2W8CA

Plastocyanin variant with n-terminal methionine - closed structure
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
106
Chain Sequence
METFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title Metal-Mediated Self-Assembly of a Beta-Sandwich Protein.
pubmed doi rcsb
source organism Phormidium laminosum
molecule tags Electron transport
total genus 24
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2w8cA00
1AAJA 3FSZA 2XV3A 3DIVA 2YAMA 1AQ8A 4HALA 1OCZB 2PPEA 4WKXA 1R1CA 1KCBA 2VN3A 3DKHA 3FSWA 2UX6A 3AG1B 3TA4D 3GXUB 4X4KA 4YVNA 1AZCA 5EHFA 2IWKA 3X1NA 1ASPA 1ILSA 2AVFA 2Y69B 3NSYA 1SFDA 3FU7B 1L9TA 2FQDA 2BP0A 3ZIYA 2GB2A 4HZ1A 4N4YB 5B7EA 3AY2A 2HXAA 1AIZA 1A8ZA 4YL4A 5B1AB 1CYXA 1E30A 2FNWA 4DP6X 4DP2X 4E9SA 5TK4A 1ILUA 1GY1A 2DY2A 3IN0A 2PP7A 4N8UA 2EIJB 2IH8A 2BW5A 1IBZA 2X87A 4WTQA 2VW4A 1JZEA 1KGYE 3T6WA 4QKTA 2J57A 2Y1AA 3NSFA 4E9RA 4BWUA 4F7KA 1J9RA 4DP0X 2AFNA 3BVDB 1B3IA 1W8EA 1FA4A 1E5ZA 5I5MA 3C75A 4PCYA 1SDDA 5B7MA 1PMYA 1NDTA 4E9TA 4KO9A 2BZ7A 3NYKA 2YXWA 3TU6A 4G7RB 2EIKB 1IKOP 3X1BA 6PAZA 3PAZA 1W6WA 4E9YA 2IDFA 2OV0A 5F7AA 1ASOA 1A4CA 3SBRA 2YQBA 4ZK8A 1X9UA 6PCYA 2WSDA 1RCYA 2IDUA 2UXFA 1NPNA 4W9ZA 4YSUA 1TKWA 2PCFA 2CBPA 2CJ3A 2QDVA 1FFTB 3UGEA 2R7EA 2JKWA 5PAZA 4A2EA 2YAHA 2PP8A 4A2DA 2PCYA 2CUAA 4M3HA 2P80D 1J5DA 5TK2A 1KV7A 4A66A 2YAEA 3X2QB 4RH4A 1GR7A 5PCYA 3MX0B 4G7QB 1WS7A 1YLBB 4AI7A 1AANA 3S3CB 3FU7A 2HRGA 2PP9A 3FQ1A 1AZNA 1SFHA 1CC3A 3NJNA 4L0PB 3S3BB 1NINA 4BDVB 3QJUB 1BXUA 4A2HA 2H5UA 3G5WA 3PAUA 3UADA 5LDUA 1CYWA 1IBYA 2WO2B 4G70B 2IDTA 3QJQB 3UACA 2RACA 2PPFA 5I28A 3PXLA 4KOCA 1GS7A 3CVDA 3T71A 2ZXWB 2VMJA 3S8GB 1OOWA 4YVUA 2DWTA 1AS6A 1NIAA 4UF7C 3HB3B 3OMIB 3UABA 4DP5X 1M57B 1JVOA 3ABKB 4KO6A 4W1TA 3UAAA 4MFHA 1JERA 3NJHA 2PLTA 4BWTA 3WKQA 5I6KA 2B08A 2R7EB 2YXVA 1A3ZA 4HIPA 5I6OA 3PCYA 2DV6A 1BQ5A 7PAZA 1OE2A 2ZWNA 3SQRA 2W8CA 5B1JA 1ETJA 2XX1A 1SHXA 3NJKA 2VSMB 3TBCA 4A67A 1PY0A 4QLWA 1MG3C 4UANA 2N0MA 1WA1X 1ZDQA 4A2GA 5FC9A 5IY5B 1QNIA 3NT0A 4Q89A 3NSDA 4YSTA 3AG4B 2XX0A 2H3XC 3NSCA 4AKQA 1L9RA 1NIDA 2DYSB 3MBWB 1ZDSA 2J55A 1XB3A 2J56A 3KW7A 1GYCA 4YSQA 1AACA 1NZRA 3WIAA 5I6LA 3NP3A 2AANA 1J9TA 3EHBB 5I6MA 1JOIA 3RYMA 1GSKA 2DYRB 1ET8A 2FT8A 4AX3A 3EH3B 1L9PA 1DZ0A 3OD3A 2TSBA 5F7BA 3CDZB 2IDQA 1URIA 2BWDA 3ABGA 2FQFA 4YSPA 3T6XA 3UAEA 3X1FA 4HHGA 4BDVA 3AZUA 2BHFA 3OM3B 2IWEA 3ABMB 3JT2A 4GYBA 4EF3A 1HFUA 3ZDWA 2EILB 1BXVA 4BXSV 4DPBX 3AW5A 1JXGA 1WS8A 4HCGA 3V9EA 2YAOA 1NPJA 3EH5B 4AKPA 3H4FA 4CSZA 1GW0A 3HEIB 3PPSA 2UXTA 2UXVA 1PCSA 3WI9A 4KNUA 8PAZA 4Q8BA 2HZHA 3D12B 1OV8A 3WNIA 4YSAA 4AZUA 4HAKA 3QJSB 1XMEB 2QPEB 2Q9OA 2XV2A 1RKRA 2QT6A 1KDJA 1CURA 5AFAA 4ENZA 2BP8A 3AG2B 3FU9A 1OCRB 1PLCA 1NWOA 1JZJA 3WKPA 1E67A 1QLEB 2HX8A 2XVBA 5B7FA 1MDAA 3IBOA 2CAKA 3CVCA 4JHVA 2YAQA 1ZV2A 3FQ2A 4BWWA 4YSRA 2IWFA 1SF5A 1PAZA 1I53A 1NTDA 1L9QA 4NERA 2X88A 2Q5BA 1KBVA 4F2FA 2XYBA 1HAUA 2QPDB 2GHZA 3FU8A 1ET7A 1MG2C 4A2FA 2FTAA 1T5KA 1AZUA 3FYEB 2VW7A 2PPAA 1JZIA 5D4IA 3T9WA 1J9SA 4FA7B 2OJ1A 1MZZA 3OMNB 4DP7X 3ASNB 1M56B 2PPDA 3NJIA 4E9VA 2GBAA 1EZLA 1A4AA 1ASQA 2XXFA 4KNTA 1AG6A 4G7SB 4HCIA 3FS9A 3QJTB 4HCFA 1PF3A 3FT0A 3CDZA 1BQRA 4KO5A 1UATA 2JFCA 3S8FB 2CCWA 1OF0A 3WNJA 2HX7A 1CUOA 4DPAX 3NP4A 3EF4A 2E86A 2HRHA 3FSVA 3L45A 4GXFA 2VM3A 5AZUA 4BXVA 1N70A 1VLXA 3PAVA 2BP8B 2OCCB 4G72B 1XB6A 2H47C 3JTBA 1M9WA 1V55B 1JZFA 3FPXA 3PLYA 3N2JA 4GP5B 4K9JA 5D4JA 1BYOA 5I6NA 2YAPA 1BYPA 3ZX1A 2FWLB 1PZAA 1MZYA 3CZUB 2GC7C 3SBPA 4E9WA 2WO3B 2HX9A 2W88A 1ZIBA 1FWXA 4HHWA 3AG3B 1BXAA 1GS6X 4CSPA 3NJMA 2GC4C 2GIMA 4YSSA 4YSDA 3NJLA 1ZIAA 1IC0A 3QJRB 5B3SB 4DP9X 3H4HA 4DPCX 3GYRA 4YSCA 5A7EA 2HLEB 3ABLB 5B1JC 1PZBA 3DTUB 1V54B 4UAHA 1NIEA 1TU2A 5I26A 4DP1X 4E9XA 2UX7A 2MRYA 3KW8A 3FSAA 1A4BA 1J9QA 3T6VA 2FQEA 1OCOB 3BQVA 2FQGA 2ZOOA 2XUWA 2TSAA 2IAAC 2XXGA 4F2EA 1EHKB 1W6LA 2AZAA 3EH4B 1PLBA 1BAWA 1AR1B 3WG7B 1AG0A 1NIBA 1PZCA 2BO0A 1ZPUA 2VM4A 2A3TA 2YARA 4PAZA 1RZPA 1AZRA 1SJMA 2CALA 5I6PA 1J5CA 1TEFA 1N68A 3U25A 1JZHA 5ANHA 3TASA 4FAAB 2DWSA 3SBQA 1GY2A 2EINB 3X1GA 3OQRA 3S3DB 3IEAA 1SNRA 2XV0A 3NJJA 3ZBMA 3FPYA 5I5JA 3V9CA 2ZONA 4P5SA 1X9RA 3N55A 1TEGA 4DP8X 2BW4A 3CG8A 3IE9A 2NRDA 4KOBA 4AKOA 2QDWA 3OMAB 4YSOA 3ASOB 1KYAA 1AZBA 1NWPA 4NAJA 1JZGA 2AZUA 1OE3A 1KCWA 4P5RA 7PCYA 1E65A 2IDSA 4NB7A 2BP0B 2FJSA 4KNSA 3NJFA 4TXVB 1OCCB 2IH9A 3X1EA 1SF3A 1F56A 2J5WA 2I7SA 2XWZA 9PCYA 2GI0A 1AS8A 1JXFA 3CVBA 2P80A 1IUZA 4KO7A 1JXDA 1XB8A 1AOZA 1AS7A 5I5IA 1NICA 3FYIB 1DYZA 1BQKA 5E9NA 4BK5C 1ADWA 2XU9A 3TBBA 2BZCA 3ERXA 2XLLA 1GS8A 1JVLA 4M4RB 2PPCA 2B3IA 1QHQA 3FQYA 3T6ZA 1L9SA 3IN2A 1PNDA 4JKNA 3QQXA 1A65A 1OE1A 1SDDB 2I85A 1SHWA 2FT6A 1ID2A 4GP8B 1WAEA 1KDIA 2LLNA 1ET5A 3QJVB 4G71B 1RZQA 1WA2X 4JHUA 4DP4X 5B1BB 2EIMB 2MTAA 4GP4B 2BWIA 1PNCA 2UXGA 4A68A 4YSEA 4E9QA 3GDCA 2VSKB 2YAFA 3H56A 4GY4A 1L9OA 1V10A 2FT7A 3NJGA 2GSMB 5D4HA 2VW6A 5AKRA 1PLAA 1NIFA 5B1KA 1KBWA 1WA0X 1HAWA 1BEXA 1E5YA 3QPKA 2I7OA 2JXMA
chains in the Genus database with same CATH superfamily
