2PPEA

Reduced h145a mutant of afnir exposed to no
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWAVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
publication title Stable copper-nitrosyl formation by nitrite reductase in either oxidation state
pubmed doi rcsb
source organism Alcaligenes faecalis
total genus 88
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2007-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ppeA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ppeA02
3WIAA 1JZEA 2YARA 1V55B 3G5WA 1JVOA 1L9SA 1WS8A 2VW7A 2JXMA 1DYZA 1PZBA 1OCZB 1ASPA 3WNJA 7PAZA 1OV8A 2XVBA 1JZGA 2IDUA 2LLNA 2CCWA 1PZCA 2GC7C 2CALA 1NIAA 2BP8B 2HRGA 2IH8A 4A2HA 2UXGA 3CDZA 2BO0A 4ENZA 1BAWA 2I85A 3V9EA 1VLXA 3NSDA 3FQYA 3QJRB 4Q89A 2YAEA 1AS8A 2DV6A 4E9SA 5I5MA 2GBAA 4AI7A 1N68A 1AZUA 3OM3B 3HEIB 3CG8A 1OE1A 1TU2A 2XLLA 1ZIBA 4YSAA 2VMJA 3ASOB 1BXUA 1MG2C 4HZ1A 2WO2B 1QNIA 2H47C 2YQBA 8PAZA 3FYEB 4E9QA 1M57B 3T71A 3WG7B 1PAZA 4HHGA 4DP7X 2IAAC 3FQ1A 4GP8B 1KGYE 1X9RA 4YSCA 2AZUA 4KNTA 2FT6A 1AZNA 4FA7B 4UF7C 2EIMB 2VW4A 1KBWA 1ILSA 4E9WA 2J57A 1M9WA 1TEGA 1E30A 4GXFA 2PP9A 1ET5A 4A68A 4YSSA 4BDVB 1RZPA 4BWTA 4MFHA 3UGEA 4DP6X 2PCYA 2WSDA 5F7AA 3EF4A 4PAZA 2GI0A 1A3ZA 4JKNA 3EH3B 5B7EA 3AG4B 3ABMB 4YL4A 1RCYA 2HLEB 2Q5BA 2XX0A 1F56A 1L9OA 1WA1X 1J5CA 3JTBA 4L0PB 3UADA 1QLEB 3QPKA 3OQRA 1CC3A 3GXUB 1NWOA 2CUAA 5B7FA 1CUOA 3AW5A 2DWTA 3X1EA 1KCWA 5B7MA 1AANA 1CYWA 1NZRA 2VN3A 2UX6A 1JZFA 1AS7A 2BZCA 3PCYA 3TASA 1GW0A 2XV0A 3PXLA 1ET8A 2HZHA 1IKOP 3KW8A 3NJNA 4DP9X 2BW4A 2OV0A 3CDZB 1L9RA 4K9JA 3ZIYA 2FT8A 3RYMA 5AKRA 1GS8A 3PAZA 2WO3B 1PMYA 1SF3A 3QJSB 2UXVA 4DP0X 4AKQA 3N55A 4UANA 3S3BB 5AFAA 1E65A 2YAFA 4KO5A 5AZUA 1BYOA 3SQRA 2PCFA 1GY2A 2OCCB 1V10A 2UXTA 3NJGA 1TKWA 2XXFA 1BQRA 4P5RA 3NJJA 2BP0A 1IBZA 2FQGA 2DYSB 4YSPA 2J5WA 2FTAA 2RACA 4NB7A 3EHBB 1MZZA 4A67A 3IBOA 1AG0A 1FA4A 2JFCA 5B1JA 4A66A 2IDFA 5E9NA 2GB2A 1SJMA 2YAOA 3FQ2A 3QJUB 3ABKB 3PPSA 1KYAA 2R7EA 3TBCA 1ADWA 1HAWA 1EZLA 3CVBA 1ID2A 1OCCB 3NSFA 2QDWA 3KW7A 2X87A 4CSZA 4BWUA 7PCYA 1ZDQA 3AG3B 1L9QA 4ZK8A 2BWIA 1IBYA 2HXAA 2A3TA 2ZOOA 3S8GB 9PCYA 1R1CA 2VSMB 1GSKA 3FS9A 3DKHA 2N0MA 2AVFA 4G7RB 4Q8BA 4AZUA 1EHKB 3OMNB 1ETJA 5FC9A 5B1BB 2PP8A 1TEFA 2AFNA 1FWXA 1NIDA 4BXSV 1W6LA 2ZWNA 2IDSA 4WTQA 1IC0A 3UAAA 2Y69B 3FSAA 4JHUA 1W6WA 4DP8X 1KCBA 6PAZA 4YSEA 5I26A 2HX8A 5ANHA 4KO7A 1PZAA 3NT0A 3T9WA 2UX7A 1AG6A 2H3XC 4N8UA 5B1JC 2IWKA 2HX9A 2FJSA 3TA4D 3NJMA 3NP4A 2NRDA 4A2GA 1JERA 2TSBA 4G71B 3X1NA 1UATA 1E5YA 2YXWA 2PPCA 5I6KA 3NSYA 2B3IA 3PAUA 3T6WA 1SHWA 3FSWA 1PLAA 3CVDA 1JZIA 5B3SB 3AZUA 3N2JA 1JXDA 3T6VA 1JOIA 4FAAB 2IWEA 4G7QB 2VM3A 4KOCA 5B1KA 2YAQA 4GY4A 3SBQA 1PF3A 1A65A 4G7SB 2MRYA 3PLYA 2VM4A 4KO9A 1NINA 2BP0B 2PPFA 1ILUA 2PPDA 3NJHA 3WKQA 1SDDA 1E5ZA 2J55A 3UACA 3GYRA 3QJTB 3FYIB 4P5SA 5D4HA 4E9XA 3AG1B 1AZCA 1JZJA 2R7EB 1CYXA 2AZAA 5I6MA 5I5JA 2P80A 2OJ1A 2Y1AA 4BWWA 2ZONA 5F7BA 3H56A 1M56B 1OCOB 3OMAB 3QQXA 2P80D 5I6LA 1L9TA 4HIPA 4YSQA 5A7EA 5PAZA 3BQVA 4W9ZA 1NIFA 1ZDSA 3BVDB 1NDTA 3UABA 2JKWA 4HHWA 3QJQB 2YAMA 3FU9A 2I7OA 4WKXA 3X2QB 1A8ZA 6PCYA 5IY5B 2EILB 4F7KA 2FT7A 3OMIB 3C75A 1KDIA 2FQEA 1GR7A 4E9TA 3H4HA 1WA2X 4GP5B 3S8FB 3FU7A 1IUZA 3TBBA 1BQKA 3FPXA 1JXFA 3H4FA 5I28A 4YSRA 1MDAA 1PNDA 2QDVA 2VSKB 1SHXA 2J56A 1ZV2A 4DP4X 5PCYA 1PCSA 2FQDA 1ASOA 2IDTA 2EIJB 2XWZA 1DZ0A 4CSPA 3NJIA 1SFHA 1J9SA 1SF5A 1V54B 3HB3B 4G72B 3V9CA 4NAJA 2EINB 1AIZA 3ASNB 3CZUB 3ZBMA 4A2DA 1A4CA 1AOZA 3FT0A 1GS7A 2DYRB 3NJFA 4DP1X 1B3IA 4YSOA 1URIA 3OD3A 1SNRA 1KV7A 4G70B 3NYKA 4HCIA 2QPEB 2H5UA 1NPNA 3ERXA 1FFTB 1HAUA 3ABLB 1T5KA 1SDDB 2FNWA 1AAJA 4DPBX 4E9YA 3IE9A 5TK2A 2IH9A 1L9PA 1NTDA 2DWSA 4M3HA 2CAKA 4F2FA 4E9VA 1AS6A 4BK5C 4YVUA 5I6OA 2HRHA 1NIEA 1OF0A 4DPAX 3NJLA 1OE2A 1JZHA 1WS7A 4DP2X 3SBPA 2PPAA 1ET7A 1NPJA 1OCRB 1PLCA 2BHFA 2XV3A 2MTAA 3MBWB 4KOBA 5I6NA 4AKOA 3NP3A 1KDJA 3FSZA 1OE3A 3FU8A 3NSCA 1BQ5A 4QLWA 5I5IA 1J9QA 2CJ3A 4GP4B 3X1BA 1CURA 1ASQA 4EF3A 2QPDB 1JXGA 4AKPA 5I6PA 4GYBA 3S3DB 2BWDA 5B1AB 1WAEA 2IDQA 3T6XA 1XB3A 4YVNA 3UAEA 1NIBA 3FU7B 1XB8A 4HALA 1HFUA 4JHVA 4AX3A 5EHFA 1AACA 1YLBB 2X88A 2YAHA 3IN0A 3WI9A 4KO6A 1PLBA 3EH5B 1W8EA 2GC4C 2PPEA 3ZDWA 3FPYA 4YSUA 4KNSA 4DPCX 1A4BA 4TXVB 1I53A 1N70A 3ABGA 1ZPUA 1ZIAA 1NICA 2BW5A 1RKRA 2AANA 2W8CA 2FQFA 2EIKB 1J9RA 2W88A 4F2EA 3S3CB 1BXAA 4HAKA 2GIMA 1XMEB 1NWPA 1BXVA 2BP8A 3QJVB 2XXGA 1RZQA 1GYCA 4M4RB 1XB6A 3AG2B 3CVCA 2VW6A 2PLTA 4KNUA 5D4IA 3FSVA 2XX1A 5LDUA 1MZYA 1JVLA 3WNIA 2IWFA 3IN2A 1AR1B 2XV2A 4NERA 3DTUB 1GS6X 1E67A 3X1GA 4DP5X 4PCYA 3SBRA 1BYPA 5D4JA 1J9TA 3DIVA 3GDCA 4W1TA 3ZX1A 3JT2A 1PNCA 4YSDA 3WKPA 1WA0X 4UAHA 3PAVA 2Q9OA 3IEAA 5TK4A 2XU9A 2GSMB 2HX7A 2YXVA 3L45A 4YSTA 2B08A 3AY2A 3TU6A 2FWLB 2PP7A 1PY0A 2XUWA 3X1FA 2XYBA 2DY2A 4HCGA 1OOWA 2UXFA 1QHQA 4HCFA 2E86A 2CBPA 3EH4B 4BDVA 1AQ8A 2QT6A 1GY1A 3T6ZA 2TSAA 1BEXA 2YAPA 3MX0B 2GHZA 1KBVA 1AZBA 1AZRA 4E9RA 4BXVA 1SFDA 1MG3C 1X9UA 2ZXWB 4N4YB 4A2EA 4RH4A 1A4AA 4A2FA 2I7SA 3NJKA 3D12B 3U25A 2BZ7A 4X4KA 4QKTA 1J5DA
