2W8CA

Plastocyanin variant with n-terminal methionine - closed structure
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
106
Chain Sequence
b'METFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title Metal-Mediated Self-Assembly of a Beta-Sandwich Protein.
pubmed doi rcsb
source organism Phormidium laminosum
molecule tags Electron transport
total genus 24
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2w8cA00
2IH8A 1V10A 3RYMA 4HCIA 4UANA 2CBPA 1ET8A 2H3XC 4DP1X 4AKQA 1MG3C 1NIEA 3NJNA 3NJLA 2GHZA 1T5KA 2MRYA 4A67A 2CAKA 2BP0A 4JHVA 4CSPA 1NZRA 2Y1AA 1AAJA 1WS8A 1KYAA 1BEXA 5I6PA 2GSMB 3L45A 3OM3B 5E9NA 4HCGA 1BQKA 3FPXA 1A4AA 1J9RA 3SBQA 1AZNA 1ASPA 2BO0A 2PPDA 4GYBA 4YVUA 3T6WA 1NIFA 3AG3B 3ZX1A 3NJGA 4DPBX 1NIBA 1E5YA 1NICA 2PPCA 1AG6A 4A2DA 1OE1A 2VW6A 4GP8B 3C75A 3EH5B 2AANA 4GY4A 2XWZA 4HIPA 2XXFA 4AX3A 1E5ZA 1KDIA 1CC3A 2R7EB 3UGEA 2EILB 2IDSA 3WNIA 1QNIA 1AACA 4HCFA 1AQ8A 1TU2A 2B3IA 4M4RB 2BW5A 1BYOA 3TBBA 3TASA 1ZIAA 3SQRA 3T6ZA 3X2QB 3FT0A 1XB6A 5D4IA 3NJKA 1PLCA 3OD3A 4DP8X 2TSAA 1PY0A 5B1JC 1ET5A 2IDUA 2MTAA 4TXVB 1PZAA 4NB7A 5TK2A 5I28A 1AZBA 4G70B 2BWIA 1AANA 3ASNB 1OCCB 3TA4D 2YAOA 2DY2A 2FQDA 2UX7A 2I7OA 3S8GB 2PLTA 1R1CA 4PAZA 4DPCX 1CURA 1ILUA 1W6WA 5D4HA 2PPAA 1JERA 1EZLA 1KBVA 1M9WA 5I6KA 3KW8A 1SF3A 3UABA 1BQ5A 4W1TA 3CDZA 1NINA 4E9SA 5B1JA 3V9EA 1A8ZA 3ABKB 3QJQB 3JT2A 3X1FA 2QDWA 3FQYA 4KNUA 4KOCA 2PCYA 3GXUB 2XLLA 4ENZA 1A4CA 1PF3A 1L9QA 2YXVA 4GP4B 3WG7B 3G5WA 4A68A 4BDVB 1NTDA 4G7RB 4YL4A 3AZUA 4YSUA 2J55A 3NJHA 3S3CB 4HHGA 4WKXA 3UAEA 3X1BA 1JXFA 5F7BA 3EHBB 2CUAA 2XUWA 3NJJA 1JZEA 3WIAA 2AZAA 5I6MA 4GXFA 4QLWA 2JXMA 1JZGA 1SJMA 3D12B 3V9CA 3FU7B 4DP6X 5B1BB 3SBPA 3U25A 1PZBA 3TU6A 2HX7A 4KO6A 4E9TA 4KO9A 4F2FA 4A66A 1KCBA 5ANHA 5B1AB 5AZUA 1SNRA 2HX9A 3UACA 1RZPA 1JZFA 1AG0A 2OCCB 4KO7A 2XX1A 3ZIYA 2HZHA 2PPEA 4ZK8A 2DYSB 5I5JA 5LDUA 4HHWA 3T6VA 3WI9A 3NJIA 1NWOA 2QPDB 3ZDWA 2BP8B 1KBWA 4DP0X 2VN3A 4NERA 1JZJA 1EHKB 2X87A 2DYRB 1SF5A 2VM3A 2YAEA 2YAHA 3HB3B 3H4FA 3FPYA 4F7KA 1A65A 2W8CA 2PP8A 4DP2X 4E9WA 3DIVA 2CALA 1J9TA 3CVBA 3OMNB 2IWKA 4DP4X 2FWLB 2EINB 4BWTA 1BXAA 3EH3B 2UX6A 1XMEB 3KW7A 4G7SB 1X9UA 1JXDA 1ASOA 4M3HA 4KOBA 2DWTA 1FWXA 3IN2A 3BQVA 5EHFA 2ZONA 1OE3A 1E67A 2Y69B 2P80D 5D4JA 1ZV2A 2UXGA 1MZYA 5I6OA 1YLBB 2NRDA 1RCYA 1AOZA 4E9RA 3GYRA 4PCYA 4G7QB 1CYXA 4E9XA 3PCYA 1ZPUA 1FFTB 1KDJA 3SBRA 1BYPA 2IDFA 1M57B 3FSVA 2H47C 3CG8A 3WKQA 4BK5C 2VW4A 1UATA 2AVFA 3NSYA 1IKOP 1V55B 2HRHA 1NWPA 5I6LA 3AY2A 3QJUB 1ADWA 1ET7A 1WA1X 2XV3A 1L9TA 2P80A 5AFAA 1WAEA 4YSCA 1GS8A 1HAWA 1L9PA 1RZQA 3PPSA 4NAJA 3S3DB 4GP5B 3T6XA 3IEAA 2Q9OA 1GR7A 1DZ0A 4BWWA 1PNDA 4DPAX 1IBZA 4DP9X 2W88A 2I85A 3PAZA 1M56B 4E9VA 2AZUA 3QJRB 3S8FB 1GS7A 2Q5BA 2GBAA 4QKTA 4A2GA 1TKWA 3X1GA 3UAAA 4YVNA 2ZOOA 2R7EA 1KV7A 1AS6A 3PAUA 3QJSB 3ABLB 4A2FA 5I6NA 1NPJA 1NIAA 4YSAA 1JZHA 4A2HA 1URIA 2FQFA 5PCYA 1IUZA 3CVCA 1NDTA 2WO3B 1PLBA 1ID2A 3NSFA 2OJ1A 2GIMA 4BXVA 1GY2A 1PLAA 1XB8A 1TEFA 2EIJB 4E9QA 2ZXWB 2QPEB 4N4YB 5B7EA 4YSTA 1SDDB 5A7EA 1AS7A 3FS9A 3WNJA 2PP7A 3NJFA 6PAZA 4G72B 5I5MA 1ZDSA 4YSOA 2GC7C 1F56A 1JVOA 2YAMA 1XB3A 2FT8A 2TSBA 1X9RA 2QT6A 3T9WA 3IN0A 2J5WA 4Q89A 2BWDA 1JZIA 1CYWA 2IDTA 2BW4A 1WA2X 4BDVA 2HXAA 4HZ1A 2FQGA 2VSMB 1KGYE 2GC4C 1TEGA 5B1KA 1J5DA 1IC0A 2JKWA 1AZUA 1PNCA 3FU9A 1BAWA 1GY1A 1OCOB 5AKRA 2BP0B 3N2JA 5B7MA 4KNSA 3PAVA 3UADA 1SDDA 2VW7A 4X4KA 5PAZA 4JKNA 3FU7A 4YSPA 3ERXA 2UXFA 3FU8A 3H56A 4F2EA 3PXLA 2JFCA 4BWUA 1BXUA 1PMYA 1BXVA 2HRGA 4UAHA 2VSKB 1FA4A 1ASQA 1AZRA 3N55A 5TK4A 2FTAA 3FQ1A 3X1EA 1E65A 4EF3A 1L9SA 3PLYA 2QDVA 2BZ7A 1KCWA 1JOIA 2XU9A 4AKOA 2RACA 3OMAB 1NIDA 1AR1B 4W9ZA 2BP8A 3QJTB 7PAZA 8PAZA 2UXVA 3ABMB 3NSDA 2YARA 1J9SA 2AFNA 3DKHA 2YAFA 3CVDA 3H4HA 1I53A 3NYKA 3ASOB 2XXGA 3FQ2A 2GI0A 2IWEA 2PP9A 4P5SA 4YSQA 6PCYA 5I5IA 3EH4B 1W8EA 1OCZB 3NP3A 1GS6X 4P5RA 4YSDA 3BVDB 1MDAA 1OCRB 2LLNA 1CUOA 2YAPA 4YSEA 2I7SA 1N68A 3QQXA 4HAKA 1PCSA 1ILSA 2CCWA 2VMJA 4L0PB 2PPFA 3JTBA 1SHWA 3AG4B 5B3SB 4A2EA 1A4BA 1JVLA 2VM4A 3CDZB 2BHFA 4FA7B 1OE2A 4AZUA 1DYZA 1JXGA 2FT6A 2DV6A 1GYCA 2BZCA 3S3BB 1VLXA 4AKPA 2WO2B 4JHUA 2DWSA 2J56A 5F7AA 4RH4A 4E9YA 4YSRA 1HFUA 1L9OA 1GSKA 1MG2C 1E30A 1RKRA 2HX8A 2YXWA 3ABGA 3AW5A 3NP4A 3AG1B 3WKPA 4HALA 4KNTA 3IBOA 4DP5X 2XVBA 3FSZA 3FYIB 4UF7C 2J57A 4FAAB 3FSWA 4WTQA 1J9QA 4N8UA 4K9JA 2IAAC 2OV0A 3X1NA 1J5CA 3NT0A 2B08A 1WS7A 1WA0X 3FYEB 2CJ3A 3EF4A 1OV8A 2H5UA 2GB2A 4G71B 3QPKA 1W6LA 1A3ZA 1ZDQA 1SFDA 5FC9A 1IBYA 4DP7X 1AS8A 2FJSA 4KO5A 2EIKB 2XYBA 1SHXA 1ZIBA 3FSAA 1QLEB 2A3TA 3CZUB 1OOWA 1B3IA 2XV0A 2E86A 1HAUA 2PCFA 2HLEB 4BXSV 4CSZA 5IY5B 1V54B 3IE9A 1NPNA 1PAZA 7PCYA 2IH9A 1ETJA 2N0MA 1L9RA 3GDCA 4MFHA 3QJVB 2YAQA 1OF0A 4Q8BA 2FT7A 1QHQA 3NSCA 3HEIB 4AI7A 1GW0A 2FQEA 2IWFA 3MX0B 3AG2B 1PZCA 2X88A 2YQBA 1MZZA 2EIMB 5I26A 2XV2A 3T71A 4YSSA 1N70A 2FNWA 2UXTA 3NJMA 3MBWB 1BQRA 5B7FA 3OMIB 3TBCA 1AIZA 1AZCA 3ZBMA 2IDQA 3OQRA 1SFHA 2XX0A 9PCYA 2WSDA 3DTUB 2ZWNA
chains in the Genus database with same CATH superfamily