1KXQE 2P5WA 1R19A 4CAGA 3EYUL 5JXEA 3PFUA 1RURH 5EPMB 3V52H 3KJ4B 4IIQA 1H3XA 3FSWA 1A8JH 5EBLB 5GPRA 3GXUB 4X4KA 2F53E 5FUZL 2KZKA 4BFIB 4Z5RB 3WHE1 2JKRM 2FEEI 4JFPA 2EIDA 3HHSA 4EI5C 3FU7B 4D0BB 1BGXH 3KH4A 3CZNA 4DEPB 1WZKA 3GGWB 1KTDB 5JHDB 2NY5H 4KXZI 1R3KA 5D1XD 2FWOB 2ADIA 4MJ5B 2O26U 2IALB 5BZWA 4ENEC 4HS3A 4HIIA 3CDCA 1FRGL 3GTVA 4FXTA 4BQ6A 5I15L 4YUEL 4K7PY 5IFHL 4POZC 4J6RL 4O4YH 3GMOA 1M2VA 3C9NA 1H5BA 2P8PA 2XZAL 5EORH 3C5SA 1N0XL 5B8CC 1B2WH 3TZVA 3LPWA 2QPFA 3RVXD 2JKIS 3VDBA 5DUMH 4FFTA 1MREL 4MWFB 5D7IF 3K71A 1EHNA 5D7LD 5AOMA 2FD6H 5C0FB 2XKNB 4OCYL 4IBVA 3WUWA 2HRPL 3V79C 1TLKA 3MRFA 3MA9H 1RSYA 3QEQB 4B41A 3ULUH 2N1TE 1F00I 1SRDA 4AC2A 3BMWA 1XGZA 1P53A 1PY9A 3K8LA 4PJXE 5HVGB 4NZRL 4JS7A 5DRNA 1KG0B 4GPVA 5HBBA 1IO4C 4A6YL 3BN9D 1TZIA 4JGNA 4FCHA 3GSXB 3D4YA 3QIBC 5JLZB 3K8MA 4D0DA 3QIWC 2HP4A 1KF9B 1UG9A 3ZYIA 1KC5L 2BNQE 2WSDA 2IDUA 4F7PB 2F8VA 2OTUA 3POCA 5D1XE 5DWUL 3VU2A 4EOWL 4WCYH 1PKQA 1NAMH 4RDQF 3V5KB 5LO7A 2Z35B 3T6QC 5IK3A 4CN1A 5I1HH 1L4IA 1HN1A 2QHLA 3WFHB 2ZUXA 4HPYH 4KDTA 2OMUA 3KEHA 4KTDH 2HT4C 4ISVA 2ITCB 1EO5A 4RMWA 3SOBL 1F6AA 5K39A 5LBSH 3ROOB 4EDXB 2APVA 4AI7A 5D7LE 2JCCB 2AI0L 4P4RB 3W9DA 1C5CH 4XHJC 4KK6C 5HYJA 1SEQH 3GIVA 4LOVA 1FFQA 1JGDB 5ESQB 5HY9B 2H5UA 1JNHA 3ZIMA 1OTUC 3HMWL 4Z95H 1LO3H 3DJ9A 5C6PB 3OL2A 4IRSB 4HX1A 3L2LA 4BFFA 2R0KH 1R17A 4AWJC 1X7SA 4KUZL 1X5LA 2G9KA 4QRPE 4I77H 5FHBH 1CJYA 1PSKH 1R5VB 1N64L 5AW2B 4FA8A 4L8SB 4ZAKB 4ZTPL 3S8GB 4PJBF 3RY4A 2OJZH 4CMMB 3IMVA 2V5RA 3MRMB 4O2CB 5I9QB 1I1CA 4UF7C 1D5IL 3HB3B 2VXQA 1IAII 3IFNL 3BGMB 3OMIB 4HIEB 4OBSA 1UACH 5DFAA 1K8DA 5KS9E 3L4YA 1M7DB 3SDDC 3UAAA 4EPSA 2ZE0A 1EX0A 1QATA 1K85A 4QHNA 1K72A 1T1YB 2YXVA 1ACZA 4FE9A 1A3RL 1P6AB 1OE2A 4LMQE 5BRZA 4LOUD 2FR4A 3LIZA 3ESOA 3BWAB 2VSMB 1H3UA 4YBLC 1J05A 4HUWA 1ID5I 1RFDH 5JQ6L 1ED3A 3IDXL 2A6JB 3JWDC 1UXLA 5CLTA 4S1QH 2JWYA 3U2JA 3EZJB 1YC8A 5FYJU 5D6CA 1DUYB 3AXHA 3SGDI 3SCMD 3KYOB 5ALCH 5FYJL 2H3XC 2ICWA 3FCSA 3GC3A 3K4DA 3PV6B 2V9QA 1DN0B 1TDQA 3OAUL 2GHWB 4IKKA 4MX7B 4XNDA 2CQVA 4Z3GA 2J8HA 2VWEE 2X3BA 1ONQA 4YZWA 4XMZA 5E95B 3EHBB 4Q0XH 3AU1A 1JOIA 1MFMA 1SDYA 1UM6H 4G3YL 2DIBA 2CLZA 1OB1A 5KW9H 5F7BA 2Z31B 2FHBA 4ZFOB 3OWEA 1R3LB 1URIA 3MBEB 2AJYH 1CICA 4YL9A 2IWEA 1EEQA 2EYSA 2VQ1B 4PGCA 1ZSHA 3KR3L 4P2OD 4IRZH 1I1RA 1IIIA 4XP5H 1RMFH 3IFPB 2CO3A 1F6LL 3QORD 4NBYB 3H4FA 2WZPD 3QDGE 3HEIB 1AE6L 4MASA 5J7CC 1FSKB 4JE4B 4PB9L 2PYEE 5IHLB 5ABZA 4AYID 4FD0A 5DHVA 4KX9A 3QJSB 2MHAA 2NDGA 4YDLB 1QD0A 2AC0A 2IJ0C 4WI7A 1MH5B 2JI1A 4IDLA 2GEEA 4HIXL 5F3HB 4D0CB 1GVIA 3VFMB 3DARA 1XTMA 5DUPL 4N8PA 1N6QL 2AV1A 3JV4B 4IU3A 2R15A 1OZUA 4DKEL 3NMEA 3FQWA 1JFQL 1J0ZA 2MPAH 3D51A 4JKPH 1DL7L 3TPUA 3F85A 1XGYL 4FG2A 5D7IE 5HSFA 4GSQA 1E4KC 2ZF9A 1ZT7B 1SVBA 3GJEB 2AQSA 2XA8H 1BQHG 1NFIA 2DQJL 3QARA 2XY1A 5C86A 5DS8A 1OAZL 3ZKXC 1YAIA 1JZ3A 3QWOA 4TNWF 2Y2WA 1EJ8A 4K3DH 4R7XA 5CEXB 1Q94B 1U92B 4W6WB 2KZWA 1IM9D 1Q0XL 4Z0XB 3VQ2C 4I5BB 3UTSB 2QKIA 2ZG3A 2APWA 4Z7QE 1BA9A 1AIFA 1A2YA 3OMNB 4F2MA 1D5XB 1AOHA 3RDTD 3ILPA 1WZMA 2O5ZH 2JIXB 1X5IA 3CWGA 3NIFB 1NLDH 2LQRA 5FXCH 5IW1A 1WBXB 2IH1B 2DKUA 3P0YL 1NSNL 3GSUA 4YFLI 4BCXA 3DXAA 4FQXD 1EJOL 5AZEH 3G08B 4LSTH 2AQNA 4EBQH 3R19A 4G8AC 1YEEL 4X9HA 3KPOB 5JPMC 4Q74A 1T1XA 1CUOA 4WI0B 3QEUB 3GXPA 4PVMA 2Q8BL 4EUPA 2C5DC 2VUKA 5MEOB 2KT6A 4HXBH 4P06A 3V0FA 2B4CH 4RAVA 4OZHF 5DO8A 3RGVB 2ENSA 1PL3A 2CR6A 1L0XA 1XB6A 1E4WH 2BVPA 2CUIA 2JTDA 3CIAA 3QUXD 4L8DB 1VGKA 1AJ7L 4DVBB 5C0BB 5HDWA 1AGCB 1TQBC 1MFVA 4P04A 4I0CC 3CH8A 4I3SH 3IKCA 3B2PA 1MZYA 2X0VA 4ZXBD 4JJOA 4KK8C 1KGCD 4WUKH 2OMXA 2X4UA 4RIRB 5DRWB 3UYOD 1MCKA 3VD5A 2PCPB 2W88A 4CJ1A 3II1A 4I0PB 4LGRB 4PRID 5E08L 3VWJC 2GIMA 2HVJA 3OC5A 1LDPH 4HKBA 3ZHKA 1G7JB 2R1XA 1DSFH 1ZIAA 3GMQA 2AQ2A 4G8FB 4NKQB 3PQYA 1KSRA 2AEPL 1FL3B 1BD2D 4TVSa 1N8ZB 4B9PA 2GITB 5ALBL 1DLFL 2H32B 4HGKC 3SDAA 4C56D 1AD9A 5IREA 1P84K 4S0TD 2PNDA 3FONB 3IJHB 4EN3D 2K0RA 5DJDB 3CK0H 4K15A 2FQGA 5D7SL 4C83A 2J12B 3NN8B 4CA4A 4TSAL 5DMKA 2XXGA 4YS4A 5LAPA 5IB2B 3PNWB 1KPUB 1MKFA 3L2NA 5FUOL 1H0DB 3OC8A 3MN8A 2VDOB 3HG1B 4P59H 4PJEF 4K0OA 3EJZD 3BZFA 3EGSB 5C08B 3LB6C 1M05B 2D4DA 2QPSA 2H3NB 2XJLA 2YRBA 1AGFB 3WIHL 5EMYA 3BT2L 1SJMA 4PRIE 5KOMC 1I7ZA 4HBCL 4I2XE 1F58H 4XAKD 1HL4A 1QVOB 3BIKB 4AMWA 3CV5A 4G9DA 2WVVA 4FAAB 4C58B 4GUCA 2VN4A 2YC1A 2WQWA 3ZE0B 2G0LA 3BVXA 1XSJA 4ZYKB 4J3OC 1QFHA 3Q8EA 3B8YA 4H8WC 3V9CA 3KL5A 4WIQA 5BMFL 4FQ1L 4X6FB 1YPZA 3I3BA 2APTA 1DE4B 4RGNC 2XXCB 3CG8A 2W38A 3ULVC 1UXWA 1M6UA 1QKZL 3MCKA 3S88L 2NNXA 3HIZA 1E50A 5KVFE 4CVZA 4JBSA 1II4E 1AXTH 4XMVA 1U3ZA 3RIAF 1TNMA 1KCWA 4BFGA 1J1XH 3ESVF 4G9FA 1LK2A 4GIPD 1T20A 3C6LB 2ICES 2V2XA 3I02A 2AEQH 1FNAA 1CFNB 5J6GB 3RB7A 2WKOA 5JDSB 4XRCB 1HIMH 1UWYA 4HK0B 4OFVA 1LEKA 4DGYH 1ODAA 2RHEA 2XWTB 5CCKL 1MJJB 1W0WA 5CJQL 1JXFA 2P47B 2Y7QB 4JFVA 1CD8A 1U8NB 3FKUS 5E70A 3NTCH 3D0VA 3WLBB 1CDHA 1NICA 5I76B 1UYWL 4ZOCA 1QLEH 3HI1B 1HZHL 3IDJB 3TCXA 1WC7A 3G3LA 1MIML 1SXAA 3LX9A 1KJVB 5E8OA 2W94A 1IGTA 1HEZA 1CDJA 5EOCJ 5DYOA 3FQRA 2VR5A 3ZKMD 3IN2A 4M8RA 