2W8CA

Plastocyanin variant with n-terminal methionine - closed structure
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
106
Chain Sequence
METFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords PLASTOCYANIN
publication title Metal-Mediated Self-Assembly of a Beta-Sandwich Protein.
pubmed doi rcsb
source organism Phormidium laminosum
total genus 24
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2w8cA00
2UXTA 3CZUB 3QJTB 1HAUA 2QPEB 4GY4A 2FQDA 1NIEA 4UF7C 2BP8A 4M4RB 3S3CB 1TKWA 2AZUA 2XXFA 1PLCA 3FQ2A 1HFUA 1SHWA 2QPDB 4YSQA 1PZCA 1QNIA 2ZWNA 1XMEB 1NIAA 3QJSB 4KO7A 4ENZA 2BZ7A 2FQFA 3T6VA 5B7MA 1IUZA 1ETJA 2FTAA 1IBZA 2HRHA 2JXMA 1A4AA 1AOZA 2UXVA 4GXFA 3T9WA 1A4BA 1TU2A 1NDTA 1MDAA 4YSDA 2CJ3A 5I5JA 2TSBA 1PAZA 1FA4A 1M9WA 4E9YA 1AACA 3T71A 1URIA 3NJMA 1EZLA 2VW7A 1MZZA 1ZDSA 2AANA 5LDUA 1A65A 3PAVA 2JKWA 1IC0A 1AS7A 1PNCA 4BWTA 4M3HA 2PPAA 1XB6A 2NRDA 1NWPA 2AVFA 2VW6A 4BDVB 1PLBA 1BYOA 1VLXA 2IWFA 4W9ZA 1L9QA 3QJQB 3AZUA 1OCRB 1BQRA 9PCYA 4AZUA 2YARA 1E5YA 1N70A 2H5UA 2IDQA 1SHXA 3AG2B 3OMIB 1BQKA 3FYIB 3NSCA 4E9XA 1PZBA 1J9RA 2P80A 2GC4C 4AX3A 3S8FB 1W8EA 2HRGA 5I6NA 5B3SB 4A2FA 3JTBA 2XX1A 4BDVA 1J5DA 1XB3A 1YLBB 2J5WA 4GYBA 1OE1A 2FQGA 3WNJA 4DP1X 4YVUA 3G5WA 1JERA 1JVLA 4DPCX 4NAJA 1L9SA 1WA2X 3FYEB 3N2JA 3AW5A 3KW7A 2BWDA 3NT0A 4N8UA 2WO2B 3S8GB 3V9EA 3V9CA 4G72B 4KNTA 7PCYA 4E9TA 2FT8A 3ASOB 4K9JA 1PLAA 1AIZA 2BZCA 5D4IA 2BW4A 3X1GA 1JZJA 1ZIAA 2Q9OA 4F2FA 4GP5B 4MFHA 1OV8A 6PCYA 3QJRB 4Q8BA 2ZXWB 2VSKB 4KOBA 4E9QA 1TEFA 1AS8A 4DPBX 4G7QB 3SBRA 3H4HA 1A8ZA 2XWZA 1J5CA 2VM4A 1JXFA 4DP9X 5AZUA 1AG6A 3X1NA 2X87A 3QPKA 1PCSA 2MTAA 2PPCA 1AZNA 1WA0X 2UX7A 2XUWA 3CVBA 1RZQA 2PP7A 4BXVA 5D4HA 5I5IA 3UAAA 3ZDWA 2CBPA 4G7SB 3TASA 3AY2A 3NSFA 3WIAA 3OM3B 1AZBA 1NWOA 1JXDA 2VM3A 1AANA 2IH8A 5EHFA 1BYPA 2FNWA 2J55A 2OV0A 2IH9A 1CYWA 2YAQA 5I6KA 1BAWA 5I6LA 2FT6A 5AKRA 4WKXA 1GSKA 1GY2A 1ID2A 2TSAA 3QJVB 3WNIA 5TK2A 1WA1X 1RCYA 4UAHA 4E9VA 3BVDB 1E67A 2P80D 1NPNA 3IBOA 4CSPA 3FPXA 2HLEB 1KDIA 1NIBA 2H47C 2IDFA 1BXAA 3U25A 2AZAA 2ZONA 1GY1A 1OCZB 2EILB 5I28A 4F2EA 1ADWA 2Y69B 2CUAA 3QJUB 1PZAA 4G7RB 2LLNA 2VW4A 4DP6X 3JT2A 3ZBMA 3NJKA 1E30A 1L9OA 3NYKA 5FC9A 4DP8X 1T5KA 3FSWA 3IN2A 3NJLA 5B7FA 1V10A 1SDDB 3NJIA 1AZUA 2BO0A 2IDUA 1ASQA 1JZIA 3UACA 1ASPA 4YSTA 1FWXA 3PPSA 5PCYA 2HX8A 1L9RA 4WTQA 3SBPA 4E9WA 1KBVA 4NERA 3ERXA 1KYAA 2CCWA 1JXGA 1V54B 3PAZA 1KCWA 1N68A 1NZRA 2FT7A 1MG3C 3CVCA 1ILSA 4YSPA 1OCCB 1SDDA 3CG8A 2BP0B 1JVOA 5PAZA 3PXLA 4A2DA 2YAMA 3FU7B 1PNDA 1BQ5A 3UAEA 3NP4A 4CSZA 4A66A 3SBQA 2DWTA 2QDVA 4KNUA 5B1AB 5IY5B 2GB2A 1NPJA 3DKHA 3EF4A 3S3DB 5B1JC 3EH4B 4L0PB 3EH5B 1AR1B 1DZ0A 2BP0A 3H4FA 2XV3A 4HCGA 5I26A 4KO6A 4A67A 3FU7A 4YSSA 1JZGA 3T6WA 4KNSA 5B7EA 3ABMB 1KGYE 2PCFA 4A2HA 2R7EB 4BK5C 2EIMB 1A3ZA 3N55A 3MBWB 3L45A 3WKPA 2JFCA 3DTUB 1CURA 3TU6A 3OMAB 2YAOA 4AKQA 2XV0A 1A4CA 1MG2C 1GS7A 2BHFA 3OQRA 4NB7A 1GW0A 5B1JA 1X9RA 4HALA 4HHGA 3PLYA 2PPFA 4YSCA 4QKTA 2R7EA 2W88A 3H56A 2PPDA 2IWEA 2WSDA 4DP5X 4FA7B 1KBWA 4AKOA 1TEGA 3CDZB 2HX7A 3HEIB 3NJNA 3UADA 3FQYA 2PPEA 2DY2A 1ILUA 1SNRA 3FQ1A 3NSYA 1GS8A 5B1BB 1ET5A 3D12B 2HX9A 5ANHA 1X9UA 4HHWA 3OD3A 4YL4A 4DPAX 4DP0X 2GHZA 1WS8A 5F7BA 2Q5BA 2PP9A 5I5MA 2A3TA 3AG3B 4AKPA 1F56A 3NSDA 4E9SA 1ZDQA 4F7KA 3EH3B 2EINB 1NICA 2PP8A 2BW5A 3CDZA 2UXGA 3FT0A 1AZCA 2XLLA 3GYRA 4E9RA 2DYSB 1IBYA 2VSMB 2BP8B 4P5SA 3AG4B 4A2EA 2XX0A 2XYBA 3T6XA 2UXFA 4JHVA 3IE9A 4N4YB 5D4JA 3QQXA 4HAKA 4UANA 2YAHA 5B1KA 1KCBA 1ET7A 2I7SA 2RACA 1NIDA 3ZIYA 3AG1B 4AI7A 2YQBA 3KW8A 3SQRA 1AQ8A 1GYCA 1I53A 2VMJA 4JHUA 4YSRA 4YSAA 1AG0A 1RZPA 2AFNA 1JZFA 3MX0B 1EHKB 4FAAB 3X1FA 1AS6A 1E5ZA 2WO3B 1SJMA 2E86A 4HCFA 1V55B 6PAZA 1CYXA 1RKRA 1L9PA 2HZHA 3NJFA 1W6WA 5I6MA 2X88A 4BWUA 2B08A 1CC3A 4PAZA 4A2GA 4ZK8A 2I7OA 3ASNB 3FSVA 4BWWA 1MZYA 4HZ1A 2EIKB 4X4KA 1KDJA 2YXVA 2Y1AA 3TBBA 2YXWA 2I85A 5E9NA 4A68A 2CAKA 2FWLB 3PCYA 1OF0A 1PMYA 1ZIBA 3TBCA 2XU9A 2DV6A 4Q89A 5TK4A 3WI9A 3FS9A 2N0MA 1XB8A 1IKOP 2GI0A 2IWKA 3DIVA 1OOWA 2UX6A 1JZEA 3GDCA 3C75A 4DP2X 1ET8A 4HCIA 2PLTA 1SF5A 3NP3A 2MRYA 3X1EA 8PAZA 1WAEA 2ZOOA 3CVDA 2QDWA 2GBAA 2HXAA 4G70B 2YAFA 3FU8A 1R1CA 4TXVB 4YSOA 1AAJA 1NIFA 2DYRB 3FSZA 1GR7A 1DYZA 5AFAA 1BXUA 4KO9A 1ZV2A 4RH4A 1OE2A 2XVBA 3ABLB 1B3IA 3NJJA 2XV2A 3RYMA 1QLEB 1NTDA 2J56A 1J9TA 3UGEA 1W6LA 2PCYA 1SFHA 1J9QA 3NJHA 2DWSA 2J57A 1ASOA 1JZHA 2OJ1A 5I6OA 2OCCB 2YAEA 4PCYA 3WG7B 2QT6A 2EIJB 3WKQA 4GP4B 3IN0A 4G71B 1KV7A 1WS7A 5F7AA 3T6ZA 1CUOA 3NJGA 3S3BB 4KOCA 2GC7C 4HIPA 1PF3A 1BXVA 2B3IA 2XXGA 5I6PA 1L9TA 4DP7X 3OMNB 1GS6X 1E65A 2IDTA 2FJSA 3GXUB 4QLWA 1SFDA 3PAUA 4P5RA 3FSAA 4YVNA 2CALA 3HB3B 1NINA 3UABA 3X1BA 1PY0A 4DP4X 3TA4D 2IAAC 1FFTB 7PAZA 3FU9A 5A7EA 2GIMA 2YAPA 3IEAA 2FQEA 1M57B 2IDSA 3FPYA 2GSMB 1M56B 4JKNA 1OCOB 1SF3A 1BEXA 4EF3A 3X2QB 2BWIA 3ABKB 4KO5A 4YSUA 3BQVA 4W1TA 4GP8B 1HAWA 2W8CA 3ABGA 1AZRA 4BXSV 1UATA 1JOIA 3EHBB 4YSEA 2H3XC 2VN3A 1J9SA 1QHQA 3ZX1A 1OE3A 1ZPUA
chains in the Genus database with same CATH superfamily