2XJLA 4AQ8A 1VFOA 3AY4C 4HXBL 1ML0A 3RYMA 1KTDA 1YC7A 3Q7JA 1D3CA 2DLFL 1MG3C 3ECBA 3VSQA 3WCYA 2IDCA 5KSBE 1T5KA 3O4LA 4CUCA 4UT9L 3AJ7A 5KAQG 1Z5HA 2F54E 1MCDA 2DZEA 4JY6B 3ZL4L 2OSYA 3KLKA 1MHCB 1ZHKA 4OGXL 4PRBB 1SRDA 4CSTA 1AR1C 4V11A 3LQMA 4XPGH 1IBDA 5F1IB 5E24E 1QBMH 3GSOA 2N56A 4YJZL 4ZMOA 1KTRL 1M1SA 5T1MB 4A7VA 4OUUA 5I8EA 3FT4B 1QUPA 2MCAA 2Q3AA 4M8RA 3CXFA 4A2DA 4RMUA 4UQBA 4OKDA 2CG9X 1FLRH 5CHNB 2BNRE 2DAVA 2VLRE 4LEXL 2IF7A 4JO1L 3L5WA 1PPIA 5DVPA 2QKIA 3MHZA 3KGUA 3P9LA 4FS0A 1WBYB 4M6OH 5HGBB 4AW4A 4JRXA 3HW7A 4IGBB 2EEDA 2FWOA 4HOXA 5ADPL 2DLHA 3NESA 2F68X 4YXKL 4NC0B 3U4BL 2XNAB 3HBZA 3BCDA 5IQ7H 3HCVB 2BJML 3LTVA 1CICC 1QSFB 4Z7VA 1HNFA 1ZJBA 1BP3B 1CGTA 1PY0A 5KG9A 4KKBC 5B39B 3G6JE 3PV6B 2R39A 3DXAB 4K3EH 3FB8B 2BSSB 4AE0A 1NH6A 1INEL 2VR5A 4ADIA 2XQ0A 3L5XH 4QRQA 3UL4A 4RMSA 1K72A 5AVVB 1TMQA 4P3DA 2C4XA 1AQMA 5CMAA 1JF1B 1F3JA 1KCSH 1CURA 4X6CE 3MJGX 1W6WA 2GTWB 5E2WH 2WLLA 5A2KH 2WLZA 4NWUH 2WBXA 3RUGF 3LVEA 1XIWB 4IU2A 2ZWLT 4KH2A 5GHWH 5MEPB 3TONA 3PDOB 4CW1B 4WENB 2LV4A 4UDUA 2J21A 2X7LA 3QQ3A 1NAKL 3UYPA 4MVBD 5D7IA 4K3JL 1G9ML 4MAYC 4AVIA 3D07A 3QUXC 2DQIL 4LARL 4QXGL 4D9RE 4NN6C 4N2GA 1RJYB 3WFHA 1JSYA 1UT1A 3EOAA 2X12A 3Q8CA 4L1TA 4M62H 3BGFC 2VDQH 3FTGA 4WU5B 3M8OH 4P4RB 3BEVB 5F7BA 3EHBB 4B9FA 5DUML 3D34A 1T89A 2CUAA 2AKRA 3VYNA 3TCLB 3US0A 3MUY1 4LOVA 2ESVE 4XVUC 2EYRA 1IIKA 1QI3A 3FU7B 5L4JA 4R7DB 3SBPA 1PZBA 3BUDA 4X6FB 2QL1A 1MCPH 4EDXA 2WXIA 3DBSA 4HSAC 4WJ5B 5B3JF 2IPTL 5BRPA 1I82A 3CUPB 5GJTL 2XN9D 2NYYD 4N2IA 3BYYA 3D09A 4D8PA 3S3SA 1FN4A 2AABH 3KHOA 4KO7A 4F7TA 2VLME 2HZHA 2E9GA 1BF2A 4H1LA 4J3OG 5L2KD 4ZTOH 4JFUA 3LXCA 4NKOB 4KQ0A 4U2YA 3NVQA 4K5PA 2D0FA 3U30B 1U3JA 1UB6B 2EE6A 1GAFL 1KXHA 4MZRA 1EHKB 4TS6A 4U1GC 1C5CH 1KPRA 5DZLA 3TO2B 5ADOH 3ULVH 3FPYA 5TFSH 1I1AB 4N0RA 4M7JL 3RTQB 2WBJD 3BQUB 3MXVH 5JW4Q 1MHEA 1UXLA 2OCJA 2JIXA 4LLWA 4PJBE 4MBRA 3SYPA 1CD9B 2YUWA 3C8KA 2VYRE 3VMPA 5IW1B 3QCUH 5M7QA 3EGXB 3EH3B 5CJOH 5HY9A 4LL1A 5KJ7E 3T0AA 4K94C 3SY0A 5K9KA 3MBWA 3EAKA 3BQVA 3D5OF 1W15A 3UTQB 3GXMA 1LDPL 1JPST 4WI0B 4F9LC 4XBPB 3A67L 1T66D 4O02H 5AZ2L 2YKLL 2X0WA 1H19A 4NHCH 4PGJA 1W0YT 1CYXA 3DVNA 2PTVA 2CIIA 1B90A 3ULUF 3GMPB 6TAAA 2IDFA 2MEJB 1CLYL 1QEWA 3HBPA 3PWNA 1MW3A 3LD8B 3QNZA 4P5MB 4YNYB 5T1KD 4P8QA 5C6TH 4AENA 1IARB 4U6XA 1C16B 4WHCA 2Z92B 2BHUA 7FABH 1WZ1L 4DCQA 1OSEA 4JMXA 4B3EA 1B0GB 5FKAA 3HIZA 3VM5A 4IGBD 5DSCB 5KJRL 1GHFH 5CCJA 3MRDB 1HSBA 1WD8A 1HL9A 1ZT4A 4NAJA 3QNYB 5H37A 2MTPA 2C5DC 2Q9OA 3L1GA 1DZ0A 4BCXA 4BWWA 1KCUH 4RMVA 1YYML 4I0CC 4ZSOB 2QJDA 1DTUA 1M56B 1IKFL 3DXAD 3QJRB 3S8FB 3GZQA 4LPTA 4WI3A 3UTOA 4NC1E 4A2GA 3FQ4A 3EGDB 3W9DB 1G9EA 4XX1E 3QJSB 1RUQH 3S4SA 3L7EA 4F8QA 1JZHA 2LT9A 5D7JC 4GAYB 3O9WB 1PFCA 3NCJL 4GAJH 1XIWD 4M1DL 5PCYA 1RPQA 2IBBA 5BJTB 4R4BB 3KPRE 5HBBA 3B6SA 3CFKB 1M6UA 3UZVB 1YPZE 4LE8A 3ZZSA 3EFOA 3NSFA 1A21A 1KEGL 1HYSD 1FGNH 4GEIA 3LKRA 2NY5C 4KX8A 5JW5A 5KBMA 4MSWB 4KDWA 5DJDA 1TUPA 2IBZX 3UG5A 4BUGA 1WWWX 2QPEB 4N4YB 1YEKH 3DGGB 1FE8H 5ALCL 1OF2A 4UINL 1GMEA 1EFXD 3EHBD 4UQIM 4LLDB 1X5IA 3TWCL 4YSOA 5EU7C 3VAEA 1XGYH 2OBGA 1W80A 4I2XE 1G0YR 4P5TA 2DMKA 3EJSA 2E7LA 1JBJA 3GHEL 2QT6A 4C59B 3FCGA 4NENA 4KY1L 5I1EH 3W82A 4GIAA 4E42A 1CYGA 3HNTL 3QXTA 4CVXA 5T3XH 4H8VA 4R5XA 3W5NA 4U1LB 3G08A 4IEFA 1E5CA 1P7KB 4RX4A 2JKJA 3APCA 2IQAB 5ISZB 5T5FL 4JM2A 3MLSL 4ZW3A 3IXAA 3VGGA 4W6YB 2ARWA 3PFQA 1KOAA 2YMXL 1KENL 3JV4B 1P1ZA 2QVFB 5HSFA 1KYOK 3P2TA 5GPRA 3UZEA 4BSVA 3TNMB 5AKTA 1N5YH 3DIFA 4D2NA 2ZSWA 2JFCA 1JWUA 3ULUE 1I1AD 4Y2OA 1BAGA 1DDHB 3BQUD 3L3OC 1H3TA 4B9JA 4UIMB 4RDBA 1R9FA 1MRCL 3DTDA 4RWYH 4APXB 4DUWA 5IVNA 2FTAA 3L1FA 4IHOB 2Y1YA 1UUNA 2WNKA 1U3HA 4FHBD 4ODSH 4Z3HA 2HVBA 4EF3A 3Q8EA 2RBLA 5AW0B 1G43A 2GTZB 4HHAA 4Y5XA 1H3VA 3ARFD 3VXSA 2AEIT 3F7KA 3VA6A 5KYYA 4OTXL 4Q9RH 1NIDA 3UFIA 3KYMA 1OGAA 3FMGH 3O11B 4JQXC 3J7HA 4NRYA 4FA8A 4AK2A 3K71B 3IJ7A 5EOCJ 4X6DF 4GI6A 4M4PA 4KV5E 2K78A 5J1SC 2A6IB 3FQ2A 2IWEA 6PCYA 3LZRA 4ZXBB 2KHAA 2NQCA 2X1PA 2V9RA 3PJLA 2JH2A 4X5LA 4DN4L 1XV8A 3GKWH 1AZZC 2ZXAA 1L3NA 2DJSA 3VWJB 5JUEH 1WEJL 3QDMB 5DD6A 2ZWKA 1DQML 4M61A 1SYSB 1RH8A 4ONGH 4OGYH 3ECUA 1J12A 1FVDA 2OR9L 4GB9A 4ESKA 1CFSA 2GSGA 1P4UA 2VXQH 3EFFB 4L0PB 3CVHH 1A8JH 1P0SE 4IOIB 2OQJB 1JZ8A 3SE3C 1MVFA 2FIKA 4BH7B 4U0QB 3S8WA 1HCFX 2YK1H 2ICWB 2JK5B 2QR0B 4GBXC 5FYLH 4P23C 4YZFF 4KY2A 4AZUA 1KLUA 4FN0A 3BVNB 4QD2E 4AWJC 3MV8B 4B0MB 2G5UA 3U7YL 3S3BB 1U8QB 1WFMA 2ZX9A 3P0VH 3VXRE 1AE6H 1GKEA 3MLWL 5BO0D 3LH2H 4U1MB 1MG2C 3V0WL 1AQKH 3HAEG 2VSDA 2Y6TE 4RFOL 3UC0H 4QHLA 5EU6E 3S96A 3V4UL 4DERA 5ITBH 1CO1A 1FZJB 3EUDA 4Z7QE 4KRMB 4WTQA 2JXMB 2VXUH 3EDKA 3O9WD 4WI5A 2CKNA 1J9QA 1V3MA 1L4IA 4U1KA 1A25A 4WO4C 4ODHL 3QEHB 3NT0A 3ZO9A 2IAMB 5BUPA 5F6IB 3S3PA 3UO1H 3RGHA 5IROC 1QFWL 1GXEA 4HWUA 1MQ8A 2VAAA 3LDBC 2WQUA 4NZTL 3B2MA 4V1DA 4XBMA 1W6LA 4N2FA 4B7IA 5F9JA 4F37K 2LAGB 3BT2L 2BK8A 4ZW8A 5GGTA 3RVUC 2Q6WA 3ILQC 4YGAB 4KXZI 4PD4K 1ZIBA 2R9HD 3RIFK 3DYOA 2EABA 4R26L 4EN3C 2CA3A 5IW6B 5INCA 3MRLA 3FFCA 5SWSB 4PJHB 1KC5H 5CWSB 1T03H 4Z7OB 