3CZEA 4NUJA 3MBXH 1OAXL 2YK1L 4PJIB 3MJ9H 4Y7OC 2AXHA 3QQXA 5F0MB 5G5DB 3G5ZB 3S97C 3EJUA 4HZAA 4B3EA 5TQ0L 25C8H 4AL8L 3VFOB 3KVPA 2IXQB 4DP4X 3V4LA 5AOKA 3QUMA 4HOXA 2ADJA 1T0MB 3VXMA 2ZAGA 1UWGH 2NSQA 1GIGL 1EMTL 5DA4A 4FMVA 3GM8A 4X9BA 5E2WH 3WHXA 3CDGA 5E6SB 4DN4H 1L9OA 1RERA 5C7XH 2YSTA 3MRKB 5JHDE 1QFWM 3CN0A 5F7FA 1PLAA 1NIFA 3A23A 1UKQA 3FCBA 3O9WB 4HS6B 3QI9A 3LQAH 1E9OA 5FCUH 5E94B 2CO6A 2IO5A 1SJXA 4FJYA 5EA0H 2P46B 3FSZA 4ELKA 4KQ3H 2YUWA 2QTVA 1KEML 2E74C 5GS1A 3UC2A 3DKHA 3TA4D 3PABB 1T80A 1XF5B 4YLBA 4B3VA 4MJJA 5FHAH 4MAUL 2B77A 1E9PB 4FTVB 1A7RL 1SFDA 4ZUVA 2NR6D 4CSSA 3TBTA 4ETYA 1P4LA 3N85H 4R26L 4YDJB 4UINH 5B7EA 3W5NA 4XWGH 2H9GB 1N2RA 3AY2A 4QRAA 4M5YH 4YPGB 1UOWA 3T3MF 3HFMH 4JMNA 5ABAA 3PDDA 2ENPA 2D9QB 2V7NB 1YHPA 4ZS6C 4NQCD 1NFDA 4NQQA 3HE6C 5JXAH 3QDAA 1CQKA 3EJYC 1WFMA 3GS0A 1J5HA 4MMZB 2BW5A 4FG6D 2X87A 1USZA 1A6WL 1FZJA 3ELQA 1KGYE 1GZQB 5MHSD 3WO3B 1BFSA 2HT2C 4R7NB 4RNRB 1FBIL 3FHQA 3FQNA 3HNSL 5C2BH 3WTYA 2AFNA 2YBRA 1B3IA 3SE4C 3DVGA 3QULB 4OQ1A 1E5ZA 2VISB 1MCWW 4M43H 3VFSA 2GSIB 1WWAX 4M61B 1SJHB 1YECH 1S5IL 1QFWL 2FHFA 4G1MB 1UXSA 3UXFA 1DQLH 4WI2A 5ACMA 1N5AB 2HLFD 1KCRH 5DLML 4ONGL 3RG1C 2E7DA 2PABA 1S7XA 4FHJA 3K6IA 1RZGB 3TBVA 2CK2A 3CLFL 1T3FB 4FFYH 2BHZA 5EC2B 3VD4A 3L5XH 4PSPA 1IC4H 1W0VA 3WFBL 2YXMA 4R2GB 3MV8D 4NCC1 3FBKA 1ZT4A 5GZOC 3TNNB 1O6VA 2YPKB 3BDXA 4OFPA 5AWNL 4ZFOL 3H0TB 2XETA 4KX8A 4PJEE 4OIBA 5E6YA 4DUWA 5IJCC 3DTXA 3T8XB 5ICZB 5KN5B 2EVHA 3QNYA 4XO9A 1X7TA 2VMDA 4QHKJ 1B6DA 2E7CA 4P5TB 3T3PF 2RFXB 3IBEA 2GIXA 1GMIA 1TJIH 3B9KD 4A37A 4AYEC 2EACA 4LPCA 5B8CB 4ODHL 3VGAB 4U6HB 4FYSA 3WFEH 1ZRUA 3VGDA 3C09B 4DH2A 2FATL 4GRMA 4OLUL 5EOTB 5EUOB 4ZUWA 3EKCA 3JWOC 4WWKA 2YKKA 3FFCB 5A40E 3RA7H 1HKLH 2A6KA 3AJ7A 3F58L 4NFDA 5D7HA 4LLDB 2SODB 5TE6L 3UADA 5GRUL 1O6SA 5HHXL 3EBHA 2DYPA 3K6SB 4M7ZC 5FAAA 2YGNA 4MLSA 2HVBA 3QUZD 3UAJD 5CLWA 2WOBA 3AXLB 5F72S 5I28A 4HVBA 5B4MD 3ZDZB 3H55A 1ZLSH 3BQUA 3CFMA 5INDA 5F9JB 4N8VB 3WNMA 4DTGH 4OZIA 3GBDA 2YQ3A 2GK2A 3KPNA 3NIGB 3D34A 2VB5A 5GRXG 5K9QG 1FVDA 4L1LA 1TTBA 1HT6A 5ESVB 3QDJB 2UUDH 3IMSA 3PL6C 1TKWB 4HG4J 4RZCA 3ZE0F 4J1UB 4DGIH 3QZBA 2UYLA 4G8IB 2CXKA 4HAFA 1T89C 4XN9A 5C0AA 4D7PA 5KSVB 5FF6A 2PW1A 5I0DA 4XZUB 2FE0A 2XIDA 4ODXA 3SPIA 4HPOL 5CIPB 3MRIB 3EDKA 1X5ZA 5T1KB 1F5WA 1MPAH 2PXYD 3BI9X 2P1YA 2ADGB 1H6UA 5FC9A 1HHIB 5HDOA 3RURA 1V05A 4F1SA 3D07A 2A73A 3BHBA 4YDKL 1QNIA 1MQKL 4PS4H 3TWCH 3VW3H 4YHMH 3VXRA 3ZL4L 1WK0A 3WFDL 4N86A 4DVRL 5LGHH 4GBXA 4FOMA 3U9UB 2UZXA 5G4NA 1KCSH 2O6EA 3BSZL 3ATAA 4KAQL 2CR3A 5KJRL 4QOKB 4Z1PA 3VH8A 4AXWB 2VO5A 3FCUB 3MROA 4OUUA 2O61A 2LHAA 2YHGA 2EEXA 4G8EB 3PHQA 1HEHC 1KB9J 1ZS8A 4JY5H 2F1AA 4PJ9D 3ARBC 1S7UA 3G04A 3LN5A 4Z7UB 5TF1L 1DVZA 1QBAA 4PY8J 5EULV 3T4AA 2FBOJ 3CX5K 4MB3A 3OM3B 4LCVA 1G1OA 2CO2A 4AG4L 1VFMA 2E76C 3SYAA 1CE1L 1I31A 1RK7A 2F7IA 2WWNA 4LF3B 1I3GL 3WN5C 5GGQH 1OGAA 3FRPB 2IAND 1AXIB 3EH5B 4H1LG 4OY9A 3WIIL 5BNXD 1Z7JA 4H5SA 4RZKA 1FL6A 2CA3A 1DUZA 2GTZB 1PCSA 2OW6A 2KS0A 2EDRA 2DWDB 2ENYA 4HAGA 3DJSA 3HA0A 4NQED 5DK0B 3T3ME 1UA3A 1H3GA 2VC2H 2QPEB 4M1CC 4R97C 3SDCB 3VXTB 2I9LB 4YQXH 5CHNB 1KLGA 1CLZH 3HJEA 4NN6B 1K2DB 3F6JA 4AIZA 5D7JB 1ZWIB 2UWEB 4S1DD 1EXGA 3B3BA 4LVNC 1AGEA 2IF7A 2Z8RA 1A1OA 2PWEA 3OJDB 3GWJA 3AAZB 4WW2B 3CQPA 4GAGH 1CR9L 4Y4KD 4BWWA 2VDOL 2AJXL 3AROA 1PYWB 1UQSA 1UENA 5D1QC 1JTTA 3BKYH 4OFYA 3HZ3A 2H0PA 4YX2L 3P77A 5C0GA 4A55A 4HIHB 2IMNA 3KCPB 1YEIH 2FBRA 2OL3B 2X2YA 1N4XL 1X7QB 2CBMA 1HK6A 5DDHA 3EJQA 3J2PA 3MV7E 2EO7A 2DQIL 4HOWA 1QHOA 4FDWA 1OAKL 3QR2A 2IANE 1JWMB 1EZVY 4TL5A 3VG9C 4BFNA 5ES4B 5I1EH 3WTUA 3D39B 1M56B 3UERA 4HMCA 1WAAF 1YDPA 4NQDB 2B1AH 1DQQA 1M71A 5FKPB 1NGQH 4HCIA 2JLLA 1XEDA 2H6PA 4JY4B 3QPQC 4LVHC 1RZKC 3FT0A 4FQJH 3P4OB 1YJDL 3KHOA 4LDOB 2CA4A 1XF2B 3BCDA 4PRDA 4B5EA 4D8PB 3MLWH 3DBSA 3DX7B 4GO8A 1PZ5A 4K8RH 1VESA 2IG2H 4YAQA 5AG8A 1Z6JT 3ARFD 3SZ6A 4HUCA 3VU1A 4WO4B 3DPBB 3PHOA 5F89A 5KZCD 4P4KC 1DTUA 3MUZ1 5CF3A 5DJZA 5I8KL 4NPJA 3T2PA 3PWVA 4H0GA 2DMGA 3D2UA 5HHMB 5KYWB 3M88A 5AAMA 1KCVL 2WTOA 2Z6FA 5I8OL 1LLAA 3D52A 5TDOB 5F3FA 1N9PA 1X5FA 3A6CL 5HPOA 1QSFD 1L9NA 2D73A 4BFBD 3U4EB 3KBHE 4FEMA 1LO5A 5FYKH 5KBMA 4Y1AD 5GHWL 4YHNA 3HNVL 3SN6N 2GFBB 3VM7A 2Q86B 2BDNH 3FUNA 4PP2B 3TO2A 2NZIA 4JFZH 4LAQH 5F8QC 2NY7H 1JFHA 2IFGA 3BH8B 3HG0A 1JAEA 3UTTB 1E4XI 4XVTL 3MXWL 3DV4A 4GMTH 4YO0A 2VR4A 2PCXA 2WWOA 4HJTA 1OARH 3ZE0E 3BAIA 3BESR 3ROLB 2WWKT 3HZYB 3N1MC 3UCQA 3F7LA 5IOPB 2GJ6A 1EHKB 3JBG7 3M1BB 3V10A 2A38A 4B60A 1EXHA 2WGXA 4KRPB 4JDVA 3J27A 5EUKB 3S3SA 2J6EL 3QISA 4LB8A 4TUOA 1HHHA 4Z7OB 1YNTB 3TBYA 4H40A 1XAKA 2AEIT 4OCWH 4AMKH 3TURA 2Q0ZX 3UBXB 5KSAD 3C08L 5K1VA 2CALA 5I6PA 3ZTNH 3WOVA 3N3EA 1U8PB 3BPOC 3U25A 1M7IB 2D7TH 4YDZA 1D6VL 2VXTH 1NCUA 3N0AA 3NIGF 2VDKB 2WMPA 5GSRA 3OQRA 2BNRD 2Q20A 2VXVH 4FNUA 1SNRA 4Y1AE 3COOA 4IOFD 2JXMB 4LASL 3E8UH 4G1EB 4GI8A 3T0ED 4E41B 5JW4N 4OD2A 3HVNA 5K1JA 3MRRA 1CIDA 5DFVD 1MFNA 4YHPA 4UBDD 2EKJA 4JFFD 5DO2D 5J3HD 5CZXC 3DMMD 1SN0A 3O3UN 2WANA 2IMMA 2NUTA 1MCRA 2IGFL 