1DBKH

Molecular basis of cross-reactivity and the limits of antibody-antigen complementarity
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
219
structure length
219
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYAFTNYGVNWVKEAPGKELKWMGWINIYTGEPTYVDDFKGRFAFSLETSASTAYLEINNLKNEDTATYFCTRGDYVNWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA DB3 FAB (LIGHT CHAIN)
publication title Molecular basis of crossreactivity and the limits of antibody-antigen complementarity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 40
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1993-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbkH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbkH02
4XPTH 4OZFG 3HNSL 3OJ2C 5C8JA 2YZ8A 1JTTA 4N5EC 4K3JL 2PTUA 2Z31A 4HJGB 1S7VA 3D3VA 2WUCH 4XWGH 5ANME 2JKXA 3P9LA 3R4DA 4HJJH 3IDYB 5ERWA 2AK4E 2G60H 3FT2A 3LQAC 4FP8H 4QRUA 4QXTA 3TO4C 2NY0C 1AO7D 1SY6L 1C12B 1EFXB 4OV6F 4DGVL 3BN9D 1Q9WA 3G9VA 3VXSD 2ADGB 2OR9L 4OUUB 2AJVL 5J12C 5D70H 2DBLH 1K85A 1SJHB 5FA4B 5DGQA 3GMNB 4RNRB 2PCPA 4I4WA 4AH2A 1JN6A 1OGAA 1YNKH 4GW4A 1K8IA 5BV7L 1ND0A 4JREB 5IEHB 4P46C 4ZDHB 2BSTB 5DVLA 3U9UB 3A6OA 4KK5D 1R6VA 3ZT5A 3HZMB 5IFJA 1HSBB 1U93A 1F90L 4KTDH 3VXRE 4NKQB 5L88H 1IM3A 4HUVB 1LMKA 4UIKL 4Z6AT 4KUCF 3IRZA 3B2VL 3T1FB 4E42B 1MNUL 5EWIL 1AGDA 3KWWB 1F4XH 3DV4B 1CE6B 4GMSH 3VXMA 3FQRA 2EDDA 2J8OA 1AP2B 4CW1B 3V5DA 2DQJH 2Y07L 1KYOJ 1OAQL 1UKSA 4DKDC 4U3XA 1CL7H 2FX7L 4GAJH 1H0DA 5SX4H 3MV8B 1G7IB 4X8XA 3ARFD 5KS9E 3QH3A 3MRBA 1OHQA 2DLGA 1H15A 4OFKA 5LCVH 1H8NA 3RVUD 2WBJA 4K94H 1S9YA 4DZBB 2FJFB 3RZWA 3MRPB 4ZUWA 3PL6D 3RI5F 2V5MA 1FAKT 4OKDA 3HUJB 2I27N 2YKLH 4GBXC 3B9KB 1MCWW 3MJ8B 2PTTA 3IU3B 4G8GA 4OZGF 1VENA 2FZ3B 4J2XA 4KROB 1WZ1L 3FQNB 3G08B 3ZHKA 5F1NA 3ULUH 1BJ8A 3B8YA 5JA9A 2BVQA 5BZWB 3KVQA 5D1XB 1PG7L 3GMRA 1ES0B 3FCTA 3H3BC 1LO2H 5CUSL 1KTDB 2DB8A 5I1CH 1WWBX 1EMTH 4L4TD 5ADPL 3F5WA 1CE1L 1A7NL 4WU5A 4A2MA 2BDNL 1ZGLB 1TVBA 3V52L 1Q9OB 1IC4H 1BVKB 1NCWL 4Y1AA 5EZLB 1IGCH 1K4DB 3OKNA 3UTTE 5L2JB 1KBGH 1WGOA 1X5HA 3JWDC 1VPOH 3OAUH 2A6DB 2Y72A 1QFHA 4GQ9L 1OTTD 5IOPB 1QFWH 4YHYB 1IEBB 4GS7B 4N1EA 1TZGH 3NTCL 3MUGA 4ZPVB 5IQ9B 3S96A 3QQ9D 1U9KA 4HKZB 1K4CA 3DTXB 1KENH 4OGYL 3AAZB 3KGRA 4OQTH 5HJ3B 1FNFA 1S7QA 3QDME 2P43B 4XGZA 4KMLB 1HEZB 4LBEA 3U4EB 5B8CA 1CS6A 4X6CF 1HINL 1F2XK 4Y5XA 4PGDA 3D87B 5CLTA 1K8DB 1G6RL 3KYMB 3S34L 4PJEE 3W2DH 3BVNB 3E6HB 4O2FB 1NSNH 5CEXA 2F5BH 1PLGL 2VZUA 4OBRA 5C0JA 4G7VH 1AHWA 2HWZH 3PGFL 1B3JA 1MWAH 1BOYA 5D2NA 3BP6A 3BWAB 4Y5YB 4GRLC 4L8DB 3WNLA 4JFYB 1HXMB 4HV8A 3WIFB 1LD9B 3BX7C 1J18A 4WUUB 4JO3L 5CSZB 4PJIA 1ZAGA 1C5DA 2YPKA 4NUJB 5CJOH 2CPCA 4YGAB 4EIZC 4UUJB 5DD6B 3T0EB 4B7IA 2PR4H 4XPFL 1MCWM 4N8VB 3T2NL 3MLXH 3T3MF 1S7UB 3HI1B 2RJMA 5E4EC 1J1OL 5MHSD 1EJ6A 4D9LL 4JFZH 1H5BC 4PR5A 1A7PL 1QO3B 3MRIA 3LEXA 1ZT4B 2FSEB 3QUKA 5DMKA 3BPLC 4YPGA 1PDKA 2GAZA 1MHHA 3MRHB 1DTUA 3I3EA 4KZEH 3LKNB 3JV0A 1F4HA 3HA0A 2XPGA 4G80B 3FOLA 3OB0K 4K3EH 4RISH 1A22B 5EOTA 4MZ3A 3HMWH 5EA0H 5F9WC 3ZE2E 4XVUD 2G5BA 3INUH 5EUOE 4J1UB 4JQIH 5E94B 1CLOH 1R24A 2CKBL 3NAAL 5HGGS 4ODTL 2QSVA 1AO7B 4UI2A 4WO4D 3VXSB 4MAYA 5E03A 1Q0YH 3LB6C 3NABL 4BKLB 1KB5H 3HMXH 1NMBL 3MV8E 2NY4C 5C9KA 3TN0A 5E5RB 3HNTL 5B21A 1WZMA 3TV3L 2DLEA 3KPOB 5KG9B 4Z78A 1MQKH 2EXWD 5SWQB 3UZEA 5I2IA 3BAEH 1HHGB 1T20A 1Q38A 4KKBC 2WBWB 3Q3GB 5LAXB 4MJ5A 3IDMA 2HVKA 4FZ8H 4NCC1 3RNQA 15C8H 1IFHH 2VXQH 3MBEC 5IW1B 5DQ9A 3WO3B 2QQKL 4WTWA 4Y4FC 4GKOA 4QXUL 1DCLA 1A6UL 1NL0H 3WJJC 4OCNC 1N2RA 2X5PA 5L6YH 4BELD 5IVNA 4LKXB 1JWSB 3QIUC 1RIUH 2Y5EA 5IVXF 4OT1L 1GOFA 4ZTOH 4KMQA 3BXNB 5AWNH 5JUEL 4ZFGL 3PDOB 5TE4L 3MXVH 3CZFA 2ID5A 1OT1A 1HHIB 1DQJA 4JG1L 5T5FH 4U0RC 3TM6A 3WIHA 2Q76B 2PTVA 2CIKA 5LWYL 1MCSA 5F1SA 4PB0L 4P3CH 4X6DE 4HWNA 3NVQA 2XQYG 5C09D 5E7FA 4EBQL 1TQBC 2I07B 1C1EH 4NZRL 3SE8L 2CJUL 3CVHA 4H20L 3OKOB 3UJJH 3M1BB 1FAIL 2FEEI 1QBBA 4QHKJ 3B2UD 4JFPA 2FRGP 5HYFA 4GAFB 1OP5K 5I8OL 3UEZA 4JCMA 3RVTD 3PWPD 3ARBD 3FB5B 4JHBA 4FTVD 1BIHA 4ZNCD 3AROA 2N4IA 1CDYA 1BOGB 2ZSWA 2DQFA 4LK4A 4XBEH 1M6OB 1FFRA 2EC9U 1NLDL 2YD4A 1BFSA 1FH5H 1MHPH 1LHZA 3SDCD 2XA8L 4F3FA 2WLZA 2Z9TA 2FIKA 3PV6B 3SY0A 1LWRA 1CR9H 4NNXB 3BISA 2QBWA 5DMJB 4PJ9A 1KCSH 5DJ6A 4H1LB 1GC1C 2YWYA 3UYRH 3PG2A 3CVHL 1NDGA 3B6SA 4OZHB 4ETQA 5ALCH 4DUWA 1MFAL 4JPKL 1DQQA 4WUUE 4LVOC 3MRGA 3W9DB 2CDFB 3CFJB 3MODH 3EFDH 1V05A 2EEBA 1FPTH 2VZ3A 5F3BB 4Y0GA 5DJZA 5TFSL 2XWTA 3CFBA 4TPRL 4TUJA 3VFWA 5EO0A 4HIJA 1L7TL 1KEGL 4I0CC 1CD1B 4NJ9H 1R3IL 2JIXD 3T1WA 3ZTNH 4N8PA 1FSKC 4ZAKD 4EDWL 3BDYH 3V7MA 3O9WD 4EVNB 3L5XL 2J7LA 2VXTL 2W65A 1YQVH 1QOKA 4FQJH 5H35B 4C4KO 2UUDK 3SGEI 3QFJA 4TQEH 3RWEA 4I3SH 3FZUD 1YY9C 1VKXA 1FNLA 3WUWB 4TYUA 1AO7E 2VITA 2XRAH 3QO0B 3GRWH 4M03A 4Z9KB 2Q8BH 5E8NA 3VXSE 4NPYB 3U7WH 5DJDA 3DX8B 5DZNA 3VFUB 5J1AB 3BRGC 4XNQA 1ZTXL 2XI9A 4P48A 4CMMA 3TESA 1UGNA 4AG4L 1OAYL 3TC9A 4XNXL 4MAUH 3EJYD 3NMEA 4YQXL 4X98B 3EYVA 4KXZI 1JPSH 3V5HB 3HC3H 3O2VL 4OZIE 3IU4L 5D7SL 3HG1E 4FXKB 4LCCB 3PV7A 2EC8A 3UX9B 5I19L 1HKLL 1GPOH 4MWFA 