2PPEA

Reduced h145a mutant of afnir exposed to no
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWAVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Stable copper-nitrosyl formation by nitrite reductase in either oxidation state
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 88
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2007-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ppeA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ppeA02
1GW0A 2HXAA 1ZIBA 5EHFA 4HIPA 2GHZA 3FPXA 1CUOA 1ZIAA 4E9XA 3ERXA 1AQ8A 3FSZA 1FWXA 5I28A 3WG7B 1SHXA 1ILUA 3PAUA 4ENZA 4L0PB 3OMIB 1W6WA 3N55A 3QJRB 3C75A 3TBCA 3UAAA 3X1BA 1J9TA 2X87A 4P5SA 1GS8A 2BHFA 2EINB 1JOIA 2PPFA 1QLEB 2A3TA 2J5WA 2PPCA 3IN2A 3NSDA 1X9UA 4FA7B 2X88A 2EILB 3UGEA 3T6WA 4KO7A 3X1NA 2Y69B 2VSMB 4A2GA 2IDQA 3S8FB 1A4AA 3X2QB 5B3SB 4G71B 3ABLB 2YAQA 1JXFA 1SDDB 4BWWA 1ZDQA 3NSFA 1AS7A 1AZBA 1L9PA 1SJMA 2CUAA 3FU7B 2YAHA 4E9RA 2GC7C 3TU6A 2XLLA 7PCYA 2GC4C 3NYKA 2BW5A 4F2FA 3D12B 3PPSA 1ADWA 1M9WA 4AKQA 1NWPA 4DP1X 1BQKA 1NWOA 2YAFA 3SBPA 4BXSV 6PAZA 3FYIB 4UF7C 3IEAA 5B7EA 1AIZA 1JERA 1NIDA 1QHQA 1BXAA 4E9SA 4TXVB 3AG1B 1PZAA 4KOBA 1ZPUA 2EIMB 3NSCA 1KCWA 1NIFA 2UX7A 4FAAB 1E30A 1AS8A 1M56B 3S3DB 2ZONA 1NIBA 3QJSB 3ASNB 2FQFA 1A4BA 2PCFA 1E5ZA 4BWUA 1ZDSA 1W6LA 2WSDA 4HCFA 1GYCA 4DP7X 1EZLA 1CC3A 1GSKA 2XX0A 5B7FA 3DIVA 1PMYA 2VW7A 5AFAA 1SFDA 2IAAC 3SBRA 1F56A 3CVBA 9PCYA 1MG2C 1SF5A 1RZPA 3KW7A 1PLBA 3RYMA 1AANA 3EH5B 4KO5A 1PLCA 1IKOP 4WKXA 3TBBA 3NJIA 1XB3A 1PY0A 3T6VA 2CALA 3FU8A 2UXGA 4HHWA 4DPBX 1BQ5A 2FQEA 3PCYA 3FYEB 1TEFA 2RACA 1R1CA 1AG6A 1HAUA 4E9YA 4F7KA 1PLAA 2UX6A 2XV3A 2HRHA 5B1JA 2LLNA 1QNIA 4A2FA 4YSAA 3NJFA 4JHUA 2XU9A 5B1AB 1ZV2A 4M4RB 5D4HA 4BK5C 5B7MA 5LDUA 1A8ZA 4YSQA 2IWEA 2UXTA 1FA4A 4YSDA 4DP5X 2HX8A 2BZ7A 2FQGA 1E67A 1OE3A 5F7BA 4Q89A 3CVCA 4KNSA 4E9TA 1L9SA 1KBVA 4HCIA 2PPEA 4X4KA 1ET7A 1JZHA 3FPYA 2NRDA 1NICA 3V9EA 1FFTB 2GI0A 3OM3B 4KOCA 3SBQA 1J9SA 4MFHA 1OCCB 1XB6A 1J5CA 1WAEA 3BVDB 5I6KA 3S8GB 1PAZA 2FT6A 3WIAA 2PP7A 2UXFA 4WTQA 3EHBB 4DPCX 2OJ1A 5TK4A 4DP0X 4YL4A 2FWLB 2BP0A 1XMEB 4CSPA 4YSUA 4HHGA 1B3IA 2MRYA 4KO9A 1KV7A 2ZOOA 2XXGA 4YVUA 4CSZA 3KW8A 1NZRA 4AZUA 1J9QA 3SQRA 3H56A 2XYBA 5I6OA 1XB8A 2BO0A 2HZHA 2PPDA 1GY2A 2HLEB 3WNJA 3WKPA 4NERA 1RCYA 4QLWA 1AG0A 2VW6A 4KNTA 1BAWA 1NIAA 2ZXWB 1NDTA 1L9OA 1WA1X 2GIMA 2IWFA 2QPDB 1RZQA 2AZUA 2UXVA 1X9RA 4GYBA 4HZ1A 3OD3A 1TU2A 3FT0A 1WS7A 2I7SA 2E86A 1IBZA 3NT0A 3ASOB 2W8CA 2J55A 1BYPA 4HAKA 1JVOA 4N4YB 3PAZA 3X1EA 2BP8A 2YXWA 4G7SB 4Q8BA 3UACA 4UANA 1SF3A 1HFUA 1JVLA 2JXMA 2OCCB 3AG3B 2JKWA 1OCRB 3S3BB 1L9QA 2DWTA 3BQVA 3UAEA 5PCYA 2DY2A 1BXUA 4JKNA 2ZWNA 1ET5A 2I7OA 3MX0B 4DPAX 4YSRA 1GY1A 4G70B 4HALA 5I5JA 1L9RA 2YARA 1AZNA 3FS9A 2VM4A 2BP0B 3FSAA 5I6LA 4NB7A 2OV0A 1GS7A 3NJMA 5B1BB 2HX9A 5I5IA 2VN3A 2XUWA 4A2DA 4QKTA 1AS6A 1T5KA 2BZCA 3FSVA 4NAJA 1V54B 2PCYA 1YLBB 2H5UA 1N70A 2PP9A 3ABMB 4GXFA 4EF3A 5B1KA 1SNRA 2MTAA 4PCYA 3TASA 4GP4B 1MZZA 2I85A 3T71A 1SFHA 1L9TA 1PF3A 3UADA 4E9VA 1BYOA 5AZUA 3ZX1A 3N2JA 4YSTA 2DV6A 3NP4A 1AOZA 2PLTA 4AKPA 4K9JA 1E5YA 1ILSA 3DKHA 4G72B 4AX3A 4BDVA 3UABA 3GDCA 4DP6X 4KNUA 3IE9A 3ZBMA 1AZCA 3T9WA 3CDZA 1JZJA 2BP8B 1NPNA 2CBPA 2XVBA 1AZRA 2IDSA 1J9RA 2PPAA 2FNWA 2YAEA 2XV2A 3FU9A 2QDWA 3HEIB 1SHWA 1J5DA 1KGYE 3ABKB 2J57A 1BQRA 5D4IA 2DWSA 2IDFA 1JZGA 2VSKB 1MDAA 1A65A 1TKWA 2IDTA 1PNDA 1AZUA 2TSBA 1NIEA 1JXDA 1OF0A 2VW4A 4KO6A 2BWIA 2TSAA 3NJNA 1V55B 4M3HA 2XX1A 4P5RA 2YXVA 4E9WA 3FSWA 1ID2A 1NINA 2FT7A 3IBOA 2R7EA 1BXVA 3NJLA 3AW5A 1KCBA 3V9CA 2W88A 1JXGA 1VLXA 3TA4D 1KDIA 3IN0A 4F2EA 2H3XC 1ASOA 1A4CA 3HB3B 2AFNA 3U25A 4N8UA 3NJKA 1CYXA 1JZEA 1OOWA 2IH9A 5I26A 5IY5B 3FQ2A 2EIKB 4GP5B 3S3CB 4DP9X 3OMNB 4ZK8A 4BWTA 3CZUB 4G7RB 2YQBA 2WO2B 1OE2A 2BWDA 3ZDWA 2FJSA 5I6MA 3NJJA 3WKQA 5I6PA 2YAPA 3X1GA 4BDVB 3MBWB 6PCYA 2HRGA 3CDZB 1RKRA 2YAOA 2FQDA 1PCSA 2FTAA 2FT8A 1IC0A 5TK2A 4YVNA 2P80D 3PLYA 3JTBA 5PAZA 2P80A 4JHVA 4E9QA 2VMJA 4DP4X 3QJUB 2QT6A 2DYRB 4UAHA 4YSSA 1E65A 3EH4B 1NPJA 1IBYA 2VM3A 1CURA 3PXLA 2XV0A 4DP8X 1M57B 1NTDA 4W1TA 1ET8A 2R7EB 3FQYA 2DYSB 1CYWA 3H4FA 4DP2X 3OQRA 3WNIA 3NP3A 1N68A 1ETJA 5E9NA 4GP8B 3X1FA 2H47C 1PZCA 3ZIYA 1GS6X 2CCWA 3AY2A 3T6XA 7PAZA 1WS8A 1OCOB 4A67A 4YSEA 1MG3C 1UATA 1V10A 3GXUB 1PNCA 2N0MA 5FC9A 3QJTB 3OMAB 1DYZA 1OCZB 1AAJA 2JFCA 2Q9OA 1ASQA 4A68A 3EH3B 3FQ1A 1GR7A 2XWZA 5A7EA 4AI7A 2IDUA 3EF4A 4AKOA 4HCGA 2QDVA 3NSYA 2CJ3A 3DTUB 1URIA 3NJGA 5F7AA 1A3ZA 3AG2B 2GBAA 3CG8A 1DZ0A 2BW4A 3G5WA 4W9ZA 1KYAA 2B3IA 3ABGA 2EIJB 1JZIA 4A66A 1KBWA 1OE1A 1KDJA 3L45A 4YSCA 2YAMA 3AZUA 1W8EA 1IUZA 5AKRA 3T6ZA 1AR1B 5ANHA 3JT2A 5I5MA 4GY4A 2IH8A 2AVFA 2GSMB 1BEXA 5D4JA 3PAVA 1MZYA 1JZFA 1WA0X 4A2HA 1I53A 4RH4A 1SDDA 4YSPA 4BXVA 2XXFA 1PZBA 3GYRA 4YSOA 4PAZA 3FU7A 8PAZA 3QQXA 2HX7A 3NJHA 1WA2X 2Y1AA 3WI9A 2AZAA 1AACA 1OV8A 2WO3B 2B08A 3QJQB 3CVDA 2Q5BA 1EHKB 2CAKA 2QPEB 5B1JC 3QPKA 5I6NA 2PP8A 1TEGA 2GB2A 4G7QB 2IWKA 3H4HA 1HAWA 2AANA 3QJVB 2J56A 1ASPA 3AG4B 4A2EA
chains in the Genus database with same CATH superfamily