chains in the Genus database with same CATH superfamily
1M1XB 1U93B 1S9YA 2HT4D 4IHOA 1IILE 4QOKD 1AR1D 1S7RA 2WZ0A 5C0CB 5KJRH 4X9HA 1PZBA 1UADC 5AG8A 3OGCA 4M6MH 4P48A 4PGCA 4J6RH 5KYWB 3D0VB 3H9SE 1K8DA 4M5ZH 1HTYA 1FL5B 3SEPA 1E5CA 4AMXA 3OTTA 3BVNB 4JANB 2G2PA 2E7LA 3SPCA 5B3JF 4FP8H 2V9TA 3SE9L 5TDPB 1A6WL 1BIIB 3DTXA 3N1GC 3NQIA 4P4KA 3A67H 1PQZA 1QASA 2D3JA 3SN6N 2VXUL 4F5CA 4FXTA 4IU2A 3RJOA 3EYSL 4N20A 3WKYA 4AIOA 3QZNA 3K8LA 6CGTA 1A1OA 2D2CC 2YAEA 4P3CL 4GKZB 1JWMB 4M1DH 1CDUA 3W56A 5KN5B 4OAWB 4YR6B 3OZKA 4YNYB 3EJUA 3CDFA 3KYOB 4KROC 3ZE1F 1LEKA 1MCOL 15C8L 4D0CB 5A7BA 1NEUA 3HS0A 1BXUA 2A6KB 1KG0A 1MJUL 4Y1SA 3VRLF 1I8IB 5F2FA 4DTGH 1QYGH 1GYWA 5DK2B 4QWWC 2QKIA 4KVPA 1WAPA 2KZWA 3K4ZA 4GP8B 1G0YR 4Z95L 5E2WH 2HH0L 4JHWH 4XCYA 5KSAD 3U1SL 2B4CH 1BVLB 3H7BB 5KBMA 4R5XA 4E9WA 1M9WA 2BXZA 2RR3A 5LNGA 3SE8H 5FGCB 4PVLA 3PRZA 1EFQA 3CIQA 4NO2A 4ZSOE 4MMXC 3UL4A 4P5TB 2C9XA 4U0RB 4IK6A 4YDNA 1PLGL 3EXLA 3MA9H 4LIQE 3EF4A 2FLMA 2HFEA 4JKNA 3GXFA 4ZW5A 3QFJB 5ESQB 1Y0LA 3MV7B 2JIXA 2NXZC 1FRGH 1PFCA 4UT6H 5DZVA 4YK4B 3TA3D 1NCDH 1T1ZB 5HDOA 2QBWA 1VF5C 3FFCD 4FC3E 3DV4A 2VB5A 5CLXA 1TTAA 5F9WB 3WFEH 2ZJSH 1HZHH 2VN6A 1XTLA 3ZUNC 4LHQB 4NM8H 3KYNA 1M7UA 1HQRB 1WGOA 4QRTA 2YWYA 5D93B 1HL5A 5EBLB 2DWTA 1HS6A 3HR5A 4LLWB 4ZPTB 1SLXA 4J4PC 5LN8A 3BX7C 2F53A 1U8HA 4Q97A 4EUPB 4Q52A 1P7KA 1GAFH 3BJ91 4O2CB 1DJZA 3UDWA 3ILPA 1R3KB 2RQ8A 4ACTA 5BRQA 3IXTA 1Q72H 4ANVA 2ZYSA 4YE4H 4K73A 1NCUA 1SOKA 4JFEE 4GI9A 3FF7A 4DP9X 3TJHC 3PQYB 5TFSL 2AMGA 2R0WH 3DSFL 1F90L 3VXMD 4TQIA 3S3BB 4ZUVA 4ELDA 1JN6B 2FB4L 2UWEF 3MV8A 4N0UA 1RZKL 1BYOA 2PCFA 3GO1L 1DCEA 1V10A 2WZPD 3ZT5A 4B9JA 1I8MB 4Y88A 4G9FD 5JPMA 5JMRA 4P5RA 4LVHC 2ZWZA 5C0FA 2X4PB 1JWUB 4OY9A 1G5GA 2EACA 3NCFB 3C8KA 1AHKA 4MKMA 5INCA 3GTNA 2QGBA 4DHLA 2YD2A 3JWDH 5ALBL 4QHUA 4ABWA 1FYTB 5B1JA 3ZDYB 5C0AB 4ODXB 1KCUL 3SCMC 4U6YA 2VL5A 4Y16D 3ATEA 4Y4FC 5GISH 5LB1A 3NSFA 1OWRM 4JFHE 4DKTA 2MOQA 4OJFH 4GMSL 3MLSL 2R4SH 4JJ5B 2PW2A 4ZK8A 1ZY9A 1WK0A 4HH9A 2VSMB 2Y6SC 1BBDL 4QRRA 1G6RL 4Q8BA 1DVFC 1MQ8A 3NCMA 1ZRUA 4YFDB 2XJLA 2JF1A 4IHBA 4RGNB 5B1BB 1KXVC 3L5IA 4NQCD 3SD5A 4Z3IA 3OKOB 4N3TA 1G9MC 1HE8A 5D2LE 5DQJB 4DIXA 3FSAA 2UUDK 3ZQXA 3NFNA 1AIFB 2O26U 1FFPA 1PGRB 4CMHC 4U1JA 3V5HA 5ANHA 2G5RA 1I3UA 4FFZA 4RA0C 3FZUC 1EERB 4BQ8A 2Y7OA 2EVHA 3W2DL 2H3XC 3VDBA 4IDJL 4HYTB 2EVFA 4RDQF 2HG0A 4OD2A 4P2QA 4XNZB 4QMEA 4EKJA 1PPIA 3INOA 4M62L 4EN3A 4R5VA 1RIVH 5ACLA 1JERA 1Q1JL 5HXMA 1AQDB 3DX8A 4M6OL 4OQ1A 1ED3B 3QWQB 2VN4A 2YXWA 5ALCL 3B5HA 3KZ8A 4M5YL 4M7JL 5HJDA 3L3HB 2DQGH 4MCNA 2JJUA 3FB6B 4KKPA 4PJ8B 2EZ0D 3F7PC 5ESVB 1TFPA 3AZUA 1QFWH 1JOIA 2IWEA 4XP4L 3HB3D 3Q6GH 1P4IL 2NY0B 4K5NA 3VVVA 1SZNA 1R47A 2H0FA 4JPKL 4UT9A 4CKVX 4ZDHA 4A7TA 3ARSA 2C1PA 1WAAE 2VRAA 4FL4C 4W6WB 1YUHB 3WV0A 4PJHA 1XXDC 5IB4B 4U3SA 5D8JL 1A3LL 1GMIA 3EGDB 4J3SA 35C8H 3IS0X 1U95B 1CGTA 4NX0A 4X6EA 2H0EA 3GLEA 1FPTH 1PKQB 4X98B 4PVNA 3K1DA 4IK7A 2XIIA 4MD5B 2OSLA 4UOW1 1UZGA 2EP6A 3GXDA 4HFWB 1IAOA 4YBQC 3ISRA 3U2SB 1L3WA 1FVCB 3QQXA 3P77A 4NOFA 3MCKB 1D2OA 4YLBA 3KPLA 3F3HA 1TJXA 4JN1H 1LEIB 3GXNA 2L7EA 5SWZD 1D9KB 2HYMA 3FU0A 1ZDSA 3MBWA 4BIKA 2HMIC 5FOBB 2F8XC 3COOA 2GTWB 4OKVB 4QTIL 4WKXA 4F7CB 2N1KA 2VERN 4LP4A 2AJUH 4Z5RA 3NACH 3NCJH 4ODWB 5EEUA 4R9HA 5DJCA 3GZKA 4A6YH 2BC4A 1KTRL 3OMIB 5ID0A 4ANKA 1HKFA 3C5XA 3D25B 4RSYA 5D2NB 1BJ8A 1I9JL 4FCHA 2X4OB 1QEXA 4TPRL 4HOXA 3GSQB 1GZQB 3O4LE 4F1SA 3D34A 1QLRA 1L0QA 2ZX8A 2B5IB 1K5WA 3VYOA 4OFPA 5CGMA 3NIGB 2HN7B 3ULUH 1PZ5A 2PXYC 1TTBA 4PEEA 1KXTB 1TMCB 1PCSA 1MCHA 3QDAA 4DKEH 4MJ6A 3HE7B 2I5YL 4MTMA 2Y22A 2XRAL 4L4VA 4LF3A 3TFKC 3WEAA 4PJ9A 1YVLA 1WC7A 2VLJD 4JFOB 4PJ6A 1ADQA 4U6VH 3GJEA 3NRPA 4PHXA 4XMLL 4S1SH 5EWIL 5JR1H 4LIQL 3RWGA 1SM3H 5DI8B 4XO3A 1CWVA 1ID5I 1YECH 1KB5H 5KVDE 1N59B 4YHPB 5C09D 1QFUL 1WT5C 2XYCA 4ZFOA 4IMLB 5C2UB 2LU5A 4NZUL 2FX8H 4I4WA 1KN4L 4N87A 2DLFL 3IDJB 3SDCB 5E6YA 4LLVB 3Q7JA 1MQKL 1LDPH 3C2AL 3L4UA 2PTTB 1HAUA 4X80H 1AE6H 1HWWA 1SDDB 4I0KA 4X7TA 3HZMB 3OHXC 4I18C 1DJYA 2XWDA 3KNBB 1KYOJ 1HXMA 4TVUA 2QFPA 3L13A 4GAFB 2JI1A 5T5FA 5JHDB 2XG5A 5HYJD 3ARBD 3QDME 3MC0A 1T04B 1TVDA 4U1NB 5GJSL 3JVGC 5EU5B 3C9NA 2NY2D 4K23L 5IBLC 3UCRA 3MV9B 2G3ZA 2MSPA 4G9FE 1FN4B 2VN7A 1NBZB 4PP1C 1VCBC 4JAMB 1MI5E 1E28A 2DQHL 3NCBB 5DTFA 2BHUA 2X6MA 4L4TD 2IADB 2OZNA 1FZOB 1KPVA 3MRHA 1AO7B 2QR0A 3VE0A 4GW4B 4JM2B 5C0BA 1WCQA 5CP3H 4IU3B 3C12A 4TVPD 1MHEB 2DEWX 2ATPA 4N9GB 4WWID 2G2RA 4ZI8A 2RHEA 3IVKB 2IDQA 4YVNA 3OZ9L 4JFTA 4WY7H 4AVHA 4U6XA 3NCWA 3V52H 4XZUB 1OKEA 3AACA 3G04B 1T2QH 3CBRA 3CBKB 4X6DA 1JV2B 1PLBA 1IGJA 3ZTDC 3HI6L 2EYTB 3R4RA 2ITCB 4RFEA 1NCJA 1GGCH 5MEOA 5IUSA 3VWJA 4TXVB 3RTQD 3U6RB 2VZUA 3LN4B 3S2AA 2ODIA 1NICA 1V7NL 4DN3H 2E7LC 4UDUB 1RKRA 2IQAB 1X7SA 2NY6C 4JE0A 4LL9A 5T3XD 1LYQA 5K9KA 4XMTA 1RD6A 2DI7A 4RAVB 1A0QH 4TVSa 5L4IA 2DMHA 3B8SA 3TNNA 1ETZA 3PNRB 1HQ4A 5I6XB 5LDUA 2FUTA 2D9QB 3A6CL 5KSBB 1HL9A 1DO6A 3DX4A 4APQB 2V5TA 3WNIA 3BKCH 2E7BA 3X12A 3JT0A 5GRUL 1WBXA 4TLKA 3RDTC 3W11D 3HS0C 3PFQA 4MASA 4JQVA 4X8XA 