2W8CA

Plastocyanin variant with n-terminal methionine - closed structure
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
106
Chain Sequence
METFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal-Mediated Self-Assembly of a Beta-Sandwich Protein.
pubmed doi rcsb
source organism Phormidium laminosum
molecule tags Electron transport
molecule keywords PLASTOCYANIN
total genus 24
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2w8cA00
4NERA 1AZUA 2GIMA 2HX7A 4KNUA 1V54B 2IWEA 3ASOB 1E5ZA 1J9QA 2MRYA 1I53A 4K9JA 1ZPUA 1NIDA 4DP8X 4YSRA 1JZIA 3ABLB 4A67A 1JZGA 3EF4A 1URIA 1QLEB 1ET8A 4DPCX 1SF3A 3N55A 2VSKB 1OE2A 4YVNA 1BQRA 2AFNA 4GY4A 2AZAA 3IE9A 3HEIB 1E67A 3AG3B 3NSCA 1ETJA 1CC3A 5I6NA 1JXDA 3PAZA 2X87A 3FPXA 5ANHA 5I6LA 1N68A 3CVCA 1X9UA 1IBYA 2X88A 1RZQA 1CYXA 1MDAA 4YSTA 5B1JC 2H3XC 1AOZA 3T6ZA 4G70B 3KW8A 1GW0A 2HRGA 3PAUA 4P5RA 1SJMA 2BP8B 4HCFA 1NINA 5I6PA 2VN3A 2AANA 3TBBA 1KDJA 1IC0A 3FT0A 1GS7A 4YVUA 1KV7A 4DP6X 1OCOB 5D4JA 3BQVA 2P80A 4DP9X 3T6WA 1BXAA 1OV8A 2Y1AA 4AZUA 4PCYA 5I5MA 4N4YB 1BQ5A 3FU9A 4BXSV 4X4KA 3N2JA 3FYIB 1ADWA 4NB7A 3CVDA 4YSSA 5AZUA 1CUOA 5I6MA 3QJRB 1E5YA 3EHBB 3G5WA 1NIBA 3JT2A 7PAZA 1PY0A 4E9YA 1JERA 2QDWA 2GSMB 1NWPA 2IDQA 3NP4A 1JXFA 1BYOA 4YSUA 2CAKA 2GC7C 4W1TA 1WA2X 3T6VA 3FSZA 3OMNB 1GS8A 4YSPA 1L9PA 3FU7A 3S3DB 3DIVA 3T6XA 1WS7A 2XYBA 2TSBA 4HIPA 1ID2A 3AY2A 3S8FB 1L9SA 1BEXA 2JFCA 3S8GB 2XLLA 5B1JA 1OCZB 4BWWA 1J9RA 1AS7A 1R1CA 3AW5A 3TU6A 3X1FA 4YSAA 2VW7A 4JKNA 4YSEA 3PXLA 1OCRB 3NYKA 4M3HA 4DP5X 1A4AA 2BWIA 1NTDA 2WO3B 5IY5B 1TEGA 4JHUA 3TASA 2FTAA 4CSZA 5I6OA 3OD3A 1NDTA 1PLBA 2PLTA 2FJSA 5AKRA 5I6KA 2YAEA 3UAAA 4DP7X 4M4RB 2ZXWB 3IBOA 5EHFA 4CSPA 3FQ1A 3WI9A 1JZHA 2DV6A 1NIEA 4ENZA 4KO6A 1WA1X 3KW7A 1V10A 2W8CA 4P5SA 4DPBX 1PZAA 4L0PB 2ZOOA 1ZIAA 1AZNA 4HZ1A 1TKWA 3ZIYA 3NJFA 3UADA 1JVLA 3S3BB 1AR1B 1YLBB 1M56B 1PAZA 1WA0X 4E9TA 1SNRA 2BP8A 2OCCB 1MZZA 2QT6A 3C75A 2XWZA 4KO5A 1KCWA 2EINB 1KGYE 4PAZA 1OOWA 3ERXA 2FQGA 4UF7C 2DWSA 3SBPA 2ZWNA 8PAZA 4GP8B 2FT6A 1W6WA 3H4FA 3H4HA 3QJQB 3UACA 3FSVA 1W8EA 3WG7B 2MTAA 4A2EA 3FQ2A 1AG0A 3NJHA 5TK4A 3T9WA 2GC4C 2UX7A 2I7SA 4UAHA 1PZBA 1ASOA 4GP5B 2R7EB 1ASPA 3CDZA 4E9WA 2PPCA 2J55A 3PAVA 1T5KA 2EIJB 2I85A 2YAQA 5PAZA 2NRDA 3WKQA 2EIMB 1NPNA 5TK2A 3X1NA 1N70A 2CCWA 4GXFA 4ZK8A 3QQXA 2HZHA 2YXVA 2GI0A 1AZBA 2IWFA 2YXWA 1JZEA 3NJIA 1SDDB 1M57B 2PPEA 3S3CB 4A2GA 2XX1A 2XVBA 4QLWA 2PP7A 2FQEA 2B3IA 4A66A 4HCGA 2PPFA 3X1GA 1AS6A 2IH8A 4GYBA 2FNWA 2BW5A 3AG1B 3QJVB 2A3TA 2YAMA 4DP4X 2VMJA 2IDFA 1PNCA 2HLEB 1AQ8A 1FFTB 1FWXA 1L9TA 2FT8A 1AANA 1ILUA 1KYAA 1ZIBA 3PPSA 4QKTA 3SQRA 6PAZA 2BW4A 3V9CA 1NIFA 4BWTA 4DPAX 1PLCA 1JZFA 3NSDA 1OCCB 1DYZA 4N8UA 3NSFA 1GR7A 1GSKA 1UATA 2J56A 1PF3A 2I7OA 2EIKB 5PCYA 1JOIA 7PCYA 1KCBA 4DP0X 1OE3A 2EILB 3CG8A 4YSOA 1A3ZA 1PMYA 2R7EA 1TU2A 3MX0B 1IUZA 2IDUA 3FSAA 3NJGA 1V55B 2E86A 3X1BA 1AZCA 1XB8A 1J9TA 3X2QB 1WAEA 3FU7B 3NSYA 3UGEA 5I5JA 2LLNA 2Y69B 2W88A 3NJMA 4F2EA 1RCYA 1BQKA 1KBWA 5AFAA 1DZ0A 1NPJA 2PP9A 4HHWA 4FAAB 2PCYA 2UXVA 2JKWA 3BVDB 2XV2A 1J5CA 4KO7A 1F56A 2BZCA 2CALA 5B1AB 2DWTA 2GB2A 2DY2A 4KNSA 3UABA 9PCYA 3DTUB 3FQYA 4A68A 4YSDA 2XX0A 3TBCA 1QHQA 1AIZA 5F7BA 5I28A 1IKOP 1J5DA 2RACA 1BAWA 2HX9A 3T71A 3V9EA 1KBVA 2VW4A 4BWUA 5B1BB 3WIAA 1CURA 1MZYA 4RH4A 1NICA 4G7RB 4KOBA 2UX6A 4AI7A 3FSWA 4BK5C 1M9WA 3AG2B 1PCSA 1MG2C 2AVFA 4UANA 1NIAA 1JVOA 1J9SA 2UXTA 4BDVB 3ASNB 1PZCA 1JZJA 1MG3C 1E30A 2VM4A 3ABKB 2YQBA 4HALA 2IWKA 3ZBMA 1SF5A 1A65A 4A2FA 2IDSA 5I5IA 3EH5B 2JXMA 3AZUA 4G72B 4NAJA 4G7SB 2P80D 2HX8A 2CUAA 2YAHA 1XB6A 1PLAA 3MBWB 4HCIA 3L45A 2IAAC 3SBRA 3FS9A 2J5WA 2Q9OA 3EH4B 3JTBA 3NT0A 4E9SA 2GBAA 2IH9A 4KNTA 4MFHA 3WKPA 1A8ZA 4E9RA 2BHFA 1PNDA 2H5UA 3UAEA 4TXVB 1SDDA 1HAWA 1A4BA 1W6LA 2CBPA 1AAJA 2ZONA 1ASQA 3GDCA 5I26A 3NJKA 4DP2X 2XXGA 1WS8A 3CZUB 3CDZB 1KDIA 1XB3A 2IDTA 5B3SB 1ET7A 3H56A 1GY1A 2WO2B 3X1EA 4E9VA 1A4CA 5B1KA 5B7EA 4WTQA 1ZDQA 3IEAA 3PCYA 1E65A 3PLYA 4HHGA 4G7QB 4AKOA 4AX3A 4BDVA 5A7EA 3NJNA 4Q8BA 4HAKA 5F7AA 2YAPA 5E9NA 1CYWA 3CVBA 3IN2A 4A2DA 3OQRA 1X9RA 2OV0A 3OM3B 4AKQA 1BXUA 3ABMB 2QDVA 3DKHA 1IBZA 2HRHA 3NP3A 3IN0A 2FT7A 1ZDSA 3EH3B 2B08A 2XUWA 4KO9A 2AZUA 2VM3A 1ZV2A 4AKPA 1QNIA 1GYCA 1ET5A 1SHWA 4G71B 4EF3A 2QPEB 2PPDA 1JXGA 2N0MA 1NZRA 3NJLA 3ABGA 1VLXA 2PPAA 2TSAA 1EZLA 5B7MA 2GHZA 4WKXA 5D4IA 1RZPA 3NJJA 1AG6A 2QPDB 3FPYA 4A2HA 6PCYA 2CJ3A 1TEFA 2BP0A 2Q5BA 3ZX1A 4E9XA 3U25A 4BXVA 1XMEB 4W9ZA 4YSQA 2UXGA 2HXAA 3ZDWA 2FQDA 1SHXA 1BXVA 4KOCA 2YAOA 2UXFA 1L9QA 2WSDA 2OJ1A 5B7FA 2XU9A 3AG4B 2XXFA 1ILSA 1RKRA 1HFUA 2YARA 2BWDA 2FWLB 4DP1X 2FQFA 1BYPA 2DYRB 3HB3B 2VSMB 1EHKB 3GYRA 4Q89A 3QJSB 2BP0B 2H47C 2XV0A 5FC9A 3WNIA 2DYSB 3OMAB 2YAFA 5LDUA 3FYEB 3D12B 1GY2A 3RYMA 1GS6X 1AZRA 1FA4A 3WNJA 1SFHA 4YSCA 3GXUB 2PCFA 5D4HA 4FA7B 2XV3A 3QPKA 3TA4D 4F7KA 3FU8A 2VW6A 1OE1A 3OMIB 2BZ7A 4E9QA 1AS8A 4F2FA 4YL4A 2PP8A 4JHVA 3SBQA 1B3IA 1NWOA 4GP4B 1SFDA 2BO0A 1HAUA 1L9OA 3QJTB 1L9RA 1AACA 1OF0A 3QJUB 2J57A
chains in the Genus database with same CATH superfamily
