1DBKH

Molecular basis of cross-reactivity and the limits of antibody-antigen complementarity
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
219
structure length
219
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYAFTNYGVNWVKEAPGKELKWMGWINIYTGEPTYVDDFKGRFAFSLETSASTAYLEINNLKNEDTATYFCTRGDYVNWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA DB3 FAB (LIGHT CHAIN)
publication title Molecular basis of crossreactivity and the limits of antibody-antigen complementarity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 40
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1993-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbkH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbkH02
2DWEB 2GJZB 5GGSA 1I7ZB 4X7SH 1X7QB 4XBPA 1DJSA 3VFNA 2X6MA 4OLWH 2IPTL 3CX5K 2PETA 3VH8G 1RV6X 2D03L 1R3JA 2GUOA 3T0VA 5LJYH 1NAKL 4DFHA 3PQYA 1MH5A 2BHZA 2DQGH 5H35B 3KR3L 1JHKH 3RJQB 3FO1B 5J0BA 2NXZD 3MYZA 1WZKA 4JDZB 2R15A 5JDJA 5KTEH 2NXYB 4NKDA 5DEFB 5D7JD 3M8OH 1I9JH 4OLUL 3V6ZB 1HCFX 5E8PB 2GSGB 5ISZA 3O0RH 2HFGH 3VDCA 3LKOA 2VDQL 1YJDC 1Z5LB 4PGDA 3SE9L 3RPKA 2OL3L 4WNQB 4APQB 2VXSH 1RJYB 2Q86B 2V7NA 3MCLH 5T1LB 4PS4H 3HRPA 3L7EB 4L8SC 1NDMA 3UXFA 3D39B 5GS3A 5SWSD 3IU3A 3SN6N 2W9DH 4GKOA 2Z35A 3QCTL 1SM3H 2C5DC 4HIXL 5MERA 3DO3A 2P49B 5GS1C 4KUZH 2EDOA 3DURA 5EZJB 1J11A 5IT2H 1YA5A 5FOBA 1EO7A 3TBTA 1FHGA 1EX0A 3V6OA 1U8NB 1FAIL 1QA9B 1RUML 4PRIA 4Y88A 4ONGH 1NCAH 4GAGH 4PBXA 4JHWL 3BPOC 5EFIA 1J5OL 4PB0H 4TNWK 4NNXA 1AO7B 3PG2A 1AIFB 4ZPVB 3TO4B 1XGQA 3QXUA 3QB7C 3ZYOA 3DGGA 3VRIA 2AS5M 3U2SA 1CFSB 1CXFA 4KK8D 5EOCH 4AT6A 3LKQA 3B9KA 2NY4C 2HKFL 5SWQB 4OV6F 4B7IA 1KIQB 2JTDA 3RU8L 2NLJB 4F7PB 2FR4A 1C5BL 5D2NC 3WCYA 5B8CC 2XWTA 3NIFF 4OCSL 4J4PC 2A6DA 3OAYH 5F1KC 4TOYL 2YD6A 1AFVH 3FQNA 1BIIA 1AE6L 4JFZH 4LNVA 4KZEH 4I3RL 2HG5B 3GNML 3NVQA 5FO8B 1GYAA 1EO8L 3V6FA 4PRBB 1KC5L 2C1PB 4CJ0A 2Z93B 4JN2A 3ZO0A 1IBGL 3RIFF 4HUUB 4PV9A 4R2GD 3S88H 4EJ1C 2G2RA 1AY1L 4JN1L 4UT7H 4GG6E 4W4OC 2BJML 3DX9A 4JO4H 4M1DH 3BX7C 4RWHA 1WBYB 5T1KD 4ZNCD 5C0GB 4H8WL 3A6BH 4P2YA 1FO0L 3GIZH 4M8QB 4YFLI 5B3JE 4CN6A 4FQ2H 3DX6A 5A2FA 4U4BA 3U9UA 4DKFH 5I19L 5GZOC 3QCUL 5D2LF 5D7JA 2YRZA 3U7AA 1KJ3H 1QOKA 5EU6B 3CCHA 1IJ9A 4HWBH 1B2WH 1AI1H 3SDAC 4J6RH 5AAWA 3O4LE 4TTDC 4Y5XB 1U3HC 1PYWB 4RFOH 3JV6A 1E6OL 3TPUA 3VFRA 5J13B 4JM2F 1NBYB 2AAVA 1ZEAL 4J1UB 1A7OL 5E7FA 2P8PA 3NIFE 3DUSA 2OQJA 2W9EH 3ULVD 2IAMB 1D9KC 3IJSB 5SWSA 3MJ7A 3LKSB 3ULVE 1CL7H 4FXKA 3GSQA 3GO1L 1DN2A 5BZWB 3CFDA 2F5AH 4DGIH 3C5JA 1QSEB 3BHBB 1R5WA 3IFLH 2UUDH 3DHJA 1YMHA 1NMAH 4FP8H 4JRYE 4M7KH 4P4KD 3S96A 3UTTB 5C8JA 5JIIA 3WMSA 4LU5H 4M3KB 2FSEA 4V2CB 3PNWA 4ORZC 3SKNB 3GSNH 3GJFA 3HZKB 1SVZA 4ZOCA 1UADC 1JJUA 4HX1B 2QADD 1JPFB 3WFDH 4NN5B 3MRHA 3VRLF 1KCKA 1HOCA 2V2TA 1P69B 3QDJB 4P57B 5D2LE 1K6QL 2ADGA 1K9TA 2HN7A 3O3AA 3FZUC 1KN2L 1GL4B 4XWOC 4KTEL 4X6CB 1ERNA 4MXWL 4PJ7F 4NQXB 3NN8B 5FM5O 2I07B 1F4WL 5HYSB 5GRUH 3MJ8B 2ORBH 1JZ8A 1CYGA 4Z7WA 3KYKH 1P84K 1H5BA 3B2UC 2FLRT 1FZMB 3S8WA 5FYLH 3OKEB 3T0AA 3IXTB 4LARL 2BY0A 2F15A 2CK0H 3CFEB 2L4OA 4GG6A 1A02N 2J2ZA 3FMGL 3KPPB 2YXFA 4EVNB 1XT5A 4PIRF 4PGCA 2J12B 5DZNA 2VXQL 1VFBB 5T1KA 3NOIA 2GTWA 5FCSH 2OP4H 2X4QA 1JNNH 3MMEA 1V3KA 2R1XB 3IYLW 4GW4A 1T0PB 3WNNA 3HS0A 1T0NB 3HE6D 2VC2H 3VRLE 4Y4FB 5E2TL 5DD1L 1S8DB 5C0EA 2NX5B 3I9GL 3WN5C 3F6IA 1DVFD 4UILL 5B38A 3S4SA 4IM8A 4R4NC 3O3UN 5JW4R 5HPOA 1ZKAA 3VDBA 3EDKA 1NAML 4PJ7E 4JY6B 4EDWH 4G6AD 2H32A 4PY7B 4NBZB 4HBQA 4LDLB 2Y07H 4YBQC 3ZHDA 3QPQD 3P9WB 3OR6B 3AFLA 3WIFA 5LCVL 1GPOH 2WIIA 2Z8SA 5H2BB 3LN4B 5JQ6H 3V5KB 4P4KA 3VU2A 3TYFA 5KS9E 3DI2B 3F5WB 3GMPA 4QY8B 3REVA 3C5SA 4KJWD 5CIPH 2DQJL 2ICWI 1J12A 3FRPA 3MLXH 5KG9B 3ESUF 2AEWA 4HXBH 3LRSA 2Y7QA 4PJFE 5IB4A 4F37K 4KVCL 2YPLB 5D2LA 1D7FA 5DMIL 3ARFB 4TSCH 5SX5K 2YD8A 3KNBA 1MELA 3C08L 3IFOB 5SX4I 4KV5F 5JXED 3SPVB 4B41A 1YJDH 4XAWL 1RHFA 1WSST 3BDYL 3FONB 3CSYA 2AJVL 5DD3H 3U30C 2PTTA 5DXWA 1FZJB 1MCSA 1EEYB 4Y19D 2DJ4A 1T1XB 4OQ1A 1IEAB 4Y19E 1LMKA 4K8RL 4OLXL 3U0PA 1NGQL 1WZLA 3C2SA 2CMRH 5HHQB 2NQCA 3G5ZA 1WCQA 1KB9K 4R3SA 4P2QB 2XA8L 2ZOKA 2X4PB 1DDHA 3DROB 1KB5B 5HHNA 2ZSVB 3RY6C 5I76B 3MRCB 1FNLA 1YEDA 5KVGH 4PGEA 1J05A 2R0WL 2A6JA 1U8PA 1YEGH 3HE6A 1WFNA 1P1ZA 5EWIL 1QFUH 1HINL 5F1NB 4G8GB 1AR1C 1DVFA 5IJVA 3BUTA 2LE9A 3MRRB 4KV5E 1FG9C 3HPJA 3ZKSD 4PJ7A 3DLQR 5TDPA 4JPKH 2CJUL 4JR9L 3G08B 4ZUVA 3DMMD 3SGDI 1G7HA 4U1GB 4NO5A 2WQRA 1KULA 5T33H 1YEEL 3HC3H 4I2XB 3BKJL 4R96A 4OLWL 2WWKT 3QIUD 4RAHA 5IB1A 3SCMC 4W4NA 4Y4HC 2AXHA 3MNVB 3DBXA 5IESL 1GIGH 2P42B 2XXCB 4WTZA 5KS9A 4YGVA 4IRSB 5GS0D 4MQ7A 3CNKA 2PO6B 4FFZL 5JZ7C 1Z0NA 1Y18B 4HBCH 3VJ6B 2VYRE 4WI6A 5IQ7H 1I7TB 5TQ2H 3QDHA 4PJFA 5CKGA 4ZNEE 5DC0A 5KTEL 2H9GA 1QLFA 2DQHH 4HJJH 2ZG2A 4ZS6D 4GRLC 2R2HB 4M48H 4X4YB 5T1DH 1A21A 1LO4H 5IBLC 1SYVB 1VCAA 1NC4D 3O0RL 5JXEA 4NQCB 5E94A 3AROA 1HQ4B 4C4KO 1IQWL 4Y19A 3EYOA 2DB8A 4HIEA 1U8IB 2EDEA 5GHWH 2HFEB 2V9RA 4LMQE 3UBXA 1EERB 1CR9L 1TNNA 3TJHC 1XMWA 1QFOA 3GMOB 3MSPA 1NCUA 1SM3L 5C7XH 5HJ3A 5IMOB 1RIUH 1J1OL 1BFTA 3NIGF 