1WSST 3DVGB 3DXAA 1D5XB 4R2GB 3REWA 4NKIL 4X4ZA 4ZUVB 4M61B 3WV0A 2DN7A 3T65A 4J23A 3MUZ1 3SE9H 5KVDH 1Q94A 3TLRA 4MJ4A 4QHNA 3WL9B 4WO4B 4PG9B 3DX7A 4DW2H 2JJSC 3VRJB 2AEIT 2ZNXA 1U8JB 4RQQB 2ZSVB 3TT3L 1JI1A 4Q6IA 1YMMA 5DFTA 4H0HB 4PUBL 3QUXA 3O4OB 1T21B 3BE1L 4XPBL 1W0WA 2XZAL 5GGUA 4I48B 1U8KA 3MGTA 3SGDH 4XNZB 5D6DA 4L9LB 3ES6B 4IMLA 4P3DB 1FNGA 4POZC 4U3CA 5KSAC 2EEDA 4PJCE 5E8PB 4F57H 1FZOA 3CDGB 2B4CC 3QDJD 4ELMF 2ILLA 2VC2H 4UT6H 4TVPD 1Y6NR 3K4DA 5F88A 3RZCC 1JPST 5CJQL 4M5YL 2X7LB 5GGRY 2Y7QA 1KTLA 1YUHA 4WEBL 2IBZY 5L7XH 3ARYA 4LSPL 1F4YL 5JW4N 2P7TA 2HLFD 1DN0B 5ALBL 5FV1L 3ZHLA 4D2NA 4ESKA 1HYSC 4PJFB 2BNQD 35C8H 1QBLL 4WCYL 3TP4A 5C09B 3GBML 2IH3A 4WV1A 1MCFA 4FQQB 3OJVC 1A1MB 2VQTA 2HTKD 5HHPA 2ZUYA 4LHUA 5DHXB 3MRNA 1E28A 3TO4A 3OF6D 2YOCA 2NX5D 2AERT 1HZHL 1RJZA 2OJEB 1FO0H 1IEAA 3N1GC 3BN3B 5DQDH 5FO7A 3MV9B 1SEQH 2ITCA 5E8DL 2R0ZL 3NZHL 2DDQL 3ARBB 4I2XB 4NZUL 1RHHA 4OM1H 1VB9A 1IQWH 4ONGH 3E6FB 4XXCC 5D2LF 5HYEA 3VFVB 4FTVB 2NY7L 2DS4A 12E8L 1OCWH 3FL7A 5HDLA 4MA1C 3FAXA 3QAZB 5CIPA 3QUMA 1DL7H 5L9DL 1FZMA 5GZOD 5F7EL 1D9KD 4P46A 4BQ8A 5DRNB 4RX4A 3RJDA 3SDCB 1I9RH 1WCBB 4X7EC 5F6HJ 3QQNA 3ULUE 4JY4B 4QXGH 1BQHB 3FHAA 2OQJB 3RWCB 3CFEA 3CVIL 1VFMA 5EO1A 1N3NA 2OJZH 3U4AA 1QYGL 4Q58C 2L7JA 3MV01 1U58A 4IHOB 3BUYB 3FO1A 1OLZA 2QQLL 4LQFL 2J2ZA 3LQAL 4G6JH 4K2UH 3PXHA 2Z91B 4CDHA 3EYOB 2NYYC 1P4BH 1K6QL 5A2KH 2K9UA 2D0GA 1CF8H 4HUMB 2BY3A 4W81A 1QBMH 4GXUN 5JDJA 4JE4B 4U2YA 5DUMH 5JZ7D 4PRNB 3L5IA 3K80A 1X5FA 3K1DA 5MHSE 3VD4A 1AXTH 2IFGA 4G8FA 4ZAKB 5KSVA 3O9WB 1MI5E 4D9RE 3QZWA 4AMKH 2VDKH 1AGEA 2R0WL 1R5IB 3I75A 1NCDL 4M7ZB 1YNTB 5EZIL 3O2WH 4EUPA 1J0YA 4UBDD 3BEVB 1WBYA 2BY2A 4PV8B 2X4OB 2DL2A 1UM5H 2BVOA 1OAKL 4GBXA 3QJFB 4B41A 4EXKA 4AQOA 2YPLA 1JCKA 1CGUA 4UV7L 1I8IB 3OJDB 4ODSH 3L3DA 1FQ9C 5HTSA 3BOVA 5F9OH 3DX6B 2EKJA 5FO8B 5E24E 2IPKB 1OGTA 3MBXH 2HT4D 1EERB 4KH2A 2DM4A 3T4YA 3GNML 4ZMAT 4TNWK 5FUZH 3DO3A 1CDGA 1UB5B 5D6CB 3U2SA 2VXUH 3STBA 3WIIH 3QI9B 1WCQA 4WJ5B 2V2WB 5HHME 1U8LB 4WI7A 5C0DA 1ZLUK 2Z8VC 4WFGD 2W38A 4MS8C 3ZMRA 2X41A 1GIGH 2XNAB 3C6LC 1DLFH 1A0QH 4P59L 4P57A 4UMGA 4Q2ZA 3EDDA 4U33A 2J1KA 4LF3B 2F5AL 3U82B 1E6OL 5LXGL 3VH8A 2Y5TA 2J8UB 4M7KL 4X6FB 1WC7B 3MUHL 2JB6A 1QBAA 4QTHA 4HCRA 2EDJA 4P9MH 1RD6A 3OKEA 5T33H 2YSSB 4R90L 4CUCA 1RZJH 1F97A 1BEYH 1KLGA 1CDHA 5FCUL 2C3VA 1CTOA 2QSCL 5JNYA 1UWEH 4EJ1C 3ZDZE 1MFCL 2BHZA 5I30L 3FO9A 5BJTB 2DRUA 1KN2L 3EO9L 1FZKA 1NAML 4XCFH 4XZUA 5DD3H 5EPMA 4PRPD 4TSBH 2XV6B 3ARXA 4GKSA 1E4XL 2DMCA 1OSPH 3RIAF 4HLZG 2DWDA 3MV9E 3U30B 5JOPE 5DR5H 1JPFB 2I5YL 3RL1B 1DJSA 4KK8C 3EJZC 3QDJB 3CH8A 4JM4H 1E27B 4K9EC 2UZIL 4HCRL 5IWLC 3PXJA 4FTVE 1J1PL 4OZFA 2R2BB 3D6GA 2H26B 1IGYA 4G6MH 4P4KD 4CVZA 3H3PH 2BMKB 2Q3ZA 1KIRA 3PGCB 2G5RA 2J4WH 1BHGA 2RR3A 2CLZB 5IFHL 2YMXL 3L95A 1A9EB 4EI5C 3FFCA 4BZ1H 1GGTA 3PP4H 2ZCKL 1I9EA 5HYSB 4PREA 4X5XA 4BFIA 3I85A 4MDJA 3WNNA 2BNQB 2CDEA 4LSRL 2CXKA 4HIHA 1E6JH 5SX5K 5IIEA 4C59B 4UDUB 4YHNA 1U95A 2OP4H 3RVVC 3IXTB 3S4SB 5GRJH 4AL8H 5JW3H 4U7KA 5MEOA 1BREA 4R7DB 4PJIF 1J86A 2NX5B 5CSGA 1U3HA 4ORGA 3BMVA 4U6YA 1P5UA 4OSUL 1UEMA 3DRTA 5B4MD 3KPPA 5GGVY 1CZ8L 5JDSA 1G84A 2EIZB 5ISZD 4NHCL 2OI9C 3KXFD 4PJ7F 2DQUL 3QNYA 1SBSH 3MJ6A 3ECBB 3HE6B 5J6HB 1W8OA 1FC1A 1HQRA 3W39B 1G7QB 3L3KA 2ZUWA 4MA7L 1T66C 5B3NA 4KVNH 3E0GA 4PJGA 5DDHA 4KI5F 5D4QA 5GGRA 3VGHA 3FRPG 2FO4B 3MBEA 4C56D 4ENED 3ZE0E 4FQCL 3KPRA 4Y4FA 5HYQB 1XCQA 3ZL4L 2A6IA 3WJJA 2P5EA 1G9NH 1F42A 3SBWA 4XC3H 5D96B 4JFFD 1EHXA 2BSED 2HRPH 4W6XB 2GKIA 4I18B 1Y6KR 5EU4A 2XN9A 1JZ5A 2NNAA 2OBGA 1NGXB 2C4FT 3TNMB 1FGNL 1ULVA 3SCMC 3TBSB 4AEFA 2OZ4H 1KCUL 4OTXH 3HI5H 2VL5A 5IESH 2DJ4A 5IBLC 1JHLH 4JFEA 4GXVL 3WKMH 3O8XB 5E9DA 4DCQA 2H3NB 3VD9A 5C08D 4NGHH 1FL3B 4NKDA 3D85D 4HT1H 4H0GA 2DOCA 3RVWD 4X9IA 1I9IL 1YJDH 2H8PA 4BSWA 2HLAA 3V0WL 1N6VA 3GMOA 1B6DA 1G0DA 2ERJB 3I84A 4YH6A 4N8VG 4MD4B 4RFNC 2K7PA 3A6CH 2J8UE 4JRYD 5T3ZD 4H8WC 4JZNB 4X9FA 5F9DC 1MCJA 1HSAB 4MZ2A 3WO4C 3GJFH 4NO2B 3RWIA 1N64L 1A4KA 1WFNA 4F8QA 4KKCD 1I1YB 4Z7OF 8FABB 3IJSA 5ILTL 4NRXB 3UPRB 4JN2B 4WW1B 1FNEB 4HWZB 5J9PA 5D5MB 3MCKB 1MREL 3OZ9L 4YO0B 5HD8D 2LVCA 4Z7NF 3S88H 1W72A 2A74A 5EN2A 1QHPA 5IMKB 2KPNA 5CMAA 1I7ZB 1IBGH 2B1HL 1RJCA 2BOBB 5MP6L 3CSPA 2BVEA 3MOBL 5JHDD 2CUMA 1GGCL 3AREA 5DF0A 4V2CB 5C0GB 3PE9A 1OY3B 5E1AB 5LGKA 1MH5B 1NGWB 1X5YA 4PG2A 4QWWC 4PD4K 4TVPE 1JK8B 3D18A 1Q0XL 4U1IA 3EO0A 3ZDYF 1S7SB 5I17A 3HZYA 1JI2A 5DHVB 2GSGA 4PJBF 3F62A 4P9HL 3IKCA 5TE7L 4JG0H 5KAQF 4NQVA 2CRMA 4ONHB 1G7HA 1TJHL 4ZOCA 3RHWF 3X12B 1JWUB 5J57B 1Q9LA 3ULVC 1INEH 5IB3A 1IC7L 2FEEL 1CWVA 3OR7A 3QHZH 1DFBL 5IB5B 5HDQL 2GYSA 3B8SA 4PRPB 3V4PL 5HHNA 2AXFB 3NIFE 2EH8H 4PJ8D 1MCBA 3JTSB 1SJXA 3BHBA 1A6AA 3MACH 3QEQE 3B9KC 4HWBH 4NHUA 2HFFB 5AEAA 1R3JA 1YY8A 3IETA 2OL3A 5F71A 2OSLA 1WBXB 3EGSB 3WFBH 1QKZL 4LASL 3QQ3B 4J6RH 2HMID 2F74A 5ETUA 4U1KB 3RTQD 5D1XC 5EUKA 4Y8AA 4V1DE 4F7CB 1JZ6A 2IFFL 2YPVH 5DJXB 4FXGB 3WEXB 3GKWL 4X4YB 1B0RA 5I1KH 1I8MA 2LAGB 4YXHH 3MRKA 3FOMB 5CEZL 5JIIA 1S5IH 4LKCA 4D8PA 3IDUA 2FJHB 2PF6A 3QDHA 4LLWB 