1XGUA 1FUNA 2A4EA 4PJHA 4UZGA 2HX7A 2Z8RA 2C8NA 2DIJA 5TTRA 5IVXB 1CLCA 2YPVL 4PWFA 3RKDC 5HJ3B 1NIDA 4WFED 3N0AA 3NGBB 3FTSA 3P9MA 4HUCA 2ZF9A 4D7PA 1AY1L 5BZZA 8CGTA 4HIHA 2GAZA 1RJYA 4AEEA 4MS6A 2V3EA 4YVNA 1UENA 1DQVA 3U4EA 3G04A 5ISZB 3PAZA 5DJCB 2JKTM 1IM9B 1J12A 2DM2A 4JPIB 1E4XH 3BAEL 4U7KA 2G9HA 3I6SA 3S36L 2R2BB 4B9KC 4GXVL 1LM8V 1OM3H 4N2DA 4FEIA 3D07A 3W0WE 4JR9L 2H9GB 3B9KC 2Q8BH 4D0DB 2BC4A 2BP8B 1CFMA 4H88H 3QS3A 5EU5A 2Y2TA 1AKJB 3C9NA 2HLFC 3NFNB 4KMQA 3HPJA 2BDNL 4AIXA 2XBZA 4P49A 3UTZB 5D1XE 4JQXC 3ORJA 5LXGH 3ZTNH 4KVCL 5CZVL 3PWPA 4CNIA 1FZOB 1KXTB 1ORSB 1S9XB 2WIMA 3QO0B 4YGVB 3OWRA 3LHAA 3VMPA 3BT2L 4XN4A 3E38A 4MD0A 2ADFH 4I9WD 1X5HA 3PQYA 4PWIA 1EO8L 1I8KA 1VERA 3GMQA 1TNMA 4QXTB 4MMZC 2J1YA 2IALB 4KJQC 3SKMA 1LE9A 3LQZA 3IDXL 2KBGA 1QSEB 1RHFA 1DJWA 4JG9A 4IKKA 2GBUA 2R15A 4ZMLA 3LNFA 4DT2A 1N5AA 4PJDE 2P5ED 1HH6B 3VXQB 1MY5A 5IQLA 1FNGA 3LXAA 4W9LC 4YHYB 2R1WA 5EZOL 1RK0B 2VL5A 3GS7A 3EZJB 1WS7A 4X6DB 3D18A 1CPUA 4ZTPH 2Y6SC 1XIWD 1FH5H 3QK0A 4LAJH 3SGEH 4M56A 2E7DA 1MCOH 5DZOA 3QYCA 5J57B 2P7TB 1QI3A 3SDAD 4FNLL 3N42B 2FSDA 4NZ8A 1S7VB 1TZIB 4TLSA 1OB1A 5I1KL 25C8H 4MA1B 5AUMB 1QPKA 1J0HA 1EDQA 4K9EL 5AG9A 4NZRH 2VC2B 4PJ8B 1NDTA 3B5TA 4PJGB 3ULUD 1CR9H 2LE9A 5AKRA 5F1IA 4N0UB 3U79A 3PIQA 4GAAA 1TZAA 5E9DE 3QNXB 5JPMC 5IF0A 4M4RB 1R46A 4TUOA 1VGKB 3NBNA 3WSQL 3STBA 3N0PB 5IWLC 1ZANL 3U9PH 3D9AH 3DX4A 4NN7C 2ZOTA 4L0ZA 2AEQL 1C7TA 4A2LA 2AQTA 2FH8A 4MCZA 3LIZH 3QG7L 1WAAE 2NYZA 4Y9GA 4HGWA 3HPJB 4Q9RL 5J11C 1AHWC 4X5WA 4FTVD 3B2XA 4HUXA 1SY6L 1NFDE 1IGFL 1I8MB 1KCWA 3ZSSA 4F37K 1ZVHA 3M46A 4PJEB 5EULV 2CQVA 2WINA 2BHZA 3MRHB 4KRNA 3G08A 4DETA 4AYGA 1Y1DA 2UZIL 4OCWL 4CC4A 5L7XH 2FJGB 3GSUA 5ESQB 4AVHA 3H4FA 3HIZA 5F2FA 1UCTA 3TP4A 4YNYB 4A2EA 3I50H 2EIDA 4OZHF 1EZVX 1LNUB 2G5UA 2NXZB 3AXLB 4B41A 3AMLA 4BKTC 4Z1PA 1BOYA 4ONOA 3CQQA 4LF3B 2CO7A 2R7EB 3KDMA 1KIRA 4G5ZL 2KQNA 1R5WA 4LSTL 3OKMB 2DQCH 4GLRI 3UTPD 3WL9B 2Z7YA 1INQA 5D5ME 5DJ2A 3WJMA 4BQCA 4XOBA 1QPPA 2WV3A 2XRAH 3MNDA 3K8KA 2N0KA 3HC2A 4HPYL 3QWRA 3APFA 1H8NA 3LQMA 2NNFA 4CSTA 2R2HB 3DGCR 1SDDB 4JR9H 1KCKA 5JLZB 2UUDH 1OWRM 1MFDH 4NKMB 3SJVA 3R0NA 2OJEB 4Z8FH 3D0AA 3PU7A 2YUWA 3KEDA 3F5WB 4P4KB 4X4ZA 4B5ZA 3KR3L 3NIGF 5D9SB 2WXOA 5ALBL 1D7BA 3O2VL 2UZXB 3GSQA 3F7KA 4JJHA 3QJVB 4QGTA 3TA3C 3HE6D 3BT2H 2EC9T 1BSIA 1GC1H 4NWTH 4W4OA 4U1LB 4XNZB 1C16A 3MACL 3TCLB 2OMBA 1FGNL 4P4RA 2AF2A 2Z35A 1FNLA 4BFNA 1NDMA 3ML9A 4QOKA 1N6QL 5AVRB 4R7DA 1KB3A 5DJAA 3W56A 1YEJL 1SLVA 4I3GA 4AM0Q 4F7TB 3D06A 4P06A 5CP3A 4D94A 3QUKA 3EJRA 3CVIH 4NLHA 2D4FA 4UIKH 4XTRD 4Z7UB 5D96B 1KT2B 3C08L 1OTUD 4MMXC 1IO4C 1YUKB 4FKKA 1LILA 4P9HH 5AOJA 1USZA 5IW3A 1V27A 3EJCA 1MVUA 1TU2A 4EZLA 3B1TA 2MKWA 2ZYSA 4A6YH 5F8QC 2UWEB 4QT5B 1HWWA 1LO0H 4MXVF 2CJSA 3MTXA 5C97A 4G6JL 2BS9A 2Y69B 2YA1A 2VRKA 2ZZUT 1MJ7L 3ZKXC 1KG0A 1KCVL 3HS0A 1E28B 4HC1A 5DJ8A 3RVUD 2NSXA 5JHDE 1DLHB 1WV7T 2W60A 3FUDA 2JJTC 2XWRA 3BVDB 4AK2A 3KS0J 2RGSA 1R4XA 2DJ4A 2JJUA 3FU0A 3MKKA 4UTBA 3SKNB 2J2ZA 4GRWF 4JPQA 2HKAA 2JQZA 3AY4A 3F6LA 5DRWA 3TS8A 2IAND 3KXFE 1T7WA 5F7WC 5IQ9A 2CLRA 3Q1SL 4F7EB 1D5IH 5DQDL 1GPOH 4UYPA 1FO0H 4JFWA 5C0AB 4LOFA 1F11A 4K4KA 5TFSL 3DA0A 1IKNC 5TDPB 2QKSA 2EUZA 3D4YA 3MFGB 4U1SA 1F3JA 2K70A 4JZJA 1NC4D 3STLA 3QQDA 4P5TA 4UQIM 4WEBH 4UTBH 4YDVB 2WCPA 3WGVB 4DVRH 2C4XA 5KYXA 3FSWA 4ZFOL 1M9WA 4GRWE 1O6TA 1XSOA 4P8QA 3QXVA 3A6CL 5DZLA 3CLWA 2ETWA 1NAMB 4HEPG 4NKDB 5B3JF 4GAYA 1XGRA 4MS8D 3UPAA 1TUPA 2BZDA 2J25A 3MQIA 3O8XC 4P4RB 3MV9A 2W65A 2MOQA 1A65A 1TVHA 2VZ3A 3PF2A 3KPRE 4ADGA 5J9PA 3BT0A 4JB9L 4F1ZA 1YJDC 1MCBA 2HT3D 4BSWA 4PRHE 5DYOB 2R0WH 3Q2WA 1WBZB 4U0QB 4PWHA 1RIVL 2Q10A 3T3MF 4L4TD 3AU1B 1DCLA 3AWFA 1BREA 4LPWA 1K4DA 4FLQA 2Y7QA 5DT1H 3MODL 4WGKA 3ZYJA 3MUY1 1CTMA 1T0MA 1A3RL 4WFHD 2PXYC 3DLQR 1IGFH 3QRGL 3PL6D 2QGCA 5IREA 2Z31C 4TXVB 2EAEA 3JTSB 4M7ZC 4FQ1H 2CRZA 3IFNL 1EZVY 2ZX9A 2HP4A 4DP2X 1BG9A 2NW3A 2OX5B 2VDPL 3DXAB 3OZ9H 4CMHC 4O2CB 4HWZB 3CFMA 3RY6C 1XB3A 5FPIA 5EO9B 2JIXD 1T1XB 5F9OL 4JN1H 1CG9B 5TQ0H 4Q9QH 3NCEB 1NFKA 4LP8A 3U4BL 4AZ8A 5JA9A 1F18A 3B8SA 1U8QB 4NQDA 2FGZA 5I16B 5TF1L 4HMDA 3WD5H 3GK8H 2XTJC 1JF1A 4AKOA 4MNQA 1SJEB 3BISA 3L9BA 3NIFE 3GBNL 4Q8BA 3FQXB 2WKLA 3VG9C 3B2DC 1FIGH 1J86A 1JCVA 4KKQA 1YDPB 3SOTA 5T1JA 1Q1JL 3IN2A 2WLHA 4PW3A 1MAMH 1QASA 5G55A 1JDAA 1I7RA 1T4KB 2QDVA 1T20B 3IMRA 1P4BH 4JZJB 2GCYB 2FH6A 3SPIA 4TOYH 3V4LA 3QI9C 4K15A 1NCHA 5EBMB 1SXNA 3MNVA 1KACB 5MEND 2Q7NA 1E50A 1QSZA 1E3FA 3PDDA 5F21B 3FCUB 1VB9A 1V3JA 3P4NA 1VGKA 2ED8A 3NJLA 4XOEA 4OB5L 4PWKA 3HBQA 1PQZB 5H94A 4Q0XH 2XA3A 2OKMA 3QCVH 3RIFK 2DBLL 4NO2A 2JQAA 5F7KC 1JNHA 1S9VA 1DJYA 4IOFC 4Y9BA 1SBSH 4X8CA 3TGXA 3VI4B 4DO4A 1RZPA 2E27H 4P2QA 1KPVB 2I5YL 1C9SA 3DPBB 1FNFA 3MCKB 4Y5XA 2ENQA 4PJDF 2WTPA 4H13C 1QTYT 1RZ7L 2O5XH 4UBDC 5CEYA 2HTKD 4N5ED 4RRPM 5HHNA 3E6FB 1JFQH 3EYFA 1IBDA 4ESKA 1OGAD 5FA3A 2OJ1A 5T1MA 3I3EA 2O61A 2BP3A 2RB8A 1HHHA 3GM0A 4KWUA 2YARA 2BWDA 3MPCA 2FJFB 4LAQL 3DXAA 1B2WL 2YEZB 3L1EA 2UY6B 5DHVB 1DVFA 4FYQA 1NKOA 1U3HC 2NXZC 3CH1A 