5IFAH

Crystal structure of unbound vrc01c-hugl2 fab from an hiv-1 naive donor at 1.82 a
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
219
structure length
219
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCAKISGSYSFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords VRC01c-HuGL2 Fab heavy chain
publication title HIV-1 broadly neutralizing antibody precursor B cells revealed by germline-targeting immunogen.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2016-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ifaH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ifaH01
1GOFA 2P24B 4UZGA 3VMOA 4BH7A 4YFLF 2G5RA 1PG7X 3TZVA 1Y18A 4FXGB 3BRDA 4HXBL 1R3JB 3QBTB 3VH8A 2A6DA 3ZKXB 2XN9B 2YR3A 4KUZH 1CLYL 1MWAB 1BFVL 4E42B 1CU4H 1J8HB 1RZKC 4PJHE 2ZSWB 4Y5YC 4TUOB 1QSFE 3C6LB 4X4MA 1O7VA 1AR2A 2LTQC 3T04D 4FQCH 4MQXD 2A38A 4MS8D 4PB9L 1OM3L 4XP6L 2QSQA 2BMKB 4B50A 4UILH 5F3BB 1NLBH 3GBLA 3BQUD 2P5WE 4HJGA 3C6SA 4Y4KD 5CZXD 1N2RA 1S9WA 1ZT7B 1WISA 4HIIB 4PJAF 4X6DB 3OF6D 3T3ME 4NQDE 2RQ8A 5AUMA 3FQRB 4OTXH 2AJZB 3LKQB 5F8QC 4HIEA 4OZGB 5CJBA 3MUGB 2DYPB 1I7TB 2XWJB 1ACYH 3VFOA 3FQWA 3IJHA 1KELH 3ARGC 4LLUB 3QCVL 5H94B 2OSLA 1P1ZB 4ZSOE 4NN7B 3MYJA 3E6HB 5HVWA 4UV7L 5KSUA 3MNVB 1VGEH 1WITA 4DVRH 5DRNB 1U8PB 2PO6B 3KPRB 1EO7A 1S5IL 4P2QA 5CWSB 4DGIH 5SX4H 5IK3A 3DX9B 2XXCB 2H41A 1DUYB 4PY7A 5EG6C 4LARH 4ZQKB 1MFAH 1I3RB 4G8GB 2DWDB 2XQBH 2JIXD 1RMFL 4U1HB 3SCMB 4OZHA 1HZHH 3UYRL 4M4PA 4P23C 2CMRL 3U0TA 3FONA 1BHGA 3QAZC 2A6KA 1HDMB 5DC9B 5DJZA 2AV1A 5HYSA 1CG9B 4KKLC 4RAHA 2WIIB 2FD6L 4ZO6A 3DSNA 5LBSL 1AD9A 4RMQA 3MC0A 3B5TA 4QHNA 3T0ED 2ZCLH 1JPTH 4N5UA 5D8JL 5C0BA 3MRNB 4S1RL 5EOQH 4XP9L 1VFBB 3GSUA 4IIQB 3SDCB 1BFSA 4WTZA 5CILH 2V2TB 3VRIA 1E4XI 3O3EA 3WFZA 5K9QG 3ARFD 3I50H 7CGTA 1YQVL 2V2XA 5E1AB 1DQQA 1MJJB 1QRND 2OI9B 4IOIA 4NQSB 4ZD3H 1B4JH 3VE0B 2I5YL 4MNQE 5T3ZD 4I48A 4QLRA 3NN8B 1UH3A 1YMHA 3ARXA 4OF7A 4C56B 4ZUUB 3JWDL 1W72H 4XTRC 2IH3B 3LKRA 3QHFH 3B9KB 2VXUH 1WCBB 4R90H 2WWKT 4CU6A 3N1QC 4OCWH 3CGTA 4ONHA 4EIGB 4HUWA 4CN6A 1WWBX 2NY7H 2EDNA 3B5GA 4HBCL 5GRJL 1MCHA 1PQZB 1SYSB 5KBNC 1FNAA 2YOCA 2IPUK 1K4DA 2EECA 1BAFL 1QQDA 3SQOL 4Z77A 4QT5B 3V4UL 2Q7YA 2AJXH 2VLME 4NQVB 5DUPH 4LQ1A 1GSMA 2EE3A 4DN4H 2YMXL 2R23B 1CE1H 1JWMB 5GSRB 2GT9A 1NBYA 1U3HA 1H3PH 5T3ZL 2H6PA 4M7ZC 5SX4I 3JBG7 4C83B 4MZ3A 5I8OH 5D70L 3HC4L 3O8XC 4NOFA 3U4EA 3VWJB 4GBXB 1NC2D 2VUOA 5HYFA 3UTZB 3KPSE 3RTQB 4F8TA 1IGFH 5CGMA 4PJBE 4YPJA 2VDQL 1TENA 4J3OC 1MQKH 3OR6A 3VD5A 3F58L 4IS6B 1AGFA 5B38B 1A4KB 3TM6A 1CR9L 4LCWB 4CJ1A 5DQJA 5IBUB 1S7SB 4QHLB 1HSBB 3GIZH 4OZFH 5TGBA 2GSGA 3VD7A 4N5ED 2D9QB 2EEDA 1N5YL 4E0RA 5I73C 4LLYB 2X40A 3LDBB 3SE9L 2DOCA 1E27B 3GMRB 3RIAF 3P40A 3QG7H 1I1AD 4XVTL 2VB5A 3FQNB 1IGTA 2NXYB 5T1MB 5C6PB 3EYFA 5I8KL 3S96A 4RMTA 1CFVH 3FFCD 5EBMB 1WCQA 5JW3H 5E9DD 3IXAB 1I8LA 4NQDA 2OR9L 4DVBB 3QUZC 5MEPB 5D1ZB 4YAQA 2QSTA 1WICA 4JY6B 3HE7D 4DGYL 4OIAA 1QRKA 5GRUL 3PDOB 4Z18A 4R0LA 4J1UB 3IU4H 3MBED 3FN0L 3VDAA 3VA2C 1FV1A 2B20A 3BGMA 4PJGA 2C7UB 2ATKA 2FECI 5ESQB 5JDSB 1GPOL 4YIQB 5KG9B 3MNWA 3WKML 3UCRA 1NMCB 4LSQH 5EU6B 1VFUA 2Y07H 3T4YB 5HYJE 4ZFFB 5HHQA 3MV8D 2ZSVA 1MFEH 3ZE1F 2PF6A 2BFVL 4DCQB 1QSEB 3LKSB 2BVYA 5E56A 3WE6B 2J4WH 1VFAA 1D7FA 5JLZA 5EOCH 3LHPL 1CK0H 3DO3A 3PP4L 1WAAF 5JORB 4AEFA 2IMNA 2HTKC 4NKIL 4NOBA 3UTPD 5KVDH 3VD9A 1B0RB 4QHMA 4FQ1L 3OR7B 3U48A 1JWUA 3GJEB 1B0WA 5FA3B 1XR9A 3BP6B 3UTSB 4OD2B 1TLKA 4MX7A 4JQIH 3KPOA 4JFDE 3U46A 6CGTA 2OP4L 4YGVA 5ALCL 5JNYB 4Z6AT 4R3SB 1FC2D 2AGJL 2XKNB 3B2UD 4AL8H 4OCMC 2F53B 2Z35B 3QQ3B 4XPFL 1EZVY 2Z31D 1U6AH 3UP1A 1AR1C 4M3JA 4C54A 1KJVB 4YPGA 4XPTL 1DANT 1KT2B 4IMKA 4MNQA 1CFSA 5SWZD 4D0BB 5HDBF 1EGJH 4EQ3A 3W9DA 3L3OA 1CGSH 1YYLH 5FYKE 5JW5B 5D9SA 4Y4FA 3MJ7A 5L2KE 3N50A 4Y2OA 5ICYB 2XKUA 1J1PL 2Z8VC 4TRPL 4C58B 3L5HA 2Z9TA 1DQLH 1MF2L 2ORBL 3O0RL 1XF4A 2C4FT 4FFWC 1SMOA 3LQAC 2FB4H 3VFSB 4ELMF 3D39D 4KMTL 4YDKH 2VE6B 2B1AH 3VXOB 5I8CA 3HI6H 3KYNB 3HZKA 3PDDA 5KVGH 4YHMH 2XG4A 2FJGB 3WV0A 4WUUD 4MQ7A 3CUPB 3HNSL 1F3DJ 2DQGH 4WFHE 5F7FA 4JJHA 3L3IA 3T3PE 3OXSB 2ERJB 1EEZA 4MNHB 1XGYH 4X7SH 5GGTH 2ZOLB 4LCUB 4PRDA 5IHUH 2G60L 2VMFA 4I13B 5C08D 3HI5H 4OCRL 3RL1A 5DI8A 5H8DA 1RZJL 3VXME 3AAZB 2AK4E 2MNUA 2ZKHL 2FJFB 1FIEA 2D0GA 3MV7B 1KGCD 1DEDA 2D9CA 1KG0B 3CFDB 4UT7L 1L7IL 1NEZG 1PLGH 3QDGE 4KROB 4ENED 3LZFH 1NAMA 5HPMB 2P8MB 1U2CA 3EYUH 4EKXA 1EHLH 3O4LB 4U1JA 3BXNB 3QDMD 4U7MA 3VGBA 4A6YA 4MQTB 4JQXC 4LRIA 5EDXA 4U7SA 2CK0H 3ARTA 2E3VA 5CSGA 1KN4L 2AJUH 5EZJB 4UTBL 4HX1A 3QRGH 1IZKA 2ATPB 5BRZD 1OCWH 3QULA 3W9EA 3GFUA 2ZUQC 4XMLL 5DMKB 4RGND 3FZUC 1Z0NA 4JAMA 4XB8A 5DO2D 4ISVA 4OAWA 