4FQXD 2E9IA 1EGJA 5ICXA 1HHJB 3WFHA 5IT2H 4OLZH 4Z5RB 5EU6D 3TYGL 1PAMA 5HGHA 3D9AH 1YMHA 3DBXA 4YHYC 3P9MA 3BO8A 4H1LG 1S9XB 4NC0B 2YD2A 1J88A 4XNMB 1VACB 5K9QI 1IGML 1DUZB 2JJSA 4LSTL 4XPHL 4ZOEA 1NMCC 3L3JA 3NCEB 2OTPA 3CZJA 3KXFB 3KJ4C 5ID1B 1JGUH 5A1AA 2PXYD 2AJZB 4WNQA 1XEDA 3VWJD 4YAQA 3LEVH 2BOCB 2X4RA 1YEIL 1ZWIB 3OGCA 3C8HA 2EDNA 3WDJA 2OTWA 4DVRL 2O5ZL 2E6JA 4N9GB 3I2CH 4DK6A 2FX8H 2RGSA 1DBML 4NBXB 3KR3L 5KSAA 1YEDA 3K2UH 2C3GA 5D8JH 4RWHA 1T0PB 2A9ML 3UYOD 1EGJL 1YEKL 3W0WE 4XBGB 2H6PB 4PRHA 4EQ3A 4LIQE 4YNYA 2JJTC 4JFFB 4F2MA 4L29B 4FZEH 1MUJA 1IAII 1BIIA 4U6HB 1QLFB 3Q48A 4UNTA 4NBYB 4LAQH 2DQEL 4QT5B 3L7EB 1D5MB 1PQZB 2ICES 3K3QA 4F9PC 4GLRI 4M4PA 2GJ6E 1WIPA 4ZFOB 5I1IL 1TJIH 4K3JH 3HB3D 5C08B 2DD8L 1I7TA 1J1XL 1TIUA 3D85B 2X4NA 1MFBL 5IHZB 1P84K 4LSQL 4KRNA 5DTFB 2IANA 3V5KA 3MRMB 5FYKE 1SY6H 1X5LA 4DGVH 2ZJSL 1NC4A 3VXQB 3TBTB 4E5XB 1NJ9B 2OR9H 1V3MA 3M45A 4I9WD 2AJVH 3BT2L 4DOHB 4JRYB 1LO0L 3ARDD 3LSOA 2ARJB 1UZ6F 2MQ0A 3QUZC 4HKJB 4DZ8A 2D3VA 4NRYA 5BV7H 2BVPA 4MNQD 2FD6L 1IE5A 4HZLA 1D5ZA 3Q6FA 4KRMB 5GRUL 2NZ9D 4PB9L 4YDVA 4BH7A 5SWSD 1F90H 3M07A 3L3GA 4PRPE 3QG7L 2XWBA 4UIKH 1T3FB 5I1HL 3JUZA 5IF0A 3NPSB 1OOAA 5JHDB 3B2VH 4ISVA 1LDSA 1MNUH 2IWGA 5EWIH 5DFVD 5E5MA 2V6HA 4TNVK 4JFHE 4AQ1B 1PKQA 2B5IB 5A2LH 5TH2A 1UZ8A 4R26L 3H6JA 2Y07H 1RFDL 2BHUA 1OAQH 1OTUD 2FX7H 5FM5M 2WWMC 3OPZL 1IAKA 3K4AA 2VLRA 1IL1B 2NZIA 1RZKL 1I3VA 1GYAA 5FKPB 1BZ7A 1KJMB 3D69A 1T7VA 4R0LC 4Y5VB 2NY1D 5EIVA 1QLRB 2BK8A 4J3TA 3KPSA 4PBXA 1UVQB 2ZUVA 4MMXC 2X89A 5L8LB 1SYVA 5C3LD 2F53B 2MOVA 3S36L 1AI1L 2NW3A 4J4PC 2EE3A 2XA3A 1WZ1H 1X5XA 1EO8L 2ICWI 4X6EA 4QGTA 5FHAL 4PJ8B 3GSQA 1FBIL 3CLEL 1PG7H 5CP3A 1HWGB 1A6VL 1OSZA 5CUSH 1QRNE 3ULSB 2MHAB 1EAJA 4CL7A 5ADPH 1CE1H 1A7NH 2YA1A 3MLRL 4ZSOA 4POUB 3GSOB 3V52H 1X4YA 3ILQD 1NCWH 4PLOB 3MLWL 5GPRA 4APQD 1KCRL 3TA3A 4LVNB 4OKVA 4PV9A 1OP5H 3RTQB 4GQ9H 4M4RA 4YHIB 3C2AL 2NW2B 3T3ME 3TH2T 3G6JA 3STLB 3NTCH 5GJTL 3C5ZC 5D7LD 2VTFA 1VEMA 4JFFE 4AT6A 4JKMA 1MCPL 2QTEA 4OGYH 1UADC 4FQXB 4I8DA 4AY0A 4XMLL 5HI5D 5ACZB 3GI8L 2VQUA 1BQHG 3VMPA 1DBKL 4XNYL 1HINH 5ANMA 2X05A 1PYWA 4TN9A 2C1OB 2HN7A 1BX2B 3LPFA 3IFOB 1UXWA 3FQTB 3MJGX 3N9GH 3U0TA 1G6RH 3QP3A 5I6XB 3S34H 4LAQL 3BDXA 4QF1B 1RK1B 4AJ0A 1PLGH 4P2OA 2PXYB 4MSWB 4P2RD 3PGFH 3VWJB 3BQUD 1XCTA 3AS3A 4WI2A 3MCLL 4JO3H 2GCYA 1P9MC 3ULUC 1W2KT 4RBPH 4RMWA 5AZ2L 1S7XA 5IWLA 2EDRA 2QJDA 2UUDH 4XPFH 2D7MA 4RMVA 3T2NH 1I3RB 3TT1L 3VXRA 2P8MA 4E0RB 4HIXL 4IS6B 1N0XL 4JR9L 4KRPD 1J1OH 3C8KA 4D9LH 1NFIB 2Q1EA 3RWGB 1A7PH 1LP9B 1EBAA 1RK0B 4EI5A 3LKRB 4U1NA 1EPFA 5DHYA 2VLJD 1HH9A 3CFCL 5DK3A 1A3QA 5LQBL 1Z9SA 5JHDE 5ESAA 3SKMA 1EXUA 2CKBH 3NAAH 1MIEL 4G8EA 3X11B 4LCCC 4ODTH 3NCBB 5DMGD 2DLFL 5KS9A 4TUOB 3JBG7 1AQKL 2ITDB 4KQ3L 3PJSA 3NABH 3NFNB 5K59F 1NMBH 4NRZA 3HNTH 3L9RA 3ARDB 1IQDA 3DARA 4R2GC 5LKNA 3TV3H 3DOSA 4YBHA 4L8BA 3BPCA 3UMTA 4MNQB 3FN3A 32C2A 1M7XA 4I77L 3C60A 1MJJB 2XWJA 3DRQB 2WP3T 4FFWC 1U8IB 3P2TA 1T2QL 1U92A 1EVTC 3MUY1 2IQAB 2QQKH 3CDCA 4QXUH 5T1MA 5DEZA 5T5NF 4HLJA 1A6UH 3CUPA 1HILA 2F53E 2Y1VA 3MLVH 3P4MB 5SWSB 2PO6C 1I85C 1TXKA 1WQVT 3VE0A 1PZ5A 3O4OC 1J5OL 3NN8A 1A3RL 3LZFL 4ZUTA 2AEWA 3EO1A 3M8OL 4JFXA 1X9QA 4OT1H 3NCMA 3WFEL 1AD9B 4XNZC 3UTTA 5JUEH 4ZFGH 5TE4H 3CD4A 3HPLB 1QR1B 5ITBL 2EDXA 3ZSTA 1CXLA 5H37G 1NC2D 3GHBL 4JG1H 4J3WA 5DI8A 3QA3A 3FT3B 1JUFB 1SEBB 4P5TD 2XZZA 5LWYH 5B3JF 3EUUA 4PB0H 3Q1SL 4JY6B 3IJHB 5TDNA 2HG5A 1PD6A 3PIQA 1MFNA 4NZRH 3MLSL 3SE8H 4PJGF 1A4JA 1IC5L 3BEWA 4H20H 2HVJB 1ZVHA 3QDMA 2E9JA 4I0PC 1FAIH 3L6FA 2A6KB 1FORL 3AXLA 2NY1B 3MJ7A 5BV7B 4MMZC 5HI3C 5I8OH 3D39D 4HJGA 2UVEA 2EXYC 2V7HB 4MHHG 4PJEA 5L2KD 4HH9B 4IOFD 1CYGA 5HYSG 5DA0B 5CILL 3MZGB 4M6MH 1C12A 1EFXA 1J11A 1NLDH 4JGJA 3UBXI 2XA8H 3RPIA 2Y23A 1S3KL 2ADGA 3EHBD 3S4SG 5JIKA 4MCZB 1T04B 1SJHA 5FA4A 2GSIB 1ZE3C 4RNRA 1VGEL 4QRRD 4XCNB 3VFSB 5EDXA 3CVHH 4APQB 1D5BA 3BD4A 4HJ0C 4JPKH 5IEHA 3IAPA 4CNIB 2YN5A 1S78D 4ZDHA 2BSTA 4BM7A 3U9UA 5TFSH 1JF6A 3HZMA 2DQTL 5D7LB 4TPRH 1H9VA 1L7TH 5J11C 1HSBA 2DI8A 1KEGH 2P4AB 1DQDL 1R3IH 4M9PA 2R56H 3S7GA 1NCAL 3GMMB 2R4SL 4Z7UB 2NY2D 3BSZL 4LLQB 4Q7DA 4EDWH 1OWRM 4X6BA 2IPUG 1ACYL 1LP9E 5EUOA 3T1FA 3CFDB 4YEEA 3EYQC 4E42A 3L5XH 2VXTH 1REIA 3VGEA 4NDMB 3DV4A 2UYLB 1ZGLP 5H8DA 3I6GB 2ZNWA 4KU1A 3O4LD 4MJ2A 1AP2A 4CW1A 3P0YL 4HMDA 2AV7B 4WTZG 2VH5L 4FG6D 3MV8A 1G7IA 3I3DA 1U41A 2FO1A 5DD1L 3BQUB 2BHYA 2EO1A 3H9SD 4YBQC 3GM0A 4PRID 2I9LB 1ZVSB 4NWUL 1PEWA 5GQBA 4K7PL 4DZBA 2FJFA 3MRPA 3VMOA 3C8DA 4KMTL 2P8PA 1I4FB 1ZTXH 3MV7B 2FBJL 3HAEB 3HUJA 3MRFB 4K71C 3B9KA 3MJ8A 4AG4H 5AAWA 3IU3A 1IVLA 1OAYH 2VAAB 4XNXH 2FZ3A 4MNQE 4YK4C 1LQSR 4YQXH 2ZP0T 3FQNA 3G08A 3O2VH 5D7SH 4KRPB 4YHPB 1FYTD 1A7RL 3BW9B 3WDHA 5BZWA 2HTLD 1XZ0B 5D1XA 5I19H 1HKLH 1U2HA 5SWSE 4YDIL 2HH0L 2ESVE 3UJTL 1KTDA 3FTGB 2VLJB 4LGSB 3CDFA 2JK5A 1Q9KB 1ETZB 3VXTB 3T8XB 4NKIH 3QI9C 1BVKA 5EZLA 1EUUA 1Z0NA 1K4DA 4OM0L 4X6DA 1BFTA 5K93A 1XIWD 3DVIA 4WFHD 4EIGB 2JJVA 2HKFL 2G9HB 3O3AB 5IOPA 1KUMA 1IEBA 3T77B 4ZUSB 4JKPL 2AXJA 3TT3H 1S9VB 4AIZB 3CX5J 5HDOA 3DI2B 