4X7DC 2BFVL 3QRFM 2WBJC 1BMZA 5DZ9A 1BSIA 5DZOA 4AJYV 3HC3H 1QSFE 3IETA 5JOEA 1UWGL 4P9HH 1MCCA 3HFFA 5TGBA 1SHWA 4P3CL 5LKNA 2YSTA 3IKCA 3DV4B 3CQPA 1DQLL 3IDGA 2WZPD 1N7ML 2GJZA 1KIUA 4PN6A 2BZ7A 3VI3A 5FGBA 4G8EB 3ROOB 2EYTA 3BT2H 3V52L 1AQKL 1M3IA 2XBZA 4P99A 3VXMB 3IFLL 3KGRA 2BVPA 2NNAA 1H5BC 3Q5YA 5ESAA 5J6GA 4M3KB 5IW3A 2Q87A 5ILTH 3A3YB 1BQLL 3GSUA 4M03A 5T3XD 5I5JA 3MX0A 2VDLB 5CGTA 4MAUL 3VH8A 1P7BA 2DTML 4GAFB 4F7MA 4U1GB 5M7QA 5TDOA 3PAVA 2NY6B 1J18A 3EFOB 3JTSA 5K1NA 1FGNH 3K80A 3ILQC 2CR0A 2P26A 2XT1B 1TOXA 1P7QD 3NRQA 4KRMB 1S7SA 5T3ZL 4AQ1C 1WBXB 2JCCB 5E2TL 5DZPA 1IGML 2F54B 5C08A 4HIEA 4IEFA 1N6QH 1DBAH 4FZ8L 3NIDE 4JQVA 1YEKH 1T0MA 2XRAH 1XHHA 3ESUF 3GMOB 3N43B 4PCTA 3TA3C 2AEOA 2DQIL 1A0QH 1P5UB 3NA9L 2V3DA 4U4IA 4UQCA 3GSRB 2HN7A 1FIGH 2VLKA 3QDME 4GOSA 4JGJA 3TT3L 1XGQA 4N68A 1OTTD 2R0WL 5H2BB 2EYSB 4J6RH 1M2OA 1C1EL 2JI3A 1D7DA 4NO3A 1RJLB 4Z95H 3ZN6A 1EIBA 4OB5H 1Q9WA 4XNUH 1OT2A 5KYYA 2H2PC 3VGEA 1ACCA 3Q0HA 1SXCA 2HFFA 4W9LC 1T3FA 2W0FB 1L9SA 1TVDA 2GYSA 4JQIH 5E8NA 5E8PA 1KLUB 4PV1C 3VMOA 1NGQL 4YAQB 3ZDYB 1JFQH 3FTUA 4HJ0C 4ZTPL 3ARYA 5E5MA 1A02N 1MI5A 1HNYA 1RJYB 4U33A 3GIVB 4UIKL 1WE5A 4JFPB 4PJ7A 4YHIA 4ZT1A 4BQ8A 2ED8A 3WKNA 2K4WA 3ASOB 4QF1A 3MAWA 4G6KH 5FUZL 2ZNWA 1YG9A 1U93B 2ZAIA 4PB0L 2DS4A 4PJ5D 1RUAH 4ZS7H 1VGEL 3LEVL 4U2YA 1AO7B 5J0BA 4OZIF 4F2FA 3TFBA 2F5AL 2CNYA 1UACH 1OWWA 2HVJA 4OUUB 1TEFA 4UQ2A 2HJKA 2EDJA 2W65A 1KFAL 3MLWH 3JWNG 4EBQH 1FVCB 1SUJA 2NNRA 2XNAB 1TVBB 1YC7A 4JJOA 5FO8B 1FCCA 4BGLA 3FCSB 1T66D 3BP6B 1E5UI 1B4LA 4QCIA 3ZW3A 1GTNA 1AZNA 3H53A 3C8DA 3NGBB 3GLZA 1M2VA 5FA3A 3V6OE 2QQKL 3ZSTA 5GRYA 2FD6L 3W5MA 3P4LA 1HHJA 1S3RA 1TLKA 2R4SL 2Q76A 4PIRF 5IBTH 3UGUA 4ADGA 1XF5A 4LCVA 4K7PX 4KDTA 3VGDA 5T33L 4EDXB 3L16A 3EGSB 3LH8A 3GI8H 1RPQA 4RWHA 3T2NL 1ID2A 4M4PA 2LHAA 4F80A 4JAMA 2HLAA 4TVPE 5TK2A 1FRGL 5CR1A 3BHBA 3BVDB 2NLJA 4JRYD 3W0WD 4XCCH 4PS8A 2HTLD 5LXGL 2DQCL 2ED9A 4CSPA 2ARJQ 4OCSH 4ICWA 5AEAA 4Z0BH 1MQKH 1MWAH 3P3YA 2ZYRA 2WP3O 4PWFA 3D1MC 4HD5A 1HILA 3VH8G 3L1FA 1IGJB 4WJ5B 1J5OH 5CD5D 1UURA 5CKGA 4A7SA 1H3PL 3BH9B 3SCMC 4HJTA 3C9NB 3PIQB 5AL0A 1ADWA 1T80A 5EULV 3BZFB 1PZ2A 3SDCB 3NIGE 3GB7A 5AWNH 5IEKA 1F3JA 5IQ9B 1IEAA 3OKEA 1K8DA 5EIQA 1ND0A 3PNWA 4BK5A 2V5MA 4ZW5A 5C0GA 2HJFB 3D85D 5F8RC 1RPUA 1DVXA 3HPJA 3HE7D 5DWPA 4AEEA 1DCLA 4XMXA 2C3VA 3WV0A 2RAMA 1I8UA 3ARDA 1H8OA 1K5NA 1QR1A 1JYWA 1BG9A 3TV8A 15C8L 1LQSR 1PY4A 3MV9B 4P5KB 3RZCA 2A77L 4WHYH 4PRHD 4Z7VB 2OMVB 3KLAB 3FULA 2IGFL 4XOEA 1BZEA 5HPOA 1T7ZA 3PXLA 5IFAL 1E0OB 3EJTA 1FG9C 1RV6X 3KPQA 3MTRA 1L3NA 3E3QE 4MNQD 2MPAH 1ZPLA 2ICEC 1YECH 3H9YA 2IQ9L 2ZX9A 3QYCA 3DC0A 1BLNB 2QDVA 4U1NA 2MTPA 4L5FL 3IMRA 3RU8L 3WEBA 5ITFB 2VLJD 4J3XA 4IRSA 3TZVB 4XN1A 3QH3A 3KYKL 1S4IA 2AEPL 2Z8VC 4H40A 4QXVA 4YBLB 1J8SA 2XV3A 3MMEA 3OJDB 4HCGA 3VFGH 4LCIH 3OZ9L 1GZQA 1NOLA 2HG5A 2VDNH 3QIUA 1JZGA 1OSEA 3CHOA 3RNKA 2PCFA 1MW0A 2ZXDA 3MLUH 5J11B 1KCSL 4MSWA 1T4KB 1ORQA 2DQJH 3OKOB 1T03L 3PAYA 2WQUA 2F19H 2YN3A 3DGGA 4HP5A 1BAFH 2HPTA 3VD5A 4YXLH 4DW2L 5IJVA 5KZCD 1E4KA 1BGXH 1OAUL 3EYQD 3KPOA 1LO3L 3VFOB 2APBA 3S36X 5DSCB 3UJIL 4E36A 1K4CA 2FBJH 4YBQD 1JV2B 1F4XH 3VD0A 2KUTA 2CBMA 1KNOA 3EJZC 2VQTA 1TTRA 3D30A 1UUNA 3L3GB 3R8BB 3R18A 4F1SA 2JTDA 4NNPH 3TVMC 1G7HA 5EEZA 3QFJB 5DMKB 1BJ1H 4P5TB 3SGKA 4A2LA 2WCPA 4RDQG 2VSDA 1RERA 3VXME 3C5JA 3CAFA 4IDLA 5C0CD 1AY1H 3QAZB 2NXZD 3GBDA 3IAPA 1MIEL 3ME0A 4DPAX 4NT6B 1D7BA 4JG1L 4LLVB 5DMGC 1RZKL 3EGDB 1IGTB 4KX8A 4NQTA 5JPNB 3MLVL 4NQCA 3X12A 3NSDA 2J6WA 4P2OC 3TX4A 4NFBA 3DRQA 4H20L 4X6CB 4X4YA 2EDWA 4L29B 4XPGL 1SJHA 2AJYH 2XLLA 4V1DB 4M1GL 4WTWA 1MNNA 2PYFA 4KZDH 4EZLA 3KPNB 3O8XD 1FAIH 4FQCL 5ISZA 4M1CD 1J05B 5DK2B 5H94B 2VL5A 5MEQB 5IJKC 4AT6A 1Q94B 3JV0A 1E6JH 3F5WA 2C7UA 3HI6L 5BUGA 3M46A 2LTQC 4LGRB 3X11A 3BQUD 1V3MA 4QHMA 3GRGA 3LY6A 2G9HB 2VDRB 4KTDH 3V0VB 1XH2A 2LR4A 1E2VA 1OGSA 2NMSA 1YY9C 2X12A 3ARBD 4PJDB 1CE6B 4Z7OB 2OM5A 2EE0A 1QQDB 3MGTB 1C7TA 2XZAL 2HVBA 2K9FB 3T3ME 3A6BH 4OU3A 2AK4A 4N0CD 5L2JA 3UTSB 4LOUD 3LHPH 2H26A 3FQXA 5KSVA 3UTTB 1BVLA 1U8JB 3TN0C 1JD9A 4RA3A 2EXWD 4PS4H 4IIZA 3ZHFA 1A1NA 1KGUA 5LB1A 4KRPD 4ZW6A 2ZOLB 5I0DA 4IDJH 3PP3K 1I7ZA 3HA0A 2H3KA 5JW4M 4GXVH 1IKNA 3EIFA 3VD7A 1I3RB 3BX7C 1XCTB 4XNYL 2AJVL 4FLHA 2OTWB 4XMZA 5E9NA 2N59A 4A68A 5HBBA 4HS6A 3MLYL 4AYFB 4Z7IA 5DQ9B 1KXVC 2M83A 2XU9A 3ESPA 1AFVL 1JGIA 1JJUA 1DJXA 4QRTA 1KTKE 4PJEA 1IV8A 5B8CC 4HKJA 3FFCA 3ZUCA 3RWIB 1MJ8L 2ZUXA 3CFMA 4DUWA 1SLUA 1TITA 5D7KE 1U8HA 3WIIH 4XCYA 1XXFC 2GIXA 3CDFA 1JZEA 2FJHA 2QQNL 5T5FL 3EG9A 3L3HB 4O58L 5JQ6H 4QRRD 5CN1A 4ZUUB 3F65A 3MUJA 3QEHB 5EBLA 2XTJD 4QOKE 4KUZL 5JXEC 3DRTA 5C2UB 3KGUA 5GZOC 4R4NC 3IRZA 3VFMB 1T83A 2YEVB 4D9LH 4U6VH 3H2WA 2I60L 3QZNA 1MLBA 4GW1A 3LNEA 4FQHA 1S5IH 2RTTA 4P57A 2PUQT 4HIXH 1DVFC 2EQDA 1SLXA 4Y1AD 4J8QA 4RH4A 3QXAB 2NY4B 5AQ0A 4D0BA 5AOKA 1KC5H 2MNWA 5DTFB 4XGZB 2F9BT 1PG7H 3Q3GA 3NABH 4PJXF 2G75B 3NACL 5C0BD 4ETYA 2BM3A 3U0WH 3AFLA 5KJRH 4WUUB 2MCPL 3LKQB 4OZGF 4B50A 1LO4H 2Y24A 4RA0C 2BSEA 4OQ1A 5GGUA 5D7SH 2CDFB 1OP3K 2HT2C 