5E8DH 4UQ3B 4K7PH 5ENWA 2Z0BA 3QXWA 5TFSL 4LASH 3F58H 3MRNA 1HWHB 5D72H 5HHMD 1NCNA 3DVGB 3MRMA 3C5ZB 3QEQE 3VXQB 4YHIB 5HHME 3MLUH 2J6EH 3G6DL 5ESQA 3CFCL 2R69H 5F7HA 3G6AB 1JZ7A 4KDTA 5DFTA 5EIIB 3ZKXB 3WFCH 5FDWA 3Q1SH 4P48A 8CGTA 3BKYH 1T1ZB 3HI1A 4LCCB 2AJUH 4QTIH 1J1XL 2HMIC 2BCKA 4K3HA 3O8XD 3EO1A 4LEOB 5BS0B 1R3IL 2GEEA 2FJGA 4ZOEA 1NFDB 4ETYA 4KRLB 3TGXA 3S3SA 2C3HA 1P7QA 1FL6A 4N68A 4KKBC 5GRYA 2NXYD 4R8WL 2NZ9C 2X10A 3JVGC 3QIUA 3WNMA 4FFYL 4GKNB 2N4IA 3NIGE 2HVJB 3RVUC 1E6JH 4N0FA 4TNVK 3BFOA 4OTXH 4B53A 5L8KB 4APQD 3CC5B 4JO4L 4LOUD 4BZYA 5T1LD 4M61A 5F7MC 4ZNEA 5FA4B 3DXAE 1ROWA 3ZDXF 3B6SB 3D39D 1C08B 1W72B 5HBBA 2DQDH 1JNLH 4XP9L 3D39E 4CAGA 1QRKA 3PGCA 3S3JA 2JLLA 5DYOA 1A4JA 3JTSA 4OLVH 4Y5VB 4HZLA 1NKRA 1NC4A 2G60L 2Q8BH 2HA1A 3UJJL 5KJRH 4RFOL 1OF2B 2XN9B 2BFVL 4M6AA 4XBGB 4GRMA 3DRTA 5KANG 5CBEB 3EAKA 4WI8A 3QDMD 1RUQH 2IGFH 4DOHE 2DQUH 3QDME 2WMPA 4L5FL 4PB9L 5GSRA 3TO4D 1BQUA 2PCPA 1A1MA 1I8MA 4UDUA 4JFYB 2F5AL 4XZUA 3O3BA 5BVPH 2QL1A 1KJ2H 1EAJA 2AQ3A 4QHLB 5C0RH 5C0FA 4E41D 3A0OA 4M4PA 1K3ZA 2Q20A 3IFPA 2FCBA 2JJVA 4HFWA 4E41E 1CLCA 4PJEB 4P5MB 5F7LB 1CDUA 3BGMB 2LU3A 3P73B 4LLQA 4LU5L 4ZS7L 1UZ6F 5HPMB 1LE9A 1EAPA 3VRJB 3W9DA 4PJIA 4O58L 1INEH 4NZTH 3ZDXE 1X7QA 2DQEL 5LAXB 1QFHA 4LSSH 4Y16B 1S9WB 4PJDF 3O8XA 2IWGA 1S9YA 1X5FA 4XWGH 3U4EB 1LE5A 4QHMB 4NUJB 5J1AB 5H35A 3FO1A 4KQ4L 3QXDA 3FB7A 3NCBB 4MXQD 5F7FA 5J12C 1OP5H 4JGUA 1I9RH 5D70L 5IBUB 5JIPA 3RGVB 1U8QB 1SEQL 1MCFA 1ND0B 2VRAA 5DD6B 3O4OC 3UYPA 2A2QT 5DEFA 1OAUH 2VLLB 2WINA 3QQ9D 1FFRA 1IGIL 3EDDA 2R29L 3EYSH 1II4E 1Z5LA 4NQED 3NA9H 1UKQA 1LP9F 3D85B 4APQA 3KJ6H 4XVUC 4N0CD 2Q86A 4NQEE 5T1LA 4LPUA 4WWKC 5DVKA 2HTKD 1UZ6E 3L7EA 5EC1B 3D39A 5FHBL 2AK1H 2VDPH 1O0VA 1IGFL 3HAEB 3O2VH 5FKAA 2NR6C 1M7XA 3LB6C 1JI1A 4CU8A 3OXSB 4OB5L 5D1QB 2DJSA 1QSED 1ZHNB 4PJDE 5T3XD 4F7EB 4IOIB 4WW2F 1EHLL 5E2JA 5C2BH 1P5VA 3UTTD 2Q76B 1U8NA 4R26L 5I1AA 3VXPB 1QA9A 1MRDL 3NABH 4K2UL 3RA7H 3HMXH 4KDWA 3QDMA 3LKNB 5CP3H 3MQIA 3IGAB 4R2GC 4ZPVA 1AIFA 3TO4A 3AY4A 2A77H 4R4FL 1H0DB 4A6YH 2BXZA 1UACH 2PUQT 1FGVH 4KK5D 2CKBA 3CIQA 1MWAL 4G3YH 1GPOL 3IDIB 3BUYB 4MD4B 3CMOH 4NZJA 4E41A 4DEPB 4UAOB 5SWQA 1KIQA 3SDCD 2NLJA 4F7PA 1MCBA 4XC3H 5GSVA 1FRGL 1C1EL 1LP9E 2OXGA 4KUCF 4UU9A 3CVHH 1NMCC 4M7LH 1A7RH 4Z0BL 4UQ2A 3RWGA 1XGYH 3BZFB 4EUPH 4MAYD 3WFHA 4HXBL 2HG5A 5ELIA 5KSBF 2UVFA 3NCJH 3WFBH 4PRBA 4TSCL 5DHVH 4LHUG 3T2NH 4HUUA 3K7UA 3TT1H 4KQ3H 5DA4A 1JNHB 1Y6NR 4ZFZB 1N0XH 8FABB 3IS1X 1MJUL 4QRSA 4OQTA 4WHYG 5GQBA 2VZ3A 1H3GA 4O51B 3BEWA 1UEYA 1QLEH 1WBYA 3ZSTA 1B0GA 4G7YH 3GK8L 5EZOL 1HKLH 4M8QA 4BFGA 3VXRE 4BH7A 4NDMA 5C08D 3SKOA 1A7BA 5DZLA 5HI3C 2FNBA 4ODTH 4Y4FD 2AJSL 5C08E 4YHNA 3BT2H 2Z8RA 5DJZB 4JAMB 1SJEB 3DETC 4Y5XA 5DUBB 3TNMB 1PYWA 2CLVB 4NQEA 4K7FB 1E27B 3BOVA 5DA0B 1FYHB 2AJYH 3O45A 1NANH 1UWGH 4H20H 4EXKA 5GRVK 5IWLA 2ZOLB 3MCKB 1Q9LB 1SJXA 4PJHB 5F7KC 1SJVA 3LKSA 1ZS8A 5FAAA 2YN5A 4JVPA 3BP5B 3RNKA 1V3LA 2NCMA 5KSBE 3BSZH 4XNMB 1QSEA 3I3BA 4WFGD 4PLKD 2C26A 3IF1B 5GRVL 5C70A 1R0AH 1WAAA 5IM7A 1ORSB 3CD4A 2AABL 1JF6A 2F74A 2BNUA 4F80A 3UTTA 4JPKL 3O11B 1I3RB 4LDEB 4PJBB 3ARGC 4UBDC 3SKNA 4L4JA 4JEGB 4E5XB 4O02H 1CFNA 1A4KA 4HX1A 4HJGA 1IAIM 5E95B 5T33L 2YPLD 3HC3L 4WFFE 4F8TA 5FDYA 5EC2A 4FQJH 1KELL 4LL9A 3GRWA 2YKLH 1MQKH 4IMKA 2YPLE 2APFA 3I84A 4P57A 4WTXA 3X14A 1HWGB 4LGPB 4XVSH 5JUEH 1GIGL 5GGTH 4PV8B 3O6FD 2LTQB 1MCOL 3SDCA 1LP9A 4ODXA 1IGMH 1RZFH 3IDGA 4NQXA 2I07A 4ZD3H 2UZXB 4JM4H 3SDXF 3NCCB 3MJ8A 1FFNB 3EYQC 5IQ7L 5IMMA 3PDOB 1TZGH 5TE4L 3IETA 3ZYZA 5H94A 4MAYA 1I85A 4UOJA 2DQHL 1A47A 2NY7H 1IM9B 3C2AH 1FZMA 2A1WL 1CLYL 1PDKA 3OKEA 3IXTA 5T1DL 4G6AC 2BRRL 4OBSA 4P2QD 4YE4L 1BP3B 4P2QE 4EVNA 3BZDA 3V8OA 1RZGA 3GMQA 3D87B 4MSWB 1ZWIB 1HDMB 4P46B 1VFBA 3BKCH 4JPWH 1NUNB 3TESA 1RURH 3TCLB 2R1XA 3B5HA 4OD1H 3FOMB 1G7IB 1G6VK 4GBXC 4XAKD 1FIGH 5C08A 2H2PC 1RIUL 3I50L 4XAKE 4Y4FA 1JWSB 1ZLVH 1S8DA 3T65B 3ARBB 1T1WB 3S4SG 4LSQH 3BAEL 3QEHB 4OM1L 5D72L 2AERT 4CBPA 4JY6A 4ODUB 4PY7A 5JPMB 1G1YA 4NFCA 3SDXE 3ARED 2J6EL 4N9GB 4XHQA 3DX7B 4OFDA 2MHAA 4HULB 2HJFA 3OR6A 5KSBA 2J4WH 1U93B 1A14L 4LEXL 1J0IA 1MCNA 1J0ZA 1P9MA 4U1KB 5KW9H 4U1SB 3BKYL 4W6YB 1MFAL 4NNYB 1BWWA 5H2BA 3F12B 4OZIF 5FYKL 5F9WB 3CSGA 4IRSD 2GJJA 4QHNB 3V5KA 1H8NA 4ONFL 5IIEA 5L6YH 2XQYG 1CVSC 4QY8A 2UV3A 3U48A 4M93C 4JKKA 3BIAX 3W2DL 4BZ2H 4XMPL 5HY9B 1L7TH 2NY1D 2YPLA 5KSVB 2B2XH 2Y6SC 2EZ0D 1FBIH 1TJGH 1TFHA 4NZUH 2FECI 3IFOA 1U8MA 4NQCD 3SPVA 2A38A 3O6FA 4C56E 2CDGB 4KDTC 4NQCE 1UM5H 4POZD 2D7TH 3N1QC 2IAND 4KJPD 3T09A 1T1XA 1HH6B 1VGEH 1IEAA 1KYOK 2IANE 1OW0A 1S7SB 1NFKA 3FFDA 1ITCA 4K9EC 4X4ZA 5MENB 1JNLL 1BLNA 1I9IH 5I8KL 4YPGB 4MNGE 4OLVL 1HXYB 1CDJA 5HHQA 4OM0L 2I5YL 3U36B 4P2QA 1YEJL 3RBGA 2X4PA 4I48B 3AM8A 4D94A 3MLYH 3UTOA 1KB5A 1PX3A 3C5ZD 4ORGB 3QIUC 4WUUD 2BNRB 2ZG3A 3CDFA 1N8ZA 2HT4D 5HYQB 3PWJB 3RWEB 4WUUE 3LRHA 3SKJH 3BH8B 4D0BB 1KEMH 1EO5A 3ROLB 3REWB 1N6UA 3WXVH 1GC1C 1YDPB 2VQ1A 4AH2B 5F1NA 4G8GA 1KJ2L 5BJTB 4P99A 3RWJB 5BCAA 2VQUA 4Q9RL 1VADB 2KDGA 5BS0D 2AW2A 5FFLA 2MSPA 5CWSA 5FA3B 1A6TA 