4ZPVA 4WHYH 4ZXBD 5IQ9A 4GAYB 1ZLUH 3BP7B 4PUBH 3DTXA 4OF7A 3X13B 3UDWC 5D7KE 4JPIB 3BE1H 1FIGL 3FRPA 2XZAH 3AAZA 3BI9X 4Y4HD 4DN4L 5HJ3A 5JXAL 1AGCB 1HEZA 3U4EA 4DKAA 4HS3B 5C2UB 1W0VB 4E9LA 3RWHB 5D2LE 2PYEE 5K9OB 4KKNA 1OPGL 5EG6C 5IKCB 4KDVA 1K8DA 2EE9A 1EZVY 3IRPX 3KYMA 4MDIB 1DEEB 3RVXC 3FRUB 5IJKA 4IMKA 2VDQL 2FHBA 2BP3A 3BVNA 3E6HA 4O2FA 2A38A 4LNRB 4XP4H 2EDBA 3MRJB 2JJTA 3EOAB 1ADQA 5CJQH 1G7MB 4M5YH 4EQ2A 4WEBH 2FATL 1NC2B 5FYLD 2V2XB 4Y5YA 4L8DA 4NSKB 5DQJB 4WWKD 1FFQA 5ALBH 3WIFA 1MAKA 1LD9A 4QO1A 4FRWA 4P5TB 2EE2A 4WUUA 3HLAB 2ADJB 1RZ8B 4ETYA 1EHLL 1QBLH 1Y18B 4WCYH 5ICYB 5HGBB 1MAML 5T3XL 2GTZB 3GBMH 3SJVD 4UDTA 4UUJA 5DD6A 4CADB 2YBRB 4N8VA 4OLVL 2GFBB 4K8RD 1A5FL 1CICD 2EH7L 1S7UA 3LRSB 3HI1A 3TJHD 2FEDC 2HRLA 5CFHA 3QHTC 1QO3A 1HZHH 1ZT4A 2FSEA 4LPCA 2W0PA 2GTWB 3MRHA 4OGXL 1P1ZB 5DJYB 5E8DH 2R0ZH 3LKNA 1G1CA 3LEYL 3NZHH 4G80A 4NP4L 4WGVB 5F6IB 1ADQL 3D39B 4NZUH 1MCQA 1KXVC 2HT2C 4ODWB 1KIUA 5E94A 2NY7H 12E8H 4TSAH 1YYLL 3OXSB 4L1HA 5L9DH 2ATKB 5F7EH 1AO7A 4JLRB 5SX5H 1F00I 3VXSA 1TCMA 1WIUA 4BKLA 3OJMB 5C07D 3CVIH 2NXZC 3IS0X 1JGEB 3DECA 1QYGH 4QRRB 1MCEA 3KPOA 5SWQA 3BIAX 2W0FA 3B9AA 2QQLH 3HE6C 4LQFH 5J13C 1HHGA 5B39G 3LQAH 4H0IA 3MRCB 3G5YB 2CLVB 3Q3GA 3L5WB 1A8JH 3IFLL 1DANT 3MV7E 4OZIA 1K6QH 1CCZA 3HG1A 3KLDA 5IW1A 4HUNB 4M93B 1KIPA 1CXFA 1T1WB 1S9WA 4G8GE 1U2CA 3TPKA 4LKXA 4I18C 5CIPH 3NA9L 1JWSA 1J7VR 4PY8I 1CLYL 2CDGA 3MROB 3BXNA 2IMMA 3PDOA 2DQHL 4ZFZB 2R0WH 4L9DA 5EZIH 1HHIA 1NCDH 1XGYL 3LS4L 5DVMA 43CAB 1X3DA 4R0LA 3QEHB 4P3WA 2VR9A 1WEJL 2H9GB 2Q76A 3O4LB 25C8L 3O8XC 4NCDA 3TYFB 2C3WA 2EYTA 1OAKH 5F89B 1ZEAL 3TBYB 4FFVD 4D0CB 1KNOB 4UV7H 2I07A 3H9SB 4G6FB 4PRIB 3RIFK 1JRHL 4JRXD 5E6YA 3LKSB 3RRQA 1ZHLB 2UZXB 4Y4KD 5DK0A 2Y06L 2J6EL 2ERJC 3M1BA 3VFRB 4B53A 4HK3J 4WHTB 3GNMH 1NUFA 2OTUA 3VMNA 5BS0D 3RY4A 2GK2A 3FB5A 5HVHB 5DJAB 5INDB 1NEZB 1FYTB 1BOGA 2QHRL 1M6OA 4Z0XB 3BGFB 3DETD 2D7PA 5EBLA 4O58L 4P59H 1MFEL 5HI4C 4U1SB 4KTYA 2XY2A 3PV6A 4LHQB 2DLTA 4NNXA 2F5AH 1XGRB 3EDKA 1E6OH 5LXGH 4OD3L 3U6RB 3P40A 4M7KH 4H1LA 3GSRB 3QG6A 4FFYL 5F21B 5C92A 3K4ZA 4OZHA 5D2NE 3FKUS 3QDGE 1J12A 3NZ8B 4R90H 3W9DA 4Z0BL 3CFJA 4ZS6D 3FMGL 5FCUH 3LV3B 4OFDA 5C9JA 3WNMA 2QSCH 5F3BA 4PJIE 2DQIL 1MFCH 2E7LA 4YLQT 5I30H 2NXYB 1JGLH 1CD1A 1KN2H 3EO9H 4Y4HB 3HE7D 1NAMH 2FYYB 2VE6B 2HT3C 4PJ7E 3SE4A 1TVDA 5CAYB 3VW3L 1T1ZB 3G6JF 2DQGL 1G7JB 4EVNA 1E4XH 1FP5A 2XTJD 3WHXB 5H35A 2YUXA 1I8KB 2VN7A 1W0YT 1T22B 2I5YH 3GSUA 4ZFFB 4KI5E 1P9MA 2UZIH 3QB7C 4HCRH 3K2MC 1BAFL 1J1PH 4OF0A 3C09C 4HKBB 1A21A 4W4OC 2DM2A 3P0VL 2C26A 4UIMB 3QO0A 5E6IC 4NPYA 5IFHH 3DX8A 3G5ZB 3LRGA 4WWKB 5J8OA 3VFUA 2B39A 1X5ZA 2ZCKH 1QSVA 1AQDB 3BMWA 5F7UA 4LSRH 1EA9C 4WI3A 4XPGL 2MCPL 4BJLA 1F6LL 1B4RA 2A6JB 4X98A 4MGXA 1GXEA 1J87A 3PWNA 3V5HA 5C0BB 3AS1A 2APBA 4E41D 4LCCA 1TZHB 5JO5B 5KANI 1S7WB 3QO1B 4ZOBA 4OQTA 4OSUH 4J12A 4PJAB 5KN5B 1DE4B 5E2UL 4OZFH 3DVGA 1CZ8H 3ISWA 1P2CB 1RSFA 3AUVA 1D5XA 4NHCH 2JCCB 5C0RL 3VI4E 1BWWA 4ZUVA 4M61A 3FQUA 5ADOL 1MLBA 1U3JA 2Z35B 5D1ZC 5GRVL 4MA7H 1AR2A 5TQ0L 3WL9A 3D25B 4WO4A 4PG9A 4FQCH 3ZL4H 5C07B 1U8JA 3BPOC 2ZSVA 4RQQA 3CC5B 1MFDL 5EOCL 4WI9A 3WJLC 1T21A 3H9SE 5IHBA 1VA9A 4P2QD 4Z7NE 5AYUL 1RJYB 4I48A 5KS9F 5E8OB 2QLVB 1FGNH 3DYOA 3ES6A 5T1KA 4DUVA 4P3DA 5KTEL 2D2OA 3KPQB 1T89C 5E8PA 3LRHA 4GXVH 3CDGA 4ZNEE 1I7UB 1WUNT 3U7YL 1VFOA 4LAJH 5DEFA 4WDIB 5D7IB 5FDYA 4U1LA 5DO2D 3ZDYE 2DICA 3BYTA 3IJYB 3V4UL 1I9IH 1EDQA 2N7AA 2IAMC 2VABB 4ZUUA 1LVEA 2X7LA 3MRQB 3O2DA 4PJBE 4OFYA 3TBVB 3V0WH 4Y2DD 4I0PA 4B0MM 1DN0A 5HYJD 1QA9A 2VZTA 4O2CA 2BJML 1IGIL 4NZDA 1TTGA 4HGKC 1ZLVH 1MELA 1N64H 4WFHE 5HHOD 4FQQA 3RDTD 1LEGB 4PP1D 1H3UA 1A1MA 1KB5A 4GSDL 4XCYB 4MJID 3D0VB 5ILTH 2ZUQC 4QHMB 4JRXB 4MQXC 1BZ9A 4Y4KB 5DJCB 4QYOA 4YZFE 2OJEA 1MREH 3OZ9H 2QKIB 2J88L 3DPBA 3OHXB 3LN4A 3MV9A 3GSXB 3LOWA 1T5XB 3MGOB 3ARBA 4I2XA 2B1HH 1AXSB 4Z18A 3E6FA 1A6WL 4XPAL 5MP6H 3MOBH 3SEPA 3VFVA 4FTVA 1GGCH 2ICWJ 1G9NC 5A16B 5JLZA 1ZV5A 1IT9L 4OBSA 3SPVA 3SDCA 4Z76A 1WCBA 4LSSL 3RGVD 2ZOKA 1BQHA 1Q0XH 2OQJA 1ED3B 5DRXB 4IRJD 1YN6B 2OMNA 3BKCL 3WXWL 4KAQL 1BJMA 4F37F 4IHOA 1BFOB 1CIUA 3BUYA 4S0SD 4LEXL 4P9HH 3QJHB 4NQCD 5TE7H 5HHXL 3V6ZA 2EYSB 3EYOA 2E5EA 1TJHH 4NM4L 2H32B 5FYJD 3L5HA 1YJDC 3S3JA 2D03L 1IC7H 4YFDB 4PRNA 3HE7B 1SJEA 5C0BE 5IB2B 1DFBH 5HDQH 3V4PH 4ZAKA 5FXCH 2HJLB 1KPUB 3I3BA 3TIDA 3NCYS 1OQOA 4LCWD 5TF0A 3NACL 2CMRL 3RQ3A 1R5IA 1YNTA 3MA7B 1IM9D 3BEVA 4Y7MA 3O81A 4PV8A 2X4OA 3UTSD 3E2HC 1QKZH 2E27L 4LASH 1EEYB 2XKNB 1A9BB 1E4KC 1I8IA 3OJDA 4S1DD 2EDKA 4HMEA 4PIRF 1U36A 1R3KB 1NCNA 1RUPL 5C6WH 2IFFH 1NLBL 3DX6A 3GKWH 5FO8A 2VRAA 2IPKA 5GRVK 3ARGD 4ONOA 2VAJA 3UC0L 5CEZH 3QIWD 4KWUA 1PEZA 2XFXB 1UB5A 5D6CA 5JOFA 3RKDD 4DEPC 4LVNC 3QI9A 4D0BB 4WJ5A 1UT9A 2V2WA 4E41B 1U8LA 1KLFA 3WHE1 2DIBA 3WLWC 4QNPE 4WI8A 3SQOL 1F11B 3HUJF 1CFSB 1IGMH 4XPHH 4LSTH 4ZODA 5D7IE 3ZKND 4L4VE 4IM8A 5F70A 5DVNA 1C16B 1HOCA 1S9KC 4MYWB 2X1WL 2D7QA 2J8UA 4X6FA 1WC7A 4XI5D 4F7MB 2C7UB 2MFNA 3K81A 3VXUD 1NDMB 1UZ6E 4ELKB 2M2DA 1YEIH 1R3LB 2YSSA 4QY8B 4DVRH 2O5ZH 1DBMH 3KR3H 1F13A 