1EK3A 3OMAB 4JE0A 3NK4A 1LLAA 4L8SA 1B9KA 4YHPA 5D6DC 2FYYB 3R4DA 4GT7A 1FVCA 1H3PH 4QRPE 2YGQA 4R3SA 5DJDB 1MKFA 3BIKB 2UZYA 4HJGA 4XNQA 1AKJD 3VB9A 1J5HA 4Z7QB 4FLSA 1K8DB 2E56A 2XQYG 2VR7A 5E2WH 3FT3A 5IQNA 3CUPB 1OP3K 2AJ3A 3HS8A 4O9HH 5I1JH 5I1EL 4OZIB 5ID1A 3L7FA 1MXGA 1U3HB 4JFDE 3SBQA 2BNQE 4KGJA 4Z7IA 2X6VA 4KK5D 5A2AA 4PRBB 4Z7UE 1Q0YL 1SVZA 4TUJA 4LSQL 4PRPB 3FTUA 1PW3A 1A1MB 4PJAB 3N5AA 3CZGA 4NO0A 1DE4A 2R56H 1REIA 3SPJA 3KL5A 3LH2H 3S37X 3EFDH 4E36A 4IRJB 4HK0B 4FG6C 4K9JA 3QI9D 1QFUH 3HI1A 3R0MA 3QPXL 4XVUD 5FM4A 3AQYA 1R9FA 1M9SA 4YSRA 1IAOB 5I1GL 2ENPA 1QWUA 1RVFL 3S4SG 4KY1H 4EI5C 3MLSL 3L9RB 3N85L 5BQDA 3UG5A 3WLBB 1HYSC 3DROA 3GJFK 4DPCX 1ONQA 4PD4J 2NTSP 5I15H 2WXPA 1DBMH 1Q72L 3LD8C 3PWVB 3B2VH 4HEPA 4ZD3L 5BRQA 4JM0A 5JQ6H 1JDCA 4NZUH 5F6IB 1EHLH 1U3HA 1CWVA 5KZCD 1JWSA 2JQMA 5AVWB 1WFIA 4BCYA 5CD5D 4UBDD 4NT6A 4FI6A 5F3FA 4MS8C 3WIIL 1CE1H 2WW8A 2AAAA 4ZW7A 2D0FA 3GDBA 4P2OC 2H3XC 3GKZA 3O3UN 5I8KL 2ICES 2AMGA 1IKNA 1A6ZA 3QDGE 4ZQKB 4XBEL 2ATPB 3M88A 1SJMA 4WI7A 4ODXA 4WUKL 1CK0H 4H8WH 5BO0D 3EUDA 1BJ8A 2UY6A 3ARDC 4KDTA 1O7SA 5EORH 2ZKHL 4Y5XC 5LHDA 1A6VL 4P9HC 3V4VH 4DFHA 4DP6X 4XWOD 5CXPA 3KGSA 1TJMA 2VN4A 3T6WA 3D25B 2Y1AA 4IKIA 3VFSA 4I48A 1UWGL 4GFTB 4U3SA 4NLAA 4B9FA 1W0WB 4V11A 2H26B 1U2CA 5I1DA 5AZUA 1CUOA 1LO5B 3UCRA 4K7FA 2VN6A 3DURA 3ARBC 3EO1A 3FT2A 4E9YA 3Q8FA 1DO5A 3L3GA 1RFDH 4BUQA 1TTAA 4DFIA 2E7MA 3PWUA 2WLMA 2WWKO 5HYJD 3IJSA 4I3SH 1LO3L 4HKXB 5F3HA 1I7TA 4WNSA 4JAMA 2X1OA 2D7OA 3FSZA 3GB7A 1E4XL 3BAEH 3TNMB 3OKDA 1L9PA 4AQAB 2XPGB 3BJ91 2HT4D 4YE0A 1LMKA 1JPTH 2YZ1A 3HC4H 3LS4L 4XBGB 4ADIA 4P2OA 5GZND 1P1ZA 3KBPA 1OAKL 1RULH 2NDGA 3X1FA 5JXAH 3MBED 3M07A 4OD1H 4PWJA 5L2KD 2BDNH 4Q52A 3RB7A 4M7LT 1CN4A 5E08H 1OAUH 1PSKL 2YD5A 3EOTH 2BWIA 3G6JB 4UQAA 5F7DA 3U9UB 1JRHH 2GJ6E 3MLZL 3TASA 1NC2A 3X11B 5I6OA 2VE6A 4GRLD 3WNMA 4L8DB 3II2A 3QFDB 3L5WA 1NC4A 5CILL 4AUUA 3CLEH 4RLDA 3KYOA 4OFDA 3DJ9A 5EHFA 3TN0A 3GMPA 2CUIA 1XAUA 3FQ1A 1HOCA 2PNDA 3V0DA 5A16A 4LKCA 4U1LA 1GMIA 4A39A 4JQIA 4ICWA 3WFDL 1X6NA 1ZANH 4PGEB 5IROD 1E8ZA 1ZIAA 3IMUA 3HNSH 4JKKA 3WTVA 3C6SB 2D7TH 4OIBA 5LN8A 3MV9D 5FXCH 2XKNB 4OI9A 1JVLA 3HG4A 2V2TB 1D6EB 1K2DB 4MX7B 3CFDB 1HIML 4E9TA 5D70L 1MZZA 3CN0A 3DVIA 1EV2E 4B60A 1T7ZA 5E6SB 2D3JA 3O8XA 5FYKD 2D8KA 2F08A 4JPKL 1ZKAA 32C2A 2AJUH 3H4HA 1KELH 5EO1B 3SDCA 4A7VA 3CVHA 5IHLB 2HPTA 1GAFL 1T66D 5IMOB 5I1CL 2FL5A 3LB6C 5LVEA 25C8L 3MJ7B 3PE9A 3RGVC 4Z5RB 1HL8A 5F3BA 1PZBA 5JQ6L 1HEZB 1F42A 4O5LH 1P4LB 2Z91B 4MB5A 1DSYA 3N50A 4FQ2L 1A47A 4N90E 4Y5YA 3KXFB 5H35A 2NXYB 1FL6A 5EC2A 4JVUA 3ZZQA 1SLWA 5LGJB 4TSCH 4Z7NB 4OIAA 3KH3A 3NJIA 4W4NA 1ZVSB 5LXVA 4HK3J 1YNTA 2WTRB 3WTTA 5HI5C 2QQKL 3DGGA 5JHBA 3A6BH 1R3HB 1UFGA 2YMTA 1E4WH 1ITBB 5I73C 3IMSA 2X1XR 3G6JE 3G3LA 4UILL 2DRUA 4KGLA 4C8XA 2QV2A 2IJ0C 5EFIB 4U1MA 4JLRB 2Q7YB 4LDEB 1CR9L 2EXTA 4RFEA 1FNSH 2DLGA 1T83C 4L3EA 1IJNA 4MNGE 4U1NB 5JIDA 2J12B 5FECB 1IC7H 4FP8H 1UVQB 2HPOA 1D2OA 2VR9A 3FRPB 4IRSA 4NQSB 3SQRA 3KPOA 3UC0H 4AJVA 4EQ2A 1PD0A 3L5HA 2R9HD 3ZQWA 1G7MB 2L4OA 3MO1B 4MD4A 3MFFA 5IW6A 1BAFL 3LZNA 5DLMH 1Y6KR 5DS1A 2Q3AA 3V5DB 5KSBE 3WDIA 5EOCJ 5PCYA 1TTCA 1INEH 1WDAA 3ZKMD 4QYAA 5KSVB 1XCQB 5CZRA 4ZW5A 1DQMH 4ZPVB 2P4AB 5EA0H 3VXTB 3ECQA 4U1GB 3MRNB 4AQOA 3IDGB 1NFAA 2RH0A 4GMSH 1XAKA 3FB6B 4DK5A 2AXGA 4ZX6A 3S3PA 5DS2A 3RU8H 2P28B 1IQWH 4HBQA 3VDCA 3UGEA 2CDEA 3AB0C 1MFAL 2CJUH 1IC1A 1JN6B 3VQ1C 3EFFA 4R90L 3EJZC 1OQOA 3MNWA 2PCYA 2BJMH 2XV2A 2YXMA 4JFOB 5FDWB 4KO7A 2BZCA 2IH1A 3R19A 4LP4A 3VD7A 1TCRA 3EIFA 5J1SC 4PJ5E 4DTGH 3JSSA 5C07B 2IALA 4ODHL 4W9KC 1RZIB 4BFJA 2FX8H 4KJPC 4R5VA 3QUMB 4HVBA 5TE6H 2AJZA 3ULVE 2NDFA 2B20A 1A3QA 4GSDL 1J5DA 3A5VA 3BQUB 1CXLA 4Y2OB 2PYFB 2OTUB 3CVIL 3MJ9A 3VJ6B 5FKAA 4JFEE 3ARVA 1IQDA 4ONFH 1D5RA 1L4IA 4NN7B 2EEAA 2I07B 4QF1B 4WHDA 1ZTXH 3KVDD 1RUPL 2Y6SD 4B9PA 1PG7W 1T21B 3L6FB 4UDTB 4PJ7E 3UPCA 5HHOA 1NFDB 1FP5A 4RNRB 1IC5L 2CKBB 4M4PA 5K5YA 4NN6B 2EC9U 3QQDB 1DQTA 2XHNA 6CGTA 4GUPB 3ABKB 1T6BX 4K8RL 2V5TA 1NGZB 3NABH 2XY2A 4NO0D 1FE8H 2JIXA 3VWKB 3VXSA 4JM4L 1MHPL 5IV2A 1IEBB 1JV2B 1IGYB 4PTTA 1RU9L 3U0TA 5IIEB 2HFEA 5HGHA 3IFOB 1ZT7B 5IB3B 4X6BA 4XGZB 3QIUA 2IH9A 5T3XH 4WF7A 3Q05A 5DEFA 4DNLA 1AZVA 1MFUA 3LH9A 3OQ3B 5IWLA 2EYSA 2NY7L 3CFEB 1NANH 5CEZH 3KLHD 5FCUL 1I1YA 2IG2H 4IHBA 3GIVB 4WK0B 2VERN 3T8MA 3CHOA 1BQUA 2W1NA 3QNZA 3UAJC 4TV3A 2OI9B 4HJIA 1KB9K 3FONB 4FGMA 1W0VB 4NJ9H 5G5DB 3CZUB 5H2BA 2WLIA 1FNEB 5HPMB 3W57A 4M62H 3FF8A 4WI0A 4NZTL 1IGIH 4JRXB 1WIUA 3UZVA 5HYQA 2BWQA 4RMUA 2X10A 5DRZA 3LQAL 4OD3L 1CL7H 1XDTT 4P46D 2A38A 5E94A 1JPSH 1WC7A 3MHZA 4PJCE 2VQ1B 4HHGA 3UJIH 4U1JB 3L9EA 4JREB 3EJYD 3MRDA 1UYWL 5LCVA 1IAKA 3NA9H 1KPRA 2GI7A 3NCXA 5GSVA 3GLEA 1XR9A 5BCAA 1B88A 4DUXA 2BSCA 2DJSA 4EIGB 5I0VA 2B2XH 2HKHH 4BBWA 4A2MA 5MI0C 5D6CB 1DP0A 4WTZA 4MXQD 5FS5A 1ZY9A 3LPGA 1MLBA 3T5WA 3RVTC 1TU2B 4HT1L 4WIQA 2R0ZL 1F86A 2PPDA 1JXGA 3BP6B 3HKZA 1F00I 1E9OA 4MMZA 2G2RA 5C0BE 4PRPD 3HLAB 2ARWA 4HMEA 3IDNB 5LG6A 1YN7A 3OKLA 5LNGA 5EPMB 3QZMA 4QRRE 3NJJA 4TKWA 