4XP4L 3TNNA 3KYOA 5FAAA 3T1WA 2XDHA 3VACA 1PSKL 4A6YA 4FTVA 2VXSH 4GQ9L 3P4NA 3UH8A 1P4IH 4FQXB 5CZXD 3K72A 2F5AH 4WUUE 5GQBA 1QHQA 3O45B 4KKLC 4ELMF 4TRPL 4XNBA 4LF3B 5C0JB 2GT9B 3IJYB 1TJIH 3ZUCA 5J5EA 3CU7A 4MXVF 2BY1A 3V4VA 4N2LA 3IS0X 4X80L 1NCIA 2OTWA 4ANVA 1D5MB 1JE6A 2D0GA 3L3JB 2PMZA 3VRIB 2RCSL 3V5KB 5B1CA 5ISZD 1D7CA 1BIIB 4LGPB 3TT1L 3VB8A 4ATWA 4JG0L 5BQ7B 1YNTF 1WWBX 2APXA 2BCKA 1HCYA 3WTYA 4G1EA 3LVTA 4KWUA 4JM4L 3VGHA 1BVLB 3KPPB 5DJ2B 4X6DE 3GHPA 1F11B 2QADC 5DEJA 2A6KA 5E7FA 4N5EC 1QHPA 1S78D 2X0UA 1EO7A 4BUHA 1IB5A 1U3NA 3BKML 2QSVA 3ZJAA 2JQAA 5E1AA 3K4ZA 3WS6C 2ZSVA 3SOBH 3HNVH 3U4EA 4Q7DA 1E4KA 2P26A 2JELL 5D6CA 1UZ8A 1LK3L 3WFDL 3MODL 5E1QA 3VXTA 1VA9A 1KGJA 3OHXB 2ZJSL 4CSPA 2IANE 1NJ9A 1E8ZA 4ZUUA 1QFHA 4PGCA 4LCUB 1Z5LA 1BEXA 2XA8L 3VFNB 2VLKA 2WLMA 4HCGA 3FTUA 4YZFE 2YPKB 5EOQL 1G84A 1A4AA 1NCBL 1P69B 3UBXB 4DSYA 4U3HA 4K7FA 1E5YA 3ES6B 3PXHA 4NO5A 2DJMA 3FC8A 4YBQD 1U8CA 1RIUH 3DX7B 1G1CA 4XGZA 4MASA 5EUOF 1MY5A 3ATDA 3VWJD 3ZDZE 3BAXA 3QDMD 4MJHA 2G0KA 2UUDK 2J5LB 2EILB 1MCRA 3ZL1A 5C0EB 3RFZC 1U4EA 4HCFA 4NQQA 4ZFFB 5I1IH 2X4PA 3IYLW 1MFEL 1HOCB 3VWKC 4O51A 5BPPA 1HIML 5D2NE 5FGBA 1ZIAA 2JB5L 2DOCA 3PGDA 4MCZA 3X2QB 5KS9A 3QZOA 1MCOL 5I18H 1KFAH 3MPCA 4OZFG 2X4NA 1JNHB 3SDAC 4E5XG 5A43C 1ET5A 3MV8D 1BX2B 1L7TL 4Y1TA 4U1SA 1T1XB 4G70B 4XX1G 4FXKA 5TF1H 1PVHA 4CVZB 4L0YA 3ASNB 3V79C 3GBEA 1A6AA 2RFXB 3A4EA 3U0PB 2FQDA 2UX7A 3FONA 3QG6A 2GSIA 3QRGL 3BH4A 4NKQB 3N0PB 5CSZB 5F88B 3L4YA 4LU5L 4XMTA 1Q9LA 3GTVA 1OANA 5HDBF 3D9AL 3WY4A 3OKKB 5AVXB 2WCGA 2XBZA 1SF3A 2ADGB 2APTA 1DQJA 1NUFA 3A3YB 3D0LA 1X5ZA 1ED3A 4PJ5B 4PRHA 3EO9H 4G7YL 3V9EA 2HPOA 4JFHE 2Y2TA 2IAMD 1MFBL 2JJSC 2EE9A 1SXAA 1P7QA 3ZIMA 4ENZA 4IBSA 5J9PA 4CBZA 1NTDA 2NR6A 5FWRA 3T8XA 4N3UA 4JPIA 1NA8A 4KITB 3C08L 3NEXA 4J1UB 5H35B 4BH8B 2E3VA 1PQZB 4J3OH 1AQDA 4YO0B 5SWSD 2FVNA 1BBDH 3D12B 4XMPH 2OSWA 3E3QE 5FYJE 1KJMB 1IBGL 3P4MA 4OW6A 2OP4L 1D6VH 4OQTA 3TU6A 3VFVA 4OT1L 4OSUL 3OLIA 2VN5A 4X0KA 3B2PA 3SDXA 5CLZA 4UT9A 5B1AB 5BVPL 2JLPA 1DSYA 2DQCH 5KYXB 5D72L 4OFDA 2YZ8A 1EHNA 1TVBB 3WAJA 1AG0A 1Y1UA 4FQJL 2XZQH 5FUOH 1A7PL 3PNWA 4JCMA 5AVUB 5JIDA 2GIYA 1NDGB 3Q1SL 4H40A 4OZIB 3C6SB 1SOXA 2NYZA 3FRPA 4WI8A 1ZT1A 1KBWA 1D2PA 3WS3B 3GMRA 3THML 1U8IB 5AAWA 3MNVB 1YN7B 2Q0ZX 4OLYL 1PDKB 2WKLA 3C6LB 2YMOA 2CCLA 1IC4H 3RFRA 1FNGA 3TCXA 3REWA 2OMBA 3CFJB 4NQEE 2VN4A 4RDQF 4N85A 5EUOE 5DQJB 1N3NB 3OLDA 5HHVL 4AEFA 3QHTC 3S2CA 1I3RB 4KKPA 3OG6B 4LP4A 4MS6A 1ES0B 5I74C 1CG9B 2UX6A 2IC2A 1YYLH 1Q9KB 4JY4A 1VCAA 1YYCA 1EGJH 2EVHA 3AU0A 3IN2A 1FVCB 1DDTA 3EADA 3MXWH 2C9RA 1F6LL 5AL8A 4IBUA 3QORB 2OKMA 5I6OA 1B4RA 3BPLB 4X6BB 1DQDH 1AOZA 1HEZB 1OAXL 1TJHH 4BSJA 4NRXA 5KVDL 4HH9A 2K6WA 5ETUB 3U4AA 3HOGA 2Z9TA 1BVLA 3VI4F 1JD9A 1ID5I 3MBED 4WTZG 2UUDH 5JZ7C 3R0MA 4FYSA 3EBIA 4HD5A 4F58L 1SQMA 4F7MB 4QJ4B 1HL4A 2NY5H 2ZCKH 2HG5B 3RKDD 5HHNB 2XA3A 2UZIL 5DZPA 2BVTA 2XQBH 4NN5B 4WWPA 4UZSA 5F89B 3I84A 4LGSB 3H0TB 4OJAA 1E6OL 2KZKA 2HPTA 4JY6A 4WV1C 1ZCRA 2WLJA 3CX2A 1UYWL 1MHCA 4PRBA 2DI9A 3V8CA 2DLEA 5F1OB 4L8SC 5F1IA 3GBNH 3C5ZB 5T1MA 1PD0A 2JNZA 3FT4A 2K45A 5ID0B 4XZUB 4X9IA 4WWKC 1IGML 1XGZA 2NQ3A 5CHNA 1RZ7L 4AIOA 2E56A 4ZS7H 4P3CL 2R29H 4UTAL 1WBYA 1L7IL 4IGBA 4ZS6D 4OZHB 2W0LA 3GK8L 4ACTA 1BFSA 1MW0A 2XNAA 4LNVA 2OMVA 3HZKB 1CMOA 1PZDA 4Y9FA 1QI4A 2Y9RT 3HCVA 2WP3T 2FLMA 2ZUYA 2QFPA 1QSFA 4XB3A 3AXLB 4YGVA 4ONFH 3ZDYF 4AQOA 3ZTEA 5B39A 4HOZA 3PV6A 5AVYB 1DJSA 3SE9H 3VFTB 4NN6B 3DXAA 2BRRH 4Y8DC 3FB8A 3N6YA 1N7MH 5EO9B 4POYA 1CTOA 2BSSA 1Y6NR 3K74B 3QXAA 3S88H 2XG5B 2YQGA 1PTZA 1JF1A 2IV8A 3MLZL 4FC3E 2GTWA 1A9VA 2JKTM 5AALA 4I8DA 2WKGA 1OT2A 1XIWA 5MEPA 3QW9A 3PDOA 4CW1A 3D39A 1DHKA 3ZKSD 5ID1B 3WJLC 5CN2A 4KAQH 4JZOB 1UOLA 5E8EB 2ITEA 2J5WA 2FEDD 4QWWC 4U1JB 1RJYA 1RMFL 2IDTA 4PJAB 4WDIB 4FHJA 12E8L 1WA2X 5ACZA 1DSWA 2D2CC 1KGYE 3N44B 4WU5A 2ZKXA 3RPIB 4B60A 1AZUA 1PNCA 4P4RA 5FCUH 3BEVA 3BE1H 1OCOB 3GNML 3CBRA 2JTYA 3DVFA 2BDNH 3AREC 1ZANL 5JPNC 1RZFH 1ACZA 1XGPB 2VKWA 3TCLA 3MRGA 4K23L 1EUTA 4X4KA 4AE1A 2QQLL 3FU7A 4X9BA 4R7DA 5BO1H 5HGAB 3RHWF 4BFEA 4X6FA 3EOBB 4Q52A 4FP8H 1KZYA 3VI4E 3C6LD 1WHPA 5AL0A 5GXBB 3RWEB 2ZF9A 3GJFB 4WJ5A 2X1WL 3AS1A 5KBPA 4XMZA 1QKZH 5C0CA 4J3WA 1T6BX 1OAYH 5AB2A 3GRWH 5JR1L 2QPFA 3GSNB 2YN3A 3P77B 2BHZA 2WP3O 1FCGA 3U1SL 4MD5B 3H7LA 3E0GA 4NKOA 2ZXGA 4N0UB 5F9DC 4X5QA 1UB6A 4QCIB 1A1OB 1IFRA 3QORD 1BJ8A 1N2RB 2EQDA 1K4CA 3TO2A 3ASOB 4HGKC 1I1AA 2Z1KA 4P5SA 3MYJB 3F8UB 3RTQA 4JY5L 3CZEA 5L6YH 3D87B 5E0FA 2EDDA 2GCYB 3VXPB 3BN9D 1KIPB 1QYGL 3ZMEA 1A0QL 4G6KH 5IW1A 1FYTE 2FB4H 3EGXA 4NCC2 2V17L 4BK4A 1KCKA 1BAFH 4I9XA 2CCWA 3MGTB 3V0EA 3HAEH 4OV5A 3AT0A 4DGIL 3UTQA 2V5SA 3AG4B 5B3SB 1KY6A 4WI0A 4HIXL 4XBPA 1BV8A 2ICES 1TENA 4EUPG 2RB8A 3WMPA 3VGAC 4F57H 1C5BH 3U6XS 4G83A 1BM7A 1WAAE 3C5ZD 2BZCA 1A5FL 1MCHA 3GMPA 4K07A 4P5MA 1OTTD 5F0JB 1FIGH 3UG3A 5CU5A 2HVKB 4P9HH 1C16A 2Z92A 4I7ZC 5F70A 3RVWD 2ED6A 3D05A 4S1SL 5JDJA 5A6IA 2FHBA 3WKML 1CFBA 3WKPA 1JPGB 1B0GA 1DJWA 4NFCA 3MGOB 5JHDB 3O2DL 5AB9A 5DSCA 4FG4A 1BA9A 