1RZFH 4N22A 4F5CE 3FMGL 1I1AB 5TD4A 1Z1WA 2VL5A 7PCYA 4F57L 2C3VB 4GSDL 2IDSA 1QLRA 4LVEA 4NO0A 1FFNA 4PB0H 1YY8B 1HE7A 3ARZA 1FGNL 1Q9WA 2NY1C 2TAAA 4XNMB 3CMOH 4FTDA 2XI9A 1G7PA 4LCWD 4ZDHB 4TRPH 3OXRB 1G7MA 3BVWA 1WHOA 5I16A 5MP6H 1IM3B 1IL1A 2E46A 2Z7WA 4CVXA 4PLNC 4JUTA 4WI5A 4Z7VA 3DO7B 4MYWB 1BIHA 4X5LA 2FDBP 4GQQA 1S9VB 5CBAA 2NY0B 4M5TA 3P30L 4O58H 1NBVL 3N42B 5C0DB 3TP4A 3MDJA 5A6MA 1YN6B 3TN0B 4IMKA 4GLRH 3ERXA 1XR9B 1T04A 1RZIA 2DQDL 2JQAA 3P3UA 3LKSA 5GZNC 5KJ7E 4YWGL 3CMGA 1TITA 3T0EE 5HPMA 4W9DC 1I82A 2OMWB 2PR9A 2QVFB 2APXA 3I2CL 3MJWA 4WQOA 4XN1A 3R7QA 3VJ6A 3WV0A 4LCCA 1W0YT 4I13B 3ECQA 4XCCL 3CBJB 5C0JA 5IIEA 3BWSA 1IZJA 3KWWA 4HUNB 4X4ME 1TTFA 1U8QB 2BP3A 4AE0A 4CJ0A 1YYCA 4FA6A 4XNBA 3D33A 1PIFA 4NJAH 2A77L 2LVCA 4JANA 4WEBH 5T1DH 4EI5D 1XCWA 2OXHA 3DVNA 5C3TA 2R0WH 4RESB 4LL9A 3CFEB 4UYQA 1UH4A 2GSMB 3NJGA 4K55A 4JRLA 4UOQA 4A7SA 5JPNC 2EUXA 3LKQA 1J1PH 3RFZA 2FLBT 3GHBL 4F9PA 3VYOA 4ENED 1HAWA 4X7SH 1WAAE 3A5VA 4GRWB 4WGWB 4HULB 2KUTA 4Y4HB 2ATAA 2YD5A 4JFTA 4POZD 4FG0A 1N3NB 2ZP0T 4Q6IB 4EE2A 12E8L 2ADFH 2WPGA 5D6DA 3GSNA 2V2TA 2XFXA 1JRHH 1MAJA 3FB7A 1AZCA 3CC5B 4ORGA 5E7BA 5EHFA 1C8PA 4PGEB 3VI3B 1BAFL 3MOBH 4HLEA 5EIVA 1JV2B 1YO4A 1EVUA 1XGTA 2FECI 3IGFA 4C8XA 4XNQA 3ARDC 4DOHE 4N4YB 4MD4B 1KIPA 4M7KH 4WAFA 4ZMNA 1VGEH 1XF4A 2ARJA 3C2SA 4HWZA 1AIZA 4I3RL 1A8ZA 1XGRA 1ZXQA 3P4NB 2Q87A 5ACLA 1FG2B 2H8PB 4G5ZL 1F3JB 1FH5L 1E30A 1GZPB 2W9LA 4DP6X 3GMNA 2QMJA 1ILUA 4QUOA 3QIBD 4Y8AA 4ECNA 5I73C 3BUPA 3QIWD 4PWEA 3AWEA 1NDGB 4A7TA 3Q6GH 3UO1L 5BJTA 1CS6A 1EWHA 2CIIA 4KI1A 4PI2A 1BFVL 1ROWA 2V4LA 4W6XB 5GGUB 1F2XK 3L4VA 1U3HB 2LFEA 3Q8AA 4QTIH 3TBWA 3E3QC 4F7KA 4QXGL 4HFWB 1J9RA 1TVBA 1C8QA 4W4OA 3ATBA 3JV0A 5SWSB 2WB1A 3C5XA 3U30C 3MJ8B 4L8CA 1ZGLA 4KO9A 1P6FA 2MKWA 4KU1A 4QHMB 4MSWB 4DERA 4G7RB 1R5IA 2X7LA 2HT4D 1JUFA 4G43B 1FPTH 1L7IH 1MEXH 4L29A 4BA8A 5KG9A 4J4PD 1ZE3C 1O6TA 1I85A 2G5BB 3KD4A 4NQXA 5K69A 1A4CA 4MCZA 1CGWA 1A6UL 1UJ3A 1T4WA 4XHJD 4UTBH 4KK6D 3FFCE 1JI1A 3MRCA 4WGKA 5DJ0B 1YUHA 4YSUA 2JMRA 4B7LA 5J89A 2ESVB 2DI7A 4N25A 4WEUD 3ZDXB 3I75A 1OTUD 4AE1A 3V0WL 1VDGA 2R1WA 4PJ8C 3HE7A 5EU6B 5GRWA 3STZB 4Z18A 2PCYA 3F62A 5FWQA 5C9KA 5I71B 5EBMB 3HE6B 4Y16A 2ETWA 4N3TA 2VXUL 3S6CA 3JSSA 2YAEA 4NKIL 2DL2A 1U3NA 2DLHA 3HMXL 1WT5A 4PRHB 2F2HA 3NIGE 5IF0B 4FQ2H 1WS7A 1YLBB 5IHHA 2HFFA 4ZG1A 3K1KC 2XZCL 1INQA 2EXYC 2F08A 3GBEA 5FYLL 1SFHA 3Q01A 3WJLC 1A25A 1KYUA 1E0OB 2DM4A 3SDDD 3AS3A 2J2ZA 4R84A 1DVUA 2DIJA 4WDIB 1G9MC 5H8DA 1OHZA 1M7XA 1JBJA 1KXQA 4Y5VA 1KLUA 5E7FA 4G42A 1QZ1A 2E9IA 1BHGA 5D8JL 3RWIB 3CQQA 2R23A 4ETQA 1URLA 3CXHJ 4FHKA 3M6DA 1FN4A 5T3ZD 2FZ3B 1AS6A 2P45B 5D7EA 4XCEA 3FJTA 1HQRB 4LSDA 2OL3L 1K6QL 2NNRA 5LBVA 5I1LA 5KYXB 5E8DH 4NT6A 1IAKA 1MHCA 5AENA 1BQHA 3IS0X 4NQSB 2GAZB 5EC1B 1JERA 2EIZA 4QOKE 1A9BA 2ORBL 4YC2C 3D7PA 4WTXA 5IJVA 3JV6A 1T1ZB 4HWBH 5CUSH 1DQDL 3LD8B 3U6XS 1S7RB 4X98A 3ULSB 1F90H 3H3PL 1H6EA 4PG2C 4YDVA 3IK2A 4RRPA 3GMLB 3LDBC 3FUEA 2QQNL 2EVJA 1UGKA 2JK5A 4U6YB 1LJMA 2Q1EA 1NCWL 4X5WA 5CD3A 1IQWL 2F7QA 1ZVHA 4LHUB 4IBWA 5D96B 2NY6D 3EJTA 5I1AA 1J0JA 3BX7C 1WWCA 2CUHA 2LW3A 2QL1A 4M48H 1YEKH 5SWZD 4G7YH 4K3JH 1KZYA 4RMRA 2J56A 3SYCA 2ZKWA 5FM5O 1I8MB 2IIJA 4LSPH 2YD0A 4HEPG 4NGHL 4DW2L 4PJXA 5K9OA 5ILTH 4AIXA 4D8OA 4IIQC 1G7IA 1G1CA 2D3JA 5FYLE 4C55A 4P57A 5T3ZE 4WO0A 1HHKA 3O11A 1QBML 3B56A 3X14B 2E7BA 2E7HA 3BVUA 3MAWA 2TSBA 1QFOA 3LOWA 3N42F 4OCNC 4OTXH 4ADGA 5I1KL 2IDQA 2BNQA 4R4BB 4OF7A 4YSPA 1I9IH 5K93A 3X1FA 2GJRA 3GJFH 5D1XA 4HHGA 2MOGA 1WITA 2G5UA 4J3OF 3NBNA 1KFAL 1JK9A 1HFUA 4DN3H 3UYRL 5J1SC 5J0BA 3E9TA 5JOEA 5KTEH 3ULVF 1N59A 1RLWA 2YAOA 5F7NC 4IRJB 4OCLC 1R0AH 3B2VH 3ISYA 2ZOWA 4F15B 2MCPL 1KWGA 1H3PH 3CN4A 3EJPA 3PHSA 5IFAH 3A21A 4Q8BA 2XBZA 4HH9A 5JZ7C 4AITA 3TZVC 4HAKA 3GSWB 4YR6A 5IB5B 4XN2A 5D7LA 4IBTA 1RKRA 2ZP8A 4IMLA 2OSLA 4Y19B 3O3BA 5D2LF 1VKXA 1C16B 3IVKA 3ZMNA 5FUCC 3D39E 5TGBA 2QVMA 3LEXA 2C7FA 4BKLB 4OIAA 4LSSH 4GRWF 1K3ZA 4MVBC 2OMVA 2AAAA 5DQDH 1ZV2A 4F27A 3L9YA 1G6RH 2OCFD 2IQAB 3MUY1 4UQBA 5DJ6A 4F37F 1EEYA 2EDNA 1HH9B 2FX8L 1QUNB 3LZPA 1CFQB 1PJ9A 2NY4B 1QPXA 4QRPA 4JNXA 2VKXA 1BZ7B 2R56L 3VI3F 2MFNA 5FWRA 4E0RB 1U42A 4RFOH 1MCOL 5I75C 2ILLA 4A2FA 1IRAY 1KENL 4ZMAT 4YXHH 2VDKL 2P8LA 3FTGB 5AYQA 5KS9A 2DL9A 5ADPH 4P2YA 5J9PA 1OD9A 4FA7B 4Z7WA 4A6YA 2ATKA 4GKNB 1MCNA 4UQIM 4MJ4A 4WHTB 3NGBC 2CRYA 3EYOB 4KK8D 4AQAA 1LMKA 4JFWA 1T21B 3IJEA 5HHME 3O0RH 1I3VA 4TOYL 5FA4B 2OS7A 3W0WB 4OLWL 3HC4L 2EXWC 4XP6H 4MD0A 4PJ5B 4P46B 4UDUB 5E1GA 3S5YA 3VWJD 3GBNH 4FKKA 4L5FL 3SGKA 3AUVA 3FSVA 4WFHD 2J3SA 4GXFA 2HLAB 2N7SA 1NDMB 4HIJA 4NC2B 1N70A 4XBPA 2BP8B 1KMGA 4MJ6A 1NJ9A 1JMZA 4JFXA 4XHQA 2ZSVB 1CN4A 2XWRA 5MEQA 3BP4A 2PO6B 3QPXH 2BIHA 1CLYL 4DO4A 1HJBC 1BQLH 3HHMA 1UASA 3UTTE 4XNZB 2BFVL 2ZX5A 4HT1H 2OM5A 3CZUB 5DJ8B 1S3RA 4P9HL 4QYOA 1K4CA 1WBZA 5CD5C 4NIYE 1GC1C 2VLRD 4F33B 3MLUH 4IBYA 4P3CL 4CSPA 2YPVH 5EH1A 3R0NA 4BH7B 4Z3HA 4JJ5B 3ZL1A 2BY1A 5DC9B 3VMPA 3ZDXF 1PDKB 5GXBB 3ZOAA 4N8VG 3LB6D 3BWZA 3KE0A 4L3AA 4OJEH 4JVWA 4JRYB 5CINH 