2FGZA 4Z3JA 1H19A 3C12A 3MOAL 5C70A 1MCJA 4YDZA 1VENA 2YZ1A 1I1YB 3FH8A 3Q44A 4KXZH 4QHNB 5HDBE 2W9LA 1HHGA 3ERXA 1D9KD 2Y6SC 3K6NA 3L1OL 4FNRA 4G8FB 4ODVL 2PKDA 5I8EA 3TBCA 4OW6A 5AW1B 4F57H 2ZOKA 4K3EH 4PRPD 4W9GC 2J4WH 4G1EA 4JCMA 3ZDYB 3PWVB 3HG1E 1JNLL 3KPRB 3F62A 3H3PH 3OKEB 4Y9CA 4YHOL 5DLLA 1I4FB 2J5WA 3LSOA 1G7LA 4PJEA 4Y2DD 3VFRB 1E6JH 4IK7A 4KK9C 2EILB 5E4AA 4J2QA 3MCKA 3WDIA 4RFNB 5AYUH 1B0WA 1KFAL 2C4FT 4PWFA 2OJZL 3DVGA 1OW0C 4ZAKD 3TO4B 2ZOLB 1OM9A 3HE6D 3L5XL 4K23H 4MMXA 4EDXB 1UURA 1HYSD 2J88L 1WT5C 2Z8RA 4BZ1L 4IU3B 1ZA3B 1SDDB 4J3BA 2DIJA 1GXEA 3DUSA 1R75A 3SPHA 5EORL 4N26A 4XO3A 3RGVA 3ARVA 4JUSA 4YUEL 2FL5B 1DVUA 1P5VB 1KY6A 4NJ9H 4Y16B 4A7GA 2Z35A 2BCKA 1YCSA 4TNWF 2VO8A 2BSRB 5FUCE 4P5TA 4PJCA 4BXSV 1Z2KA 2IMNA 5ANMB 1SY6H 5DUBA 1M4KA 4Y5YA 4UOW1 1UM4H 2QEJA 1Q0XL 1RZGB 3GZOA 4KKNA 3MAWA 2VCOA 4M5SA 4P2RE 1QYGH 4L8DB 3S5YA 2ZZUT 2UX7A 4XTRD 2YPLB 4PJIA 2C7UA 1AVAA 3SKMB 2K3HA 1NKGA 3D69B 3MNZB 1A6AB 1CR9L 3DX7A 3QJSB 2GTZB 4ZZFA 3V8CA 3GMMB 4KRPC 3PQYA 2IPTH 4GPVA 1EH9A 4TS6A 5HI4C 3UTPE 2AMUA 2AEIT 1QSEA 3ATFA 2VW7A 2DMHA 3FUDA 2DEXX 4NQDB 4PS4L 5F0PB 5I30H 2ZNXA 1CDJA 2CBTA 4OH2A 3IDYC 1J0ZA 1FZOA 2FWOB 1A8JH 4EEEA 4XAWH 1KXTB 4HC1H 4BFJA 3EO0B 1XB3A 1R5WA 3BAJA 5DF0A 5JXED 2V37A 4PRHD 1DLHB 2M8XA 3NCBB 4M9PA 3GJEA 3D2UB 2B59B 2XRAL 3RWIA 1GOFA 2RACA 4P4KB 5CLTA 3MOQA 2L8AA 2ARJB 1S3KL 1PLAA 2P52A 3Q6GL 2LLNA 5FUOL 3CZFB 3P4NA 4R9HA 2DJSA 1NCDH 1E6OH 5DT1L 4UT7H 3HLAB 1SOKA 4C47A 1T7XA 1QRKA 1N7ML 2FJFA 5JPNB 4LFHG 2HX8A 1B4LA 1P6FA 3DTDA 2F7QA 4PLJC 1T5WB 4B0MM 4CN1A 1AY1L 5F7BA 3LDBB 4O02A 1XF2B 1XF3B 4J1UA 1NGYB 3F8UB 3HI6L 5DEGA 5C0CB 3RPIB 5ENWA 3EJUA 2YPKB 2DQIL 1J9SA 2VJXA 1FGNH 2R8SL 1KIPB 3G08B 1B0RA 2XIDA 1EDHA 4PB0L 4LSPH 2P8LA 2VLKA 2X44D 3WNMA 4XN8A 3FW6A 5I0ZA 3SQBB 4W93A 2PP7A 2E9IA 1I8LC 2D0FA 2ZAGA 4QTIL 4JDEB 1KTLA 1TO5A 4WTQA 3VMPA 4PVLA 4GAGH 4QYOA 2GW5A 4MB3A 3ZR5A 3P0VL 2WBJA 2XA8H 3WFEH 4WRLA 2RIKA 3VSVA 2P5WE 3HMWL 1CQYA 1NCOA 4WFED 4Q9QL 2NY1B 3TCXA 3SDAA 2HLEB 2HUHA 3S35X 3UC0H 3KYMA 1AYOA 3IXAA 2XTJE 1KXQA 1Q9KA 4F15B 3P0YH 4LCUA 2VW6A 4KNTA 4ERSL 4JQVA 1AXSB 2DL9A 5DC9B 4HSQA 1I7UA 1MLCA 1L9OA 2MMXA 1I75A 2X4NA 3EYQC 2AC0A 3MLTA 2AZUA 3EJRA 4NO2A 5C9JB 2QKIB 2G75A 5IKCB 3EO1A 4NC0B 4R96B 2Z8WC 5JHBA 1DQDH 1B0IA 4UM9A 1WS7A 3BZ4A 4D0DA 5EZIH 5TQ2L 4BH8A 3BUBA 4OJFH 5FGBC 3U7YL 3SDCA 4U4IA 1T2QL 1MREL 1ADQA 3H9SE 2NY2B 3C6SB 4QRRD 5T1KB 5FDWB 4AGPA 1BJMA 2HJLA 4OSUH 1WLHA 1PDKB 3WXWH 4M6ML 1BXUA 3CVHA 3U0PB 3DX6A 2BPBA 4XE5B 1KCVL 4MD5B 1DO6A 3FO0L 5ID0B 2BP3A 4UQCA 4YHYB 3EXJA 3FS9A 5F21B 2EDYA 1ZVHA 2BP0B 2H41A 2X4TA 4I18C 3MNVB 4ABVA 1UOLA 5JA9A 4X5RA 4KXAA 1ULVA 5C0BE 4I0PD 3SBWA 2WLHA 3SD2A 1E5BA 2B15A 5K9KB 1RUPH 3KE0A 3BUPA 3NABH 4DERA 1P4IL 3PWUA 3NESA 5FV2A 4GXFA 4EF3A 2O6EA 7FABH 2YO3A 1QBBA 4MVBD 4XRCB 1S7TB 4AT6A 1W0WB 4LPCA 3OLIA 5EC2B 1XGYH 2WLZA 1JNHB 3LZPA 4IIQB 1CFSB 4N0UA 3SO3B 2YN3A 3HJ0A 2CJSA 1U8IB 2Z4QA 1JYWA 4KMTH 3UIZA 4FQJH 3IFLL 4N3TA 1VCBC 3ZUCA 1J5OL 1CJYA 1NUFA 1RSFA 1XL4A 2A74A 3BQUD 3JVGC 1N5YL 3JBG7 1RUAL 3FFOA 3RB7A 2EE6A 1B6DA 4JFOB 2OSXA 5SWSD 4FQHB 1JGEA 2OQJB 4KX7A 1HCVA 1A9EB 1P84J 2APFA 3T65A 1AZRA 2IDSA 4KVCH 3W9DA 1IARB 2JLPA 3HG2A 3OC8A 2NYYC 3L5IA 3O6KL 3BMVA 1A9BB 1OSYA 5K39A 3CZJA 3SKOB 1TKWA 1PNDA 3REWA 3IDIA 3LNFA 2H2SD 4LOUC 2W07B 2J44A 3TC9A 4AYGA 4WLCA 2XQBL 3D0LB 1U8OB 4GS7C 4PEEA 4P5RA 2OI9C 1LEKB 1AQDB 1TJMA 3RP1A 4X7EC 5ICXB 3WELA 2FJHB 5JHDA 3QIBC 4FLOA 1ID2A 3II1A 3IBOA 4ZW7A 3GGWB 3NPSB 4XMWA 3FCTB 3GTTA 4D9LH 5G4MA 1U8NA 3CFCL 4BEIA 3MYZA 1RUKL 4P05A 2H2PD 3MYJA 1KDIA 3RTQA 4ALAL 2LOEA 3R0MA 3VWJA 3OG6B 3FUIA 2IGFL 3GC3A 1G9NC 4S0TD 4N0CC 1HILB 3PHQA 4QHLB 4AWJC 3HAEA 2EXYD 3ABZA 3L4XA 5CF3A 2VITA 4LLMA 3ARFB 3OL2A 4NUGH 3CFNA 4NRXA 5K59E 32C2B 3D30A 1UHVA 3EOAA 5IQMA 1U8PB 3EO9L 3OSKA 1HOCA 3MV9B 3Q06A 1O9ZA 4IJ3B 3KCPB 3RWGA 5HYSA 3B3BA 4X0KB 1QABA 2BNRE 4GW1B 4UTBL 3PJLA 4ZNCD 1ZSDA 4LVHB 2VSDA 1OAQL 3N42B 1QLRA 4W6WB 1J11A 1S7RA 5C0ND 4R26L 1IC0A 1UVQA 3RVUD 3NIGF 2W0LA 2H1XA 1S2EA 3CAFA 3E8UH 3ILQC 3HG4A 2VMJA 3VUAA 3BPCA 2FEDC 3P4OA 2HSIA 1A4KB 4XBGA 1KLGA 3HNTL 2R9HD 1YEDA 5ESVA 2YOCA 4CC0A 3TF4A 1SLWA 1HZKA 4KZEH 2XWEA 2NXYC 4NQCD 3US0A 2VR9A 3T04D 1N59B 2IAMC 3QUZA 3JVFC 4PI2A 3S4SB 3V4PH 3VSQA 4D9QE 4APQD 2XXCB 1OCOB 2Q6WB 3ZKXC 5E94A 4NNPH 1XWVA 2A0LD 3TJHC 1PNCA 4XPBL 1VFOA 5ECJE 5L4FA 2CIIA 1QR1B 2I60H 2OAAA 4JFEB 4QHMB 3G5XB 3O2DH 4LEEA 2IQ9L 1ASQA 2CO3A 1IM9D 1KTCA 2NLJA 2XG5B 3OR7A 2ZQKA 3P9LA 5I1HL 2C4FU 4XO4A 1G7MA 1Q1JL 1CGYA 5AEAA 1E4KA 1IAOB 3QXDB 4L23A 2IALA 2XWXA 1DQLL 4DKFL 5C2UB 4YXLL 5KVDE 1J7VR 5BVPH 2NYZA 3I9IA 4ZFFA 1A3ZA 1B2WL 4G8EA 4J8QA 4FXGC 4OFPA 3ROLB 2KZBA 3LKQB 2EIJB 1BD2D 4A66A 3S96A 2V17L 1JPSH 3AZUA 3UMTA 4RRPG 1QUNB 4YSCA 1AGCA 4HOZA 5EWIL 3L4VA 1I7ZB 1J8SA 2NY3D 3VXUE 1FVDB 3VXME 5LBVA 1CTNA 2G2RB 4HWBL 3EF7A 3T0EC 1NC4B 4RGNE 4X8JA 4OT1L 3AQYA 3VA2C 4WQOA 1IKFL 2WZ5A 1MWAA 4H8HA 3G9AB 3F12A 5JZ7D 1BSIA 1OGAE 3GYRA 3PWJB 3CUPA 3O45B 1OHQA 