1LEGB 3SDXA 1J0HA 4ZS6C 2ZUXA 4X6DB 2P48B 1EGJA 3AREA 1AGDA 1T5WA 5F93C 4QHUB 3CZJA 3UZEA 4I2XA 1CE1L 2C1OA 4LVHB 4ALAH 1SVCP 1MRFL 5D96B 1OB1A 4J3OC 1IEBA 1ZVSA 3MNVA 4HC1H 4MA1B 1PEWA 2W91A 2OL3B 4L8DB 1T21B 4IRSA 5I1HL 4Z76A 3EBAA 2R0KH 1J88A 4P9MH 3M1BB 1CS6A 1Y18A 3VFMB 3VJ6A 4LKXA 4LPVA 1I7TA 5GZNC 4RWYL 1F11B 4MDJA 2XPGB 5B39G 3BRGC 3MZGB 5HVHC 1PKQB 2R2HA 4X4YA 4EQ3A 1SYVA 4NC2B 3IDMB 4LBEB 4NQCA 1KTDB 1KACB 1HQ4A 2XN9D 4MZ2A 3NA9L 4KMTL 4TQEL 4AQOA 3RAJH 4J3WA 5HDQH 4ELMB 2XN9E 1NLDL 4QNPF 1EHXA 2IANA 4FMFA 3RVWC 2WZPD 3OPZL 3QJFB 2HFEA 1RK1A 5MHSD 2VDPL 3O2VL 3MUZ1 3UBXG 5KZCD 3OAZK 3GMOA 3ALPA 1A6ZB 4JVWA 2ED8A 4UQ3A 4PTTB 4OLZL 2N56A 1PVHA 4NN7B 4NM4L 2NXYC 1KLUB 4JZJB 3QQNA 2A74A 1C16A 3DVGA 2BVTA 4MNHA 3NABL 3C5ZA 3VXQA 4YHIA 1TNMA 3RA7L 4OF3A 2E6QA 3LV3B 1QO3B 2R2EB 4WUUA 2JJUA 3F8UB 2YUXA 3G6AA 1V7NL 3V7AE 5BO1H 4XPAH 3RVXC 1JTOA 1GGTA 1XR8B 3RWCB 3WUWA 1OWWA 4F15B 4LCCA 4LOUC 4APQC 2AEPL 5C0ND 4HJ0C 2EIZA 3RP1A 3GFUA 4LCWB 1NGYB 4LEOA 4EN3B 4Y89A 1S7XA 1M7DB 5BS0A 3EO9L 7CGTA 2R4SH 3S34H 4PRHB 2H8PA 1FNSH 3SE8H 3CVHL 1ADQH 1MUJB 4QNPE 3NACL 4JY4B 4NKMA 1GGUA 4YXKH 4P23D 2H26B 2QR0A 3RGVD 1TQBB 1Z9LA 1S7RA 1OGAB 1GHFL 3NCJL 3BRFA 2HVJA 3ARTA 2N1KA 1QYGH 4M5ZH 2DLFH 1RHHB 1MHHB 1UG9A 3WHE0 3N06B 1N0XL 3UYRH 1R6VA 3L5IA 1NBZB 1SYSA 2Y72A 5FGBC 3CC5A 1PKOA 4H25B 3P3YA 5HYJE 4XRCB 4LIQL 4U7SA 2I9LB 3B6SA 2EE3A 5JDSB 1C08A 1W72A 4XCYA 1EZVY 2OR8A 4M9OA 4Z77B 4ODBD 3KPNA 5IFJB 5KANI 5M95B 5D1QD 4XVTL 4KHXL 1JZ6A 2QLVB 3BT2L 3C6SB 4XMKH 3FQUB 5IHLB 4P2OC 3HC0B 2PYEB 5C9JB 2NZIA 3OZ9L 2XN9A 1FPTL 3O6LL 3ROOA 5C6TH 1GSMA 3X17A 4WHCA 1Z2KA 1XGUB 5CBEA 5C6WH 4XNYH 3Q6FB 5K9JH 4DVRH 3S98A 3IRZA 3N9GH 4GUPB 3B9AA 4TUKL 1FC2D 4NCDA 5DURB 5F7UA 3BSZL 3UC0H 4QHLA 3S36H 4WI2A 1MCDA 3DGCR 2VABB 2BX5A 3HCVB 1BVLB 1RAMA 1NGPH 2QQNL 5C0JB 4MX7B 1MCEA 5LXGH 4P5MA 4XNQA 3P73A 4JQIH 5HPMA 1CXIA 3QQ9C 4K94L 5F3HB 5B21A 4I18B 4M1CD 1FDLL 5FF6B 5AD0B 1T2XA 1LDPH 2BVQB 4O02L 4Y5XC 1EK3A 2BVPB 5LAXA 2JELH 5J13C 2H2SC 2VLMD 4YR6B 1S9WA 5EORH 1MQKL 2VLME 4YHYB 1CK0H 2BXYA 5EZLB 5JUEL 1MFNA 2IAMC 4MJIB 4QHMA 5J1AA 3W9EB 3CZFB 5CJQL 1N4XH 1FVEB 1OSZB 5E1AB 1F6FB 4HPYL 2P5EB 1ONQB 2ICWB 4YGAB 4P23A 3E8UH 4UI2A 3MLWL 4UIKH 3RGVA 1ND0A 1IKNC 3ARSA 5DD6A 4P9HL 4K9EH 4X7DC 1A7PH 1LO2H 3DYMA 3L5XL 3LPGA 4MXVF 5D1XB 3NTCH 4YQXH 2QSVA 4XP6H 2EC9T 2NTSP 2F53D 4NN5C 4JFEE 4RCAA 1DBKH 3BPCB 3U7YH 1DQQA 3MOAH 2F53E 3RIAF 3VD9A 3O6KH 4LF3A 5EC1A 1MEXL 2XRAH 5CEZE 3UTPD 4MB4A 4OZ4B 3UTPE 5D1QA 5EIVA 4OD3L 3MR9B 3C6LD 4B0MM 1GC1H 1LHZA 1X5KA 1ZHNA 2ZCHL 4GSDH 5I15L 4MJ6A 5ETUB 3WEXB 3FAXA 3N0PB 4IOIA 5HHXH 2G9HB 2ID5A 3GMMB 4OCWH 1I85C 2Q76A 3N1FC 3VXPA 3VWKB 3BH9B 1N2RB 1DBBL 2JJSA 4AM0A 2R1YA 3LKNA 2WWMC 3QCVH 1HSAA 3A67L 3MNWB 3IGAA 1TVHA 1BJ1J 1U8KB 2ESVB 4KXZI 2JB6A 1WBZB 5I1CH 1VDGA 5L88L 4PLNC 4G8FB 3L5JA 3BUYA 3MGTB 4MD4A 4JFHE 3L3IA 4H88H 4RGOL 4YWGH 4ZTOL 5IROA 1XAUA 1W0VB 5D6CB 1D6VL 1CTOA 3UROR 1IC5H 4CMHB 3JWOC 1MJJB 1RZ8A 4JKLA 1FZOB 3CVIH 4Y4FC 1S9KC 3PDDA 5IVNA 3MJ9H 4QXTB 3OKNB 3KHOA 4GT7A 3GJFK 1L7TL 1IM9D 1A9BA 2YHGA 3DOSA 5TE6H 4OGYH 4HD9A 2B2XL 2QQLH 3MLVL 1FBIL 1SEBB 1TETH 1TJGL 3IVKB 1JNHA 4ZFZA 8FABA 3P30H 4X7FC 1AHWB 4OZFB 1PG7L 3HZMA 4O51A 4UINH 4Y2DD 1P9MC 4JB9H 4P46D 3PP3K 5E6IB 2GK2A 1QHPA 5IW6B 3ESVF 4JPVL 5ANME 5EU4B 1PD6A 3EHBD 3NPZB 5BOPA 1BBDL 5BV7B 3MRIB 1K4DB 1I7UA 5I1LB 1SMOA 2BHYA 5AWNL 5T5FH 3VDAA 1KCUH 3D2UB 2EDNA 4OCNC 5DJZA 4LVNB 4JAMA 3TV3H 4DTGH 4JO1L 5DRNA 5BQ7B 4MD0A 4NC0B 3NH7H 5TDOB 1CXKA 2CLVA 4K7FA 1U36A 3PL6D 4KJQC 1MREL 4PJCB 3BZ4A 3QUZB 1MJ8L 3ARFC 3TT3L 5A16B 1MLCA 1LNUA 2EDRA 1BJ8A 2ZOLA 4HEME 1DANT 1Q9LA 4PJHA 3BDBA 1J1PL 3I2CL 5D7IF 1A7QL 3WXVL 1JPTL 2CUHA 3C6LA 2CO7B 1MIMH 3V4PH 3IF1A 2GK0B 4V1DD 1XF5B 5DK2B 5FV2A 1ORSA 2EDYA 4V1DE 3DYPA 4KRMB 4PJ9B 4YHZL 3C60B 1I3RA 4HPOH 2AJ3B 4PJBA 5DJ2B 1ES0A 1CIUA 4FABL 4L4TD 1MCPL 4KHTH 3Q5TA 5TPWL 1CFQA 4JFXB 5F7EH 3VXUB 4E5XA 2X4OA 4L4TE 5GJTH 4UTAL 1XZ0A 1VKXB 2X70A 5BOZG 3HC4H 4O4YH 4UDTB 4F57H 1OAQL 3S37H 3RIFK 1I8LA 2GJ6D 5DQDL 3ULVL 1KV3A 3GBNH 2GJ6E 4HMEA 4EQ2A 5ERWB 1RSFA 4OGXL 5FV1L 4L9DA 2XQYK 2ADIA 2HTLD 3JZ7A 3PDOA 5CEYA 1R5VB 4ZFFA 1BZ9A 1QQDB 5E24E 1OPGH 2BOCB 4FZ8H 1IM9A 3ARUA 3P40A 5D7IE 1RUKL 3ZZ1A 1DBMH 4XI5D 4UV7L 2VDKH 2NNAB 5ILTL 1BOGB 4U1GC 3GJEB 2J8UF 1BD2E 4MSWA 1ZWIA 4NZRH 2MQ0A 1HDMA 4P46A 3RAJL 4K3EL 2BZDA 4DKAA 1LEKB 4XPHL 4DKDC 2R23B 4X99A 1EZVX 2HT3C 2OCFD 1QNZH 3I6KA 2CQVA 3TCLA 1V05A 4D9LH 1G7IA 2CUIA 3EDJA 1QP1A 4ZAKB 3HNSL 2PO6C 5L2KB 1JWSA 3K8MA 1A6UH 2YPKB 1NC2D 1JRHL 1EVUA 2EH8H 5F70A 3T65A 2MCPL 1T1WA 5CMAB 4LSDA 5JW4Q 3BPNB 2YD5A 3QEHA 2ATPB 2ZNXA 4FG6D 3PL6A 4WU5A 4NRZB 1KBGH 1RD6A 3SGKA 4ODUA 3GIVB 1CWVA 4N9GA 1OT1A 3DX7A 2DL2A 2YMXH 4WV1B 1H3XA 4U0RB 4QHKJ 3EDEA 3QUYB 1ACYH 3SGEH 4HIJB 4U1KA 1SY6H 4U1SA 4AIOA 4POZC 4NNYA 2F58H 4KJPC 4P2RD 4V1DA 3F12A 4E42B 1DBJL 4P2RE 4L9LB 1EXUB 2J8UE 2HFFB 4UV4H 2GYSA 1NFIB 2VLKE 3VH8B 4Z78A 3KPQB 1T6VN 5FK9B 2HKHH 2VWEE 3H8NA 1N5YH 5I75B 4N0UB 1JYWA 2FZ3B 2LU7A 3MBED 1NGXB 2EDXA 2JJWA 2E7BA 4DGYH 