5GRWA 2A9MH 3GRWA 1EGJH 1YEKH 5HY9B 4QRPD 5BJTA 1I9JL 4JJHA 2VKXA 4N9OB 2BVTA 1AKJA 5D9SB 1CN4A 4JRXE 1P7KB 2N1KA 5C0ND 3X3FL 1D6EB 3FFDB 2A83B 1QSZA 1WZLA 2DQEH 2W91A 4EOWH 4OCSL 1CDIA 1VFBB 3KPLB 3FO0L 2QQQA 3ZZ1A 1JPFA 4NNYB 3RL1A 4WFED 3VFPB 5I1IH 3ZKSD 3QDJA 2H2SD 1E27A 1J1XH 4C57C 3O6FD 2FWOB 3D2UD 1MFBH 4OD2B 4LSQH 4G42B 4N0UB 2H26A 4O00A 5IW6B 2FH8A 2E7MA 4UT9L 2ZJSH 3PGCA 2MQCA 3BJLA 2VN4A 4Y2DB 4NFDA 1XR8A 2CLZA 1HHKB 4GO6B 1A9EA 1J8HB 2B8OT 4IEFB 4FABL 3BT2H 5HYJB 5B38B 4FMKA 1FRGL 1LO0H 4MQ7B 1IZJA 1NFDB 3GI9L 5HYSA 5I73B 2BNQA 3QUYC 4J3UA 2FL5B 4HDIB 2NTFB 1CD9B 1KPRB 4IIQB 4UDUA 1EX0A 5HHOB 3RDTB 3IXTA 1A6TB 3S4SA 4Y16D 2ZZUT 4YFLI 4MJIB 5I9QB 2FD6H 1G9EA 3OF6A 4R7DA 1N7ML 5GRUH 1SHMA 3RJQB 1Q1JL 3UJIL 1XH3A 4PB9H 3TEUA 4TVPL 4JKLA 1WTGT 1RI8A 1MY7A 2EIZA 5I18L 3QG7H 3H0TB 3V2AR 4O4YL 4F15C 5I1HH 1YYML 4Q9BA 4KRLB 3ECBA 3F7YB 3HE6A 5J6HA 4Z7WB 5CINL 3I6LD 3W39A 1G7QA 2BNUA 1LILA 1K2DB 1JTPA 3DUUB 2MPAL 1ONQA 5F1IB 2FO4A 4R26H 2RHEA 4X4XB 1AD0B 2OLDA 3WNPA 5HYQA 4IRJB 1RFDH 4HEME 1HE7A 1IAIM 3OPZH 4L1DA 3DVFA 4S2SB 4OI8A 3SDDC 1V3JA 3S8WA 5J4MA 3DMMD 1XF5B 4I18A 4NQCB 3LPGA 5ENWB 3C5SB 3WNKA 1T4KA 4WTZA 3TBSA 2X4UB 3IT8D 1EJOL 5IJVB 2A0LC 3JXAA 3O8XA 2H3NA 2W60B 5KSBF 1DSFL 3S36H 1AI1H 1FL3A 3UTZB 3TZVD 1CG9A 2VLKB 4MLIA 1EO8H 2R23B 5FHAH 1DVFD 1FBIH 4LCWB 2EO9A 2VZ1A 3WN5B 3CLEH 3LD8B 2CXGA 2E6QA 4CGTA 1A6VH 5EZJB 1IM9B 3MO1B 5BV7C 4OF6A 5IG7B 4MD4A 3SE3A 1RUQL 3MLRH 3FB7B 3N85L 3UTSB 4JZNA 1HSAA 2X4QB 4XP6L 1EAPB 5F44A 3MLWH 5M94B 2R8SL 4NO2A 3W0WA 3SQBA 1ZHBB 1KCRH 2YC1B 1I1YA 8FABA 2EZ0D 4PJHB 1S8DB 3UPRA 1YEJL 3C2AH 5I0DA 4WW1A 5CHNA 4HWZA 2WMPA 1C08B 4MA3B 2Z31D 5GJTH 5FB8B 3MCKA 3D3VD 3ARGB 3PGDB 4YO0A 3DI3B 1HI6B 2XXMB 3QIWB 4OGAC 4XMPL 5LGHL 1MCPH 1Y6MR 2DAVA 5IMKA 2XTLA 3CX2A 4UILL 4XMLH 4Y19D 3GI8H 2BOBA 1DBKH 4XNYH 4XCEB 1CL7I 4CDGC 5SX4I 2BXZA 1XGUB 1JNLL 5AAMA 5E1AA 1QHOA 1MH5A 4GKZA 5CBAB 3VFOA 1TNNA 4N0UE 1BF8A 1ZK9A 1S7SA 4LIQL 4U1HB 5DHVA 3VXUB 3NCCB 1N26A 3AFLA 4PLNC 3IDNB 1KT2B 4R96B 1J8HE 5HYJE 5JMOC 1J05B 4ONHA 3MCLH 3H2WA 1NFDE 3S35L 1UJ3B 5GS3A 1JWUA 3DGGB 5IGXL 2PW2B 4QRTA 1SQ2N 5AZ2H 3BIKB 4P23D 1MHCB 4QRPB 2VLME 5HHOE 4OZHF 3LCYA 1RUKL 3TT1H 5IB5A 4UV4L 2AEPL 4PRPA 4HIXH 4W68A 1N0XH 4JR9H 4KJPC 2XICA 2GJJA 5FYKL 3VXMD 1QTYT 5E6IA 3OKYA 2JJUA 3MC0A 3JTSA 1IGFL 1F8TL 4WEMB 3IGAB 4CN4A 2GHWB 2P45B 2HFFA 3CFCH 2CQVA 5LQBH 1J0IA 3O6FB 3D2UB 1QFWI 4PJ5E 5A2JH 1GGBL 3OKMB 4RWYL 3I6KB 3ORJA 3EGSA 1WBXA 2WBJD 4Z7WE 5DSCB 1AY1L 1X6NA 3ELAT 1MIEH 3QPXL 4YPJA 2DLFH 4G43B 3BZFB 3EOBB 1UWGL 4U1KA 1XGTB 4CU6A 3BRFA 1AQKH 1AXIB 3P30L 4M02A 4PJXB 4KQ3H 5T1LA 4F7CA 4HPOL 5DJXA 4FXGA 3WEXA 4X4YA 1GHFL 2EDOA 2VZSA 43C9B 3DROB 3FOMA 3BUTA 4G6AD 2P5EE 3RU8L 4PBVC 2FJHA 4IRSD 4LLWA 2VDPL 1HHJA 4Z5RA 1T1XB 4I77H 1P6FA 5D1ZA 1T2QH 3AM8A 2CSPA 3ETBF 4XVSL 4XH2B 5JHLL 1S9XA 5K9KA 4XNMA 1VACA 4Y1AD 1DUZA 1J5OH 4LVEA 2VLKE 2QEJA 5EU3B 3KXFA 1A3RH 3LZFH 3M8OH 1KELL 5ID1A 3WJLA 3WFEH 1A7QL 2AJZA 4GG6B 4G9FD 4G7YL 4MVBC 5ITBH 2DF3A 1ZWIA 3ARWA 2B1AL 3GHBH 1ORSB 4Y5XC 1AC6A 1B90A 4RAUB 4N9GA 3ARPA 3UTPE 4OF8A 2IALB 3QEGL 4RGOL 2Y36L 1Q72L 3QPQD 3Q1SH 4FS0A 1BQLL 2ED7A 4JFFA 4IOSD 4L29A 3DMMB 1G7LA 4M1DL 4UQ3B 4NO3B 1L9MA 3MLSH 3QWOB 2SEBB 1CFBA 1IC5H 4U6HA 1AHWC 5J1TC 5GZND 4JAMB 5MI0B 5D2NC 1LO3L 3FO2B 2WSKA 4QT5A 3L7EA 2E7HA 1FORH 2IG2L 1D5MA 1PQZA 3LH2L 4L4JA 1UWXK 1BPVA 5GS0C 2APVA 4TSCL 3D85A 3TZVB 4EN3D 5IHZA 4HBQA 1Z3GL 2R9HC 4J3VA 1KXQE 5DTFA 1CI5A 1DVFB 3MRMA 4O9HL 4PY8J 4LCUB 5CILH 2P24B 2LTQC 2Z93B 4NZTL 3W11D 1VGKB 3TBTA 4E5XA 1NJ9A 1S3KH 4LPWA 4NN5B 5EU5A 5JXEC 3QHFL 5GGSB 1VGEH 2FX9L 4KI5C 2KQNA 4HS8L 3KPNB 4HKJA 1QRKA 4F7PB 3TFKD 5KVFL 2KBGA 3B3IB 2VDML 3G04B 4PJFF 3DHJA 3TVMD 3EHBC 2Z31B 4ZFOL 1IEHA 4QRPE 3D3VB 5E4IA 2DQTH 1WVZA 3BZEB 2O5XL 5CWSA 3ZDZF 1KC5L 1GJIA 4KK6D 1JYXA 1DQDH 1BBJB 1LDPL 1OP3K 1ZSDB 1NCAH 3FB8A 3TN0C 4C83B 2R4SH 4Y19B 5CEZE 3V6OE 2DKMA 1T3FA 4KJWC 1MVUB 3BSZH 4I1NB 5C0FB 1YPZB 4NQDD 1KJ2B 1ACYH 4AEHL 5JHDA 1PZUB 3FONB 4MAYD 2JE8A 4LCYB 4ODHH 2RIKA 3HR5B 5D93B 3P11L 4OCLC 5T3ZL 2PCPB 4I4WB 3AS0A 4KJQD 1VDGA 1QSFE 3P0YH 2GK0B 3C2SA 4GH7B 2VH5H 3QCTL 2GY5A 5DD1H 1O7VA 2I26N 1IL1A 3QNXB 4PJXE 4NWUH 3GUTB 4MB5A 4NN7B 4K7PH 5FKPA 1KJMA 4KMTH 4Y5VA 4YR6A 4O2EB 1C7SA 2FBJH 5FDWB 1QLRA 1UVQA 4YDLB 2DKSA 4P23B 3JZ7A 3WE6B 4LPXA 2H2PD 2F53A 5IHUL 2FDBP 5DK2A 4NYLB 1A7RH 4PJ8A 4HIEB 4LNVA 3V5DB 1RJLA 4YDIH 2HH0H 3UJTH 1NBVL 3KYNB 3ULSA 2MHAA 3SDAB 4HLZH 2BCKB 5F9JB 5EBMB 1RULH 4GG6E 1LK3L 1LO5B 3I6LE 4NKMB 5GRXG 4OM0H 5C3TA 5HVHC 3AGVA 3VXPB 4JDZB 1FDLL 4PRBB 2HKFH 2NW2A 4YFEA 4HGMA 3STLA 4JKPH 1U8HB 1J9CT 5FIEA 2VNCA 1MQ8A 4PRHE 4IRSB 5I8KL 1FIGH 4FQXA 4DN4H 5JXAH 3QIBB 2G75B 4TTDD 4HPYL 3QXVA 4D3CL 1EEZB 2R1WB 4F9LC 1ITBB 1BX2A 4LOUD 1OPGH 2UWEB 3IFOA 4BZ2L 3SKUD 3FQTA 4PJ9D 2GQHA 3T3PF 4Y1AB 1FLTX 2NXYC 1T1YB 2YXFA 2VDQH 4QF1A 1CK0L 3ZYIA 2X70B 4QGYA 1RK1A 4QOKE 3B5GA 4M6AA 1G9ML 2PXYA 4MSWA 2GT9B 3U0WL 3AB0B 3MNVB 1YEFL 4G9FB 3VWJA 2FATH 5C0CD 1OD9A 3MUGB 3S96B 4BFBD 2CRIA 5HPMB 5J3HD 1K4CB 2AABL 4DKFL 