2J57A 3GSNL 3MRDA 5E8NB 1ZLDA 1P5UB 2Z0BA 3EF7A 4WTXA 4JFSA 4WNJA 3KXFB 4NUQA 3HN5A 4XTRD 1J7VR 3G9VA 4K94L 4UANA 4HWEH 1UD8A 2P9RA 5EZJB 4PRDA 1OV8A 4ZSOA 1F1GA 2ZT9C 1T21A 1SN2A 3ZKQD 5T5FA 3CSPA 4L4VE 5E99H 4QRRB 5GRJH 2EJ1A 3ZTCC 1IBYA 4QJ5B 4M6AA 4OCRH 2FJSA 1INDH 2EIKB 1WCQA 3EGDA 3W9DA 4DTGH 3OG4B 1MAMH 1FFQA 4YDMA 2P24B 5EU5B 1TIUA 3O9WA 2NOYA 3IE9A 5BJTA 3DRQB 4B50A 2VLJA 3CFKA 5JQ6H 3UZVA 3AXIA 4A7QA 3LB6C 1VFMA 2YD1A 3M7OA 2VOTA 3BVVA 4LPXA 2N1KA 3SBWC 4JBSA 4RA3A 1BBJA 2YUXA 4KI5D 4MSWA 3EYOB 3TBVB 1BHGA 2HTKD 4GH7B 4UQDA 2C4FU 5JHLL 3VXMB 2YQBA 2HFFB 2VWEC 4MMXB 1WZLA 1XF2B 3DGGA 3Q44A 5BOPA 1INQB 3SDDC 5E95B 2Y06H 4UTBL 2WAQA 3BLPX 5A2IH 3OWRA 3LN4B 1YY8B 4LLDA 4Y4HB 5L2KE 2G60H 2VXVH 1AIZA 3KE0A 3QO1B 1MAJA 5I1AB 2L7QA 1WLHA 1L3WA 1HU8A 3VFMB 1MRDL 3WLWC 3GSVB 3II1A 2Q8BL 1E4WL 5C7XH 1VF5C 1P6WA 3L3OB 4A2LA 1E0OB 1K3ZA 3MJWA 1OPOA 3UERA 3VD3A 4U1LA 4UB0L 4ZNEA 1PZ5A 2IQAA 5DRXB 3U4KA 1Q1JH 3QUZC 4KDVA 4HWBL 5T33H 5L7XH 1KB5B 4GKZB 5I1KL 1QA9B 1WS8A 4HA1A 1OB1B 5FGCB 3TNMA 3V2AR 3TPUB 2LVCA 4M7ZB 4OZFH 4P2OD 4ZD3H 3DJTA 3LJ3A 4BZ2L 5C86A 1NIBA 2NY3C 1DDHA 2OYMA 3O6LL 1PZ2A 1TQCC 4PHZA 4UIMA 1MFDL 5E1HB 1WBXB 3FFOA 4APXA 3ZN6A 1EAJA 4IHOA 4JR9L 3DO7B 1C1EH 3X3FL 1TKWB 3FCSB 3RIKA 4WW2F 2J2ZB 1G6VK 2KPNA 2GTZA 4MXQC 4AIZB 4DIXA 1R5VB 2IDSA 2X9WA 3UAFA 3IMWA 1GYVA 3GSXB 4XNUH 2ZOLB 3IFLH 3O11A 1YEGH 3K71A 3T6ZA 1SGKA 4HEMA 4B41A 4PS4H 3OD3A 3PWJB 4MQSB 1DFBL 1GYAA 1HZHH 3B56A 2A6IA 4KXCA 4AG4H 1NMCC 2WSKA 4L23A 4ZXBA 5DTFB 1EXHA 4UV7L 1NSNH 4EAEA 4AGQA 3MRQB 3L4XA 1GYWA 2J73A 1DEEB 2W0KA 4PJFF 3VWJA 4ES9A 3NIDB 2ZG2A 3QDMA 1NM9A 1SYSA 1CPUA 4XNMB 4R0LB 2AMUA 2ZYHA 2NZIA 1XF5B 3X3GH 2BM3A 3EFFA 4LGRB 4Y4FC 3L95B 32C2A 4IOIA 2OQJA 3UTPE 1NCAL 4BH7A 2LTQC 1Q0EA 4W1TA 2O26U 5D7LB 1AGBB 3KXFD 2ICWA 2JK5A 2QR0A 4RMRA 1NFDF 3QJQB 1KB5L 4WO4B 3BVNA 4OM1L 3MV8A 1C8PA 1U8QA 4N8VG 4J3XA 1FJ1B 2DPKA 2F7PA 2VH5H 5JXED 4U1MA 2DWXA 1QW8A 3NJHA 4NT6B 4QRRD 1WFNA 5C09E 4X6EB 5TPWH 4ZODA 1AP2B 4PJEB 2VQ1B 1UACL 3RAJL 1QTSA 1EZUA 2QGBA 3GS4A 2FGWL 5HYJD 1JYNA 4KTEH 4Q74A 1EANA 1FZJA 3LZQA 3Q43A 4GRWB 5HHMB 2Y7OA 4Y4KD 2JXMA 3ULUH 5I8CB 4BZYA 4DP6X 1EHXA 4PG2A 3QEHA 3MVSA 1OPGL 3NAAL 4RDQG 2IAMA 3TP4A 1FNEB 1ZS2A 1ZE3C 2MSPA 3K1KC 4Y7MA 35C8L 3ZRCC 4NXKA 1M3IA 4NZ8A 4POZC 4YMPA 2AK4B 3SKUD 1KJ2B 4GW1B 2A5UA 5DRNA 1C9SA 2V7NB 5LXVA 3NCWA 3VXMD 4WGWB 4KK5D 1KBBA 2FUQA 2WQXA 1A6TB 1WUZA 5IW6A 5CIPB 5SWSA 4PJHA 4LQ1A 1FZOB 5CWSA 2JKRM 4AXWB 4Y4HD 1GPOL 2QPDB 4LCIH 2E47A 3HI6H 1X5YA 3MLUH 4PJGF 3MACH 4TOYH 2OJEA 2MJWA 3CBJB 3ZZ1A 2A9AA 3KNBB 5CEZE 4FQXA 5F44A 3L4CA 3NZ8B 3O45A 5HHOD 5BRZE 1F4HA 1RZKL 2J44A 2GT9A 4LF3A 5C0JA 4Q6IB 2CALA 4G6AD 1NC4B 5AZEL 1ZRUA 2LW3A 4ZMXA 3ZE1F 1D5MA 4ABVA 3A21A 4BWTA 4TUJB 1JG9A 3L3JA 4KMLB 1WSST 2BSTB 2YO3A 1NCGA 3NFSH 4K7PH 4Y2DC 5EOCH 1ASOA 3V5KA 4U33A 1BIIA 4MDRA 2H41A 4KVNH 5BQ7A 3B37A 3HC0B 1YG9A 4ADJA 4NKDB 4IKNA 5J8OA 3KPPA 3KYNB 5DJ2A 1F11A 2W80C 1HOEA 3M17B 4E9XA 2J6EH 3RQ3A 1FFTB 1CGWA 4NN7C 5DO2C 4NFBA 4RAUB 3BWSA 3EYFA 1S9YB 1Z2KA 1BZ7B 2EE3A 1S7TB 4HCRH 4NLHA 1N6UA 4FLSA 4G8AC 1IC7L 4EIGB 1DVSA 4JVPA 1H6FA 2W9DL 2NZ9C 5EIIG 2EDLA 2VXTH 4M6NH 3ECQA 1KJ2L 3I02B 3OHXA 1QW9A 4H2AA 4PREB 4JB9L 1WA1X 3TFBA 3PL6C 3RFZB 1RHHB 1DQQB 4LCUA 4JFDB 4NNPH 3KJ6L 4PB0L 5DLML 3VFNA 1O75A 1OARH 2WANA 3OC8A 2YPKA 3EO1A 3UBXA 2LQRA 5CEXA 3M45A 2WWMC 5FXCH 4O4YL 1GZHA 3QR1A 1A1MB 3SDAB 3DSFL 4TKWA 1FO0B 1NAMB 5FDWB 1SUJA 4DQAA 3DX7A 3CXHJ 5IHUH 2OS7A 3HNSH 5EBLB 5FYKU 3CDFA 4ENED 3ASWA 2ZOOA 4JGUA 1JV2B 2MPAL 2IADB 4MA7H 4XB7A 5C0EA 3RGVC 2ATPA 4KKQA 3W1ZA 5I75C 4ODTL 4ZFFA 1NIAA 5F9OH 4GS7B 4J7RA 1URIA 2WUBL 1T04B 5AUMB 4LASL 1HQ4A 1OSYA 1Q72L 2LFGA 1A6WL 1MCWW 4XWOC 4N8CH 5D7LD 4NJ9L 2PW1B 1AVAA 4FADA 1VZGA 3ZTJG 1JNHA 2HFGL 1BX2A 1IQDB 4MYPA 3B4NA 4MNHB 1T1XA 3EKCA 4CVZA 1SXNA 2W92A 3I74A 3G6DH 1DCLA 3MV7D 4JZJC 3S2AA 2RFXA 4PJXF 1TCMA 1SDDB 4LFHD 2BNQE 5CSZA 5F88A 5BZDB 4AEHH 3OKKA 2HFEB 4TNFA 1OGPA 2CO3A 3BC9A 3DDGA 2ADGA 5I15H 5HHMD 4PJ5A 2Z64C 3SE8H 1J1PL 4WSJA 3CFMA 5TGBB 1I3UA 1QLRB 1F2QA 1FP5A 2OX5B 3H8NA 3SQOL 2Y6SC 3RPBA 1SJHB 3C6EA 5JW4N 1JZIA 1A7RH 5F2FA 4GI9A 3NSJA 1YEJL 2AK4D 2DQUL 4N9OB 4XOEA 2R4SL 1RJLB 4JO4L 1TJMA 1MWOA 4JN1L 2OK0H 1FO0L 2R2HA 1PJ9A 1NAML 4J1UA 1IGIH 3A47A 4NPYB 3TZVB 1PQZA 4BH8A 5J6GB 2VDOB 4AJYV 1QFUL 5C7ZA 2VZ3A 2VMEA 4YO0A 3ZHNA 5C92A 4CADB 3MREB 5D71L 1R3IH 3IF1B 2BPBA 3ESOA 3P11L 1MJ8L 5JNYA 3ARVA 1B6UA 1ROWA 4JKNA 3CFCH 3NCFB 2AJSH 4KPHH 3QRFM 1JP5A 1E43A 1KJMA 5EA0H 4G5ZL 3KDMB 4MWFB 3V5DB 4NBYB 1ZJAA 3U2SB 3WFBH 5GISL 4P0DA 1KT2B 4PP2B 1DJXA 3D18A 3OGOE 4FRWA 5KYXA 1FFNB 1N6QL 1WITA 2A77H 4HJTA 3LYRA 4XMLH 1CF8H 1TVBA 3FQ1A 3FUMA 5I74B 4ZMYA 2JB6B 4CMHB 3T4AB 4YHNA 1NDGA 4AV5A 4OZIA 4FNRA 3C6SA 3JUYA 2OTPA 3WS3A 3HPJB 1T7WA 1J9SA 1U8IA 2ODIA 3MNVA 1YN7A 3HMXL 3HE7C 4HMCA 5EEXA 3H4HA 4KRPC 4EUPH 1CXLA 4OLZH 2YGQA 1PDKA 5CM1A 2GI0A 1AMXA 1AOHA 3C6LA 2VQUA 4KUZH 4YSQA 4F8TA 1W8EA 3T3PF 2CR3A 1H3PH 4UTAA 2VUOA 3AY4A 3CFJA 3O6KL 2M1KA 2NW2B 1JPFB 1IJNA 2BNUB 5DQJA 