3LMJL 3C5ZC 4JRXD 4UUJB 5E4IA 5FCUH 1KSRA 2ARJB 1RZIB 2HJLA 4JRXE 4PY8J 5A1AA 1C5CH 2VKWA 4P5TB 2GJ6A 2CDGA 4L29B 1HHGA 3CLEL 4XH2B 3ZKXC 4ODVL 1EDQA 1HILB 3QJHA 4POYA 1OY3B 3MRLB 1HH6A 4ELME 4KFZC 1A22B 1S7SA 1CN4A 4QF1B 3T2PA 1UCBH 1I8IB 4U1NB 2NY2D 1F02I 5F3BB 4PD4K 2F8XC 2XA3A 5CD5D 3NGBB 4RGNB 5ESVA 1CZ8H 4P3DB 3OAYK 2R4RH 4PJ8B 3VMPA 1T89A 4Q9QL 3V0WH 4XNYL 5HYQA 3PWJA 1WK0A 3BZEB 3P0YL 3GSXB 3RWEA 3UP1A 4JHBA 3BH8A 3K81A 3WIIL 5D5MF 3ROLA 3MV7B 1DQTA 2K9UA 3OX8A 1C12A 3REWA 4FQLH 3R4DA 1YDPA 4P5KB 3UPRB 5IF0B 3EYUL 4UOW1 4AH2A 4B50A 1OWRM 4LCWD 1ZAGA 2RB8A 4JFOB 4AEFA 3RWJA 4EN3D 1K8DB 5IFHL 1VADA 1EHNA 2DDQL 1NGPL 3FB5B 4JDVB 4PRHD 2VDOL 5D1ZC 4X6DA 4XXDA 1RZJL 3JWOH 4Y5VC 3TH3T 2YWYA 3K8KA 4HUVA 5DO2D 4QHUA 3WDJA 2E7CA 2GFBB 1OGAD 4KY1H 3LZFH 4KZDL 1ZT4B 1FZKB 2WK2A 2Y5TB 5IVXF 4P2RA 3O6MH 1RUAL 4QRPB 4IRZL 4K3JH 1IAMA 1HIMH 3DHMA 2B1AH 3SDYL 1RPQA 2EXYC 2ZCKL 3M1BA 4FNLH 3H9HB 3MLRL 4PUBL 3VFMA 4QRRB 3EYFB 5CILH 2BVEA 3M07A 1DL7H 4X0KB 2XPGA 3MBEA 1OTSD 1U8LA 4M6NL 4K9EL 5D5ME 3P9MB 1A7PL 1LO2L 3PGFH 3RKDC 4JRXA 4KI1A 4IOSD 4NHUB 5KVDL 2P5WB 2X4UB 3IDMA 1U91B 3QHZH 3SJVE 4LBEA 3KYAA 4M7ZB 5JW3L 2DF3A 2OJEA 3QZWB 4Q9BA 4YQXL 2PYED 1KTDA 4NJAH 1FSKC 5CSGA 1OCWL 3SDDD 4X9FA 5E6ZA 4EUPG 3RUGB 3QEUA 4Y16C 1FFOB 3HUJB 4ELMA 3U7YL 2V17L 3MOAL 5HGHB 1J7VR 2ZUVA 4WO4D 5F9DC 1Z9OA 2FB4H 1MWAB 2BC4B 4NP4H 3IDXH 4FQCL 4UIMB 5GS0L 4NBXB 1A6ZA 3SOBL 4U33A 12E8H 1GC1L 4GMSH 7FABH 4MJ2A 5ABDE 1IQDA 5HHXL 4I3SH 4U1MA 2IH1A 1KLUA 4JZJA 2ITCB 1UA6L 5DHYA 1GZPB 5GGVY 5AZEH 4FQQA 1QO3A 4YNYB 1UWEH 3QCVL 3GM0A 1DSFL 4H5SA 3PWNA 4AEIL 1KIRB 4GRWF 5CP7B 5DD5L 1XR8A 4UT9H 5C86A 3WUWG 1KB5H 1LO3L 1NEZA 4JFPB 1EVTC 4LCWA 1M05B 4LGRB 4EN3A 2FLBT 2KKQA 1EMTH 2OS7A 4MJID 1M7DA 2DQIL 4I1NB 4KKAC 1LDSA 3MRKB 5GGQH 4MJIE 4PRHA 1TPXB 1MUJA 5FUOL 3FRUB 2FEDD 4JY4A 4JHAL 2XZCH 4Z95H 2WWKO 4WHTB 1CF8H 3KPRE 4NM8H 5IUSA 5C0DB 4G9DB 5CEXA 3CPLB 3G5YB 5CAYB 2QQKL 5I18H 1B6DA 4LKCA 1OGAA 3EUUA 1JN6B 1QR1B 1RJLA 3TN0B 4BYHA 5CHNB 3GI9H 3BD5A 1T4KB 2C3WA 5JOEA 1JK8B 2AJZA 4G8EB 4QT5A 1RHHA 1MHHA 4X6FA 5KVEH 2FHCA 1JMXA 4N0YH 4FQ1H 4R0LC 4HUWB 2XG5A 1DTUA 4M5YH 4H25A 5BW7C 5F88B 3UPAA 4XRCA 3G04B 3PHSA 4ODWA 5JDSA 1MCKA 4L8CA 4DEPC 4Z77A 5ADOL 4GRWE 1MCRA 3DVFA 1YEKH 2ED9A 3FQUA 4JPIA 1ZHKA 1IT9H 2PYEA 5C9JA 4RNRA 1AP2B 4ZQKB 3SDDA 3NH7L 2V5YA 3K2UL 5GS2D 4ZXBD 3V5DB 3VWKD 4MCYB 5FYJD 1XGUA 5D8JH 5ITBL 3EO0B 1DLFL 3K8LA 3EJYD 5FYJE 1Z9MA 2PR4H 4TVPH 5I1EH 1IAKB 4WO4A 4BKLA 4ZO9A 4WJ5B 2ESVD 1OAYH 2X7LB 4HT1L 3V52H 2ESVE 4YXLL 2YN3A 1MIML 3SO3B 2EE2A 3FFCE 3G9AB 2Y36L 3NAAL 4F7MB 3HCVA 4N5UA 4OKVA 5C0JA 4MX7A 5I8CB 4IRJB 1AKJB 4HPOL 3VXOB 3JWDC 1GXEA 4QWWC 4KHTL 5F3HA 4I18A 3RWDB 5AD0A 1NGZB 5FF6A 3TLRA 4R9HA 4F58L 5GJTL 5MEPB 2B4CC 2FATL 4YBLC 4HH9B 3MNZA 5IBTH 3WNKA 4NKOB 2BNQD 3ORJA 4YR6A 2BSRB 1IAIH 5HXMA 2BNQE 4O4YL 4F57L 3TWCH 4ESKA 5EZLA 1HE7A 5ID0B 4MJIA 3VCLA 5IFAL 2BP3A 4KJYB 4RISH 1CT8B 3W9EA 4ZUWB 3QA3B 3CZFA 3BYTA 4JLRA 3WXWH 5I1JH 3MV8B 4NYLB 1FVEA 1OSZA 4KKLD 5E1AA 2CKBL 3QFJD 2P5EA 2ICWA 1HZHL 3MROA 2DICA 3QFJE 5ALBH 3QBTB 5CBAA 4Y4KD 3ZE1F 3V95A 4HUNB 1DBML 5E9DB 1LEIA 1T66D 5K9KA 4YUEH 3FO9B 3HMWH 1JGUL 3VFPA 4OGAD 1CGUA 1NBQA 4NZRL 1K4CB 1Y6MR 1N0LA 3STZB 4NO0B 2Y5EA 3QO1A 2CUMA 3O81A 1EBPA 3DSFH 4OSUH 3THML 4NRXB 1OM3H 4X6BB 3X13B 4D9LL 3MODL 5DUML 4TUOA 1LK2B 1A1NB 3LQZB 4OQTL 3X3FH 3MR9A 1OVZA 1A6UL 3IU4H 4GS7C 5ETUA 2EH8L 4HCRH 1TVDA 5KAQF 3QDGB 2MPAL 3VXTB 3GMMA 1NSNH 2FBJL 1QSZA 3L3DA 1W72H 4R7DB 4ZXBA 3VWKA 3BH9A 2FX9H 2ZCLL 4KROB 5BZDB 3P4OB 4M62L 2DM2A 2BVUA 2YBRA 5L7XH 1NCBH 1V3MA 5C09B 2CDEA 3MNWA 1OAKH 5HHPA 1XEDA 1U8KA 2ESVA 2R39A 2K1MA 2AEIT 1WBZA 5C0AE 5C9KA 3BQUB 5J3HC 3ZE1E 4WI5A 1B4JH 1UJTA 3RTQB 2F58L 3MGTA 2BY1A 4OAWA 4TPRH 4HKZB 5FGCE 3EHBC 1W0VA 4PRDB 4KPHL 3H9SB 4HMDA 4UV4L 1WTLA 1R3KB 3CH1A 4J3SA 3CFBB 3ARBC 3W11D 5T3XL 1N5YL 4QXTA 4OCRL 3VGAB 2XY2A 2UWEB 5DTFB 3B83A 3BISA 3I02B 2BNQA 5CSZB 1YY9D 4ZYKB 2CR6A 4HIIB 1XF4A 2AV1B 3GSRB 4S2SB 1SEBA 4Q58C 4L4VB 5FCUL 4S0TD 3LEXB 2W0PA 4IHOB 3WHXA 5FKPB 1AHWA 2DQCH 4OZFA 4L3EB 1OTUC 1H15B 4RDQF 1QBLL 1WBXB 4F7CB 1XGRA 5IW6A 3QFJA 4LSVL 3GRWL 4YEFA 5EU4A 2M1KA 3PGDB 3MCG1 1BREA 2YUVA 5F9WC 1XF2B 4Y4KA 1INQA 1VEPA 3MRGB 3WD5L 1U6AL 4E0RB 5I1LA 4ZUTB 5BMFH 4ZAKD 1CDCA 3MOBH 1NMBL 4MA7H 1O7VA 3FQTA 5GJSL 1E4XH 4PPTA 4GMTH 2K3TA 2YR3A 3OKOB 4ZUUB 1CZ8L 5INDB 1X4XA 4Z7VB 2ZPKH 1IKFH 4PJCA 4HS8L 4ENED 5DRXB 1PGRB 4S1QH 4YDKH 1JGDA 4KVNL 4XHJC 5DJ6B 1MQ8A 2K7PA 4O2FA 2M26A 4MMZC 1IC7H 4I5BA 5C92A 1UXSB 2AI0L 3Q6GL 2YZ8A 2MQ3A 3NZ8B 3VXSD 4KDVA 4CL7A 3VXSE 4CJ1A 5L2JA 2VH5H 3FQRB 3Q5YA 3HAEH 1ZMYA 3CLFL 3DO7A 2XQBL 4G7VH 4FXGB 1BBJB 3B8YA 1I3GH 1QFPA 4WY7H 4JFXA 2NY0B 3VXUA 1MHEB 4LLDB 2FHFA 3AB0B 5LGHH 5JHDB 4X9BA 4JO3H 3CDCA 4NZDA 1MVUB 2W92A 4UDTA 1YMME 1G84A 1MFCH 1HHJB 5A3IC 1I3UA 3TA3C 4K3JL 4OI8A 1U3ZA 1FL5B 1NEUA 4DUXA 1QKZH 2NY3B 3L95B 3OB0H 1S78C 5KSUB 1Z0MA 4KMLB 3VXME 2ADJA 4NNPH 5KSAB 4W81A 1OQXA 5IGXL 1DL7L 3O3EB 3EJJX 4YZFF 2CLRB 3FO0H 5DGRA 3UPCA 1QQDA 3PF2A 5HD8C 1I8KB 4CMMB 2YD7A 4RMWA 