5D7JD 1HINH 3FOLA 3PJLA 4PJ8D 4FFZH 3L3JA 3OXRB 3RGVD 2BP0A 5D7KD 1FHNA 2JK5B 2V37A 4W6WB 5F88B 4OJAA 5TQ2H 4RGND 3UO1H 3WKNA 2ZE0A 3LHPL 2E6QA 2UXGA 3VG9B 1AHMA 2GSIB 2K78A 1NUNB 3HMXA 3BHBA 1TMCB 4QXWA 4B7LA 4MA3B 4G11A 5JPMA 2P8MA 3BUIA 3KJ6H 3VXTA 4HBCH 1G7JA 2GK0B 4UV4L 1RIHH 1E5UI 3ESVF 4JNXA 2GTWB 1MFNA 3PWPB 3WUZA 1H9VA 5EDXA 5DD1H 1TFHA 3DGDA 5BOPA 2R29A 2FQFA 4DGYL 1G94A 3KGRA 3VI4E 5BZDA 1MAJA 2H47C 3W5NA 2EDJA 3QORA 4EZKA 5CO1A 3MZTA 1F0LA 4QRRD 5F0PB 2EDWA 5CLZA 4FFYL 3WNJA 4AENB 2VR8A 1JD9A 3GXUB 3L3KB 5D4HA 2E59A 4AM0B 1FZKB 1QI5A 3UL4A 1JYVA 4F7KA 1D9KB 1CFVL 4WZ9A 5JXEA 5IFHH 1AS8A 1QLEH 3P77B 5MEPB 2X3BA 2X6MA 1B3IA 3BYYA 4LEXH 4ZO9A 1SFDA 3K3QA 2V2WB 3F01A 5E6RB 1QLRA 4MAYC 3S37L 1BGXH 1DQLH 3EBGA 1T0NA 4X4YB 5IJBC 4WI9A 1DSWA 3WS3B 7TAAA 3VFWB 3BPCB 1URZA 4TMPA 1AZUA 3BP4B 5FYJH 5GZNC 4U1HA 1C5CL 3BWSA 2NNXA 4NHCH 1ZPUA 3BGFB 4GBXC 1YVLA 2C3WA 4FG0A 4ANUA 3LRKA 1BIIB 2ZWLT 3N1MC 1HI6A 1S78C 1CT8B 2Y2WA 1P4LA 1URIA 3EO0A 3I02A 4M3KB 4XBGA 1EAPA 2FBRA 2HJKB 3MXWH 2Z8VC 3L17A 2WLKA 4JM2C 3AQZA 3AG3B 4JKPH 4X7SL 5DHYA 1CC3A 2IIJA 4JS7A 3SEPA 5EN2A 4AEHH 4OW6A 4RQQA 2R9HC 1N68A 1F4WH 4AL8H 3QZWA 3H9HB 2EYRA 4X42A 5I17A 1FNGB 1CL7I 2FSEA 2ZF8A 3D85A 2WOBA 3DYPA 1DCEA 3CVHH 5A6IA 5I82A 2BOBB 2YRBA 1NUGA 3EJQA 4HS6B 5JPNC 2QKIC 2N4IA 4LARH 2VN3A 1LD9B 4K5NA 1Q0EA 3EYUH 4EKJA 3TBBA 1Q0XL 4PVLA 2AEWA 3IK2A 5JHDB 4YVUA 3DHUA 3ZT5A 1HEJC 3BPOC 4X9IA 4XP4H 1N3NA 1KGXA 1GTFA 2ZKHH 4OZHA 1KLFB 4PSPA 5GGTL 3PJSA 4S11A 1TVBA 1XBDA 2BSTA 2UWEE 4FNRA 4NM8L 5F89A 5ADPL 4URKA 2DQFA 1XZWA 3R06A 5E6ZA 1BQ5A 4C57C 1D7CA 4RDQF 1G43A 3FYIB 1XCTB 3QG6A 2ZTBA 4ORZC 3BKYL 1DUYA 2X4TB 2FO1A 1WIOA 1PY0A 3O4OC 2IOIA 4FZ8H 1CD1A 2C9AA 1O9ZA 5E6UB 3WN5C 1M05A 3IFLH 1U6AL 2GTZB 3ARQA 3S3DB 4EUPB 2C9RA 3LMJH 2Z91A 4HIPA 4LCWB 1YEDA 3RTQC 4R6UA 3LXBA 3DVNB 5H37H 4XPTL 3UJJH 2A9AA 3S8GB 3VXSB 4XPBL 4JAMB 1HXKA 4LCYA 4XR8C 3GB7B 4K3JL 3OF6A 2NR6D 4V2CB 1EHNA 4JKNA 4A37A 3ZGIA 4E9LA 1JUFA 5E6YA 3ABZA 2AMUA 1EX0A 1FCCA 3E8UL 1T2XA 4N1HB 5CR8A 3OD3A 1HZHH 4PJ5B 1V5JA 3CSGA 4IMLB 2PLTA 4YDLB 1SYSB 3CLFL 2WKOA 4XCYB 5CINL 2PYED 3O6LL 1OALA 3RWCB 1JVKA 2HH0L 5EBWB 5FUZH 3TJEH 3LX9A 3ES6A 4IOSA 2OTUA 3CX2A 4H0HB 5KS9F 5GS1A 4M02A 3MRMA 3L7FB 4MA1C 1V10A 1QQDA 3L95B 5F1SA 4BSWB 3VE0A 3G5YA 1CGWA 4JFFA 1FF5A 4JRXA 3RFRA 1EXHA 1MCFA 2YRZA 1Y1UA 3KAAA 4HZ1A 2YA0A 1TKWA 5HDBE 3ULAB 1ZGLA 3QH3B 4H1LG 4WTZG 2MCPH 5SWZA 2WVVA 3T4YA 5CGYC 1NAMA 4OI8A 3S4SB 1GZHA 4LDOB 1HCFX 1PGRB 1VACA 1HSAB 4BZ1H 3LNIA 5D70H 2QPUA 3AROA 3JT0A 2QVFB 4P2RB 3PWLB 1OOWA 5IQ7L 1MFEH 4PJEE 5C3LD 1F1AA 2FT6A 4TULH 4G1MA 1MAKA 4ODUA 2VJ8A 2LU7A 5I1AA 5L4JA 2UV3A 2YWYA 4FQJL 4OCRL 3PWVA 4WHYH 2I7SA 3QEQA 2ESVB 3D2UA 2BNQB 2F54B 1HJCA 4H1LB 4EI5B 3DNKA 4XCFL 1NANI 3QFGA 5C1MB 3FN3A 1KPUA 3K72A 1J0JA 3O3BA 3H0TA 4KJYA 5BV7C 2FIKA 2ZX6A 5DRXB 4IRSD 5D1QA 2A83B 3X1NA 3MRHA 2P8LA 5A3IC 3QQXA 2W0LA 1Z9SA 1C5CH 3BO8B 1OGTA 1JZEA 1A0QH 3GXMA 3U6RA 4AQ8A 4GKSA 4LCIH 5GGUA 4KROC 4LLAA 3ECUA 3S3CB 3MBEC 3WFCL 3SPVB 2ZUWA 4JFSA 4UOJA 3RLSA 4BKSC 4NBXB 2PPFA 3EDJA 2EYTA 4LB8A 2XVLA 1GGYA 4KITB 3DBXB 5C86A 1BD2B 2A3TA 1TFPA 3BDYL 4X7SH 3L2LA 5TH2A 4HSQA 1DEDA 1RPQA 3NZHL 1MH5B 2Y24A 4PCTA 3K2UL 1WP6A 4K71B 4OSUL 4P2OD 5GZNA 1QBML 3FQRB 1FLTX 5CZXD 3IJHA 4XOCA 3DETC 3PPSA 4GG8A 1TTFA 1UZ8B 3SJVB 3GO1H 3MROA 2GITA 3CWGA 3UG3A 2A6IB 4BWTA 5HVWA 2AITA 5HGDA 3FO1A 3N1QC 2BVQB 2EEDA 2P9RA 3QUYA 1S5IL 2AGJH 3ZO0A 1EEYB 5HD8C 1UQSA 1TZIA 2D7TL 3O11B 4HHAB 5IMMA 1RXLA 2IBGA 4ZODA 1J7VR 2ZYHA 1RHHA 3BZ4A 4UMSA 3IRPX 3WLWD 1ZMYA 5KSUB 2EILB 2PW2A 4NQVB 4TRPH 3TCLA 2RAMA 3ILQD 3HZYA 1EUTA 4LMQE 1IUZA 4BRVA 4NC0B 4RGOL 5EO9A 1KCRL 2LR4A 5C0IB 3RUGA 2VL4A 1JGUH 3FTWA 5IF0B 3FU7B 5EF2A 1NKRA 3QJFB 4X9BA 3PV6A 5FYLH 3TJHD 1E43A 5KSVA 3GHPA 5LQBL 5I75C 4K7PL 3QXAB 4AMKH 1N5YH 3NEEA 4RCAA 3QWRD 1R5VB 1DVYA 4GIPD 2CJTA 2WOYA 4UDUB 5CLTA 1IVTA 1CFSA 1U95B 2BLFA 1F56A 1HHKB 1GGTA 1IMHC 3OR7B 3VFPB 4UINL 3DTUB 1MWAL 3ELQA 4KJQD 2OW6A 5DS8A 1P9MC 1PG7L 3J2PA 4V2BA 4L4JA 3DC0A 3RWJB 1MNUL 2XY1A 3TBCA 2IMMA 4QTIH 2E3VA 3VRJA 1I7UB 2QVTA 4O4YH 3IGFA 4OD2B 2E4FA 1NH6A 2A6KA 4K5PA 1TQBC 5IKCA 5D7IE 5DD5H 5C0DA 5FFLA 5M7QA 4D9RD 4M7ZB 2NY4C 1AD9B 2MOGA 1DQML 2GIYA 1BPLB 1U92A 1DBKL 4Y5YC 4M9PA 5DJ0B 2AEPH 3N1GC 5T3ZD 5IQOA 2ZUQC 2EDDA 1A7OH 4IRJD 2H9GA 3QE5A 2F58H 3AC0A 1W72L 5KVGE 1P4IL 1FCGA 4I77H 2B3RA 4CDGC 2FSEB 4BH7A 4EVNB 3OAUL 3AS2A 1MJUL 1TJGL 2I69A 5IGXL 1QSFD 1AD0B 2WXFA 1WZKA 4ZNEA 1F90L 4X5QA 1WT5A 4MNQB 5TDPA 2IDSA 4HGKC 4ZSOA 4DKTA 2NY4B 4GAGH 1UWFA 3FMGH 3FQWB 4WO0A 1XIWA 4N2AA 5GS0C 1PKOA 1WPCA 2CUAA 3C2AL 1XXDC 3SDYH 1X7QB 1PLAA 4PW4A 1D3CA 3O6ML 1E27B 2OMTA 2Y7NA 4ZMWA 4Z77B 4ZX3A 2NCMA 2ZWKA 3E2HB 2PYEE 2V33A 4XPHL 4M4RA 5D2LA 4KFZC 2DIEA 4N20A 4OIIL 4MFHA 2VABA 2DL9A 1CE6A 5F88A 3ECBB 4GMTH 1LWHA 3L13A 4OZGA 4L1BA 4HSCX 4NM4H 2VO5A 2BMKA 4XWGH 2NXYC 3KWUA 1R0AH 2XI9A 2CBPA 5KVDL 3RTQD 5JW3L 3GBLA 2DQGH 1ZT7A 1QNZL 5GZOA 3W38A 2XKNA 4FOMA 3IAGC 4QTFA 3N40F 1KXVA 2BY2A 3LPPA 5CJ8A 4EKXA 1BZ9B 4HGMA 