1I3RA 4NGHL 1ES0A 3OJMB 1CG9A 4IRZH 2XQYG 4XI5D 1Q9KA 3VRLE 2VDLH 4QHMB 1D2OA 2EEFA 1BGXH 1MN4A 5GRVK 3SKMB 1MWAH 2PWFA 5CLYA 4RRPA 1FVCA 3T2OA 5GS1B 1RZJC 3IJEB 1FBIL 3UP1A 3QORA 1PG7X 2ALAA 2VM4A 1RULH 3AQYA 2VDOL 2WB7A 3NN8A 4X6BA 5FHBH 1HEZA 1X7SA 2ZG1A 2DV6A 1ADQL 5ETUA 3WAKA 3GS7A 5IBLD 4NKIL 2Z31B 3C60B 4F7MA 4WUKH 5ECGA 3RJQB 4NIKB 4RH4A 4F8LA 5I19H 1NGWB 4PR5B 1X5FA 1Q0XH 3BO8B 3BKYL 2HG5A 3I2CH 5HHNA 1MCLA 5F89A 4PW4A 3QG7L 1KCLA 4GSDH 3HE6C 1LO3H 3LS4H 4PU2A 3KDPB 1T2QH 4KJQD 1MSPA 3WNOA 3H0TA 5IBTH 3QFDB 2VDRH 3V0FA 1LO4L 4UF7C 3MCKB 2B39A 2E76C 1X44A 5K59F 5JHAA 3W9EB 1RZGB 2Q7YB 4Y2NA 3C5ZA 5J0BA 5JIKA 4FNPA 3CFEB 4EBQH 5ID0A 4XZUA 3QPKA 1WWAX 3VRJB 3FKUS 4H5SB 1NEZB 3QDJB 1CIUA 2CDFB 1KBKA 2UWEF 4S10A 4FZ8L 3QXWA 3VNZA 2FDBP 4R7LA 4C47A 2NY4D 4FJZA 5IEKB 1EBAA 1GA2A 2DB8A 4G9FB 3DOSB 2OYKA 4OZHA 5HVWA 2HLEB 3AB0C 4M9OA 1J0YA 2BSRB 4L3EA 2HWZH 3HZKA 4R90H 3ZHDA 1K2DB 3JWOL 3ZZLA 2N0MA 4R6UA 1V3JA 2Q7AA 3AXLA 4AH2B 4FEIA 1CK0L 1F1DA 3VFTA 4C56B 3SO3B 5E0QA 2C1OB 1H8NA 4O58H 4TVSa 2WZPD 3IE4A 5EO9A 4MNGE 1NCJA 1D5ZB 1UXSB 5IK3B 5CKAA 3BSHA 4Z76B 3LMJL 2XG5A 1FCCA 4TTGA 3AACA 4P9MH 2H3NB 3NZHL 3TZVD 5LWYL 2DQ6A 3W0WD 4K2UL 3M1BA 2G3ZA 5MERB 3UG4A 4OCXH 1F4WH 5HVGB 5JPNB 2DQTL 1U91A 4LVOB 4QRSB 2CCVA 5IOKA 3L3IB 4PJIB 4HLEA 5ID1A 2WWNA 3BZDA 4JZOA 3R8QA 2M2DA 2MIZA 3NFNA 4U1JA 1V10A 4DJMA 2E74C 4PJAA 1BEYL 1EZVY 3PGFH 4X9FA 5DRWB 4JGMA 3FW6A 4R5TA 5FM4A 2RTTA 3MRJB 3MV11 1BZDA 1CXHA 4JRFA 4UMGA 3ZMNA 4L37B 2GHZA 4NBXB 4A67A 5KBDA 1DSFH 1GOFA 3NJVA 4PBVC 5DUPH 1XGPA 2UVEA 5KVGL 1XL6A 3KM1A 1JS4A 5HPMB 1SEBB 1CE1H 5MENE 3OXSB 4EO5A 1F18A 1BQKA 2V9QA 3NA9L 5HGAA 3RA7H 3EOBA 2H1PH 3T6WA 3K1DA 3NFPB 4DPBX 3LKPB 4XN9A 1F41A 1UZGA 4L4TB 3VXOB 1M7UA 2EDKA 3C75A 3O2DA 3RDTB 5CD3B 4L2YA 3GSNA 2FHCA 3L2MA 3OZKA 4AX3A 2VR9A 2Q76B 3P77A 1FL3B 3QAZB 1T6VN 1CN4A 1TXKA 4HT1L 4MD5A 2Y36L 4QXWA 5DDHB 3TA3C 3QQDB 1HNYA 1JYVA 1TQTA 4ETQB 1LYQA 4N0UA 4J3BA 1TVHA 4IJ3C 4QCIA 5K59E 1A1OA 3MV9B 4LPVA 3L4ZA 1N2RA 5FFLA 4GMSL 4PP1D 3VGAB 3NIGB 3MYJA 1QHOA 1XCXA 2DWEB 2E7DA 3DJ9A 4KQ3H 1ORSB 2KYIA 2Z31D 3C60D 5FUCE 3BZEA 2B0SH 2O6EA 2GCYA 1EUUA 3MRHB 4HUWB 1KIPA 1TQBC 4N0CD 5F8QC 3VXPA 2I7OA 3QDAA 2FAUA 3DI3B 4WIQA 4WEBH 1CE6B 4O9HL 2CO7B 5I8OL 3MGTA 1SM3H 2IQ9L 4GKNA 4Q0XL 5CGBA 1EZLA 3NG5A 1CFVH 4JO3L 3KW8A 2GJ6E 4ZRGA 4CU7A 5K9QI 5KVEL 4P2AA 4R83A 3T6QC 5JHLA 2CHWA 4LSSL 3RHWK 5BXFB 2QDWA 1G9NL 1YNLL 2AVGA 3PWLA 5BV7H 1OP5K 3GXUB 4NHUB 2FL5B 5ABDE 4UTBA 2HVKA 3NCMA 4UT7L 5E6IC 1AZVA 3QZPA 3QDJD 4WKXA 1JNNL 3HS0C 3FCUB 4RMBA 1QRNE 1JPGA 1Z9LA 4PBDA 3A4AA 3MGOA 5AW5B 5JHDA 1IBFA 4LHUB 4Z3JA 3FHEA 3QA3B 1TZOA 4G9FD 4CVUA 5E8NA 1P5UA 4I0PB 5D7JA 5D1ZC 1OTSD 1SJMA 5IVOA 3KXFA 4N1EA 3V9CA 1IU1A 1ICTA 4I77H 4XN5A 2DWYA 5EZJA 1OAUL 1ZGLM 4JRYE 1EZSA 4Z7WB 1KCBA 5ANHA 5JXEA 5AZUA 4HWBA 4OAWB 4Q58C 4TVPE 4QRRA 1U41A 4U2ZA 5I16B 2P5EE 5MP6L 3SKOB 5G4OA 5GGSB 2DYSB 3QAQA 1JK9B 5LDUA 5GSVA 1HHIB 4N0YH 1O9WA 1IAKB 1QBML 2H1LM 1SY6H 3DNKA 1CGXA 3ETSA 4Z23A 5H4ZA 2P24A 5EU5A 4BZ2A 1NGQH 3DRQA 2X87A 5I24A 1AC0A 3ARQA 3PJSB 1NEUA 1U8JB 4HP5A 2AXWA 1DLHB 2PO6B 4DP2X 3L9RB 3BXNB 3EFDH 3FT1A 2FECL 3EYOA 3TBVA 2G75B 4XXWA 3LNDA 4KTYA 4QOKD 2HFFA 4KQ4H 4MMXA 3VDCA 1XF2A 4R8WL 2RAMA 2J7LA 4HPOL 1X9UA 4FFZL 2E9JA 5IM7B 2DIBA 4XHQA 1U95B 3LN4A 1YA5A 5J89A 5C0GB 1YY8A 3QUZB 3VD7A 4Y4HA 4WFEE 4FD0A 4LCWE 2XQYK 4LSTH 5IF0B 2IFFL 5DHEA 3VXNB 4XCFH 3QO1A 3CH1B 3MA9L 4K3EL 5I1AA 4EXKA 2YZ1A 1N4XH 4FCAA 3VFMA 4FNLH 3AXHA 4KK9C 5J12C 1MCWM 4G8IB 4NO3B 3N85L 2VCOA 2NY3B 1KCSL 3L3OA 3KJ4B 4HD9A 5DC2A 4L4TD 4BK5C 2R1XB 5E2WL 1FGVH 1K8DB 3RDTD 3NSYA 3WIHH 4NWUL 4CAGA 3ESVF 1E5UI 3F85A 3ABZA 1JJUA 1X6NA 5GHWL 1A4JB 3L5JA 3ZTNL 3QBTB 5DRXA 3PWPB 2PUQT 5DQDH 3HR5B 1KB5A 3H2WA 1GSMA 2B5IC 2HKHL 2NY7H 4GKZA 3CIAA 3FNKA 1OHZA 4XAKE 3FUKA 5KVMC 3VDBA 4XNXH 5ESAB 5CINH 4TSBL 1OB1A 2B4CH 1MIEH 2VABB 2K8QA 1KTKE 1GR7A 3BMWA 2QSQA 3MV9D 4OF8A 4QRPB 5D1QC 5D96C 5FCSH 3TPUA 4N90D 5I1CL 1IBZA 2V2WB 3LV3B 5F9WB 5IHBA 1UASA 2GK0B 5MEQB 3BIKB 5LGHH 2ZP0T 3SCMC 3IAGC 1KULA 3KYKH 4F9PC 3DO7A 3ALXA 1SQ2N 1BPLB 4APQC 1TKWA 3H6JA 3LIZH 2K0RA 2J2ZA 1KV7A 4AIZA 1R5VA 1KIQB 3MR9B 3HBQA 1M1XB 3M1OA 3GSXA 1RFDL 1OP5H 4URKA 2ZD0A 4QUOA 3I50L 5ESVB 2ENQA 4FFWD 1IILE 3PWJA 5EORL 3US1A 1I1FB 2E9BA 5T1DH 3CFDA 3I3EA 4HFUH 5C0ND 3VGFA 2D7QA 2AABL 5DTFA 5CP7B 4JFEE 2VB5A 5SWQB 3MRQA 1DEEA 3CSBA 1IGFH 2NCEA 4M5TA 4K9EC 4FQCH 4XNMA 2VC2B 3DOIA 1XF5A 5EZIH 1UXWB 2X05A 2CWRA 3ULVL 2VE6B 3STBA 5AW9B 1LD9B 3ARYA 1LP9E 1ZDSA 3BW9B 2R83A 3MXVL 2ALWA 2JJTA 2R27A 4I0PD 1AGBA 4W9JC 5D7LA 5EU4B 2DBLH 2WAHA 4W9KC 4NBZB 4WO4A 4RNRB 1SEQL 4RGNC 4A04A 5EEYA 2BY0A 3DPBB 5L88H 4Q89A 2OMTB 5IROA 1D7BA 4X50A 2GI7A 1UWGL 2FH8A 3D33A 1FJ1A 1J1XH 2V8LA 4N24A 1W91A 1QPPA 3QIWC 4LQFL 3AGVA 4NT6A 4X6EA 4OD1H 1PZSA 4UNIA 1AP2A 2EDJA 1CGYA 2VQ1A 3BD3A 3LH9A 4PJEA 1AH1A 5AKRA 3G6AB 1Z32X 4RLDA 5FO8B 4NHCL 4EN3A 1FPTH 1I8LC 2VDPH 4JANB 1CFNB 5GJSL 5I8CA 5C6TL 4X4ME 1MFVA 4ZPVB 1FNEA 1KXVA 1KYUA 3IU3B 5IJDC 2Y0SA 2PO6D 5AW7B 2Q87A 