3PGFL 3T77B 3MLZL 3TEUA 5TE7L 5MEOB 1C5DB 4U1LB 1BOGA 1HYSC 4LRIA 3GJEA 3MJGX 4NJAL 4PJ8D 4MWFA 4L1DA 5EO9B 4HK3N 4ZFOB 4LVHC 1F3JB 2V5TA 1LEKA 3WSQH 2R23A 1NQBA 5D4QA 5D96C 4RMSA 4PJAF 2F19H 1YECL 4FFVD 1L6ZA 5ALCL 3R0MA 4ZAKA 3LKRB 1T7ZA 1N64L 2YPKA 12E8L 1U95A 7FABL 2A6IB 2YOCA 1OSPH 2EEBA 3H3PH 2VE6B 1U9KA 5FYJU 3WO4B 5CFHA 1F58L 1OP5K 4NRZA 2FL5B 3G6JB 2F5BL 3S35H 2YUZA 4LLUB 5CGYC 4DFIA 3GIVA 2IFFL 3JWDH 5CLTA 1YYML 4WV1A 5LQBH 4NO2A 4YZFE 4O9HH 1JL8A 2B4CH 5DJAA 2BDNH 2IALA 3D6GA 4HIJA 3EOTL 4NGHL 3C8KB 1KB5L 3IDUA 4E42A 1IARB 3AS1A 1EXUA 3VFNB 1QEWA 2HFFA 5C0IB 5C07B 1N6QH 1NFIA 1CCZA 1TDQA 3VH8A 1GH7A 5D7LD 1R3JB 3UO1L 5FK9A 3LPWA 1J10A 3LIZH 5CD5C 4NN7C 5D7LE 2HVKB 3PQYB 4X8XA 4PJAE 2FZ3A 1S7QB 4JZJC 4MB3A 2O61B 1IGCH 4PR5B 3S9DB 2MKLC 2VDML 5EO1A 5MEQA 4UUJA 3MA7B 1E4KA 4UTBH 3VGHA 3CDGB 1HSBB 4UT6L 5LWYH 1EGJL 3MACL 4FQ1L 4XH2A 4X4ME 4F15C 4BSWA 5ISZB 3TIDA 3V4VL 1PY9A 2D7OA 3LKOB 4PLJD 2FO1A 4N0RA 4EN3C 4XP1H 4ZO7A 4QF1A 1UM4L 5IK3A 3QPXL 4U1NA 4DAGH 4H8WC 4KRPB 2KZ1B 2V7NB 1EFXB 1Q0YL 5DEGA 3A6CH 1ZANH 3IT8D 1JHLH 1UZ8B 4P3DA 2YSSB 4PJ8A 4O5LH 3WJLA 1TQBC 3UJTH 2A9NH 5E2VH 3DURB 5FOBB 1NUFA 3E2HC 5CSBA 3TBTB 1S7WB 5F9OH 3V52L 2GKIA 3UPRA 5IF0A 1A6VH 1L7IH 1EJOH 2EIDA 5EFIB 3ZTJH 1K3IA 5K9QG 3SE3A 4JFOA 5BXFA 4Y1AB 1XGQB 1YEFH 3G5XB 4JDVA 1AXTL 2W0KA 3BPLB 3GSVB 3TBWB 2DAVA 3SQOH 4U6XA 1XCQB 2ADFH 3B9KB 3B9EA 3UMTA 3OG6B 1X5HA 3ZDZF 2VL5B 2XWTB 1B9ZA 2Y5TA 3MREB 2A6DB 1UEMA 4LQFH 5TH2B 1T04B 3RVTD 4GXVH 3K80A 1BIIB 1OTTD 4RIRB 3GHBH 5TDNB 5CJ5A 3D1MC 3ILPB 4X9IA 4AL8H 1MCJA 3V6FB 1X4YA 4PBWD 3FN3A 3WXWL 1WZ1L 1I3VA 4JN2B 3EYFA 3DSNA 4LHUB 4QRRA 3S97C 1MAJA 1EUTA 3VG0L 2VXUH 1WIPA 4I77L 1E0OB 2IPKA 2AKRB 3DX9B 4NWTL 1AGCA 2JCCF 3P9MA 4LPYA 5HVWA 2NXZB 5IV2B 5JO5A 1ODAA 2F54E 2X4UA 4NHUA 1U91A 3ARZA 2IADB 1ZHBA 3BGAA 5EOQH 1RJZB 3U9PH 2X89D 4X4MA 3HUJA 5I1GL 3UYOD 5EG6C 5ACZA 3ARDB 5HGHA 4YHYC 4XNXH 5FGRA 3IDYB 3CU7A 2Q6WA 3LEYL 3R1GH 4XPBH 3JV6B 3TPUB 3VFRB 4MDIB 2EICA 4NSKA 2CDFA 1YQVL 1AH1A 5DUPH 1JYXA 2P8PB 3U7WL 3AU1B 3DUSB 2FEDC 2OQJB 3HFMH 3QP3A 5I1IH 1H3PL 3VGBA 2D4FA 3I3DA 4MHHG 3T8XB 1EV2E 3GSQB 3U0TA 1W72L 4IRJD 2DM7A 4PYGA 1GZPA 2FX9L 4XPTL 4HG4J 3KVQA 3C5JB 4U7MA 4G6MH 3C09C 4YNYA 1NANI 6CGTA 3MRQB 1T7XA 5D1XC 3QQ4B 1NCBL 1JF1A 2WIMA 3V0VB 2IMMA 2XWJA 4HUXB 5E5RB 3MO1A 1KIRA 2YD3A 3OAUH 5JA8B 2R0LH 3S96B 1HH9A 3ETBF 4BZ1H 5CP7A 3STBA 2FSEB 3WUZA 5E7BA 1T03H 2JCCE 4NUGH 3OKMB 2EDJA 4JFPA 1NEZG 3GJFB 1MF2L 1UWXH 3BP7A 1G7JA 2I9TA 1ZLUK 3WLWC 3MRKA 2XACC 2IPTH 4ODHL 1HOCB 3KPOB 2V2TB 3ULUF 5A2LH 4TN9A 2D03H 2ADGB 2WBJD 2ZP0T 3FRUA 2HN7B 5ICYB 4ZOBA 1CD9B 1Q72L 5C0DA 3CPLA 4NHCH 1YZZA 4NT6B 3KR3H 5FO7B 5I30L 5T3ZD 3QISA 3EOAB 1A7NL 5EBLA 1JN6A 1QR1A 3TN0A 1WWCA 3EJYC 3VD3A 1JK8A 4G8EA 3C87A 3QI9B 1LVEA 4TYUA 1H5BB 2GTZA 1Z6JT 4HUWA 3CXDH 1J8HD 5F88A 1AC6A 3G04A 2VDQH 4CN1A 1J8HE 4PGCB 2OL3H 3T1FB 4Z8FL 5T1KB 1ZA3B 4CMHC 4K7PY 1X5ZA 2WLYA 2X4QB 3MMEB 1IGTB 4K8RC 4ZSOE 3ARPA 4PP1C 1HHHA 1AP2A 1BIHA 3QCTH 4ZQKA 4BFIA 4HIXH 2X89A 1J18A 3HS0B 1TJHL 1X5JA 3V5DA 3ULUD 4MCYA 4DKEL 3O4LB 3EFDL 3G5VA 3ULUE 4WDIA 5C09D 5B38B 3S4SB 5CD3A 1RUMH 1AHWC 5AEAA 2IQ9H 3LOWA 3TYGL 5E6IC 3RTQD 1J5OH 4KKLC 2DTSA 1D3CA 3L1OH 4LLMB 2VMFA 1CD8A 2F8VA 4F7MA 1IRAY 4LK4A 5BV7C 4ZFGL 3FQXA 4IRJA 3WIFB 5HHVL 4UNVA 3WDHA 3VXOA 4KKNA 1U2CA 4MB5A 4JRYB 1I3GL 4WY7L 1NGZA 4LVNC 5I8OL 1CICD 2HKFH 1NCWL 5MEPA 4HH9A 2JCCA 3TYFB 1B0WA 3QWOB 3SHSA 4NKOA 1C5BH 5E56A 4JO3L 1ZT7B 2DWDB 1DEEA 3GMPB 3QUZC 4OCSH 2PXYC 1P4IH 4L4VD 1MFCL 4TOYH 3HNTL 5ID0A 1O7SA 4L4VE 4XNZB 2QADB 2Y7QB 4JCMA 5D2LB 3GNMH 2DM3A 2CR3A 1CT8A 1EO8H 4ZUWA 4JQVC 1FNAA 1KC5H 1QKZL 1WC7B 5C0BD 5D9SB 2HWZL 1IBGH 2WBJA 1EEZB 4NYLA 4AENA 4NNPL 3VFSB 1B6UA 1WTGT 4I0PD 5C0BE 3WJJA 1AY1H 3VXNB 4PJGF 2Y06L 3CSYB 2BJMH 4IIQB 4JM2B 4PJ9C 3C60C 1A2YB 3D9AL 5DD0H 5E9DA 4H8WH 2OMNA 1Q9WB 3QXAA 2YWZA 1UC6A 3FO9A 1RIHH 4C59B 3KDMB 4D8PB 5I19H 3QCUH 1K4CA 1G9NL 4QOKD 1J8HA 3WSQL 5E5MA 3MV9B 2CPCA 3G5ZB 4QOKE 2Q87A 4R3SB 4NRXA 3SE4A 1X6NA 4EBQL 2KQMA 4X6BA 3X13A 5LVEA 2F19L 2ZOKB 1E6OH 4ZUSA 1DDHB 1LK2A 2ZUUA 5J06A 3DVIA 3K46A 1YEDB 4ZSOA 2ZUTA 1DQDH 5DMGD 4YXHH 3BXNB 2CKNA 4CKVX 3QDGA 4ONHB 3QXTA 3W11C 4GAYA 3EJZC 3GO1H 2ZG1A 1F2QA 4R7DA 3HE6B 1P1ZB 4UMGA 5BZDA 3P4OA 3JWDL 4QRQA 5C09A 1NBVH 5IJVB 5HYSG 3HPJB 5LQBL 4KI5F 4PJ7B 4LRIC 4O9HL 4YX2L 4U05A 3KJ4C 3MGOA 1KTLA 4G42B 3RTQA 1DBAL 1G7HB 3VI4F 4YAQA 1WCBA 4NO5B 4JRWA 3LY6A 4OBRA 4Y5YB 3GI8H 3H9SA 2NY3D 3U4BH 4EI6A 1K6QH 4ZAKC 1FP5A 1R3KA 4FQXC 5CGMA 1WITA 1KN2H 3QEGL 1CICA 3OKKB 2DOCA 1MPAL 4MXWH 4MQSB 3UZVB 2UWEA 3BPNC 3I02A 2AP2A 4ZYKA 1G0DA 1IGCL 4HIIA 4D0DB 3SKMB 1F4WH 3AVEA 2AV1A 4ENEC 3GSRA 4L4VA 1INDL 4UTBL 3LEXA 2VLJD 4X6EB 5LWYL 5CJOL 4WV1C 1MCLA 5DT1L 3WL9A 2VLJE 4U0RC 5FKPA 4B7LA 3HLAB 3QUYC 4LARH 1H15A 5C0BA 1WBXA 4F7CA 4XCFH 5MP6L 4QXGL 3RIAK 4I0PA 3FMGH 4F9PC 4KI5D 1ZOXA 2EH7H 5E94B 4XP1L 4OZHF 1ULVA 2WUBL 3CAFA 4KI5E 1XF2A 4L9LC 3MRGA 4E0RA 1KIPA 2VXQH 4ZUTA 2XZAL 3GZKA 2V2XB 4XPGL 3EYOB 3W39A 3A6CL 4HIEB 1G6RA 3UBXB 1TTUA 5I75C 5HTSA 3VI4E 