1S9KC 3ZE1B 5B39B 3QNYA 4Y89A 1S7XB 4HJEA 4P2CG 2ED6A 5A43C 5I1AB 2HJLA 5HJBA 2XT1B 3QR1A 4G9DB 1E9PB 3IEAA 2AXFA 1OP5H 1ZLWK 3ZGHA 3BRDA 1A4JB 4P04A 3MRPA 3KPLB 4YN3A 4Q6YA 2EH7L 2O6EA 2ZCHL 3JTSA 4Y4KC 1QI4A 3GO1L 3U30B 4AENA 5KBKA 5D7JA 3DURB 2OYPA 4L29A 1QAWA 1EQWA 3ABMB 3CFQA 1E5AA 3DKHA 2CA4A 5D7EA 3V0FA 1P4BL 2VDOB 2HRHA 3UJTH 3LQZB 3AB0B 1KBGL 3PYCA 3L4UA 4WJG3 1ETZA 4F3FA 3EDKA 2AJVL 3MBXH 4MDIA 1CF8L 3BKCL 2Y5QA 4PJAE 3RDTD 3BXNA 1U42A 2IPTL 4FFTA 4F8QA 4OF5A 3ARXA 3NZHH 4U4IA 5AYUH 4HOZA 3RZWA 2IG2L 1ED3A 5LAXB 1J1PL 1WCBB 1A22B 3CXHK 3TIDA 3ZZ1A 1T2JA 1QSVA 1IT9H 2G0LA 2VCOA 5D4IA 1QR1A 1IFRA 4NJAL 1NL0H 1H3VA 2HVJA 2Y23A 4MJIA 2R4RH 5E2TL 2DB8A 4E9XA 3Q6FA 5K93A 2I60L 4W9ZA 4ZAKB 2APVA 2W07B 4XCCH 1JK8B 3ALWA 5BS0B 4URTB 4P3CH 1DQDH 4DGIH 1U3YA 1YO4A 4HWBA 5FV2A 5H37A 5ITBH 5HGAB 1A7PL 2CIIA 4PJ9B 2VZVA 3AG4B 2A73B 5DYFA 4ONGL 4RGMB 3BH8A 3QHZH 4HIQA 5ENWB 4OT1H 1L7IL 2AK4D 3L3OB 1NGPL 3MV9B 1I3RA 5D71H 4EO5A 1ADQA 3F85A 1OGSA 5HHME 4HUVB 4XTRC 2Z0UA 1SY6H 5KVFH 1JNLH 3BQUC 1Y0LB 2K1MA 4FNTA 1FFNA 4G9FA 4Z0XA 3ZKNC 1KIUA 3RI5F 4PB0L 1N4XH 3O6FB 1AHKA 1E8YA 3MRPB 1UD5A 1E6OH 1BECA 1UA6L 1I7ZA 1UB5A 3OMIB 4LSRH 1ZHKB 2C1PA 1KEML 1IEBA 2VR4A 1K5NA 4YL4A 4BHUI 1OSPH 1T5XA 3TYFB 5IFHL 1XEUA 4HZLA 2HN7A 3IU3A 1CK0L 4H8WL 1U8PB 1J1XH 4XO3A 4AQEB 2DZEA 1S7TB 2D2OA 3QA3B 5AB0A 2JKXA 1CCZA 3QJUB 4OIIH 2BXYA 4LDLB 2ZP8A 2GIMA 3D85D 4IS6B 5EU3A 2CHDA 4L4VD 2ZXCA 4EN3C 5KYWA 4ES9A 1IQDB 5IB2B 4XN2A 5C0GB 1XH3B 4HAFA 4WQOA 1T0PB 2H2PC 4ICXA 5EOTA 2K4WA 1DBML 1GKOA 4ZD3H 1FV1B 1ZT4A 3D18B 4QWWD 5AVYB 4OF8A 1MHCB 4KHXL 3ME0B 5EU4B 4EJ1C 2XN9E 3O45A 2O5ZH 2FGWL 5DZJA 3VXUA 3C5ZA 1ZE3C 5DHXB 7FABL 1EAOA 2OYLA 4JG5A 4KKLC 2VLKD 4TQEL 1C1EL 4F24A 2XICA 1BQSA 5E9DB 1BVKB 4RGNE 3RUGE 4ATWA 3LZPA 4S1QL 1D5IL 1FZJA 4MJIE 4ANXA 4MJ5B 1H8LA 1MI5E 3T6ZA 1JYWA 4J2QA 2WYTA 3CX5J 4MX7A 1JHTB 4MAYB 4J3XA 3UYPB 1I1AC 4OGYL 4EDWL 3RGVA 4ZUVB 4ZOBA 1NINA 4QTHB 4ZMQA 1IIKA 3INUL 2A4ZA 4XRCA 2M8XA 5EOQL 1B0RA 1HCVA 1TTBA 1DLFH 5C0BD 3W3BA 5CJOL 1GS7A 1D5BB 5ANMB 3L5IA 4LVEA 1HXYB 2BSED 5GHWH 4A7UA 4JMNA 3KPRD 3VH8A 2R59A 1KGWA 1R19A 3QRBA 2OP4L 1NQBA 2NMSA 2A9DA 4XPFH 1GW6A 1CLZL 3ESNA 3S7GA 5IW6B 3PIQB 3SE6A 1U58B 1TQWA 5MERA 2N3JA 4BFIA 4P2RD 2N01B 2I9TB 4JPSA 3UMNA 3N3EA 2QEJA 4G59C 4J4PC 2C7FA 1YNKL 1CQYA 2YWZA 4FX5A 4Y9CA 1TQBB 5GS2D 1T7YA 3RPKA 1J0YA 5C07D 1R75A 4FMKA 1JF1B 4MCYA 1RK1B 3QEHA 2WUCH 2A74B 3FU7A 4OGQC 3ZSTA 3DIVA 1MJ8L 2XWXA 2WGXA 2ESVD 3KWXA 2P8MB 4MZIA 3I9GL 5DYOA 4E41A 4GBXD 1A6UL 2IQ9L 5LGYA 1MCEA 1W8OA 3LN4B 4GQQA 5C0GA 4NN5B 1I8LA 2QSVA 4PREB 1KELL 4IKLA 2F53A 1Q0XH 3NJVA 3D3VA 3BGMA 3G08B 3HMWL 4L8CB 1BHGA 2ALAA 1MFCL 1XGPA 1JNLL 4YFLI 1DBJL 2ZP9A 1NBYA 3SDXB 1MLCB 3VFRB 1KJ2L 1YC7A 3MLTA 4WUUB 3RWIB 1NA8A 3PQYB 5EZJA 5AZEL 1CICC 5T5FL 4CSPA 3MRBA 4J3UA 1NBVL 4GUOA 3GBNH 3WIHL 3F7YB 5B3NA 2ARJQ 1UM4L 4AZ8B 3D2UD 3ULUC 2W0FB 3LZOA 5C0CA 4H8UA 1S9YA 3KNBB 3X12A 3UTZA 4DEPB 1PZAA 4K2UH 5SWZE 2CBQA 1RUKL 1S7RA 4N22A 2J5LC 2HFGH 3ZIYA 1Z6JT 3W2DL 2CXKA 2WQUA 3CFCL 1SOQA 3ZU8A 4G8GA 1KJVA 4YHIA 1WZAA 4WW1B 3SD5A 3RGBA 4ZFFB 5D93B 5IVXE 4UV7H 4YDKL 2CR0A 1Q8MA 2VC2L 4MQXC 5I76B 3CK0H 1UXWB 2R23A 4N2KA 1W6WA 3P4MA 4XZUA 5FGRA 2N56A 2WSPA 5KBLA 1U3JA 1AJ7L 2EDLA 1ZSHA 5C08E 1BW8A 1UACH 4NQCB 4JB9H 1VFAA 4Y4HC 4Q6IB 4KQ0A 4LZKA 2J6EA 5IFAH 1MELA 4RMTA 4QRFA 4XHJD 1HNGA 4AMWA 3VDBA 3QSKB 1L3WA 2CZNA 4CBPA 3WXWH 3MRQA 5ERWA 4BHUA 3QFJE 2LOEA 4YL9A 3CCHA 3U0PB 2LGNA 5FW6A 4EXPX 1KLUB 2HMID 2JJVA 4IS6A 5EU3B 3N40P 5I24A 2FUQA 3ZL1A 4NXKA 5IESH 2XWBB 2ZPKH 2CCLA 2Y1ZA 3AGVA 1MFAH 2CJUL 1I9RL 3SKOA 1AO7B 5TE7L 4JZOA 1WEJL 1B2WH 2EECA 3MV8A 4QRSA 3C60A 2GJJA 1FAKT 1F2QA 1QBLH 3VE0B 3D51A 4J23A 4TLTA 4IRSC 2E9GA 3PDGA 3FU6A 4M5SA 3JWOL 1YJDH 1TZHB 3ZDXE 2DI8A 3K2IA 2GEEA 5AB1A 1B0GB 2XZAL 1HDMA 1DUZA 1JDDA 2DMCA 5DFAA 1CFQA 1L5GA 1Y6NR 3OF6D 1TYJA 5DU7A 2WNKA 1KN2H 1OCCB 1RZGB 3DETD 2EC8A 4FTVE 1UATA 2B1HH 4HUVA 3DECA 4LPTA 1ZA6A 3GZPA 2EIKB 1JOIA 4Y2OA 1LP9F 1LL1A 1P7QD 4AYEC 3VXMA 3MDJA 5AVVB 3HI5L 5SWSE 3RVXD 2Y1YA 1OEZW 4TNEA 1BJ1J 1GRWA 3MX0B 3RJQB 4G8AC 1QO3B 1MVUB 1QEWA 3P30H 1N8ZB 2BOCB 1L0YA 3UZEA 4D8OA 5L0QB 3LJ3A 5CJXC 3TO4A 4P48A 4XT1C 1KTKE 2A9ML 3FAWA 4XZUB 3RIAK 1BDYA 4X8GA 3PWUB 5JR1H 3I84A 5KW9L 1TQVA 5MENA 4QXVA 4BD4A 4OZGE 1DBAH 4TN9A 4N0UE 2NZ9C 5F9JA 2P49B 3LCYA 3GUTB 4PJGE 2O5XL 3BSZA 4JFPA 2B1OA 3DVFA 3H3BC 4DZBA 4X9FA 2R39A 1X5IA 2ILLA 3J7HA 3MV11 3QPQC 4R4ND 3OAZK 5FUCC 3GSXB 5KS9E 1FLRL 5LNDA 4PJXB 4KV5F 5ETUB 1PFOA 2ADJA 4WY7L 5I28A 2NTFA 3D5OF 2IXQB 3OVUB 5DHDA 4EN3D 2QVKA 3V0IA 1BP3B 3ARZA 2Z92B 3CC5A 4AYFA 2KDYA 2WINB 2KERA 2NLJB 5FYKE 3OZKA 1OSYA 5K1JA 4EDXA 1CXFA 1G7LA 1SJHB 2DD8L 4JO8A 1MFCH 3FQUB 4NFCA 3LZFL 3X13B 4PJHF 4HLEA 3CPLB 4U1IB 3AREA 3QZWG 1B90A 1XGPB 1FO0A 5FAAA 4MLSA 1M42A 1PZCA 4LCCB 1TTGA 2GUOA 4YBHA 2DL2A 3MRLB 1VFOA 1WHPA 2YMXL 3UCQA 2YQBA 5I16A 4HALA 5JDJA 2XYCA 1Q9KA 2IWKA 4JMXA 3BQUA 4KAQH 3TTSA 1UM4H 3ZE1F 1JGLH 5EU6A 3SPHA 3FMGL 2X05A 3I6LD 1CMOA 2DQHH 4KY2A 3VFGL 4G83A 5TJWK 