3KH3A 3BZ4B 1UWXK 3P9WB 1CU4L 2W80C 2P24B 2P28B 2QR0B 3QDGA 4FG4A 4YE4L 1L5GB 1T5XB 4UAHA 4UM9D 4HUXA 1TZAA 2PYEA 5DF0A 4UIMB 3K2UL 3RI5K 3MLVH 4WFHE 2F54B 4JO1H 4J3OD 3Q48A 2RIKA 3VXUD 1K3IA 1LHZA 2AJSH 4E41E 1H8OA 3LKPA 5BQ7B 3OKNA 1UUNA 4TSCH 2AZAA 4KJYA 4RGND 1FIGH 3ULVD 4WNJA 4XC1L 1AR1B 4MQSB 4IU2A 4X9YA 1ZLUK 4JG9A 2A3TA 1HL5A 2CLVA 1RZPA 3CLEL 3HLAB 1HNGA 4J6IA 2UZYB 1JHLH 5JHAA 2VLRE 5D7IA 4OZ4A 1MF2L 5DS2A 1A1NA 2W91A 5ANHA 3T2OA 1Q8MA 3TJEL 3MRPA 1HSAB 3X1GA 1NGWB 5CMAB 3SE8L 3ZBMA 4BSVB 4LCIH 4NIKB 1MSPA 1JHTB 1FV1B 2HUEA 4ODVL 4UUJA 1KBGL 3HZKA 4DP8X 5JORB 2R0ZH 1WBYA 2UZIL 3QORA 3ZUCA 4ESKA 3O6MH 1LM8V 1EAPB 1UTDA 4JRXD 4ZZKA 4JPWH 2CZNA 3TNMA 1I7TB 4XPAH 1G9EA 1QA9B 2XWBA 3IB4A 3IPFA 4PRNA 4NAJA 3ETTA 3NZ8A 1JZGA 4LQFH 1YYLH 4W4NA 4OB5H 4EN2A 3WEXA 1ORQA 4L1BA 3FRPG 1VCAA 2DQEH 4S1RH 4W9KC 5F0LB 3VXUE 4B9IA 1F3DH 5D2NC 3GXNA 3D69A 3TYFA 4PRBB 4RGNE 3ULVE 3IJYA 4K9EH 1DO6A 5DVMA 3QZMA 5HGHB 1Q72L 1TFHA 1KB3A 2PUQT 1Q9LB 4K23H 4YHZL 3I9AA 4XE0A 4Q9BA 1ROCA 4RMUA 2EH8H 3JWNH 4KO7A 5EZPA 1FC2D 3QUYB 4NM8H 5E9NA 3BPOB 2YWZA 2XU9A 2BIQA 5FCSH 4XAWL 1O7VA 3W39B 4S0HA 4WJ5A 3GSOB 5D2LE 1DDHB 3H1ZA 2OMBA 5J8OA 2D31A 3QCUL 2WLIB 4RLDA 2MQ0A 4N9GB 3B7RL 1CT8A 4GRWE 3WGUB 1U95B 1AO7D 2JKXA 3VFUA 2ZWKA 5E6IA 3L16A 1GZHA 1BEYH 3RDTA 3U4KA 1AY1H 3VXOB 3OHXB 2K1MA 3S96A 4N1CA 1N26A 3U4BL 3U83A 2XACC 1CFMA 2ZCHH 1RZ7L 1GGIL 3ARYA 3QA3A 4ADJA 5KVEE 3VI3E 4FQXA 5MENB 3LVTA 4KJPC 4M5SA 3SQBA 3UPAA 2VJ8A 4A7VA 4RA0C 1CL7L 1QG3A 4XB8A 4FQLH 3MV11 4FZ8L 2VXSH 3CGTA 1GOGA 4L9LC 4UT7H 5DD5L 4DEUA 5D4HA 4YXKH 2WIIA 2WWKO 4WWNA 3NSJA 2QZQA 3F01A 3DYMA 5L4FA 4U1LA 5GJSH 3L54A 3TESA 3BUBA 4NRYB 1NCAL 2GUOB 1SEBA 3ZSTA 1LE9A 1TVHA 3C5JA 4RWYL 3Q1SL 3DIVA 3L95A 4K71C 4ZS6D 2Q7AA 5BRQA 3PP4H 1AKPA 2F15A 3EJYD 4CADB 5AEAA 4KKZA 2PTVA 2WXMA 4EMZA 4ZXBA 1ADQL 2CGYA 3UOAB 5FO9A 2DQHL 1YEJL 2ZKYA 3VCLA 4PRIA 1U93A 3NSYA 4I2XA 1CF8H 2R69L 2CNZA 2HT2D 4NDMA 2W9EH 5FDWA 3Q43A 4JHWL 1Z0NA 5D1ZB 5ADOH 3VO0A 1AO7E 5AVXB 5DVPA 3Q3GB 4YL4A 3HHRB 4GS7C 4CNIA 4F7TB 3V0AC 4JLRA 1O0VA 5I1CH 3W5MA 4U1SA 4WKZB 3ZKNC 5F7DA 2A74B 1C7TA 3V4UL 3CSGA 3MREA 3FTWA 3PJNA 3AREC 1QEWA 4JM2B 3WJJC 4EN3A 1T7VA 4HXAH 2X42A 3LZFL 3MGOB 3CX2A 4LEXL 4MNHA 1XZ0B 5FK9B 4N2OA 3WEOA 2CDFB 4QIRA 5JPNB 2VW4A 5GZOD 3TCLB 2IPTH 3ZDXE 4TQ8A 4F91B 2GJJA 1IGIL 2ZUQC 5F7YC 8CGTA 1OSZB 4KQ0A 3B6SA 5EOCL 2YMTA 4P2QB 3BVDB 4NCDA 6FABH 3I50H 1FA4A 3PP3K 1U8KB 1AFVL 3WNNA 3F64A 4H1LH 3VDCA 5JUEH 4HJJL 5KYYA 3CFTA 1H9DA 6PAZA 2ZAHA 1AKJB 2IDFA 2VDPB 1KYOJ 2OV0A 1C1EL 4U1MA 1NANI 3IF1B 4KVPA 1JGEA 5C09D 3AVEA 2NNAA 4FABH 1M1XA 2D7NA 3LRSB 2DH2A 3CN3A 3UZQA 3VRJB 1EHLL 1RCYA 1RLBA 3U7AA 3P2TA 4U1KB 5IHWA 5KUMA 4MDJA 5GS0H 1DSWA 4S1SL 3VAEA 1HOCA 1A7NH 3CZFB 3QDMB 1U58B 2HKHL 3NOIA 1OAQH 1ZVSA 3UBXG 1FFTB 1EGJH 4HSQA 1CDIA 5FFGA 2X2JA 2CUMA 2OA9A 2PP8A 3I9GH 3QUKB 3IMTA 3S5ZA 5TE7H 5EPMA 1I9EA 1J5DA 1PLGH 5TQ2H 3WIHA 1KV7A 4QTFA 2UVFA 2QMKA 5EBLA 5C8JB 2DJSA 3TV3H 1YYMH 4JO3L 1A3LH 3TT1H 1HZKA 2A9AA 5CJ8A 2B16A 5ANMB 2R2HA 4EKXA 3F83A 4M00A 3UG4A 2B5IB 3FU7A 4MJIB 4U6TA 4GXUM 4KK9D 1KJ3L 1D5MA 1NGYB 1MAML 1BSIA 3GGWA 3PL6D 4KRMB 4J3SA 3MNZB 5JHDA 4CU8A 2DLGA 4P2AA 2FWOA 2BHUA 5A7BA 1FFPA 2E8YA 4MJ5A 5CILL 2IALA 2VR9A 4QKXB 1JZ4A 3GUFA 2LABA 3H9SD 1OQOA 3SGEI 5SWQB 3B9AA 1YQVH 3HPJA 4R3SB 4M7JH 5DR5H 1KEGL 3FT2B 3ETBF 4L4TB 5C09E 2V5SA 4JFQA 5LNGA 1E5CA 1JZ6A 1PCXA 3HW7A 3ILDA 1MCSA 1C5BH 3O81A 2CJUH 1OSEA 2EXTA 3MACL 4Y8DC 1T5WB 4MWFA 2QEJA 4ODUB 2OMTB 3FRUB 1IC7L 1MFCL 3EO0B 3GRWA 3NUKA 5C0FA 2XKNA 3PXJA 1HHGB 3LTVA 4OM1H 4ZNCD 4OH2A 2CDGB 5F70A 4AQEB 4JZJA 3TOPA 3MHZA 4KY1L 4MFHA 3KHQA 4ODSH 2UY6B 3SSGA 3IGUA 4BWTA 4Q58C 4KZDL 3WKQA 4M8UA 3EOTH 1RIUH 3DX6B 1MRCL 3OR7B 3QJZA 1MCJA 3BKMH 4TNEA 2WBJC 3MVSA 3S48A 1INDH 3N5AA 4FXKC 3WS6C 3GSXA 1E5BA 1QRNB 1JNNH 1PY0A 3ARBD 1OPGL 2N0MA 1PD6A 1NBYB 1RK1B 4K73A 1IILE 3LNFA 5CCGE 3VFVB 4F7PA 4NXKA 1YAZA 1ZVNA 3FOLB 4G6JL 4IBLT 1BFTA 3H9SE 3ZRCC 2FLRT 1N5YL 1M7UA 5K9KB 2JLPA 2Z35A 4AKQA 3QI9C 3NCJH 5DUJA 3PJSB 1JP5A 5JNYA 1K8IB 3WFHA 2OP4H 1CWVA 1U3JA 1V7MH 1PW3A 4HGMA 3AT0A 1JDAA 2ITCA 4NNPH 4OW6A 1DANU 2CE6A 5FO8B 3SPGA 4OJFL 2DYRB 3ROOA 3ZRFC 3I6GB 5T1LB 2D3LA 2QSCL 4QXTA 2GK0B 3AADB 2JCCA 4ILDA 4OQTL 4M1CD 1KT2B 4P4RA 1RI8A 1G9NH 5KVGL 1HINL 3KYAA 4Y19E 5BQDA 2FVNA 2FX7H 2F8IA 1I7RB 1JGDA 5ESQA 1BJ1J 3UIZA 2R2EB 5HYQA 2EEDA 1B4JH 2V2WA 2V17L 1WS8A 3I6KB 5LCVH 2DQGL 2BIMA 3WO4C 1QPKA 4NFBA 4M1GL 3LDBB 4X6EB 5D1QD 1R5VA 4EXKA 5JW5B 2CHXA 5IT2H 4CMMA 1P7HL 3N44B 3GHEL 3QUMH 1E27B 3BGMA 4HIEA 2F8XC 5BS0B 4KZCA 3ZUNC 1M7DA 3F7QA 5CLZA 4OT1L 1KXTA 1QW9A 3APNA 3KWVA 2XY2A 2XVBA 5E2JA 1T1YA 1CDBA 4LCUB 4NKOB 5I82A 2VR8A 3TF7C 4OZFG 1EZUA 1MIEL 4J3XA 4ZRGA 3HC0A 4X5RA 1SF5A 3BWAA 3QPQD 5C2UB 1S3KL 4O9HL 4AYSA 4TSBL 4PJ5E 2A6JA 3O4LB 4UAOC 3VRLF 3THML 2ZUYA 4MBRA 4F2FA 1E4JA 4WUUD 3BAJA 1DUYA 2WM0A 4JDEB 1QRKA 2ZKXA 4R8WL 4GO9A 5FV2A 3QG7L 1AP2B 3CSTA 1W72A 5D4IA 2ZPKH 3QBTB 1DN0A 1Q0YL 1J9SA 3TL5A 1P2CB 4JK0D 4KGLA 4UMGA 4P9ML 4P4KD 2G3NA 4E9VA 4GQRA 