3DECA 4WEMB 5EA0L 4U2YA 5I15H 1A1MB 4ZDHB 1Y6NR 1SJVA 4BH7B 1LWRA 1P7QD 4AMKH 5GS3A 2NY4D 2VXQL 32C2A 3TZVB 2NY0B 1Y18B 1MCCA 4IRZH 4ZXBB 2X4UA 3PHSA 3VH8B 3KNBA 2A6DB 4PP1C 5DQDH 2VJXA 1QEWA 1Z9OA 1VPOL 3G5VB 3QO1A 1OP5K 3RX8A 4JHAH 4M9PA 2GCYB 3UYOD 4X0KB 3LS5L 3TH4T 2FSEA 4PJDF 3FT2A 1GC1L 4JN1H 4M7LT 1CD8A 2F5AL 3JUYA 4AIZA 2AKRA 2A77L 5DRWB 3ARWA 4HJGB 3ARBC 4DQOL 1FO0B 3C6SB 2YA0A 3PF2A 2N1KA 2ICCA 4L9LA 1N2RB 1S9WB 1P6AB 2VLKE 2BVPA 3EJYD 4UUJA 5J13C 2WUBL 3W82A 1MFBL 4XNXH 1MAMH 2CRZA 1JGEA 1CDIA 4MQXC 3NIDE 4HIEB 3V52H 2DQDH 1V7NL 2E7LC 4MS8C 3KPQB 3VFOB 1FORL 4OLWH 2HA1A 3RAJL 3RPKA 3U36A 4DUXA 3C09B 1A3RH 1KEML 1YUHA 2XRAH 3BQUC 3DGCR 1EA9C 4HS8H 4M8VA 3TT1L 3VXUE 4YJZL 3HC3H 3M1BA 5EB9A 1GHFL 2DS4A 4Y4KC 2OSLB 5CZXC 4Q2ZA 1KCSL 4RISL 3N1PC 3MYJB 2QL1A 4MA3A 3X3GL 3VFPA 2BDNL 2ZG2A 5E08L 1X5IA 1EUUA 2O5XH 1F2XK 2APTA 4JFDA 4PY7B 4HFUL 2XICA 5DURD 4F15C 2HFTA 4RMSA 4GAJH 3TF7C 4L8CB 1LEGA 1ZEAL 4KJWD 5ID1A 1I75A 3LY6A 2KZWA 2AJSL 4WRLA 4MAYA 3MROA 3HS0B 4XVSH 2DQCL 5FKPA 3WDHA 3U0TB 2A6KB 1UACL 3GO1L 4YUEL 3DHJA 4MA1C 5DJZB 3RWCA 1VEOA 2M8XA 1INQA 5HYSB 3QEQD 4DAGL 4KTDH 1I8IA 4P46D 2FO4A 1DLFL 1I9EA 3WNKA 1AD9B 4ODTL 3QXDB 4UT6H 5A3ID 5IV2A 3PGCB 4UOW1 3IJSB 3OKDB 2VLRB 5C0BB 1RIHH 3BKMH 5L2KA 3GSUB 2P8LA 3X3FL 4F7TA 4FFYH 4XP5H 1JHKL 2J8UE 1EFXB 2IBGA 1BP3B 1F3JB 1BIIB 3VRIB 3O3EB 5J06A 4ODHL 2IPKB 5A2KH 3AROA 2CLVB 1DQQB 3X13A 3I3DA 3QXAA 4MAUL 1HI6A 3E0GA 5FO9A 4IOIB 2GYSA 3T2NL 1MCPL 2EDRA 3T0EC 2X6MA 1X7QA 1KCUH 3B9DA 3PWUB 4LQFL 5I1IL 3HMXL 4L3CA 4R6UA 1CL7L 2B2XH 3IDGB 2GEEA 3BI9X 3K81A 4TTDD 5CS7A 1MY5A 5INDB 3QUMA 5E7BA 3CDCA 5MI0B 4I5BB 2B7DT 4HUWB 4HWBL 5B3JE 4JREC 3LKOA 2CDFA 3VXMA 1F11A 3BKJL 2AK4A 2MHAA 2CIKB 5D2NC 2A1WL 1DBMH 2Y5EA 4OF5A 2EC8A 3BDXA 4XPAH 1K4DB 4ZMAT 1F90H 1QQDB 2EO1A 2OJEA 2X4RA 2C26A 4Z77B 3EOBA 2J7LA 4PRPD 2VC2H 5E8OA 4UIKH 1EJOH 3L3KA 5CMAA 5IBTL 5J11C 3RVTC 1KC5H 5E94B 3F7QA 2GT9B 2C3WA 5AD0B 1U3HB 3SKNB 1ZANL 5LGHL 3C60A 1OB1A 3O45A 2DQEL 2EYSA 5SWQA 2Y06L 1URLA 4H8WL 3WFDH 3P0VL 4HDIA 3VWKA 4J4PA 2YK1L 1YEEL 1MFCH 2X7LA 2DDQL 4ERSL 5ENWA 1NL0L 1FQ9C 5DC4B 1ZLVK 4G5ZH 1FL6A 3OR6B 1I9JL 1ZT1B 3AMKA 2YPLB 4XP1H 2CKBH 3ZL4L 4LLQB 5DQJB 5DTFA 3VXRE 3V95A 5L7XH 3ORJA 3T4AA 2IADA 1KBGH 4HIXL 4E0RB 2YPVL 1NEZB 1MHHA 1G7IA 3F7VA 5FUOL 1UENA 4R4BA 1C5BH 2FATH 5KS9E 1IGTB 4LPVA 2AJYH 3V4VH 2X41A 4H5SA 1GAFL 1UQSB 3NCYP 4Z5RB 4DZ8B 2CGRH 4YXHL 3KLHD 5JQ6H 5L6YH 1A6ZA 4Y2DD 2VLKA 1I8MB 4N5EC 3MV9E 4DKEL 5CJXA 3JVGC 2RCSL 4NZTH 5L2JA 4YAQB 4KJYA 2V17H 3QIWA 1PX3A 3LS4H 3MRJA 1RK0B 1I3GL 4U3XA 1FFQA 1N0XH 1TCMA 2ITDA 4JR9L 4K3HA 5C8JB 1FV1B 3ROLA 3BGMB 4PJGB 4LASL 2ZJSH 1OTUD 4FQIL 1MCLA 3MNWB 4XBPA 5IVZA 5IVXF 3AS1A 5TE4L 3NGBB 5HHQB 2ZSVB 2HRLA 4AENA 1UADC 2W9LA 3HE7C 5A16B 3WL9B 5LGJA 5C0FB 2YD6A 4MXVF 4S1SL 1VFAB 1AC0A 2VXSH 3MBEC 5JLZB 3TIDB 2BY1A 4WU7A 1FVCA 1XGUA 4M5YH 1T21A 1T2XA 1OGAD 4O02L 4JO4H 5D96C 5FA4B 3L5XL 2H32H 4FTVD 5DMGC 4NHUA 4IJ3B 3JV4A 2JB6B 1BGXL 1CXIA 3MJ8A 4DWHA 4I18C 4LL9A 3NCMA 2PXYD 1JWUB 4CMHB 1JNJA 1XR9B 1U8LA 5DVNA 3DV4A 1U8MA 2YD9A 4RFOH 5I6XC 5DT1H 4ZS7L 1CBVH 4JFEE 4CVUA 5B8CC 4WW1A 3TNMB 1OF2A 2O61A 3GSQB 2FIRT 1LE5B 4OI8A 1G6RH 3LMJL 3NPSB 1OTTD 2YXFA 4Z78A 3SKJH 2G2RA 3FTGA 4UOW0 4TYUA 4QTHA 5E5MA 5DD6A 4R7DB 3BZ4A 3OZ9L 1ZOXA 2ZUSA 1QBLH 3OKNB 1CDHA 4OCXL 1CFSB 4QGYA 4XZUB 5GRVK 5C09D 3B2UC 3W9DB 3L3OB 1IQWL 5DR5H 4YK4B 5SWSE 4Y4FB 3MJ7B 2WWMD 1T1ZB 4F9PC 2Z31C 2VSCA 1A6AA 4YHKL 4PRHB 1BEYH 2ESVE 3HNTH 1PZ5A 4LVHB 4F7EA 2K9UA 4GXVH 1CICA 3W0WE 3WLBB 3O3AA 3K2MC 4LSDA 5T1KA 1XF4B 1OP5H 2MPAH 5B39G 5HYIA 3MCLH 3RWEA 1OARH 1RZJC 1TXKA 1GOHA 4WV1A 5I8CB 1FIGL 3HZKB 4YHPB 1IC5H 2JB5H 4P48A 2PTTA 2V9TA 1JPSL 3BAEH 4LRNH 3EUUA 5IJVA 3LEXB 3L3IB 4WW2C 4ZFOB 1P6FA 1EEZB 1HH9B 1UWGH 3UJJL 4PRDB 3MJ9A 2G5BA 4P59H 1FGNL 3AB0C 1SJEA 2UZYB 3QIBA 4K9EL 3RL1B 1YPZA 4BFIA 3NA9H 2EZ0D 4NO0A 3OG4B 1MJ7H 2W07A 3T0VA 2Z4QA 5ALBL 3VGEA 15C8L 5L9DL 3LV3B 4ODVH 2A9NL 4D0DA 4NC1C 4NT6B 4LNRB 1NAMB 4Y16D 3DUUA 3V9FA 4MJ2A 2AJVL 4G7YH 1X4XA 4HIHB 4OGXL 4A6YB 4IRSA 4JANA 3IFNH 3MACH 1KLGB 2WNGA 4K7FA 1B0GB 1ETZA 4HX1B 4WW2F 5JHLH 4WHYH 3QULB 3VXRA 5BZWA 3W9EB 3MGTA 2BP3A 4M9OA 5IFHL 4ENEC 2EDWA 1YNLH 2FLBT 4JAMB 4Z7UA 4P2OD 4OAWB 3LKPA 4QXGH 1GC1C 3NZHH 4JDTH 32C2B 3UTQB 2X4QA 4NN5C 2X4UB 3EOAA 1BOGB 3MRLA 3OAYK 1X5LA 5FYJD 3VGAC 1V3LA 2R56L 1DZBA 4I3SL 4QGTA 2GSIA 4N90D 5H37G 3MLXL 2IC2A 1J18A 2AXGA 3MV9A 4RGNC 3JTSA 5DO2C 2NX5D 3GNML 5BW7C 3C8DA 2FSEB 5FHBL 3KPNA 4XWGL 4LVEA 1HHGA 2NY4C 4JVWA 4OLZL 3KYKL 4R26L 4J23A 5HHOE 4XNZB 5B21A 5C3LD 2AKRB 1NCWL 5D5MF 3P0YL 1K2DA 1RZ8A 4HAFA 4L9LB 5EFIB 2XY2A 1CQKA 1M7DA 5C7XH 