5GGQL 3DXAA 2LU4A 4M3JA 1GKEA 2C9QA 4G3YL 2BH0A 1EEYB 3WN5A 1C5CL 4ZFQA 1RIUH 1FNHA 1IM3A 4O58L 3QFJE 1DVFB 2HPOA 4ZG1A 4HFWA 1MVFA 3QAQA 1HHJB 1KMGA 4XVUC 3B5HA 3PGCB 4PJHF 2PYEE 4L0ZA 1S8DA 2JB5H 1OP9A 5CGYD 4BHUI 4DCQA 5DJXA 3QCUH 3QUGA 2K9FB 4X5XA 3RY6A 4HIPA 1INQA 2DW5A 2XPGB 4Y1AA 4HIIB 1UCBH 4GI8A 3PJSA 3KLLA 5TGBA 4Z1PA 4Y4FB 3OMIB 5FHBH 3FTYA 3ULSA 3UYRH 2BHYA 4F7TA 2F9BT 3QEHB 5D2NE 4J3OD 4AIOA 3H9HA 4Z8FL 1FG2B 3C8DA 4CILA 4PY7B 2EINB 4H20H 1H3GA 1H0DA 2EH8H 3F84A 3GB7A 3BKMH 4WI5A 1XGTB 5T1MA 2B2XL 2Q2EB 4L3CB 4XNZB 1U8CB 4KO7A 3SE8H 5HVFB 1FFPB 4WK2B 4ODSH 4G8GA 2BLFA 4PJFA 1J87A 8CGTA 1A3RL 4HEME 4IS6A 5I1DB 2H32H 4NKMB 3ABLB 4XP9H 5FKPB 3FRUB 4AYEC 4HPYL 4WEUD 1A47A 5F7HA 1AZBA 2JK5B 3A23A 1NSNH 1A7BA 2J5LB 2GTQA 4M8VA 4N86A 4OB5H 1AI1L 3S5LA 4DZ8A 6FABL 4HUCA 4N2EA 2GC7C 4N90D 5J4MA 1JRHL 1OAYH 5IW6A 4WSJA 4J12A 4F2FA 1XR9A 1BX2B 1CGXA 3FQUA 5KSAD 1AZZC 4U1HB 1DJYA 4RETB 5I23A 1EZVY 2OSLB 4JFHE 3IEAA 1KJ3H 1IFRA 3T0WA 1QHQA 2OMBA 1DZBA 3O9WC 1G7IA 2YD8A 1JFQH 5GJTL 5IQNA 4QWWD 5E4OA 1SJHA 1HHGB 4NM4L 4P23C 1D5MA 1J5HA 1JDDA 2GJJA 3QDMD 4MQ7B 2F1AA 3WUWB 4KU1A 5I8EB 3Q6FA 3QE5A 4LRIC 2V5TA 2ZOKB 3MO1A 2YPVL 5GGSB 2NX5B 3D07A 1ZLWH 1E5ZA 3GLZA 4YQXH 2VT0A 3HS8A 4ZJ9A 1DR9A 4Z95L 3LSOB 1G7LB 3QFDA 3QUYC 5SX4I 4Z7NF 5KW9L 4XX1E 5CZKA 4DVBA 3HC4L 3MDJA 4DEWA 3AREC 3MCKB 3DO7A 4IRJC 2ODIA 4Z3HA 1E9OA 3DDFA 1TOXA 3K81A 3TJEH 3E3QE 1BBJA 3DVGB 3SGEI 1MG2C 2WANA 3K2KA 1KACB 1FC1A 5KJRH 4Z7IA 2PNDA 3AB0C 4GO8A 1IKOP 3IGAA 2D8KA 4XVTH 4XMPL 1GGBH 5IJVA 3DUSB 5GZNA 1WVZA 5GRWA 4XGZA 3FYEB 1TEFA 5DK0A 5HPOA 3RGVB 2DQJL 3BIBX 3AT8A 5E5MA 2D7QA 3JUZA 5KVFL 2B1HH 4JPWH 3LZOA 2Z35B 3FBKA 2BCKB 4HXAL 1QAWA 4ORGA 5DO8A 3GBEA 1HL9A 5B1AB 3KM2A 4PJCB 4D9RE 5LDUA 4MAYD 1LMKA 1TZHA 3FCSA 3K6SA 4Y5YB 5EUOA 1G87A 2EDRA 3B7RL 5GGSY 5IFAL 3MV7A 3DK0A 2GFBA 2Y5TA 1LNUA 5BVJA 4CU6A 3HI1A 4O2EA 4ZFZA 3VGFA 4EDWL 4PJIB 2C7UB 3U83A 3P3YA 3S3SA 3V9EA 1IV8A 4PV9A 5I1LA 1T1XB 1FCCA 2P28B 3ALWA 3DX7B 5INDA 1WWWX 1KC5H 3FF7A 2KLSA 4ELDA 3AS3A 4EQ2A 3PQYB 1UJTA 2NY5C 3DX9A 2OJ1A 5TK4A 4XMKH 3EYSH 4CSPA 1QSEB 4DOHE 4RDQF 2MRYA 5D8JH 3J8F7 5C0GA 2G2PA 1VADA 1OW0A 4Z7WA 5GGTL 2B7DT 4HFUH 5LNGA 4RBPH 3QHZH 3KYKH 4NP4L 1ZE3H 2B9BA 5BCAA 3UZQA 1WT5A 1XGQA 4XBPA 2DPKA 1XO8A 4U1IA 1G9EA 4J23A 4NEHB 1F97A 4MJ2A 2EDQA 4RNRA 5LGHH 1R5WB 4X4ZA 3ZO9A 4ODWA 1JV2A 4JY5L 1SQ2N 2Z31D 3KL0A 3QRGL 3QB7C 1CB4A 2ENSA 1BAWA 5CEXA 4F3FA 3RWIB 1L7IH 4YX2L 3GLDA 1A7OL 4OJAA 1LEGA 3QAZC 1D5XA 4EQ3A 2D2OA 3P4NB 4JPKH 4NWUH 3U1SH 1NMAH 3MI6A 1N4XL 1CLZL 1TTCA 3H55A 4NUJA 2FJFB 1KXVC 4ELMF 1W16A 1JVOA 5GRYA 2N1TE 1XZWA 3M8OH 4J1UB 5DEGB 4MJ5A 2JXMA 3CHOA 3RU8H 3WD5H 2X2IA 4ZNEA 2VXTL 1L6ZA 3EOYG 3S3BB 4JVWA 3VNZA 2J21A 2E7MA 2OBGA 1KWKA 4J5VA 3V7AE 4L4VD 1B0RB 1JN6A 1HL4A 1KZQA 2AXFB 2P8LB 2VLKB 3MA9H 3MUZ1 4LPWA 2PETA 1M3JA 1GIGL 1MCLA 4YSRA 5C09D 4JFFE 4OI7A 3B9DA 2MOQA 4LSQL 1KTLB 2J1WA 3ZKMD 4QYOB 5BV7B 1X5IA 3BGFB 2Y7QA 5FKAA 4B9IA 2WBJB 1RUQH 1JD9A 1XGZA 5IEHA 5DURD 5IT2L 1GVIA 2XUWA 2Y07H 4QKTA 4WFGE 4XC3H 4YZFF 1QASA 3DUUA 1GTNA 3QDGE 4NZRH 4H0LC 3B4NA 4Z7OF 3SDAB 2AEQL 2K7PA 4M5ZH 3L8QA 1UUNA 4RGMB 2DYPA 3KYMB 3IXAB 1Q9KB 4BFOA 4LCUB 1EJOH 3MRLA 1UEYA 4IKJA 3UP1A 5EOQL 1KT2A 2ZPKH 1I7UB 1BV8A 1MLCB 4XTRC 2X4NB 3GUTA 3GHBL 4NO2B 5I0WA 1AOZA 1BYNA 2G75B 4NN7B 3EO1B 1A7QL 2N56A 2EDHA 1JTTA 4UM9B 3DNKA 3U46A 3BZ4B 4D0DB 2WWMC 5EOTA 4BH8B 5JR1L 4AX3A 4EBQL 3MBWA 3VX1A 3BKYH 3CLEL 1DL7H 4LSSL 3GBNH 3SDCB 3W82A 3ZLQC 2CCVA 1CU4H 5E1GA 3T9WA 2OW6A 3MBED 2WOYA 3Q9QA 3L4WA 4WJKB 1M7UA 1D5IL 3JWDL 2HJLB 2P43B 1X4YA 2JJTC 4GJTB 4PGDA 1AKJA 1OAZH 4ZUWA 1Q0YH 1K2DA 3AU0A 3CVHB 5D70H 1GAFL 3SPVA 2VW4A 1QA9B 3DX6B 3HE7C 3NIGE 2VKWA 2CO6A 4GKZA 1I8LA 3VD9A 1ZXQA 4MJIE 5E2WH 4IKKA 3ZRFC 5C0IA 4M7LL 3TT3H 4GBXA 4K2UH 4QHUA 2K8MA 3UTSD 2VZ3A 5C08D 3BJ91 4XC1L 1A7NL 4NENA 2RCSH 3SE4C 5E2UH 2AK4A 4KNQA 3PWUB 4HJTA 5D1XE 1PYWA 1LVEA 1EVTC 3FHQA 5HTSA 3QDJE 2ESVA 4AT6B 4UB0H 5AWNL 4G83A 2PCXA 2I9LB 3V10A 4UOJA 4ZK8A 4N0UB 4Z7AA 4JM4H 2H0PA 4X83A 1F58L 4LRNH 5KZCB 3QK0A 4DSYA 3S34H 1OCWH 3BOVA 1U9KA 4RMUA 1TSRA 2A74B 2NY4C 4UV4L 4W70A 2DI7A 5BUPA 4CL7A 5HHXH 1NCGA 4BGDA 5JMRA 5A16A 1X7SA 5LG1A 4IKIA 3QUKA 4HF5L 4NQED 5I74B 5DO2D 5F8RC 3OXRA 5FGBA 1JGEB 4GXVL 4YHLL 3W11C 4CJ1A 2YGNA 3T65B 2OTUA 4JHAL 3RURA 1W72L 1EUTA 2MWCA 3D4ZA 5HY9A 3W9DB 2BIIA 5SX4H 2YAOA 3V4VH 3ISYA 4DTGL 1MY5A 3CHSA 3KGUA 2BVYA 2DMBA 4JB9L 5K39B 4ZMAT 2DM7A 4I88A 1TKWB 5PAZA 1CDIA 3REWB 2V3EA 3IDIB 4TSBL 2BVTA 2F7PA 3SGEH 3ZT6A 5F1SA 5KSUA 1U21A 3VSUA 5E5LA 5CLYA 2XNAA 1I8IA 3NEEA 4K94L 4LCWE 4C54A 3PP4H 5HDLA 2WXFA 4I18A 4DP8X 1M57B 2VDMH 3LKOB 2GSIA 3NOIA 1HXMA 2XPZA 1MJUL 4PMFA 5LG6A 4J6IA 3NJVA 3W39A 2ALAA 1T03L 4UIMB 1U8NB 4NWTL 3STLA 3MYJB 1ZT4A 4M5TA 1URZA 4JMNA 4UAOB 2YK1L 4QOKE 4Z7VF 4NN6C 4DUWA 5CZXD 3OHXC 1XAKA 1AAJA 2ZX9A 3HB3D 1G1KA 1A22B 4MXQC 4YPJA 2C1OA 3VMNA 2J43A 3MRKA 3MOAH 3DIFA 3PHQB 3BN9D 1O6TA 2YSTA 2IDUA 2V9RA 1CWVA 3HAEB 4KC3B 4PJHE 5DHDA 4YGVB 4AKOA 2R1YA 2VITB 4LLMB 4P2CG 4CMHC 