4H8VA 4HK3N 3ZZLA 3UTPD 2YAEA 1B4JL 2EADA 2XSKA 4HBQA 3U4EB 2QT6A 1M05B 2OCFD 4W6WB 5F1OB 2WNGA 5E1AA 4TTGA 3VU1A 5C8JA 4G71B 3N0PB 2MIZA 5ESVA 4FLRA 1MJ7L 4AUJA 3GF8A 5CJOH 3IMUA 5I16A 3JUZA 3S3BB 4KTEL 3QIWC 3L3DB 2F2HA 4RGNE 2W9DL 4DCQB 4HG4J 4JFQB 1Q9LB 5DJAA 4UIMA 2XXGA 3BYTA 3MLTA 4NFDA 5DRWB 1F11A 5IB4B 2PCPA 2I69A 1YNTF 2WGNB 2JIXD 1URLA 2AAAA 2YZ1A 4WWKA 5AAMA 4XCFH 1IBGL 1XSIA 3IBEA 4D2NA 2D4DA 2CLZA 2ZUSA 4MCMA 4TULL 3V0WL 1JMXA 4E5XG 5I1EH 4RX4D 4MQTB 1YN7B 3C6LB 2OP4L 1CK0L 1T1YB 2LGNA 1HCZA 4HS3A 1M56B 4CDHA 2P5WD 3QJHA 2D7TH 4EF3A 2PO6B 2P4AB 1T2JA 1S2EA 3WNOA 4I0KA 5FLUA 2A2QT 3ZL4L 4TOYH 1MVUB 1GGIH 3MROB 4MMXA 4W70A 1Q1PA 1BMWA 4JR9L 3MV9E 4GP8B 4ZQTA 2NX5B 4XTRC 5EU5A 3MNVA 3TC9A 3VXQA 4KFZC 2CHZA 3LV3B 1P7KB 2DD8H 5JLZA 2H6PA 4WQOA 4HLZH 1DANU 1RU9H 3ARGC 1S9YA 1R3KB 1BJMA 4HA1A 1OZUA 1NBVL 4HSQA 3GJFK 3T65A 1VFOA 4NQEE 3CIQA 1DO6A 1ICTA 1ZS2A 1U8OA 4XO9A 2ESVA 3LS4L 2XA3A 3U7WL 1LK3L 1UT1A 4FNSA 3KEHA 4DPRA 4UTBA 4R83A 1BBJA 1TKWA 2R1WB 4MVBD 4P2RE 3TF7C 2IAMB 5I73B 1KB3A 3GTVA 1T0NB 2F58L 2VISA 1AJ7H 1T2XA 4PREB 5ABZA 5F7HA 4AM0Q 1QNIA 2FHCA 1KIPB 3DVNB 3QJSB 4GFTB 3SDAC 2NSMA 4ENZA 3DX8A 4Y4FC 3K6SA 4RIRA 4XX1G 5JW3H 3HG1E 3OAYH 4MWFA 3WELA 1E2ZA 3AUVA 4NRZA 1IL1B 2Y3NA 1HCVA 2EDFA 2WBJD 4YXHH 4Q4EA 4X7FC 1D5IL 4PJ9C 2WTPA 4X83A 2BIOA 3MOQA 5K9QG 3T4AB 5L4FA 4HPHA 2TSBA 1NJ9B 3LRMA 5DEJA 1E7UA 3MODL 3DV4A 2F1AA 5F1SA 5T1KB 2WXOA 3JUYA 1B9KA 4OW6A 1SXZA 2JKWA 3B2VL 1CIDA 1Q72H 2RB8A 3MCKB 4G8EA 4WCYH 3RX7A 4EI6B 3ROOA 5F3FA 4F93B 5KYXA 5LNEA 4P0DA 4Y16B 3FJTA 2C9QA 4TLTA 1RVFH 1NCHA 2AVFA 5F7FA 3C09C 5LN4A 4M6OH 1UQSB 4NZUL 4BFRA 5K5YA 1FVDA 4POUB 3F7QA 5A40E 2R2HA 3QFJE 3WL9B 2B4CH 1BQRA 3IDMB 1T21B 1VA9A 3HG4A 3QWQB 4JUSA 2D7PA 4ERSH 3HZ3A 5C0RH 2OAAA 1CDJA 1OGAD 4MKMA 2WPGA 2KERA 3EFOA 1NKRA 1RY7B 3EO1B 1WBXA 2JCCA 2F54A 3R4DA 4Y4HB 4YZFF 4Z7UF 3OV6A 3KXFB 4JZNA 3GMOA 2FQGA 1ZXKA 3A4DA 2C34A 2B8OT 3KPSE 4V1DE 2Y7QB 3S2AA 1P5UA 1Q1JH 1L0YA 4POYA 1HL9A 3PRZA 1L7IH 3GSRA 1OTUD 1YZZA 4IMLB 5SWSB 1QEXA 3MUGB 5IT2H 3HBQA 4HF5H 2CGZA 1VKXB 5DURD 2EYSA 5KVGE 5SWZB 1WAAF 5C0AD 4EI0A 3V9FA 1RJLA 4G42B 1MLCB 5F1NB 1SYVB 4QJ4B 1UM6L 4P23B 1JZJA 1N3NB 4GP5B 5DC0A 3G6JB 4S1DC 2H2PD 3NFNB 5E1HB 3QJRB 3WFEL 2W0FA 3ZKMC 1KLUA 3DNKA 5D1ZA 4YAQA 1GZPA 3PWPE 5CEZE 1XO8A 3U4KA 1RJYA 3GIVA 4YR6B 4JFPA 5ID0B 2FBOJ 3AABA 3M1CA 5CSZA 2VM4A 2Y07L 5AZUA 5GGQH 2QELA 3X3FL 2YOAA 1AO7A 1EEZB 3I6KB 2PP7A 3JWNH 1U36A 4BCZA 3ZDWA 5IBUB 3BAXA 2JJSC 4UT6H 2NTFB 4AG4H 25C8H 2ZUQB 4NKIH 3AQYA 4X50A 4OUUA 4WGVB 3CCHB 2JLPA 2X3AA 3OG4B 1BYPA 2VE6B 4JL1A 3NCYP 3D51A 4OGQC 1FVCA 2XNAA 1TVBA 1PS3A 2OMXB 5FO8A 1AKJB 1CFVH 1TETL 3O6FB 3FCSA 3Q8AA 3BP6A 3GHBL 3SODB 4UAHA 4OGXL 1WT5A 2FCBA 1NPNA 2ILLA 5AB1A 1L3WA 3IBOA 3L2MA 2V9QA 4EZMA 1MHEB 3S5ZA 2WQAA 2H47C 1DCEA 2IDFA 1I1YA 3SN6N 4OD1L 4C4KT 3F01A 3LS5L 1MJUL 4EDXA 3EGSA 3S35L 4J3VA 4XPTH 1JPEA 1YEIL 4PP1D 3FOLB 5CCKH 2LLNA 3RIAK 2FJGB 4ODHL 2NYKA 2ZXBA 1E90A 3TO4B 1Z5LB 2DN7A 3FSWA 4GLRH 5DEZA 3B2DC 3HUJE 2DMBA 4KVNL 3IE4A 5GS2D 5LVEA 1C5BL 5EA0L 3CJJA 3WFBH 4WJ5A 3QORC 4KK6C 1XIWB 2XBDA 4FI6A 3BH9A 1KN2L 3C9NA 3PIQA 3QNFA 3SCMD 5KVEH 4AL8C 5FXCH 3NZ8B 5E1IA 1JF6A 3BZFA 5EZJB 2CGRH 3SDCA 4NBYB 4KDWA 3SPHA 1OAZH 5IQ9A 4KXAA 4OVVA 5I0YA 1KXHA 4BD4A 2OFQA 2WW8A 5HHPB 5KVFE 1XQ4A 5BV7B 3QGVA 1L0PA 2XWTB 1FO0L 2VCOA 3MOBH 3U83A 3VWJD 1W72B 2HJFA 2IOOA 3S96A 2VSCA 1FL6B 4N22A 4DZ8B 4KQ3L 5I8CA 3BKJL 2VJ0A 3QQ3B 1CFSB 3B9AA 3QG6A 4Q14A 4XRCB 4FX5A 1MREL 2DQUL 4P5KA 2J1WA 3Q44A 1W8NA 4XVTL 4HJUA 2ITCB 2Y06H 4Z7VA 3KLAA 2COQA 2X3CA 3P30H 4WGWB 3FMGH 1LE5B 2BIPA 4GSDH 4ZFQA 4YSSA 2NX5E 2HFTA 3EUDA 2ZSWB 1BLNA 1HZHH 1OSZB 4M48H 1T6WA 5DK0B 3BXNB 5GGTH 3PGDB 5ITFA 3IGLA 1AQDB 1FNEB 1KJ3L 5H37A 1QNZL 3TZVA 3VDAA 1KGXA 1IAIH 5ACMA 2I07B 4IRJD 1N19A 1AVAA 4PJAE 3HFMH 2R1XB 3KGTA 3IYLW 3QI9C 3PF2A 1NGYB 1U3NA 1VRSA 3TH3T 2VLRD 3B9VA 4XHQA 2FSEA 4HCRL 3IVKB 1PQZB 1VERA 1WITA 3MREB 3JQOB 2CRYA 4M5ZH 4QTIH 5DS2A 3IDNB 1WIUA 1W8OA 2YQ2A 4XBEL 4JFOB 4L9DA 2MQGA 4NSKA 4PJBB 1T4KA 3B2UC 1FNSL 3N1MC 4KUCD 2ATKB 3OKOA 2MOGA 2XY1A 5FWQA 5A2FA 2WSPA 3DDGA 1ZKAA 4IK6A 5B1BB 3VFOA 5DSCA 1KLGB 2DWYA 4Q6IC 3QZPA 3SDXE 2ZXQA 3WD5L 4N9GA 5IWLC 4R96B 3ZHDA 5KW9L 1ZDQA 2IANE 3EJZD 4F7TA 5JIDA 5HDRA 4Z8FH 1R3HB 4UM8B 4N8PA 5M94B 2EXYD 4DJMA 3Q1SL 5EOQL 2NXYD 5DMKA 4ZMWA 4P5TA 5EBGA 3WNPA 2YXFA 2VSMB 3KR3H 4TQ8A 3PDOB 3U1QA 3WSQL 2XA8H 2EAEA 4U1MB 5DZJA 3IE9A 1NC2B 4K3EH 4MZIA 4NT6A 1MFEL 1XGRB 4LLVA 4UANA 2V2XB 5JPNA 1IGTA 1NCTA 2BY1A 5F93C 3TBSB 2AGJL 3BZDA 4OF5A 2QKIB 4G5ZH 2X9XA 4P2OD 5TDNB 3V9EA 3BGFB 4X6CA 2OPCA 1H6UA 2XN1A 4L29A 4L3ED 5IB3A 1EHLH 4FXGA 2JF1A 1ZEAL 4FNUA 5L6YL 1GYAA 5CD3B 3KPNA 3ES6B 1NUNB 1ZXQA 4OQTL 5E2UL 4YXHL 4OT1H 1J05A 4GG6E 5DK2A 1DJYA 3DTDA 1WQVT 5B39B 4L8SC 1Q94A 1W16A 4ZPVB 5AW4B 1XL4A 3W39B 1WO2A 5FK9B 3NJFA 1NCNA 1W6WA 4G9FB 4M7ZB 1PY9A 4Y9FA 5D93B 2OCJA 2G9HA 5CUSL 1YN6B 1J0YA 4FNTA 4PJDA 1KGJA 1CE6A 1YY9D 1S46A 2SEBB 2YGNA 1QQDA 3MGTA 4ODTH 2CE6A 2WINB 3CH1B 3VO0A 4LB8A 3MNDA 2O6DA 