3L45A 3ZKND 5F9AC 2J5WA 1BZDA 4LLDA 4PTUB 4XI5C 4UQEA 1AXIB 2DMHA 4E5XG 3WE6A 1ORQB 4QRUA 2JTDA 3DRTB 3DPBA 2XZCH 1NMBL 1NDGA 2CDGB 3FU3A 1A3LL 1J10A 1YEWA 3FO9B 1F45A 4FJZA 5IM7A 3CDZB 5GRVL 5EO0B 4X6CB 4ZFOB 2R1XB 5B3SB 4JO3L 1ODUA 1I7UA 1Z9OA 2DWEA 3FTZA 2WGNB 1C08A 1LEGA 4J8QA 2LAAA 2WTOA 5B1KA 4Y2DA 5C08A 2BIPA 2WLLA 5CIPB 3WKML 2VR6A 1RK7A 4N25A 5D2NE 1CXHA 3CNKA 4KNQA 3VSVA 1F97A 3WSQH 4LU5L 1HQRA 4LGPB 4LHQB 3QDHA 4XX5A 5B38B 2BFVL 5E9NA 3QO1B 4P5MA 3N6YA 4YHPB 4LBEA 2OR9L 1BXUA 3US9A 1YDPA 4M29A 2YLHA 1UT2A 3BGMB 4L8CA 4FNLH 1IBZA 3LYRA 4PRAB 4M6OL 3GMQB 3EHBD 4HUXB 4WFFD 4JFTA 4DQOH 4F8TA 3US0A 4BCZA 4KO9A 5CCHE 5BRZB 5EOCL 5EORL 2DMBA 5CCGE 2OK0H 2Q2LA 1MW1A 2VDQH 2XWTA 1EJOL 1NUFA 4OM0L 2DYPB 3HI5H 4U1KA 4Y5VB 3HHRB 3HZYB 4F92B 5FB8B 4KZDH 4P0DA 2RALA 1U21A 2M83A 5F1NB 1WFJA 3FCSA 1NLBH 5E1HB 5IB1B 4PSRA 3KGUA 4HJJH 3VD4A 4FLOA 3C5SB 3JBG7 2V17H 5E1AB 3CZJA 5B7MA 3QIWD 3IXTA 3MFFB 3COOA 1JTTA 3DUSB 4N0UA 4UOW1 3ZE0F 1BQLH 3BAWA 5E51A 4K0OA 5B38A 4KUCD 1YYMH 6PCYA 3VFMA 1B2YA 3GLZA 3ZX1A 1NFIB 1BZ8A 4KK6C 1KCSL 2ZSVA 3VMNA 1S46A 4FE9A 4F9PA 4YQXL 1H6UA 3AFLA 5FHAH 2WYHA 2VLJB 2YAOA 4GIAA 2UXFA 4XNMA 1DQJA 2NY1D 2XU9A 4TPRH 3SGDI 1TLMA 3EF7A 4E41E 2SEBA 4ILDA 3B9KA 1XGTB 3QEQE 1P7KB 2ADGA 5TFSH 1K72A 2H8PB 2B16A 3OLEA 1UKSA 5HYJA 3B8YA 4WFGD 3BD5A 4X6FB 4Y4FB 4J3OC 2ORBL 3AITA 3FXIC 4HUMB 4HIEA 4OUOA 2BP0B 4HWEL 4Y0GA 4BFKA 4Z7OF 4NKDA 2DYSB 1J87A 1RUQH 3KPQA 4KTEH 4KK5C 1YN6A 1A6ZB 4Y1AE 3K74B 1RURL 3CXHJ 3F7RA 4EIZC 4YSCA 3RTQA 2G9HB 2ZUQB 4OKVB 1P5VB 1U4FA 3QIBD 3D39E 3TA4D 4C4BA 4L48A 1AXTL 1MF2L 1MRDH 4RISH 3MREB 1RJLB 5AVZB 3WY4A 4AGLA 2E0PA 3VH8B 5FYLE 3V7MA 1UZ6E 2BNQD 3UTSD 3HE7B 1QLFA 1VFBA 3BZDA 2YA2A 3ARSA 4R7NB 4DN4H 1UXSA 4JZOB 1MW3A 3T4AA 1J5OH 4G1EA 4XNUH 1H0DA 1FNEA 5BQ7B 5HPMA 3NCWA 5GRWA 1AACA 2EEBA 4KKBC 3T1FB 2B9BA 2RCSH 5C9JA 4NERA 4FNPA 4HKZA 4CAGA 2A1WH 4N2CA 1MI5A 4HD9A 2NYYC 5E5LA 4YHZH 4PU2A 3QHZL 5ICXB 3SYQA 4RZCB 1VRSA 1EBPA 5DJ8B 2EXSA 1WZ1L 2JI1A 2G3NA 3OSVA 4O2FA 4QPEA 3MXWL 4FTDA 1BQRA 4J8RB 5SWQA 5TQ0L 3HE7A 2YPLB 2BXZA 3FPXA 3K5SA 3T0EE 1JPGB 3CVCA 3G6AA 1GMEA 1RZQA 2V7HB 5INCB 1BZ7B 3D30A 3LY6A 4NX0A 3IJSB 5KBMA 5GGSA 4L5FE 3BFQG 3JWDH 3L1OL 4V1DE 4L29B 2G3ZA 1SUJA 1FBIH 4H20H 2K3TA 5I6PA 3BC9A 3PQYD 5IUCA 1I1AA 5D8JH 2AANA 5DWUH 3WJLA 1DO6A 2F7OA 4D0BB 2GW5A 4KXBA 4PHZA 1MQKL 4XO9A 4H0IA 3WN5A 4B7IA 4ZUTA 3U9WA 2PCPB 3BXNB 2WMPA 5C0CE 3VD9A 4IW4C 5E5RB 4GW5A 4OLWL 4KKNA 2X4RB 4DKEH 1UWXH 1N18A 4GH7B 1DFBL 1NJ9A 4I0PC 4DUWA 1ZSDA 4M5TA 4OKVA 2NQ3A 4RESB 4JANA 1YRKA 2WNXA 2D7PA 4QGYA 5JHLL 3O4LE 5DD3L 5I18L 5I6MA 4QRTA 3W5MA 3PXJA 7PAZA 3S9DB 1AXSA 2ZKWA 1G6RA 3H9SE 3NP4A 4LFHD 4OZFH 5I0XA 4WW2C 1JXFA 2YN3A 4YSUA 3FQTA 2HCZX 3TIEA 2CAKA 3D3VE 5J3HC 2ARJA 2GC7C 1I3GL 1WA2X 5FCSH 2MCPL 4IOFD 2FB4H 4NT6B 1GS8A 4ES8A 2BVOA 5JIPA 4OJFH 3G5XA 1A21A 3IDUA 1L9SA 4ZUTB 1JI2A 4ZTPL 1UGNA 4KH9A 4Y5VA 3P4OB 3O4OB 4FG6D 4WHTB 2XLLA 5FO7B 1R24A 4QHNA 3AXLA 4I4WA 2BRRH 5L2KB 5IBLC 2P8PA 1BQHA 2DI7A 4D8PA 4P2YA 3ZE2E 4DAGL 3H9SD 1RUQL 3H9YA 4MGXA 4FCHA 4QXGL 1TO4A 3ZLQC 1DVUA 2Y07L 4K94H 5G4OA 2OCJA 4X5PA 4FABH 5I6KA 4TQ8A 4PREA 5DT1L 3U0WH 1AO7D 5KVFE 4MD0B 2YPVA 2DH3A 1FI8C 1QRNA 4TVPH 2PR9A 3UXFA 1NIEA 2COVD 4JDZA 1JG9A 2Q7YA 2YFNA 1CFNA 3D9AL 4F58L 4PS4L 2Z8SA 1CT8A 3B2MA 2W80C 3B7RL 2OMXB 3C5ZD 3Q44A 4M6AA 4FG2A 1PVHA 4K3DL 1NGWB 4Q2ZB 4M7JL 1KTLA 1ZHBB 2OCCB 2XVKA 5GJTH 2YPVH 4RA3A 3PWJB 3N44F 1F6FB 1D5ZB 2IBZY 3GSOA 1CDYA 4LMQI 1R5VA 5D1XA 3MV8E 2HKFL 4XPAH 1N59A 2J1WA 4ZMZA 5I17B 4G8FA 4P59H 1K4DB 1S7SA 2OSLB 3WG7B 3LVTA 3MRGB 3T8VA 2YMOA 5E8DH 4NQDB 4JDEB 1AG0A 1GYWA 4KJWD 4PJFE 3ZE1E 4BK5A 1VGEH 1ZT4B 1E4XI 1EGJA 2WO4A 3GGWB 3IDGA 4JO1H 3T3ME 5HHOD 2ZSWA 4B50A 4ZO8A 1CICD 2ATKB 1TYRA 4YDIL 2OX5A 1Z9MA 4H7VA 2NRDA 4M1DH 4KX8A 2X09A 5F1IB 4DW2H 3WNLA 1TIUA 5H4YA 1F6AA 1NBVH 2Y25A 5IBTL 4XN8A 4B0MM 2YXVA 3H7BB 2Q8BL 5KJ7E 2DI9A 4JCWA 5BUAA 4LQ1A 3WHE0 4WHCA 4HH8A 5I19L 2VO8A 5IVZA 4IBUA 2HFGL 4PM1A 4PW9A 1Y7VA 5CZVH 2E7BA 3ZTNL 1PQZA 3AG1B 5H94B 4AEIL 1SXBA 3CDYA 5DUMH 3VFVA 4Y4KA 5HDQL 2I26N 4U2YA 3SY0A 5HP5A 4GI9A 4QLRA 4UV7L 4YK4C 2VLJA 4YDKH 4G8GE 4NCDA 4YHLH 3ZKMC 1AQ8A 1VEPA 4ZNEE 1ZVNA 2FECI 1AANA 2LTQC 5T5FH 5AOKA 5KSAC 2F1BA 1IM3B 1KYAA 4LDCA 1SDYA 4QKTA 3SE4A 3UGUA 2YRPA 5AW5B 2NW2A 3WN6A 3K6SA 3S35H 4DPAX 1IE4A 1U36A 4G9FE 1JZFA 4N8UA 5E00A 5JOPE 3GPEA 1T22B 4NOBA 2MPAH 1U33A 1WCQA 3V10A 5DJZB 2KLRA 3V6FB 3Q6GH 4NO2B 3U7YH 1SXCA 5J12C 4GRMA 5D7LB 5I0YA 1AC6A 4HIJB 4EOWL 4CN6A 1OCWL 3CG8A 1AVAA 1DSFL 5C7XL 1A3ZA 5MEPA 5CMAB 4PV1C 4OZFG 1U8QA 2ZJSH 3Q8AA 5C0AA 3IETA 2VDRH 3QW9A 4ZMNA 3SE8L 1GC1C 1OARH 5CGMA 5HGBB 5L7XL 3IBEA 3MLSH 2LLNA 3N85H 4WI2A 1M71A 4WTXA 2IGFH 5E4OA 5TDOA 4A04A 1BQKA 2PP9A 1DBBH 2X4UA 2OR8A 3GBDA 4HJSA 5EG6C 4ONHA 3A4EA 4M61A 1BJMA 4G5ZH 1IRAY 3CZFB 4K94L 2GB2A 4YHOH 3AJ7A 2WVVB 4YC2B 3IWVA 4QHPA 2BSRB 2CHZA 3Q2VA 4D9QE 2GHWB 5DURB 3R18A 4UM9D 4JDTH 3KPSD 1RIHL 5EU6D 4MDIB 1A6WL 1K5NB 4PGCA 2ZXAA 3SCMA 1QEXA 1UM6H 2KS0A 3NZSA 1SHSA 3EOBA 3CD4A 5F7HA 