4LRNH 3LNGA 2QTEA 4TQIA 1T22B 2NQ3A 1J8HB 3K7UA 4HCFA 3BWUC 4S2SA 5AOJA 2HG5B 2MCMA 2Z31A 3R8BB 4ZFOA 3QZWB 3OZKA 1R3LA 2HFGL 2BVTA 1IGJB 4DPAX 3DLQR 1AI1H 2E86A 4WWKC 1JS4A 5AALA 4DQOL 1NCDL 1RUQL 2FL5B 3A6BH 3GLDA 4G72B 4MCYB 3TS8A 3QUZA 1ZXKA 4DZ8B 3N2JA 3K2MC 1QSED 5AVWB 2NUPA 1BPLB 4IJ3B 3BLKA 4XVOA 4PWJA 3U2SA 1UFGA 5IMMB 3HS0C 1J48A 3BQUC 3H7LA 2XFGB 4E9WA 1IKFH 1PX8A 2HX9A 3QR1A 1PTZA 2G9HA 4NNYB 4XO3A 4K94L 2BXZA 3S35H 4IBZA 1KNOA 4WSKA 3SDXF 2QPUA 1MH5A 1CD9B 1ECYA 5F3HA 3VFMA 5DI8B 1VACA 3TFBA 1D6EB 2LVEA 3B2XA 4U0RC 5M94B 1WIOA 4BSWA 5L2JB 1FJ1A 3E6HA 3BFOA 2HN7B 3B1TA 1AYRA 2N7AA 4ZQTA 1ZT7A 3GJEA 2DWEB 2N7BA 4ZOEA 2X1XR 1J9QA 5EF0A 4LBEB 1UB6B 4LLQB 5H2BB 1NEUA 5CEXA 1Q94A 2Z7UA 4Z0XA 4CU7A 1NC2D 1T7WA 2J7LA 3UTSA 2W5PA 4A2LA 3FT3B 1NC4B 5BUAA 5KVDL 4GBXC 1HS6A 3L3OB 3IU4H 1D5XA 4NLHA 3PRZA 4OLXL 5CZXD 2JIXA 1QX1A 4JM4H 4AQZA 1WBXA 4XX1E 1HE8A 4LHUG 3BH4A 1S9KC 1NAMB 2ZX9A 4RAUA 4PJ9A 3D3VB 3S4SA 1UM4H 4L3EB 1IAOB 4HKZA 2D4FA 1JZHA 3OKDB 4OM0L 3KPOA 3LKOB 3RBGA 3RVUC 3WEBA 5AD0B 4WI0A 3LNDA 1DSYA 3QEUA 2WTRA 3AY4A 2NY1D 1GL4B 1N0LA 3BIAX 3GFUA 3NIDF 4UZSA 3T4AC 5MEOA 2XV0A 3BSZA 3RGVA 2X9XA 5ISZD 1X44A 3MV7A 4TNVK 4V11A 4L8DA 1X9RA 5L2KB 4N90D 1JXKA 2IANA 2X6UA 4HZLB 2QQKH 2QVKA 3LNIA 3BPLB 4AUUA 3CTTA 4GQ9L 3IGLA 3NABH 3KBEA 3KBPA 1YRKA 3MODL 5LN8A 5DRWA 1OE3A 1TT6A 2PCPA 3QZPA 1DBML 5GZND 3T2QA 2PYFA 4MQ7B 3S9DB 2XJKA 1E65A 4UV7H 4V1DD 5I1IL 3OPZH 4JR9L 5FGBC 3ULAB 4FJZA 5F1KC 3D09A 3IT8D 1G4RA 2B20A 4IEFB 4G8FA 2WCGA 1JD7A 4HFUH 2I27N 5HGBB 3QAZB 1XD0A 4W9FC 3LSOB 2UY7B 4ZW3A 1FL3A 4YHLH 1BPVA 1N8ZA 4XVJH 5TPWH 1SY6A 2GITA 1KTRL 4WU5B 2H32A 3O6KL 3OGOE 4A7GF 1AOZA 3FONA 1KIUA 5I8EB 2VDPL 2XRAL 4IDJH 4KMTL 1WEJL 2JI2A 2GVYA 4Z76B 2K3TA 1MNUH 4M4RB 3QRBA 1TTGA 3NN8A 5F9AC 1I8IB 4NHCL 3M1CA 2OR9L 3EFFB 4G82A 5E4OA 2H6OA 3VQMA 4AQ8A 3UPRB 1T03L 5IB2A 3OKMA 4XOBA 1KPUA 5IESL 2FT6A 1H0DA 3EGDA 5KSBF 3HG1A 5FKAB 4A7UA 1AMXA 2EEAA 4BK8A 1ET5A 1JPSL 2EP6A 2YD4A 2QSQA 4ONHB 4GAJH 4NP4H 3L1FA 3QNFA 3VRLE 3B9EA 2H3NA 1KYFA 4PTUA 4UNIA 5HGDB 4AYMC 1PFCA 1IKNA 1SOKA 4X8CA 4V1DE 2AS5M 3H56A 3BIKA 4F24A 3ARDD 3W1ZA 3EJCA 1WFOA 3PUUA 1RK0A 4EZKA 4JE0A 4YLQT 3N44F 3VVWA 4NX0A 2XQYK 4X9FA 4ZMOA 4ZD3L 3CZLA 1D2PA 1Y0LA 3FAWA 3I3DA 1RAMA 1AQ8A 4H26A 4KVNL 3FH5A 2BY0A 5EZOL 2I5YL 4FLHA 2Y36H 4YVNA 4P5KB 4MNQB 3MI6A 3QJHB 3BYYA 3A4FA 2FQDA 2KPWA 1DQTA 2GB2A 2NYKA 3C6LA 3CHSA 4KTEH 4GG8B 1CFNA 1XIWB 5JDSA 3BC9A 2JH2A 4XRCA 4HK0A 5D71L 2XWTA 4FC3E 4JFDB 1MJJA 4ZUTB 3MRNA 2JKJA 4LNRA 2NSMA 4HG4K 4W9GC 2C9QA 3CVHH 2Y7QA 2DQCL 1U8NA 4PRPB 2A6IB 4ZFGL 4XMPH 43C9B 4PYGA 2M2DA 5J13B 3NCMA 3WLBA 4Z8FH 2FIRT 5I76A 1X9QA 3GSVA 2WP3T 4UILL 3C5ZB 3IDJA 3SDXE 4L9LB 4F5CA 1VENA 3PE9A 1E6OH 3F7VB 4MZIA 4QKTA 3QDME 3ARGC 3ME0A 5BO1L 1HCZA 3O2VH 2GBUA 2DMCA 2NPLX 5DMIL 2YD6A 1W8EA 3G5ZA 1L3NA 2DEYX 4PJ8D 1ZKAA 5G5DA 5BZXA 4AYBA 1WCBB 1FFRA 2DLFL 3D2TA 3NPSC 3IKKA 4PV8A 3SYPA 2ZJSL 1FUNA 2OQJB 1ZHKA 3D5OF 1B2YA 4FNSA 1CK0L 3M7OA 3D85B 5DVNA 4NHUB 2AV7B 1R6VA 3E3QE 3DRQA 3RGHA 2UVEA 2A9MH 2EXYD 3CIQA 4FFZA 4KBPA 5EU4B 2CLRA 4NKMA 1A1MB 3I6SA 2GBTA 3QT2A 2WVUA 3O3AA 1SM3L 1BBDH 4HS6A 4N2EA 2BOLA 4F8NA 2WQRA 3UROR 3GSQB 3RWCB 5MEPB 3GXIA 1BFOB 5E94A 2J6EA 2YEVB 3T0EA 3T77A 5DWPA 1S5HB 4UT9H 1B0RB 3U0TA 1CXKA 5PAZA 3BE1H 3MNVB 1YNLH 1QSVA 2OKMA 3CFNA 3AREB 4LLUB 3DMMA 4WENB 3CFDA 4ALAH 4XOAA 5E8NB 3PABA 4JHAL 2ZWYA 4QRSB 4X4MA 5HHOD 3CFJB 5E23A 3U9WA 1E9PA 4FTVA 8FABA 4KXCA 3FNKA 1MCIA 4LSUL 3VUAA 3BKCL 4XWOC 4I7ZC 5J57B 1QTPA 4YDJA 1NINA 2H9GA 4JPVL 2YSSA 4BDVB 4YPGA 5A2FA 2M8XA 2B59B 2MTPA 4O02A 5L7XH 5DZ9A 3LHAA 4PW4A 1WAAA 2V7NA 4OD1H 1MRDL 2TRHA 4UMSA 1JD9A 3HFFA 2R8SL 1QRNE 1DP0A 3FTVA 5DJAA 2R1YB 2WXJA 2EXSA 1T2QL 4JHBA 4MMZA 4MZRA 5KSUB 4N8CL 3SO3C 2C9AA 1ZMYA 3MUJA 1YMMD 1LL1A 1S9XA 4DUXA 1OF2B 4DZBB 1DVYA 1IGCL 4YVUA 4IMKC 4FNPA 5FGCB 3CSYB 4R7NA 5JQHC 4DP5X 3OLIA 4DVBA 1JV5B 2A9CA 3DHJA 1W9XA 4M61A 1SJHA 2P5WD 4MQTB 5L4JA 4DK3A 1RIHH 2BOBB 2R7EB 3CPLB 4G1MA 5JXED 2IH3B 4HIPA 7PAZA 3WTWA 3QZOA 1Z3RA 3SQRA 1X4XA 1CLCA 2W8CA 1MRFH 3KYMB 2I60L 3NJKA 2XZQL 3P11L 5MI0C 1OANA 1RZGA 1MG3C 1Q1JH 1T3FA 4EI5A 5EC2A 5LKNA 1CBVL 4A2GA 3LPOA 2CIKB 3ML8A 1MWAA 2FX9L 1ZHBB 3OAYK 3EZ8A 1UT9A 4JN1H 5KSBE 4AIOA 2WVSA 3RTQB 5H35A 3RFZC 1RURL 3V52L 3D4ZA 4F9PC 5ICZA 1G7LB 5KN5A 3PDGA 2NXYC 2J5LC 5A6IA 4JZOB 3NFSH 4P5TA 4PJDB 3RX5A 3UZVB 5I1DB 1PKOA 2X0WA 1ZV5A 3QFJD 5DRZB 3F7RA 5B8CA 1BGXL 1YMME 1BVLB 4U6HA 1TMCB 5JZ7D 2NY5L 3TZVD 2PW2B 1NBZB 5EOTA 3H6JA 5BS0E 3FSOA 2X2HA 4M7LH 1DBBH 3QO1B 3FFCA 3EXLA 3DUUA 1U3YA 4L2YA 2P5ED 4LLDA 4O4YL 4JQIH 4MVBD 2DQMA 5EORL 3N9GH 4WWPA 2W0LA 4PRAB 3AXLA 1B2WL 4NUQA 3QIBA 3TVMC 3IGAB 5HI4D 3RKDC 5DUML 4W9JC 5HHNA 5LXGH 3QIUB 3R1GH 1B0GB 2FD6L 1DJSA 4JO8A 1NBCA 5B38A 2BCKB 3K46A 1OV8A 1HU8A 3MA9L 3ULUL 3US9A 5ESVA 43CAB 2ITDB 2A9BA 1AC6A 4J1UA 4RQQA 4G8IA 4KJWC 1QLEB 3QFJE 4GSUA 4XZUA 4DSYA 5IQMA 2Z4QB 2NZ9C 4DGVH 5DQ9B 5CIPA 3MRIA 1ZLUH 4MA8H 1AQHA 1BMGA 2FJUB 1JYXA 4ANUA 1I85C 5EEZA 2EXWD 4Y2DC 4WCYL 1JSYA 2B3RA 