1FBIH 3HG3A 4B0MB 1QBBA 1YEEL 1SXBA 5L2KD 2DV6A 1B90A 2VC2L 5E8EB 3UTTA 3DJTA 1U8JA 2BXYA 2D31B 3VACA 3TN0D 4BYHA 4HU8A 1YMHB 1JNLL 5HGDB 5IQ7L 2DQDL 5IFHL 3LXBA 2HLFC 3UCRA 2H6UA 2ZOLA 3UEZA 5JIHA 3GDCA 4DP2X 2Q8BL 1SF5A 5DJZB 2J5LC 2J25A 1I3RA 1FZJB 1GRWA 4LSRH 5BRZB 3BI9X 3W2DL 5ADOH 4HFWB 2JKXA 1XF1A 2OTWA 4KZCA 4QRUB 3RRQA 1LP9F 3CX5J 5ITBH 4AYFA 3ZDZB 5HVHB 5DQ9A 2EC8A 4LSVH 3BRGC 2DYPA 2QSQA 2DM7A 4IIQA 4XAWL 4M61B 3FTWA 2X2HA 3FSZA 1OK8A 5I71B 5C3LD 1VF5C 4GT0A 2E8YA 3GXMA 1V3LA 3RWIA 4UQAA 1WUNT 3VTTA 4OV5B 2XVBA 5EUOF 3OR6B 5FPIA 3ISWA 5FF6B 3RYMA 3FF7A 3UGEA 3L3HA 1JPFA 2EUZA 4WAFA 4IGBD 1D6VH 3QUZC 4ZUUA 1R75A 4H88L 4OFVA 2Y2TA 1FV1B 3RFZC 3U2SB 3SY0B 1Z9MA 1YEHH 2XHNA 2GPZA 5GZOD 1J10A 3VFMA 2AEQH 4R4ND 3TYFB 4TSCL 3WAJA 5C0DA 2Z7UA 5DC9B 1DTUA 2WP3T 1DVFD 3QXAA 3HE7B 5I5RA 3EYVB 2D73A 1Z9PA 2IFFL 5DTFA 4DK3A 4XGZA 3NPSC 1KTCA 1EHAA 2D03H 3IDUA 3NCJL 1NLBH 3SDYL 4WUUA 1UJ3C 1BCIA 3LKQA 3KLKA 1BXVA 1FNFA 1Z0MA 2B3IA 5CLZA 4LHJB 2GW5A 4F9PA 2WVSA 4X9HA 1YNKH 4WK2B 1CGSL 4Q9QL 1T04B 2CALA 3U4EA 2BH0A 1M05A 3X1BA 5TQ0L 1JXKA 4JN1L 3VYPA 2FATH 4XWGL 1FFTB 2DQTH 4U1KB 2NYZA 4PJHE 1Z9LA 4P4KD 4RMWA 1IFGA 4OGAC 3L3DA 4IMKA 2GSMB 3BGMB 3K72B 1SF3A 2OL3B 4QXGH 4M62L 4EIZC 3AADB 1Q9LA 1A7BA 1EHXA 5DRWA 3BMVA 4D0DB 5IB4A 5D1XC 2QKSA 4AK1A 4GSUA 1II4E 2GJPA 4RSVA 4JL2A 4JM2B 3VD2A 4ZFOB 3VRIB 3R06B 6FABH 3U30B 1YN7A 1G0XA 5K69A 1KENH 3FFDB 3C6LA 3PFUA 4NC2B 3TP4A 5HYJE 2Z31B 1T1YA 5CN2A 2FNBA 5KZCB 3FN9A 3QJTB 3SEPA 3LMJL 1A6TB 2X6CA 3S5LB 1TZIB 1FSKB 2FQDA 2PO6A 1KT2B 3KPRD 1W9XA 4M7JL 5A2AA 3ATFA 3HAEB 1MVUA 1NBZA 1QPKA 4WFHD 2X4NB 2EDTA 2R56H 4BELD 2O5XL 2CJUL 5JO5B 2OMTB 2H8PB 3LV3A 4XTRD 1P7KA 1XTLA 1KULA 3OG6B 1EXGA 4P2YA 4RAVB 4YHZL 1R3KA 2WANA 3T08A 3T0VA 3FB5B 4P46D 3T2OA 1QWUA 4EKXA 2EJ1A 3FO9B 2VQ1B 1WTGT 1KCVL 4PHZA 4NZFA 5HDWA 4FL4B 3O3BB 3DI2B 5I1KL 2VXSH 4G5AA 2NY5L 2R1WA 3D6GA 5T3XE 2IAMA 1RP9A 2Y2YA 4HKXB 5HDBB 1IX2A 1T1ZB 1T0NA 5EWIL 5EU7C 3VDBA 4PREA 1MFDH 3C8KB 1OWRM 3CLFL 1AGBB 1KIPA 3DVNA 3O45B 4OBRA 5BO1L 4DETA 4LP4A 4I4WB 2Z6FA 4K5MA 5F72S 1PNCA 4PRPD 2A4CA 4Y4FD 4RMUA 5A2LH 5D96C 1CGVA 4FEMA 1X5AA 3O8XB 2KHAA 3B1TA 4GLRI 4WI4A 2VO8A 3FUDA 5JTWA 5KTEH 2IALB 3W37A 2Y7LA 2BCKA 3WTTA 1IE5A 3T4AA 4JVUA 1ZCRA 3I84A 4ZI8A 4JQXA 3TTYA 1NJ9A 1A14H 5DT1L 1HXMB 5DUMH 2A6IB 2B7DT 2R2EB 5T1KA 2OZ4L 1HWWA 2IH1B 4NJ9H 3GK8L 5EORH 5F7NC 5I74C 1KBKA 3MOAL 5FHBH 5FHAL 3ZTJG 3MCKA 2VAAB 3D8MA 4G11A 4Y4KB 2IDCA 1CDGA 4Y16A 3K0YA 4IYKA 1U4FA 3DOSB 4JN2B 5C0NC 2XZQH 1U4EA 3VGBA 1UQSA 3CZJA 3M45A 3A21A 3ML9A 5GRZA 1HDMB 3WL9A 2E6PA 3G5WA 2ARWA 2AJXL 3IDMA 4XN2A 3WMSA 3CE1A 1T21A 1ZE3H 1ODAA 5LGHL 4LQFH 4HWUA 3V6FA 3E9TA 5CFHA 2ADFL 4K3JH 1XSKA 3X3GL 1D5XB 2QADD 3A6CH 4MKTA 4JM0A 4DVRL 3I6LD 2RHEA 3EO1A 2I9LB 3RUGE 1EJFA 3QJZA 4Y0GA 3DK2A 4Y4HA 1ADQA 3Q48A 5BW7C 4QHKI 3CK0L 3KXFA 4PJ5E 1O6SB 5EO9B 2Y7QA 4WEEA 2KS0A 4LPWA 4LARL 2Z9TA 4IMLA 5SWSA 2JJTC 3OQ3B 3MUGA 4XP6H 3ZE2E 4QRRB 5I8KL 2QSCH 1VKXA 1KB9K 2BSTB 2PWGA 3BVUA 4GI9A 4TKWA 4YLBA 5IUCA 4FFZL 5SWZA 3GSNB 2XTJB 4AMXA 1SXSA 3V8CA 2IV9A 1IAII 1K2DB 4HMCA 4G42A 1DQML 1MLCA 5D5MB 3WUZA 1T5XB 1SYVA 4NQVB 3WIHA 3AB0C 4ZPTB 1OOAA 4JDTH 5AAWA 1KCUH 3E38A 1PCSA 2UX7A 1DJZA 5GZNC 1N3NA 1B0GB 2K7PA 2N01B 3G6JA 3NFNA 5MEPB 5AVRB 4S1DD 4Q9RL 3AY2A 1IBBA 3ZKMD 1ZHLB 5GHWH 4OLWL 1HC1A 3AROA 3MCLL 3PL6D 3HLKA 5C0BB 4MQ7A 3ZRSA 5EHFA 2FNWA 4YR6A 5JHLL 4LAQL 4C8XA 5CLWA 3P73B 4UTBH 4O02H 1KCKA 4BK4A 3KVDD 2VRKA 2VUOA 1RCYA 4P3WA 5DUJA 4JRYE 3W0WE 1WV7T 4RAHA 5D7JC 1EEZA 4C59B 4JFFB 2RIKA 2NTFA 4OTXH 4PWIA 3VQMA 3BKCL 3LKPB 5EIIA 3B2PA 2FECI 4OCXH 3CCHA 4OI8A 1I7UB 1JNHA 1BXAA 3WENA 4JZOB 4F15B 1PIGA 1U9KA 5F71A 1PZUB 1TT6A 2VE6A 1IZJA 3RBSA 1SM3H 3RA7H 4HPYL 4AEHH 3MBXH 2OMXA 1IGIL 2EZ0D 3O6FA 5TF1H 1FZOB 4ODSL 3WU1A 3BC9A 4Z7WE 3IXAA 4MA8L 2JJVA 4GO9A 1Z6JT 2BZDA 1MHEA 4K94H 3TWYA 5IB5B 2DQGH 3MLRL 4HIJA 4DIXA 1TTFA 3HB3C 1L0QA 2P5WB 3EJPA 1NKGA 3GLDA 1EVUA 1YPZB 3QZWB 3ERXA 3DYOA 3DMMC 3ZE1B 5BS0A 3FOLA 4ZW3A 5KANG 5EZIL 2VDLH 4FN0A 4U6XB 2FJGA 2ICWB 2XQYK 1J0JA 3TO4A 1Z5LA 3ELAT 2J2ZB 1R4XA 4PD4J 4G8AC 4PRHE 2HRLA 2IBZX 4S1SH 1Q0XH 3ECQA 3CFEB 2ZXAA 4GMSH 3FU7B 3L95B 4H0IA 3NP4A 4MNQE 4CSZA 1XIWA 4I0PD 4KK6D 4BV1A 3UIZA 2DWTA 3BE1H 3EHBC 3L54A 3S37L 1KIQA 3NZ8A 5EZJA 1DBJL 1DZBA 3MO1B 2VLJE 3S3DB 5I1GL 4L8DB 3G5XB 2WNWA 2X38A 1Y6NR 2HMID 3QXTA 4WWNA 4HG4K 1KN4H 5HHXH 3P54A 5C6WH 1TQBB 5HHPA 1K6QH 3BUQA 1WFNA 4KO6A 3D5OF 4NIKB 4A1RA 4CC0A 3TCXA 2XWTA 4JFVA 4PFEA 4P9HL 4QY8A 4X4XA 1W72A 3T6WA 1QASA 4GAGH 1X5MA 1FL6A 4K3GA 4MCNA 5FCSH 3LNHA 1U41A 1CFSA 2DZEA 4XRCA 5IVXB 3APMA 3BT2L 3FTXA 1FNGA 3B1UA 3N44B 3FT3B 2ITCA 1MG2C 4W68A 2BHFA 3EJJX 5JIQA 5IROA 4PLKD 1F4WH 1CD1B 4GBXA 3O6MH 4LSQL 1H19A 5J5EA 3EH2A 1BFOA 1H5BB 1DJIA 2ZSWA 1DFBL 3QPXH 1OSZA 3H42H 1Z5HA 1ETZB 1TEGA 4NP9A 4HSAC 3BXNA 3Q8EA 3PGDA 4TMPA 4WUKH 1FGNL 1AQDA 1FNEA 3C5ZD 2HJLB 3VSVA 5HYFA 3N06B 5C0CE 1IKFL 1G9MC 2LLGA 2NY0B 2Y6TE 1TQTA 4WZ9A 5JIKA 1MH5B 2R1XA 1IGYB 4HHWA 4S1QH 2AK1H 1N6QL 1DBAL 4XH2B 1NGYA 