4UUJB 4HKJB 3TBSA 4XCCH 3O2WH 3CDYA 1FFNA 1JGEB 2DTML 4LDOB 4P3DA 1DBAL 3O6ML 5ECJE 3SGKC 1JCKA 1LMKA 3SQBA 5AZ2H 1J1OL 3U36B 4F9LC 3H9SE 3QUKA 4IBLT 1KTDB 5D7LD 3Q48A 4S1QH 1YUHB 3QFJE 3LN9A 1K85A 5FYJL 4HV8A 5HHNA 4XWOD 1FRGH 4Q2ZB 4L4TE 4G8EA 2VABB 4MA3B 3TO2A 4KQ3H 2E7CA 3EJYC 1FCGA 4KV5E 3VFPB 3HUJE 4OF3A 2KQMA 1KSRA 5F7NC 3ZHLA 4JFDB 5T3XL 5GSVA 3D87B 3QCUL 3WBDA 4JFEA 1DL7L 3QXUA 1UWXK 1LEGB 5KSBA 5TQ2H 2ARJA 4N0UE 5ID1B 3DX6B 5EIIA 2I9TB 5EU4A 1J0YA 5I74B 3H3KA 3EOTH 3MROB 1YN6A 4WO4C 3VA6A 4GXUM 5IT2L 4HKXA 1BQSA 3GMPA 3RWCB 2AJ3A 3BISA 3PG2A 3VU2A 1K9TA 2FO4B 4WI9A 2GUOA 3RIAK 1PSKL 5F6HJ 3SY0B 1IM3B 3V5DA 2Q8BL 4NQED 1JL8A 4KJWC 5EZLA 4PGJA 4D2NA 3KLSA 4BJLA 4R7NA 1WSST 3TN0A 5IV2B 5SWSA 3BKCL 5D1QA 1FFPA 2P8LB 4Z0XA 3DRTA 3TNNA 4DUWA 4S11A 2HG5A 2GKIA 3VG0L 4OFYA 4OI7A 3W0WA 1A8JH 4XMPL 1UCTA 4BH8B 4WI8A 1VADA 3HNVL 4P46C 5KVEL 5FV2A 4U1NA 1FDLL 1N64L 1MRFH 2QQKH 1HI6B 5F88A 3U9PH 1DVFC 5HVFB 4HMCA 5A3IC 3BT2H 4L8BA 4UIMA 3HA0A 3O2VH 1EJ6A 4L3CB 4YHZL 1HSAA 1MWAL 5CP7A 4XMKL 4WWKC 4XPBL 5I1CL 2X05A 5J6HB 3OKKA 3VI4F 3I2CL 3K7UA 3QPXH 3BW9A 4KGJA 4RX4A 1FYTD 5I1GL 4M43L 3LKOB 3HZVB 1WTLA 2CDFB 1D5IL 3VXSA 2MHAB 4PJDE 3STZA 2F54A 1MAJA 4DFIA 5TJWK 4MCYA 1M1SA 2IAND 5EORH 1K4CA 5KANI 4TTDC 4GG6F 5EBLB 2X4RB 4R2GC 2R4RL 3EOBB 2UWEE 4OB5L 5MERA 3I84A 4PJFF 2NNAA 3LH2H 5E8OB 5DDHA 1LK3L 1WJ3A 1XT5A 4NC0B 5CMAB 5T1LB 1G9NL 3BZEA 1GXEA 3PWJA 1DANU 4YNYB 2DMBA 3QFDB 5B39B 1QA9A 2AW2A 3C60B 2VITA 4WENB 3WJJC 1MHCB 4UB0H 4EXPX 2EYSB 4ZUWA 5I1JH 5SWQB 1RIUL 3O6FD 2E7MA 3EDEA 2X4TB 1BM3L 4ZO9A 3VWKB 2A9ML 4K07A 3GEWB 4JFFD 3TBVB 2VLJA 2X7LB 2W60B 2C4FU 5J8OA 1V7MH 5GGVH 2R0ZH 3QNXA 1XCQA 5ACZA 3X12B 2DB8A 3VCLB 3Q3GA 4U1IB 4X6FA 1DE4A 1UXSA 3FQTA 5DTFB 3SKOA 5MENE 4NN6B 2R0LH 4JRYE 5AEAA 2IADB 4CBPA 1KCLA 4MJIE 1JRHI 2VN7A 4BSWB 3SHSA 1MHHB 1G7IB 3WS3A 4JKKA 4OIIH 1RFDH 4GS7B 3MA7B 4R4BB 5C07B 4JO2L 3CX5K 4H5SB 4M02A 5J56B 3U7YH 1A6ZB 2VLKB 2HJLA 1YQ2A 4O2CA 2VZTA 1BVKA 4NUGL 1Q9KB 5L2JB 2UZIH 1ZTXH 4HIJA 4JHBA 4KJYB 3LRSA 1LO4L 3QIWB 3MRJB 5LGKA 5IVOA 9CGTA 3H9SA 4OZFG 3UC0H 2ITDB 3QFJA 3AXLB 1FE8H 1VEMA 3OBAA 1R0AH 3ROLB 1QO3A 2DI8A 3ZT7A 4LSSL 1MVFA 3GSOA 3KLHC 3IKKA 2F58H 3IFLL 4L4TA 4Y2DC 5IVZB 2UUDK 4FQJL 1P5UA 3TCXA 3DBXA 3HUJA 1VSCA 1JP5A 2QADD 4ZNEE 1RZKH 2ZOKA 4AENB 4BZ1H 3D2UA 5LGJB 1NBZA 1JYWA 4AT6B 1FLTX 4U1GB 2I24N 2B5IC 2DBLL 3FB7B 1WUNT 4WU7B 1XGUB 1T21B 4N0UA 1OTUC 3VFNA 4XPHH 4L8DB 3UJTL 2EDBA 5HJ3B 1T1YB 5T5NG 5ESAA 1NCAH 5MEQA 3VI3F 4EN3A 4Y5XA 4NHUB 3MJ6A 3JV4B 3OXRA 3MJ8B 3ESVF 2F8XC 5E8PA 3G5YA 1U8LB 3GSNH 3DUHA 5ESVA 1SMAA 1U8MB 3QCTH 1R5IA 3IXTA 3DROB 4A2LA 3MRRB 1ORSA 4NUJB 4JN2A 1G7HA 5FM8A 4WW1B 1J10A 1OF2B 2RFXB 3HE6A 3K4DA 4PRBA 4K94C 3PL6D 4YBHA 4YGAB 3BMVA 1V8HA 2AXFA 2PXYC 2G2RB 2OZ4H 3FTGB 1NMAH 2NY6B 1AXSA 1A6TA 1P53A 4LNVA 1WZKA 4QTHB 4YFLI 5DD6B 5E5MB 1FVDA 3BZ4B 2P46B 1I1YB 2Q1EA 3A67H 1ZWIA 2X10A 3IF1A 3LRHA 4HGWA 5IMLA 4YC2B 3UTOA 2KPNA 4GMSH 2X4SA 3CFCH 4G6KH 1KFAL 4O51B 4QRRE 4PJIE 1OTTC 2WMPA 3P4NB 1RJCA 3IGAA 5EU6D 3FAWA 4QRUB 4M6MH 5D6CA 3W11D 1A6AB 1HEZB 1XF3B 4P5TB 1PZ5B 3BUYA 5F6HI 4YXLL 1YECH 5JMRA 3O3AB 5T1KB 4OQTA 1JF5A 2PKDA 1Z5LA 4K9EC 2PYFA 5F1NA 2FX8L 5F96L 3ILPA 1A1OA 3J8F7 2P5EA 1KB5H 4WV1B 5H2BA 5AAMA 4AG4L 1TQCC 3DO7B 1W0VA 1IGCL 1Q0XL 2ZCLL 3A6OA 1JPTL 4OKVA 4MB3A 4TVPE 1AFVL 2WWMC 3C87A 1EERB 5IJVB 4JG1L 2UWEA 1CD9B 1BOYA 1G7MA 4BK5A 2MCPH 1T4KB 3OTTA 4YXKL 1AP2B 5FCUL 3HCVA 3AU1B 3DVNA 4RQQA 1YPZB 4APQD 3TJEL 1B4JL 4NO0B 3TO4D 2PYEB 2A6JA 2V5TA 1LO0H 2Y23A 3G6AA 4U1LB 4KTEH 4WI6A 3WFHB 5JDJA 4DKAA 2WBJD 2UVFA 3MJGX 1I9IH 5DHXB 5FGCB 4P4RA 1UM6H 3VGDA 4XCNA 4EVNB 4GG8A 3S36X 2X89A 2OS7A 4P4KB 4Z0BL 5BS0D 3P11H 1GIGL 2YBRB 3MOBL 2EZ0C 4EXKA 3O3UN 2VL5B 5E6IA 1A7OH 1U9KA 5IEHA 1FNSH 3PNWA 1TETH 3LAFA 3GSWA 4K7FB 3I6GA 4PGZA 1ETZB 4K7PH 4B53A 3BPLB 4V1DB 5MENA 4WFFD 1RZGB 3VXRB 3V6FB 1LK2A 2WBWB 3BKYL 1IAIH 4JRYA 2V2WB 2J6EA 2W65A 1UWXH 4Y16C 4Z7UB 3SOBL 1T03H 4CN1A 1QR1A 4JB9H 2FGZA 2IALA 1QPPA 1J1XH 3MFGB 1CE1L 2X4QB 3IDYB 1EEQA 1UM5L 3OV6A 4D9RD 3EOAB 2I60L 3MRLB 1QBMH 1TTGA 4YDVA 3RJDA 1JYNA 5A1AA 3U4BL 4MB4A 4L1DA 4JKMA 1OL0A 5IW1B 2GSIB 2AXGB 5DSCA 4OIBA 2VR5A 1JK8A 4P2OC 2B39A 1IGFL 3KPNB 4IM8A 1QUNA 3V8CA 3MXWL 3M8OH 3AC0A 3MLTA 4F57L 1DQML 1LGVA 4GFTB 3WUWA 1EO8L 3EDJA 1F4AA 5IBLD 1CDYA 5D7IB 2YKLL 4RAVB 1RZ8B 4WHTB 5DA0B 3MV7D 4O4YL 3NCYS 4NQCD 4ZNEA 3FRUB 1JGVL 3Q1SL 4P3DB 4RWHA 1J05A 3WIHL 3EKCA 3BZDA 3U1SH 5ERWA 4U3HA 1RU9L 5F6IB 5HHNB 1Q9WB 4FQQA 1QSZA 2HFFA 1MEXL 1JWSB 3SDAA 1MI5D 4G8EB 1T89C 3IFPA 3TO2B 2XTJD 2DI7A 1NCBH 4JDVB 3EOYG 3GRWH 5F9AC 5HYEA 4JZNA 3F7PC 4J3TA 1D5BA 2AEPH 3THML 1L6ZA 4XH2A 