4DVBB 4YAQA 4GIOA 1E9QB 3R7QA 5IQMA 3I6GA 4IMLA 2WLZA 1RPKA 2F5BL 3D7PA 3PP3H 4PJ7A 4UANA 1WO2A 5KSAB 4LHJB 4JBSA 4N8VA 1LP9A 1R3JB 2H26A 5IVXF 1ZTMA 4BDVB 5BO1L 4HG4J 3ENEA 1KGCE 2AXFB 2EH8H 3FFOA 4FS0A 3VX1A 4NNPL 3T4AB 4TVPL 3SYPA 1QQDB 5FGBC 3V4PB 1MLBB 2APBA 4YZFF 4K23L 4Z18A 2YAHA 3APNA 3QUZA 5GPRA 4AC4A 1JP5A 2VR5A 2WYIA 4Y19B 1NGXA 4MDJA 1GYAA 4O2EB 2ODHA 4FFWD 1FGVL 1I9IL 2X2UA 4IBSA 4QY8B 5E1GA 3FS9A 5E9DD 3CZNA 5L4IA 1XQ4A 3QULB 2ATPA 3QUZC 2CBOA 1U8CA 3HNTH 2MWCA 5DMKA 4NO5A 1JYXA 4WU5A 1F1GA 1ASQA 3GDCA 3I75A 3FRUA 1WSST 1DL7L 4LPVA 1HESA 4DKFL 4N8CL 4LIQH 2WJ7A 2Y7MA 1ZGLB 1F13A 4K07A 3O41A 4I48B 4U6YA 5BW7A 4W9FC 5J13C 1OLZA 2ZUUA 1A4CA 4EIUA 4L9LB 3GKWH 4Y8DC 5DVMA 3ROLA 3O0RL 3Q1EA 4PRIA 1KBPA 4AEHL 3NRFA 3CMGA 2Q76A 3HUJB 4G7QB 4LSUH 1WHOA 1CD9B 4XN9A 1TITA 3FZUD 4IKNA 2WB7A 4RAVA 3MJGX 4IRJA 1UOLA 4XMVA 3GZOA 4BZ2H 5EZIH 3EBIA 5FWRA 1DLHA 2BVTA 3PGDB 2JKJA 4GINA 3BW9A 2DQHL 1OAKH 1RULL 4LSVL 1BBDL 1NLDL 3LOWA 4XMPH 4ACPA 1S3KH 5ILTH 3QNFA 2Z7ZA 5D71L 3VXNA 1ZV2A 4CVXA 2VDNL 3S48A 5DK0A 1KEGL 1J8RA 3IT8D 1UXSB 5TDNA 1MVFA 2ICCA 2YGVA 2R1YA 4ELMA 5I8OH 1A4KA 1S7UA 3HC0B 1Z5LB 3MX0A 3L95A 4IQHA 4KZEH 1NZRA 4R2GB 4PBXA 1QYGH 2F2HA 4X6DF 3CLEL 3GXDA 3JWNH 3OKKB 4HIIA 4D0CA 1SJXA 4BSVB 2VRAA 2PPAA 1MWOA 1YPZF 2FEEI 2LFGA 3S34L 1QRND 3F00A 1MY7A 1KV3A 2K9UA 2YKLH 3H3PH 4N2IA 3WUWA 2OJZL 2NY0D 5DZ9A 4FQHA 4GKZB 2E27L 3OSKA 4AWJC 2LT9A 4OF7A 1QSEA 1U8JA 1PX3A 2Q3XA 2CU9A 3ARWA 3C5SA 2FQDA 2F8VA 3P54A 2Y36H 3TTYA 5ITBL 1IGCL 4NP9A 1DVXA 3QCUH 1INQB 5DC0A 5DJ2B 3WJMB 1QKZH 3GXIA 4QIRA 5B7FA 3DHPA 4HKJB 1PFCA 1H15B 3BEVA 4WCYH 2DJMA 2P3YA 4DF9A 2QHRL 1M7XA 1UJ3A 3APDA 2FWLB 1G9MC 3HHSA 1JXJA 5FUOH 4AYSA 2UVFA 4NUPA 2DYRB 4YDJA 2LU5A 3SDDA 4OZFA 1EHKB 4Q89A 1HNFA 3MLWL 4YDZA 3B7UX 4JN1L 3NCYS 5HD8D 2EVJA 2E8YA 2YAFA 2IQAB 3OWEA 3TBYA 4HISA 4X8JA 2F5BH 2K6ZA 3RVXC 1RUMH 3QCTL 2F8XC 3IJ7A 3QORB 4ZYKA 1OGPA 4LVOB 3R1GL 1OY3B 5JPNA 4PR5A 3BP7B 3JUYA 5KBPA 5FV1L 5E6ID 2H0EA 5BXFB 2C3VB 3OC5A 3DX8B 3KPSE 2D3LA 2ZG1A 3Q8BA 3VWJD 3O2WL 1UXMA 1C5DB 3ARGA 4D9QD 4M5ZL 2EVHA 1CTNA 2XCMC 1AKJA 3C9NB 5CAYB 2ZKXA 32C2B 3ALXA 5L4FA 4EXKA 2FUTA 5FDYA 3REWA 5EU7C 2GSIA 5D1XB 1A3RH 1HH9B 1TEYA 5CEYB 4UNIA 1QTPA 3BFOA 2C34A 1IAIH 2X9WA 2DQDH 4GSQA 3O2DH 1SOSA 3K2MC 2IWEA 2PETA 4NWUH 5GIRA 3UZQA 3DRTA 2XPYA 1MCQA 4X8JB 5E1IA 1U8OB 1WVZA 1I3VA 3VQLA 3TNNA 1U91B 2J5LB 2Z8WC 4JRXD 4AVKA 5C0DB 5JIMA 1B6DA 3EF4A 4KH2A 2HN7B 4LHUD 4FADA 4AMKL 1BBJB 3VAEA 3FZUC 4K23H 4WI3A 2KC0A 2O5ZL 2VH5L 1IFGA 5I6NA 4NZUL 1I1RA 4UNTA 3HW7A 5D2LE 1ZA3B 2XIDA 4DEWA 5I71B 2R1WB 1X9UA 1IBYA 2P26A 1SM3H 1FZKA 3EYQC 1CDCA 3PP4H 4K3EL 3JYCA 2FX9L 2JELH 5JOPD 1NAKL 4XNXL 5EZLB 4RFNB 4G8IB 4UDUA 3EO1B 3F58L 1N2RA 1ACXA 1O5PA 3FT2B 4UM8B 3T65B 3VSTA 3L1OH 1UM5L 3M45A 1J8HB 4O4YL 3V5KB 1RERA 2DQUH 4ELKA 1S8DA 1YYLL 1BOGB 1KV7A 4GEJA 1R3IH 2FEDD 1M2OA 3HRZB 2WXHA 3IGAB 3TXAA 2FO4B 3EADA 1LO4L 4HU8A 3B9KD 5IFJA 4OLWH 1JGUL 1M3JA 2KZKA 2ITDB 5BUGA 3VGHA 4UT9A 3ZDYF 4BXSV 1MHEA 5D2NA 4JY5H 3U2SA 3LKPB 1S7QB 1XWVA 3FCBA 2I5YH 4Z7WE 3RGVB 1X6LA 2QQLH 3RZCA 2NZIA 1UB6A 2WP3O 1JERA 4JFHD 4MKTA 3ARFC 4NPKA 3FFCB 2AGJL 3Q9PA 3MV7E 2PF6A 2W81C 1I3RB 3IMVA 4WGVB 5CZXC 5DUPL 4AJ0A 4HWUA 4KMTH 1R6VA 3C2SA 3WJJA 5GRJH 1OT4A 1NUDA 2BY3A 1PU0A 5EDSA 5SWQB 2XYBA 1JWMB 2XFGB 4LCWD 2X5PA 4QTIL 2Z9TA 5CJQL 3VD5A 2VDMH 2PUQT 3MV8B 3HCVB 12E8H 4PP1C 3KYKL 4W9JC 1OAYH 3CSYA 4JN2B 3IWUA 1OAQH 4QHKI 1TYEB 4H8HA 1EUUA 4Y2NA 3TN0D 1N5YL 1MCCA 3NPZB 2NW3B 4QRRB 2YPKB 3RAJL 1KMGA 3L3GB 4JHUA 1M2VA 1KC5L 4PY8I 5AW6B 2IADA 3N44B 4QNPE 4H25A 5JDSB 4FFWC 4OY9A 3HUJE 1U8LB 1PIGA 2OXHB 2ZXWB 1TR7A 5CN2A 4B9JA 4BZ1A 4JG0L 4AJYV 3WI9A 3DIFA 4YE4L 4KKCC 4PI2A 4XCNB 4YXLH 3CU1A 4LSDA 2BCKA 1F4YH 4P3WA 4N9GA 3V8OA 4CL7A 1ZXQA 4OZHE 4IRZA 3Q8EA 3VXMB 1R47A 5DVNA 3RNQB 3KYNA 5HI4D 3O8XD 3PHQA 5JTWA 5MP6H 3O3DA 5HTSA 4HS3A 1A7BA 5E2JA 1FVEB 1F02I 1YLBB 4TSBL 2ZOKA 5ADOH 4EZMA 1IBBA 1YNTF 4YHKL 2XWZA 3AAZB 3TBSB 3HNVH 1V3LA 1FFPB 4G7VL 4PAZA 1QUNB 5JW3H 2HG0A 3H2PA 2FQGA 2Q86A 5E23A 4L8BB 5AOMA 4APQB 2VDKL 5D7LD 4PJBB 1DJXA 4PRDA 4CKQA 1TZHA 4ELMF 4LCYB 2ID5A 3GMMA 3STZA 5ESAB 3AS1A 1NCTA 4UT7H 1WC7B 3KHOA 4UB0H 3CN4A 4M5YL 1OANA 4Y4KD 5IW1A 5E2UH 3CUPA 4Q7DA 3AT9A 2FD6H 4JG1H 5BS0E 3MJ8A 1OPGH 2WQ8A 2NOYA 4XCYA 3ULVH 2IOMA 3WLBA 1T66C 5DD0H 4APQC 1HTYA 2EIMB 3DX6A 4M61B 4QAMB 1G1KA 3EJPA 1NPNA 4OJFL 3G9VA 4Y16A 5ICUA 3WEAA 5FYKU 4A1RA 1R3KA 1T1YA 2X0VA 5KVDH 4N2BA 5IEHA 3DYMA 1CGTA 2NR6C 4D9LL 2NQDA 3KL3A 3VXME 4QLWA 5CU5A 3SGKC 2PP7A 4PJDA 3X1GA 4GYBA 3LRSA 4OZ4A 1NGPH 4C83A 4I85A 1UUNA 3SDCC 2DQFB 5B8CA 2KLSA 4WEBL 1HHIA 2G5BB 1BD2D 3VGBA 5C0CD 4U1KB 3SE9L 5K59F 4XODA 4O02H 4X4ME 4P23D 2P5EA 3G5VA 2QLYA 4WWNA 3WEBA 3NDYE 3ZVVA 1T2QH 1KFAH 3P9LB 3V8CA 3A4AA 3P73A 5C0JB 3PQYE 2K6YA 4IEFB 4U6HB 1IC7L 3PWJA 1R3JA 1NGYA 4CJ1A 4LBAA 3BKYH 2R4RL 4PI0A 5E2TH 4BQ9A 4JO5A 4F58H 4AW4A 4GXUM 2VXUH 5J7CC 4LL4A 3ZKXB 1JK9A 1OQXA 5ALCL 4AE1A 3RB5A 4OV6F 1J9CT 3EG9B 2CK0H 2CO6B 1LQSR 3MOBH 4U3XA 1OCWH 1VJSA 3NJGA 2WUBL 2R1XA 