4BZYA 3P3TA 2AERT 1WS8A 2GHZA 2XRAL 3QI9D 4RAUB 5F7BA 5HDBE 2VZUA 3FUKA 4ZW7A 3IVKA 3RGVC 5IBUG 3MREA 4AKPA 5DVLA 4AQ1B 2NZIA 3IDNA 5EIIG 2QFPA 1H8NA 3LZFH 4JFOA 4PJBA 4HETA 4H8PA 3WFCH 4ZAKC 1JTOA 1L6PA 1TEYA 2X1XR 4IBQA 3TA3B 4OCWH 4J6RL 4AJWA 5CIPA 4Z95L 2WKOA 1CLZH 4LSUH 4Y19D 4EUPG 4XCEB 3DUSB 4HUVA 5D7IB 4UINL 1A64A 3U6XA 5GRXG 5T1LD 4XNUL 3L5IA 4ODVH 5DURB 4YFEA 2GG1A 3IFPA 2I7SA 4KV5E 3R7RA 4R96A 1BVNP 4YN3A 3QISA 5BVPH 1KJ2B 3UP6A 2YBRB 4NOFA 3P0VH 1R3HA 1O7DC 1YQVH 4UM8A 1J7VR 5CMAB 3OL2A 4FQXC 1N18A 2E7HA 4FQ1H 1IFHH 1XWVA 3SQRA 2BDNH 4MHHG 4OCRL 3PDOA 4WI2A 4N5UA 4G6KL 2A6DB 4U1MA 3MJWA 2HWZH 2AV7B 1NC2A 2NZ9D 2O4EA 1RUAL 1XGRA 4ZS7L 2V2XA 1JK9A 5DWUL 1BV8A 1CURA 3TBSA 3UJJH 5AOIA 3G5YB 2HZHA 1F1GA 2X88A 5TDNA 1OT4A 3PFQA 5BZDB 4KKLD 4MCZA 3BJLA 3MLWL 1KDJA 4JANB 2W1NA 4EBQL 5CD3A 3N91A 3ES6A 1XEDA 2X53A 4JFHE 1QHOA 4Y5XA 1BZDA 4MJID 5B39A 2MMXA 5CZKA 1F3RB 2PWEA 4HXBH 4I89A 4X7TA 5FK9A 4NZDA 3BIBX 1FPTH 4G9FA 1FLRH 2QHRL 4M7LH 4D9QD 1YN6A 2B1OA 3GSVB 4QRRE 2P45B 3AGWA 4PBXA 4WEMB 2SEBA 1N2RB 4JO8A 3DSFL 2WINA 3CH1A 1X9QA 4W81A 2BXZA 2X70A 4HV8B 4G70B 3FN0H 3GBNH 4N0FB 3OAUH 5D2NC 3QR2A 5D5ME 2A99A 2VN4A 4FG0A 3ZZSA 5K9QI 2PF6A 5E8EA 4X8JB 3CXHK 4LGSB 4Y1AE 4XCCL 3WXVL 3TBWB 2D31A 2Y1YA 3T2LA 3WS3B 3TWCH 1YMHA 5HGDA 1AC0A 4OCSL 2X4QB 3QDGD 3GHPA 4Z0BL 1EHNA 1MQKL 1YSOA 2HLFD 1MWAL 1YEGH 2YMXH 3L4WA 3VXOB 5H37H 5C0BE 1X3DA 5DZVA 5DJZA 5CZXC 1FZJA 1CT8B 5BRZA 1J5OL 1IC5H 3ECBA 2AC0A 4HFWA 1EZVX 4QRUA 3DO3A 4RFEA 1ZHKB 1RH8A 2CXKA 3UTPE 2XZCH 5T1MA 4PCYA 4M61A 5AWNL 3V4PA 4OY9A 1E6OH 1OTSC 5EZOH 2DPKA 1PD0A 4G8IB 4L8BB 3OR6A 1LGVA 2L7QA 3SCMB 3BISA 2V7HB 2LAAA 3NCCB 4U1HB 4NRYA 3QUMB 2ICCA 1F41A 4PYHA 4S11A 1UKQA 4K0OA 4KITB 4N2BA 4N85A 5IBLC 3SY0A 3U2SA 4A55A 2GBVA 5FDWB 4A7TA 2A0LD 1EUTA 3Q5TA 2FJSA 3TYFA 4G82A 1K4DB 5IV2A 1NINA 4ELDA 5KOVC 5CLYA 2OJEB 3NCYS 3N0AA 3EYVA 4DP4X 4I3RH 3QUYC 2YAPA 3TXAA 2CJSA 1O5DT 4ZQKB 2P5WE 2CA4A 5J89A 4QIRA 4FQ2H 2OYMA 2CKNA 3QHTC 5L8KB 2D0FA 2PTUA 4UQ9A 3QC5X 1GCFA 2ORBH 4LSPH 4EZJA 2H32A 1G6VK 3FUJA 1KSRA 1T04A 3A6OA 3BVNB 3VD4A 1QWHA 2ICEB 4U1KA 4ALAC 3ALPA 3ZDXE 3NIDF 3MNZB 4P48A 3ZX1A 1U2YA 4JE4B 2VDNL 2Q8AH 3KBEA 3BGMA 3K72A 3KG5A 3QYMA 3MLUL 3NG5A 1IAMA 3W11D 3WEAA 2RJMA 4HD9A 1G43A 2XPZA 4D0DA 1EJ6A 5CP3H 2CR3A 5LNGA 2FX8L 4AENB 1UWEH 2DQJL 2VLRB 1OP5K 2CZNA 3FQ2A 1J1OH 2F19L 4ZG1A 1NBYB 1BAFL 4JM2A 1MXDA 4CU6A 4YXLL 4GKNB 4XWOD 2VDRH 1BGXL 4ZFOA 3VRIA 3R06A 4ZW8A 3ZKQD 5I0ZA 3W38A 3B6SB 3FFDA 5C0JB 1V7MH 2FQFA 1JHLH 2FBJL 2Z31A 1F4XL 5CGBA 4PVBA 2DM4A 2P8MB 2F6AA 1A6TA 3NMEA 1TZIA 1KT2A 5KJ4A 4DGVH 1EGJA 3BLPX 3WE6B 5E7BA 3FSOA 1G4MA 2CIKB 2X4NA 2XWRA 5AVTB 5IVXE 3HKZA 4HT1H 4I0CC 4NPJA 4IBLT 4LEEA 2AQPA 1U8PA 1XR9A 4HUMB 3VSUA 1URIA 1AY1L 5BNXD 1WP6A 1MZZA 3BZ5A 4RAVA 2ZSVB 2WWMC 3FQNB 3TVMB 1IT9H 1H3GA 1A9VA 4F3FB 3FB5A 1LLAA 3JWNC 2D0GA 2WVTA 3FO9A 2VQ1A 1XB6A 2NRDA 3II2A 3O3BA 3DX6B 3K4DA 4X8GA 4XOBA 4JGMA 4BZ2A 3BZ4B 2A1WH 5F0MB 2AJYL 1T1ZA 3RPIB 1DQIA 2IGLA 2X40A 1E8XA 3LEYH 1FAIL 1UD4A 3O45A 1FFQA 2Y6SC 4JX0A 4BSJA 4AZUA 3D4ZA 4I4WA 1ZT7B 1OGAE 5GS3A 4L3EB 3SBWC 5BUPA 1E6JL 2H5UA 1BQKA 3K8LA 4I88A 1O6TA 1AHKA 3OR7B 2KZWA 1FH2A 4KTDL 5C7XH 4G9DB 3ZTJH 2ETWA 4WO4C 4GYBA 3WNJA 1HXMA 2LTQB 2E46A 2A6IA 1PX3A 4RETB 3CFCH 3A6BL 2R2EA 3LXUX 4KVCL 3FKUS 2IH1A 3N2JA 3AW5A 3LHPL 5CZVH 2WO2B 2VAAA 3BWUC 5CEXB 1XAKA 2ZWSA 3SQBB 3VRJB 2BNRB 3T3PF 3U82B 4Y4KA 5C0AE 3FBQA 3DOSA 5FGCB 2PABA 4JN2A 5DEGB 5FV2A 5C0ND 4IDJL 2Q3XA 1AIZA 4DEUA 5D4IA 1RZFH 1S7XB 2PWHA 4MJHA 1HDMA 4N6RB 3BZEB 4X5XA 1YJDH 4I77H 5HJDA 1YRKA 3IJYB 3UO1H 4LVHB 1XH1A 4UZUA 1D5XA 3NIGF 3VXUD 1N0LB 1COBA 1DVQA 2QQLH 4YDVB 3DO7B 2BIHA 2I9LA 1T22B 5KVFH 3WIIL 5D1ZI 3QR0A 2LW3A 4N0UB 3ZMEA 2WTOA 2AQ2A 1L7TH 1T89A 5DZAA 5JQ6L 1FYTB 3L1OH 1O6SA 2Y7OA 5B7EA 1WA0X 3KAAA 5EO9A 1QI4A 1DJHA 4ZS6C 5B8CB 3ZKXC 1THAA 5KSBA 4I8DA 4O51B 3WIAA 4X6BB 4D9LL 3K91A 4A7VA 1S5IL 5FO7B 3ULVH 2BSTA 4HIXL 2VRQA 2J55A 2OV0A 4LVNC 3GSNA 5I6KA 1BAWA 4JCWA 3WY1A 1KC5L 1K2DA 4B53A 4AIEA 4RMSA 5DA0B 1QI3A 3UYRH 2TSAA 4Z3GA 2VMDA 4L48A 2XXMB 3NABL 4GI6A 4ZPTA 3U0WL 4E9VA 4CKVX 4K4KA 1DVFB 1VZIA 2J1ZA 4P9MH 5CILH 5KJRL 5GZND 2YGOA 1LO4L 4S10A 5MEPA 4JZJC 2RD0A 1INEL 3U4BH 1OPGL 4L4TB 3S3PA 1TQCC 1ZHLA 3HI1B 1DBMH 3U25A 2DQFB 4NQXB 2ZZUT 1XR8A 3MC0A 1HT6A 4M56A 1GY1A 3P73A 4AJ0A 5HGHB 2AV1B 3ORJA 1E9PB 5CJOL 1VIWA 4X5WB 1S9WB 3EH1A 1JGVH 5D7JD 2ZXEB 4JFFA 4IOFC 1UZ8B 3F7VB 4QO1B 2VH5H 2IDUA 3LKPA 1CU4H 4YDNA 1ASQA 1EUUA 5HGAB 4UNTA 3MRFB 1I7UA 3PGFH 4JZOA 3QIWB 5AYTA 1N4XH 4KBPA 4XCFL 1THCA 3UC0H 5I1EL 4S2SB 4FMFA 3N6YA 4B95C 1LO2H 1I4FB 2VT0A 4ZUVB 4UV4L 1V54B 4FLSA 1I9IH 4ELMA 4PR5A 1UA3A 4UCFA 1R5VB 4I1NB 5IESH 5IJBC 2XTLA 5T1DH 5LG1A 1CXIA 2BCMA 3GO1H 4TOYL 1GGIL 5PAZA 3H9ZA 3HG0A 5DC4B 4XR8C 3V6ZB 4Z6AT 1DQVA 1YPZA 3MA7B 3QZWA 3QARA 1ACXA 1FFPA 1TPXC 2X4PB 5HJGA 2ZYHA 3LVEA 2GB2A 3EF4A 2ICWA 3T6QC 4JB9H 4WTZA 2J2ZA 4ZOAA 3CFEA 3ARGB 4BH7B 2WXIA 2YD0A 5CBEA 3FU7A 3KCWA 3L95A 3QWRA 5L8LB 2IWGA 3LHAA 3O81A 1AJ7L 2EECA 4LESA 4U0RC 1CE1H 