4JFEB 3TT3H 6FABH 4AH2A 4EEEA 4TUKL 4XC1H 5GJSL 1ODAA 1AKJD 5EUOF 2P4AB 3U7WH 5KSBB 4XWOC 2EIEA 5EU4B 2NR6D 3HFML 4ONGL 1ADQL 1X5AA 1YN6B 2JJSC 5EU7E 1IM9B 1T80A 3O6KH 1BBJB 4HKXB 1CXEA 1NCCL 1A3LL 5DJ2A 3GMPB 25C8H 1FPTL 2AJ3B 5DA4A 1E6JH 2GUOB 4ONFL 5JPMA 1IKFH 5EZLB 2IPUG 4R7NB 3B8SA 4PJIA 1U42A 5J0BA 3LPFA 1P4IL 3DRTB 1JMZA 4KXZH 4Z0XB 4PBXA 3QYCA 5KVFL 3C08L 2PW2A 5C0GB 3C6LC 1VADB 4JGMA 4U1NB 4Q0XL 1CLOL 1JJUA 1KIQA 5F88B 5GGQL 3BP7B 4PUBL 5K93A 4L8BB 4L8SC 4UIMB 3CK0H 4OV6F 1R24A 4OGZA 1J5OL 4KKBD 1UCBH 3GMMA 5CP7B 4JFOA 4HQQL 5IJKC 1U6AL 4YWGL 4G6JL 1G9NC 1CLZL 8CGTA 3BW9B 4HC1H 4JO1L 2FX9L 4QHUA 4P2QD 4JZOA 3SGEH 3FT3A 3QHZH 3VXSB 2LFGA 1T6WA 5DUBB 5D2LB 3RNQB 4X6CF 2F54B 3ULVL 4JY5L 5IF0B 1SY6H 4HJJL 1CF8L 2I9LA 1UWEH 3MODH 1K4CB 1DSFL 5E8EB 1AO7E 3MOAH 3HR5A 3FB6A 4TOYL 4G8FA 2HN7A 4KPHL 4RAUA 2NNAB 2UUDH 3H9ZA 1U8OA 1WT5C 3V79C 1DBKL 3FOLA 1R3KA 2D7TH 2IG2H 3QR2A 5BO1L 1T83A 2OX5A 3LQAH 4K7PX 1OP3K 2ZNXA 3OHXB 2JCCA 1T20A 3WXVL 2VITB 1CCZA 4JPIA 4LCCC 5DHVH 5DHYA 2XA8L 3QNYA 1WBYA 2AEQL 5C0BD 4LIQE 1LEKA 4OF0A 4OZGF 3RA7H 4AM0A 3OB0H 2FBJL 3MX0A 1KJ2H 2VLJB 3WD5L 4M5ZL 5C0RH 3A6BL 1NPUA 5ICXA 1TNNA 3WNMA 2XFXB 3P77A 2GITB 3QNXB 3ZT6A 4F3FB 4KDTC 1OD7A 4FS0A 4MD0A 4KH2A 2NQCA 3Q3GB 4X6FB 3O4OB 1NAKL 1S3KH 4FQHB 1X5GA 2BNRA 3O6FC 4WHCA 3ROOA 2QQNL 2EDYA 1P4BH 1FNFA 2HJFA 5E1HB 3S98A 1RULL 3WS3B 1SBBA 4HT1L 4YZFF 2H9GA 4CADB 1YY8B 3W81A 4HXBH 4M93B 3STBA 2AJUL 3MLRL 1X5HA 2WBKA 1CLYH 2NW2A 4HS6A 1E4KA 2CLRA 43C9A 1BFVH 3BN3B 1RZFL 3FL7A 1UVQB 1AH1A 2V7HA 3Q6FA 1BVKB 2IFGA 5ID0A 2E7HA 3VFUA 4HIJB 5A2JH 1IQDB 5ADPL 3LRSB 4H20L 4M61A 3ZKQD 3C9NB 2OTWA 3H9SB 3RKPA 1KTLA 5DK0A 4PB9H 1OM3H 3QFJB 4XP6H 3G04B 2BHYA 3FHAA 1OAXL 3MOQA 1BBDL 3QDHA 3RPIA 5HPOA 1HK6A 3REVA 3G5XA 1NDMA 3SGEI 3G6DL 3FB5A 3DBXB 5FYLE 1DQTA 3QXTA 3MREA 2ZOKB 3BIKA 5CGTA 3D2UB 5H35A 3QDAA 1T04B 4F58L 2EYTA 2J12B 1ZA6B 1SEBA 2IPTL 2BOCA 1FL5A 1CTOA 1UZ8B 2DKSA 2VDLL 3QUYB 4M7KL 3WNNA 3VFNB 3QCVH 2HJKA 3BPNC 5ESAB 3ZE0F 4Q9RL 4UV7H 3G9VA 4PG2C 3A6CL 1XEDA 3BUTA 2QADC 4EI5A 3CNKA 3OXRB 3VJ6A 4PYHA 3EGSB 1QSFD 2NZIA 3RTQC 3ME0A 5E8PB 1S5IH 1YC8A 5ESVB 3SJVB 3WHXB 4GG6E 2UV3A 4UQ3A 1R5IB 4N8VG 3IXTB 1T2JA 1ZA3A 3TFKD 5HHPA 4PJFE 3W2DL 3H3BC 4HUNB 4OLVL 2P5WD 3HE6B 1EHNA 1MH5A 1RMFH 3MLVL 4KC3B 2VZOA 1DQJA 2YA2A 5AG9A 4CW1A 3UYRH 5IUSA 4HK0A 1F02I 4PIRF 1FNHA 2CMRH 3QEGL 3ZDYF 1I3UA 2BX5A 4NQDD 1S9VA 2O5XL 3MUY1 1KYOK 1FVDB 1HQRB 1RD6A 1BWWA 2FD6H 3ALPA 1DBJL 1ZWIB 3KPLA 1TVHA 3IF1B 4HGWB 5LBSH 5IMLB 2HFGL 5J1AB 2MFNA 2X4SB 3PL6C 2P45B 5D8JH 1KPRB 4S1RH 4XP9H 4LGRB 4WHDA 5GGRA 3IGAB 3RWGA 5D6CB 4UI2A 4R9HA 1A6PA 3RWIA 3BUYB 4QO1A 1YQVH 1Z5LB 2PYFB 4G8IB 2CRMA 3ILPB 5ETUA 2P5EB 5H2BB 4M6OL 1YA5A 2I5YH 4PJ8A 4OKVB 4X9GA 2V5MA 4Y8AA 1LEIA 3JWDH 5BCAA 4Y4HD 1A9BB 5JHDE 1MHEB 5INCA 1AO7A 3W11C 3VG9B 3G6JF 2ICEA 1G7MB 3ZLQC 2FEDD 1L6XA 4NQXA 1WWWX 4CGTA 3TC9A 2JJTC 4W70A 3CSGA 2XPGA 3HCVB 1CZ8L 4N9GB 4OF6A 4PJ5E 1MCFA 1OSZA 4HBCH 5HHXL 3I9GL 1RI8A 5GRJH 1T1XA 3G6AB 3RNKB 3O6LL 1KN2L 2MJWA 4X9HA 3CH1A 1GOGA 1BAFH 1QFOA 4I77L 2AQ3A 2CH8A 3SQOH 4P4RB 4XNQB 3V4UH 3J7HA 5BVPL 4DW2L 4R97B 4H0IA 4RDQG 5E0QA 3BO8A 5F9DC 4PJ9D 2YMXH 4APQC 1M05A 3TO4C 5E6IB 5IEHB 1GZPB 4MNQD 5T3ZH 5ABDE 2VQUA 5BVJA 4R4ND 2WBJC 3WNLA 5IKCA 3B2VL 4N0CC 4NRZA 1NFDB 2QKIA 5D70H 4EOWL 3HC4H 1IC7L 1G9ML 3NFSL 5EZOL 1DN0A 4BUHA 1QR1B 2CXGA 4Z7QE 4ZUVA 3NFNA 4UQ2B 3TBYA 2OXHA 2YPKB 4NNPL 1T1WB 2VDQH 1E4WL 3MUZ1 4D8PA 4HFWA 4MGXA 3S4SA 3U79A 3F58H 5L8LB 1P69B 1CR9H 1CFBA 2WV3A 5DSCB 2DMCA 1X9QA 4Z7NF 1N5YH 5FIEA 2VLMD 1PJ9A 1X3DA 3C5ZD 3SE9H 4X5XA 1IKNA 3MLTB 4P99A 4XVTH 3VXTB 2YWYA 3CFEA 3QQ9D 3G5ZB 5I8KH 3O11B 2DN7A 3IVKA 4PRIB 5JIPA 2APWA 1AY1L 3RI5F 1CDCA 1RUKL 2OR9H 4UDUA 1RUQL 1QBAA 3KPSD 4W6YB 1J05B 1DR9A 1EBAA 5K59E 3NCBB 1ZSDB 1HXYA 4DGYH 3V7MA 2NXZB 5GRUH 1BD2E 1X4ZA 5ERWB 1UXWA 3FN0H 4KU1A 4HLZH 1QFHA 1IAOA 2DLFL 4GAYA 1GPOH 1CE6A 2HFFB 3TH2T 3WKMH 5IW6A 5JQ6L 3SDAB 1NCUA 4Z7WE 4HUVA 4PGDA 3L5WB 2APFA 3OKEA 1QKZL 3M07A 2BFVH 3AREB 5ISZA 4RMRA 5I1LA 1ZGLP 2HYMA 4JZNB 1SJHA 3MRBB 1D5BB 1X4YA 3CXHK 3JV6B 1XGTA 1OQOA 4LHUA 4XH2B 5IFAL 2DQJL 2BC4B 2CKBB 4AH2B 3LHPH 2KQNA 3QI9A 2FZ3A 3PP4H 2Z91B 4QNPE 1OGTA 3TVMA 2XTJC 4NKIH 1OP3H 4FQ1H 4QOKB 5BQ7A 3NZ8A 5DJ2B 1K8DB 1KF9B 1RHFA 3MA9L 2CDEA 2DJSA 1F4XL 3V2AR 2EXWD 5AZEL 3BP5A 4BM7A 2JJUA 5JPMB 4JO3L 1K8IB 4A6YL 2OP4H 5ALCH 4G9FE 3GK8L 5FOBB 2ADIB 2AGJH 2NR6C 3DNKA 5TE6L 3RY4A 4PJIB 2VZ3A 3PDGA 4KY1L 5HYJD 5C0ND 4XPFH 2PW2B 5IG7A 1NBQA 5GJTL 1PGRB 4XPTH 3KJ4B 1OAKL 4MD4B 1P84K 1YEKL 1BQHA 4N8VB 2Y1VA 5JHDA 3PQYE 3IDMA 1OVZA 2GAZB 4JFOB 4NCC2 3E1F1 1J1PH 4TRPH 3M17A 3PABA 5IB3A 1WIUA 