5AD0A 1SMOA 2AXGA 3GHEL 3PHOB 4L3AA 4OQ1A 4QHLB 2J8UF 1EHLH 1RV6X 1WAAF 5DLML 1MAMH 5T3XH 1E4JA 2VIRB 1MJ8L 1CT8A 4KKLD 3NCYP 4OLVH 1AR1D 1A5FH 3HKFA 2EH7H 4A6YB 4E0RA 1D6VL 2DIAA 4IS6A 3QFJD 1P5VA 1C5CL 2N7BA 3RWGA 2P1YA 4R4NC 5IVZB 4YHLL 1LP9A 4LLYB 3WNOA 1RK0A 1WT5C 5CKAA 3LKRA 4I3GA 5HGDB 4OGXH 3LEYH 4NP4H 1ADQH 5JW4M 1H3GA 2V9TA 1G7PB 1EZVX 4EN3B 2X6MA 5BO1L 1F4WL 1YYLH 1FFOB 3X11A 4HIIA 1AJ7L 4RDQF 2X4PB 4EDXB 3SGJA 4TUOA 2YPKB 3OXRA 5A3IC 2ITDA 1UKQA 2BC4A 3LDBC 3CGTA 4QKXB 3C5JB 4YHKH 3NFNA 3QXDB 5IR1B 1DBJL 3PQYE 3T0VA 2WBKA 2VLRE 5D7JD 4X0KB 3MRIB 4MNQA 3H7BB 4YPGB 4C54A 1MJJA 1U8IA 5EOTB 3TVMB 1FFNB 2IQAA 4KDTA 1TZIB 4GW5B 3UROR 3VH8G 5FA3A 3P4MA 5SWSA 4Q6IC 1LK2B 3M17B 4OLWL 3G6AB 3NA9H 3QUXC 4NQDB 1CLYH 1AD9A 5D1QD 3RUGB 3NIFF 2DQHH 5DUPL 3JTTA 3PHSA 1XGYH 3LS4H 5ECJE 1YMMD 4X9BA 4LVHC 3FT3A 4Z78B 2VMFA 1WEJH 1JUFA 1SEBA 3KAAA 1T20B 4HX1B 1INDL 1ZEAH 4GRMB 4JY6A 3MLZL 2WUBL 3RNQB 2M1KA 4DFIA 4GXUM 2CD0A 3JWOL 5CJBA 1JRHH 3UPAA 2HVJA 1TDQA 4LLDB 2Y06H 2J6EH 1EHAA 3G6JE 3OAYK 2LU7A 5D2LA 3EYSL 4C4KT 2IH1B 3OSKA 4LPUA 2NY6C 2A73B 3VGAC 3OBAA 1O5DT 4JM2D 2XG4A 1OTSC 2V7HA 4PTTB 1DQJB 1GGIL 4HH9A 3O41A 4WV1C 5B38G 2CUIA 3WDIA 1JGDA 2QHRH 2ZPKL 4MXQC 4XP9L 4O58H 4N5ED 2ZG2A 1MFEH 5T5NG 1CD8A 4KDWA 2YA2A 1CGYA 5IBTL 4KGJA 4MCZA 1T04A 2GSIA 1DQLL 4OD3H 4LHUD 3S37L 5J89A 4XCNA 3VFSA 1INQA 4FFYH 3TO4D 2GI7A 4APQA 2NY0D 4FQ1L 2BNRD 5HXMA 1UH3A 1FZJB 1ZLWH 1FGVL 1F4AA 1NGPL 3P73B 4PGBB 4Z0BH 4N90D 3FMGH 4CNIA 3MR9B 3KPTA 4JANB 2DQIH 2M26A 3DYMA 4YDJA 4BFEA 2F54D 5IFAL 4KTEL 2NPLX 4MJ6B 2X1PA 4P46D 4Z7UA 4RGNE 4LLQA 2UZYB 4M1CC 4F3FB 3VW3H 1KLUB 3BP5A 1KCVL 2DQGH 4WVRA 2W9DL 2YD5A 3CFDA 3SY0B 3R8QA 1ZXQA 5D5MF 1XGQB 4ONFL 2UYLA 3I6GA 3DURB 3S97C 4H1LH 4HUUB 4JDVB 1I3UA 1BAFH 5GS1C 2AV7A 5I16B 1DQQB 1NCTA 5E7BA 1KTKE 2ARWA 1TPXC 5C0CB 2I9LA 1ZVSA 3VFNB 4TUJB 4YGVB 3IDJA 3PDGA 1I4FA 3MV7A 3VG9C 3HAEA 2MCPH 2YUZA 4XPGH 2HP4A 3F6IA 1KYOK 2O61B 1NUGA 2VAAA 4OFVA 3WFCL 1QPPA 4N1HB 4D9QE 2R1YB 1YDPB 2FJGB 4GW1B 1QEWB 4YHPA 3QCUL 3V7AE 2Y6SD 1XZ0A 1I3GL 4GBXD 3GIZL 2P5WB 5E2UH 2YPLD 3MLPA 3FTGA 2VLJA 4N0YL 1KOAA 2LFGA 3VG0L 5CD5C 5C0RH 1R5WB 1Q9KA 4NQDE 1ETZA 5E8NB 3VXTA 4EI6B 3ARSA 5ADOH 4FQLL 5MENE 1G6RA 3LKQB 2NY3C 1X7QA 1KACB 3KNBA 1FC2D 5TQ0H 4CMMB 2VZVA 3KLHC 2KL6A 2G9HA 1P7QA 3O3AA 4WHDA 3VD5A 3T77A 4ZUSA 4I0KA 3BGAA 4AIZA 1MFDH 1F3DJ 4GAYA 5EOCH 3BP7A 3X13A 4JPIA 4KK9C 4UAOC 5AYUH 5D7JB 3LY6A 1AGCA 4NQEE 5ACMA 4HS3A 2B0SL 1W0VA 2XXCB 3QISA 3RWHA 5KTEH 2FGZA 5K9OA 4WU7B 3KDMA 4K3DL 4JCLA 5IKCA 1JZ3A 4JHZA 5FOBB 1P69B 3T65B 4MDIA 5CZKA 1DEEA 1KBGL 3FRUA 3U7YH 3WSQL 2ADIA 4NQTA 2FECL 1NCCL 4LNRA 3IAQA 3CDYA 4UINL 3V4UH 4XAKE 3EOAA 3DX7B 3VWKC 1NAKL 1G7MA 5D1QB 1CDJA 1FCGA 1NC2A 1AH1A 2V2XA 3ZLQC 4NSKA 5DQJA 3KS0H 3QDGA 5GGQL 3FT4B 2CKBA 3HLAA 3S5LB 4WFFE 2BJMH 2GUOB 2QR0A 2ADJA 1RZ8A 1IGIH 5ICYA 5HGBA 2GTZA 3ILPB 4JO1L 4ZS7L 3EDJA 3MREB 4CADA 4GSDH 2YBRA 4GRLD 2JELL 2GFBA 5TF1L 2ORBL 1YECL 3LRSA 4HK0B 1KB9J 1HKFA 2AJ3B 4PJ7A 9CGTA 2VZOA 3OAZK 3W2DL 2YD8A 2PN5A 3VA6A 2J88H 5I73C 2GTWA 5GISL 1P1ZA 5DJYA 5JXEA 3T4AB 3B43A 4JM2B 3DX9B 1PBYA 4ODWA 1JMZA 1A6WH 3O2DH 2YD1A 4XPAH 1KB9K 3UP1A 3OXSA 3HCVB 3WFDL 2GEEA 1IT9H 4WGWB 1OAXL 2X2YA 5JTWA 1JYNA 4LSSH 1KIQB 5GS0L 2IH3B 2W9EL 1U3HC 5DRZA 2H41A 3IDIB 2QSTA 4FHBD 3BKCH 3WXWH 4LHUB 2DTML 4KAQH 4QRRA 3MRNB 3TO4B 5HPOA 4LEXH 2NY0B 2B2XL 4JFZL 2BNRB 5I1EL 3G5YA 3F58L 3HI6L 5HHXH 3GSVB 1IEAB 4WTXA 5KSBB 3L5WA 4FA8A 3LB6D 5GJSL 5J12B 4RISL 4NM4H 4K3EL 1UENA 2NY4D 1TETL 1GH7A 3VI3E 2D03H 3HUJE 2F54B 1A14L 1JGVL 2EKSB 1G0YR 4KKBD 3QUMB 5F72S 3SBWC 3F7VB 2AQ3A 1P4LB 1UH4A 3MBED 3MROA 1JF1A 1UM6L 1EUTA 2P5WE 3KPRD 4Y4FD 3NACH 4ZFZA 2CMRH 1LE5B 5EO1B 1LEKB 5TGBB 1NQBA 43CAA 4OJFL 1LE9B 2LV4A 4CN1A 1YEGL 3QEHA 4MQTB 3UZQA 1JFQL 3FO1B 3O4LA 5FHBL 3HR6A 3TYFA 3QIUD 5F89A 1ORQB 2E27H 3TBYA 3VCLB 4YBLC 4D0CA 1KNOA 5TE6L 4IOIB 2CGRL 1X5IA 3H9SA 3ARFB 3LD8C 1RZIA 3LKSA 1RUPH 3VFRA 1NGQL 3V95A 3THMH 5EB9A 1XGPB 2PW1B 4WHTA 4N0CC 3UC0H 1KULA 3PL6B 2F8XC 5KSVB 3QZWB 1JPTL 4ZNEA 2O5YL 1CGWA 1AGEB 4GQPH 1NGZA 5INCB 4PP2B 5T3XE 4EUPB 1OF2A 5INDA 4J7RA 1WICA 2R4RL 2ENSA 3DIFB 3STZA 1FYTA 3SOBL 3TBWB 4DN3L 1BVZA 4Z0XA 3SQOH 4DK3A 4P9HC 1YC8A 4PJBA 4U1SA 1B2WL 1M7DB 1HXYB 3MLTB 1XGRA 5KSUA 3VGDA 3U6RA 2ICWB 2EDTA 2VSDA 4GKNB 4L4TB 3GSRA 5TDOA 3FAWA 2I25N 1S7TB 2R2HA 1RUMH 3ROLB 3IKKA 4NO0D 4YUEL 4U1GC 1FJ1B 3T4YB 3NZ8A 2BX5A 2ATPA 3AREC 4N5UA 4UTBL 5F7MC 3HNVL 4H88L 3NCJL 4F9LA 1BF2A 1KXTB 3LV3A 1FN4B 4PG2C 1FLRL 1TLKA 5BXFB 2ICEB 1I9JH 4Y4HA 1KTRL 3T0EE 4XWOC 2FYYA 2VE6A 3X3FH 4Y8DC 5JW5A 4RA3A 3P4NB 3GSNB 2X44D 3IXAA 1G7JA 1IMHC 4OCSH 5KVEL 1MCRA 3WXVL 1C5BL 3ZKXC 4LRIC 3FO0H 4QCIB 5ABDE 5T1DL 1I8KA 3O0RL 2JB6B 4ZOAA 1OD7A 4ZFFA 3CFKB 3UTQB 1PX3A 1ZKAA 5I74C 3HPJB 2I9TB 4HKBA 4M62L 5ALCL 5EIQA 1V3LA 3SDXF 1R3HB 3HZVB 3V6OC 4J3OC 1KF9B 4UT9H 5IW3A 5JQHC 3G5ZA 4WWKA 4FABH 1YY9D 1V3KA 3C6SA 5H37H 1FRGH 4LGRB 5F7KC 3GI9H 1AQDA 4PLJC 1PW3A 1WT5A 2JTDA 1FNSL 2BNRE 3LN9A 3HZKB 4Z8FL 3OR6B 2A6JA 3O3DB 4MNHA 4ZQKB 5KSBE 4GRLB 4N90E 3VGBA 