4FKKA 3BPNC 3UJTH 2YXFA 1F2XK 3V79C 3LMJH 4H8UA 4WU5B 4BUHA 3PAVA 1V5JA 5CZVH 3T0VA 3H2PA 4TRPH 3MRDB 1SN2A 3RAJH 2WB1A 2B08A 2AABL 3O0LA 3H3KA 2HRPH 4TTDD 1CICC 3JWOL 3QFDB 5F9DC 5D1ZA 4N0RA 4OLWH 5K1NA 1ECYA 3EUDA 3SPGA 4PMEA 4BDVA 3F7RA 5B3JE 2TSAA 4LQFH 1X9LA 4WI8A 1XSOA 3HLAB 3QIBD 4XWOD 3C6SB 1AZBA 4LCUA 2Q7YB 4YHKL 4H0GA 1HHKB 4CMMA 1NEZA 1P5VB 1UWYA 3QUHA 5GJTH 5GXBB 4QEGA 5TDOB 2I7SA 2R56H 5DFWH 3ROOB 3WKNA 5L2JA 1TPXC 2IC2A 1UENA 4QOKA 5CM1A 4G8GD 2BJML 4RIRB 4YHLH 2D31B 3UTQB 4OLVL 3JUYA 1J05A 5IOPA 1PSKH 3K6SA 4NAQA 5E5RB 3GSRA 3SKJL 4HWUA 1V3JA 1KENH 3LQZB 7PAZA 3JBG7 3PNWB 1CFNB 4UZSA 5FK9A 4UNVA 3QG6A 1P7HL 1M7DB 4YHYC 1N6QH 1ND0A 2OI9C 3LEXA 3FB7B 2OYKA 2BIIA 5IHZA 1MRCH 1HHHB 4AQ8C 2Y7LA 3LDBB 1WIUA 4QHMB 4OM1H 2IFFH 2ZQKA 3CDZA 1G7MA 2FJHA 2WXLA 3IJEB 4ANWA 1L7IH 2G0KA 2WLMA 2XN2A 1Z7JA 1VLXA 4WF7A 5DR5L 1ZJAA 5HJGA 5BV7C 2PW1B 1QFWM 1IM3D 1FFRA 2DV6A 3NFPB 5I5MA 3B6SA 2DQIL 1DJSA 3C2SA 2APTA 3TIEA 2AQRA 2CJUH 4GKSB 3L81A 3CG8A 3D69B 2A73B 2GKIA 3O8XA 4NC2B 4U1IA 3BUBA 1O6SB 3KWTA 2QZ5A 4KH2A 1FLRH 1MPAL 4YHNB 3O2DL 1W15A 3PF2A 3P2TA 4OZGE 3HMWH 4DKFH 5KSAA 1ZVYA 1A9EA 4MJIE 5JQ6H 1X9RA 4I1RA 4YSCA 3QAZC 5D1QE 4OZIA 4KNTA 1IEAA 1QACA 2WTRB 2EIZA 4P2RA 1QQDB 5BMFL 4JMXA 5IWLA 2J57A 1JNLH 5AKTA 3DVNB 1WQVT 4M61B 2BVQB 1Z1WA 5HGBB 1K2DB 3TTYA 4KJYA 1KJ3L 1XF4B 1XSKA 3GSVB 5ENWB 1KYUA 3P02A 5FA3A 4LSUL 3Q9PA 3TA3A 5K59E 4XRCB 2AJSH 3VTTA 3VFWA 4HIJB 3FFCA 3QJXA 4AENA 3CK0L 4WUUB 2A5UA 2UWEE 4NJAH 3LIZL 5JHLA 3MYJA 1W0VA 2ZKXA 2VITA 4LVOC 3BI9X 3QIUB 3IGAA 1M05A 4OZFB 1JGVH 3O3EA 4OJAA 4XX1E 1AI1H 2OXGA 3HZKB 4ZTOH 5J6HA 4Z7OF 5B7FA 5D7IB 3CC1A 1JPFB 1YJDL 4KRPD 2BNQE 4KV5F 1N8ZA 3HN8A 2FLBT 4HDIB 1UACL 2I32A 1SN5A 5E8DL 5C0DA 4EN3C 3SKOA 1N7ML 5IT2H 2X5PA 3WGVB 1PEWA 1EMTL 5GGRB 1OAYL 2VLMD 3VJ6B 1TZAA 5CBAA 1V8HA 1CB4A 3L4TA 2XFXB 3VXMA 1I7UB 2VDMH 5GGTL 3QUXD 1RHHA 3FUNA 4OFVA 4NUPA 1CL7H 2FT8A 4HS8H 2Y24A 4GQRA 2N0KA 3L4WA 3VXPB 1D7BA 3MRMB 1CK0H 4BELD 3TPUA 2WZPA 1K4CB 2WXNA 3D39B 1E65A 1JFQH 3I84A 5GGVH 4MZRA 5T1DL 3MJ9H 1LD9B 3QP3A 2R69A 2UXTA 4LRIA 5DJDB 1Y6NR 3ARDB 2Y7SA 5F7MC 4LPWA 4ETQA 5HHMB 3CFKA 5C0JB 4XP9H 3Q13A 2VLLB 3IFPA 3MOAH 2Q6WA 1IBZA 2HA1A 4MS6A 1KNOA 4MX7B 2WBJC 4WEEA 1OALA 3U46A 3GSNB 4I1PA 4R2GD 5EIVA 1AFVH 9CGTA 4Y16A 2YAOA 2EE3A 3T8MA 1T5XA 1UB6B 3BWZA 3QZPA 4N86A 3MRJB 3HMXA 1QWUA 4JRXE 3AQDA 1KXQA 3CVBA 5MEPA 1NFAA 4FQ2L 5H8DA 4QHKJ 3VSVA 1TO4A 2QQLH 2DRUA 3BQUB 2MHAA 5ADOL 2FGWL 1MREL 1YN7A 4K8RH 3IPEA 1NFDA 1FL3B 1NAMB 4PJDF 2OMWA 1R1CA 1H19A 2IPTL 4WW1B 4AVKA 4WUKL 3O4OC 2AJZA 5DCCA 4UDTA 1CU4L 1X4XA 4G7RB 4NQCA 2F54A 3TX4A 4H44C 5F6IB 2UY6A 4UT7H 4XH2A 4PRID 1YDPA 3OR6A 3FH8A 4OTXH 1D6EB 3DSFH 4MNGB 3H9YA 7TAAA 4TQPA 3WU1A 3VA2C 1MIEH 4LGPB 4L1LA 2WUCH 2GFBA 2UY7A 1E4XH 1LK2B 4XGZA 4JPVL 3NCXA 1B4JL 4Z7UA 5I66A 1ORSB 1GIGL 1PZAA 2BY1A 3A6BL 2EVJA 4TNEA 3VXRB 3X3FL 3MOBH 4YC2B 4W9HC 4E41B 1U8OA 4NKOA 2AV1A 5F21B 4XI5C 2XQBL 1F3JA 3NQKA 3WXWH 3AWGA 3ZKXB 4ICWA 3WDIA 1PZDA 4R96B 5K9OB 4W9LC 1I9EA 4LAQH 2CUIA 4L3EE 3DOIA 4G1MA 5LBSH 5I6KA 3GRWH 1A7QL 1C5CL 4M7KH 2J72A 2DLEA 1CS6A 4MJJA 4PSRA 4ZMTA 2DL2A 2WGNB 2X4SB 1A1MA 2BOCB 4GMSH 5ICXA 1KSRA 1KPRA 5BOZG 2NUTB 2HPOA 3N3EA 3IE4A 5C08B 1K8IB 5KYXA 3CPLB 2NZ9C 3Q8CA 1PFOA 3CPUA 4JZOB 1FNEB 1R34A 4KJPC 4RRPG 1NAML 1R3IL 2X42A 4YDIL 1OW0C 2RGSA 2N7SA 1E5ZA 3NA9H 3QC6X 5T5NG 2WXKA 3APNA 1NANI 2NR6C 3EFOA 5D4HA 3BKJL 2NW2B 2OR9H 4L3CB 1I9IL 5DJXA 5EBWA 1CYXA 3KXFB 3LKSB 4DEUA 4HULB 4HUVA 1BDYA 3ARFD 1NCTA 1VZIA 1ZV5A 2QADD 5HHNA 1TVHA 5SWZA 5ESAB 3S98A 4W9GC 5HHQA 5I6LA 3SDXB 4W9IC 3T4AA 1UWEH 3IKKA 4NQQA 4UM8B 1DQMH 4GXUM 5JW4Q 4H1LH 1MCPL 4ADJA 2NXYD 2AXFB 4FZ8L 2AK1L 4AL8C 3QUMA 1HEHC 1R5IB 3J07A 5CEYA 1OWWA 3KYMA 3MNZB 5DSCA 1P1ZA 1A4KB 4I7ZC 4JFZH 2H8PB 2HVJA 3CN2A 4FXGA 2DQEL 5FYJD 2BSEA 2VISB 2KI6A 3H4HA 3GI8L 3NSJA 4YFLF 5BRZE 3L6FA 4CW1B 4HG4J 1FO0H 1T20B 2CM6A 1KEML 3L4YA 3QZWA 3B7RL 3MBXL 2AJXL 5DVKA 2OSXA 2K7QA 4FQIL 1A7OL 2LU4A 3L2LA 1UOWA 4HMEA 5JORA 2NLJA 4L8BB 5K39A 3RIKA 3H42H 4F58H 3VXNA 2VLJA 3K8MA 3ZMNA 1O6VA 5E9DB 5C9JB 1NDGB 4KKQA 3SGEH 3SSGA 3MRCA 3KBEA 3MRNA 4FFVC 5C09A 2JKNA 4GRLB 1DJHA 4ORGB 4HJ0D 3J27A 4KXCA 2F7OA 5B38B 4GQZA 2OW6A 4I3RL 3SKMA 1YNKL 4LVNC 1YYCA 1NLDL 4K94L 1F2QA 1BLNB 1NKRA 1Y18A 3BHBA 4XMZA 4JO3H 2DJSA 4LMQI 2Y07H 5C07D 2YA2A 3GJFH 4N22A 3L9RB 4JQVC 1KV7A 1U8PA 4KK9D 4AJVA 3FRPB 1Z9LA 4QTIH 1CGWA 5CCKH 5A6LA 1YNLH 3BP4A 4CN4A 1VGKA 4XNMB 5HI3C 3VU2A 4BFBD 2DM7A 2IJ0C 1S7UA 1HDMA 1AAJA 5AUMB 1JZ6A 3A24A 2PWDA 3ARZA 2Z91B 4X4YA 1TO5A 4FJ6A 5HYJA 3V5DB 2QV2A 2WQUA 3ARBA 3B56A 5MP6H 1I9JH 4N0FA 4MD4B 4NIKB 5HD8D 1HHIA 5D1ZC 3PU7A 3ZKND 2VC2B 1OAUH 4L8CB 1EVUA 4TQEH 2YPVA 2GK0B 2ZPKH 2ZUWA 3MUUA 5AVXB 3EKCA 3CFNA 1IAKB 4ZUTA 1LDSA 1OGTA 4LHUG 3MYZA 4L4TA 4NUGL 4X4MA 2V0AA 3ULVH 4X5RA 2E9WA 3PP3K 3THML 3EJZC 3IM1A 4H88H 3V4PA 5IM7A 3ES6A 4LFHG 4J3UA 3IFOB 2QPDB 3VGEA 4KI5F 1TJHL 1HHGA 4KY2A 1AR1C 3CHOA 3FUEA 5D6CA 4DO4A 4FLRA 2WZAA 2R8SH 4UB0H 1OB1B 3WE6A 4NZUH 3T08A 3P69A 4OZHF 5EHFA 5G55A 