1MF2H 2ORBH 3O0RH 2Y4SA 3NTCL 2EDXA 2GJ6E 2R2HA 4JZOB 1OSPL 4KMTH 2FHCA 2OL3A 4OCSL 1Q9LA 1A7RL 4X5WA 1NFIB 1JZ5A 3EO0A 5HGHB 5LWYL 2Q8AL 3HNSH 5J7CC 1EV2E 4MAYD 4FQXB 3FB6B 4JFQA 2HN7B 3IS0X 1U8OB 3ULVF 3NMEA 4X6BB 5AWNL 1R3KB 2G60H 3WDJA 4LSUL 4LDEB 5B3NA 5MEOA 4OCRH 5IB2A 4M6NL 1ITBB 1RZJH 1Z9LA 2JCCB 1T20B 2ZKHH 5FYKD 3RDTD 4JPIB 5A2IH 5DHYB 1WBYB 4H1LA 4GRLA 4UT7H 1L7IH 1WC7A 1LEKB 2SEBA 3DURB 4LLWA 5L2KD 3VFGL 4QY8A 4U0RB 3KYOA 3P4OA 3CPLA 2A83B 1L0XA 2M26A 1KULA 2ED7A 3BEWA 5J57B 5ICXB 2H8PA 3EW3B 1QZ1A 2YSSA 1A64A 3CSYB 4KK9D 4MD0B 1P7HL 1KN4H 3GMNA 4X99A 4UTBH 2O26U 2BNRB 4I3RL 3H9HB 3ROOB 4WFHD 4XMLH 2HJFB 1HHIA 4Y1AB 5FO7A 5EA0H 3WUZA 3OGCA 5T3XE 1KB5A 2OMNA 2X9XA 5FAAA 3BPOB 3FN9A 2VXQH 3QEHB 2NY2D 2AS5M 1PG7L 4TN9A 4ZTPL 4OZHF 3VXMD 3MRMA 2AK4D 4BKLB 5GGVY 2E8YA 5FKAA 3MMEA 5FYKL 1VPOH 1LP9B 5E4EB 3OKOA 2CLRB 2XZQL 3BH8A 2VO5A 2DAVA 3QDGD 3Q6FB 3JWOL 3LS5H 3O3BB 4MDIB 2P49B 2ICWJ 4YH6A 3L3HA 4KJPC 5MI0C 1I7RA 3MLZH 4QRPB 4JHWL 1BD2A 1GC1H 1X5JA 1KIRA 5DK0B 2FO1A 5TH2B 2F5AH 4G6ML 2A77H 3G08A 3L9RA 5ELIA 5C0JA 1S7VA 2Y9RT 4HZLA 1T2QL 4DQOH 2NMSA 2WIMA 4EUPH 2W9DL 4Z7WA 1A4JA 4HWZA 3G5XB 1NDMB 4GRWB 4WU5A 3REVB 5E8DL 4PJEE 4HJ0D 1IE5A 2EH7L 3MZTA 2WUBH 1MFBH 5H35B 5CAYB 4J4PD 5DFVD 4X80L 5DVKA 4E9LA 1V7NH 3QUML 1SEBB 3PWVB 1FORH 3RAJH 2BOCB 1FL5B 3WIIL 3CXHJ 2P1YA 5I71B 1KEMH 5M94B 3RZWA 3TT1H 1TPXB 3VFMA 2X4NB 1GGIL 5DXWA 2XN9E 1KCSH 4RISH 3AS0A 2DD8L 3SDXA 2X1OA 3X3GH 4KI5C 4CMMA 2BDNH 5CIPH 1J8HE 3VJ6B 3WFBL 5E08H 2EDQA 3Q6GL 1DEEB 5EBWA 2XWBB 4HFUH 1A7QL 3GBNL 1VEPA 4UQ3B 1BQHG 3R0MA 2AV7A 3E8UL 1ZA3B 5AAWA 4ZO8A 4G9FA 1ZEAH 3TBTB 2CR6A 1MH5B 3O8XA 2AJSH 2EDDA 4XCFL 1FNGA 3CFKA 2DQCH 1PW3A 4LFHD 2C1PA 1R5WB 4PLJD 4X6DE 4TUJA 1UACH 1S9VB 3GO1H 4YUEH 4DAGH 5JTWA 4OZGE 1ZVSA 4FZ8L 1DLFH 4TPRL 3TFKC 4LEOA 3SKMA 1P4LA 1TVHB 5DJYB 4GW1B 1T7WA 2D0HA 1JPGA 1FSKB 4ODTH 3VFVA 1P84J 3VXUD 4UTAL 3QEUA 4KI5F 5BV7L 2EICA 3PQYA 1BJ1H 5E95B 2EIDA 4HH9B 3X3FH 4JZJA 4PGEA 5GGRB 3RWGB 3FCTA 2X9YA 4IDLA 3RWIB 3KPRE 4NJAL 4ODHH 3PWPA 2EIZB 1H0DA 3K46A 3CVHA 3SPVA 2GJ6A 5CGYD 1T66D 4NFBA 4MAUH 5ETUB 1UZ6E 2DF3A 4R0LC 1OTSD 3RGVA 4GKNA 3T2NH 1MCPH 2VYRE 4PJ8B 4Z7VA 5F71A 4YZFE 4G8GE 4LQFH 3NACL 5I1IH 3MLPA 3HMXH 1LEIB 2GHWB 1CL7H 2ICEB 1NANI 3NGBC 3QUZA 3X14A 3DX8B 1NDGA 3QWRD 1XIWD 4NQXB 2HFEA 4I4WA 4PV9B 1HE7A 2FYYA 4HWBH 2IQAA 3F12B 3WEXB 1J9CT 1OSZB 1PVHA 2A1WH 2XZCL 1S7XA 3T3MF 3X11A 4Y4HC 1FP5A 2LU4A 2VLLA 1E4JA 2IMMA 2VDML 2FEDC 1FG2A 3SDDD 5IBTH 4KK5D 4K3EL 1JF1A 4J8RB 4KRLB 3UTTA 2C3HA 2IH1B 4TULL 4X98B 1ZANH 5LGHH 3IDJA 1XGPA 3N1FC 4XRCA 2DQEH 5BVJB 2VERN 4RFNB 2QKIB 2Y06H 1UG9A 4H8WH 3D18A 3P0VH 1H8NA 3HLAB 5FB8A 4GSDL 3BVNA 3UX9B 2YK1H 1YEEH 1A7PL 3NFNB 5IQ9A 3TCLA 4PJ9C 2DDQH 3WO3B 1CICD 4ERSH 5T1KD 1NL0H 5C0CA 4NDMB 4IMKC 1I9JH 3S4SB 4ELMA 3BGFB 1E4XL 1RHHA 4R4NC 2H1PL 1RUML 3D3VA 3ZL4H 3CC5A 4XXCA 5HDOA 4K7PY 3KYAA 2R15A 1ORQA 4N0YL 4ORZC 2FDBP 3FO2A 4O5LL 3RL2A 4HIXH 4IRJD 1XGQA 4U2ZA 1D9KA 4L5FL 2YPVH 4S2SA 2ARWA 4LVNC 4RGMB 4X5XB 4CAGA 5FUOH 2V5SA 1ZS8B 1AGDA 2YC1A 2YD1A 3EHBD 1V3MA 3QIBD 4MYWB 2YD5A 5DEFA 5DD3L 2A73A 1GAFH 3IVKB 4QXTB 4POYA 4X6EA 4PJEA 5IESL 1S7TA 4CVZA 3VGGA 1KUMA 4LLDA 2AAVA 4CDHA 4JRXA 2ID5A 4UDUB 4DKEH 2RCSH 2P24A 3C5ZC 3P9LA 3KAAA 5EUKA 1I3GH 4Y7MA 1CL7I 3KXFB 1RZ7L 1T0NA 2PR4L 4FXGA 3QQ9C 4IRSD 4WTXA 4DGVL 1MRCL 1R3JA 4JR9H 3WSQL 2MKWA 4LASH 2XN9A 4FQIH 1AJ7L 4KDWA 2DLTA 1CE6B 4KMQA 4LCWE 4HUVB 1JVKA 4KKNA 2M1KA 2ICWI 1FJ1B 4E42A 4PGDB 3VXRD 5TE4H 1J8HA 2GFBB 1G1YA 2ZSWA 3RIFF 1ZMYA 3OKEB 4GW4A 5F70A 5ISZB 4F7PB 2DRUA 1SJHB 3MRKA 4MDJA 4S1SH 1XGTB 4TTGA 3MJ9L 3TPUA 1HKFA 4OCNC 1MUJA 1LO2L 2ZG1A 4JRWA 1WWAX 2FZ3B 5JW4R 4O02H 4HUUA 3TVMB 3L5XH 4HIIA 3IKCA 2E6JA 1BGXH 3MV9D 4X6DA 5E24E 4QCIA 1LDSA 3NZ8B 3GSVB 1YNKL 1LE9A 3LKQA 1S7RB 2OBGA 3MUGA 2DYPA 1P9MA 4ZS7H 1VGKB 2R1WA 3AM8C 4GLRI 3MRFB 3BIBX 3SO3B 1U8KA 1OP9A 3AUVA 1FZOA 5D71L 2WSKA 3S35L 1VFOA 1G7LA 3O9WB 3LMJH 3MNVA 2YUZA 2L4OA 5ANMA 1EAPB 4L4JA 3DRQB 2PO6A 5DJCB 3WFCL 2HH0L 1CD1B 1MNUL 2EXWC 1QSEE 1NUGA 5CWSA 3OZ9H 1DUYA 1HKLL 3JZ7A 3EDKA 1Y6MR 3QDJD 4OCXH 1F3RB 1MCJA 1MCEA 1BQHB 1IQWH 2DWDA 5JHDB 5FDYA 4L9LC 3IDMB 4AZ8A 4HG4K 5C0NC 4KVCL 5GHWL 5F9WC 4Y5VC 4Y5YB 2OR8A 2PN5A 4YHKH 3M17B 5IB3B 2LTQB 1HDMA 1JIBA 3QIUD 2RAMA 3UTSE 1CG9A 2V6HA 2R2HB 4Z7NE 2WIIA 1Z3GL 5HGDA 3NABL 1FIGH 1Q9LB 4JKPL 4X5WB 1DTUA 2AK1H 2H26B 4PJ7E 3EYVB 3AS3A 3GKWL 4GKZA 1JPSH 2NLJB 4IIQA 2F53E 3MR9B 3SDCA 4OM0L 4FFVD 2V2TA 4JFQB 3UJJH 2A0LD 2ZCKL 1INDL 5E1AA 5JIKA 1FGNH 4WI3A 5CZKA 5MEOB 4K9EH 1QFWL 3ARGB 5IB2B 2EDOA 4Y4KA 5ALBH 3F6LA 5HGBB 3TN0D 15C8H 5F7KC 5SWSD 2IH3A 4H1LB 3OF6A 4MAYC 5I9QC 5L9DH 5D1QD 