3UJIH 1NAML 1HHIA 3BUYB 1KBVA 3WJMB 2D8KA 1SYSA 2Y7NA 2P5EE 4R96A 1MWOA 5I1HL 3HG4A 5HYJD 4FEIA 5K9QI 3IDNB 4JFHD 3GSNH 3IFOB 2E3VA 3CZSA 4HPYL 3MFGB 3U9UA 1R33A 4NXSA 4KTDL 3EOBA 5D7KD 2B14A 1VJSA 4MDRA 5EIIB 5LBSL 2H2PC 5EG6C 3WO4B 4QOKA 4F7CB 3P73A 3AB0B 1TTAA 3BUTA 5GGRA 1MCPH 1SMAA 1QI5A 4JVUA 5FEBA 1C5CL 1XAUA 3VFTA 4OF5A 3TEXA 1WT5C 4QXWA 1SEQL 1PF3A 5CD5D 5T5NF 2D0HA 1KBPA 3BUIA 1YA5A 1EK3A 5JW3H 2IDCA 3HAEH 2W0KA 3DK2A 4WI4A 4Z95L 2PTTB 1XTLA 3RWJB 3U7YH 3DUSB 4UM8A 5DSCB 1LO3L 4IGBB 1HSBB 4LQ1A 1C12A 2R0KL 3J8F7 4UZUA 1Z9PA 1P84J 3QEHB 1DLHB 4IOIB 4I77L 3HMXA 4NWUH 1PSKL 5FHBL 3KGSA 1RHFA 5HGAA 1SMOA 4JW3A 2GY5A 2OJZL 4KZ0A 2MEJB 4BZ1A 2GTZA 3Q0HA 1AD0B 2VR3A 1UACL 2DWDA 4FQQB 2OJEB 1EAJA 4I9XA 2W60A 5TDNB 1WAPA 3VXTA 3SEPA 2J73A 2I9LA 4TTDC 3SO5A 3UGXA 5CHNA 1WF5A 3L4TA 4H25B 2ZG1A 5LJYH 3H9HB 4XNXH 2DDQH 5D7JA 1ZWIA 1QHPA 1HL8A 3E1F1 4I88A 2X12A 3OJDA 2W59A 1RFDL 3AAZA 4WW2A 1M3IA 2Y9RT 4Y5YB 5JA8B 2HLEB 3TWYA 4S1QL 2OZ4H 2WN3A 5CEYB 3CU7A 3Q2LA 4L3EE 1MY5A 3VGFA 3PPEA 2G60H 2MRYA 4HIHA 3FSAA 3KCPA 4GKSB 4Y5XB 1RP8A 1NL0H 3QG6B 2OL3A 3QQ9C 1X7QA 2BSCA 4P2RD 1ETZB 1QBMH 4Q97A 3IDYB 2OSWA 2K7PA 2IAAC 1Z5YD 1UJTA 5L2KE 3CH1A 3KNBA 1JWSB 1JWMA 4G6FD 4Q0XL 5T8IA 1FYTB 1Y07A 1UM6L 4I85A 3D39A 5CP7B 3MLSH 2KDGA 5A2IH 1IIKA 3LH2H 4P07A 5KW9L 4TUKH 2VM4A 4NQDA 3I9IA 4WJKB 5CKGA 1Q9KB 4UTAA 4W9CC 5AOZA 2AKRB 2AJYL 4YJZL 3K6NA 1TEFA 4QRTB 2O5XH 3P4OA 5HDLA 1U2YA 4ZPVA 5EFIA 2IPUG 1KJMB 4IRZL 3S37H 1LNUB 2XG4B 4KITB 4XP5L 3LKRB 1RMFL 2SEBA 4D8PA 3DX7A 5CKAA 2D9CA 3MNWB 1NOFA 3CUPB 3AFLA 3WY1A 2BW4A 3P9LB 1J12A 3FUHA 4WO4A 3GMMB 3X11A 3M7FB 4IKLA 4O51B 3EXJA 2ZT9C 4PV9B 1DANT 3ZZLA 2WQAA 4J12A 4J2XA 2J43A 2WKLA 4P2RE 4MZ3A 1DR9A 4PREB 5KYWA 3CSBA 4X8XA 2EC8A 4NB7A 4ZOAA 3HR5B 3EUDA 1OLZA 3NJFA 4KHXH 3MRDB 2IH9A 3QXAB 1TCMA 4XTRC 4N0YH 5IM7B 3V5HB 2FO4B 1GYUA 5G55A 2WKOF 3LEVL 3POHA 1BJMA 1OTTC 2NXZB 3FUKA 3U4EA 4MMYB 2MPAL 4JKPL 3O6FB 3PP3H 4Y9CA 5HI3C 2OZNA 2HTLC 1J9CT 3O45A 4JL1A 2XA8L 2Q86A 1XDTT 3B7YA 4KJPD 3HKFA 1B0WA 4G8GB 1PQZB 3FYIB 3BH8A 3DXAD 3UTTA 5D2NE 4K3DL 2P8MB 4W6YB 4UB0H 2XLLA 1NCTA 4BFEA 3RNQA 1P7QB 3ROLA 3R8QA 1ACXA 1OSPH 5KBPA 3O41A 3BRDA 3OQ3B 5KAQG 2NY3C 5IOPA 2BINA 3T1WA 1SLVA 2O5ZL 3M1BA 4BUHA 1NLDL 4NC1C 4PJFB 2V33A 1SDDB 3BO8B 3C60B 5EUKA 4WFFD 1Y7VA 5J12B 2F8OA 2ICEC 3ASWA 1RJZB 5AZEL 1NKOA 1XHHA 2EIMB 4LSTL 2JF1A 5FECB 4EBQL 4MNQE 1RXLA 2BWIA 2EQDA 2G2PA 2OX5B 5DGQA 4QRRB 5GGVH 1U8PA 3H7BB 4HXBL 4Y7MA 3QWNA 2Z8VC 5DHEA 5F7MC 2Y07H 2B4CL 3VWJA 1E4WL 1H6FA 1YEFH 4YHYB 3T2LA 1XGQA 2Y3NA 1QFPA 3MTXA 2DEXX 3I3EA 3WY3A 2JXMA 3ZKND 3PQYD 1GYWA 1MFDH 4E41A 5TF0A 3IDGB 4I3SL 1AAJA 4Y2OB 3WDHA 3QZWG 2PPEA 4WUKL 2Q3AA 1TXKA 3X12B 3ALWA 4XBGB 3FO9A 5SX4I 1F3DJ 3WBDA 4NO5B 4QAMB 1TZGH 1E2VA 2IWKA 2VWEC 1I1AA 3RPIB 5B39B 4UQAA 1Z9OA 1NEZB 4PMFA 4BCYA 1LDPL 4GSRA 5EO1A 4OU3A 2C3VA 1DSFL 1QFWI 2VLRA 1A6ZB 1XGUB 3L4ZA 4JFED 5F9WB 1YY8A 5DT1H 2JB5H 3CXHK 3SY0A 2HXAA 4XNMA 3U0PB 4DJMA 5IBTH 2D2OA 2VITB 2ZQKA 2ICWJ 1ZEAH 1XEUA 2YMXH 2H2SC 1BG9A 4E9SA 1EFXD 2VC2B 4M62H 5DHYB 1GY1A 1MFAH 5A3IC 1F4YH 3CK0L 5J6HB 1TG8A 4M02A 1OZTG 4AV5A 3DOIA 5C0DA 1MLCB 1YN6A 3P9MB 5DMYA 2GSGA 1DJHA 1XR9A 3LRLA 1JZEA 2VDRH 2C3WA 5CXPA 3H2QA 3VXUA 1JGLH 4P59L 1XF1A 4KROC 4ADIA 3OGCA 4QJ4B 3QQDA 4A7QA 5DK2B 2PWHA 4EEEA 5B7MA 1D9KC 1PMYA 3CZJA 2BZ7A 1PY4A 1LD9B 2EIKB 1F58L 1MJ7H 2J1XA 4UDTA 3PAZA 4DGWC 4D9RE 1TVDA 4R0LC 4G59C 1U8QA 2G4GA 2IAMB 4AQ1B 5C0RL 1ASOA 2WZ0A 4G7VH 4K3GA 5LHDA 4U1HA 3RJOA 2QGEA 1U8JB 4G9FD 4JFEE 2X4SA 3L3JB 5D2LA 1ES0A 1ZANH 1MHEB 4WK4B 3ZDYB 4OZFH 5DEJA 1KTKE 5F1OB 2B9BA 4Y4HA 5DRXB 1JVKA 1AXTL 4BINA 2VGLM 2J8UB 1N3NA 1JPFB 1J1XL 2YXFA 35C8H 1KCUH 3MRQB 4B6ZA 3CC5A 3UCRA 1WWWX 3FDWA 2E56A 2J72A 4JKLA 2AEQL 4PGEA 3VI3A 1CZ8H 2HKAA 3BWUF 4D3CH 4CN4A 3ARGB 5FGCE 1HIML 4DGYL 3GMRA 1UB5A 3DX2A 1AZNA 2NTFA 1YEHH 4MD4A 2BLFA 5DZPA 4H2AA 2CBQA 3H8NA 5ECGA 5KANG 1J8RA 1IVLA 2B15A 1FG2A 2H8PA 1F3JA 1G7HB 1PD1A 3NTCL 3LHPH 2WBJD 5CJXA 5BRPA 1S7TB 4G70B 3RVTC 5IW6B 2OK0H 1QLEL 2WXNA 5C9JB 3VXMD 4CUCA 1ANUA 3VFNA 3Q13A 3QQ4B 3QNZB 3CVDA 3GS4A 5BXFB 4TN9A 2AGJH 3KPLB 1XBRA 5GGUA 2HVKB 3MBXL 3SQOH 3MJ9L 5HTSA 4C57C 1BIIB 4IW4C 25C8L 3BEVB 3I85A 2IC2A 4NQTA 1DFBH 2K9FB 3QJXA 3QI9D 2X44D 3O0LA 1TLMA 5AW8B 4AJYV 2DQ6A 1AO7A 4TQPA 2H0FA 1UWGL 3BUDA 1WD8A 4OF8A 4FFVC 4QHMA 5E6IC 5E2WL 2FSEB 1GZHC 5JYMA 1BQ5A 3RL1B 4G43A 4DN4L 5C0NC 5C7XL 2RTTA 5AW6B 1ETJA 1USQA 2G5BA 3GPEA 2LOEA 2ZX7A 2WP3O 1ZDQA 4K2UH 3LQAL 5FCUL 5CEZD 4UOW0 4YH6A 3OKYA 4MKMA 5DJ0A 1RZ8B 3PGFH 5EA0L 4Q89A 3EBIA 2J4WH 3GRBA 4KQ3L 3BAKA 3OJVC 3REVB 2DYSB 1F42A 2IOOA 2Q7NA 5DURD 4BKSC 4PGDB 4BQCA 3STZA 1JPST 3VXME 5FGRA 2ZOLB 1RPQA 5FHAL 5EBMA 3HE6A 1ZJAA 5GS2D 5A2JH 4FJ6A 2MCAA 2QQQA 4PRHA 2XPYA 1GSKA 4FF9A 1ET8A 3N85L 4HOMA 1JDCA 4AX3A 4UINL 3CFBB 4PTTB 4WVRA 1SVZA 4XWGL 3TYGH 2WXIA 2XDHA 3A3YB 4M5YL 4Q2ZB 3RWEB 4AT6B 3ZT6A 3HFML 1NCIA 3IDIB 3B5HA 3G6AB 1UCBH 3T6XA 3S7GA 4JZNA 3VYPA 4X7FC 4RX4D 3FCTB 1M42A 4Z0BH 4N2KA 3RY6C 3UTOA 5JXAL 4YEEA 2YPLB 3QWRA 4PJFF 