3RGVD 4KDWA 1SRDA 1ULVA 5DFVD 4ZPVA 3TNMA 2IVFC 3AC0A 1Y1DA 1XIWD 5T5FH 3RTQA 3BN9D 2XTSA 1A47A 3DMMD 3LZNA 1AGCB 5GS0D 4FNLH 4L1DA 1W80A 3IWVA 3SGKA 1KJ2B 5EN2B 1N70A 1SVBA 4XXWA 5E1AA 1U8QB 1ZIAA 1PJ9A 3SKNA 3STLB 1FVDA 1KBPA 3GIZH 1ZHKB 4JFFB 4U1MA 1S7SA 5D70L 5F0JB 1IGCL 3SGDH 2Z8RA 3EGXA 1FJ1B 3U4KA 4PLJD 5L8LB 3ZRSA 1N10A 1H8OA 4CJ0A 5D96C 1AHWB 4ZMLA 4FN0A 5ETUA 5D4IA 1JGEA 3BYTA 5FW6A 2XX1A 2VC2L 3WIHL 2J20A 2X28A 3VXSE 1QLFB 2HAZA 5AB0A 5EF3A 1QOKA 3O8XC 1INDH 5C0IA 3VG9C 1HIML 3VI3F 2VSDA 2NQCA 3FT4A 4HKBB 4F2MA 3POCA 1FGVH 1N0XL 4RAHA 3RL1B 3VCLA 1BYPA 3JTTA 1UCBH 3D51A 5F7DB 4NN7C 5F7EH 3P9WB 4YDKL 4HJIA 5E8EB 5JDSA 4UAHA 1BMWA 3PWLB 2CGZA 3ZDZB 4F80A 4X4XA 2VDRL 5IWLC 2C5DC 2W92A 1M71B 3AY2A 4WJKB 4J3TA 4UTAL 1CFQB 4AIZB 5KYNA 1G1OA 2R1XA 3CXDH 4KH9A 3QIBA 2A74B 2XJKA 3K80A 1CD1A 3EH4B 2IALA 5DD1H 1R0AL 3OAYH 3PABA 1ZGLM 2QHRH 1KBVA 1WBZA 4NAMA 1KJ2L 5D5MA 4P5TD 3CU1A 4Y5XB 2BCKB 4AZ8A 3LXCA 4DZBA 4QTFA 3KCPB 4XBGA 4XZ4A 4G8GA 3QFJD 5I75C 3HZVA 1BP3B 1XAUA 3CFDA 2PCPB 1LMIA 3MV7D 3RIFK 4MAUL 5LAXA 2I27N 1DL7H 5F0PB 4OD1H 2NNFA 1I4FA 5IVZB 3FBQA 3CSFA 1MRDH 2Y3AA 4ZMNA 2VW7A 3PXJA 4PTTB 2E7DA 1T0NB 1X5ZA 4CA4A 1OQXA 1W72B 3WIFA 2PUQT 2VQ1B 3BIKB 5EN3A 4CU7A 2JJVA 4EIGB 5GGSB 1PG7H 1NUNB 3AT8A 2WVVA 1MVYA 1L6PA 1A7RL 2BLFA 5FGBA 2CALA 1NJ9A 3S35L 3VGHA 5AYTA 4NUJB 4XB3A 5J6GB 1MVUA 1UH3A 4PD4J 1UD3A 4FNPA 3QEQA 4XN2A 5IFJB 4G5ZL 5F7KC 2ATKB 1NLBL 4ZFFA 3UG4A 1IM3A 3B9AA 3B7UX 1ZLEA 1IT9L 2I85A 2HKFH 4XO9A 2GEEA 2XICA 1RFDH 3ZQ9A 4LOVA 5ABDE 3FU3A 4U1LA 3PJSB 4M48L 1XL6A 4IW4C 2E3VA 2RBLA 2ILLA 2XWCA 3FO0L 3TV3H 3QJHA 4L9DA 1VFAB 5E1IA 2XQYG 1UD5A 2CRZA 4GAYA 4WEUD 1PEZA 4IJ3B 2I60H 4HZ1A 4Y16C 5F7NC 1MNUH 1CF1A 3FYEB 4C47A 3D85B 2WN2A 4Z7OE 1OAQH 1PAZA 5HYSB 1IGFL 1ZLWH 5MERA 1QEWB 3TJEH 3DUSB 3IAPA 3P4OB 2XWXA 4M6AA 3WFBH 4FQXD 5HY9A 2FSDA 1QWNA 4P04A 3DNKA 2UZXA 1KBWA 3NRQA 2ZUSA 1TEGA 1FYTD 3PYCA 5C0AD 1OTSC 4LOUC 3OXSA 3T65A 3CDYA 4X9IA 3QO1A 4PY8I 1XF3B 3I9GL 1E8XA 1RURH 3QPXL 3Q2VA 1W72L 2FUQA 1N0LA 4TSCL 5DD5H 3V0WH 1J5OL 2ZUQB 4EOWL 2H32A 5L4FA 3G9VA 3FQUB 2FGZA 3ZO9A 5I76B 1DHKA 1MFBH 4I2XB 3M7OA 1JNHB 3V55A 4FA6A 1EV2E 3G6JA 4UQ3B 1N6UA 5ISZE 1UXSB 4RGND 1UJ3B 3GI9H 4RESB 2VKXA 1EQWA 4GW1B 5F9OL 4FQJH 1UWXH 1OP5K 5I30L 1SMOA 4S0HA 3LD8C 4C58B 2CKBB 2OL3A 5LXVA 4LDCA 4UUJA 4NSKB 1AMXA 2DLIA 2G5BA 3QZBA 5E5UB 3PE9A 4OGZA 5MI0B 3OWRA 3QUXA 4KKCD 1GZPA 2HZHA 2X3CA 3CVHH 4EI5B 4F8OA 3CMOL 4QCIA 3DI2B 4D9LL 5BMFH 1TQVA 1WFIA 3ZIYA 3KEHA 1S9WA 5DRWB 4OZ4B 4PJDE 1A21A 2WO3B 3OL2A 4YIQB 3B5TA 5A16A 1M3JA 1ECZA 2V2XA 4LASL 3G08A 4ODBD 4P9MH 2R39A 4PJ8D 5KVDH 4OB5L 1Z5LA 2OCCB 4LSQL 3H2WA 3GMRA 3QHZH 4F57L 3F7YA 4A04A 1NA8A 1JTOA 4PJIA 1RVFL 2Y4SA 4ICXA 2NY0D 4FQLL 3FCUB 5K1JA 4HZAA 4X6BA 1WZAA 1TOXA 5FIEA 1GJIA 1U3JA 1NOAA 4LLMA 5AW1B 1AG0A 2Y9RT 1P84J 3CZKA 5L4MA 2XPYA 4ZUUB 2R29L 3QG7H 5D6DA 1N9PA 1FGNH 4P05A 2WQ8A 3BP6A 4JO2L 3EYOA 5FHBH 5E6ZA 5MEQA 3T4AC 5FA4A 4IIQC 2A6JB 1BAGA 3U82B 3G5VA 4PJAB 1LNUA 5GRWA 3TESA 5F72S 2IBZX 4WENB 5DVNA 4PRIA 2E9BA 2WN3A 4H2CA 3L4CA 1LGVA 1D9KD 1FI8C 3GXPA 2WC7A 2X2JA 4PLKC 5GRJL 4S0SD 1NGXB 4BKLB 1TEFA 3GXTA 4UCFA 2Q20A 4XCNB 5IR1A 4WFHD 4P07A 2IDSA 4Q9RH 1RUPL 4PJXB 1FFQA 4FD0A 5AOLA 3DBSA 6PAZA 1T22B 1THAA 5T1DH 2R23B 2KHAA 1UD2A 5FKAB 4Y5YC 5BVJA 1BBJA 4PUBH 4BA8A 5BS0B 1IVTA 1KTDB 1C1EL 4K7PX 3DLQR 1DVUA 1GSMA 3VFGL 1BQSA 2AMUA 2L7UA 5IJBC 3D4CA 4H26B 4PLOB 4U1SB 4ZFGL 4ELKB 2P5PA 2VMFA 3D4YA 4EDWH 2WXPA 5MHSE 3MTRA 1SXNA 4G2AA 3HE7D 3MV7E 4R4FL 5KTEH 2VZOA 2IV9A 3BKML 4XHJC 3T6VA 3N2JA 4N2LA 4UQIM 1ZCRA 4PRDB 5HGAB 2O6DA 4XMXA 2JMRA 2DS4A 3QUKB 4XVJL 1F42A 4JY5L 1KYOK 4WW2F 4BRJA 3TTSA 4Y4HC 2CMRH 3G5XA 2VABB 2MQGA 3M88A 1BMGA 1OP3K 3BD5A 3B2UD 4PJEB 1IGIL 1NMAL 3SDCD 5ITFB 1DFBH 2YPLE 2NY2C 1IX2A 3QW9A 4PY7B 4CN6A 1MFEL 4D0BA 4DGVH 1JZJA 5D1XE 4YDJB 2JCCB 3FUIA 4GPVA 2WOYA 1E8WA 2VJ0A 1KJMA 2DWEA 3PQYE 3WUWB 1RZFL 5L88L 4KQ4L 1HSAA 2YEZB 4MS8C 4Z7VF 4NRXB 3V10A 4F7TA 5JHDD 2VMDA 2WKLA 5BXFA 1C7SA 1D5ZB 1E27B 2J1YA 4BE6A 3SOBH 2C34A 3UABA 3WTUA 2PR4L 2O6FA 3MV9D 3S97C 4FXKA 2PKDA 3HC0B 3RY4A 3SPHA 1A3QA 5DJ6A 1NCAH 4DPRA 3CX5J 2YKLH 2WXOA 2QEJA 1AO7D 3UROR 2VJXA 1PU0A 4JM2D 4LGRB 4BH8B 5LBGA 4N2IA 1AGFA 2CIIB 4YXKL 2HFFA 3ZDYE 5C0AE 3RTQC 3MNMA 4OGQC 1AP2B 4PU2A 4CC4C 3HC4H 4BFJA 1E4KA 2PCXA 1IC7L 2QQQA 4X0NA 4E2OA 5CFAA 1GA2A 2JSFA 1ZWIA 1GVIA 1D6VL 5AOIA 3KCWA 2DQTL 1ASOA 1I8LC 1M4KA 3S37H 3KD4A 4H0IA 5IB3A 1SDAB 1EEZA 5EA0H 4PSPA 2O6PA 3NJIA 3L3GB 4CSPA 2CK2A 4G11A 5ACZA 1V54B 2VO8A 3NK4A 5DD3H 4KNQA 4FNQA 4K3EL 4K3GA 3UTTD 4PCKA 4A2DA 4JFXB 3W11C 4DW2L 3NTCH 5C07A 5C3IA 5JNYA 2GYSA 3BH8B 1T83C 1WFTA 2CR6A 2GTZB 2FR4B 4XMVA 1AKJB 4F24A 3QULA 1MRFH 2B2XH 1TJIL 2A9ML 4KI5E 2ICWI 1C16B 4KBPA 4NRZA 5TDNA 4FYSA 4DERA 2SODB 5FXCH 3EH2A 1CZ8L 3QO0B 4OZHE 2LAGB 4JPQA 1TQUA 2PNDA 1I9RH 4LOEA 2JELH 5G4MA 4DGIL 4MB4A 3FTZA 1U2HA 5FM8A 5C2BH 5AAWA 3R8BB 3S36X 1Q38A 2YS4A 1U92A 3MFFB 3AS3A 3ARXA 1QP1A 1R3HB 4OGAC 2WLJA 5BVPL 4LBAA 2DH3A 1GGUA 1EO7A 2E46A 3HC2A 2L3BA 2RH0A 3TVMC 