5D2LE 1YN6B 1GC1C 2VZOA 2AK4A 4AYGA 1KJ2A 1JHLL 4GW1A 5HDOA 5B4MC 4E0RB 1I85A 5F93C 2V7NA 1CF1A 4ZQTA 4NSKA 1GHFL 1SN5A 3X1EA 1B0IA 2FSEA 5DZAA 4EVNB 4HAGA 3U0WH 4EKXA 2B1OA 4GRMA 2V3DA 1FZOA 2BOCB 4AXWA 1KCUL 3AMKA 3B34A 4MRBA 7PAZA 5I30H 3MCLH 1EJ6A 2VC2L 3O41B 1AXSB 3KNBA 3VFGL 2YWYA 3NZ8A 1DBAH 4TF4A 4LAJH 4GINA 4ZX5A 3FT3B 1T22B 1DUYB 2ZCZA 3NP3A 4Q6IA 4UV4H 3ECWA 1NC4A 1RUQL 1OCRB 1MREL 1IGTB 1QP1A 4HBCL 3S48A 4YR6B 2ZG3A 1U8LA 4TUJA 4IIQC 4TULH 3SYCA 3ULVD 3D2UD 3BZ5A 1P4LB 3RWGB 2BSTA 5I0ZA 1QQDB 2HFTA 4XP6H 3C2SA 3OKNB 3PWPD 4LO9A 1XX9C 5E1IA 1DVFC 3HC0A 3PL6B 4KRLB 1XH1A 5HHPB 1FGNL 4NKDA 3MRRB 4GG6B 3TJHD 3KH4A 5CP3A 1QBBA 2BHFA 3KYNA 3U36B 5JW3H 4JPKL 5BZWA 3RWCB 2FT6A 5J13B 1JIBA 3BPOC 3IAQA 3M17A 4OLWH 4QRPD 4RAUA 1S9YA 2CPCA 1BZ7A 1S7TA 7CGTA 2UZYB 1HQRB 1CFTB 3CXHK 4WFGD 3PWUB 4BD4A 4TYUA 1CVSC 2XVGA 2HX8A 3QCTH 4LCCC 3V4PH 3VQ1C 1XGYL 1QSEA 4HALA 3I02A 4PREA 4ZUTA 2Y07H 3UOAB 3UAJC 4MJ5B 3RFZA 3HVNA 4I88A 4JFDA 5F0LB 5I1EL 2NY2D 2RQ8A 2G9HB 3RP1A 5CUSH 3NRPA 2C9QA 1ZSDB 3U6XA 3N1QC 1WJ3A 1LVEA 3CVHB 1WA0X 2CJ3A 2IPUK 3SDAA 2EUWA 4LIQE 4JHBA 3HG5A 1FO0A 1XGTB 1NAMA 5FDWA 1SPDA 4P2RB 4AYMC 4LSRH 3LEVH 1EDYA 1FG9C 5AYTA 4MA1C 5EBLA 4JM0A 3TBTA 1A2YA 1QATA 1JV2A 4ALAH 2IADA 3QEGH 1OW0A 4NQDB 4OIAA 2MCPH 3SKNB 4F1SA 2G2PA 1N5YL 4AGMA 5CEZH 1MFAH 5EZOH 2J8UA 5AUMA 5HYJE 1T04A 1E8XA 1BZEA 2E8ZA 7PCYA 1S3KH 5F72S 2PW1A 3P9MB 2HT2C 1OF0A 3S6CA 2GFBB 1L0YA 4FYTA 3WN5B 3HEIB 1NCNA 3MX0B 4OI8A 2R0WL 4TN9A 1IQDA 4L29B 1OGTB 1MF2L 2ENYA 3BAJA 1S9WB 4MNHA 2QQKL 5TE4L 3II2A 2YPVH 3AQZA 2JCWA 2L7UA 4IKIA 3ROOB 4D7PA 2X9YA 5C0AB 5BZDA 3FQXB 4ERSL 2XOTA 3CN1A 4XPHH 2V5YA 2C34A 2BVEA 3IJ9A 2HFEA 4W9EC 2DH3A 3KBHE 3PQYB 5EEWA 4Z0XB 3QP3A 4YS4A 1U8MB 4YFLI 4ZFGH 5TGBA 3VFWB 3QNXB 5EF0A 1QLRA 5JUEL 1CI5A 2OX5A 1SJHA 4ONGL 3KLQA 1Z3GH 5HHOE 3VDAA 4X4ZA 2CBPA 5DMIH 3SJVB 3QZBA 4OCLC 5AW3B 2PETA 3CVHL 3MGAA 1RJLA 4XO9A 1FL5A 2AV7B 4MQTB 4S1RL 1AGFB 1I3GH 3TZVA 5J6GA 1NCCH 1F00I 2YK1L 3EYQD 5HP5A 3QFJB 1AAJA 4X99B 2QKIC 4DVRH 1ADQA 4CADA 3MREA 4JL1A 3IF1A 1KYAA 3WXWL 3L3HB 3P0VL 3VTTA 1LDSA 4UOQA 5L9DL 4HWZB 1J9RA 3HE7B 1A7OH 2PPDA 4MWFA 3V5DA 3AG3B 3ZX1A 3U2SA 3UTZB 1KT2A 4PP2A 1U8HA 3HKFA 4C8XA 4DOHE 1FFNA 2OMWB 2WY3B 3UC0L 5AW1B 2HT4C 2VIRA 3G9AB 4P59H 5ITBL 1HKLL 1MCKA 2ZOKB 4OCYL 4ICXA 4LBEB 2RIKA 2JB6A 2Z7YA 3BVXA 2MHAB 5KS9F 3T4AA 5IVXB 1XH3A 4M4RB 2GIXA 4XPFH 3ARGC 4BRJA 1RERA 2BW5A 3UO1L 3FUFA 5I2IB 3OAWA 2NUTA 5BS0E 3FN0L 3QRLA 3HPJA 4V1DE 5FW8A 3SQRA 2Q8AL 2DWDB 3MV01 5JDSB 4G80B 5I1JH 2W94A 1XSIA 2TSAA 3ARZA 2HJKB 3B9KB 1IC5H 3KBEA 1WGOA 1PZAA 5FW6A 4MXWH 4YH6A 5I1GH 5I8KH 5T8IA 3ILPB 1JZ4A 2CDEB 4GSRA 1AANA 5JA9A 2NW2A 2BNUA 5I9QC 2Y22A 1T03L 1KC5L 1E2ZA 2H6OA 4CNIB 3WSQL 3GXTA 3ZE2E 2IFGA 5JXAH 1R1CA 5CD5C 2VXSL 4Q4IA 3CDYA 3SKMA 4K8RC 3MOAL 2JI3A 5CKGA 1F58L 1WISA 3AQDA 3IJEA 4WV1A 1PG7W 4YEFA 4HC1H 4LVNC 4Y1AB 1TJIL 1FNHA 5B1JA 4DFIA 1A8ZA 4D8OA 5FA3B 1Q8MA 3N06B 2OXGB 4L8SA 1RJZB 1VHPA 3FQYA 3KD4A 4RMTA 3P2BA 4HISA 5ACMA 5KN5B 1Y18B 1BG1A 1PF3A 4AVJA 5L4FA 2Z31A 3C60A 3FUDA 5DYFA 4U3SA 1VDGA 4XVJL 1U6AH 4FABL 4J39A 1NGWA 1RUMH 3QQ9D 4P2RD 4WWKA 3DARA 4EOWH 3BO8A 5F3BB 3MV7E 2IGTA 3I6LD 3WTUA 5CBEB 4HFWB 3POCA 3CDCA 1DLFH 3QFDA 5FGRA 5G5DB 3QIBB 4ZX3A 3MRPA 4OGAC 2VERN 2WXNA 5E00B 2Y1ZA 3SDXF 2D0HA 5L2JB 5F7UA 3W9EA 4RESB 7TAAA 5DZ9A 4L0ZA 3HNVL 1RZGA 1NMBH 2J43A 2Q7YA 5HHME 1SYVB 3STLB 4E41E 4PLKD 4NZDA 1IAMA 4RSYA 3T3MF 3UTSD 3CFEA 4RA0C 1PKQA 3VRJA 5F7HA 5H2BB 5E4EB 4H5SA 1NEZA 4FXLA 1CDJA 3QDJA 4LXFA 1CD0A 2OCCB 4XC1H 1KIUB 5I5JA 5IB3B 4HHWA 5ESQA 5IEKA 1MHHB 4G9FA 3T6VA 3DOSA 4XHJD 4DGYL 5FOBB 3TFKC 2BSRA 3PQYD 1K2DA 4NERA 4P04A 4A55A 3CFUA 2QSCL 2CH8A 3EYVB 3WJLA 4AH2A 4KZ0A 1SVZA 1R24B 2RHEA 1VFAB 2YUVA 4C56A 2C1OA 2XWJB 5H37G 2BSDA 1D5ZA 1UXSA 4KGLA 5IK3A 1DBKH 1CU4H 4Z76A 2WXJA 1XT5A 4PY7B 1JZ2A 2DW5A 1JXDA 1O6VA 3PP4H 3UEQA 4FMFA 1KFAL 2DWTA 5CZVH 5IP4A 5AG9A 1FWXA 3ZKXC 1LK2B 2EYSB 1ZLVK 5IQMA 2YLKA 5EHFA 2ZONA 4ZUSB 4N0FA 5K93A 5JPNA 2P80D 2J1ZA 1AD9B 2DI8A 4QRSA 3ZPDA 3L3IA 5D6DA 4PJIA 2YXFA 5KSAB 3PCYA 5DJAB 5I71C 1KBGH 1DCEA 3IFNL 4AEIL 5AOJA 3HMWL 5JQHC 5CAYB 2N4IA 2AERT 5DRWA 2FNBA 1N12A 3VFPB 3PE9A 5HJ3B 3MRJA 4R3SB 2ORBH 4DKAA 5DMYA 4L37A 3P3SA 5DURB 2X28A 4E68A 2CHZA 3T2LA 5TF0A 3N42B 3SEPA 5DK3A 1QFWI 4ZOAA 2D03L 4GFXA 1AJ7H 3PPSA 5ENWB 1SEBA 5D2NC 3CN4A 4NUPA 3OXSA 5FO7B 3HG3A 3JSSA 4HGWA 3AWFA 4X8JB 4Z7UA 1JWMA 1UH4A 3KGRA 3NFPA 5F96H 1KGXA 4Y16D 3B9KD 4LSPH 3LKPA 3FCTB 1TETL 5T3ZH 4ZTPH 2X09A 4L4TA 3VXOA 3R8BB 2PWGA 4CN6A 3RDTA 5CD3A 2Q5BA 4UT6H 2DS4A 1TQBB 5DWPA 1BBDL 4M00A 1CLCA 3MRFB 2Q76A 1DE4B 4MS8C 1FL3A 3N40F 3A24A 5A2LH 4X8GA 3IETB 5DDHA 3QQDA 4OM0H 3VQMA 4ETQA 3A4DA 2AEQH 3FHQA 2ZCLL 2FQFA 1AC6A 1QR4A 1PJWA 4YOKA 1JFHA 2ICWI 1E90A 3MV9A 1GGIH 2H0PA 2DQCL 4UYQA 3QC6X 3CFBA 1SLWA 1J5HA 2ZUVA 4B5ZA 4R97C 2XZQL 2E7LC 4PRPB 3MNDA 5FUOL 1ORSA 2SEBB 5B22A 4HUWA 3MRHA 1P5VB 5CNHA 1DVQA 1ZXKA 1ZY9A 2ZWYA 1IVLA 1PY9A 1CE6A 4RZKA 2CO7A 5FPIA 5D7EA 5F0PB 5TE6H 1R5WB 1UD2A 1O7DE 4JM2C 