5EU5B 4JHZA 1WC7B 1XH3B 2SEBB 4LLWB 2A9NH 2BERA 4YBQC 3RWFA 3ULUL 2BVQA 3O3DA 4QY8B 2ESVD 3CPLB 2AJVH 3W0WD 3N85L 1EFQA 3BEWB 4LMQE 2H8PB 2N4IA 4OGXH 1OPGL 2YSSB 4V2BA 1PDKA 5D93B 1SYSA 3FMGL 1I1FA 5KSAD 3GMOB 5HVHC 3JWOC 5KVMC 5IFHH 4P23B 1YJDL 2F74B 2O5ZL 3QAZB 1HHIB 4LCYA 4G80B 5FO7B 3NBNA 1ZHNA 3P11L 1KB5B 1I85C 3MLWL 4NQVA 1XCTB 4P2RB 3RHWF 1NQBA 4RX4D 5HHMB 4KK9C 3QHTC 4UNVA 2P8PB 3KPPB 2JIXA 2WK2A 2R56H 4MJ4A 4Z95L 3MMEB 1NGYA 4I3SH 5EPMB 1MCRA 2APBA 3MLXH 4FZEL 5D7JD 3L7FB 4KRPD 4ZOAA 3BH8B 3VWJA 1K3ZA 1QTYT 1TZHB 1T03L 5K9OA 3V5KB 3T1FA 3O2DA 5FHBH 4XWGH 2ZCHL 1FL3A 3DOSA 1I7RB 4OLZH 3O4LE 3KYKH 2NY2C 4R26H 4AJ0A 4FOMA 1BD2B 1KIRB 4N0FA 3RBGA 4JFZL 3G08B 1NCWH 3L9RB 4IS6A 1S7VB 5B38A 5C0JB 4HZLB 1A4KA 3FQUA 3P0YH 4HWZB 4WU5B 1F00I 1S7SA 1HSBA 2K3TA 4M1DL 1ZV5A 1T5XA 1N4XL 1KENL 2AI0L 4HK3N 3ARFA 3V5HB 4DOHB 4N68A 4LLYA 3F7YA 1H8OA 2DTMH 1DBAH 3O6MH 3QWOA 2Z92A 1CDJA 2C5DC 3KWWB 3OG6B 5F7MC 5D2NA 1KB9K 1AGEB 1B9ZA 3HPLA 1U8HB 5DMYA 5FYJH 2IAMD 1QOKA 3VFMB 2DWEB 2PCPB 3T3PF 5EBMA 4RGOL 1I3VA 4HJ0C 5F72S 4XBGB 3SDXB 1OAZL 2J5LB 5D1ZA 2OMBA 4J4PC 5AYQA 5DFVC 2EXYD 4XHJD 1LILA 1WZLA 5HI3D 5T3XH 5DRXA 5DZNA 3QCUH 5HHOD 3ARVA 4O2FA 2AV7B 3V6ZB 1DL7H 4J1UA 5BV7C 4M7ZB 4OSUL 3ULVE 5EIQA 4HPYL 5KG9A 1NEUA 5C0AB 2YUXA 3O8XB 3S5LG 4WUKL 1FNGB 3IJYB 4NN6C 3CFKB 4ZFFA 3I75B 5IT2H 2C1PB 1AQKL 4TUJB 5C1MB 1QSEA 1MPAL 3LKSA 5LVEA 3WE6A 1T7ZA 1ZVSB 3L1OL 1HYRC 1PSKH 4LEOB 3H9SD 3N06B 3SKMB 1IFHL 1II4E 5C0EA 2Q8BH 3QFJD 1JPGB 4RRPG 1EIBA 3VFVB 3QEUB 2R8SL 2VZVA 4J3XA 3BKCH 3KDMA 2QHRL 4L4TD 3RP1A 3GMQA 1B0RA 4PLJC 3RI5K 4HG4J 3FCTB 3VG0H 5I73B 1TVDA 3V0AC 2BK8A 3GJEA 4XMPH 3JV0A 3BP6A 1NCNA 3HNVH 3PWPB 1H0DB 3UTSA 5KVEH 3QIWC 4OD2A 4RFEA 1VACA 4P9HL 5DJDA 5C0DB 1PBYA 1FDLH 2W1NA 2BSED 3RGVB 3RY5A 5JNYA 5F9JB 4Z7VB 2FR4A 3L5JA 4NHCL 4PJ7A 2F53A 1JYXA 4FQ2L 4YHZH 3EJZD 1MWAH 4XMKH 4EN3D 3QUZB 3JVGA 4XPBH 1NDGB 5I1CH 2G9HB 5DJ8B 2ADJA 2E9IA 3LCYA 2HFEB 5CGYC 3CSPA 3I2CH 3H8NA 1I1AA 1KJVA 1W0YT 3JWNC 3BESR 1QLRA 4I4WB 4O2EB 5I1GH 3NVQA 4FFWD 2XIDA 4M43H 1KT2A 1OTSC 2IQAB 1F97A 1JZ7A 1D5IH 4M48L 3FFCA 5E2JA 3SGJC 4D0CB 1S7XB 3K0WA 1I4FB 5E9DA 1CWVA 4Q74A 2VLRE 1HHJA 3HE6D 1FAKT 3HZYA 3NIDF 2CIIA 2VDRL 2VLLB 5ICYA 1XIWC 3OPZL 3BJ91 4OB5H 1LK3H 1FG2B 4QHKJ 4WFGE 3FKUS 1VB9A 1WTGT 3VD4A 4LSRL 1G9NH 1MCBA 3UTTB 2VE6A 5ADOL 3UBXG 2DICA 3LD8C 3IDJB 4NRYB 1XGPB 3CCHA 1OQXA 4GOSA 3MV8A 1RIUH 1T6VN 1FFRA 4I0PD 4I18A 1BM3H 4ODXA 1F4YL 3OXSA 5HGAB 3ZTJH 1A7NL 2NY6C 3SDDC 1SYVA 2ZOLA 4KK5C 3TCLB 4UAOC 1C5DA 1CXLA 1HILB 5C0CB 2IFFL 2COQA 2NPLX 4ELMB 4S1DD 1RHHB 1LO3L 4PB0L 1KPVA 2FJFA 3D3VB 3CFDA 1ORQB 4XCYB 2R4SL 3RL2B 5HPMA 5F1SA 1UH2A 1D9KB 3MLSL 4S2SB 4OLYL 1CICC 3BRFA 3BXNA 4XP4L 5F93C 4U6HB 1MJUL 1AGDB 3ZYJA 1FLRL 4JO2H 1HHHA 1JPFA 5KN5B 5DEFB 2A73B 5EZJA 3WHE0 2UYLA 1GGBL 2G75B 3D25B 3C2AL 4PJEB 3SGDH 4LSVL 4CVZB 1Y6KR 1RK1B 3EYSL 4U7KA 2R29L 4JRXB 4IRJC 1HNFA 5EZIL 4JDZB 3MRGB 1RVFL 5F7HA 1JHTA 1A1MA 2BNQB 5F21B 3P9LB 3QEQE 4ZDHA 2AABL 1LO4H 2N56A 5EUKB 1EBPA 2X89D 1XF5B 4OQTL 3EHBC 1RIVL 1T0NB 4XAWL 3QIBC 4ZXBA 1KB9J 5DHVB 5DJXA 1QLFA 4LSSH 1WF5A 4G42B 3ARBD 2YPLE 1TQBC 3IFLH 1U58B 4FQJH 4RMVA 2BXYA 1JMXA 3G5VA 5MEND 2GCYA 5HY9B 1KJ2B 4I2XE 4JRYD 5B3JF 4X0KA 2D7QA 4MJID 4GW4B 5IROC 5JZ7D 1W8OA 4PV8B 3D39A 5IIEA 4HH8A 4TSAL 3MRKB 3PHOB 4QYOA 4MDJB 3V0WL 4IRSC 2DBLH 4L4VE 4QRTA 3TWCL 3TPUB 3RWDA 4Q9BA 1MUJB 5DRWA 3IAGC 3UJTH 1FO0A 5E70A 1AXTL 4HUUB 4PR5A 2DQIL 2HT4D 3IKCB 4QCIB 1CVRA 3INUL 4HLZG 1LE9B 4XNUL 1YPZF 4GRMB 5C08A 5ICZB 3IB4A 3KPQA 3WS6A 2HVKA 3HMWL 4J3SA 1UJTA 2R1WB 4WNQA 5ILTL 2Q7NA 1U8KB 3K8KA 2VRAA 1FZOB 5K33A 4PJGE 5KAQF 3GM8A 4ZFGL 1G7LB 3OL2A 4CL7A 3DV6A 2ZUQB 2DQUL 3TYFA 5DEZA 5ANMB 3FJTA 2J6EL 3DXAB 3CU1A 3LSOB 2PNDA 4X83A 3DGGA 4S0SD 4GW5A 3DTXA 4ZOEA 3DUSA 4L8CA 5BRZA 5SX5K 2PW1B 2X42A 4Y19B 4Z7UF 1Z0MA 1HN1A 1KFAH 3HS0A 4QKXB 3I3BA 1ZGLM 1RV6X 5IVNA 5KS9F 4JCMA 3S5LB 3KYMB 4YXLH 3WDIA 2V7NA 3SGDI 2Z8WC 2FX8H 5F96H 4LLAA 5HGDB 3K4AA 4OBRA 4ZTOL 4AG4H 5FDWB 3QXDA 1IGCH 1Q0XH 3PGCA 2YZ1A 3UJIL 3IJSA 2VLRA 3OKDA 4GKZB 1AFVH 2BCKA 1TVBB 1O0VA 3PXHA 4B7IA 2XYCA 4JG1H 1EFXA 3N9GH 1F3JA 1BIIA 1Z2KA 3QIUC 5FUCE 3SDYL 3D85D 1UT9A 1IBGL 3ZT5A 3SGKA 2IPKA 3HB3D 1F6FB 2CLVA 4YXKH 5FCUH 1RUPL 3BQUB 3CAFA 3TJEH 1GL4B 5CBAB 4ZNCD 3PWUA 4Y4KB 2Y6SD 5JXEA 3MZGB 1IILE 1YJDC 4YDLC 4QRRD 2QSCL 3JV5A 3RWFB 3IDGA 4NNXB 4FFVC 1Q72L 2BVQB 3O3DB 3RUGE 5INDA 4PRHE 2A0LC 2VISA 5EOCJ 1MLCA 4I5BA 4QF1A 4GJTB 4Z0BH 1GIGH 4F15B 4NM4L 3MOBH 3RVTD 3SBWA 5C6TL 4JVUA 2CIKA 3ULUF 1I1FB 4PG9B 5F97E 3TN0C 2X4OA 1IGIL 2NY5L 1AI1L 4TVPD 1R6VA 2Q76B 2VZUA 5D1QC 5EWIL 2AEIT 3BKYH 4QHKI 4HKZB 5F7YC 3DSFL 