1KCSH 1PLCA 2B1AH 3TBVB 5I6NA 2EE2A 4AKOA 3CH1A 4PV8B 3V0DA 3PDDA 4HUMB 5C3TA 1TG8A 3PGDA 3VI4F 4TUKH 1CR9L 1ZA3B 3OC5A 4LCWA 4Y9BA 1ZTXE 1JXGA 1QBML 4AKPA 3MRFA 4PR5B 1ZJBA 4N0CC 1RUKL 1UFUA 4X6CB 3RGVA 5IQMA 1FF5A 1QTPA 3T6XA 3V0AC 4D9QD 2LAAA 1XIWA 3PGCA 5I1JL 2YAHA 1YLBB 3DMMA 1JK8A 3O6LL 1EX0A 3LXAA 5E00B 1FZMA 1YEEL 2R0KL 4HC1L 1M1XA 4I48B 4JM0A 2WZ6A 4I87A 1U93A 1WGVA 4Z0BH 4XNQB 2BY0A 2R0LH 2B15A 5EOCJ 3MNWA 4Y2OB 1UOKA 2P8LB 5C0CA 3E6HB 1QFOA 5FGBC 1RJZB 2YPVH 5D7SL 2AITA 1Z3GL 3DGDA 2E6JA 4FZEL 2WQVA 5KYWA 4GKNA 2D7TL 3D0VA 5JYLA 4F2EA 1EO8H 1FL5A 4POZD 3K5RA 1KB9K 3P3RA 3HUJF 1BOGA 3BVNA 4NFBA 4XP6L 1YN6B 3QR1A 1BIIA 3QWRD 4GG8B 3FQXA 2CHNA 3GBML 2BVPB 3BP5B 1WV7T 5D2NE 4Z3JA 2FDBP 4RFNB 1E3XA 2VDQH 1DLFL 4PJFB 3KLLA 3ZOAA 4GKZA 5ABAA 3BKYH 3QEHA 3VX0A 1JWMA 1BX2B 4J3WA 4J5VA 3NIGE 5F0LB 4OAWA 4YR6A 4YNYA 4D0CA 4EEEA 2A4CA 3CSPA 4RDBA 2OCJA 1DCLA 2AXHA 4JY6B 1I8IA 3ZTNH 4G80B 1FE8L 2VR8A 4WNQB 2Q9OA 4FXLA 4CU8A 5DK2A 4HZLA 2GSMB 3Q5OA 1ACCA 5DHVA 1KT2B 3KR3H 1XGPB 4GG6B 1EH9A 1URLA 3KWVA 1BVLA 3H7BA 1G43A 4H40A 5B39G 3CXHJ 2HJFB 4MZIA 2D7OA 1UXLA 3C09B 3ULUC 4WRLA 5JPNB 3T6ZA 5FB8B 1JBJA 4P5TA 3FK3A 4PJ5E 4HWNA 3RPBA 2CO6A 1F3DJ 4WCYL 3RIFF 4BSVB 1AOHA 4IIZA 3VGDA 4OLXL 3NJXA 3QFJA 4OFDA 3FUJA 4POYA 1DVQA 1A2YA 1SYSB 4JDEA 5F88A 3LKOB 3QPQD 4NKQB 2WINB 3NOIA 2YKKA 3MZGB 3DJRA 4WUUD 1VA9A 2H1PL 1WZ1H 2X2IA 3BH9A 3C6LB 5FUCC 4D8OA 3GK8H 2DI8A 2V33A 1BD2D 2ZZUT 2IGLA 1P4LB 1JZEA 2JKIS 3QIUD 3CC5B 4FQCH 1KIUB 3RFZB 5C6TH 4IBVA 5EBLA 4LLWA 4ZPTA 1MCEA 2XY1A 5D9SB 1IE4A 4K9EL 1G6RA 4EUPA 1WD9A 2IDUA 4HPYH 2DD8L 3CFBB 3N41B 4O2CA 2W59A 1R3KA 4N90E 1T89C 1T7ZA 3KPSB 5J1TC 2B77A 2R59A 4GAJL 5J9PB 2C4XA 5I8OH 2F1EA 3IGFA 4ENZA 3MA7A 2F08A 3P3UA 4P8QA 2AK4D 3H3PL 2WLKA 4LU5H 3G7TA 3GMOB 5L8KB 3I6LE 3FU5A 4NXKA 3DV6B 3QJRB 1OT2A 4J23A 1JN6A 3L5HA 1JPSH 3OJMB 5ICZB 1DE4B 2ARWA 4DOHE 1RK1A 1UT9A 2FYYB 3D39D 5KUMA 3N5AA 3OAZK 4YSAA 2X4PA 1BQLH 2XQYK 3U6XA 2R0ZH 1EHAA 3IJ8A 2FBJH 3ARDD 3GIVB 1RV6X 1QSVA 1T3FB 4FQXA 5HHMD 4OCXL 1IBFA 1X5HA 1FYTA 3GKWH 4U1GC 1BGXL 4PB0L 5DHEA 1UM6H 3CZFA 5LGHL 2VE6B 2X1PA 5TF1H 1FNGA 4MB3A 5FOJA 4ODXA 5JUEH 5FECB 4JKWA 3X17A 1F6LL 1EJ6A 3SQBB 4LOFA 5AWNH 4NGHH 3HR6A 2VDKH 1P6FA 5EORH 1OGAE 3QRGL 1O7DC 1BJ1H 5FR3A 4XXDB 3EDDA 5CAYB 5CKGA 1UTDA 3D30A 3I85A 2E4FA 2OMXA 2A9NH 2DQJL 1WA1X 3A3YB 3D18A 4ZRGA 3MLYL 4KROB 1U8NB 4E0RB 4LNRB 2BFVL 3OKOA 4XO5A 1ZT1B 4A7GA 1DQTA 5DQJA 1H3PH 3NDZE 3UYRL 3MLWH 1AIFA 4I77H 2E9JA 1QTSA 2PYFB 3ZHFA 3B9EA 5C0CD 1RULH 4LPCA 1X7QB 2J12B 4QRSA 4Y8DC 3MODH 3GINA 4AJ0A 4Y4KC 4HEMA 5M94B 2XN9E 5B7MA 3T2NH 1ZTMA 2JB5H 3Q06A 3ECUA 1QR1A 2GJJA 2MH4A 3VXRD 4L5FL 4MMXB 1NKOA 4NLAA 4H8WL 2CGYA 1AQDA 3D08A 4E41D 2VERA 4Z7NF 1VESA 3IU4L 4TS6A 1HK6A 1ED3A 5F3FA 2VZSA 1B3JA 3NABL 4K71C 3QDGB 1L9RA 2RCSL 4ZS6C 4NNXB 3FB6A 4LCCA 2HLAA 3CZLA 2NXZB 4R26L 3WYRA 4H0LC 3BWSA 1H6UA 2N01B 4M7ZC 4EBQH 4AT6B 4KZEH 1N8OE 5L7XL 1PVHA 5TE6L 2E76C 4MLSA 3FQWB 2GY7B 2CE6A 3VAEA 4NDMA 2QVIA 4GI8A 4PRBB 3B2DC 4GUCA 5C08D 2CUHA 4MDIB 3U4AA 3EO9L 1DFXA 2F7RA 1NM9A 2QADC 3Q2CA 4NZJA 3H9HB 3ZJAA 2RACA 4AYID 3FQRB 5F7UA 5AOJA 5IB4A 1E50A 2C9QA 3QWOB 5I1CL 2IAMC 3WJMB 1U95A 3CIAA 4PJBF 4PJ7F 1PKQA 4X98A 2EICA 1UXMA 4EXKA 2Q10A 2WXQA 4P23C 2MPAL 1I7ZB 3EGSB 3U2SA 2CLRA 3UO1L 3MCKA 1JRHH 4AYFB 1GYVA 1NUGA 3UBFA 1LEIA 2A3TA 1OL0A 4O2FA 4W4NA 4W9JC 3EBGA 1D9KA 3F5WB 3IS1X 4WEMB 4I9XA 2WM0A 2GJ6E 2K1MA 5FOBA 3CMOH 1BWWA 1QFWI 4UV4H 4F7CA 3L9BA 3PJLA 4XCFL 3MLTB 4ODWA 1MCNA 1P0SE 5I74C 4FERA 2P45B 5JA8B 5CJQH 4LVHB 4LEEA 1IC0A 4N8CL 4XWGH 2IMNA 1XHHA 1J9CT 4WFGD 5CIPB 2X4OA 5EG6C 5GIRB 4A2MA 1AC6A 4J3OG 1E6JL 5JA9A 2ZG3A 1XSJA 2HN7A 5E2TH 3SCMB 3WSQL 4Y4FB 1KXTA 3SE3A 4NNPL 2NRDA 1A6ZA 4G71B 3A22A 3HE7A 5J12C 2BHYA 3S34L 3ZU8A 4Z7VE 3OAUL 4GQPH 2OMTB 1RZIB 3PAUA 5ITBL 4JFOA 5F3BA 4OD3H 4K2UL 1N5YL 2YD0A 1DVFB 1JZIA 5DI8A 2GVYA 2R1YB 3KWWB 3V6BR 1HYSC 5CS7A 4PTUB 1Q0XL 4IGBC 1N59A 4IRZL 4YO0B 4GRLD 2WPGA 4LARH 3WHE1 4UM9B 3DHUA 2YGQA 4Q9CA 2ZF8A 5T5NF 1TQWA 4P46A 4XPTH 1S7WB 3N9GH 2ZWLT 2C7UB 3SDCA 4CMHB 4H8HA 3UJIH 2E56A 3EJYD 3BXNB 2WXHA 2PTTA 3NJHA 2Y36H 3CZNA 1SDDA 2Z4QB 3CHQA 1NCWH 4JRYE 1CXLA 3BUTA 3HZMA 4X9FA 1TYEB 3KNBA 4L8DB 5DMIL 1EK3A 5TGBA 1P1VA 4KI1A 5IBUB 4JR9H 3BLKA 2AZAA 2APFA 5C3LD 5I5JA 3N85H 4GEIA 5JHDA 3EOTL 3ILQC 1DN0A 4EI6B 1YCSA 4JFQB 4OU3A 1T04A 3LKQA 2G4EA 2G30A 4U1NA 1M2VB 5DEJA 4K5OA 1DBMH 5EU7E 2ID5A 5A7EA 3VFGH 1KCKA 3MV9A 4FYRA 5EIIB 3BZ4B 3T8VA 4E5XB 1FN4A 1NBZA 2DIJA 5E95B 3BVXA 1M2OA 4JAMA 1DJIA 1HSBA 4NM4H 3MJ7B 3Q0HA 4LSVL 2IADA 3X2QB 2GHWB 1AO7A 2EILB 1TTCA 4GW4A 4JM2A 4IOSD 4NO3A 4IU3A 3P30L 1XIWC 4N9GA 1D5RA 3L3KB 4FL4B 3IVKA 2WO4A 2XPGB 3LEVL 2JB6B 3F7QA 3BDBA 2VLKE 3MNDA 3H3BC 4XZUA 3ML9A 5KSVA 1FORL 1JZ4A 2Y2TA 4PP2B 2EYTA 2ITCA 2PO6D 2XETA 4Z18A 4UWQB 1B2WH 1BREA 2BWQA 4PLJC 5EOTB 1IC1A 5K9QG 3LN4A 3ROLB 3CFCH 3PHQB 2O93L 3ARWA 2W94A 2CIKA 4S1QL 3UTTA 5KBNC 4UDUA 4G7VH 2BSRA 2IQAA 3KHOA 3NIFF 3WEXA 3BO8B 4JQIL 1XBDA 4JFFD 1KACB 3CZUB 5FYJH 4B0MM 3P0VL 5KS9F 5C0NC 