4ZUUA 3OKOA 1JHLL 5F7WC 1M1SA 2MTPA 3FN0H 3QDAA 4QOKA 3KYNA 2CO6B 5E2TH 5DD1H 3I9GH 1E4KC 4UILH 5ENWB 4LLVB 3MRNB 4HMCA 4P5TC 3E3QC 1UXSA 5SX4H 1NAMH 3T2OA 5F9OL 1KN4L 1R3HA 3PV7A 1JYNA 1EJOL 3H42H 4NC1C 1NCTA 1Z9SA 3HKFA 3FQRA 4OUOA 3HI6L 1ZVHA 1N5AB 5LCVH 5C07D 3CX5J 3GSOA 4FXGA 3EO1B 4OIIH 3ZKNC 3NGBC 4RGNC 3ZTNL 4WFHD 1C7SA 4WFHE 4CN4A 3Q2CA 1MVUA 1FL6B 5GS2H 2DQJH 3DMMB 1HHJA 3DPBA 3OJMB 1ZHLA 2NYYD 4KWUA 5E99L 5DS8B 2EYRA 2HT2C 3BP4A 4KVCH 5DMIH 4FFVC 1FL5A 4FZEH 3X12B 4J23A 5F7YC 4TRPH 4KKCD 3L95A 3N1PC 4AL8L 3RDTB 3AUVA 4YHML 3JTTB 1YY8B 1MIEL 3O3EA 3IJHA 4QYOA 3BDYH 1IMHC 2AJVH 4WRLA 4HWEL 3UTSE 5EU3B 1QTYT 5SX5H 1DQML 4KRPD 4M61B 3OG4B 1EFXD 5MEOA 4LSPL 3E1F1 4LRNL 5KAQG 2VLJA 1EA9C 4K8RH 4OLXH 3M17B 1P4BH 1H3TA 1NGQH 4ZFOA 4PFEA 1A4JB 3SGJA 4N1CA 1NC4B 2XA8H 2UYLA 1HXMB 6FABL 5DJ0B 4JKMA 4K7PX 3P11H 4GRMB 2B39A 1PW3A 1KG0A 1XH3A 2VE6A 3F7PC 5GSRB 4Y1AD 4CU7A 1A1MB 5BV7H 1I8MB 2FL5A 4Y1AE 1T2JA 3D0VB 3G6JA 5EWIH 1L0QA 3CH8A 4LLUA 3SEPA 1HINH 4U1JA 1JWMA 1JHTA 2XZQL 3IXAA 3PXHA 4GG8B 4M7ZC 5C0FB 5TGBB 4RX4D 1P5UA 4M00A 3QEQB 2CJUH 2R0LL 5HHMB 2OR9L 5FO9A 4JR9H 3K4AA 4MNQE 1DFBH 1T03L 3KYOB 1V3JA 1LE9B 1Q1JL 1K8IB 1OAZL 3PV6B 1MRCL 1YEEH 2W60B 1KNOB 4XNUL 3BKJH 5J11B 5C0IA 1TENA 4RDQG 5C07A 3WS3A 4LHUD 5IESH 3O8XB 1S9YB 2HVKA 1LE5B 3BN9D 4NHCL 1S7QA 2BSSB 1TLKA 2O61A 4PR5A 3H3BC 4J3UA 1ZK9A 4FFZH 3QXDB 1GOFA 3FB7B 3MA7A 1AGBB 3CDGA 5L0QB 1HSBA 2C4FU 4QHKI 4HKBA 2DMKA 4PG2A 1GGBH 1E28B 2Z8WC 1MHPH 2DS4A 1BQLH 1JF5A 2APWA 3PE9A 1Q38A 2WINB 4BQBA 3AAZA 2QBWA 3CXDL 3ARDD 5T1MB 4WFEE 5IR1B 2ZZUT 5B4MD 4Z9KB 4EIZC 2ENSA 1QSVA 1I1AD 3L9RB 3DXAB 1QZ1A 1IQWH 3NCFB 4H0IA 1EFXA 4MS8D 1Q0XL 3AC0A 1TPXC 3OXRB 1LO5B 2V5RA 2L7UA 1CR9H 1UZ8A 1FIEA 5FKAB 2YSSA 3BMVA 1J1OH 4OFIA 5FUCE 1NKOA 1UFUA 4PY8I 5K9QI 1KCLA 1MNUH 2LABA 3QNZA 3RVVD 3TN0C 4WI7A 5TFSH 2LVCA 4YFEA 1AR2A 5AZ2L 5I1AB 1S7WA 4KK6C 4OZGF 4DOHB 2IQ9L 3WKML 3QDMB 2MJWA 3G6DH 1BQSA 4XBEH 3CFCH 5DGQA 3HB3D 2R9HD 3L1OL 4BSVA 4Y1AA 3ME0A 1ZT1B 3G5XA 4W6XB 4LCIL 2CKBB 2OMBA 1J1XH 3GSVA 3TBWA 3EOBA 1XCQA 3W5MA 4E41B 5DFWH 4RX4A 3BPOB 5D7SH 1R3IH 2QEJA 1QR4A 4M6ML 5GSVB 4BQCA 3PABB 2VL5A 4UU9B 3MREA 1P4IL 4UQ2B 4XVJL 5TH2A 1T04A 3RWGB 3QI9D 4R8WH 3WFHB 4RIRA 1SQ2N 5TDNA 3ILPA 1P84J 3KAAA 4N5ED 4FTVE 1RFDL 5DJCB 4FFYH 4JG1H 1CE6B 4LHUA 2EKJA 4QRUA 2RR3A 5F72S 5IG7B 2A0LC 1DLHB 1U3JA 3ZE0F 1BFVL 5E2WL 4H1LG 3SO3C 4LLWA 4QRSB 2AKRA 4P3CH 5EUKA 3I75A 3BEWB 4IRJC 2ICWJ 4OZGE 1LO0L 5DD0L 3T4AB 5IV2A 4X7CC 4IMLA 1B0GB 2EDHA 3O2WL 4LHJB 1T20B 2IADA 1OD9A 1XIWD 4AQ1B 1S9VB 2X42A 4IBLT 4XP9H 2QJDA 1RJZA 1RIHL 4BH7B 4NDMB 3SKOB 3PDGA 3O4LD 4OLEA 3ARDA 2G60H 4YHNB 1MAML 3T0ED 2D3VA 3UJJH 4MHHI 3MLTB 4MA3B 2GT9B 3T0EE 3H0TA 4NQEB 2BFVH 1L0YA 4J12A 4MDIA 1I1AA 3NFPA 3O45B 2MKWA 1DQDL 3AU1A 4YXHL 1BPVA 4Q0XL 4L5FH 4L3CB 4PB9H 4D3CL 4XC1L 1ZS8B 1JP5A 2UZIL 3T8XA 3OQ3B 1KEGL 4M8VA 4PJDB 3RNKB 2D0FA 2ZNWA 3VFOA 2P8MA 3MRQA 1SBSH 2AQ1A 4HGWB 3QQ4A 4JRYD 1NBVL 3V0VA 5IM7B 1X5AA 4HUXA 3ZE0E 3BJLA 2F74B 2BNUB 1WQVT 3CDYA 3IS0X 4HH8A 5IBUG 4X7TB 4ZS7H 3S3PA 3OKMA 3LD8B 4M7JL 3UAJC 1NDGA 1S7UA 2YRLA 4O58H 2FX7L 3VG9B 1CFNB 1A4KB 1CDYA 4HJGB 2DQEH 4HLZH 4G9FE 1MCQA 3GI8L 5EC2B 3KPOA 3RZCC 3QG7H 3U4BL 3X14B 5ICYA 3OJVC 4ELKB 3DI3B 2P7TA 5A2KH 1HCVA 3SDCB 5ECJE 1LP9B 4ODXB 4NT6A 4JM2D 3IDGB 5FO7A 1VB9A 2FIKB 4KQ4H 2XNAA 3B9VA 4OF0A 1JZ5A 3EOAA 4KROC 4HK0A 5I2IB 4FOMA 4GAJH 4MCZB 5D70H 5IMMB 5IJKC 3QI9A 3IETB 5K9OA 5H94B 4MAYB 2QTEA 3IB4A 1SEQH 2ZSWB 4HXAL 3QUMB 5MI0C 4Y8AA 4ZTPL 3DIFB 3BQUC 1IGIH 1LWRA 3MV9D 4WW2B 2R29H 4XCFL 4OIAA 3H6JA 1R3LB 1QSFD 4HKJA 4X7EC 3MV9E 1G7QA 1KB9J 3T0XA 2EH7L 1U58B 5EB9A 4OZGA 1RZGB 3GMQB 4GJTB 1QSFE 4G43A 2X1OA 3HHRB 3T1FA 1ZA3A 4U6YB 9CGTA 5H37H 3VXRB 1XIWA 5FHBH 1YEHH 1IGFH 1IGTA 4N8CL 4ZPTA 4OCXL 2JKXA 4WU7B 5DFVD 3FN0L 3VWJD 5C08B 5JW5A 4OB5H 5JPNB 1UYWL 4PJ5E 3O4LA 5DMYA 4LNRA 1UXWA 5I8EB 3KWWB 3T0EA 1EHLH 3GBLA 2E3VA 2GHWB 4R26H 2IEPA 4DK6A 1MRDH 3RY5A 2XTJD 5DJYB 4J8RB 4K2UH 5JIKA 2DI7A 4RMTA 2E7LA 1HI6B 3GSWB 2XTJE 5DRZA 4MVBC 4RAVB 2QKIA 3H42L 4LLMA 2MHAB 1S3KL 2ZUWA 4MQXD 4FHBD 3VD5A 3ARWA 2HJFB 4R4FH 1S7VB 3WN5B 3OR7B 3D3VE 5KSBB 4NO3A 4KMQA 4KK9C 1MWAH 1RULH 4JRYA 1NPUA 2BRQA 4OIIL 3MA9L 5CGTA 3T4YB 1MOEA 5IIEB 3QWOA 1ZT7A 2DWDA 1FRGH 1C1EH 4OFVA 5SV3A 4Z0BH 4GW1A 5FYJL 4BFBD 4I3GA 2DBLL 5C0CB 1PZUB 4FQIL 3O9WC 1ETZB 3VFVB 4FZEL 3U0WH 4TRPL 5CLWA 2J5LB 1WC7A 3PWPD 5D9SA 1EEZA 1FLTX 3VFSA 3PWPE 5DMGC 1U8MB 3VXNA 3O6FB 4NBYB 2VITB 3QSKB 1MJUH 1KJMB 4IIQA 4OKDA 4JM2A 3TZVD 2MCG1 1A2YA 3RWHB 4QRTB 5DVMA 1OP3H 3GK8H 1Q9WA 1T6WA 5EZOH 4K55A 2NY0C 3FFDB 3PWUB 1T1YA 3KDMA 4HIHB 1P4BL 3AB0C 4D8PA 1BLNB 1T83C 4NQDD 1G7PB 4OFPA 2AJSH 5K59F 1A9EB 3MV9A 4NQDE 5F8QC 4JDTL 1QSFA 3ET9F 2D7PA 4H0HB 2VTFA 1OLLA 1NLBL 2NY3C 1ED3B 3P11L 2E27L 4S11A 4EIGB 4I4WB 1N8ZB 4X9HA 3BXNA 4XB8A 5KSAC 1CDBA 5INCB 4ONHA 2NY6D 2VDRL 4LPTA 4GLRI 3VWJA 1RY7B 5BV7L 1CLZL 2VQ1B 4NQSA 1AGEB 3WIHA 3CK0L 1UJ3C 3E3QE 3DV6B 2AABH 1B0RB 2RHEA 4Z7UF 4LSTH 1VFMA 3L3KA 3OF6D 4YHOH 5CWSB 5F9JB 1A6TB 3SDXB 3QUXD 4PJXF 1DFBL 4BA8A 