4BUQA 4F7PB 1DLHB 4FQIH 4IOIB 1IQDB 4BK5C 2EIMB 2R0KH 3LKSB 2B1AH 1ZLWH 4RZKA 3EHBD 2EE9A 3MO1A 3WKPA 5JW3L 4L8DA 3N43F 3G5XA 3GXIA 4PJGB 2YKKA 3STZB 5FAAA 4TUOB 4DGWC 2PTVA 2XV0A 5J13C 1QA9B 3CFNA 2WLIB 3SDAB 2BVYA 2WK2A 3QB7C 2VLRE 2HKHL 5B1JA 4KKAD 4CGUB 4UT7H 3LZQA 4F7CA 2AABH 1V7NH 3T3MF 1B88A 1M7XA 1ULVA 3LX9A 4Q9CA 2IWEA 3WIHH 2EC9T 5E99L 1LL1A 1ZA6B 4PJ9B 4MDRA 5KSUB 5J56B 1Q72L 4WCYL 1JIBA 2OJZL 3H2PA 1B6DA 3ULAB 2WLJA 3FT3A 4JFDB 3RVXC 1EO7A 3D12B 4HUWA 4IRSC 3ZDYF 1P69B 4DP0X 4NN5C 2B77A 2J72A 2WQRA 3HE6D 4FNPA 2B4CL 1F56A 3BESR 2CUIA 4JUTA 1N5AB 4KX7A 4LIQH 2GHWB 4GKZB 4B7LA 4ERSL 3S88L 2PW2B 2BVQB 3FT2B 3C87A 3QPQC 4IJ3C 1JRHH 4OJAA 3KBHE 2NY2C 2HJLA 1UB6B 5KOMC 3BWSA 4DKFL 5C71A 2WB1A 3UZVA 1ZSDA 1MH5A 3ZYOA 4ZFGH 1EDYA 1BZ8A 1IGYA 3KCPB 4KKPA 4XH2A 5E00B 1CR9H 3LOWA 3NEOA 3D3VD 2YAHA 4XNAA 4AW4A 4DQOH 1ET7A 3OZKA 1TTUA 1T1WA 1Q1JL 1P53A 4AQ1A 2ZKWA 1L7IL 3D0VB 4IOSA 4OZFG 3WTVA 1JDAA 4L3EE 5CCJA 4FQQA 2JB5H 4HF5L 4YDLC 3ASWA 2W0KA 1E9OA 3TA3A 3OPZL 3CU7A 3T04D 2O26U 4XCEA 1RZPA 5J57B 5D7IA 1RHHA 3RX9A 1BP3B 2X4TA 4X4ME 1U2CA 1ACYH 4C54A 6PAZA 4KGJA 4XOAA 4PLNC 1NMAL 2AJ3B 5HYIA 1FI8C 4BRJA 2YBRA 4X42A 5CMAA 5A16B 3DLQR 2Z91B 2VO5A 2DKSA 4HJJH 1FGVH 4KI5F 4DGYH 7CGTA 3GBMH 1PD6A 4J1UB 2I85A 2PW1B 1XGUB 3P69A 2AS5M 2A6DA 2XDHA 5L2KE 2KL6A 2YD2A 5GGQL 2AV7A 1JG9A 1I8MA 4WTZG 1XMWA 1Y6KR 4KXZH 3W81A 4NZRL 3G5YA 3N42F 1HE8A 4UT6L 4AG4L 3OMZA 25C8L 4NKIL 4OFQA 4CMMA 2J6EA 4UUJB 4F20A 4PJ8C 2J73A 2MRYA 2E76C 1DQQB 3LPPA 3PABB 3CVDA 4JANA 1UGKA 4OF3A 5CN3A 5FB8A 5BV7H 1CFVL 4ZBJA 2D0HA 2YQ3A 1NANH 2C5DC 3GZOA 5CFAA 3VD9A 1ZS8B 1W72H 2Z1PA 4EI5D 3D33A 3RY4A 3VFUB 2G4GA 5E6IC 8FABB 4DUXA 1IM9D 1HOCB 3GSVA 4LLUB 3P4OB 3WEXB 3TNMB 1N64H 1N2RA 4FDWA 3GMPB 4PGJA 4HV8A 1BF5A 2A38A 4HOXA 1IKNC 4N0FA 4XPTL 2FYYB 1U91B 4Z7VF 4C56D 3VFRB 5CJ8A 3VB8A 3LSOB 1JZHA 5CCKL 3EF7A 4H8WH 4NZTL 4X8JA 3SJVD 4J28A 5FGRA 7TAAA 1IAKB 3B83A 4H4NA 3PV6B 3IN0A 2X4QA 1UXWB 5JW4R 1WS7A 5T3XH 5F7AA 1OAKH 3VXOA 3ECVA 4BSWB 2HVKB 4YHKH 3H6JA 3MRBB 3D0LB 1BIIB 4WI7A 1CT8A 3WFBL 1X4YA 1PF3A 4IKKA 5CZXD 1GL4B 4E0RB 1OAJA 3LNFA 5KVEL 3QRBA 4N5ED 1ZHKA 1E65A 4GRWB 2CGRL 4FTVD 1OAZL 3QORB 3V7MA 4L8BA 4G8IA 5HXMA 4KWUA 2V7HA 3BAEH 1PJ9A 4U1HA 3KLHC 3U2JA 3CVHL 3MOBL 1TNNA 2VN6A 1BEXA 4KO5A 5FDWA 5IBLD 1NSNL 2P8LA 5EU6B 3RVWC 4GUOA 1FN4B 2R51A 1K4DA 2XKNB 2OJEA 5D7HA 3L9YA 4FKHA 3PWNA 4HEME 2E7MA 5DJ8B 1UATA 3P30L 1A7NL 1TENA 1TDQA 3QUYD 1U8QA 1EBAA 2H3XC 3FMGL 3B3BA 4GXUN 1KCLA 1QW9A 1RXLA 1HQRB 4ZQKA 4NKDB 2P8PB 1HAUA 3HRZB 3KPRE 1JVKA 1HZHL 2APWA 4WFHE 1MCWW 4M48L 1MCKA 5GGTL 2OR9H 1VPOH 3BVNA 4MJ4A 4YWGH 4ZX3A 2PXYC 3NN8B 5I8OH 2ICEA 5JDJA 1XMEB 1WYJA 2A6JB 4KO7A 1HVXA 2Y23A 4WWKC 5AAMC 4X6CF 4XP9H 4OZIE 4YIQB 3MNZA 3HOGA 4LAJH 5E4EC 1ZOXA 3ARED 4ZO8A 3NSXA 1ETJA 3QEGH 2HRHA 4M5ZL 5ANME 1A4AA 1CYGA 3CFKB 5DHMC 4WEBH 1AH1A 3QI9B 4AENA 1NDTA 4HWNA 2WQ8A 1O7VA 2WAHA 4PIBA 1UA6L 1NBYA 2BSRB 1GW6A 3HI5H 2C4XA 4K2UL 4H2AA 3VG9C 2AANA 1QX1A 5D7EA 3KPPB 1AS7A 3S37X 3B6SA 3QEUB 4PRPE 2H6OA 5C0JA 4MXWH 2F53B 4H5SB 4PJDF 2IQAA 1A7PH 4Z7OF 2Z65C 4F2MA 2DM3A 1EAOA 4WFFD 1NUGA 2NY7L 3CZNA 1LEKB 4MNGB 3WE6A 2VLLB 4BFEA 2VLMD 3MZGB 4UQEA 1PLBA 2CIKA 4HJIA 3N1FC 2J1YA 3BEWA 3LCYA 2F7PA 4LP8A 1T7XA 3KR3L 4B9CA 1D9KB 4OV6F 4TUKH 4HC1A 2XA8L 5AW5B 1KWGA 3O3AA 2ZSVA 3TVMA 4F3FA 2XWJB 4LLDB 3IGAB 35C8H 1H8LA 1PZBA 2P80A 4NBXB 1MJJA 4G5ZL 1UD8A 3DX6A 3JTBA 3P0YH 3EADA 4A2FA 1C7SA 1UXSA 1QSEB 4NQDD 5KANI 3HG5A 3TPUB 1EHLL 4MMZB 3BZ4A 1OE1A 3RPIA 3T1WA 2FAUA 2Z8SA 4J3UA 3L8QA 3QT2A 2J88H 4HKBB 4Q6YA 1WA2X 3FYEB 4OT1L 4ZMYA 1ZT7A 2WLMA 1RUMH 2V7NB 5H4YA 5E0FA 1P4UA 3I6LE 4QLRA 3OR7A 5L9DH 4K94C 1OF2B 4MJIB 4G9DA 2P46B 1J8RA 1GVIA 4L8SB 1CDUA 2BZCA 5IJKA 3REWA 4WO4D 3REVA 4MFHA 4ODTL 1TXKA 1FBIL 5BZXA 1ZK5A 5C7ZA 2VXVH 2XTSA 4TLSA 5CEXA 3U48A 1KOAA 4JLRB 3SQBA 1ANUA 3VRJA 2BNRA 2D3VA 3EJRA 5TDPB 2KC0A 1A8ZA 3ZSSA 4ANXA 5DEGA 3UEQA 2EEFA 1JCVA 5ADPH 3QR1A 4DP9X 2X9WA 1LE9B 1S7XA 3SD5A 2VZTA 4G43A 4N6RA 1NCBL 3CVBA 4JY6B 4BXVA 4R7LA 5D4HA 3BZEA 5ADOL 2GAZA 5C08D 5JIPA 3NSFA 5ITBL 3IJYA 5FFGA 4LSVL 2QPSA 2OL3H 1N0LA 2QBWA 3K5SA 5BMFH 1CFNA 3CC5B 4YDVA 2VLKD 4KJQC 2IPUK 1T22A 2UWEA 4JFUA 2PR4H 3RTLA 4PRIE 5A43C 1CLOL 4OZHB 1FYTA 5DHDA 1NUDA 1JWUB 5KSAC 5B8CA 3RWGB 3T1FA 3QHZH 4ZS6D 4XPHH 3FPXA 3RG1C 4UOW1 4O51A 4DESA 3D2UB 3ALWA 2EDMA 2AEQL 4X6BA 4AY0A 4ZMOA 3TEWA 3S3JA 3MDJA 5FO7A 1PZ5B 4J12A 3QUZB 3ULVF 4QTFA 1EGJH 2LV4A 4IW4C 5D1ZC 5FYKU 3HAEH 5JXEA 3RFZB 4IJTA 4PEEA 3O3EB 4WI0B 1MI5D 1WWCA 2D03L 2HFGH 1S6NA 1NLBL 1E30A 1ID5I 4BFOA 3IPEA 1FFRA 1CXEA 4L9LB 1TYEB 1YNKL 4L4TA 4QI3A 4IHOB 3RDTA 4BFNA 3HI1A 1ASPA 4NQXA 5HY9B 4HFUL 4DTGH 1UJ3B 5A1AA 2YMTA 1HINH 1PKQE 1KBVA 2FATL 2DQTL 4NERA 5HGHA 1JXGA 2PKDA 2APFA 2AV1A 3BKYH 3I50H 3Q1EA 3LQZB 4BZ2H 5IHUL 1E9PA 3PAZA 4X5WA 5CLTA 2HP4A 1S9WA 4OIFA 4LSTH 3GJFB 2UY7B 1L6XA 4QO1A 4KVPA 5HGAA 1WT5C 5DEFB 3MRFA 3WJLA 2EICA 3TYGH 2JKLA 3QIWA 3ULUC 1XBRA 1RJCA 2E47A 2W38A 1JPGA 2W59A 1Z9SA 1LWRA 4X0NA 4GQZA 4S2SA 1EZUA 4ZOCA 5D1QA 3TTSA 