1VHPA 2BSSA 3WHE0 3VI4E 1DUYB 1EGJA 3FUMA 2MOVA 3KLQA 5KSBA 3HZ3A 3SDDC 4FLOA 2K9FB 4K8RC 3DARA 3VFSB 4ZNEA 2V7HB 3ERXA 3ESUF 3EFFA 4I0PD 2HCZX 4JG0H 2P28B 1T5KA 2J71A 4X5LA 3PL6A 1S6NA 4LLUB 5KZCD 5DHXB 2PXYB 3F58L 4ABVA 2JE8A 2G60L 4QTHB 1N64L 1QRNA 4IQHA 3WBDA 3PY9A 4DVRL 4POUB 1RU9L 2J5LC 1CXKA 1S7QB 2YSSB 2WSPA 3MRDA 1RZKC 4UQ9A 1F13A 5GHWH 4XN4A 5CEZE 5JDJA 2WVTA 2P5EB 3GZOA 5AOZA 2NQDA 2C8NA 4XP5H 3BZFB 4HJJH 4H1LG 5E8OB 2BS9A 3K72A 5FX3A 4MVBC 3M07A 3UMTA 4KGLA 2ZSVB 3NP3A 2F6AA 3RWIB 1NGYA 1INQB 3HLAA 1I3VA 4GP4B 2N3JA 4BCXA 2Q7YA 3C6SA 3O2DA 4EPSA 1CURA 4KTDL 1HHKA 3DO7B 4FG6D 5IEKB 3QI9C 4F15C 2PYEB 1SUJA 4N25A 5TDOA 2XN1A 2YC1A 3V6ZB 4KKBD 3OHXB 4I18B 2I25N 3IDGB 3KXFE 4WKZB 4TN9A 2QMKA 4RIRA 1HILA 2D31A 3K6DA 4WU7A 5A40E 2ADFH 1Q9WB 4XNXL 1QI5A 3GSWA 4AQ1C 2LW3A 2X41A 4R0LA 3HC3L 2X9XA 4ANXA 1CLZL 5I8KL 3RURA 4G8AC 3SDXE 2QQNH 3ABGA 1CE1L 3LEYH 1F4WL 4LMQE 1HXKA 1CFNA 1M7DA 4F7PB 2FQFA 1HH9B 3JV0A 3LIZA 3S3CB 2CH8A 2GIMA 1WICA 4XCCL 2HKAA 4M4RB 3QYMA 2P5WD 1PD1A 1QPKA 1MELA 3AY4C 4QHMA 2Z7UA 3RWHB 3ZHKA 1AYRA 5JW3H 4WWKC 3FSVA 3IJEA 1CDBA 1MZYA 3IDUA 1JVLA 3HHMA 1F4XH 3KPNB 1NOLA 1DJGA 2DQUL 2OBGA 3NFPA 3SJVB 3RY6A 4U49A 1LL1A 4Z7QB 3HAEA 2EH8H 1CDCA 4IHOB 1S7RB 3S2CA 5GS0H 1QBMH 2PWHA 1SY6L 3D69A 4FQXC 2A73A 2X1OA 1ZSHA 5T3ZL 3LZFH 4W1TA 1O6SA 2KYIA 2MNUA 3GBDA 4PGCB 4YHNA 1XVSA 2VKWA 3H1ZA 5E9DE 4L37B 4I13B 5I0YA 3DHMA 2WTRA 1S5IL 2EYSB 3FAXA 2NY6B 1QQDA 5LG6A 1RP9A 4ZTEA 3CVIL 1L5GB 3DVNA 4M61A 2BVQA 4OUOA 5SWQB 4GAGH 3I6KB 3QDJB 1P9MC 4WZ9A 1PKOA 2WSKA 3P73A 1XF4A 5ENWA 2YAPA 3GSVA 3LX9A 4PS4H 6FABH 3FCGA 2F8VA 4KMTH 5HJ3B 2CKNA 3UX9B 4MJ5A 4ENEC 4FF9A 2ZXWB 1U0QA 2VJ8A 3LZOA 1QVOB 4HIJA 3RDTB 4A2EA 4OBSA 3HS0B 1R24A 2EE0A 4JFVA 4WUUA 4XXCC 1J1PL 5CUSH 2BNRB 3BPNB 3O3BB 4H0HB 1BD2A 4AXWA 4HP5A 3D12B 3LVTA 2Q1EA 4I9WD 4XTRD 3QIUA 4AGNA 2TRHA 3CLEL 1TZGL 3HZKA 4UTBH 2VDPL 4KQ3L 1JPFA 1WS8A 1T7VA 4M1GH 2DQDH 2IO5A 1CICB 3MTXA 4PRHA 3X3GL 4MQ7B 2JJTA 4OCWL 4KZDL 3M86A 43CAA 2HFEB 5DD0H 5GGRA 5DT1H 2H0JA 1S9KC 3VJ6A 2IH8A 2AK4A 4LCCC 1XT5A 4N8VB 4CVWA 1I7UA 1AZVA 1I8KB 1G4RA 4OLYH 4GQQA 4LRNL 4O9HL 5FKPB 2F7PA 2QV4A 3CZSA 4EI5D 3MRMA 1I3RB 3NZHL 1K4CA 1CBVL 3D39A 4PRPE 1H9VA 1JD9A 1TPXB 3FCBA 3SGJA 3OM3B 1P84K 1ZK9A 1LD9A 1XD1A 2ZCLL 4PJGF 4UIKH 4UI2A 4XN7A 3ARDA 3N40P 3E6FB 3UP1A 5HP5A 1WP6A 2MPVA 1CVRA 1U8HB 1OTUD 2HJLB 2K8MA 4RGMC 5G4NA 3SY0A 4MX7A 4L2YA 3TV8A 3BEVB 1YEIH 5EF0A 5LJYH 3CDCA 3V9FA 3GSNA 5J1SC 3IXTB 1J8HA 4MA8H 2FT6A 3K2UL 2NY7H 1RERA 5DWUH 4YHYB 2O5XL 2OI9B 1QBLH 3MRJA 4J7RA 5F89B 5JXEC 5L9DL 1ZEAL 1IBGL 2V6HA 3K4DA 5KJ4A 32C2A 4Z7NE 1KTBA 3F64A 5H35B 3ALXA 4ZUVB 4NQDE 3MRLB 1CF8L 1UKQA 3MV8B 4N0UB 2HT2D 1NAMA 2PCFB 1EEUA 1A3ZA 4IBLT 5BV7B 3HKFA 4PB9H 4GAJH 3EFDH 1OF2B 2E0PA 4HBCL 2Q5BA 1CQKA 2J2ZB 1T7XA 2H3KA 1BPVA 3H3PH 4H20H 1D6EA 4MNGA 3O81A 1HNFA 4Z77A 4PREA 1EAJA 2ORBH 5IQ9B 5I18H 4LCVA 4H25B 3OQRA 4WTXA 1LK2A 3QB7C 3QZOA 4U6YB 1RMFH 2VL5B 1CUOA 3QAZB 4JZNA 1ORSA 3SE3C 2C9RA 1CGSL 3LXUX 2ADJB 3VXRA 3OKDB 4PJ7E 3BGFC 1SLUA 2UX6A 3L7FB 4AGOA 2PW2B 4FTVB 4UINL 4E41A 2EKJA 2YK1H 2EH7L 1H3VA 2Q3AA 5BS0D 4RLDA 5HI5C 1GTFA 1WFUA 4HH9B 4HLZG 4R96A 5K9OA 3UTPE 3V0HA 1ANUA 1NEZG 3KW8A 2WQWA 2BW4A 3B9VA 3V6OE 5I15H 3RYMA 2AEIT 3LPOA 4ZOCA 2X4SA 1WSST 2BOCA 4R4BB 5AFAA 3B2UC 3V0JA 1QWHA 4P46C 3FN3A 4LVOB 2XFGB 4OFYD 2F5BH 5DJ2B 1XGUB 5C08A 1K8IA 3DOHA 3V5HB 3CPLA 3BUIA 1KCVH 2AC0A 1F1GA 2XXFA 1YYLH 2OMZB 3F7KA 4Z7IA 1HKLL 3JTSB 5ILTH 1A6UL 2IOIA 4ABUA 1ONQA 2ZG1A 4R3SB 2A9CA 2W38A 3BIAX 2BFVH 1E4XI 2XNAB 1SJEB 2NYZA 4NB7A 4EN3B 5I1HL 5IW6B 5TPWH 2JFCA 2YA1A 5DUMH 1NOFA 3QWNA 2Y5TA 2AEWA 4XPBH 2NW2A 2MCPH 3DTDA 3FUKA 3LKSA 2AXWA 4IRSC 2VRQA 2EEBA 3L3DB 3OKNB 1FFNA 3Q5YA 3EJTA 3GB7A 2DDQH 1RUML 1JGIA 1F97A 2Y06H 5K9QI 2EECA 2HXAA 1D5XA 4UM8A 5CLYA 2IEPA 2AXFA 4WGWB 4AZUA 1MCQA 1R5IA 5E6ID 1MWAB 3MNZA 3BVUA 1HINL 5AVVB 1FWXA 5IHBA 2B0SL 4WTQA 2Y69B 1ZTXH 4JHUA 3WNMA 2OXHA 2WBJB 2WQRA 1Q94B 1DDTA 1DQJB 4YHOH 1T20A 2E75C 4JRFA 2OSLB 3MJWA 4MBRA 4NENB 2V5YA 3T2LA 2VCOA 3LNDA 4X7SL 1WYJA 1EAPB 4LSRL 3P77B 3QS3A 5IGXH 3KPLB 1FHGA 3QCUL 2X6BA 2D3VA 3UMNA 4N0YH 4FLSA 3BLPX 1RUQL 4HUUB 4NYLB 1G87A 4L23A 5C9JA 1SVZA 2ALWA 2WKGA 5DQDH 2ITDB 4HT1L 1PLAA 3O4OB 5EU4B 4GRLA 4ORGA 2Q3ZA 1MEXL 2QL1A 4FLQA 4UOJA 5DJCB 1GMEA 2P1YA 1UT1A 1KLGB 5B38A 4OJEH 3LHPL 5LWYL 2JH2A 4F8TA 2RAMA 1DBKH 1C12B 3L9RA 2FE0A 3RVUD 3FRPA 3PL6C 3BVVA 4V1DE 1AKJD 4J3BA 2PWEA 1CD9B 2ENPA 4XNMA 3D50A 4AJWA 2JKTM 2XWJA 3WKQA 3DX9B 5AUMA 2RFXA 3WNPA 4AQAA 2A2QT 2Z91A 2NT1A 3H7LA 3MV11 3CCHA 5KBLA 4F27A 1TQCC 4L4VB 2IG2H 5DLML 1FL6A 5I6MA 4MD4A 1UOVA 1GH7A 5ANMB 4YDLC 4L8CA 3U4BH 3FOMB 3P3TA 5ECJE 1V3KA 2GK0A 4ZFOB 4JG1H 1IAKA 1P7BA 3NIFE 3BQVA 1EFXB 1N4XH 3GSOB 2WP3T 4IMKC 1YA5A 4IOSA 1I3GL 2Q7NA 3T2OA 2AS5M 5LGYA 4UOQA 1V05A 6PCYA 5KS9E 4BFIB 2AI0L 1SUHA 1K5NA 3MROB 3IFOA 1S7VA 4U3HA 5HYFA 4FEIA 3NMEA 3INUH 4GMTL 2GJRA 4UTAA 5EF1A 4HOMA 3GEFA 2XG5B 3RL2B 2PO6A 4R0LC 5ID1A 4HU2A 4WHDA 1MJJB 1OAXH 2X4QA 4PJAE 5TE7L 4OF3A 1AGCA 3QCVL 2WCGA 