1QP1A 5C0BA 3U4BL 2AI0L 5JO5A 4M1GL 1S7WA 1N7MH 3QO1A 1EHNA 4PJAA 5KN5A 4TVPH 1FG9C 4YXLL 5I18H 4TVSa 5HVWA 5HVGB 3KJ6L 4O4YH 3MOQA 1OW0C 1YYMH 1GCFA 1B88A 5CINH 5FYLL 1JIBA 1H5BB 2Z35A 4ODXA 5J56B 1LP9F 5DJ8B 1I1FB 3NIDE 5IK3A 5EU7E 2CDEB 2HFEA 2MPAH 4LQ1A 2YRLA 3D25A 1XMWA 1X5KA 5F9WB 1GAFL 4FMFA 5C07A 3CC5A 5A2FA 3H8NA 5DEGB 5F96L 1K5NB 2EYRB 4K8RL 4UU9B 1YNLL 2AKRB 2VR4A 3BIBX 1RJYA 4U6YB 1FYHB 1YC7A 3K0WA 5E8OA 3S9DB 1CFQA 5JA8B 3BRDA 4KKAC 5FF6B 1EJOH 2NY4B 2XY1A 3R1GL 5AYQA 4NQSB 3QNYB 4M48H 1I7UA 4DWHA 2E9WA 1DSFH 4WDIA 5D7IA 4L4VA 2YUVA 3BH9B 4CVUA 3ZDXF 1A2YA 3OG6B 2VABA 3MBEB 3D0LB 2YRPA 4POZD 5KSAD 3MRQA 3HRZB 1CXIA 3O45B 2WWKT 3TBVA 3TJEL 2ZG3A 4Z7VB 4L4TE 4QRSB 3N85H 3QIUB 3RZCD 2KQMA 4XP6H 2R8SH 2R2EB 3IS1X 1WF5A 5BW7A 1LEGA 2QQNL 4OZHE 4XCYA 3FB6B 3W81A 1LNUB 2VL5B 3CSBA 1WTLA 4QHMA 1HYSD 4JRXA 3MOAL 5DJCA 4Y4KA 4F7TB 5FGSA 1LEIB 3A6BL 2YWZA 3QEUB 1KJ3H 2EDFA 5E1HB 2QKIA 4D0DA 4XMPH 5LGHH 2IAND 1TQBB 4CRPA 4UILH 3GK8L 4XTRC 2WINB 5BQ7B 2Q7NA 1AXSA 1NC4D 3ZTJH 4EKXA 5JPNB 3PWPB 1VERA 2P8LB 1JNLH 5C0AD 5DMIL 3V0VA 5FECA 4JZOA 5ESQB 1RZKC 4HWUA 1EBPA 4OCYL 1ED3A 2VISB 5DRXA 3DHMA 4LIQH 1DZBA 1RIVL 3QR2A 1BFOA 5I8CB 3QJHA 3V7AG 3CCHB 3UBXB 4L3CB 2EYSA 4NO0B 5D93C 1OP3H 2A74B 5EN2B 3S35H 3GGWB 1TJGL 5IGXH 3GKZA 3VXNB 1FNAA 3L5JA 4PBWD 4GAGL 4IBLT 5LJYH 5M7QA 4LDEB 5MEPB 1QSED 1TVHA 1JWMB 3U48A 4JFDD 5GS1A 5DZLA 1RUKH 1CD0A 5IB2A 2ZOLB 4AM0B 4UV4H 2AEPH 2NYYD 1VFAB 5FYKH 2JIXB 4HG4J 2HJLA 3D18B 1KPUA 1TMCB 4H26B 3VRIB 1IGFH 1F8TH 1BZQK 3MA7A 2OJZL 2IADA 4FQ2L 4P23C 1HWHB 4L8SB 3F7PC 5FUCE 4Z77A 2IJ0C 2YD6A 5DHVH 4Z7UF 3F65A 1GGBH 4G6JL 4RWYH 4HG4K 1AY1H 4NQVB 3BDBA 4DJMA 2XKNA 3QPXH 4XHQA 5GIRB 1UWGH 1EVUA 4G9DB 3KPSD 3IDGB 1ZA6B 3P30H 2PYFB 3TF7C 4HPOH 1R3KA 3SDAC 2NR6C 2FIRT 1GHFH 5HHVH 3RU8H 1KJVB 2KZWA 2MCG1 2VDPH 5F3HB 4YC2C 1PGRB 4LDLB 2YD3A 4D0BA 3TA3C 4E41A 2XQBL 1DUYA 1TTFA 3TH3T 4NHUB 1U8NB 1KG0B 2JF1A 4XVSH 1F11A 2AJYL 1CFSA 1NAMA 3IETB 5JHLH 2OL3B 3X14B 3N1MC 2VXVL 2F74B 3AU1B 3JSSA 1KELH 3CU1A 3QIBC 4F7MA 2C7UA 1U8MB 1A7QH 2DYPA 2BSRB 4G7YH 4MS8D 4ELKA 3C6LD 2KKQA 1R3LA 2B1AH 1I8MB 4QY8A 3VXOB 4LFHG 1MJ7L 1F02I 2R69H 4MQSB 4PJFE 5ICXB 3QEGH 4ALAL 5JPMB 4RGOH 2Y36H 1Q72H 3U79A 5HY9A 4M6OL 1BQLH 1SM3L 2P49B 1NGYA 5C09E 5FO9A 3DBXB 4M1DH 3SDYL 2GW5A 5D9SA 4KPHL 4P2OC 3BO8B 2AK4D 1KN4L 4LRNL 3BWUC 3VWKA 5CGYC 3FFDA 2A83A 1LO3H 5H94B 1UFUA 5L8KB 2KUTA 5E8EA 2IG2H 1WBZB 1VFBA 3LH2H 3KPLA 5EBWB 1QFWM 4X5WB 4NNYA 3ME0A 1PKOA 3RX5A 3VFPA 4TSCH 1BM3L 1M7IB 2FWOA 3PWPE 4OD2A 4I2XE 1Z3GH 4AYFA 4N0UA 3EDFA 5IW6A 4LPTA 4O9HH 5KSAB 1X44A 2QADC 5EORL 4RGNC 4NZTH 4X9HA 4KK8D 4Y2DA 4UNVA 4F33A 3EJZD 1J8HA 4WI6A 4WI4A 3U46A 5HYJA 5B38A 5DMYA 3QHFH 4MQ7A 1NFDA 4QTIL 3RZCB 2FX9H 3VXRD 1UQSB 2FL5A 2LQRA 2NTFA 4HDIA 2X1OA 4HS8H 5I1AB 1ZT1B 1CFNA 1KPRA 3KG5A 4N0FB 5HHOA 3RDTA 1IJ9A 1A6TA 1NKOA 4RIRA 3CXDL 4MJIA 5KVFH 4HFWA 4EI5D 2VDMH 4R97C 2LABA 4LLMB 3QSKB 4HHAB 5CD3A 1I7TB 2AVGA 3JUYA 1FVDB 4NQXB 3H9HB 4DGYL 3ARUA 1G0XA 2O5XH 2V5RA 3TWCL 1KC5H 2IANB 3V8OA 1LDPH 3RVVD 1HYRC 4PJ5A 4AEHH 4Z7WA 1T03L 3RPKA 3C60C 1K2DA 5C0AB 3P11H 5T3ZH 3DUUA 3BPNC 5GGSY 1SYSA 1E4WL 5F1IA 1D9KB 2X4TB 4X4XA 5I8EB 1AD0A 5IMOA 2CK0L 4IRJA 4ODUB 1TTUA 3MYZA 3OKDB 2EDWA 5J1SC 3QCTH 3QWRA 2C1PB 1RIHH 4S2SA 4Y89A 4JEGB 4MA1B 1T66D 1XF5A 1X4ZA 4NQCA 4P2CG 5ENWA 4YDVB 4MCYB 2PETA 3C5SA 4XHJC 2AS5M 3VRLF 2X4UA 4OV5B 5I71C 1MCKA 5IJVA 4GRWB 1B9ZA 1ZOXA 1QSEB 3IFPB 2W60A 3T3PE 3UTTD 4JFDB 5IHUH 3UTZA 4UTAL 4LLVB 2VLKA 4X7CC 5DC4B 2LVEA 3SCMD 3S5LG 1UZ8B 2R23A 3LKOB 3VFTB 3P4OB 5MERB 1BQSA 4LCWA 1MRDL 1JV5B 3WN5A 3MLYL 5IBLD 4U2ZA 4GT7A 1IM9A 1NBVH 3MO1A 5IG7A 3RI5K 2E8YA 4X7DC 3FB7A 3UTSA 4BA8A 2E7CA 3VI4F 1LK3H 2RB8A 4JFOB 4OD1L 2X4QA 3BH8B 3QDMD 1WAAE 4KV5E 3D69B 3LKPA 2YC1A 2ZKHL 1Z9MA 1BMGA 3GIVB 1S8DA 2HJFB 1PY9A 5FYJL 3IDYC 3ET9F 1C08A 4MA3A 1DBBL 5FB8A 1UACL 3ARGA 3PGDA 2Z4QB 1HI6A 3FQWB 3QIWA 4X6EB 4OFPA 3ZKMC 2OS7A 3KLAB 3TNNB 2X4SB 3AY4C 5I8KH 4YX2L 4P5KB 1T6VN 1MPAL 3GSQB 3EFFB 1KFAL 1DLHB 4HPYH 5ICZB 4D3CH 4LDOB 3QWQB 4G3YL 5I1LB 4XCEA 1EEQA 1A64A 4JREC 1XGUA 2A1WL 3BZ4B 4BZ2H 3D5OF 4U6VL 2CK2A 3QDJE 4BSVB 4OZ4B 1CK0H 3EW3B 3JV6B 1PG7X 5FKAB 1G9MH 4U1HA 1K9TA 3U0WH 2BRQA 3VXUA 1YEFH 4H5SB 1DBAL 3C6LB 3IDNA 1KT2A 3CLFL 4R96A 1FV1B 4QWWD 2OXGA 2AABH 1J05A 4DKFH 2WWKO 3GHEH 1UJ3A 3G6DH 1Q8MA 4KFZC 4LRIA 1KPVB 2PW2A 2UY6A 3BIKA 3O3BB 5DLMH 2BNQE 4CBPA 1MHCA 4QRPA 1X4XA 1MJ8H 2LE9A 1Y0LA 2HN7B 3JV4A 4JB9H 2XKSA 1UXWB 1VSCA 2AK4B 2YS4A 1D6VH 2W1NA 1BP3B 4R7NB 3O6LL 3V6OA 5CEYB 1C5CH 1MEXL 4YHLH 1QLEL 2C4FU 2NX5E 4FQHB 4S1QL 3ULVD 4YZFF 3IGAA 3UAJC 1B4JL 3MV8D 4QRQB 3D2UA 4ZD3L 4M3KB 3OKMA 5BO1H 1F4WH 1QSFA 5A2IH 4KROC 5C0AE 1S7RB 1AJ7H 4G43A 3BZFA 3EOBA 5FAAA 1XGTA 4P4KB 1TFHA 4PJXA 4PLKC 1QNZL 2E6PA 2WV3A 1TENA 2LU3A 3L3OB 43C9A 3DROA 1DBJH 3ALWA 3QQ4B 4KUZL 1N4XL 2D9CA 3ZT6A 1OW0A 5D1XD 2APWA 1T1XA 4DKEL 2VDRL 1V7ML 4HWBL 4QHUB 4GRWE 1HDMB 1MF2L 4XH2A 1QSEE 4TNWF 5DYOB 2BFVL 3OKLA 3WFBL 5DVOA 4GS7C 3PWLA 1SVCP 4OLWH 5EU3A 4L3ED 4MNGB 5ISZB 1JNNL 4LP5A 5CZXC 4GG6A 