3H54A 4P3CL 5MEQA 4NRXB 3GSNA 3WNKA 3JVGA 3L1OH 4OCXH 4ODVH 3V95A 1NUGA 4O5LH 5IFHH 1ZY9A 1HOCB 3T8VA 5BRZE 4WEBL 1O9VA 5I75B 3RWGB 4YDJA 4AYDC 2EE9A 4GI6A 5HYSB 4HJEA 1U8KA 4UQ3A 3MNMA 2H6OA 4LCIH 1WC7B 3CD4A 1JNLH 4YHOH 5KUMA 4EKJA 4GLRI 4WUUD 1JZIA 1ZSDB 4LBAA 1DVQA 1FH5L 1QLRB 1RP8A 3Q2VA 5EPMA 1MLBA 1S7RB 5AVTB 1UVQB 3B2VL 4PD4K 5I9QC 2BS71 1KFAH 2HVJA 4IMLA 4GRLC 1F4XH 1DQIA 1MCQA 2OJZH 3IFNL 3DGGA 2VXQA 2VZUA 3IBEA 3QFGA 3BPCB 3HG1B 3DYMA 2IOMA 4LSVL 5DJ2A 3L5XH 3P4OB 2J88H 2DQCL 4XBGB 1KLGB 1FC2D 3CN3A 5D1QD 4BZ1H 1YEDB 5ESVB 3DVNB 4WI3A 4E41D 1TQVA 5JIQA 3QIBA 1N6QL 1JYVA 1N26A 4K71C 3NGBC 4TUJA 2GBVA 3W2DH 1XIWD 3QUZB 4NN5C 4X50A 2AS5M 2AZAA 5EORH 4AGLA 1FNFA 1ITBB 3C5ZD 2B08A 3B2UD 3QJQB 3QRBA 1QI4A 2ZWZA 2Q5BA 1SN0A 3ZKND 2WYIA 5I6NA 5E94B 4GUOA 1ITCA 3D3VA 4KI1A 2CIIB 2GB2A 4XNAA 4YWGL 3ARBC 2AANA 4PRPE 1XXFC 4M43L 3ML9A 2NLJB 3OR7B 3P9LB 4NS0A 1N64L 5CP7A 2X4QA 4FCAA 5CIPH 1G7MB 1BM3L 5DEZA 3OB0H 4IRSC 1GYVA 2IALB 2LV4A 4ZTPL 2IIJA 2XBDA 4XX1G 3WG7B 4ZFFB 1OALA 5LGYA 1CR9H 2B14A 1FYTA 3U7WL 4AG4L 3L3IA 3HPLA 4G8EB 2X87A 3S3JA 4UT9L 4OIIL 3SDXA 1CGSH 1BFVL 2HFFA 3NSDA 3S96B 2YD5A 4O51A 4OVUA 2FH6A 1QFUL 4PS4H 3RHWF 4Z7NE 1CLVA 1YG9A 2ZAIA 2CGRL 3Q8FA 5LHDA 4EMZA 2VABA 3LRKA 2EXWD 2YEQA 1MWAB 2X6CA 1WIUA 3F12B 3MLRL 4HIEA 2H3NA 2J71A 3CUPB 2IAMA 3A5VA 1H6FA 3VFOA 3BAEL 5D96B 1T7VA 4XVSH 5DVPA 1IKNC 2WXHA 3WN5B 5F9JA 2KDYA 1S3KH 3Q6GH 3APDA 4B9CA 5FUOH 3DWTA 3L5JA 4PJ6A 3ZL4L 5DHYA 3SYPA 1ADWA 4ZOCA 4JREC 5DT1H 4FXLA 3SKJH 1NWOA 1XV8A 2EEBA 4PLKD 3QO0A 5LKNA 3NMEA 3NIDF 4DCQB 2PXYD 5DJXB 2BSBA 1AY1H 4X5XB 5E5UB 1JNNL 4CC4C 1INQB 3VFTA 3QJOA 4Y1AB 3NSCA 3U0TA 2WKLA 3HI6H 2E8ZA 2EDJA 4FAAB 3PJSB 3CXFA 5TGBB 5GZOD 3EJZD 4X5WB 4IBSA 1BQHG 2UY6A 2X1WL 1F1AA 3ULSB 4F7TB 2R8SH 2W9DL 1NBYA 1JAEA 2ICCA 4PB0H 2E6JA 2MQCA 1BZEA 5C07A 2AK1L 4S0HA 1H0DB 4QTIH 5CU9A 4QJ5B 3GB7B 4R0LC 2XZAH 5T1MB 3B9KB 4PRHE 3VYPA 1JGLL 1GSKA 3UTTA 1NFIA 2WP3T 2HFTA 1EK3A 1PMYA 2AJ3A 3NCEB 3P0VH 3BZ5A 1BPLB 4JRYA 2H6UA 3PWPD 4NHUA 1I9RL 3BDXA 3CDGA 1MCWW 1ZHBA 1SF5A 3CJJA 4G8GB 3GSXA 4PJFB 4PN6A 3D25A 4FA8A 4IS6B 2KMWA 3T0EA 3LEXA 3HMWH 3DVIA 3LPFA 4Q9QH 2IFGA 3MUUA 1N67A 3VJ6A 2IFFH 1YN6A 2D7NA 2JKTM 3FU5A 3OV6A 3P3UA 3PDDA 1OY3B 4ERSH 1NA8A 2QPUA 5EA0H 3S5LB 1LWRA 1BIHA 3SEPA 3B8SA 3DOSA 5FYJU 1Y7VA 3C8KA 5AW9B 1DQVA 5IW6B 4JPIA 1CLOL 4PRIA 2C1PA 4EAEA 4LESA 4Y9BA 4RMRA 4P06A 1XR9B 3FQUB 4PG2C 1ZSHA 4Q56A 5IB4A 1DLFL 1JHKL 4O9HL 2FLMA 5TQ2H 3R8BB 4B95C 1MAJA 1FA4A 3II2A 3QP3A 3KPPA 3V7AG 1TMCB 3CPLA 1G7IB 2CGZA 4XH2A 3SE3C 3U7YH 5D7IF 1T2QH 4CSSA 4Q89A 4ELME 3N44B 1A4JA 1KBVA 1SJHB 2FYYA 2D3JA 1D5MB 2E7CA 2NR6D 2JVUA 3OM3B 4M6MH 5GS0H 3K80A 3Q6FB 4HV8A 3EYOA 3MO1B 1CXLA 1FYHB 3CV5A 4MAUL 1J5CA 1HHKA 1IE4A 2P1YA 4WFEE 5C92A 4MCMA 5JZ7C 2XG4A 1LO3L 3FO0H 2UXFA 3HHSA 4ECNA 3QFDB 1R0AH 2DKSA 5BS0A 1TQWA 4K5LA 3DO7B 3N04A 1TEYA 5IHBA 3U9WA 3LHAA 1BBJB 1CVSC 3R0NA 3LPOA 3OLGA 4AZUA 4ZMYA 2CZNA 2G60L 4BFBD 4JJHA 1P4IH 4E42A 2AQ2A 3GMPA 3IGAB 4N8VA 3SDDB 3WFZA 3NFNA 3P2TA 2YBRA 4YZFE 4JFWA 2Z6FA 2GG1A 4G7YL 4UQ9A 5IJVB 4Z7OE 4IQHA 2Y2WA 4XGZB 1RHHA 1I1CA 1SM3L 1YEGH 2BSDA 1A6ZA 3CX5K 1NIAA 1ECZA 3CN2A 2ZXWB 4NBZB 4UQ2A 5DK0B 4QRRE 1JRHI 5E5MB 1INEL 1Z32X 2PCPA 1RK0A 5B8CC 2WKOF 2RMNA 4PGBB 1XCTA 2B4CL 4M1GL 4NP9A 1N8ZB 4ORGB 1J5OH 1N5YH 3T2QA 1I9EA 4J3OC 4WW1A 3NDZE 2I7SA 4RMTA 2OXGA 1RUAH 1M9SA 1TZHB 1WISA 3FCSB 3HPJA 4NO5A 5F6IC 3K6SB 5JLZA 3O9WA 4WO4D 3JWNG 4MB1A 4HBQA 3O3BA 2MCG1 3MV7B 4P2AA 2GFBB 2DQGL 1BF2A 2Y5TB 3AU1A 1LNUB 4GLRH 5BVJB 3HI1B 4O2EB 4ZFZB 4P23A 1JVLA 4H8QA 3AG3B 3I85A 1NGPH 3O6KH 3QUXC 4OGAD 2JKXA 5I1LB 1KGXA 5FYLL 4LRIA 1DDTA 1KLUA 5A6LA 5INDB 2HKHH 3QR2A 5EMYA 4G70B 3DX9B 1FUNA 2XQBH 3GBLA 3RI5K 3VFMA 3VQLA 3QUYA 4ZX4A 4FRWA 1R9FA 4S1DD 1T83C 1N0LA 3AREA 2ICES 3QPQC 4ZFOL 1T0NA 4IRJA 3L13A 5C0GB 5FO9A 4FHBD 4MQTB 2VN3A 3FFCD 4Z7WB 3CFCH 1E4XL 3H9ZA 3UZQB 3ZE1B 1RUKH 3CPUA 3IMWA 1XGQB 4XBPB 5KSAC 1B4RA 1L4IA 4U1IB 3BKCL 1Y6MR 1MEXL 4RNRB 4UQAA 3CN4A 1UD6A 3VDCA 3ZTNL 1RU9L 4ALAH 3ULUC 1JV2B 4KI5F 4ZMNA 4L3AA 2VLRA 1E3ZA 1MNNA 2DQUH 2H1PL 2IGFH 4LLUA 4QWWC 5CEXB 2RD0A 2C9PA 5K1JA 2Q1EA 3KXFE 3Q3GA 1LEGB 4F7PB 1D5XB 1MCFA 1FNSL 1BZQK 2E27L 5FW6A 1P2CA 2V7NB 1WD8A 5D7LD 2HTKD 3BAKA 3L2LA 4NUJB 1TSHA 3WMSA 1XHHA 3EO9H 4GG6A 3DRQA 5E8OA 2ARWA 3PNWA 4UTBH 1XCQA 2YAEA 2R29L 4MJ5B 3S9DB 2JXMB 2J6EA 4DK5A 5LN8A 1OAQH 4YHPA 4H26A 1J0HA 1WZ1L 3GRBA 1CFMA 5CM1A 5CP3H 3ZOAA 2ZKMX 1OM3L 1NIEA 4H7VA 1JN6B 3P3RA 1JXDA 4KRPB 4O4YL 5HHMB 4NAQA 4KO6A 4WI4A 4NLAA 3QISA 4L4TD 4QHPA 2ZUSA 2OTPA 5KANI 3ETBF 5ESQB 3ZZQA 2F54D 2Y7QB 5FKAB 5DWPA 3RBGA 2R7EA 1LP9A 3KLAA 4H1LG 4PREA 3IDYB 5IEHB 3OPZL 2Y1VA 4OFYA 3DUUB 1WPCA 1PG7W 4OJEH 2F2HA 4MAYC 2DYPB 1WBZA 5F7DA 4XPBH 35C8L 3L1FA 4OUUB 2GY7B 1E5UI 2EIKB 4CAGA 2IQ9H 2X5PA 1E8WA 1KT2B 3DURA 4KROC 4Z7VE 3KLQA 3L3JA 4W4OC 5DZNA 4FLQA 4GRWB 1U4EA 4R6UA 4WEMB 4X6EA 3GUTB 1Q1JH 1DBKL 4S2SA 4NFCA 1DQLH 2D0HA 2BWDA 1W80A 2OZ4L 1J1PL 2B1AL 1I1FA 2EH7H 3U46B 2E3VA 4HKXA 5A3ID 5EOTB 4AUYA 4R3SA 4B0MB 3MBWB 