4KTDH 5KVMC 1N6VA 3BWAB 4G42A 3AREB 1AGDB 1T5WB 2WW8A 2EYSB 4Y5YA 2C1OB 1KELH 1OP9A 4MGXA 4JY5L 4XP4L 3RDTD 2J88H 5GRJL 1OB1B 2XFXB 4LVOB 1IEBB 1ZVSB 4X83A 3HPLB 5K59E 3DUHA 1W8OA 2CSPA 3OKKA 1MCOH 1WIUA 4Z76B 2RFXA 4D0DA 4U1IB 3SKMA 4HV8A 5F97E 2DLGA 1QLRB 4LKXB 2OM5A 5B39A 4MDJB 2D31A 4X6EA 5TE4H 4Y4HB 4MZ3A 1GGBL 1KENH 2NY1B 1MHPL 5A2IH 2A1WH 1BQLL 1CLYH 3HLAA 4OIBA 1B88A 3TFKC 3PWPA 4M03A 2BRRH 4YLQT 4C56B 4NPYB 3CFIC 1FAKT 3MBXH 4YE4H 2BMKB 3INUL 5E5UB 5LG1A 5DLML 4EUPB 3KPSB 3HG1E 4Z7UE 1F97A 3TZVA 3N50A 2SEBA 5FYLD 2IANB 4PJXE 2V2XA 4J3VA 5FYLE 1RK1B 1F3DJ 1TQCB 1D5IL 1JTPA 4O2CB 4MNGB 5JLZB 2VZ1A 4MJ5B 2C3GA 4NQDA 4N90D 3I50H 4UB0L 3OHXB 3R8BB 4K23L 4OZIB 5EU7C 4N90E 1MNUL 5T3ZH 2NYYC 1TIUA 4LLVA 3BAEH 4OM1H 3QEQD 2A74B 1K85A 1C16B 4MNHB 3S5LA 1A6AB 3ECBA 1RIVL 3K1DA 2Q7YB 1HQRB 4WUUB 4F8QA 4BQ8A 1QHOA 4HWBA 4XBEL 2OI9C 1D5ZA 2W38A 1A14H 4LEXH 4K71B 1PSKH 1N5AA 1HNFA 3WUWB 4FFWC 4KRPC 1MFAH 5TJWK 2EIZB 4OCYL 3ZLQC 5FYKH 5F89A 3L3GB 2FEEI 1S7XB 5HVGB 5D7SL 4Q6IB 4ONFH 1HK6A 4IOFC 3QUXA 2H8PB 3VFUB 4K94C 3P4NA 2PF6A 2VIRB 4TULL 3DMMA 3T0BA 5B3NA 3W2DH 3QHFL 4NKMB 1XGPA 4HS6A 5DS8A 4XMPH 4WW1B 2QR0B 2ENYA 3V6OC 3X12A 5D71L 1S7RB 2NTFB 3FB6A 4NWUH 4N9OB 3RDTA 4Z7QF 4JG1L 2JB5L 1OLZA 2EDLA 1KPVA 3KPMA 4I0CC 3JTTA 1YY8A 2B5IB 3GSNA 2KUTA 3VMNA 1UT9A 3DUUB 1SYSB 4LCUB 2VAJA 1GGIH 5EU3A 2O26U 3DXAD 4P3CL 4DN3L 1CLOL 2EYTB 3JV4A 4XCYB 3B9KC 3X11A 4P9HC 1T2QH 3RZWA 3M17A 3KPNB 1EUUA 1JPSL 5I8KH 1TZIB 2XICA 5IMKB 4OM0H 1MFEH 2I5YH 3LS4L 4GAFB 1YEJH 4Z7UA 1HXMA 4F3FB 4YDLC 1UB6A 5CKAA 5DJ0A 3ROOB 4PJXA 4WGVB 3CX2A 4Q9CA 4K3DH 2PYFA 3SO5A 5F8RC 5KZCB 1HHKB 3D0VA 4HEPG 4ISVB 3DRQA 2NXZC 4Z7QE 2ZWLT 1SBSL 5FM5M 4GG8A 1G7MB 5TGBA 4Q9RH 1Q94A 3QEQA 2BSED 4XNQB 4PREB 5SWZE 4JREB 4JGMA 5D7JC 2X4TB 3KYOA 4WI9A 1K8IA 1OL0A 3PV6A 3IDYC 1A5FH 2W60A 1KNOA 3TJEL 2NY4D 1CE1H 1MRFH 1A64A 1R24A 5BVJB 3U79A 3QG7L 4R90L 2HH0H 3HA0A 4MS8C 4JJHA 2R2BA 4ERSH 4J4PD 5IB2B 5AYUH 5I1HH 2YA2A 3HRZA 5D2NE 2BSSA 1XF3A 4X80L 2DYPB 3OKDB 4U49A 2W9LA 5DWUL 1IAII 5F7DB 2V5MA 1MHCA 4RWYH 4MJ4A 1AGBA 3EKCA 2PN5A 1QD0A 4GAJL 3WFEL 4P23B 5LGJB 2CGRH 2CLZB 1E28A 2VXTL 2LAAA 1N7ML 1J0KA 3CXHK 5T1MA 2GY5A 1RU9L 4RMVA 4QTHA 5CIPA 5IR1A 4WTWA 1PZ5A 4X8JB 5HYJB 4KMTH 4TQEH 3L9RA 3DXAA 3MRPA 1NLDH 2FD6H 1DQQB 4KK8C 1GAFL 5GZOD 3OPZH 3OXRA 1LO5A 4LF3B 1AD0A 3NCMA 1KGCE 1YEHL 2YXMA 3FOLA 2WSKA 4TTDD 4BQ6A 1CBVH 1LD9B 4MJ6B 4OLZH 4NM4H 4WWKB 2EEDA 3QI9C 4N8VG 4GH7B 1H5BC 3KLDA 5FOJA 4N5EC 5A43C 4AM0B 4QGYA 2R1YB 3S36X 5LKNA 1KXQE 4J7RA 5GS1A 2X05A 2X4SB 2EC9U 5ESAB 1HSAB 1V7NH 5IHUL 4OLYL 1TVHB 3BDXA 2ED7A 2C3VB 1ZT1A 1ZTXL 2JB6B 4LPXA 5E4EB 2AEPH 2O5XL 5JA9A 1RULL 15C8L 3L3IB 3JV5A 3EO9H 2O5ZL 2ITDA 1F90H 3CU1A 1DUYA 5F6HI 5AG8A 3EFFB 3NMEA 3PABA 2COQA 3PXJA 1KCSL 1RZ8B 3NACH 1X5GA 3EDFA 4YIQB 3LVEA 1B90A 4LLAA 3K4DA 4C54A 3FZUD 2EE6A 1A9BB 1GHFH 5DJCA 5SV4A 3U0WL 1CE6A 3G9VA 4PBVC 3W82A 1F4XL 2YA0A 2E7LC 3D0LA 1YQ2A 5IG7A 5B8CA 1DLHA 3ULVC 4PRPB 4RSVA 3GSUB 5IW1A 3VW3H 3LHPL 3HZMB 3NCYS 1VERA 3T4AA 5DC4B 4BUHA 4P3WA 4LIQH 1VENA 1D5MB 1T20A 2DD8L 3VXRD 1T0MB 1S9VA 2P4AB 1CXEA 2MFNA 3BKML 4P4KC 4S1RH 5AYQA 2XWBA 1I7UB 3TIEA 4W4OA 4XVTH 2R8SH 4KHXH 3DJ9A 2FBOJ 4HWZB 1KJVB 4Z0XA 2DL9A 1X5LA 4LP4A 4FRWA 3MLTA 5DRNB 1EFQA 3OZ9H 4JFEB 4MA3A 4MD0B 1ZLWK 2GT9A 1FPTH 3O6LH 4WUKH 4XNZC 2F53B 2QADC 3O3DA 3C9NA 2Y25A 4JFFB 4KUCD 3BZ4B 2VDLL 4HWUA 3FQWB 5HHOE 1P53A 1MLCB 1LNUB 1YPZF 2EE9A 4L3CA 2LV4A 4LDOB 4WVRA 2FGZA 4TUKH 3T3MF 4IIQC 4PJDA 4JM2C 2AK4E 5FECB 2RCSH 3HZVB 3C6LB 2W0LA 4RQQA 4HGWA 1FORL 2XKNA 4PRNA 2EDFA 1ZXQA 5IKCB 2QQNH 4LSTL 1G0XA 4YHOL 4OT1L 2ERJC 3QO0B 4X7TA 1ES0B 1OOAA 3QAZB 4K94H 4KTDL 4GKZA 1FDLH 1CFQB 1FVDB 2X4OB 5C0CD 4WFFD 4PGBA 2BOBA 1XZ0B 2X70B 5C0CE 4NOFA 4DN4H 3DTXB 4CVXB 2DTML 1FYTE 1DANU 2J88L 1VPOL 3BYYA 5CCKL 2MQCA 3P77B 1IL1A 4ELKA 3EGSB 3QULB 1AQDB 3SBWA 3QFDB 5DFVC 2FIKA 2XV6B 3HE6C 1N26A 5CJQH 1MLBB 3LN9A 5I2IA 4HPYH 4MCZA 3U6RA 2ADIB 5CEYB 4NJ9L 1VESA 1DVFC 1YPZE 4ZFFB 3MLWH 1BZ9B 3IAPA 1KYOJ 1DE4B 2EC8A 2ZSWA 3TH4T 1KENL 4AY0A 4P9HH 3QUMA 1WJ3A 3S7GA 3T3ME 43C9B 4C57C 1G9ML 3DIFA 3L5XH 1U42A 3UX9B 1MFDL 4WW2A 3ZKMD 3GMRA 3MFFA 3MTRA 3MBXL 1BFOA 1R3LA 3VFWA 5JR1L 1FNEB 3QPQC 1U58A 3DVNB 4Y5YC 4UOW0 4QCIA 4Y2DB 2OR7A 5ANMB 1JZ3A 4U6YA 4X99B 2AGJH 5IVOA 3VXRA 3RNQA 1PJ9A 1MEXH 3I6KB 4DUWA 2R56L 5F1IB 4RA0C 4WU7A 2R0ZL 4XCEB 4WHYH 5JPNA 2EDQA 1BF8A 4OD3H 2ZCHH 5I15H 2YA1A 3T0DA 4KJWC 4UNUA 5T3ZL 5I8EA 3KWWA 1FNGA 1WEJH 1DQLL 4KTYA 3UTQA 2FECL 3PL6B 4WU5B 4DZBA 5DJYA 5TF1L 4J8RA 1DBBH 4HW6A 5E6YA 1HI6A 3GSWA 4GBXB 1JI2A 1ZSDB 2E5EA 2IQAA 2VZOA 4RAVA 1EEUA 3A67H 5HSFA 5IHZB 4YEEA 2VXVL 5JXEC 3FCTA 1S7VA 3WN5A 3OR7A 1AR1D 2DLEA 1QFWI 3BIKA 4XGZB 1PSKL 5L88H 2EECA 1KFAL 4V1DB 4RGOH 4ZTOH 1SBBA 3T4YA 4DK3A 1D6VH 1KCVL 1CGSL 4IEFB 3MXVL 1RZJC 4Z78B 2YUWA 3H9ZA 1BQHG 4L4TB 2H45A 3ULUL 5C0CA 4Y4HD 1V8HA 3IKKA 1ETZA 3VFVA 3MRDB 2X1PA 4MA8L 3MLVH 4NWUL 1WFTA 4BJLA 4C56D 1K2DA 2HJLB 3RHWF 5JZ7D 2IF7A 4X4XA 1MY5A 5JXAL 2GJ6B 3GJFH 2VITA 3O2DA 3RBSA 1HHGB 3KPSD 1KJMA 2OTWA 2OTUB 