2BS9A 3U1SH 1I4FA 3TONA 1RFDH 1KENL 1HKLL 5D1XB 1VEMA 1XD1A 5I1GH 2N0KA 1BQHG 1R5VA 2CNZA 2FX9H 4KXZI 4Z3IA 1KZYA 1SYSB 4ZX5A 3S6CA 4J3OG 4H26B 3PQYA 1QLRB 1UKTA 1GSMA 2KPNA 5FM8A 3VM5A 4FCAA 3LB6C 3N50A 1R17A 2R56L 2Q7AA 4I48B 3V6ZA 4DFHA 1AMYA 2K70A 3MA7A 3ABZA 3HW7A 1WHOA 3L7EB 1Y6MR 2X4PA 1OZTG 2ZOWA 1CLYH 4HSCX 4HPOH 1NANI 3L3KB 5HHMD 1HYSC 2WXGA 3JT0A 3WCYA 3TU6A 4GSRA 1XT5A 3NUKA 3SDCC 2VXSL 4BH7A 3ARGA 2EIDA 5I18H 3P3RA 1A1MB 1X9RA 1NGXB 3GZKA 4FMKA 3OAYK 1MFDL 2CUMA 4W9GC 4LBAA 1DLHA 1DVYA 4IOIA 4OIAA 3ARFA 3LKSA 4XZUB 3BAWA 3H2QA 3PG2A 3DVGB 4FA7B 3AC0A 3II1A 3FQRB 1JGEB 4QMEA 4DK5A 4PJGA 4K9EH 5E4OA 2PPEA 1NAKH 3U0PB 3STZA 4TUOA 4A6YB 5KBDA 1ZVHA 2H1LM 2IMMA 5JNYB 3HS8A 3TT1H 2DMCA 4JPKH 4FYTA 1MF2H 5KTEL 4IU2B 4YL4A 1QA9A 2WLIA 3SDAA 1BVKB 3RWDB 1A9BB 3CLEH 3GSNH 3RZCD 1TTCA 1A14L 5D96B 4NC0B 3E8VA 3VTMA 1AXIB 4MBOA 2D7NA 1MELA 5DUML 4F7KA 4FZEH 1GZHA 4TVPL 3IPFA 5EORL 3TIDB 1TNMA 1ZA6A 2CLVB 4PJ9A 2H1XA 5FHBL 5FWRA 3O6KL 4H0LC 1IC1A 5C1MB 5C0IB 3G6JF 3MYZA 4JFDA 2Q6WB 4Y19E 1IARB 3T6XA 2XZQL 3RVXD 4PJXE 3TZVC 1S5HB 3CDGA 5I74B 1KV3A 4IRSD 4GRMB 1KACB 2BS71 2BWQA 2K6YA 1N5AA 3NOIA 3HRPA 3HJEA 1EA9C 2WXFA 2BJMH 2PW2A 3IAQA 3QJXA 4B5EA 3FT2A 3QIUD 4K3JL 5C09A 3A6CL 3QPQD 3B2MA 1UB6A 3GMMB 2NY2D 4G6FD 4U7MA 4I9WD 1JBJA 2CH8A 1HNFA 4GRLC 3KCPA 4FG2A 1EHKB 4NHCH 3D9AH 5E00A 3RX8A 1RZIB 4NC1E 4KROC 2QVIA 3FCGA 5BRQA 3E1ZA 3AU0A 3D0VA 4RMTA 4R6UA 1AP2B 1H3TA 1CC3A 3MLXH 1JCKA 3BYYA 2QSCL 2X4OB 3VRLE 1WK0A 4U6HB 2AJUH 3CXFA 2YFOA 2FWLB 3PPEA 1URZA 4PLJC 2M2DA 2BP3A 4MJIE 4Q6KA 2IV8A 2A9BA 4JDTL 4Q4IA 3WI9A 5DHVB 1NQBA 3CSGA 1QFPA 1GGBH 3JWDC 3L9RB 2NY1C 4JFZH 5D6CB 1CXKA 3WMQA 5GHWL 5A16A 2KKQA 2Z91A 4U0QB 1QD0A 2VDOL 1DQTA 2IPKB 4NQCD 2NCMA 1X5IA 5GQBA 1UXMA 2Q7NA 2ZOOA 4GAYB 4MXQD 5EDXA 4J1UA 4O02L 2PW1A 1XGUA 3AM8A 3FU8A 4X6DB 2IADB 2MQ0A 3D52A 1IM3D 4FXGC 2N4IA 3L5JA 1NIFA 4QXUH 3MRJB 1BXUA 5JA9A 2OULB 5ISZD 1TZOA 3EDEA 3QDGE 4TQEH 4OTXL 3NJJA 3RPKA 1T5WB 4OCXL 4LEBA 4R8WH 1BWWA 2VZ3A 1AXSB 3DX9B 3QDJB 1DQQA 3PABA 4EN2A 5D7JB 4RNRB 5K39B 2PCYA 3ETBF 1OB1B 3QWNA 3MBXL 4AEHL 3V5HB 3PHOB 3NJHA 4PBVC 4K23H 3JWOH 4GW5B 2W0LA 1SOXA 3EZJB 1NFDB 2AK4D 2P48B 3CSPA 4JDEA 4LEXH 8FABA 5E2WH 3BUYB 4OLXH 1HOCA 2DQGL 2FVNA 5GSRB 2H3NB 4KOCA 4LLUA 4U1JB 3P4OA 2ZXCA 4ZOBA 3WEXA 3TNMA 1NEPA 1E4XH 1HE7A 5HGGS 4YGAB 2FYYA 1U91A 1XDTT 4JFSA 4GKOA 4YUEH 2BOLA 3LSOA 2P9RA 4DUVA 3FSAA 3HB3B 1I1FB 1IAKA 3DUUB 3MJ8B 5IW1A 2XQ0A 1YMMB 3RKDC 1WUZA 2ARJB 3BAYA 2IAAC 1UXWA 4IIQC 4S1SL 2AQNA 3DMMB 2GJ6B 2HVKA 4BSWA 2A4ZA 3F7LA 1PG7X 1LTXA 2QFRA 1RMFH 1JGUH 1A21A 1YYMH 2YPKB 3D0LA 1BIIA 3FFCD 3MRBA 4HUNB 3Q06A 1QO3B 3VXRB 1OHQA 4E0RA 1R9FA 1M4KA 1DEEB 3LZPA 1Q0EA 3BWAB 1YEDA 1QPXA 2BERA 5DMJB 4WWID 1F8TH 4FULA 4N6QA 3WUWB 4LPUA 4K07A 3BQVA 2O5YH 4XO4A 1HAWA 2E0PA 3KS0J 4F8PA 3QORA 5HHXL 2CKBA 4Z7UE 5ELIA 5CINH 2L7EA 1OGTB 4ZUSB 4PJBF 3EHBB 1K6QL 1HZLA 2VN3A 1NCGA 4Z7NE 5ESQB 1HCYA 2ROXA 2UXTA 5DRZB 4XAKD 1JNJA 1BW8A 2OMNA 4UF7C 2BP8A 1TSHA 4NS0A 5EU6A 4N8VB 1NCIA 1FN4A 4KK8D 5DO2D 5GSVB 2ADYA 1HFUA 2XKNA 2BSED 2XFGB 5DRXA 5K9OB 1KJ2H 2DEYX 2P1YA 3GSWB 3PDGA 5DJ8A 1G7JB 5KSUA 1S9XB 3T8VA 4Z3EA 1MRDH 1UWXH 4TSAH 3T6VA 1HQRA 4N2IA 4NKDA 1F4WL 1UASA 2K78A 2P8PA 3HRZA 1WF5A 3O6ML 1YJDC 4IKIA 1BBDH 4YBHA 1DHKA 5EN2B 2UXVA 3AXHA 3GSOB 3PJNA 4IMKC 3QPXL 1ZGLM 3B9EA 4BCYA 3MU3A 1KB5B 4YSDA 1G1KA 5C3IA 3EFDH 5EOTA 2J6EH 5HI4D 1I75A 2VW7A 2A6JA 2X5PA 4UOJA 2GUOB 1DQKA 1PZSA 3KBPA 4S1QL 3VFVB 1IC0A 2AK1L 4WWKD 3VFPB 1U92B 1I7TB 4RQQB 2G5RA 2CM6A 3K46A 2PPAA 4BWTA 4F92B 4AV0A 1CTOA 3CFKA 3ZE2F 1VLXA 4TN9A 3CZKA 3DX7B 3D3VB 1F13A 3G9VA 4JG5A 4M00A 4WW2F 5DJ0B 3WFCL 1BWMA 3AZUA 1OM3H 2BSRA 2WMPB 1FJ1B 4G59C 5EU7E 3RGVB 4EIGB 1KEGH 1A6UH 1DQJB 1CZ8L 5JXAL 5IB1B 4ODUB 1OL0A 1T2QH 1F86A 3KPPA 3QEUA 2F53A 1N70A 3A47A 4H5SA 4ODVL 1VESA 4ZAKB 2UYLA 3FYIB 4MLSA 5BVPL 1G6RB 1LEKA 4E41A 3QZBA 4MNGA 4UYPA 3ATEA 3P0VL 5DD0L 3PV7A 1YQVL 3K2KA 4YNYA 1J5DA 3ZT6A 5ID1B 1D5BB 4LPXA 4QNPF 5FGSA 1E4JA 1NCOA 1UH2A 1IFHL 1TO5A 2ESVD 4FQ1L 1E42A 2DIAA 3JVFC 4S0TD 1D9KA 1MIMH 3K74B 4M6MH 1UADC 3RURA 4ANVA 3GJEB 4Z3JA 2IAMC 5FFLA 3B3IB 4HDIB 4GQ9H 5E8OB 3TBYB 2E6QA 2H41A 2HWZL 1RHFA 1X9LA 5JHDB 1R24B 3I9GH 3LN4B 2XWJA 3L4UA 3IGAA 4FQXB 4GB9A 5ECGA 5BQDA 3V9CA 7PCYA 5BZWA 4I1PA 4ONFL 4QJ5B 4JFEB 5GS2H 3QZOA 3ZDZF 4BIKA 1QSEA 3TPUA 4MMZA 4BA8A 3ZHNA 3VDCA 4W4OC 3G6AB 1G87A 3PWUB 4HKBA 1GC1H 4YC2C 4JQXC 5I1LB 3QUMH 1QATA 1IE4A 2ENJA 1FE8H 2X28A 3VXUE 4Z7WF 4HXBL 5AVVB 1G9NC 4I13B 1FUNA 4Y2LA 1FPTL 1FLRL 3N04A 4AC2A 4LKCA 4M7LL 1OF2A 4L8SA 2YGPA 4W9KC 1I9RH 3KYMB 2JB6B 2F7QA 4NOBA 4ZXBC 4AYID 3F3HA 1TVHB 4RBPH 2ZCKL 3QCUH 1O0VA 3GKZA 4N9OB 2YN5A 3OAUL 4RMRA 1IM9B 1XFPA 5CJXA 1JXDA 3CIAA 4JLRA 4UTAA 5JW5B 4E42B 5H35A 2IH9A 2ZKYA 5TDPA 4IKLA 1NCWH 3TWCL 4XXDB 4C56B 5F3BA 3K1DA 5FW7A 1YEGL 5D7LB 3QJVB 5G2NA 4P49A 4XP1H 5KAQG 1LE9A 3C6SB 3HBZA 4JY6A 1IC5L 2F54D 1KTDA 1C5DB 2HLEB 3UX9B 5CM1A 2FEEI 1BQSA 3O2DA 4Y5VC 3QUKB 5LDSA 6TAAA 3W1ZA 2AZAA 3CC5A 1AE6H 5D55A 3W3BA 1E6OL 4KJQD 