4CBZA 3F7KA 5HDQL 2O5YL 5B3JF 3FU3A 3NQKA 1S78C 5LAXA 1M53A 4PRNA 1PSKL 1EAPB 4OTXL 5D6CA 3JZYA 3H85A 4NO0D 5D5MA 1J8HD 4NQCE 1KTJA 3ARGD 3WE1A 4PGDB 1SJEA 5EWIH 4FI8A 3VACA 4ZUWB 3CGTA 1K2DB 3VA6A 3RDTC 1RIHL 2AEWA 3CFJA 3SPVB 4L18A 2EDFA 4HWBH 1IT9L 4DP4X 3QJUB 2CO6B 4GKZB 1G4MA 1U36A 4OT1H 5KYYB 4PJAA 5CEZH 1IKFH 3R4DA 4QPEA 4G8IA 5C0IB 1KGJA 3D39E 4GBXB 3UBXG 5LBSL 4NUQA 4QHUB 4UU9A 5L0QC 1X5XA 2DYSB 3VXMB 4DP2X 5GGQH 4NENB 5E8EB 5L2KD 1G0YR 2V0AA 3MV8E 4ZO9A 1DVYA 4G3YH 2AK4B 1PZCA 1QFHA 1C5CH 1YYCA 4O58H 2DQ6A 4N0FA 5GGVY 4IYKA 2ZKXA 2AQTA 4L3ED 2ESVB 1PY9A 1I8KA 3ZHNA 5B39G 3TTYA 5H35A 1JYNA 1RZJL 1HHIA 1M2VB 1EEQA 5A7EA 3MROB 1I8MA 3GRWA 4L5FL 3CDCA 5C0RL 4ZUTA 1U8HA 4JPVL 2K0RA 4WWKC 4TUKL 4ZMPA 3QCVH 2Z1KA 2WLJA 2CJ3A 4DKAA 5A16B 3MRRA 3QUKB 1NCWL 4NSKA 3OXRB 5IJKC 2Z4TA 3AWGA 4Z8FH 2B3IA 4HX1B 3KPRD 3ZKMC 4PLOB 2OTUB 3WENA 2JJVA 5HY9B 4JE0A 3V55A 5I0VA 3IE4A 5FFGA 4E0RB 4X4XA 2JJTA 1SUJA 4K7PY 5AKRA 2P48B 4QTFA 4LMQI 4A7QA 4Z23A 5I1JH 5J11C 5JPMC 3GSUA 2VDRH 1W0VA 4I0CC 4AIZA 5E0QA 3OAZK 4J3UA 3HE7A 1A3RH 2XNAB 1I8IB 4R4FL 3Q5TA 5JXEA 3IXTA 4XBEL 2Y6TE 1AIFA 2H1LM 4OFKA 1I7TA 2ZSWA 4I18B 1IU1A 2IV8A 2CHNA 2GSIB 3GSVA 1LE5A 3IS1X 1KPRA 4XPAH 3W39B 2Z8VC 5JIDA 3SE4A 3ESPA 4PYGA 5AB2A 3OGCA 3NZ8A 1JRHH 3STLB 4Y16D 1HEZA 3PGFL 2LU5A 1ZT4B 2VUKA 2QPEB 2X4PA 1JDCA 2A2QT 5EO1A 4Z9KB 1VKXA 3MRJB 1EO8L 3VM5A 1MJJB 3LKSA 3HCVA 3VXPB 1QVOA 1FFOA 5HJDA 2CR6A 2EZ0C 1M1SA 4R7DA 4A2EA 2C1OB 1LILA 3MBEC 3MRKB 3DIFB 5FXCH 3DX1A 3HC0A 3D09A 5GJTH 2B8OT 3KHQA 3Q2WA 1VZGA 2R1YB 3NIDE 4XCCL 2C3XA 1CUOA 4YOKA 3UJTL 1NGWA 4W9HC 5CFHA 5LQBL 5MEQB 4NM4H 4HMDA 3GSNB 1PFCA 1UWGH 3D18B 1R3IL 3GHEH 3PAUA 4YBLC 2A83A 2AAVA 5T33L 2G4EA 2FJGB 4M5YL 5DHMC 2CK0H 4JO8A 4YDJB 1L0PA 3L7FA 3V6FA 1U8KB 4UQ3B 3RX7A 3HBQA 3FTVA 4JO5A 4RDQG 4F7MA 3LZQA 5ERWA 3ZPDA 1YEHL 1X9UA 5AG8A 5KW9H 4NQDD 2ADIA 1KB5A 3HC4H 5EPMB 2HVJB 4IMLB 4N20A 4DVBB 4OGZA 5DJ2B 4PFEA 3KL5A 2IADA 1BPVA 4JO4H 3M6DA 3SYQA 4GS7B 4AE1A 4Z3EA 2OI9B 1JXFA 3D4GA 2NUPA 4KVPA 3ZY7A 4FEMA 4NQUA 1BZ7A 2X4UA 2EIBA 4XMPH 1TENA 3QIBB 2EVFA 3LRMA 4TUJB 3OKLA 1UEMA 4P4KD 4UCFA 1CD9B 4QXGL 4FMVA 3VFUB 2DQJH 2F15A 2WVSA 1D7BA 4JFUA 1O6VA 2ZICA 2CDGA 2YLHA 5T5FA 5KVFH 2AHIA 5DHVH 1T7ZA 4BFKA 3QDME 1F45A 3D3VB 3LNDA 2QBWA 2A77L 5DO2C 1EXUA 2MEJB 4HG4K 3VGHA 5AOMA 4HUWA 2W94A 4NZ8A 5IG7A 1Z66A 4H25A 4E9SA 1G1YA 5CP7B 3CSTA 1YDPB 5IFAH 2XZQL 2QJDA 1ZPUA 2FX8L 1VACB 2GTWA 4EDWH 1FI8C 2J1XA 2WYZA 5D7IE 2HWZL 2AEPL 2R59A 1WTGT 5J13C 1FYTB 2GIXA 3L3IB 3HPLB 4S1SL 2CNZA 4OIAA 4K3DL 4R90L 4BWUA 3ULVC 3SDXB 3DVFA 2HFFB 5CJQL 4MTMA 4O51B 4ENED 3WEOA 3BD4A 1YVLA 1D6VL 3EZ8A 4AJYV 3V0VA 2Y1ZA 4GRLA 4H13C 5FM8A 4NP4H 1RVFL 2NY1D 2VABB 3V0DA 4O02L 3GBDA 3KPTA 3BFOA 2XZCH 3HB3C 3LCYA 4POUB 4JY5H 2NXYB 1S6NA 1T6WA 2H3NB 3J27A 3BN9C 2IAMB 4R8WL 2EUXA 3VFOB 3NK4A 4ZXBC 1HAUA 5IMOA 4YX2H 4HS3A 1DFBL 1A7OH 5EFIA 3NZHH 3ZKXB 1QNIA 2L7QA 5E6IB 3IVKA 4UT6L 5DHYB 3GSWA 3MLVL 5SWSA 5T1LB 2B39A 3ARBA 5BV7L 4QKXB 1N4XH 3ZL1A 5IF0A 1H3PL 2OL3H 4URTB 2J12B 1QI3A 2EICA 2NY2D 4IRSA 1GJUA 5EF1A 4UBDD 4FL4C 3EBHA 3VFTB 3U0TB 1TTUA 5I8OL 4U3XA 4F91B 1EGJA 1Z9MA 3V0WL 1ZCRA 4RZKA 3L3HA 3OJVC 2UY6B 3IMVA 2R0WL 1NBYB 3OAYH 5D1QC 1MCBA 4ZRGA 1NFKA 5C07B 3UJIL 2CR0A 3QR1A 1GIGH 5GRVK 3LN5A 4ZW5A 3M1OA 4L8BA 1IL1A 1XIWC 5LWYL 1NFIB 2OYKA 1LJMA 2AJ3B 1UXLA 4IKLA 1B3IA 1YQVL 2J8UA 3RWHA 4JQIH 2LE9A 2DLGA 3CDGB 4CSZA 1ZHBB 4HSCX 3GSXB 3D25B 4JFFB 3T0EB 4TVUA 3N41F 5DJAA 2ENYA 2BO0A 1KGWA 2I32A 1ADQL 3PPEA 1YN6B 4CVZA 5FM4A 2PABA 4Y4HD 3MR9A 3DHMA 2Q7YA 2FBRA 3A4DA 1Z0MA 3OKYA 1GGUA 5EOQH 3WNLA 4M00A 1PLGL 3CVHL 2NDFA 3C8KB 3DOSB 3QDGB 4KI5E 1IKNA 3TTSA 5K5YA 3BRGC 4JPIB 5J1SC 4PRIB 2OXHA 2C1PB 4IRZA 5EDXA 1EMTL 1FDLL 5BXFA 3LIZL 2KQNA 4OGYL 4HZ1A 4K4KA 1A7QH 2Q8AL 5IB4B 2I24N 3Q48A 3IMBA 2ATPA 4HPOL 4L4VE 1YNLH 5JR1H 4EBQH 1CDUA 3CLEH 1TQBC 5I0DA 3KPPB 5EEVA 1CFQA 2HRLA 2N0KA 3CPLB 5C09E 4XH2B 4N4YB 3CQFA 4CC4A 3BDYL 2BP8A 5C3LD 3OG4B 2GY5A 1WZKA 1DUZA 2FYYB 1A6PA 4PHXA 1D5IH 3JWDH 3QEGL 2PWDA 4HP5A 4LGRB 1SOQA 2X0WA 3BLPX 5F7MC 4OZHA 4HV8B 1BVLA 3NCXA 3O4OC 5FGRA 1GAFH 4F7EA 1HHKB 2I7OA 4XN2A 4R2GD 1EVUA 4PSPA 1YJDC 1ACZA 1AGFA 2F68X 3G9VA 5BS0B 3RVWC 4M7LH 4ES9A 4PR5A 1A7NH 5AVUB 4DN4L 1AS6A 4WI8A 1YLBB 4PCKA 3EH2A 4J4PD 3GMPB 4N8VB 4E42B 5BQ7A 2YBRB 5KTEH 2K70A 3WY3A 5IB3B 1IM9A 5FYLD 3M86A 4XT1C 1L9NA 5GSVA 4P46C 4ESKA 2A6JA 4HH9A 2R2CA 5AWNH 1J1XL 1SMOA 1FL6B 1EO5A 4AL8L 4UQ2B 1A6ZB 4E9VA 1KJMA 1JP5A 1UUSA 1PG7X 1F58H 2B3RA 2MIZA 5F44A 3RZCC 2PCPB 4XB7A 1RK0B 1NAML 2WCPA 3E6HA 1GSMA 2JTDA 4PG2A 3TVMC 4DGUA 3IKKA 3PF2A 3VD1A 1KB3A 4UV4H 1MF2L 4WW1B 2ILLA 3L3GA 2OXGB 5FYJL 4NO5B 2YC1A 3NTCL 3HPJB 3RX5A 2WN2A 2DEYX 3O9WB 1E9PB 2G30A 4HF5H 1BD2A 4L1LA 5JLZB 2FUTA 2RTTA 4GXVH 4YHLH 1ZWIA 2QTEA 3IK2A 4OLWH 5KVEL 1JZJA 1NPNA 3AU1B 1W72H 3AUWB 5B3JE 1PEZA 1UCTA 4TM9A 3UTSE 1BQRA 5C08E 2R69A 3REVA 4DTGH 3CXHJ 2VSKB 3NK3A 4JB9H 1USZA 5FLUA 1KLUB 4TSBH 3HN8A 4ZTOH 3X12A 5AW8B 2NSXA 2ZNWA 4BQBA 1OTSD 3IDJA 3VFMB 3FUFA 3FAXA 3QUYB 4K94H 