1VPOL 2PWEA 4TL4A 4TNFA 3H85A 4ZO7A 2VMCA 3GSQB 4JPKH 4JQIL 1CF1A 1IGTB 2WBJB 4Y4FD 2YMXH 2N59A 5D96C 5FYKH 4IYKA 4YUEH 1RCYA 4HLZG 3H9ZA 1TT6A 4KI5D 3SGDH 5C0FB 2XG4A 3CXDH 2ZSVB 3HKFA 3OR6B 1OW0C 1I9JH 3K46A 4DZ8A 2CSPA 4MD4B 4WGWB 2ZXQA 5CBEB 1HQRB 3BD4A 3V6ZB 2FZ3B 1NGQL 5FK9B 4XAKE 4ZW8A 1N0XL 3QIBB 3W11D 1WRFA 2DY2A 3OGCA 4PG9A 3LSOA 3FQYA 1L6PA 1QTSA 4ERSL 5LGHL 2AEOA 4L3EB 1P7KA 4JZNB 2OMTB 4XHQA 4P57A 3ZQ9A 4D7BA 1I8IB 3MJ7A 2EEXA 3EJSA 5TE6L 1J8HE 3V0WL 3IXAA 5T8IA 3TBWA 2FWSA 3T71A 2COQA 1YG9A 4HWZA 1T7XA 4J3OH 4NZFA 4ETYA 2NNAB 3IDJA 3QJZA 3FCTB 4LLYA 4Y2DC 2MPVA 1H6FA 3FOLB 4HUNB 2VMEA 1JPFB 1RJZA 4WDIA 2EIZA 3IXTB 4U6XA 3MRDB 4YR6A 4MB4A 2OZNA 4R96A 1OXYA 3ZYOA 4ISVA 1I75A 5DFVC 1QSFB 2VISA 4RA0C 1E2VA 5ETUA 4DH2A 3LRGA 4L0YA 1KPUB 3MI6A 2H32B 3J27A 1KB5L 5LWYL 5HVFB 2D9QB 3NABL 3S8WA 4MHHG 3B9AA 3MUGB 4PJFB 4XCNA 1IAIM 4ZSOB 1HILB 2BOLA 1N0LA 2WB1A 2ZT9C 3QUXB 4RWYH 5D7JC 3UC2A 3WFBL 2QV4A 2F53E 4X0KA 3QDAA 1QRNB 3LEYH 3SHSA 2QTEA 3MGAA 3TVMC 4HKXA 1UFUA 3DV4A 1GJIA 2G2NA 4E9RA 3TEUA 1CLYL 1QBAA 3KJ4C 1W6LA 2ZONA 4HXBL 1SRDA 4LEOA 2WXNA 3BKMH 1A0QL 3I6KB 4X2UA 4OFVA 5BJTA 4H8VA 3TF7C 1GVIA 4HJJL 3ZR6A 1WS8A 5DR5L 3OPZL 3MAWA 5AW1B 3BKJL 2YRLA 3BUYB 4GAJH 1ZPLA 5I0ZA 5DZPA 3PABB 4ORGB 4J4PD 4H4NA 2WMPB 1VDGA 3GSVA 3PCYA 1E65A 3NTCH 5HJDA 3ES6B 5K33A 5C70A 4PG9B 1Q90A 1D9KC 5DFVD 2HTLD 4IGBC 3QC5X 4E68A 4A6YA 1UQSB 1UWYA 5C71A 3RG1C 5F7AA 4AIZB 3Q2NA 2QL1A 2ZG3A 4KJWC 3WNNA 1CDIA 4NDMB 5T3ZE 3B3IB 3KPMA 3QEUB 3T2LA 2V5YA 1GCYA 1QSED 2VNCA 4IK6A 2DQMA 2EDNA 4AJWA 2QMJA 2XUWA 2AZUA 4UAOC 2LU4A 1CDGA 1RZKC 3QQ3B 1E90A 5DRZB 3I9AA 4GMSL 2B4CH 2HAZA 3RPIA 3HPLA 1RURH 4KXAA 1BFVL 2KL6A 4YDLC 3IS1X 5C92A 4PJBE 3ZL4H 1H5BB 4OU3A 3AS0A 1KIUB 4PJ5A 1OOAA 1ND0B 3EYVA 3H9SB 3MRIB 2R8SH 4HOWA 4WU5B 1C7SA 3LNGA 3FPYA 2EXWD 3CHXA 5DVLA 4EBQL 4JGNA 2BSEA 3GSRB 4KXCA 5CFHA 1QVOA 3WDHA 4G6AD 1TOXA 3CHQA 1B0GA 4M6ML 5E99L 4W93A 1H0DB 5E8EA 4LKXB 1ZEAL 1ZJAA 4QHNB 2G4GA 1P53A 3V6OC 1ZLDA 5DRNB 5HGAA 1MHCA 1A5FL 3MRJA 4FXKA 4Y9FA 5L4MA 3CFJA 3ULVF 2ICEB 2QVIA 1NCWL 2AK4B 1CBVL 5C07A 1NMCB 3NPSC 3PJNA 2XBTA 1MCSA 2HG5B 3FUHA 1NFIA 4OF6A 1OD9A 4UNUA 4WO4B 3NRPA 5IROC 4PJ7B 4PJHE 4OKDA 1CBJA 1T6WA 1AZRA 3TJPA 4L4TA 2Z34A 5KVGH 1Q94A 4WRLA 1EO8H 4WWKC 4PJHB 1EH9A 2PCFA 2WJ5A 1M71B 3QUHA 1CDHA 3TO4B 3GMLA 1WCBA 5KAQF 3IS0X 5AEAA 1YEHH 3HB3C 2V6HA 3H3PL 3WIHH 4LLWB 5DCCA 4OLUH 3QHTC 1AIFB 3VFTA 4IJ3C 1RLBA 1WZLA 4QHUB 4KROB 4DCQB 4GI8A 3I3BA 3QUMA 2F68X 3F5WA 4JRYD 4J5VA 5IMKA 3QCUL 2OXGA 3QDJA 4D3CH 1BFOA 1BEYL 2B1AL 1EEZB 2H6PA 2P5WE 5ITFB 3RTQB 3D85B 5CEZL 2R69L 1E6JL 4Y5XB 2MRYA 2QGBA 5CLWA 1G6VK 4XMWA 3K2UH 4Q74A 3P9WB 4LLQA 3M17B 4ZUSB 4BK4A 3HS9A 3CIQA 5JUEL 1UZ6F 4OH2A 4NZTH 4G9DA 5JW5A 5IHHA 3FB5A 1AGFA 1SGKA 1XSKA 4W9CC 5ALBH 1U41A 1PLGL 4JY6A 2OI9C 3W82A 2UZXA 4HF5L 2J8UB 4FTVB 5F0LB 2G4EA 2KMWA 3DHJA 1G1YA 1JXDA 4GFXA 5F1KC 1ZLVK 5C7ZA 2IO5A 3IJEA 5I6LA 2X4NB 3GNMH 3PAYA 3R1GH 4ABQA 2VLKB 4RGMC 2FJGA 3VNYA 3VYNA 1T03L 3M7FB 4DHLA 5EIIG 2HUEA 1EEZA 2H6PB 1KN2L 2FYYA 5ITFA 3GPSA 1MHHB 5IJVB 3D48R 3F58H 2AKRB 2DWYA 4M8RA 4R26H 1DE4B 1U92B 3BVNB 3NOIA 4N1CA 5J6GB 2HYMA 4GKNB 2BRRL 3WL9A 3HG1E 3GUFA 1HSBB 4A55A 3CX5K 5E1QA 1PYWA 4G8EA 4BFFA 1OCOB 4MA7L 1C5DA 4LCWA 2W0FA 5J6SA 1BXAA 1M4KA 3FT4B 4JZNA 4AZUA 3KYOB 3MUJA 3RUGF 5IGXH 5LO7A 5C8JB 1S8DB 4NPJA 3S35X 3ATAA 4MSWA 1KCUH 3MUHL 4FQXB 4OZIF 4LBEB 4XE5B 1E5YA 2WD0A 3MCLL 1IT9L 2QDWA 1JL8A 3LEXB 3W0WA 3OL2A 1K6QL 1MNNA 4NAMA 3QG7H 4AIZA 3CC1A 4HJTA 4ODWA 1WFMA 4PS4H 3DXAD 4Y7OC 3OJ2C 1MHEB 2FX7H 4HIEB 3RWHB 2DLFL 4FFYA 3GMOA 4YBQC 1L0QA 1OZUA 2DLIA 1ZEAH 2AV7A 5I66B 1JE6A 3P40A 5EU6B 3RWEA 4H8PA 2BK8A 3ARFA 1NCCL 5ELIA 2D31B 3ILPA 1N64H 2A9NH 5T3ZL 1BZ9A 2JI2A 3Q7JA 3RWFA 3O9WB 4PFEA 5FK9A 3HS0C 2WTRA 2FATH 5T1KB 2VAAA 3X11A 4C4KO 1QA9A 2JCCB 1THAA 1XGZA 2QSCL 8FABB 1TEGA 3GSNH 4P2QE 6FABL 3WGUB 5GS0D 3ISWA 4JCMA 4U1HB 5D72L 5DJYB 2F7RA 2H1PH 1T1WA 1BZOA 3G9AB 1LE9B 4XMKH 2QFPA 5LAPA 5SWZD 2Z7UA 2V2XA 3BAIA 4YX2H 3P4OA 4WHTA 4PS8A 1EDHA 2YD7A 3O6KL 2ZXGA 1T4WA 2B77A 3SDDC 3QIWC 3P0VL 3PGFH 3GMNB 5IHZA 4JFVA 5D7IF 4JKLA 1FFQA 1KJMB 2O6FA 2X4QB 1G87A 3S3BB 3SB3A 5KSAA 1WA0X 2P42B 4QOKD 2BC4B 2BP8A 2J88H 3Q3GA 1X7SA 5E8NA 5I1HH 3SQOL 3SQBB 3SGEI 1CGVA 3BO8A 4XVJH 4F2MB 3IJHB 3RY6A 3QWQB 2ZWNA 4G6JH 1TNNA 2BNUB 2C9QA 2J73A 4PLJC 1BX2B 3MRKB 3NJXA 2BCMA 3NJHA 4NQDE 4Y19A 4FQLH 4R0LA 3GFUA 1ES0B 1AHWB 3CDGB 1BD2A 3HZKA 4U6YB 3BLPX 5CP7A 1PLGH 3QP3A 3NIGE 2ESVE 1Z9LA 2HTLC 1QP1A 1ASOA 3D4CA 4LLWA 1NKGA 4JO4L 4LLUA 3TZVA 3C08H 3ZHLA 1M7IA 2WBJD 5JPNB 4ZFOA 2J55A 5EIVA 2MHAA 4RAHA 4YIQB 1HIMH 4UAOB 1IBFA 4JM2D 4AK1A 5ABZA 2BFVH 2IVFC 2HZHA 2YXWA 4P2RE 1E6JH 5HHXH 4RIRA 1M57B 5IBLD 3IVKB 4KI1A 1FZMB 1CI3M 2PPEA 4R7DB 5C0BB 5IVNA 1MJ7H 5DLLA 3MLXH 3EOAB 4HCGA 1AS6A 4ZDHB 1PPIA 2YPLA 4OFQA 3FUIA 5DUML 3QRLA 2H0FA 4R0LB 1D5MB 5LG1A 1WFTA 5BMFL 3QR2A 4TVPD 1Z5LA 4RSVA 2F15A 2X42A 3QDJE 4G7VH 4XCCL 5ECJE 2HLEB 5JIIA 2AC0A 1UB5B 2ITCB 3KLSA 2J1ZA 4NBZB 3B3IA 3KPMB 3UPRB 1AC0A 4FN0A 3BUTA