3QIBD 4G72B 1MCSA 1IC4L 1L0QA 4NQTA 3E3QC 3W56A 4XVOA 1I9EA 3T9WA 5BXFA 2DTMH 3RX8A 4NHUA 2FL5A 3E2HC 1YZZA 4FFZA 3QPQD 1EGJL 2FX8L 3QEQD 1AD0B 5HYQB 3WEBA 5B1KA 3EOTH 4QNPF 5I1DB 4YDIL 3WD5H 3FZUC 5CGTA 3SPGA 3ZY7A 4YFLF 2BP0B 1U3HC 4LHUA 3DX1A 3QA3A 1CBVL 1BFTA 1TJHL 3IPBA 3ZVVA 3JV0A 3W0WE 1OGSA 1MLBB 4RGMC 4I0PA 1J86A 1CVRA 4HJUA 3FCBA 2AJZB 3RTLA 5GRZA 4B7LA 5D1XB 1Z3RA 2ZCKL 1IQWH 4J3OD 1A6VH 4LPUA 1HI6B 1NBQA 3QWNA 2VR6A 1KMGA 4Z7WA 3CDGB 1LXMA 2VSKB 1XO8A 1XR9A 4FQLL 2PABA 1CTMA 4OAWA 5DFVC 3HJ0A 5EWIH 5DJXB 3E8UL 4A38A 1MQKL 4BKTC 4PRAB 1AGCA 3SKOA 2Z1PA 5GGSA 3QUGA 4HIIB 1JK9A 2P46B 1HHIA 5KSBB 1R3KB 1IAKA 2ZXEB 4I48B 1JOIA 2X1OA 2F54B 1IEAB 4JKPH 3T0EE 5I6XB 4PVMA 1YMMD 4X5WB 5LQBH 4WCYL 3H6AA 3LRLA 3PJSA 1X5XA 1U8JA 5KSAD 1DLHA 2D8KA 2PO6A 4HUVB 4ZS7L 2KPWA 3L9RA 3BXNA 3EH4B 2B1HH 2ZWSA 3DMMB 4OGQC 2G75A 3UGUA 4Q9CA 4KJWD 3INUL 1MJ7H 1VRSA 2BNRB 4QI3A 2VLRB 4HAKA 4DUVA 4YAQB 1EAPB 5IM7A 2P8PA 2HRLA 3PRZA 1U95A 2VZUA 5C08E 5C0GA 3QUZA 5I0YA 1B88A 1EHAA 3KLHC 4ONFL 1X6LA 3DIDA 5IF0A 3L4TA 3ISYA 3BHBA 1YEFH 1NBVH 3IJSB 3SE9L 3VXNA 3CH1A 4N2DA 1N7ML 3UBXI 1JF5A 4DEUA 3NH7H 2WLYA 1V7ML 4GEJA 2QQQA 5D96B 1JNLH 3S88L 1GVIA 1VZHA 4G8IA 4NO3A 4D9QD 2J56A 2YQ2A 2IEPA 2Y23A 3G6JB 4X8CA 5I0XA 4G8EB 2R1XA 4YSRA 4MKMA 3L8QA 5GGSY 2JVUA 3SCMB 5JHMA 2YXWA 3APMA 2YRLA 3GMMB 4FLOA 1M7XA 4APQB 3DGCR 1A4JA 5DZJA 3SYAA 3PWPA 4U3CA 1PLGH 3WHE1 3HR5A 2WJ7A 4X6CB 3ZYOA 1CLOH 4JQIA 4FAAB 1BJ1H 3CZJA 1RUPH 5ESAA 1RVFH 2VABA 2KMWA 2J3SA 4NQSA 2B16A 3HAEB 4AUJA 2AQNA 4NUGL 3FUHA 4LSVL 3ZHFA 2V2WA 3LV3A 1XL4A 4X9HA 2GK0A 4PRPD 4NI3A 5MEQA 3BIKA 3GLDA 1OSPH 4U0RB 1A3ZA 2BDNL 1RZFL 3OR7B 5B3NA 4N6RB 4HBQA 4ZPTB 2XYBA 4YHKL 3ILEA 4RMWA 1KIQA 3ZYZA 1ETA1 1M1XA 3K6IA 3W5MA 1MHPL 1NL0L 3LN9A 4O5LH 5AYUH 5C0CE 2P49B 2ESVB 2H2PD 5ESVA 1QKZL 2ZNXA 2WCSA 3DX9B 1I1FA 5LBSH 3GRWL 1NUNB 1V7NH 2A99A 2AF2A 4F15C 5CP7A 4EI5B 4JREC 1Q90A 3AS0A 2CO6B 1T20B 4JUTA 2XV2A 3UPRB 1FAKT 5J6SA 3T71A 2MOGA 4J6RL 3VMOA 1E4KC 1JDDA 4PWIA 1ZEAH 1XWVA 5F7EL 1UXWA 5BCAA 4J28A 5IFHH 3FU3A 4GNKB 2VE6A 2E7CA 1LD9A 4N2EA 2DTSA 3BW9A 3D3VD 2EE2A 1WG3A 5EU4A 4HJJH 2G0LA 1PIGA 25C8L 2DIEA 5DFAA 4NYLB 5D1XD 1P84J 4RNRA 3BJ91 2Q7NA 4G6KL 3DPBA 2WQVA 1R17A 2OMTA 5AENA 1MLCB 2YA1A 2ROYA 3MNMA 4AYBA 2MQCA 3CQQA 4PLJD 4OIIH 2VQ4A 3CZLA 1UVQB 3P73B 4PJBB 2YGNA 2GABA 4RAVB 1IZKA 2Y7NA 4QOKE 3SSGA 4UMSA 2Z35B 4GUOA 5DYOB 3G6AA 4HW6A 4JHVA 2CK0H 5JPMC 5FO8A 5KANG 2X6CA 2Y1AA 2X2IA 1C5BL 2I27N 5LN8A 4JANA 1BFVH 1CFNA 2F54D 2YRPA 2GSMB 4K9EL 5L4MA 3WO3B 1FIGL 1EFQA 3EW3B 3E1F1 3MSPA 4EXPX 4AJ0A 4ZPVA 4S1QH 5FGBC 3IU3A 2VL5B 3EDDA 2WCPA 1KELL 2CXGA 5K33A 5D7KD 1YN6A 3EOYG 3DMMD 1OE1A 2O4EA 1I31A 1WHOA 5FHAL 4OZGF 1R3HB 4E0RA 3LZLA 1A7NL 2P8LB 4G6ML 4HK0B 3B7TA 4AIXA 4FXKC 2BNRD 3HRZB 4M5ZH 2VLRD 1DVZA 4EVNA 1AACA 4HWEL 2BOCA 4DZBA 1H15B 1LO0H 2EIZA 3TASA 1U8NB 1AYOA 2YSTA 1AXSA 3O41A 3ARTA 1JZ5A 3ARUA 4IRJD 4S0TD 3T77B 5E99L 1VAHA 3FT3A 3VG9B 1AYRA 1T22A 2H0EA 4NB7A 1DUYA 1NANI 4WFHE 1EZVX 5IFAH 3VD2A 2E6QA 3GHBL 3NIGE 2XJKA 1R75A 1IGTA 4KROD 3S3JA 1E3FA 4PVLA 4YR6A 3EBAA 3ME0B 4OZFB 4EI6B 1P4LA 4ILDA 2PLTA 4PN6A 1QQDA 2DKMA 3L3GB 3OKNA 1GC1L 4KMQA 5D4HA 1KBVA 3PL6A 3ZZQA 5HHPA 5ICZB 1U92B 2ID5A 3MJ9L 4LNRA 3MRRA 4JPSA 4GG6A 2LR4A 3U36A 4PJ8B 3VU2A 3RWCA 3IS1X 2FBJH 3KPRB 5IHZB 3FRPG 4KOCA 3OAUH 3R7QA 1E4JA 1YPZB 4L48A 1ODUA 4UU9B 1M9SA 4MVBC 3REVB 3KWUA 2UZYA 1HQRA 1CFTA 2Y06L 2MWCA 3PWUA 5DWUL 4D9RD 3AZUA 3F04A 5E4AA 1JGDA 1N5AB 3ARBD 1YJDH 5DHVB 1HHGB 3PUCA 4LPYA 2X2UA 6FABH 3TVMB 1GGUA 1XBDA 4MJ5A 1U33A 2DYPB 5GS2H 4GXFA 2HLFD 3W2DH 2G9HA 3FT2B 4CC1A 5FO9B 2J1XA 3B7RL 1ZSDA 2ESVD 2YD7A 1TJGL 3P69A 4HJSA 4I2XB 4BUQA 2EUZA 2HX7A 3C9NB 4TLTA 3EIFA 4EI5D 1XGTA 3KGSA 1UC6A 1Q1JL 4P2RA 5H37H 4X98B 2F5BH 4M7KL 4PJHF 1NGZB 3Q5TA 2HX9A 1F4AA 1O6TA 2VNCA 3OF6A 1TZGH 3SY6A 3U7WH 2DMGA 1ORQB 2NYYC 4QMEA 4NQDA 1UD5A 3MLVH 3SKNA 3NIFE 5AD0A 2VLMD 2R56H 2R8SL 3RWFB 1OT4A 4BEIA 5D93C 3TWYA 1XSJA 1QWUA 3P9MA 4TPRH 1SF5A 4G43B 2GFBA 1E6JH 3NK3A 4KKNA 5DC0A 3HLKA 1C1EL 4J8RB 3WN5A 2QV2A 3IBEA 1LE9B 3MX0A 4XVSL 4XC3H 4L29A 1S9WA 4XOCA 2KH2B 3CHOA 1HXKA 2WBJC 3GC3A 4OZGE 4DGUA 4ZMNA 3BAYA 3ROOA 4XR8C 1A3LH 5C0AA 1ZA6B 4BBWA 1BXAA 3QISA 3MZGB 1PG7H 4GG8B 3IFLL 2HTLD 2D7MA 1UXMA 3FQXA 4XMKH 4TQEH 3WTWA 3T2NH 2O61B 1DVXA 1MY7A 3QC5X 3JWDH 1DJZA 4AG4L 3PQYA 2FIRT 4OZ4B 4Z0XA 2C9XA 3H2QA 1S7XB 1NSNL 1ITBB 1U8MA 2XFGB 3G5XB 3KWXA 4YHOL 5F7LB 3LZNA 1G9MC 3QNXA 3S5LG 3VFWA 2Q86B 4PTUB 2DIJA 1T66C 1ZPUA 4Q97A 5D5MF 1UM4H 1U93B 1THAA 3SJVA 3LEXB 2Z0UA 1R3LB 1RIHL 3WENA 3FUEA 1G6RA 1ONQB 5I6LA 4M8QB 4ZUVB 2A38A 2EECA 4U6TA 3VI3E 3QFJA 5E8OB 3HZYB 2EDQA 4X99A 2P80A 3EBGA 3ARGB 1RZIA 5D55A 2BVPB 4GJTB 1RQ5A 4IGBC 3L3HA 3UTTD 1BWWA 3K2UH 5HXMA 4HWZA 1BZQK 1MFNA 3HE7A 2LU7A 1G7MB 5ELIA 3CSFA 43C9B 3UTZA 2BFVL 2D4DA 3Q2LA 4QRPE 2EVFA 1IFGA 1GTNA 3ZR6A 3FFDB 1MEXH 3VXRB 2OMWA 3P9WB 1GS7A 4GO6B 4WFGE 2ZOKA 4KTEL 3BESR 1H9DA 3MLXH 4LBEA 4W4NA 2AXFA 4RSVA 3ULUL 2CDGA 2MHAA 1AS6A 2WN3A 2UY7B 2Z8VC 3SE6A 3F7LA 4M4RA 2COVD 