1NH6A 1UWYA 2Z34A 1MIML 1N0LB 2EO9A 3AREB 5DD5L 4E9WA 4F8OA 4B9YA 1T0NB 4IRJB 1MJUH 4PS7A 3VQ2C 3DV4A 5FO9B 1RK7A 3QSKB 4FJZA 1T03H 2C9AA 3TCTA 5F7YC 2QPSA 4NWTH 3HRZC 1XF5A 4LCWB 2W88A 3AB0B 2ZYSA 4ZUSA 5CSZA 2C3GA 2OKMA 5EZPA 2YK1H 4JFED 1Q9LA 3AJ7A 3CFKA 2VLRB 4NQEE 4AEHL 5A2CA 1T22A 3JWNC 3ZHDA 4LLUB 3PAYA 1HXKA 2YOAA 3CZUB 4G7VL 1RULL 2CXKA 3EBGA 3Q3GB 4OZFA 5B8CA 2NR6C 4BM7A 4LPXA 4QOKB 4MWFA 4P3CH 1JGUH 2FJSA 3APCA 3MRCA 5GQBA 1P2CB 3BE1L 1KBGL 4CRPA 4WHTA 3QQ3A 1YEJL 2OX5A 2VZSA 3GLEA 4JUTA 2DICA 3DRQB 5E8OB 4CSTA 4WEBH 4NRZA 3L3KA 3J7HA 4AGQA 4B27A 4L8CA 4X9FA 3PNWB 1XCQB 3E0GA 5ITFA 3U36A 1BLNA 1FH5H 4YHPB 1CF8L 3QUXA 3LMJL 2LTQC 4LSTL 3B2VH 3JTBA 4MCZB 5CU5A 3VNYA 4XMLH 3C5SA 3IFNH 1OGTA 1Q1PA 1UOVA 4LSVH 2QT6A 1S9VB 5BOZG 1MH5A 2DQCH 5HI5D 1T83A 1IBYA 1A6UL 5AL0A 2A9AA 1N6QH 2R7EB 1LP9B 4X9IA 3KLAB 3ZGIA 5F3FA 3A67L 4OZGA 4PREB 3T1FA 2ZD0A 4LOFA 2JCCA 2J2ZA 1MJ8L 5KSAA 1E4XI 2AXWA 1DVFD 1CYGA 1MRDH 4JFDA 1UATA 1WBZB 5F7DB 3SQOL 2GJZA 4YWGH 2W0PA 1KCUL 3EH3B 4M43H 3DURB 1I9JL 3L3JB 1N64H 4WUUE 4XB3A 1BM3H 3QAZB 4S2SB 3K1KC 4YFEA 4HXBH 3ESMA 3U82B 1AQMA 4ZTPH 1MWAL 4Y4FD 1I1FB 3APNA 3U6RA 3B1TA 4V2BA 4HKXB 1NBZA 4R3SB 2A7BA 3U4BL 3GKZA 4HIXL 4JGMA 5KYXB 5LAXB 5BPPA 3T3MF 3ZTCC 4UT9H 4WSGA 4H2CA 4OIIH 4X6DA 5D6CB 5DFVD 2WLIA 5AW7B 4E41E 5BO0D 1BFVH 1YC7A 5D5MB 1I7RA 3GIZH 4JL1A 1IUZA 2H26A 4YXKH 3WY4A 5F1OB 4UILL 2W38A 1J12A 1SJEB 1QFUH 2X7LA 1MHCA 4LLWA 3OKDA 5SWZE 3AQXA 3CFJB 5EU4A 1NFDF 3VVVA 2BIMA 1WFNA 4XPGL 4DT2A 3TM6A 1J1OH 3WGUB 4PJAB 1PJWA 2YA0A 2Y4SA 3M88A 5F9AC 5DJCA 3RWFB 4G8IB 4I1NB 2JJWA 4UU9B 4PAZA 3CZNA 1XH3A 3QQXA 2QHRL 2VR5A 2EVJA 5CEZE 3FK3A 3BAEH 4GB9A 5KAQF 1J05A 4A7SA 2XQYK 3QZNA 4DEUA 3BUTA 3ECBA 4XPFL 4MAYA 4N0FB 4B53A 1FBIL 4NOFA 3ZDYF 4C4UA 1I8KB 5H35B 1HHIB 1GW0A 1E2ZA 4W4OA 1ZIBA 1I8MB 4ZUTB 1U8HB 2ENJA 1JNNH 5ACZA 3ATBA 3MGAA 4XMZA 1U8QA 4JN1L 2JV6A 4FEIA 2B1OA 1VB9A 1QFWL 5I28A 1R3JA 5IM7A 4Q58C 3MRRB 5TE4L 3TT1L 3KH3A 1QHPA 2W9DH 4NSKB 5DUPL 3X1BA 3ULAB 2XWBB 3DETC 3ZT5A 1DVXA 2AK1H 4K5PA 3WEXA 5JO5A 4KXDA 5DJZA 3EJSA 1TDQA 1JGLH 4X4XB 1NCUA 3GSUB 3X1NA 1W0VB 2MCPL 1OP5K 3RDTA 1I9RH 4AIZB 2VQ4A 5CNHA 5AKVA 3GI8L 2FX7L 4FYQA 5I71C 2QVIA 1ZTXL 4DO4A 1R5IA 5IMKA 2K1MA 2VQ1A 3IXTB 4H0IA 2P5ED 3NCCB 5F96L 4Z7QB 4IOFD 4JGJA 1AIFB 4UZGA 5E00A 1IZKA 1LGVA 2ZSWB 3N1FC 4UZSA 5BZWA 3GSVB 2Y72A 5AALA 1LE5B 3AS2A 1KPRB 3RGVD 4E9RA 1Z9OA 3OGCB 3NZ8B 4LEXL 1X44A 1CLOH 1HEZB 1S7XA 4W68A 2X4PB 3QUHA 2BSSA 1BCIA 1VKXB 4P5TD 3IYLW 3LKSB 1DLFH 1JHKH 3P4LA 3HCVB 1SLVA 4O9HH 4OF3A 1FFOB 4Q6IC 1KIQA 3IGKA 3UAJD 4R7DB 4FQCL 1BEYL 3NA4A 2ICWJ 1MIEL 3HC0B 5HHOE 4OCWL 4KOBA 4QGYA 4RIRA 3WN6A 3PJNA 3ARGC 5E1AA 4KK8D 1W9XA 1NGWB 2EEXA 4IGBD 5GGUA 2Y7OA 1E4JA 2NY4B 2F8VA 4WHDA 3PWPE 5KBDA 1SDAB 2KZ1B 2VAJA 2A83B 2W95A 4OY9A 1IFGA 4F8LA 3SCMC 5IJKA 4MAUH 3L7FB 3FCBA 3V6FB 1X5ZA 4U1GC 5F7UA 2AP2A 1ZDSA 1IBGL 1LO3H 1XQ4A 3MOBL 4F7MB 3SJVA 5ERWB 4HCFA 1GYCA 1OP3K 4Z0BL 2YA1A 1QSED 1CC3A 2ADIB 1KB5B 2C3HA 3ETTA 3V4UH 5B7FA 2ICWA 3D5OF 5ITBL 5JPMA 1Z5HA 5IJCC 4BZ2A 3A6OA 3NPZB 4ICXA 3SBRA 1T0MA 4FP8L 1BZDA 3KZ8A 3E2HC 1HIML 2G60H 2XN2A 2VLLA 3WO4C 3GIVA 4OD2A 5CJXC 3RIFK 2NUPB 2WXMA 2Y7NA 3KBPA 1E7VA 1BZ7B 2X4UB 2DWEA 4G7YH 2MPAL 4Z5RA 3VM7A 3MRIA 2G5BA 3OKLB 4KZ0A 1P53A 1SM3H 2ZIDA 3AUVA 4Q52A 1CCZA 1R1CA 2NZ9C 1ORQA 1INEH 3RKPA 3BVXA 2CDGB 2UX6A 4JQXC 4WIQA 4M1GH 4NN6B 1EXUB 1JZ4A 4A37A 4HUWB 5DJ8A 4NHCL 5KVFE 3H53A 5E24E 5IG7B 3MBEA 3K46A 4LLDA 3IRZA 4MNGE 5GRUL 4DW2H 1JHLH 2DQGH 5CCGE 4L0YA 4ISVA 1HWWA 2GTWB 1IC4H 1NDGA 3KCWA 2EQDA 2FVNA 5FYLH 4HD9A 2YKLL 4ZUVB 1UH2A 2OPCA 3FUJA 3MX0A 2VR6A 3FCUB 3QS2A 1MKFA 3O81A 4UQDA 3H9YA 1TYJA 5DVMA 3ESOA 3UZVA 4H40A 5B4MD 1DBBH 4JNXA 3KLHD 2WBJD 3DRTB 4LL1A 1TTRA 5I9QB 1X9LA 3V0VB 1SBSH 4GRLB 4YVUA 3HJEA 1V3MA 3U4AA 4UQIM 2FIRT 1QWUA 1E4XH 3TH3T 1IE5A 3SDAD 4XMXA 3W5NA 1AH1A 3BKCH 4K55A 1MEXH 5A7BA 3ARDC 5F1NA 3ZTNH 1RU9H 2ZTBA 4R83A 3H6JA 4HD5A 4NN5B 1A1MA 4PTUA 2H1PH 4X7FC 4CBPA 4N22A 1CI3M 2ZUXA 5IMOB 4HS3B 5EFIB 2HMID 4JFZL 5A40E 3IVKB 3QDHA 1KBKA 1XEDA 4Q74A 4PJ5A 3GSWB 4UM9D 1JL8A 2E27H 3DK2A 4NQEA 2EYSA 3Q8AA 4LF3A 3QEQE 5SWSB 3ARBB 2QELA 3PP3K 5IMMB 3NT0A 4Z3FA 2E0PA 1HHHA 4GIAA 4XCEA 1ZLDA 4HAKA 1U95A 4IRSB 4FZEH 2CDFA 1B6UA 5G4NA 3P0GB 2R29H 1SF3A 2BY2A 2VWEC 4HWUA 1CXIA 1UD4A 4S0SD 3VTAA 2BERA 4S1QL 1NL0H 3L3HB 4Y5XC 3FFCE 4JG9A 5BRPA 4FFTA 1OM3H 1WFUA 3K71A 1TQUA 3JTSA 5FX3A 4O4YH 4DJMA 4ETQA 3DJTA 3FUNA 2G2NA 4DPAX 3LN5B 5C8JA 3Q13A 4LSDA 4L8BB 1IL1B 5H4ZA 2ZXAA 5KYWA 1JZDC 2J8UB 3RWHB 3T0AA 3NJMA 3RAJL 5IESL 2WYTA 4NQTA 1JMXA 2FX9L 3CFUA 3OPZH 4NIYE 3VAEA 1WCBA 3TYGL 5DJAB 4BFNA 4CVZB 5D7LE 2C5DC 2TRYA 5E70A 1EDQA 4PCYA 2XXMB 35C8H 3MR9B 3W81A 3WEMA 3RWCA 2Q7YB 1KCRL 4BE5A 1WFIA 1EERB 4ZXBA 2AJYL 1Y6KR 3C60C 5FA3A 5AZUA 4GUPA 1O9WA 2OXHB 5BXFB 1DBKH 2RALA 2OZ4H 1J1PH 1TTAA 1ZVNA 4JREB 4I9XA 2B1AH 1ID5I 1ILSA 1JCKA 1N9PA 3N91A 5IJBC 5L8LB 2ATPB 2UWEE 3HFFA 5DZAA 3TFKC 5JDJA 2QADC 4DP6X 3ZE0B 4ZS6C 1CFQB 2BVPA 2O5YH 3K2IA 5KEZA 4L4TE 4ODTL 1PSKH 2BP8B 4NM8L 