1IC1A 5CBEA 5DUPH 1RQ5A 4PJAF 3ZYOA 4HMCA 3L9RB 4YXHL 3OGOE 1ORSA 2CIIB 1V5JA 4RAUA 5HHQB 5E6ZA 4PYGA 2JCCF 2OI9B 3E3QE 5EOQL 3LIZL 2ZG1A 1INDH 32C2B 4C56B 5JR1L 5FYJU 5IJKC 3MLZH 2WUBH 4IMKC 1HNGA 3DMMA 2AK1L 1I1AD 4UQ3A 3QWOA 3JWOH 1NCBL 1ROWA 2SEBA 2CR3A 5E00B 1UCBL 4MD5B 3DSFL 4ORZC 1B6UA 4OAWB 3FO2A 1KGCD 2D7OA 4Y5YC 4A2LA 3EYSH 4ZUTB 5D5ME 3HNSH 1QVOB 2B20A 3QRGL 2VUOA 3WUWG 4RAVA 2FBOJ 3TZVA 4HUXA 1RZGB 1GGIH 1U91B 5DI8B 3SCMB 3VDAA 3T0EC 4QOKA 1DVFA 2ZPKH 2P24A 4QNPF 4WFGE 2Z93A 5HVFB 4XP9H 1VGKA 1I1RA 3JV5A 2E3VA 1UM4L 5D7IF 5IBTH 2H45A 3CIQA 5GGSA 1DQLH 4HD9A 3S37H 3SKOB 3QCVL 1A6PA 3PWVB 5E2TL 4FQ1H 2F19L 3GJFK 4IJ3B 3AXLB 4F7PA 3MJ7B 3BKML 1FGVH 1NGPH 3B3IA 3HHRB 3G04A 4RFNB 4RFEB 1TJIL 3BN9C 3OB0H 2GIYA 4PJEB 3WO4B 3BZEA 3QUZD 5IFAH 4KTEH 3EIFA 5GSRB 4OIIL 3NGBB 4LMQE 1BBJA 4C83A 1ZSDA 3N50A 4Y19A 1MVUA 5C0FA 3V79C 1YPZA 4ZYKB 2W0LA 3RPIB 1KCVH 1KJ2A 2W9DH 3FONA 4LCYA 3MRLB 3HR5A 4ONFH 1WFUA 4P4RB 2Q8AL 2M8XA 3IVKB 4KK5C 1D5BB 3BKYL 1MCOL 4Q9RL 1ZS8B 2GK0A 5EZOL 3T2OA 1FE8L 3LS5L 4M8VA 2HA1A 3HG1D 3PQYA 1HQ4B 3C87A 4DAGL 3QNXA 3GUTA 3EZ8A 4XT1C 3WS3B 5EU7C 4NFBA 4K7PY 4O2EA 5FDWA 1NBQA 3RX7A 1BBDL 2WWMD 1QZ1A 3LN5B 4P23A 3WE6A 3ZKQD 1N5AB 4X6BB 1JVKA 5EUOB 1AGBB 1V8HA 3WFCH 1KJ2L 4POYA 5E95B 1T6WA 4NYLA 3BP4B 3ARFC 3V4VL 3QCUH 1MVFA 2EE6A 4HIEA 2G2RA 1I3GH 3RVUC 3GIZH 4R4FL 1FFPB 2X1XR 3KYNA 1A1OB 7CGTA 3PL6C 3SDAA 5IMLB 4N0YH 4NZJA 2BCKA 4MNGE 3VG0H 4JVUA 4J4PD 3S6CA 5ISZE 4QXWA 4TTGA 5A43C 5KOVC 5F9JA 5EBMA 3KXFE 2VXSL 1WLHA 1LO5A 4NKMA 5I66B 2VDOL 4FQLH 2BDNH 3VXPA 5EBGA 1Z5LA 2P8PB 4JDZA 5GRZA 2EICA 2C3XA 2Y6SC 4PRBA 4XC1L 3HAEH 3RL2B 3B9DA 5IP4A 4WRLA 4C56E 1U8HA 3UTOA 1E4XI 3S3SA 4IRSA 2Z8WC 4JQXC 2IMNA 5F7FA 3QIBA 3DJ9A 2VDNL 2G75A 1X5GA 1EEZA 2B0SH 1KCLA 2R1WA 2E8ZA 5EU6B 3PF2A 2JK5B 3C5ZD 1B0GB 2UWEA 3SDXB 4K3DH 5I76B 4X7FC 1OTTC 1CLZL 2YEZB 4X6DB 3WSQH 1T1YA 1I1CA 4PRAB 3UBXG 5KBNC 5TPWL 4HQQL 2E7LC 1NANH 5C08E 2D31B 2X70A 3QQ9C 1NCCH 3I02B 4L3EB 4UINH 3X17A 4N0RA 2GT9A 4L8CB 1NAKH 2W9LA 4G9FA 3MNVA 2V5SA 2XYCA 3SE4C 1T7YA 3CPLA 4U49A 5HPMA 4K7FB 3MRRB 1NMCB 4N8CL 5GGQH 2Q6WB 2WM0A 4DOHE 5J06A 4M3JA 3PHOA 3KJ4B 5DJ0B 4JRYE 4QHLA 5CZVL 5T3ZE 3DYPA 3MLUL 1A6ZB 4JO1H 4OCWL 2VIRA 5EULV 2EDEA 4ZS7H 1UH2A 1I1AB 2YD9A 2JELH 4C58B 3HS0B 5BOPA 3N9GL 5TF1H 4A6YA 2ORBH 3D48R 4UT7L 3KPMB 1YECH 3ZO0A 3ULUD 5IVZA 4YDKL 4LLYA 3Q5TA 1FL6A 3BD5A 4XRCB 5HGDA 5GISH 5JMRA 5ID0B 4PJDB 5BRZD 1G7PA 4EN3A 4AENA 4DGIL 2Z92B 1OAZL 1FFOA 3WFDH 1ZLSL 2X4PA 1OAXH 4EDXA 1AIFB 4RSVA 5GS0H 2W9EH 4UDTB 3C5JA 3QXDA 2DTMH 4RGMB 5FUCC 3MTRA 3GMLB 5IR1A 3MGAA 1JPGB 2BY0A 4NT6B 3RNKB 4A6YL 5E2VL 2B2XH 2EC9T 4XVUC 5I1EH 4XMKL 3F58H 3HI6H 4X0KA 4R8WL 1MI5D 4D9RD 1AE6L 3H7BA 2V2TB 4UB0L 5DVKA 2BZDA 5GJSH 3U0PA 1NFDF 3TVMA 2CR6A 3WLBB 1FFNA 1TETH 4R2GD 1TZIA 2DWEB 4WO4C 4GW5A 2AJUL 4GUPB 3F7RA 5IB1B 1MRCL 2ZCLL 3QUZB 5D71L 1A14H 1JGVH 5FK9B 4BSJA 5DXWA 2IQ9L 4OB5L 1LK2A 2ICCA 3M17A 3G6AA 3RAJL 4CVWA 3PDDA 2EXWC 4FFWD 4NQDA 2VL4A 4LPYA 2B7DT 3PNWB 1UM6H 4HF5L 4FOMA 3RUGA 3ULVE 2NTSP 2VOTA 5MENA 5TQ2L 4ZG1A 4OJFH 4IDJL 4L9LC 2PO6D 4MB4A 1YEGH 1JFQH 3WS6C 2W0FB 4XXDB 5FHBH 4HX1A 1D3CA 3I50L 5F7YC 3MJ9A 4UNUA 3V9FA 4GRMA 5SWZD 4Z7WF 2FB4L 2MJWA 5T1KD 5TE6H 4OZIB 2CGRH 3HG1B 5HHMD 4EBQH 5IMMB 1KIPB 2O26U 1H8SA 4RDQG 5FUOL 3MLVL 4NQEA 4LLDA 1S9WB 2CJUH 1NGQH 1JZ8A 1CIDA 4M8QB 1RY7B 5I1GL 4R4BB 2IH1A 2Q7YB 2O93L 3U36A 1UG9A 2A73A 7FABL 2CDGB 3E8UL 5ITFB 1JPTH 2O5YH 4OFYD 4PTTA 3UO1L 5EU6E 4I0PD 4R0LB 2R4RH 1K3IA 3SDXE 2V5YA 3SOBH 4DN3H 2EYTB 1BFVL 1ZT7B 4PGCB 3EZJB 1JHKL 2R2CA 5HI3D 3ARTA 4N68A 1B2WH 3MJ9L 2DQDL 3B2UC 2VQ1B 4L3EE 2EXYD 1MJUL 5EC2B 4OUUA 1OVZA 1LO4L 2X42A 5CP7B 3AY4A 2HKHL 4JKWA 1B0WA 3RVTC 1RVFL 3GMNA 4P99A 3ARBC 5DK0B 1X6LA 3VFGL 1FZJA 4YUEH 4G6KL 3P73A 4UTBH 4PGBA 3HNVH 4H88H 4PJCB 5AG9A 2OTUB 3MV9D 3NCJH 3QAZC 5JOPD 1MFAH 3MR9A 3VD7A 4JANA 3SDCC 2XACC 3OX8B 1FLRH 4CJ0A 1MHEB 5FCSH 2RQ8A 3R06B 4MJ6A 4HJ0D 5F7HA 4PJHF 2LAAA 4M6ML 3U7AA 3WIHL 5EBLB 4WEUD 4ODBD 1KLUA 1KGCE 4HUVA 4WY7L 4HEPG 3IYLW 5KVEH 2ZWLT 3WXVH 1C5BH 1JNHB 4O02L 3C5ZB 1XGQA 2NLJB 4PJDE 5T1DH 3O0RH 3GB7B 2BXYA 3QG6B 4K55A 3Q5YA 3KWWA 3DURA 4HUUA 4JDVA 3VFMB 3SO5A 2A77L 1CE6A 8CGTA 4M62H 5I16A 3ARZA 3EYQD 1T0MB 4TNVF 3ZE1F 5C9JB 2CH8A 5C0CA 1FL5B 4P2RB 4JQVA 4ZAKC 3VFNA 1AGFB 1CFVL 3O9WC 1BVLB 4YGVA 5JORB 3RY6A 1U3YA 3V0AC 4I9WE 4L8SC 4M7ZC 3RIAK 2R56L 1FNSH 1OQXA 4RBPK 3FZUC 1WJ3A 2O61A 1L6XA 4Z8FH 3NBNA 4YBQD 3T2QA 3ZTJG 2R1YA 1YDPA 4LL9A 2FJGA 1F58L 3GSUB 4GW1A 3U4BH 1QEWA 1MAJA 2AI0H 4XB7A 4M1GH 3HC0B 3ZDXE 3IU4H 1YN7B 2P5WA 4YXLH 1T7WA 3ARRA 3W9EB 1ES0A 1XF2B 2AQ1A 5BRZB 1R5WA 2HFGL 3KJ6H 3RWDB 4TOYL 4EI6A 1Z0MA 5TJWK 3H3KA 5FYLH 3EJYC 1ZGLA 1Q9OA 3HN3A 3LKQA 5L2JA 1IAMA 5AG8A 2A6DA 2ENYA 1GAFH 5GGTA 3QI9D 5F96H 5LGJB 1HHHB 3PWNB 1CBVL 4K8RH 1YNLH 2R1XB 3DUHA 2VERN 4KHXL 4HKZA 3HC4L 4M9OA 3DWTA 5D7JA 4D94A 1MI5B 4XPBH 4PJXF 3RA7L 4WU7A 3DVNB 3R1GH 4HGWB 1ZANL 3CX5K 5FOBA 1CQYA 1NBZB 3FQUB 2Q86B 1MLBB 4BK5A 2EDLA 4TRPL 2D7NA 4OLEA 2VDLL 6CGTA 2EDQA 5D1QA 4AEIL 5KJRL 1T5WB 2EDYA 1WZKA