3VD0A 2X40A 1LO2H 4CILA 4A2HA 4WWNA 5DFWH 5EU6B 5I2IA 5LDSA 4NPKA 1TZIB 4Z7QB 5JDSA 2DWDA 4NWTH 3QFGA 4PJ8D 1J87A 1XIWC 1PLBA 3KPRD 1LM8V 4M5YH 2HJKA 3B9KA 5C07E 1G4RA 4HEPG 1J8KA 2GIMA 4NFDA 1EVUA 4JFTA 2K9FB 3ILPA 3BZ4B 1HYSC 1SOQA 1IEHA 1DO5A 2CDEA 4E9QA 1I9IH 5JW4R 1HN1A 4QT5B 3GUTB 1UD4A 4WEUD 1MCBA 3G04B 2GEEA 4UNTA 4CNIA 1OALA 3MJ8B 4LCIL 3IRCA 2Y3NA 3QRBA 3HI6L 3MLUL 3MACL 2D9CA 5H94B 4UZGA 1UG9A 3TVMD 4EQ2A 3EHBC 2NQDA 2DYPD 2XCMC 6PAZA 2PKDA 4Y1AA 3KAAA 3FJTA 1JVOA 3O2WH 5LNGA 3U1QA 1XB3A 1F3DH 5FA3A 4F1ZA 2OXGA 2YA0A 3V10A 5KN5A 4MKTA 3N3EA 2BXYA 1K3IA 1Y18A 4XODA 3DYPA 2WYZA 3OSKA 4L3CB 4XO5A 4FQQB 4KU1A 2X2HA 3RGBA 3M86A 2KQMA 4XXCC 5F3BA 3FBKA 5EF3A 4BCZA 1X5MA 2CBTA 5JOFB 5E2VH 5CBEA 4HFWA 4Q9BA 3N2JA 1A02N 5G5DA 5IB2B 3STZA 5KYNA 2J6EL 1ACCA 3QIBA 5DJ8B 3RWDB 3ZYIA 2D7TH 5E00A 1V27A 5L2JA 3HN8A 4HCRL 3GT6A 4OJFH 3U30C 3STLA 3LCYA 3W57A 1SYVA 3JZ7A 3OTTA 4GAGH 3PXLA 4KKAD 4X6DB 5D5ME 4TSAH 4KK8D 2JCCE 4BGDA 3ULSB 1MFMA 3T1FB 2EP6A 3V7MA 3ULUD 3TEXA 1FNLA 1I1AC 4JFZH 1BECA 5H2BA 4ANWA 4OZIF 4HJIA 3BQUC 3DUUB 2ZUXA 3IDXH 5EU3B 4NNPL 2HUHA 1KIUA 1WZAA 1Q94B 5IB3A 5E6YA 4G1MB 1UJ3C 3DHPA 3GXIA 1TU2B 4R4ND 4GXUM 2JKSA 3HRPA 5FOBA 2E7MA 4FXTA 4Z3FA 2N7SA 2FE0A 3ARFC 1NOLA 2J1KA 1ZOXA 4OR1A 2VERA 2MKLC 3JWNC 5GGTH 4AK1A 4PJDE 5T3XE 3Q2NA 1LE5B 4UILH 5IHUL 5C97A 3EYVA 3V0HA 3HNSL 4X7CC 4GQRA 4N2MA 5C9KA 1R24A 1A47A 1VFAA 3MI6A 3Q5YA 2DMBA 2IPKB 4MQXD 4MA7L 4U6VH 3ZT7A 4L3FA 3LD8C 4MJIA 5KTEL 1W0WB 4PY7A 5GIRB 2J8HA 1CFMA 4HZLB 3ZDZB 1UM5L 3V4VH 3WXVL 1LK2A 4IW4C 3H2PA 3CAFA 4ZUSA 1BQLH 2DQEH 1AD9A 3ENEA 5TDPB 3VFUB 5C0BB 3BGAA 5D2NB 4AZ8B 4ZFZB 4AVHA 5E5UB 1UHVA 5KSAA 3G6DL 3H55A 3OZ9H 3RG1C 5DJAA 4G8FB 4IRSB 4MZIA 4NO2B 4LLQB 3B1TA 4QXTA 4PB9H 2FEEI 3BDYH 3VXRD 1L9OA 3VFOB 3VFPA 2R0ZH 3ZDXF 1JFQH 4AM0Q 4CJ0A 4M7LH 4R3SA 2DEYX 1EMTH 3KEDA 2AP2A 1R0AH 1DL7L 1XGQB 3TA3A 2I60L 5CJ8A 5EU6D 3C5JB 3D08A 3HC4H 5ENWA 1I8AA 4HF5L 4K9JA 5FO7A 2YD6A 4B9IA 4X8JA 2Y7MA 3O9WC 2B08A 3EJJX 4KVPA 3QB7C 3FCTA 1AKJA 1K5NB 2DJ4A 2ZUQB 4G71B 1YUKB 1IGIL 1QVOB 4FQIL 4OZHF 3QJFB 2F8XC 1D7DA 5FC9A 1Y07A 1CXFA 1B9ZA 4PLOB 4ES8A 3TF4A 5FYLE 1DE4A 3NTCH 5IUCA 3CFCL 2ZUTA 2AJSL 4YXLH 3I6LE 5ANMB 3IETA 1HKFA 1OWWA 2BMKB 2R9HC 1KN4H 4F5CA 4ZMZA 3BWAB 3MKGA 4CSZA 1ZLWK 1YNTB 4Z7NF 4ZMTA 4H8HA 4LSQH 5FIEA 1ETJA 1NCWH 5BMFH 3TYFA 3KL5A 4FKKA 4RIRB 4XMLL 5CZXC 4PRPA 5DD1H 4DVBB 2SEBA 1Z9MA 5FYKE 3BP7B 4OF6A 3UTSE 3VQLA 5A2FA 3VQ2C 3EDEA 4IBLT 1P5VA 2NW3B 5E6IA 4YXHL 3KPNB 1PFOA 4LVHB 3UDWA 3HS0A 1N70A 1S5IL 4M48H 3IAPA 1T7XA 2OI9B 3IJ8A 3EYUH 4HOMA 4Z1PA 1R5WA 2XPYA 3TBCA 2L3BA 3ZBMA 4RGMB 4PJAF 5D1ZA 1H3PL 3LNFA 1RUKH 3N44F 1MXDA 3MRBB 3DTUB 3UIZA 1S78C 3QIUB 2H0JA 4FQPA 1AD0A 2UVFA 5HYQA 1MWAL 2WJ5A 4NQEB 4LLVB 5I1DA 5EUOB 1I8MB 3M6DA 4P99A 3P40A 4Q9QL 1U3ZA 3U82B 2CAKA 1T1YB 2BP0A 1FF5A 3CJJA 3GSUB 1Q0YH 1I7RB 2XRAL 1OM3L 1M7DB 4OCSL 1MLBA 4MHHG 1CGVA 1IAIL 1KEML 2WTOA 1CDYA 3Q6GH 2AJZA 4WUKL 2RQEA 5D1XA 1ASPA 5C71A 1Q0XL 3Q6FB 4JE0A 3VXUB 3FH5A 4OLVH 1HI6A 4MMZB 5CILH 1A3RH 1NICA 4PJ9B 5TE7L 3WDIA 4GSDL 2PPCA 3CDGA 3GUFA 3R06B 2C7FA 4P2QE 5IBTL 4YBQC 3A23A 2VDRL 2YD8A 2XZAH 5FYJL 3ZDXE 4C57C 4HIPA 4OQTH 4UBDD 4PRAA 5DU7A 3TN0B 3UZQB 3VWJC 5CEYB 3WNIA 3V6OE 2CD0A 1Y1DA 4FYQA 4UT9H 5KOMC 1R3KA 5KSBA 4I48A 2XTSA 5IVXE 1IEAA 1XXFC 3B2UD 1UWYA 3KWWB 3WNMA 3ZL4H 2O5ZL 2XI9A 4EBQL 5ECJE 3VG0L 4LLUB 1T0NB 5C0BD 4X5WA 2OPCA 1UZ6E 3BWUF 3X17A 4AJVA 1AIFB 4PSRA 1I9JH 1KB9J 3L48A 3V0GA 5KSUB 4HUVA 4PS7A 1AZBA 4IRSD 3DMMA 4O2CB 3ZO0A 4FFYL 2AJXL 2Z8RA 4KX9A 2PR4L 1L6ZA 2D3LA 3KWTA 4BK5A 2C9PA 2DY2A 4L3EE 4LEXH 2BNRA 4JW3A 2VLRA 2HWZL 1EAPA 4JO1H 4MB5A 5LBVA 4YAQA 3MLYL 5AKSA 4FHKA 1S5HB 1OLLA 1JERA 3GRWA 3LIUA 4QAMB 4AW7A 5ADPH 2CNYA 5AVRB 4Z7NE 4YXKH 3IJSA 3MJ7B 4KJPD 4O58L 1R34A 2UV3A 1XH0A 4GT7A 4AEEA 2BIIA 4ABUA 4JFHD 4PG2C 1A4CA 3N50A 2BIHA 2XWRA 2IAMC 5F6IC 4GP4B 3G6JA 4G7RB 4G8EA 2H9GB 8CGTA 4HQQH 4YSUA 2F58L 3SCMA 5A7BA 4H88H 2KLSA 4QTFA 1CD1A 4HHGA 2GJRA 2B8OT 3GMMA 1ZLWH 4APQA 4ZG1A 3L7FA 4WSGA 5IJKA 1JXKA 4N8VB 3EG9A 2NLJB 4X6CA 1QI5A 4AL8L 1U8KB 3GMQB 3T8MA 4WY7L 3DDFA 4M1CD 4PJ7E 5B1BB 3C12A 3SPVB 1NAKH 2FO8A 4F27A 3NABH 3CZGA 4K3JH 4NQUA 2H6PB 5FYJD 4QXGH 5IG7B 3WO4B 1QLFB 2AS5M 1MIMH 5I0DA 5KEZA 3QEQE 3UACA 3OR7A 1CZ8H 5DUPL 5BV7B 5AYQA 4N6RA 4ZPTA 1O0VA 1X4ZA 1REIA 3UCRA 3ZKND 1XCQB 2QGCA 3F7RA 3FTXA 1T0OA 4OFIA 3RA7L 3CZSA 4D9LH 2H1PL 3L3KB 2HN7B 4IOFD 1YCSA 4UOW0 3VSUA 2OYPA 2ESVA 3WUWG 1KZQA 1P84K 2YAHA 3DX9A 5GRVL 3O0RL 3QIUD 3VI4B 1PBYA 5HGGS 2JQMA 2CO6A 1T20A 3HLAB 2IPTH 1OWRM 4DGWC 4DP4X 3HFFA 4XOBA 3E6HA 2NSXA 3UPRA 4NQED 3QIWA 3RE0A 2BZDA 3V0VB 3RVTD 43CAB 2VR4A 3H9ZA 5DA4A 5DGRA 3DETD 3SPHA 5C0DB 1TTUA 1BLNB 2YRZA 3CFQA 2WXGA 2WXMA 1F86A 4I4WB 5DUBB 5JPMB 3OHXC 1KXTB 3CQPA 4KQ3L 4N1HB 2UXGA 3PS6A 3GYRA 3MBXH 4NYLA 1OP3H 3DK0A 4TVUA 1YMME 3N1GC 1KDJA 3AADB 3VXUD 4AMWA 1I3VA 1MLCA 2YWZA 3CTTA 4M7JH 1KSRA 1ZS8A 4PJ9D 4GQZA 2WIIB 3MBEC 5DZNA 1BF5A 2B1AH 1UVQA 3P73A 4PJBA 4RAVA 4FI6A 1CFVL 3KYAA 4BRVA 1NWPA 3MJ9A 2Z35A 4ODWB 3DGDA