VLME 1I1RA 4O02L 2KZKA 1N0LB 3CNKA 2IDUA 2VUYA 3VXQA 2VR7A 1L9OA 5ITFA 1QLEB 3N85L 1J0HA 4X7SH 3EJPA 1UWEL 1BVZA 1QTPA 3D4ZA 4RMWA 5IR1A 2VDMB 1EWHA 4HAGA 3AGWA 4DKDC 4NN6B 4NLAA 1Z3GH 2FJUB 3GXFA 4FDWA 4TUJA 5F6HJ 2YRBA 4ESKA 4NP4H 1GCYA 3AS2A 5IB2A 2VW6A 4J4PA 3STZA