3SOBH 1M71A 4LCYB 4MA1B 1M6OB 4RNRB 4RMUA 1ZHNB 1CGVA 5E94A 1AGCA 5AD0A 1UM5H 2XOTA 3FN3A 3SKNA 2I60H 5KSAC 2JIXB 5D1XD 1W0WA 5F89B 4P3CL 3U4BH 3ES6A 1NGYB 2Y36L 4W6XB 3F6IA 1JZ3A 2ICES 5K9OB 1SJXA 4XX1G 3QEQA 3T1FB 2V9QA 2FWOB 4BQCA 1FCCA 1FL3B 3MXWH 2B8OT 4HULB 4F57H 5I16A 1DQMH 4XT1C 5KOVC 4N0FB 5TE7L 1EO8H 3T0EB 4LPYA 3L3GA 4OV5A 1ZT1A 5DQ9B 2YPLA 3FQUB 2YKLH 5T5NF 5D7JC 4LLQA 4KRPC 3KHQA 4TVPL 4LEXL 1VCAA 4I2XA 4O4YH 1T5XB 3ARFB 4GQ9L 3DARA 3H3PL 1B4RA 1JGVH 1H5BC 3F7YB 3Q1SH 4JPVL 1QRNB 1U2HA 1NEZA 4RCAA 3QWOB 3WIHH 5K9JL 2Z92B 4L4VA 1MLBA 2DLHA 5D2NB 5TF1L 3HPLB 2UVEA 1RU9H 1WGOA 2B0SL 2R0KL 1UQSA 1H3XA 1TFHA 4Z5RA 3JXAA 3GSXA 4DZ8A 5HDQL 3R1GL 1MEXH 1W2KT 1BREA 1GVIA 4WEBL 1I8MA 2LV4A 4LK4A 3IDNB 1VKXA 5DWUL 1L9MA 5J11B 5GS0D 3S97C 1RK0A 5DRXB 3THMH 1E28A 2VAJA 4LVOC 3CX2A 4O2FB 4IOFD 5T33L 4HLJA 4NCC1 2IAMC 4TUKH 1A7BA 1R5VA 5GJSH 5C8JA 1PKQA 1D5MA 2W0FB 2V9RA 3HFMH 2DL2A 4ONGH 1ADQH 2R39A 5GRWA 3F5WA 4H25A 2JK5A 5DMGD 4PRPA 3FOMA 1A6UL 2EXYC 4XHJC 1NCCH 1A3LH 2R1XA 3O81A 1CGYA 4P9HC 1CIUA 1FPTH 5A16A 5HI3C 3WL9A 3MUHL 5C0FA 5MHSE 4EBQL 2XQYK 2I26N 3TIDA 4ONFH 5C0EB 5DD1L 3V4PL 3LN5A 1WLHA 4XVUD 5C9KA 5FA4A 3KDMB 1NC2B 1KPUB 3GMQB 1P4IH 2JB6A 4DEPC 5KVFH 1N59A 3C08H 1NLDH 5IVXB 1NGPL 4E5XA 4ODWA 3A0OA 5GS0L 4RFEB 1VACB 5DJDB 4LP5A 4Q0XH 1CLOH 5GGQH 3MUJA 1JNLL 4PUBH 2FR4B 3UDWA 5HI5C 1KJMB 4PJ7B 3TNMA 3GSQA 1A2YA 4PYGA 5I1AB 2QJDA 1LE5A 1IL1B 1J5OH 1BFOB 3PIQA 4HQQH 4EI5D 2ADJB 3RIFK 2NY1D 4H0GA 4YWGH 1JTTA 4G6JH 5DZOA 1CLZH 1I1AB 4R7DA 1WZMA 1QLRB 5CCKL 4JO1H 1U8JA 2FX9H 1S7QA 4U6YA 2ZUYA 4YE4L 3OKNA 3HAEH 4XZUA 3FFCB 4NWUL 3ULVH 4N90E 4KVNL 4JY5H 3T09A 5E9DB 2X09A 4HJJH 3EJZC 4P0DA 1F45A 1HHJB 1CF8H 3U2SB 3HZYB 3T8XB 1I9RL 1WFUA 4EN3C 2CIIB 3L7EA 1DSFH 4Y5XC 1T1ZA 5F1KC 3RUGA 4PRHA 4TOYH 5BXFB 5E2UL 3HE7B 4KPHH 3WLBA 5FK9B 3OKMB 1VA9A 1DBKH 3BJLA 5BO1H 1PY9A 3OJDB 2R69L 1JNHB 2XZAL 5J12B 4YHPA 4KV5F 3T65B 1Y0LA 1TZIB 1F4HA 3HUJF 3WXVH 5D96B 4YQXL 5J1SC 3HE6C 1J88A 3CCHB 3MV8B 2XA8H 2AEQH 5TF0A 3LEXA 3RJQB 5BOPA 4I18B 4ODXB 4ZFOA 4F33B 1HH9A 3GUTA 4NZJA 2FBJH 1SYVB 3ARDA 3WD5H 4M5ZH 3WXWH 1ED3A 3UPRA 3A6BH 3KLDA 5I6XB 1C5DB 4OBSA 1OGAA 4ZYKB 5B8CB 1YNTA 5BZDB 3IAQA 3BWAB 2LVEA 1QBBA 4PLNC 3DMMD 1KPVB 1NAKH 1EEYB 2ZG3A 1QFUL 3LV3A 4I0PC 2QQNH 1AO7D 3CZFA 4NT6A 4LNRA 4G6AD 5TPWL 3BD4A 1RULH 3GBML 4HIHA 1A0QL 3TA3D 4HT1H 1OAYL 2VL4A 1TDQA 1KLGA 1HHHB 4S1DC 1JPFB 1B0GA 1Q8MA 3MLRH 2UYLB 4M7JL 4S0TD 3BDYL 3BMWA 4G6FB 2Z31B 1PD6A 1RZFH 1I7ZA 2FGWL 5SX5H 2ZP0T 1U91B 5DVMA 5IB4A 3EFDL 1DUZA 3H42L 3NIGE 5DD5L 1JHTB 3MNZB 3MRPB 5ADPH 3N0PB 2APXA 4H20H 5SWZB 2WINB 3UTQA 2OXGA 3EDDA 5C09A 3TESA 1BOGA 2HKFL 1OAXH 5DJXB 1BBDH 1QLFB 5I1EL 5D72L 2D4DA 1J0ZA 3LVEA 3G6DH 2ZWLT 4BUGA 2KH2B 1O5DT 4NSKA 4WW2B 2HVJA 3D39B 4XXDA 4R97C 2L0DA 4F58H 5IIEB 3MLZL 4QYOB 2IPTH 1UA6L 4QRTB 5C07E 2H45A 1VFMA 4YHNA 3F8UB 4W4NA 3RWDB 2VDLH 2AXJA 4M7KH 2WAHA 3DVGA 3WYRA 5CP3A 3TIEA 3H9YA 3GZKA 3H0TB 2UWEF 5DGQA 2R1YA 4Q9RH 2FL5B 3MSPA 4PR5B 5EFIA 4OCYL 3V6OE 1F13A 1FG9C 3A6CH 4OZIA 1N7ML 4LIQL 1EVUA 1K5NB 2R2EA 4HKJA 5FCSH 3HZMA 5BOZG 5JZ7C 3P9MB 4R96A 4U4BA 2Z93B 4KKAD 5C08B 3QJHB 3D0VA 2HVKB 3U30C 3RHWK 5DF0A 5GGUA 1KTDA 3E6FA 4MLIA 4WNQB 1JRHL 3W2DH 4OLVH 4TNVF 2IANE 5EC1B 3MLVH 5I19L 2VABA 3DV6B 1BECA 2HT4C 3TYFB 4WO4D 5FYLD 3GM0A 3QEGH 3BPCA 3SE3C 3U7AA 1AGBA 5GS2D 4Q9QL 4MWFA 3DGGB 3TH3T 1QNZL 1JPST 4AEHL 4GW5B 4NN5B 3RY6C 1IGML 2XXMB 3DTXB 4X7FC 4X9FA 1DBJH 3DUSB 3VGAB 3PGFL 4KZDL 5BRZB 4JGJA 2HFGH 4DN3L 1DDHB 3DX6A 3IETA 2I9TA 5A2FA 1ERNA 1KJ3L 4PLKC 1I1RA 4JLRA 4RGNB 1ZXQA 4MNGB 5JOFA 3EAKA 3TV3L 2P42B 1P7QB 2V7NB 5I1HL 4MD5A 2RHEA 4UMGA 3QO0A 3SY0A 3T2OA 1IM3A 1IZJA 4M6OH 4LHUD 1DVFD 1IGYA 4YBLC 1EHAA 3JWDC 3QI9D 5FF6A 5D4QA 2BCKB 2NX5A 4F2MB 3NCJL 3KJ6L 2L7JA 2HLAA 4WWKD 5FYLL 4Z76A 4BH8A 3VMNA 5JXAL 1N6QL 3KPMA 5IB1A 4CU7A 1CZ8H 5F3HB 5KJRL 3NA4A 5L88L 5HHXH 2B4CL 3I9GH 1A9EA 2NY5C 2EE9A 3U0WL 1S8DA 1T89A 3O6LH 4JFXA 4AQ1B 4CKVX 1KN2H 1PAMA 4I77H 4R2GD 5J6HA 3HB3C 2VISB 5BVPH 1PZUB 4DW2H 1MLCB 1PEWA 4QF1B 3S36L 3HZVA 4KHTL 1QD0A 3T2QA 3ARUA 5F9OL 2YRPA 2Y6SC 5CJ8A 5DJ0A 4AIXA 2X4OB 1GGYA 3B2VH 4EOWH 4PJCA 3GJFA 1IC7H 1G9MH 3NFSH 5EBLA 5IOPB 5EZOH 1N5AA 1M71B 3QUXD 1DCLA 1S7WB 1SBSL 1MVUA 3HI1B 1INEL 5DURB 4LAQL 5T1LA 4NNPH 4NFDA 3TYGL 5D7KE 1AGCB 1E4WH 4YNYA 3QFDA 4PJ5D 1YPZE 5B39A 4FP8L 1W0WB 1ZT4B 2PYEE 5SV4A 3ES6B 1FNEA 1MHCA 1NH6A 2QQQA 4X6CA 1KIUA 1ES0B 2X4TA 3LQMA 5FGCE 4ODSL 4UNTA 3QZWG 3QEQB 4PRAA 5JR1L 3TBVA 2ICWB 1C7TA 2W60A 2O93L 5I16B 3ETBF 4NQEA 4BFGA 3D69A 4PJIF 5D1XC 3L3GB 5FUZL 3X12A 4OV5B 4RIRA 1F42A 3VD3A 3VCLA 4U1IA 1DN2A 4V1DE 1AY1H 4I2XB 4R8WL 4BSVA 4GRLD 1RUKH 