1KJ2A 4OQTA 1TQSA 4D7BA 1Q0YH 1TQBC 1U8QA 3OXRB 5DTFB 3U30C 4YE0A 1CE6B 4JFFA 1XF5B 4B60A 5EZOL 2EIEA 4B9FA 1R3JB 1FJ1A 2CLVA 4O2EB 1AOZA 5D7JC 1AHWA 4KGJA 5JOEA 5GS2D 1W16A 1R5WB 4L48A 1LILA 3RY6C 1URIA 2CBMA 4M6NL 1SNRA 1QLFA 1PZUB 1E6OL 4I0PA 3NYKA 4X9GA 1UQSB 4MA3A 4U7MA 4K7PL 1OK0A 1NPNA 1EEYB 5HYIA 3D9AH 3DRQA 5BS0E 4HKBA 3IT8D 3WFCH 2X53A 3MLUH 5CNHA 5EEWA 5FYKL 3GF8A 1JF5A 2VXTH 2XT1B 5F7DA 5TK2A 1UA6L 2X2HA 3CXHK 3KL3A 4UBDD 2DWSA 5E8EA 3BIBX 1M1SA 3WY3A 1VPOH 5K9JH 3B5GA 1OB0A 2H1LM 1MLCB 1MCCA 2RA1A 4M3KB 3RA7H 4DETA 1YMMD 4M93C 4N2MA 1M71A 2E27L 5IK3B 1CFQA 4KDTC 3TYGH 1H3UA 1R5VA 3TNNB 1CLOH 3GLAA 5CR8A 1F4AA 4BK8A 1OCRB 1XH0A 3VD2A 1CXHA 4KOBA 5T1MB 1CI5A 2VDOB 4LVNB 4U0QB 1KDJA 4Q0XH 4Z7WF 2YMXH 1WBXB 1EGJH 3VX1A 5J89A 4MQSB 3T2PA 3HNSH 2F8IA 4PMFA 1D7DA 2ZKHL 4EF3A 1MCIA 4OCRH 4WWOA 4AH2A 3TEWA 4Y5XA 5I6PA 2H26A 3W3BA 4MJ4A 4XP1H 2J6EL 2A6DA 1RUAL 1UUSA 3S6CA 3T3MF 1OPOA 1LP9F 1E4WH 1XB8A 1UA3A 2WLLA 2PCPA 2X88A 2C9PA 4FG0A 1LO2H 5IG7A 1E8YA 3IRPX 3VH8A 2GQHA 5IVZA 5D1ZB 3C6LD 3S4SB 2H7WA 3ARVA 4FE9A 4KUZH 4PTTA 4D8PB 2ITEA 1W72A 2CHZA 2W9EH 3BIKA 4PJCF 4WEBH 2Q3XA 5GGSA 2BW5A 4YZFE 3I3BA 2P5WA 1LHZA 1VGEL 2WUBH 4NUJA 1HEJC 4ACPA 4JHAH 2XXGA 2JQAA 5IFJA 3DVGA 3PV7A 4Y19B 2ATKA 2J8HA 5GZNC 3KPSD 4JVWA 2VDLB 4ALAH 2D7NA 3CSGA 3GMPB 3SGJC 5I2IB 5L2JB 3IU3B 2P3YA 3QZWG 3PJSA 1AR1B 5IREA 3HJEA 3LNHA 4C57C 1J05B 1KLFB 5IOPB 1VFAA 4TSAL 3K6SB 3QXWA 3WTTA 1PYWA 2VDOL 5EDXA 4XBEL 2VXSH 2XZCH 1DBJH 2DWDB 4X5PA 1X44A 4OM0L 1RZ7H 3D8MA 3FO1B 2OLDA 1KGJA 5FK9B 5DO2C 2M83A 3LEXB 2CDEB 5HYSA 3KL0A 4C54A 1HESA 3P4OA 1EDYA 3MLZL 3BAIA 3QEGL 5EUKA 5TQ2L 3O2WL 3PGFL 4NQEB 5D1ZI 5DYOB 4AMKH 1OSPH 4OLZH 1Q8MA 3O45A 2VZ3A 3VTMA 3I50L 1XH3B 2WIMA 5D96B 1CDJA 1GY1A 3HE6C 4PWGA 5GGRY 3U6XS 1BZ9A 5HVHC 4LVEA 3OJDB 2P44B 4AY0A 4GW5B 1UD8A 2OR7A 4FOMA 3IRCA 4L9LA 4QIRA 5DUPH 3O8XB 5HHXH 3KJ6H 4BZ2L 2J1KA 3VG9B 4HUCA 3IWUA 1OPGH 2R29A 4X8JB 3SE4A 4DCQB 4YHML 3K6OA 3FQUA 1ZHBB 5I76A 2JTDA 4PJGE 4I2XA 3SO3C 1F45A 1JNHA 2ENJA 4MHHG 4NN7B 1YY9C 1ZSDA 2YGOA 1UXSA 4KROD 1UJ3A 4WK0B 4ZQKB 4OZIB 4GW1A 2YO3A 4P2RB 5E0FA 5IBTH 4MCZA 2P24B 4NBXB 1L9SA 1SY6H 5IZ7A 2GT9B 4QWWD 1E9OA 2IOMA 4A37A 5I17B 5ICUA 2EE9A 3JV6B 3CN1A 4KKNA 4NSKA 5HI4C 1FC2D 4G42B 1IQWH 1M53A 2ROYA 3R1GL 5J6SA 2NT0A 3VFWB 2G5UA 3FFCB 4EI5A 3IMRA 4X6CE 4HAGA 4YX2L 4OZ4A 3ZYOA 4LL4A 4YIQA 4XBPA 1RZJH 1IC5H 3QDGD 3ZE2B 2W1NA 3FQYA 3FB5B 3HCVA 1BFVH 2WXFA 3O3EB 5I75B 2QGDA 2OXGB 4HCRA 4EIUA 4OZFH 1Y6MR 4IBUA 4MZ2A 2R4RH 4JQXA 3GUTB 1R3LB 5SWSE 2Z7YA 3S88H 3GMQA 2WOBA 3VFUB 1B4TA 4G6KL 1NCBL 1WF5A 4R84A 1QTYT 1MHPH 3CQFA 3T71A 3UJJH 1U8JB 3FONA 1OARH 1KY6A 4YQXH 2QQKH 4K94C 1MJ8L 4J4PD 4DQOH 1YEKL 1RHHB 4D9RD 2FJFB 4PBDA 1TMQA 4RWYH 1WD8A 4C56B 2A6JA 2EDXA 2ZWSA 5DZ9A 2X40A 3UGEA 1GZHA 1Q9KB 3CHXA 4KZDH 2LTQC 4PAZA 4QXUH 1MFVA 1UYWL 3MCG1 3WEOA 2NYKA 3WDHA 4KAQH 4D94A 5B7EA 1DR9A 4YL4A 4WI2A 3IJ7A 3V4VB 3VFVB 3PUUA 25C8H 2A77H 2Q6WB 4BKLA 4JDTL 2QKSA 1UWGH 1NGXA 3DIDA 3NGBC 3WFDL 4BZ1H 5EU6B 4XCNA 3PXHA 2XA8H 2VDNH 3DO4A 4MDJA 4PJXA 2TAAA 3F00A 1WEJH 3FRUB 3I3EA 4GRWB 3LZPA 4RWHA 4Y16B 5CXPA 4WI5A 1T22A 1X5MA 3VFPB 3GSNH 4AGMA 2WCSA 2R23A 3WFHA 3H9ZA 5IVXF 1CFVH 5FKAA 5MEPB 3X1EA 3D3VE 2EVGA 1M7IB 2O5YH 3EHBC 3WNOA 4GO8A 1HX0A 3HRZA 4PV9B 5CEXB 2X4UB 1CYWA 1JG9A 2MHAB 2MCG1 3Q8BA 4YGVB 1U58A 3PCYA 4G7YL 5LN4A 4XVTH 4QD2E 3SCMD 5E6RB 4XVSL 4XPAH 5IQNA 3AQXA 4H26A 4Y4FD 4DO5A 5E24E 2F54B 8FABB 2UY6B 4HQQH 2CK0H 3OR6B 3ISWA 3G5ZA 5CINH 1ZEAH 5FCUL 5HGDA 1JGUL 4F7MB 3DUHA 1OOAA 1JJUA 3TWCL 2Y6SD 4XPHL 2XQ0A 5F8QC 3U7YH 1JZ8A 3SO5A 4OVVA 5IMLB 4B27A 2OZ4L 2GFBB 4XGZB 4JX0A 5HGAA 1BLIA 5JHBA 1KMGA 3QUKA 4IBYA 4KK8C 1KY7A 1NANH 3DX3A 1TU2B 2VABA 5DVOA 1BIHA 1O7VA 4UM9D 3LD8B 1U8OB 1YC7A 2AV1B 1NBYA 2CJTA 3IPFA 4KXAA 4NKOB 4PJEA 1OAZL 1LE5B 5ITFA 5LDSA 3MRQB 1LVEA 3H85A 2BY2A 4PY7A 3FZUD 1LQSR 4G1MB 4OSUH 3KYKH 3UXFA 3UIYA 2JCCA 1PG7X 4XPFH 3W1ZA 5FUZH 5F0MB 2COVD 2FEDC 4TULL 1U30A 4N2AA 3WUWA 5I0DA 2KBGA 2Q8AL 2DLHA 1A1MB 4BWUA 3TLRA 2MIZA 1PX8A 1GPOH 5C70A 3FBKA 5CEZH 2GABA 5C0EA 5E6IA 1D5ZA 4L1SA 4UQ2A 3CH8A 3U83A 2BZDA 2VMCA 2N0MA 3KM2A 4PGZA 2BXYA 5FGRA 3V7AE 2QSVA 3L1OL 1EHKB 2C26A 5FYLD 5I8EA 4RMUA 3T8XB 4ONGH 3L1GA 5JIPA 3QUYC 2NCEA 1G94A 4BXSV 4JB9L 4FFWC 1VFOA 3OV6A 4UMGA 3NH7L 2PO6C 4J3OF 3PWUA 4MBOA 2CIIA 3LCYA 5DJXB 5GS1C 1GYAA 1I75A 4LGSB 3VFOB 5GGQH 4JLRA 1UWXK 4KO7A 4BKSC 1AP2A 4ELMF 2R15A 1TF4A 3FHAA 3DRTB 1MCWM 3GBNH 2J8UF 2F58L 2Y7MA 1HI6B 2Y5QA 3T4AB 4IIQB 5JXAL 1JPGB 3NFSL 4Y9FA 1MCJA 5A2AA 3RUGB 4FMKA 2OJZL 2YA0A 3Q1EA 2LFGA 4HWBA 4YBQD 3KYMB 3HNVH 2DKSA 2W0FB 2HVJB 1A22B 5D55A 3SPVB 1USQA 4JFXA 4FAAB 1OD7A 4I0PC 3BH8A 3C5ZC 2HMID 2UZIL 1VADA 3HI5H 4HC1A 3RPIA 2GTZA 3RX9A 4MMYB 3L6FB 5KVEL 1AKJA 4YWGH 5CCGE 4YS4A 4E68A 3UTSB 1DANU 1MHCA 5E8PB 3CHSA 3PWNB 1C16A 1WPCA 4O51A 5FGSA 3VSUA 3D07A 4JRWA 2BVOB 4EIZC 3O41B 2ZIDA 4Y5YB 3DIFA 1RIHL 3PWVA 2D0GA 2V9UA 1BQHG 5EFIB 4X8CA 4CC0A 1QATA 4GI6A 1OXYA 2H45A 3MRCB 2OJ1A 2Y1AA 1R3HA 3MRNB 2J6WA 4RCAA 1H8NA 1M56B 5KUKA 