4F57H 1H6FA 4F2EA 1D5MB 4HZAA 4G7YL 5D6DC 5KYWB 2VW4A 4OZHA 3NJKA 4BKTC 1SGKA 1L9OA 1JWUA 3RWGA 2P49B 3F83A 3Q9PA 1V10A 2JK5B 5JZ7C 5AAWC 1FDLH 3D2UA 1MCPH 5F7KC 3KNBB 1UKSA 3CSBA 5HTSA 1Q90A 1PZ5A 3QUZA 2FWSA 5INCB 5TE4H 4BZ1A 4E9WA 3RFZA 4I3RL 4F8NA 5D1ZD 3O3EA 4XPFH 2X1OA 1MG3C 1WEJH 5DYOA 2AHIA 4HC1H 4YSPA 3DTXB 3BUPA 3H9HB 3LQAL 4FQ2L 4G6AC 4L9LA 3DO4A 1SJXA 3VXSB 4AMKH 4JW3A 4KNQA 3L1GA 2ORBL 4LSPL 1AO7D 3CPLB 4X98A 5FUCC 4ATWA 4BH8B 1UJ3A 3IRCA 3KLSA 3HC4H 4A39A 3DYMA 4AWJC 2ITDB 4FG6C 1YNLH 4M8QB 3GRBA 4FTDA 5HDBF 2PYEB 4H2CA 3GJFA 5EF3A 1QFWM 2UY7A 4YFLI 5GS0L 4D9RD 5BJTB 3IDIB 3BN3B 5DEFA 4WSGA 2Z4QB 3RKPA 4UNIA 2ZE0A 1BF2A 2ICWI 2X2JA 2Z0BA 1J1OL 3CFQA 3POCA 4PTUB 5ALBH 3ULUD 2QPFA 4H13C 4F7EB 2YUVA 3P9MB 1WAPA 5F7WC 3ARPA 1AYOA 2DQHH 1U95B 5D1XA 1JHLL 1ZHBA 4JFXB 5FO9B 4KV5F 5B3NA 2B20A 1E50A 3INUH 1PPIA 4QXTB 5T5NG 4U49A 4DGVL 1SYSA 4H26A 4MYPA 1S7VB 3NDYE 4FOMA 3SGEH 2VDPH 4HT1L 2BNQE 3STBA 3BD5A 4I48A 2PPFA 1PEWA 1VCAA 4NO0B 1W0WA 5B22A 2AQ3A 4YS4A 4JRWA 4MJ6B 1WC7B 1HI6B 2FBRA 3L7EA 2ZOKB 4XB8A 3VFTA 1CLVA 3I2CH 2AQQA 1IT9L 3L3KA 1DANT 1P4BL 1OB0A 3MA9H 3UADA 1ZVNA 5GRUH 3SKOB 4RWYH 3NIFE 3PGCA 3VSQA 3QYNA 3SDCD 2EH7H 3BMWA 4RFOH 1RULH 4HISA 4KK9D 3BW9B 2A1WL 1A1MA 1I1AC 1BZ9B 1NGXA 4KH2A 4Y8AA 4Y7MA 1CF8H 1LP9E 2MSPA 4DSYA 5JOPD 3LEYL 1E4XI 3T0WA 5BV7C 3AS0A 3VG0H 5A2CA 4XZUA 3K4ZA 4GO6B 4GUCA 3DVGA 4FYSA 4NQDB 5D8JL 4L4VB 3WAKA 3FQRA 1MFUA 1JGEA 2JV6A 3FT0A 5MEOB 2OR8A 4XMKH 3GFUA 5FYKH 3MZTA 3PYCA 4A6YA 1SPDA 2XYBA 1TFPA 2VWEC 2R8SH 5LLIC 1UOVA 4IU2A 5C7XL 1BVKA 3RWDA 1A9BA 4LRIA 3VQ2C 2NW3A 2WKGA 3OB0H 4XP5H 3IJEA 3EO9H 5IROC 5D5MF 3TIDA 1A3RH 2CLVA 4GBXC 4JO3H 4LNRB 5CZVL 1C5CL 1GGCH 4GKLA 2BVPB 2NNAB 4WO4B 5ESAB 1CQYA 4PJCB 4D3CH 3BFQG 5C0IA 1SN5A 1E5CA 4Q0XH 2Q6WA 3TCLA 4XVUC 4YDIH 3MX0B 4QRFA 3I9AA 3TZVD 1ZMYA 3X1FA 1AS6A 3VH8B 2WO3B 2YRBA 3D87B 3G6DH 1KGWA 5E1GA 1L9PA 3L5XH 5TDOB 1XGZA 4I77L 2RBLA 3WKMH 1QUPA 3UO1L 3SE9H 1I9EA 3ELQA 3WIFA 5I6XC 3BDYH 4U3HA 4BWWA 2QJDA 4LDOB 5DYFA 1MZYA 4AYMC 2QQLL 1BZ7B 3GMMA 4X4KA 5AUMB 5C08B 2Z64C 3GGWB 2WTRB 5KVFL 4W9EC 1OF0A 3SE6A 5EIVA 1L7TL 1NDGB 2DB8A 4Q89A 5AL8A 1BEYH 3L1OL 1BDYA 4ZDHB 4LLWB 3U6XS 4HLJA 2FE0A 4KROD 5DLLA 3R1GL 1UZ6F 1AP2A 2HSIA 1OOWA 4PJIA 3SQOL 2RCSH 4MQXD 2NZ1A 4QAMB 5FUOH 1IC7H 3EYSL 3ULVL 2X4OA 4HGMA 4U6HA 2G30A 3ZKXB 3AXIA 3UYRL 1NEUA 4XPBL 4TXVB 4P5TD 4PLJD 1HXKA 2J8HA 1WVZA 4P9ML 5CILL 4LVNB 4N2OA 3P4MB 3L9RA 4YFLF 4KQ0A 4L3CB 5D6CA 2BHYA 4F37F 3U4BL 1SN2A 3ZE1F 3MACH 3SOTA 1DBML 2LVCA 1NTDA 4PJ7B 1J9TA 2HFEB 2IPKA 3BSHA 4YHYC 2WQSA 4PG9B 4GAYA 4NP4H 3U9UB 3BGFC 3VNZA 4JZJB 4C56E 1IILE 4X6DA 4FP8L 4ENEC 2IADA 5D2NE 2XBTA 2OJ1A 1TQCB 2OCCB 2XCMC 2O5NA 3SJVE 4AEIL 2ZG3A 3ILPB 3MRJA 4IS6B 1CGXA 2HVJB 5E1QA 5FM5M 4Y5XC 2L8AA 1J9CT 1KWKA 1AOHA 4CDGC 2VH5L 1UVQB 1CU4L 4MS6A 1DBBH 1GAFH 1T5WA 1U21A 4R5XA 1L5GB 2ZUWA 1AXSA 1MCDA 3DX9A 3PGFL 3DETD 3QDJA 3WY4A 1N4XL 2QL1A 1ZLUH 5BRPA 5K39A 1RZJC 1I3GH 3UC0L 3TJHC 1JZ5A 3PHOA 2MHAA 1LO2L 2WIMA 5BUAA 2Z0UA 4QCIB 4GW5A 3Q2NA 1I9IL 2E6JA 3EJYD 1MFMA 4FTVE 4HJSA 3IAGC 1NFDA 3RP1A 4D8PB 2YD8A 5IESL 1HHJB 5T1DL 4KKCC 4AQ8C 2Q76B 1GXEA 3GO1L 4LHUB 2GIMA 1B3JA 3BUYA 3UTTD 1XF5B 3JVGA 1T7YA 2H3NA 5GSRA 4U1JA 5IVXF 5I1DB 4ZYKB 5A6IA 3U9PH 1A6WH 1A25A 4WF7A 1GMIA 4JFYB 5E4AA 1PZ3A 4Z3HA 5EEXA 1RZ7H 3ABKB 3NCFB 4G3YH 3MFGB 2MQCA 2NLJB 3M86A 3APFA 5J6SA 4OLZH 3CZFA 3PP4H 3QUXC 2FJFB 1I1FA 3DUUA 1X5LA 3MJ8A 3OBAA 4JB9L 1YMMA 3DROB 2ARJA 3RKDD 1TPXB 2DYPD 2ZP0T 4F5CE 1MW2A 3DMMA 2GJ6A 3M8OH 5EO1A 5HHMB 3LRHA 2XICA 4QXWA 2YPKA 5DD5H 1PAMA 1IVLA 4X2UA 1QO3A 3VXRA 4ZUTB 5BQ7B 1CE1L 2JXMB 1U3HC 4RZCB 4Y9BA 5C92A 2R0KL 3TH4T 1TU2B 5TE7H 3CX2A 5TE6H 2WUCL 5IB2B 2AW2A 4P8QA 1UD3A 3OKEB 2QPDB 5DF0A 2V37A 1FH5H 4QHUB 4WGKA 1TTAA 3TFKC 2ISDA 4R2GC 2K45A 4ZUSA 5C0GB 5AD0B 4YOKA 5ESQA 2YKLH 2Z93B 3K6NA 3WNLA 5B7MA 2NY4D 2QHLA 4UT7L 3MI6A 4OF8A 5DRZA 2X2UA 2AABL 4TUUA 5DI8B 5D7IF 1XSJA 3A4FA 3QDHA 5F6IC 4DERA 4EZKA 5J13B 4N8VA 4EVNA 1ZV5A 2ZUTA 4ANWA 1LILA 4KGLA 4WUUD 3Q2VA 5GSVA 1S7WB 4I1RA 4H44C 2HTKC 5JUEH 5K9OA 1QYGH 1JI1A 5D2LB 2XN9B 3GSWA 1EZLA 3S4SA 4LOVA 1A9EB 3T09A 2BSSA 1S9XA 2I26N 3SE3C 5LG6A 1BOGA 1OSYA 4WFFE 3EOTH 5F6HJ 2AEWA 4XP4H 4U1NB 5LGKA 2UV3A 2VAJA 3DIFB 5EN2A 3GSOA 5DRNA 2VLME 4IRSB 2HKFH 4ONOA 3Q43A 1JRHL 4W9ZA 1KB5A 5KN5A 3IDYC 9PCYA 4C83B 1A6ZB 4ZFGL 1GZQB 2GUOA 3VFVA 2FB4L 1X5XA 2WD0A 4JM2C 1CR9L 4TNEA 3VFPA 2YJLA 4N3UA 1U92A 4N25A 2Z7ZA 3ZJAA 4RQQA 1EEQA 4DQOL 2NY2B 3JWNE 4G6FB 5CGYC 1BFVH 2APSA 2GC4C 2XQBH 4LLQB 4MSWB 3F7RA 2HRGA 3IJ9A 3NTCH 1X7SA 3C6LD 3R0NA 4ORZC 1SVZA 5LWYH 1CN4A 3OKYA 3D3VA 2JB5L 1FSKC 4FYQA 3ULVD 3MLSH 1XX9C 1AQMA 5DJ0A 2PO6D 4I3SH 1ETB1 2F7RA 1FJ1A 2WMPA 3RGVA 4CSTA 3U46B 1IEBB 2ZAGA 1DQJA 5EF0A 3QUGA 2YPLB 3HS0B 2I5YH 1ACYL 2RFXB 3OAWA 3BAJA 4ZAKA 3VMPA 4B9JA 1P0SE 4YDLB 2Y5QA 4YHNA 2CO4A 4NWTH 1G6RA 3IPBA 3TEZA 1G7HB 3VI3E 5BQ7A 3FQTB 5ID1A 3GXNA 1D5BA 2WAQA 3PS6A 1ZHNB 4HJJL 2BW4A 3W5NA 4DGYL 3GBML 3L08A 6PCYA 1ESOA 3GJEA 2FHFA 2GSGB 3B3IA 4HDIA 5E8OA 1E8WA 2IAMD