3VFSA 4ANXA 2XV2A 1DUZB 4CKQA 4NKDA 1MFMA 3I9AA 3DARA 2WCGA 2I5YL 1ES0A 3MJWA 1BVLB 1RIHH 5D1QA 5I1KL 4F7EB 3HZMB 1IT9H 1THCA 5C7XL 1T89C 1QWHA 4ZPTA 2TSAA 4LMQE 1AGFB 4N6QA 2KQMA 2DD8L 5JHDD 1XIWA 5FYJD 3I02A 5GGRA 1Z9NA 3P1VA 4FFYL 5J1TC 1ZA6A 2EIZA 2WXKA 3IMTA 4PR5B 3WDJA 2JKRM 2EECA 2RJMA 2OR9L 3KH4A 2JQAA 5CLZA 3RTQD 5EF0A 5BQ7B 4J8RA 5JHMA 4HWZA 3VWJD 1T4KA 4JKKA 1IM9B 5DYFA 4ZS7L 3DGDA 5GSVB 1JZEA 5FHAL 2A6JB 4HH9B 1PY4A 3N42F 1ETZA 1UJ3C 3GTNA 5E2TL 1RZJH 3JV0A 1KJMB 4FFWC 5F7LB 3QWOA 2PUQT 4L5FH 2WO2B 4I13B 4ZDHA 2JE8A 4JPVH 1J8HE 3E6HB 2XCMC 4TUKH 4GUCA 3E9UA 3CBJB 1KEML 3ZDWA 2E9WA 1HU8A 4EN3C 2GBTA 2GT9A 3L3GB 2YC1B 4YMPA 1G9MH 3CHPA 3U1PA 3K2MC 1NCWH 6PCYA 1BD2B 5AVSB 1G5AA 4U6XA 2YXMA 3P2DA 1ZWIB 5JOFA 2G4GA 4N2GA 5CJ5A 2QQNH 2F6AA 3GFUA 4QXTB 3GUFA 4UTCA 4ANUA 4G5ZL 4GG8A 3B7SA 3ZTEA 3T3ME 2SODB 4DHLA 3REVB 2P44B 4FYSA 1FG9C 3KWTA 5F6HJ 3JUYA 5J1AA 3X12B 4Y9FA 3IDNA 2YSSA 2P8PA 4FG6C 4R4FH 2DYRB 1HJCA 5FA4A 4Y4HC 4L3EE 1NFDE 1E65A 1UENA 3WHXA 2HJKA 4NT6A 4JY6A 5L7XL 3TA3C 3QUZD 1T3FA 3BVVA 3DV4B 5F89A 2JJSC 5K9JL 1AO7D 2OW7A 4G43A 5E9NA 3MUJA 1XF5B 1KIUA 2JLLA 5AW5B 3B2XA 3LB6C 3ET9F 3RFZC 2EUZA 4JG5A 3GEFA 3OF6A 4ZUSB 2QFRA 4KITB 5FO8B 1EA9C 3KEDA 3GXUB 5CSZB 2LU7A 1EO8H 4P46A 2F58L 2N0MA 3CFKB 1OAKL 3QYMA 1T22B 4A68A 2AITA 3E7JA 3GMLA 1BDYA 1GR7A 3KPRE 4AI7A 2VXQL 2YD4A 3T0DA 3LRLA 5FO7A 3RZCA 3GO1L 2GITA 4OZFB 5B8CB 1GOGA 4HSAC 4XCCH 4DIXA 1Y07A 4JO1L 4MWFB 4OJDH 3TVMA 3Q01A 3UJTH 4AQEA 5LQBH 2NCEA 1XH0A 3HG3A 1YYLL 3BO8A 1R3IH 4WHTB 1OT1A 2OX5B 3L4TA 1RH8A 2V9QA 4R2GC 5F6IB 3NBNA 1I31A 2B4CC 4M5YH 2OYPA 4NRZB 2QPFA 2DN7A 3L3KB 5JA8B 1CGUA 2W0FA 3LRGA 3QYNA 4L8CB 4GSQA 1F5WA 2AGJL 3ABGA 3IJYA 4NQSA 1MW3A 2YIHA 2FATH 4JFPA 5ITFB 3RIAK 3U36B 3KMDA 5JDSA 1YEHH 1VFAA 1BLNB 2YAMA 4I3SH 3QUXB 5DMGD 2WP3O 3K4AA 1UWXK 1N6VA 1MFUA 1VGEL 3C5SB 1G9NL 2VSCA 1OGTB 4MA3A 1PZ2A 3N50A 1MH5B 3IJ9A 1MFBL 3BYYA 2QZ5A 1JNJA 2YPVA 2P46B 2DLEA 4QTHA 1I53A 2Y7SA 4WDIA 5ANME 5HHNA 3EH1A 5F7KC 3RJDA 5I24A 2EDWA 1LE9A 4WW2C 3FU7A 3DXAD 3W56A 8PAZA 3NJHA 3ECQA 4OZGB 3T1FB 3QORC 4K8RL 4QXGH 3CFMA 2BXZA 2JCCB 1OV8A 2J2ZB 5KSAB 3HRZA 2CO2A 1CMOA 1IM3D 2ITCA 1JGDA 4JFDB 2Y06L 3QIWC 5CWSA 4H8WC 2IWKA 2A77H 5F3BA 3KR3L 4LLVA 3ROOA 4KTEH 2IJ0C 4QJ3B 4XXWC 1ZT1A 3K91A 3BC9A 5DXWA 2NR6A 3BWUF 3QDMB 1UM6L 1F4AA 4NQDE 3FPXA 4ABQA 5B38G 4JPSA 2FX8H 4D7PA 4WY7L 3BW9A 5FCUL 2HWZH 2AEPH 3U6RB 4MMZC 3RGBA 1RFDL 1UA3A 1NBZB 2WK2A 3EYFB 3C75A 1OTSC 2DMKA 2NTSP 3ILEA 3GBML 2EACA 3LH9A 3OTTA 1EJ6A 4S1SH 4R90H 4X6DB 1QLEB 1WK0A 2WLIB 3D05A 3D2TA 4P3WA 5CJQH 3D9AL 1I7RB 2H26B 4WTZG 3IJSA 1D6VH 4P5KA 4UDTA 2I25N 4B9PA 5DMYA 2X7LB 3V0GA 1MHCB 3Q8BA 3JV5A 2VSMB 2V5SA 3OKDB 4G8GD 4LLWB 5GRJL 5EU4B 1M42A 4A2GA 2YXFA 3GS7A 1AR1D 2D9CA 1CICC 1NBVL 1RVFH 2ZX7A 4DO6A 3MJ8A 5F72S 3ZDZB 5FS5A 4O02H 4JVPA 1NKRA 5DJCB 4FQQA 1ZDQA 4UINH 4OF6A 2CUAA 2YAHA 1XH3B 2CHXA 3GNML 3IJEA 3O8XD 4PJXA 4R8WH 5EN2A 4DWHA 1J05B 2GC4C 3RWDA 1DFBH 4YDMA 3VYOA 1JPTL 3D12B 3ECBB 5GGTA 1YQ2A 4MAYB 4LP5A 1EXGA 3PPSA 4UT6H 1OWWA 1KENL 1N5AA 5I73C 3TZVD 5BV7H 3FBQA 4PJEF 5IIEA 2EVIA 3PABA 6PAZA 3GSOA 4UF7C 1H3PH 4EZLA 3LTVA 2EADA 3GXPA 4FI7A 1USQA 1B88A 4ODXA 3VMOA 3FL7A 2AMGA 4GKOA 5KOMC 4IEFB 5LCVA 1OTTC 5ACZB 1U8QB 1FFRA 3TV8A 25C8L 2EDLA 5I8OH 1QTYT 3V0WH 5IM7B 5C0AA 4KKLD 3EYUH 3S3DB 1A14L 3A4EA 9CGTA 5DSCA 2COVD 5A43C 3IGLA 5DWUL 5JW4N 4JHWL 3ORJA 3UJIH 2O26U 1YEFH 5F9OL 5JO5B 3WEXB 3HRPA 1C5DA 2V2WA 5LWYH 4H1LA 2DQDL 3Q8EA 2R83A 4HIHA 3RL2B 3WNNA 1SFDA 1YQVH 4A7GF 1C5BL 2CJTA 3RDTB 3DJZA 1G9HA 3QW9A 5F71A 4PJCF 3MLXL 1PLBA 2R51A 1R5IB 5H37G 1IEAA 2JKIS 5IMKB 2VQ1B 4F24A 3F05A 1ADQH 3QT2A 1YHPA 3TBBA 5GZND 5E00B 3FRPG 4XNUH 4R7NA 3SOBL 1F86A 3QBTB 4U05A 5BZWB 5L0QB 4L1BA 4PJIF 2TRHA 3TIEA 2X0UA 2FCBA 2YRBA 4TSAH 1PLGH 3CVHH 1AG6A 1I1AD 4NPJA 2E75C 4AITA 1S9YA 1S7XB 1EMTH 1FDLH 2D9QB 2BSSB 1PL3A 3LIZH 4KJPC 5I18H 4LE8A 2YHGA 3RVXD 2Q8AH 3LPPA 4TQEL 4TOYL 1A3QA 1KIQB 4EVNA 3CC5A 4KJYA 3MV7D 4M6OL 1QBML 4DGYL 4RIRB 5SWQA 5E1AB 4FJ6A 2Y6SD 1RXLA 2UWEA 4L4VB 1K3IA 3FPYA 1QFWI 3QEGH 3ESNA 5DQ9A 1RQ5A 2XQYG 1FQ9C 4GXUM 4Q2ZA 2GJ6D 4OF7A 3W9EA 4WJ5A 4J3TA 4EOWL 5I82A 1S5HA 1OGPA 1BQLL 1PAZA 4FQLL 2FT6A 3ALXA 3EOTH 2AJUL 4UNTA 2F54A 2QQLL 1CVRA 4KK9D 3SJVB 2WWNA 5IOPA 4DPCX 4XODA 5DJDA 4DP0X 3VE0B 5DURB 2ICWB 5JPMB 4MJ6A 3F2LA 5CCJA 4AENA 1BHGA 2CK2A 1AP2A 1T0MB 3F7LA 4FQ2H 4DN4H 2VLLB 2PMZA 3GIVB 4OD2B 3WIHA 3ARWA 3BFQG 3WKNA 2WW8A 1LK3L 3LKPA 2G5RA 2DWEB 4Z5RB 3OKOA 3IFPA 5B39A 5IEKA 2X70B 4N2OA 3MRIB 1BBDL 2G5BB 4M8QA 3ZHKA 1KGUA 5E99L 4QLWA 1J1XH 1HSBA 4ABUA 1EJ8A 1BFTA 2SEBA 1HH6A 1NCHA 4AL8H 3FOMA 1CT8A 1ORQB 4LKCA 1TR7A 1TTGA 1RZQA 2IH3A 3AXHA 4I9WD 5HGDA 2EDNA 2WNWA 1EZVX 3UTOA 1DJWA 2WTPA 4U6VL 2OA9A 3RX9A 5DUJA 4YHNA 4Q6IA 1MF2H 4IOIA 1ML0A 2CD0A 4X42A 3NTCH 5DJ8B 3DHPA 3KWVA 3MBEB 3FB8A 4LLDB 2HG0A 4MZRA 2F8IA 5I8CA 5KVEH 3ARGA 5CCKL 4ISVB 2NOYA 3AXLA 3U4EA 2KDGA 2Z7UA 2EYTA 4WU5A 1NDGB 4IW4C 5I1AA 4YBLB 2ZYIA 5PCYA 4KRPD 2DY2A 3SCMA 3W0WA 1X9QA 4G9DA 1GMEA 3MX0B 1TCRA 