4LSRH 3VVWA 3GDBA 3TFKD 2JQZA 1AQMA 3BHBB 1JZ3A 2NY5H 1NGPH 2P5ED 3M6DA 3D5OF 3TBVA 4C4KO 4PV8A 3QJQB 5CILH 1OCWH 1A8ZA 5IY5B 3HVDA 2BVEA 4U2ZA 5E2JA 1VGKB 4NWUH 4Y4HB 1S7UB 1RPUA 4PR5A 4M6ML 3NPSC 4J6RL 2IQ9H 2A6IA 2BPBA 4N0FB 4YL9A 4M5ZL 3TBBA 2PYED 3IBEA 2NY2B 2X6VA 4GFTB 1ZOXA 3PAYA 5E00A 5DZNA 2QDVA 2C4FU 3GD1C 4FP8L 2AERT 2YOAA 2J56A 3KEDA 2BSTA 3HG1E 4XNQA 2JVUA 3A67L 4LSTH 1OGTB 2P8LA 3E6HA 4L4TB 1SDYA 1RJZA 3ECWA 4LNVA 4QT5A 2X0WA 1G4MA 3EZJB 3FCSA 2QTVA 5IM7B 4X99B 3E9TA 4M1DL 1N3NA 4Q56A 5IBLD 1B4LA 1IFHH 4OJYA 1FIGH 4OJDH 1AIZA 3IYLW 3ZBMA 3HG2A 1ZD6A 4IOIA 4PP1D 3NZSA 3MN8A 3QZLA 1YN6A 4MGXA 3H54A 2IBGA 4DTGL 1B3IA 1QYGL 2BVPA 1N26A 3WE6B 3OD3A 4NQXB 1YEDB 5E2WL 4PJFA 4PG9B 3TF7C 4YHZH 2CR0A 4JHWL 4Q14A 3RTQB 3T3ME 2B4CL 4KY1H 1G7PB 4WI3A 3E8UH 2EYRB 4RGOH 3MLVH 3SE8L 4QRPE 2O61B 1QSFB 4NPKA 1QA9A 2GITB 1FIEA 3E38A 4JY6A 1A5FH 1FVDB 4MHHI 1YMMA 4WNQA 2J7LA 1S7SB 3MA9L 2A4ZA 1VEPA 3IETA 4HIEB 4OQTH 2XWBB 4RZKA 1SBSH 2BVUA 1KT2A 4FI6A 4QXTA 4R8WH 4R7XA 4GG6A 4DPAX 1FNFA 4XCEB 5EEVA 1FRGL 2VN5A 5ETUB 1JGEB 2ZX6A 3OKKB 5GGSY 2NY6D 3WFEL 1T66C 5JPNA 2ZJSL 5FB8A 1HZHL 1OE3A 1ZXKA 4L9LC 4PJHF 4YZWA 3FQTB 3RY5A 5FW8A 2CBOA 2JWYA 2CJ3A 3KGTA 3LS4H 1MUJA 3E0GA 4NM8L 2ZKYA 3QDJD 4JFWA 4BSVA 2XPZA 1YEGH 5JOPE 4GYBA 2CD0A 1HYRC 4NEHB 3W5NA 5B3NA 5JDSB 1HNGA 1GAFL 2E8YA 3DOSA 1MCWW 1MAKA 3RDTD 3LKOA 2WINA 1HFUA 4HALA 1NFKA 1GW6A 1Q72L 3M8OH 5FFGA 2AEQH 1CO1A 3C6LA 4YE4L 2BNRD 3F85A 1W91A 4WI6A 1P4LA 3EH5B 4TF4A 4KXBA 2H6UA 3ZDWA 2OJEB 2P49B 3CC5A 1OZTG 3ZKMD 3RFZA 1P2CB 2R0WL 2VR7A 4OGXH 3ZTEA 1CD1B 2YEVB 4N2BA 3EYQC 2IALB 1JYVA 5BQDA 5FYLE 3PABB 1WFMA 3CLFH 4I5BA 4PWJA 5A2CA 3CFBA 3TVMB 2CO3A 3JV4A 4C55A 1IU1A 1CICD 1XCQA 1XMEB 1NWPA 3KPSA 4APXB 2EE6A 5L2KE 4AZ8B 2DTML 4HUNB 1XB6A 3BMVA 4GSDH 4DZBB 3IFLH 3T04D 4YAQB 2BIOA 3B3IB 3GMOA 1M7XA 3QE5A 3JWDL 4KTYA 4WIQA 4Z9KB 3BZEB 5LAXB 3UZVA 2XV2A 1SXSA 3DECA 4JQXC 4FMVA 4HBQA 3X1GA 1U8KB 1DE4A 3BUYB 1U3ZA 2DIBA 2FYYA 4UZUA 1R33A 4OLUH 3SBRA 3M1BB 5G5DB 4OJFL 3WIFB 3QARA 3HNTH 2R4SL 2X7LB 3GIVA 2FX7H 1T3FA 1NM4A 1JPTH 3AS2A 4X2UA 3ULVF 5IROA 4HX1B 1MVUB 1RIUH 3QEQB 1HVXA 3S37X 2XACC 3AQYA 4L18A 4ZFFB 3MRRB 5FECA 1GZHC 1IM3B 3TC9A 3D6GA 3SQBA 4KK5C 2UYLB 1E90A 3VI3A 4OBRA 3CNKA 3DX1A 4CBPA 1O5DT 1LO3H 2AKRB 1BM3H 2IH3B 3IJYB 4XXDA 4D2NA 2W07B 3Q2LA 2FCBA 4XMPL 5J11C 2WLYA 1NL0H 2A1WL 4L1TA 1YPZB 1F6AB 4LNRA 2GBVA 1WE5A 5JOFA 1PD6A 1QRKA 1RIVL 1ZT1A 2N59A 3HW7A 2GUOA 1F4HA 4PVMA 4OT1H 4QKTA 4HMDA 5HY9B 3HRZC 3ISYA 1X7TA 3L3OA 5AVUB 4TNVK 4UILH 3OXSB 3AT9A 3T65B 4FNRA 3LIUA 4K3HA 1Q90A 1QFWL 1A66A 2AAAA 2LLNA 3K6FA 3QO1B 3Q6GL 2YXMA 3C60C 1H5BC 1DZBA 2N7AA 5E8NA 3GMMB 2JQMA 4FTVD 3QXVA 4JBSA 8CGTA 3O2WH 1NKGA 4X6DF 5CD5C 3QDGA 2QMJA 3TN0C 4RAUA 4NNXA 5B1CA 4X9BA 1PCXA 3S5ZA 2KPNA 3G6JB 3KVDD 4ZAKC 35C8L 4FQQB 4LBEB 3MRIB 4O00A 3Q1SL 1FPTL 4TTGA 1GL4B 4JJHA 4P3DA 2XLLA 1E7UA 4MDIA 3S36H 1EAQA 2WO2B 1QNIA 1TJMA 8PAZA 4JN1L 2CKBH 3WG7B 3PHSA 4J4PA 4O02L 4LXFA 4U31A 1IBDA 1GZPB 5IB2A 1J1OH 5D7LD 3WJMA 3JVFC 1IEBA 5DS8B 4ONOA 3N42F 1E8ZA 4IRZA 4P57A 5TTRA 2AJUL 3NACL 3NCJL 4HK3N 3GHEH 1RZPA 5E6IC 3VM5A 5A16B 5CHNA 4A6YL 3EGSA 1Z5HA 2V2XB 4LCIH 2EO7A 4JKPH 4AYFA 5F7AA 2ZUXA 3SJVE 3GMRB 3F7YB 2B3RA 1UM5L 2EADA 1F02I 4HCRH 5DUBB 1K3ZA 4X6BB 5BUGA 1D3CA 3ULUL 3EDKA 3OR7B 5AL8A 3ZQWA 3MACH 4LLMB 1RPKA 3UADA 1KLUB 3WMQA 3GS7A 4DKEL 1IGYB 2BIQA 5D72L 3MXWH 3FHEA 3QFGA 5CIPA 4ZS7H 3BP6B 3VTAA 4U6VL 4U1GB 5JR1L 4S1SL 2F74B 2WBJD 1UA7A 1SM3L 1I82A 3V7MA 4F5CE 3L4ZA 3G5VB 1YECL 1KB5L 4I3GA 2VN3A 3SCMA 2EDLA 3CUPB 4Y4FA 4IRJC 2J44A 1TEYA 3W9DA 2LVEA 2AQQA 2HTKC 2FX8L 2KH2B 3PWPB 1ET8A 1U36A 4ZFZB 1MJ7H 1RZIA 2GW5A 5HPOA 1JRHI 4X80L 3T0DA 2IGFH 1AE6L 2H6PB 2WZ5A 3ZUCA 1NEPA 3L9YA 2R1YA 3KWWA 4YO0A 2D73A 5KG9B 3IPBA 1WAAF 2YN3A 1KXVA 4GFXA 1GY2A 4GEJA 3OKMA 4KHTH 3GSUB 3NJGA 1DQQB 4QRUB 4M5SA 2F68X 3BD3A 2HPTA 4Z78B 4XVUC 5DHYB 5FWQA 3L48A 3BXNA 4EUPG 4GKLA 2ZX9A 2CQVA 2Z4QA 1T4WA 4Y4KB 3LPFA 5HGGS 4JQIA 3RVXC 1EZVX 3O2VH 3B9KA 4U6HB 2Z7ZA 2NNRA 3QJUB 3ABKB 4ERSH 4URKA 1AGDB 4ONFH 2APSA 5IQOA 1O0VA 2ZUUA 4C59B 2QDWA 4GO6B 4XI5D 3MRBB 3QEUB 2X87A 5FO8A 1CFTB 2QPUA 2WLHA 4JFQA 4K71B 2Z1PA 3VD7A 2MJWA 3M1OA 5EIIA 5EZPA 3BZ4A 4E5XA 4WY7L 5FF6B 1QI3A 3DKHA 2BK8A 4NQUA 3V52L 4YDVB 1IGTB 1T2QL 4M7ZB 3W0WD 3VWKA 3G5XB 4JPIA 1EFXD 1ETJA 2F53E 5FYKD 1GGCL 2NCMA 2XN9A 2X89D 3G6DH 3E8VA 2IWGA 2VTFA 3FN0H 5DUJA 1N19A 3L3KA 3ETBF 4DP8X 2QADB 2NZ9D 2KZ1B 1PL3A 4KJPD 5CGBA 1H3TA 1KJMB 2IAMB 4H2AA 1BG1A 2YD4A 4KRNA 1A0QL 3UH8A 4N8UA 2WAHA 2HX9A 2NR6D 4P23B 3ZDXB 3WTXA 3N43F 5EOTA 3MV8E 1HU8A 4N0UE 1NMBH 3SY6A 4Z23A 2Z3FA 1MNNA 3BKCL 4HS6A 1VKXA 1YNTB 1BSIA 1KC5H 3NSYA 3QUZC 4WO0A 4HJTA 2C3GA 3BO8A 3UJTL 4YFEA 2ITFA 2J25A 2VM3A 3DYMA 5D1XC 5I74B 3LMJL 1AGFB 2HFFB 3IJSA 1DUYA 4GY4A 4OI9A 1TYRA 1A65A 2KQNA 2J73A 3BT0A 4K9EC 5CZVL 1IIIA 4TRPL 3RQ3A 4HKZB 3ZW3A 2NSXA 3RAJL 3VFSA 4OF5A 2V7HA 2HRPL 1ILUA 3E7JA 2Z31C 1ZWIB 2X6AA 4OIIH 3LJ3A 1EANA 4OLWL 1G9HA 3GYRA 2WJ7A 1ZANH 2RD0A 1QZ1A 2QSCH 4E9XA 4GBXD 3VXUA 5IB3B </