1HQ4B 3V9EA 1ADQA 4CKVX 1T0PB 3WMQA 3ZW3A 1S9YB 1EXUB 3RWIA 3KWUA 3ZRSA 1WIPA 1R46A 1BOGB 5C2BL 2L7JA 4H13C 3WNIA 4M43L 3T4YB 1YECL 2DJUA 2KZ1B 1HQRA 1SBSH 5FO7B 1EHLH 5AFAA 1U91B 4LGPB 1KCRL 1A47A 4NQSA 3N41B 1TQCC 2VMEA 4DESA 1JTPA 2YGOA 4FFYL 3L5XL 2Y7OA 1S7RA 1IC4L 4OGZA 4R5TA 3ULSA 2YRLA 1I53A 5C09A 1WP6A 3G5YB 4QRUB 4EIUA 1RJYB 2L3BA 5E4EB 3OAZK 4U6YA 2FJGA 4HYTB 4MMXB 1DQJB 2QPDB 3QSKB 4LHUA 3QCVH 3L3GB 1ET7A 4WWKD 4GW4A 3MLXH 3LZOA 3RBSA 3QE5A 1OB0A 1VCBC 5F1SA 1TJIL 3MV9B 1I8MA 5C0CB 2DYPD 3GO1H 3H9YA 3K4AA 2OJ1A 1HH6B 2GABA 3ASNB 3NJIA 3WFEL 2ZOKB 4M6OH 1O5DT 4AEIH 2L8AA 4ZO8A 1SBBA 3BQUD 3KJ4C 1AG6A 2V3EA 4AOFA 3D8MA 4GKZB 1FZOB 3QRGH 2XN0A 3RA7L 1HKLL 2VR6A 4PJAB 1BQRA 2A83B 4MNGB 4LSQH 5IB4B 2Y5TB 1G94A 1MCFA 4DEPC 3NP4A 2X3AA 3SD2A 2C9RA 4QLWA 3DSNB 5KVFH 3H9SA 5GS3A 1XCXA 2E27H 1VZHA 1ZLSL 1M9WA 1JZFA 3LYRA 4PLJC 4DTGL 4WI3A 3PWLB 1IFGA 4IRJA 4XGZA 4KZDH 3MYZA 1JZ7A 5T3XD 3KPQB 3EYVB 2VAAA 1J10A 4DGIL 3DC0A 3GSWA 5IB5A 1YMHA 1R5WA 4B96A 3WY4A 3KS0H 3EIFA 4XMXA 4BGLA 4D9QD 4YSSA 3VXRD 4YSDA 4Y19A 4N24A 3NJLA 1FYTE 4GBXD 3RL2A 4L4VD 1I9RH 2BOCB 2JJTC 4PBVC 1B9ZA 1JPGB 1V3JA 4BKLA 3ZDYF 5EDSA 1MPAL 3BN3B 4B7IA 4HKJB 2D7OA 2J8UF 5T1JA 5GIRB 5EN3A 4CW1B 1E90A 3L4UA 1HCYA 4PS4L 3TWCL 3HZVB 3VW3L 3HN5A 1PZBA 3MO1B 1HH9A 5I26A 2ZCKH 4YHML 1OWRM 1F1AA 4HKXB 5HP5A 3RVUD 2J1ZA 1A4BA 1BZ7A 2F6AA 3L1EA 4NUPA 5LGHL 1IB5A 1OCOB 2EDQA 1AVAA 4PY7B 4BUGA 2NX5B 3DROB 5TJWK 1ODUA 3KDMB 1XH0A 1KCSL 2WINB 3WN5A 4F2EA 2G3MA 5KVGH 1W6LA 3FTGA 4AL8C 2HJLB 2H26B 4JHZA 3IFLH 3KPSD 3QK0A 3VACA 4AEHH 5BV7H 4GKNA 4M56A 4JY5L 1AG0A 1TZHA 2XPGA 4HIQA 4WHTA 3EYOA 2J71A 3WIFA 1T21A 3DK0A 4ZPTA 5AB1A 5FA4A 3QC5X 4UIKH 1H6TA 3WL9A 4PJ5A 4P46A 5DTFB 3KMDA 5DFWH 3OX8B 3HG3A 3ZU8A 2A4EA 1OWWA 5GGQL 2DLIA 4L4VE 4KZEH 1S78D 1D5BB 1R34A 2L4OA 7FABH 2EKSB 3LXUX 5E1HB 4UQ3B 4HLZG 2EDJA 5IHZA 5MERA 3CFKB 2AXFA 2EVIA 4Q56A 2C9SA 2PO6A 2VERN 1QW8A 3CHRA 1WQVT 4G8GE 1Z5HA 4KOBA 4IRSC 3QFDB 1FNGB 4L8BB 2DBLH 2VC2L 3OMAB 5E5UB 2BSRB 4HA1A 2Y24A 3T1FB 4YQXL 4MRCA 4OFYD 4HF5H 1CLZL 4L8SC 4RSVA 4ZAKC 4O2FA 2GY7B 4F33A 4TXVB 5I9QC 3IDUA 5C3LD 4BH7A 3A67H 3HB3C 3KPSE 4PJFE 4HSAC 3TCTA 3ZHNA 4JJ5A 2E7MA 5F9OH 4GAGL 4M03A 3K72B 1UEYA 2P80A 4DNLA 3BKYL 1IUZA 3LPGA 4QRRE 4AJVA 4YIQB 1EIBA 1KCKA 1YEIL 2GTWB 2QR0A 1L5GA 1LXMA 2Y3AA 4YE0A 5HHQB 4BEIA 3PS6A 4PGBA 4UIMA 1CB4A 2ZYIA 4M8QB 5DZVA 1DJIA 2B3IA 5DVKA 3U4AA 3V0VB 5E03A 5I1EL 1G9HA 3QJOA 3SGJA 4XN8A 2E9WA 5BQ7A 5DC0A 2DTSA 1A65A 1XD1A 1JYWA 2B1AL 3KXFB 2NMSA 1KDIA 1QEXA 1MQ8A 1NGQL 1R75A 1QMUA 5IJKA 3PV7A 4JY6A 1NCGA 5B1BB 1E42A 1PFOA 2NCMA 3K2KA 4FQJL 4OBRA 5CO1A 4AGNA 3EHBC 5HDBB 4NENB 3HLAA 5IG7B 4L3CA 3VYNA 3D2UD 3MLWL 1QWUA 4K8RL 2Z31C 2IG2L 2VABB 3C8DA 2X4QA 5EIIG 5AKRA 3V55A 2ZOTA 1HSAA 1QNZH 5IWLA 2EDYA 3MBEC 1NGWA 1U0QA 4BSVA 1DJWA 3ESPA 3Q8FA 1JHTA 1SXNA 2XG5B 2Q3XA 2Z7YA 4HUUA 2E6QA 1OCZB 2IBGA 1SXSA 1R1CA 4LLMB 1EAPA 1KN4H 1JZ5A 1V5JA 3GJFB 1I7TA 2F58H 4RFEB 3SODB 2NT0A 4P23B 1E28B 1FSKC 3X1NA 2AVFA 3E1ZA 4EIBA 2YQ2A 1L9TA 5FYKU 3MLYH 2QADB 2XBTA 1E8WA 3KWXA 5CLXA 4YDLC 4PRBA 1E5UI 5FYKL 3I6LE 7CGTA 2IOIA 1RZJH 2HG0A 2BDNL 2ZXEB 4NRXA 4LGSB 5DK3A 4JFZL 4LAQL 1Q9LA 1FO0H 2NY7L 3CBRA 2FNWA 4DP2X 1O9WA 1UC6A 2NLJB 4GMTL 3QUYA 2HMIC 2WIMA 1OARL 3FHEA 2ODIA 4E42B 5A2AA 2Z9TA 1W72H 4DIXA 1FYHB 3UL4A 2R51A 4UNUA 5IQ7H 5DZJA 3N50A 3UIYA 3W39A 3GSOA 4H0IA 1DDHA 2A1WH 3MTRA 2IADB 4LKXB 2XN9B 3L3DA 5HGGS 4NJ9H 3D06A 2AJ3B 2DM3A 1P5UB 3O2WH 3TBSB 3ZDYE 1G6RB 3TF4A 5LB1A 4N2MA 1U95A 5ID0B 2J8UE 3EYQC 1UVQB 3V4VH 3QHZH 4OCWL 2Z1KA 3OHXA 4UT6H 3RVVC 1FZKB 4AMKL 3ZTNL 1NFKA 1IKOP 4PWKA 1U8HB 3WE1A 3WYRA 1T7XA 4TVPD 1FP5A 1I9JH 2G2RB 2D7TL 1AQMA 1EO7A 2J1WA 2VXTL 3IM1A 1S7SB 4NUGH 3RRQA 4EIGB 3V5DB 4R90H 3RPBA 3V7AE 4Z78B 5E2UH 1Q4NX 3CVIH 2IVFC 3NACH 2VXVL 4XWOD 1TFPA 4U2YA 3AQYA 3E8UL 2WNXA 4G11A 4I9WD 4NO0D 1L0PA 1SXCA 1WYJA 2XNAA 3RGVC 4ZZFA 3BPNB 2R2CA 4HS3B 5JHLH 1RZFL 3BW9B 2H45A 4AY0A 1TQUA 4CADA 2EIEA 4LP4A 1GHFH 1M3JA 3CFUA 1ACCA 2ZWLT 3EOYG 1YEGH 2B9AA 2HCZX 2J25A 1H5BB 3C9NB 2P8PB 1LO2H 1A4JB 1XF3B 4GJTB 4XCFH 4PB0L 3VE0B 1TIUA 5D5MF 2UUDK 4V1DA 3V6FB 1NH6A 3CMOL 4P2CG 1MCWM 3HI6H 4I0PC 2EE0A 3H6AA 5F88B 2JJUA 3QXUA 3W11C 2X2UA 4TRPL 1TENA 4MAYB 1A7PH 3R4DA 5MP6L 1CGYA 2RALA 3MBWA 2X4TB 1UM5H 2K6YA 5EEXA 4BZ2H 4F7TA 2PETA 3MRFB 3P0VH 4HU8A 1OP3K 2X53A 4O58L 4NBXB 4ODTH 3DSFH 1KYDA 1DVQA 2RACA 3VFGH 4LFHD 4PJ7B 5CBEA 2VCOA 5FS5A 5HYSB 1GSMA 2KH2B 1NGPH 3KVQA 3D9AH 1GS7A 3MGOA 5EZIH 3T71A 4APQB 2CM5A 1I1YB 5FK9A 5JPNA 1TEYA 2AK4B 4MXQC 5IVOA 3ECVA 2JJSC 3ARPA 4HCRH 3KLAA 3ZZ1A 5D55A 4CL7A 1OSZA 3BSGA 1IC5H 4BK4A 2WLLB 3BP5A 1PKQB 1U8KA 2NXYD 2QBWA 5E6ZA 4AQ8C 5H94A 4LPWA 3VXSD 1YN7B 5IK3B 4XN4A 5D4QA 5HHPB 5C3IA 5FLVA 4NJAL 2AXJA 5T1DL 4WEBL 3F7YB 3HNTH 2R0WL 3S5LB 2R29A 5CSZB 1SDAB 4ISVB 4UANA 3AU0A 1J1PL 2EJ1A 3U1SH 3LRSA 5K39B 1ZLWH 3ARSA 5B21A 3VRJA 1IKNC 1HTYA 3SDXA 3GINA 3TJHC 4U1KA 2XICA 2E59A 4OIIH 4X7SL 4AV4A 4PGJA 5IROA 3B43A 1QUPA 3WNKA 3AG4B 3CZFA 3QDMA 1LWHA 1U30A 3F84A 4XN5A 2AMUA 4URKA