4YAQB 1VIWA 3HAEH 1ZGLM 4IDJL 5LB1A 2OMYA 5I5JA 5FYLE 4JO3H 2YARA 1MIMH 4ONFL 5DD5H 5L2KA 5I6LA 3QJHB 2OK0L 1LK2A 2OV0A 1GS7A 1HKFA 4ADJA 3B37A 4LPVA 1VA9A 3AT0A 1LEIA 3OZ9H 1PZDA 4JZJC 1OZTG 3P3SA 5CJXA 2DYPD 5F1NB 5T8IA 3MV9E 2AJSL 3UAJC 2J6EL 4U4BA 4WNQA 3TEUA 3FQNA 2NYKA 4AEHH 1A1MB 4PTUB 1DBAH 3J2PA 3GQFA 4N9OB 3F7QA 1AXTL 2EKSA 1U8JB 4G7VH 1NLDL 2NXZC 2P9RA 3PHSA 4IGBC 4XR8C 3ZX1A 4ANVA 2GEEA 2NY5L 4JQXA 4OIFA 3W1ZA 4Y5VC 1ACCA 4NQEB 1YEEL 2EYSB 2X2UA 4LF3B 3BE1H 1F3JA 3FAWA 5BZDA 3DOHA 4YLCA 4PLJD 1V27A 3ETSA 1HHHB 4XCEB 5JHAA 5DRWA 4K73A 1U95B 4RA0C 1F4WL 3VI4A 1QX1A 1YMMA 2IDCA 5E8PA 3LVTA 3T4AC 4BUHA 1QZ1A 3ELAT 1IGCL 1PCXA 3ABKB 3I75B 3NCWA 1AKJD 3IS0X 3KNBA 1CF8H 3QG7L 4U3HA 3BVTA 3VU1A 4HWEL 4GMTL 4LSTH 1WCQA 2QV4A 5J13B 1J88A 3K71B 3JTSB 2OCFD 2WQWA 3P9MA 4ETQB 4ZSOA 3DYPA 4XNMB 5C8JB 1K8DB 4J6RL 4JFEE 1JUFB 4HU8A 2WJ5A 4FKEA 5D55A 1F1DA 4GRMA 5KAQG 1SEQL 1A6UH 4PBXA 4RESB 2WZPA 3FN0L 4POZC 3ATEA 4YDKL 5KYWB 3S88H 4WK4B 3A67H 3HBGA 4FTVA 2AK4D 3FULA 3LN4A 3BD5A 1MJ8H 5AVWB 1WCBB 2D7TL 4ZOAA 2A1WL 1FFNA 4G9FA 1QNZL 2CA4A 5FV1L 3IN0A 3ARDA 5FLVA 4N3UA 3ARSA 2ESVD 3CBKB 3HB3B 3OZLA 2WZAA 3G5ZA 1CYXA 3SQOH 2IH9A 2CDEA 3HC3L 3RWCB 2X6VA 1XSJA 4KHXH 1KCUH 3O41A 2AXHA 1I9JH 3EYQD 4ZXBB 3ZXAC 5FA3B 4G7RB 3STZB 2VXVL 4GUPB 4AUUA 4FMFA 4AYID 5CD5C 2X3CA 3RWEA 4Y9EA 1MVUA 1HQ4A 2HLAA 1MWAH 3LZFL 3VWKD 4GI9A 2DZEA 1SXZA 2Y24A 3C6EA 1GPOH 2ZCLL 5E9DA 1O7DE 3U4BH 5B4MC 3GJFK 2BVPB 2HRGA 4HIXH 3UG3A 1J0IA 3KLHC 3B9EA 3IPBA 4FL4B 3VFSB 4PD4J 1HH9A 1K8IA 4LNRA 4NKDB 1K6QL 3G6AA 4Y5XA 2CR3A 4UILH 1CPUA 3KYAA 1ES0B 3FB7A 4K3GA 1KN4H 2ZAHA 5D1QB 2WVVA 2XVLA 4QXWA 1P7HL 4E41B 3FO2A 1XTLA 3GRWL 2QL1A 4ZPTB 4U7SA 1JF5A 3KM1A 1KN2H 1XIWB 3I02B 4OZIA 5I15L 2DDQL 2K6ZA 4W1TA 5D7EA 5GGRB 5C86A 1CYWA 1ZA6B 5DQDH 2QHRH 2HMIC 3TO2A 2UY7A 4GP8B 1O75A 2H47C 4KKZA 4PH8A 7PAZA 1Q8MA 4J8RB 1MG3C 4HWZB 4RSYA 1FBIH 1T4KB 3LJ3A 1ZHLA 5T5NF 3QJTB 4B6ZA 1DYZA 1ETZB 4CJ0A 3C60A 1WWAX 4Q7DA 1NCBL 4V33A 3QWOB 5JHLL 1YECL 1R3KB 4AVHA 4ZDHB 2ZUQC 3F58L 3MGOA 3CFBA 1MXDA 4JN1H 1NUDA 2QFPA 1QFWH 5DRXA 4L5FE 2GBAA 2CHDA 2VDLB 5TE4H 1TQBB 2DWDA 3A21A 2W92A 5DUPH 2Z91A 3OVUB 2W5PA 2CM5A 1RV6X 5DS2A 1UASA 3QPXH 2J73A 3AWFA 2NYYD 3SD5A 4M7KL 3VU2A 4PYHA 4PLNC 4KKAC 3W3BA 1TFPA 3KPSA 1JF1A 5GGRY 2H9GA 4LOUD 4I85A 2MCPH 3O4OB 5J1AB 2EABA 3GI8H 2FX7H 1T89A 1ZTXH 2YSSB 5D1ZC 2P8PB 1E8YA 3N5AA 3H42L 1YPZA 5F1IA 4WU7A 5FA4B 2DBLL 5F96H 3QIBD 2HJKB 2X41A 4FFZA 4NT6B 2GUYA 1A64A 1F18A 3PU7A 4JY6B 4Y9GA 4X6BA 4YSOA 1NMCC 1T3FB 1R46A 2PR4L 1CTOA 5F89B 2HYMA 2BIQA 4RMQA 5F2FA 5ICUA 2QR0A 2OR8A 4G43B 3RPBA 3EFOA 2GSGA 5DUML 1GKOA 1DJSA 2LVCA 4ZMQA 2XVKA 1KIUB 4LEXH 2Y9RT 2FH8A 1X7QA 3D3VD 3QPKA 2PTTA 1LO2L 1NMBL 4WWNA 4P46B 4JM2C 1U42A 3DHJA 1KB5L 1LMIA 1Q9OA 4S10A 4N0CD 1UJ3A 1I1RA 1V05A 5ADOL 1U6AH 4FQCH 3O2VH 1BEYH 3HLKA 4HIJA 5I1GH 4PJEE 4Z78A 4OCWH 5FO7B 3RZCB 2GITB 1FV1A 5BUGA 4LOVA 1WE5A 1HQRA 1QMUA 4QCIA 3TVMB 4AQEB 2EE2A 5CSBA 3FSZA 4LDEB 1ORSA 4EN3A 2HFEA 4X4MA 5IR1A 5J6GA 3BO8B 4K8RD 3BVNA 1JGVL 1FYTD 5BJTA 3QJRB 3VQ1C 4PJ8C 1J9TA 1D7CA 4PJDA 2EDOA 4OLEA 2BC4A 4NQSB 1IBGH 3MOBH 2A3TA 4JFPB 1LD9B 1YAIA 5T5FL 5AD0A 5JDSB 5F0LB 4Z0BH 1VFAB 3NACL 1DTUA 5ITBH 3ILQD 3U30C 3EBAA 1ZVYA 4KMLB 4HUNB 1MCPL 2FEDD 4FP8H 2XI9A 4MA3B 5IZ7A 1HIMH 1A4AA 1UXWA 2ZX6A 4YL9A 2JIXD 3S8FB 1P84K 2DMGA 4Y4HA 3BVWA 1L6PA 2GAZA 4PJCE 1X5JA 1MPAL 1MRCL 4QTHB 4WDIB 3LRSA 4U0RC 2ZE0A 2MPAH 2IAMD 3TA3A 1LE9B 1SVZA 3FU7B 3GKWL 2JJSA 3P77A 3HNSL 7PCYA 2VR8A 5I1EH 4FZ8L 3HRZB 4MDJA 1TUPA 4PJIE 2E9JA 3RFZA 5I76A 2ZSVA 1JGDB 5CWSB 2AJXL 4OLXL 4LIQL 5F3BB 4OQ1A 4LLVB 1EHAA 3ROOB 4NHCH 4RAUA 1RSYA 1KF9B 2BSCA 3HBZA 1ZT1B 2VL5A 1F41A 2XBZA 5GRUH 4A2MA 1YY9C 4PJFF 1QSEE 1IJ9A 4P2OC 1KCWA 3PY9A 5J5EA 5EEUA 3BW9B 3IDXH 1AS8A 2BFVL 3S48A 1TIUA 4PWKA 4XPTL 2E7LC 1ZAGA 5G5DA 2YD1A 2YKLH 3BESR 5DZPA 4BUQA 5IK3A 3OR6A 5ABAA 4PBVC 5DVOA 3US1A 1TYRA 3MXWL 3UTTD 5IQ9A 5DJ6A 2BSED 3IJSB 1TITA 4JRYD 2LTQB 4P5KB 1FNEA 4UDTB 4AVJA 3GLAA 5F88A 1VRSA 3T0ED 3UL4A 1NC2A 4BGLA 4Y2OA 3VSTA 3MJ8B 1BP3B 2ZWKA 3MTRA 4A6YL 3HI5L 3NJIA 3T6VA 1Z9LA 4FQQB 1MVYA 2VDKL 1EGJL 3N44F 1OK0A 4WW2A 1HZHL 2W60A 3IJEB 5CZVH 4RMVA 1X6NA 3QORA 4PJXB 1BG1A 2R1WA 1JPST 5EN2B 3P4MA 2BSTA 4ZFOA 3RWDB 5E6YA 2LLGA 4JFZH 2XV3A 1RZKL 1X4XA 4KUCD 3QIWA 2CO7A 1FZMA 1MCCA 3R06A 4XVUD 3RKDC 1N5AB 3AMLA 5TE7L 2X4SA 3FB6A 5IIEB 2VLKE 4BK5C 3GSOB 3ZYOA 3LD8B 2F53A 3WFBL 4XXWA 2BZ7A 1OE3A 1V7NH 1UB6A 4N2HA 5IB1A 4ODXB 4BINA 2Y1YA 2R0ZL 4XI5C 1L9SA 4BIKA 1EBAA 5DLML 4MMZA 4S1QH 1QATA 3K8MA 5C0AB 3OPUA 5IB2A 5DSCB 3MODL 1F6FB 4PP2A 4M3KB 3TNNA 3WCYA 3P30L 1Z5LA 4GRWH 5AVZB 2GPZA 1KXQE 4IRZL 4OF5A 5EG6C 1AD0A 1C5DB 1U41A 5KYUA 2Y7LA 3T0VA 2V2WB 4H1LB 4Z3GA 1QW9A 2R29A 3RAJH 5IESH 4DQOL 3DECA 3EXLA 5CR1A 2FX9H 4GQZA 1CICA 4S1RL 1U92B 3I9GL 3GXDA 1IEAB 1RMFH 2KT6A 1XGRA 4LHQB 3F65A 4MKTA 1NANI 2XYBA 5EUOF 4GAFB 4N8PA 3TYGH 3UBGA 4W9CC 5BW7C 1K85A 1P1ZA 3PWLA 3WNJA 1OSZB 4R7NB 5MHSD 1MCIA 2BNQA 4AEFA 2O6FA 4URKA 3NZUA 4MDIA 1KCRH 2X12A 2YQ2A 3T77A 3TIEB