1PG7H 2IC2A 3RWHA 1GGIL 3DV4A 3KPSE 4QRTA 3QJHB 3U4AA 2P24B 5CJBA 2O93L 1IM3B 2ILLA 1ITBB 4CNIB 4JPVH 1WT5A 5D7IB 1BBDH 4XMLL 2C4XA 3PWUA 4R6UA 1T2QL 3CGTA 4HIHA 4HLJA 1FN4B 1G7PA 5AWNH 1A9EA 3LRGA 1GCFA 1MFEL 1BOYA 3DMMC 1BD2B 4JO1H 5ESVB 4HUMB 4OZIE 4LAQL 3ES6A 3IAQA 3LSOB 1MREH 1MJ8H 1CXHA 4IJ3C 4P59H 1ED3A 3TT3H 3L5WA 2VAAB 3RDTC 2ZKHL 3RJDA 4I4WA 5INCA 1CFVL 3I2CH 1J1PH 4K3DL 2WV3A 3FT4B 5GS0C 4YO0A 3OX8B 1C12B 1A7QH 1JPTH 1AJ7L 5JNYB 1AGEA 2E6JA 3TM6A 1NC2B 3H7BB 3RY6A 2W65A 2Z91A 1I1YB 3DV6A 3RI5F 4G80A 5A2JH 1B0RA 3LN5A 5EUOF 5I66B 1G6RL 4YHZH 2EDKA 2DKMA 4I9WE 5F9JA 4OUUB 4FABH 4XXDB 1MCPH 1OT2A 1S9XB 3BWAA 5TPWH 4UTAH 5IVZA 2HMID 1IC4H 4HUVB 2EYSA 1A5FL 5HDBF 1CQYA 2YEZA 5C2UB 3MLPA 5A40E 2XFXA 1OAQH 2HH0L 3HMXA 3BGFB 3HPLA 1BJ1H 3IRPX 4P2RB 2H32H 5CP3A 2AEQL 2J8UB 4ERSL 5DQDH 3ULVH 5AYUL 4KKBD 2VLKB 4A6YA 4U1IA 4P2CG 2NZ9D 4OGXH 4W6WB 1QLRA 4P49A 3MRJA 5J1TC 4N8PA 3V5HB 4Y4HA 4HQQL 3RVUD 2CGRL 3MBEB 1MCWW 1U8LB 1RUKH 2FIRT 4JRXB 1MCWM 4WCYH 4C56A 4NPYA 4UV7H 4AYFA 5EN2B 5ILTH 1F45A 2BMKA 2OJEB 4JG0L 3MLSH 4RMQA 3V7MA 3CSPA 4EUPA 4DGVL 4YHLL 3KPSA 5EUOE 2MWCA 1J87A 3QEUB 1UWXK 4K3EH 3LS5L 5J11C 2FD6L 4XPHH 4CDHA 2CD0A 3PJSA 3IFNL 4HK3J 3O8XC 1T5XB 1Y6KR 3GUTA 4O2CA 3MFGB 4MNGA 5JLZA 2OJZL 2NY2B 4MJ5A 4XCNA 3HNSH 1CBVL 3OHXA 2C9AA 4OZIA 1JRHH 2MCPH 5L0QC 1IQDB 4U1MB 1KLGA 2IH1B 1A6PA 5DHYB 3S5LG 1A6AA 5EBWB 4HKXB 4U3CA 2Q7YA 1HQRA 4FQQB 4ZFOL 4FS0A 3O41B 4H5SB 3PWNB 4EI5B 4LSRL 1KLFA 4XPFL 1RZKL 2Z92B 35C8L 1S5HA 1HN1A 1NEZB 3D48R 1YNKL 3RGHA 1PLGL 1DBJH 3V0AC 3L3GA 4DUVA 4Q6IA 3LEVL 3EW3B 2DYPD 1F90L 3VFUA 3NCYP 2VIRA 5DF0A 1A3LL 2W1NA 4ZODA 3WIHH 1F6AA 1I1CA 4WW1A 5CEXB 4LKCB 2NTFA 3LMJH 4Z7WF 1RJLB 5SWSE 4XP5L 2AJZB 4QT5B 2GY7B 4NCC2 4X6FB 1AQKL 3TO4C 1CQKA 3AY4C 3CLEH 3DUUA 4DW2L 1MSPA 5HYJD 3VW3L 2YRPA 1E4WH 4LCUA 4ODVH 4OJFH 2HJKB 4GG6F 4HLZG 1RVFL 5M94B 2G5BB 1VGKA 4QO1A 3JVGA 5I71B 4FXLA 4NRYA 4ODWB 2EYTA 4L8CB 5D5MB 5GGTA 1GVIA 5EPMB 5B3JF 1XR9A 4S1RL 5I74B 1TZIA 3SJVB 5JHLL 5IMKA 4X98A 2R8SL 2LVEA 4XVUD 4JPIB 1ZHKB 5EUOA 1Q8MA 4WWKD 4RNRB 4F3FA 4XT1C 3SDDB 5GIRB 4WUKL 1FVCA 4MD5B 4Q9QH 2NR6D 1I75A 5L9DL 3ZL4L 3LB6D 1XCTB 3P0YH 5CZVH 4WO4B 4BKLB 3L3OA 3WIIH 1HHKA 4HF5H 4P2OB 3ULVF 4CVZB 2RCSL 1H3VA 4ISVA 1NL0L 3EYUH 4JZOB 5IVXB 1V7ML 4MXQC 4Z7WE 3BE1L 1G7MA 3CFKB 5IQ9A 5H37G 5IFHH 2DDQH 1T7WA 1IGYA 4OKVB 3BESR 4X5LA 2VDOH 4PREA 1IZKA 5E00B 3W0WD 1RZJH 2X4TA 3MXWL 4GW5A 1Y0LA 3W0WE 4ZO6A 1FG2A 1KPUB 1KPRA 3MNZB 1AXSA 1JTTA 4DN4L 5EBGA 3QZWG 4KZDH 5BVJA 4N0CC 1BVKB 1M7IA 1MVFA 2HTKC 1RUAH 4IRZH 5IWLC 4PRPD 5IB2A 2A6KA 3VCLB 1L0XA 3SDYH 3OJDB 4PRPE 3OKDA 2DYPA 2ZCKH 1WF5A 3MLRH 3MRFB 4PUBH 4JLRB 4NQVA 5F7DA 3KPRB 4G6KL 1J86A 1IAOA 4JO2L 2RIKA 3MROB 4L3AA 3GBML 3ZDYF 5LGJA 2CLZA 5CBAB 4M6NH 1JPST 2RQ8A 5F96L 5KVDH 5E8NA 3D5OF 3V9FA 4H26B 1LEIB 5JW3H 3LD8C 5K9KB 5KN5A 2GITA 4JFED 4RA3A 1OCWH 3VG9C 3VFPB 3ZKQD 3GB7A 4X8JA 5HYJA 3ISWA 4JFFD 3OSKA 4KK5C 2V17H 2B1HH 4IMKC 1UQSA 3QO1B 4JFFE 5CEZD 4AK1A 2AGJL 4AMKL 1U8JB 5HI3D 5KVFL 4GRWB 5GGVL 2VQTA 3M45A 4U6TA 4MAUL 3TBVB 4BK5A 4FQCH 3DETD 4TUOB 3SDCC 1OGTA 5GS0H 3SBWC 3SOBH 3QIWB 1LD9A 5LGKA 2P44B 5TQ0L 1WEJL 4WWKA 1CFTA 3L3DB 4MAYC 1UA6H 4ZXBB 1I4FB 2B7DT 2YBRB 2D0GA 2X4SA 1DSFH 5ESAA 3BEVA 4WW2C 2CDEB 3DYOA 5DR5L 4AEIH 3QNYA 5HHPB 2C3VA 4LGSB 2VB5A 5JOPD 3ZDYE 5DD5H 4MYWB 5JOPE 4JFHD 1LO3H 3QHTC 3FFCB 3LKPB 4MXVE 4HAFA 4OAWB 2X1XR 3ARGD 1XGTB 5JW4M 4OD2A 4UBDD 2DQIH 3L5HA 1U8OA 1FLRL 1A0QL 1C7TA 3ZT5A 3EFFA 3GEWB 3W0WA 5KS9F 5FUOH 3CH1B 4JHAH 2V9QA 4RMRA 2A73B 2X1WL 4YIQA 1YUHA 3ARXA 1FQ9C 2QQKH 2BNQB 4M43L 1XF4B 3U83A 4PJFF 3EZ8A 3PHQB 3F65A 3U1SH 1G7LB 4QXUL 4PRPA 1QPPA 2FRGP 4F2MB 3EYQD 3GSUA 3WHXB 4RRPG 3L3HB 3LCYA 2X2YA 1DR9A 1BMGA 3EYVB 2Z4QA 1XGRB 1D5MA 4PLKC 3QFJB 1T0MA 1UM6L 4HC1A 3B2VL 4YK4B 1VACA 5ADOH 4FMKA 4Y4KB 1UB5B 4A2MA 1INQB 1JPGA 1ORQA 1F13A 3X3GH 1MY7A 4HWZA 1JUFB 5B22A 3FQTB 1KJVA 1Q9KA 4JFEA 1FH5L 3RL2B 4CRPA 3K2UH 2F53A 2YC1B 1F8TL 3WYRA 4JFFA 5ITBH 4P59L 1RZ7L 2Q8AL 4GBXD 3FQWA 1DLFH 1JGDB 2J5LC 4C58B 2H2PD 1W8NA 4O2FB 4AG4L 4O00A 5BRZD 4I5BB 4ODSL 2H41A 3O6FC 2WQ8A 4HT1H 5BRZE 3D25A 4YDIL 5FECA 1O5DT 3HZVA 1TCMA 3KLAA 4YXLH 2HFTA 1BM3H 3WV0A 1GRWA 3PWVA 2H3NB 1WT5C 2Y36H 3NAAH 3PP4L 5L2JB 1N59B 1OW0C 5IKCA 3QNXB 3OWEA 5DVLA 3DO7B 3QO0A 4HGMA 1N3NB 3ZKMC 1FVDA 2H1PL 4F58H 5C0AB 4OF5A 2FATH 2KBGA 1IC4L 4AZ8A 3MRBB 2JE8A 3AM8C 1U3YA 3DTXA 5EU5A 4JFDB 3I85A 3LPFA 4CVXA 2EKSA 4DWHA 3A6OA 2VLRD 5FGCB 3P77A 3HNVL 3ARGA 3EGSA 2VLRE 5IFAH 1YN7B 3QULA 5F9AC 1ZLSH 1AQDA 1TZHB 5D6DA 4BQ9A 3QFDA 2M2DA 2X09A 1D6EB 1MLBA 3NFSH 2ADJB 2CKBH 5DHXB 2Y6SD 4M02A 1HZHH 1X3DA 1DE4A 5EOCJ 5CZXD 43C9A 4WCYL 4DQOH 1IEHA 1ADQA 3AREC 1BD2D 4PD4J 3F6LA 1CFBA 1FNEA 3MLSL 1JGUH 3DVNA 4MWFB 4Y2DA 5ANMA 3F7YB 3L7FA 4LVOC 3THMH 1IILE 1P7QD 5F1IA 1LK3L 3MODH 4JCLA 5DUMH 4IRSC 1H9VA 4XCEA 4OQTH 4X7SL 1DP0A 1U95B 2MPAH 1I7RA 2FBJH 2NY1C 1DUZB 2ZCLH 3IAGC 4M62H 4GBXA 2EZ0C 1ZSDA 2DQGL 5IHZA 1JHKL 5DZOA 5BRZA 2H6PB 4NO2B 5DJAB 3HR6A 4PJIF 2IALB 4XGZA 2WBKA 3VXSB 5F1OB 4TTGA 3M8OL 1I9JL 4TUJA 3MC0A