1RUQH 4Z7UE 4BSWA 2XT1B 4LKXB 4B5EA 2YA1A 5CJ5A 3MA7A 4L4VB 4LHQB 4QXUL 4HD9A 5C07A 1MLBB 1T83C 3RFZC 1KIPA 4WCYL 5C2BL 2OL3L 4AK1A 1KLUA 1RJZA 2DLFH 3GSXB 3BEVA 3V6OA 2GK2A 4OFPA 4U33A 1JZ4A 3LB6D 5I8EB 2P43B 1Q9KA 1G7JA 1VKXB 4U0RC 3VGFA 5CEZE 1QKZH 1U93A 4YFEA 4JQVA 1RJYA 1E28B 5IFAH 2DQJH 2VH5L 3AXLA 1ZLSL 1R5VB 4HCRA 4MMZC 3NOIA 2VSDA 2IANA 5HGGS 5GPRA 4LCCA 1PKQB 1D5MB 5D7IE 3IYLW 3C8KB 2CDGA 1A3QA 1CS6A 3F5WB 4H25B 2JK5B 2BRQA 4PRPB 4NGHH 4YDIL 3FOMB 4PS4L 2OQJB 2R1XB 1JGLL 5GS0C 3BP4A 3MA9H 1NAMH 2YD7A 4AT6A 1F4XH 2JCCF 4N0RA 4IOFC 5AZEH 3BPOC 1EPFA 3FB7A 3V6BR 4JO3H 4A6YH 4PY8J 3GK8H 4L8DA 1UKSA 3LN5B 5HJ3A 5TE6H 4D3CL 1T1YA 1X6LA 1BPVA 3WIFB 3ULUE 4KY1H 2LU3A 1N59B 4NYLB 2BY0A 4E41E 4E5XB 5E99H 5LQBL 4JM2D 1BJMA 4ODWB 5GJTH 3VW3L 4KZEL 3DROA 1OAKH 3MRRA 3ZTNL 4IEFB 4NUJA 2YUVA 1YEKH 4XVUC 5IWLC 5KSBE 5TDNB 2RFXA 2AP2A 1A2YB 5CBEB 3GKZA 4XNYL 1J7VR 2LAGB 1ZK9A 3CZJA 4LGSB 2JKXA 3OX8A 4FQLL 2OTUA 1MCSA 3PIQB 4D9LL 3N1MC 4TSCL 4RDQF 2FIKB 5K9KA 4MCZA 3NTCH 1U8JB 2F15A 1S7QB 1I1YA 2VDOL 4HWNA 5KZCB 3O41B 4U6YB 1OSPH 5L8KB 2F5BL 1SEQL 4OCSH 3T0XA 1A7RH 1NGZB 4G9FD 1TPXC 3ARPA 4K2UL 4OGYL 4Y2DB 4JG0L 1XZ0A 3OJVC 3ZE2E 4O51A 5LWYH 5EU7C 2Q8AH 3L7EB 1DFBL 3P4NA 4MA8L 4QRUA 4EI5C 1CT8B 4KUCD 3RUGB 1HEZA 1WEJL 2NY1C 1XF3A 4P5TA 5IHZA 4UU9B 3PXJA 2JJWA 3GHEL 5AWNH 4NZUL 2CJUL 3D48R 4LOUC 4LSUH 1YC7A 3BRGC 3MLUL 1ONQA 1MRDL 2EC9T 4GRWF 4M6NH 3K2UL 1P5VA 1Y0LB 3MRCA 2AK1L 4PD4K 3UROR 3DO7A 4PG2A 4YHYC 3PQYD 1M7XA 3RZCD 1HINL 4LBEA 3TLRA 1BWMA 3VFGH 3D6GA 3TPKA 2I27N 1RUAL 3H2WA 4HMEA 1C5CL 3GUTB 1KNOA 3ARDB 5M95B 1IAIM 2IEPA 1DLHA 1T4KA 1ED3B 3UPRB 8FABA 4Y89A 1AP2A 2GJ6D 3AU1A 1OGAB 3ABZA 1IEAB 1YNTB 1U95B 5I17A 2PYEA 1JTOA 3VXSE 5IHLB 5D2LE 2F54E 4U1LA 1G6VK 3WFHA 3LIZL 1FZMA 4HS3B 4I3RH 2PXYB 3EYOB 3CZFB 1UB6A 4EVNA 4HGMA 1MCNA 1EMTL 4R4FL 1CIDA 4P4KA 4UV4L 2YBRA 3AMLA 2VL5A 5IMOA 1PG7H 4ZTPH 3ZTJG 3DMMC 3FFDA 1AHWC 1NC4D 4HZAA 4V1DA 5FYKH 1RZGA 3V6FA 1EVTC 4MSWA 2XZQH 2V2WA 1I7ZB 4G6AC 5IB4B 1FVEB 3JWOH 1XMWA 1A6VL 1DUZB 1MREL 4I3GA 3TA3C 1GRWA 4JFYA 2VLJE 1MIEL 2EYRB 3D9AL 4JHWH 5T5FH 3CVHL 5C09B 2ZUXA 1TQCB 3VRJA 3KG5A 4G6MH 2Z0BA 1W72A 1WFTA 4I9WE 1T2QH 3T0WA 5IW1A 2W9DH 5IMMA 5HSFA 5E8DH 2VZ1A 5F1OB 4BQ8A 5DFWH 2ADGB 4HF5L 4NSKB 2EH7H 1OW0C 2R9HD 4XC3L 2HVJB 2ITCA 4XXDB 4D9QE 3QJFA 1G7QB 4X80H 5T3XD 1KACB 3QUMH 1I7UA 3QZWB 3T0BA 2XWTA 3WIIH 4DUVA 4YHNB 2BSTA 1F6AB 4LU5L 3ZYZA 3DVGB 3TIEB 1RQ5A 3FO1A 5D7IA 3ZSSA 1GGIH 4RAVA 4WHTA 4LSTL 2R1YB 2DD8H 1CDUA 4OZIB 3MGAA 3E3QE 4AYFA 2R2EB 1NGWA 3HZMB 4KI1A 3WFBH 5DMIL 3FRUA 4R96B 1UYWL 1NCDL 4JPWL 3Q6GH 3KR3L 3R8QA 3CLEL 3D0VB 1A7QH 3GBNH 4YDJB 4NQUA 3E8UH 5GGUB 1CLCA 3E6FB 2Q6WB 2WBJA 3CH8A 1Q9WA 3ZKND 1G9EA 4FG6D 4WDIB 1JWSA 2JJVA 3CSBA 2DQTL 3W39A 4XCFH 4Y16B 4LLVA 4E41A 4JDVA 1LDPL 3BPCB 5BS0A 2DIAA 5J9PB 1AGBB 4KKAC 1GGUA 1L4IA 5L0QB 4MWFB 3ZO0A 3U9UA 1IKNC 4FZ8H 4FN0A 4TPRH 3HR6A 4I8DA 4UTAH 1S9XA 4OF8A 4OZFA 1AE6L 3IETB 5BV7H 1R3HA 2XN9D 4JLRB 1IM9A 4P2OB 5JOFB 1BBJA 2PUQT 4L3EE 1J8HD 2D7NA 3KLAA 3KS0J 3C6LD 3HRZA 4NJAH 4PY8I 4JEGB 4MD5B 4M03A 1BX2A 2FX7L 4LF3B 3SJVE 3QO0B 1YEJL 1BVLA 2DQFA 1H15A 1IGYB 1S5HA 3B9AA 3PV7A 2EDTA 3NACH 3U4AA 1AC6A 5FF6B 2NX5B 3Q5TA 1JFQL 4G3YL 2P7TA 2HLAB 5C0GA 3P0GB 4Z76B 3S9DB 3KPMB 1FBIL 2RIKA 5IB1B 2DYPD 2VDPL 4OUUB 5E2TL 2WLZA 4PREB 3BP7A 1ZLUK 4OGAC 2XZCH 1A9EB 1GGCL 3QI9C 3BZFA 1JYVA 4OLXL 1IARB 4PD4J 1S8DB 4NQCA 4JFXB 3UZQA 3MV01 1ND0B 1G0XA 4FFZL 4YHOL 2VDMH 2CUMA 2PO6D 3KPRD 1ZHBB 1R3LB 5D7LB 4K3EH 2P5EE 4TULH 3T1WA 5DUBA 5D2LA 5DJ0B 3RNQA 3AVEA 5I76A 1EUTA 2QR0B 1K6QL 5IF0A 4G8GD 4RWYL 5CEXA 4H8WC 3CJJA 5FOJA 4FMFA 1WWCA 4PJCB 5E8EA 3GJFB 3SCMD 1N5AB 4GSDH 3WFEL 1A7PH 1LHZA 1MVUB 2C3GA 1MCQA 3ZDZE 1AKJA 4NO3A 4O9HL 3OHXA 4BZ2H 1E4XH 1ZKAA 3HTLX 2H1PH 4M4RA 2JF1A 5GS1A 1FNEB 1RUMH 2LQRA 3MYZA 4X6CB 5ACMA 3ALXA 2F8VA 4N0YH 3SDCD 3QUXC 3ECBA 2YN3A 3QA3B 4O5LH 4PRAB 1OAQL 4L5FH 3L6FA 3HAEA 5CLWA 1V05A 1EGJA 4NQEB 4BELD 1HYSD 3D69B 3VFTA 2XFXA 1KLFA 2GITA 4F3FA 4ZOCA 1J0IA 1J12A 4NKDB 4RIRB 5DD3H 4L8SB 3SE8L 4FQHA 5IESH 1FC1A 4C56D 1HCVA 1NFDE 1TTFA 4N8PA 2VOTA 3IFOB 1ZHKB 3B83A 4BSVB 3B9KD 1T0MB 5C6WH 5IQ7L 3W5NA 1BQUA 4CADA 1YY8A 1RZ7H 2PR4H 4DGVH 4F37F 3KS0H 1KIPB 2D2OA 1MRCH 3PHQA 4RMWA 3WSQH 1KLUB 1RJZB 3WO4C 1AJ7H 1UJ3C 3S37L 1BQLL 3BEVB 3IU3A 4GKSA 2DQHL 3HN3A 5DRZB 2HT3D 1JGDA 3HG1E 4GRLC 1UVQA 5GGTA 5GRXG 1G7JB 1FYTB 1MCWW 1U93B 3QP3A 5KTEL 1UM4L 1ZVYA 3RX5A 1IQDA 3C9NA 1RJYB 1OT1A 3MRIA 3NH7L 4UT9L 2RBLA 3MJ9H 3TBWB 1DBBL 3G04A 1XR8B 5D93C 4OD3L 1LO2H 1LO5B 5F44A 2IANB 4KFZC 4LCCB 2DTSA 2J1KA 4PRIE 2CDGB 2F19L 2J2ZA 3D1MC 1MFDL 3LB6C 4X7CC 1I8KA 3VWJD 4OLUL 4GBXD 2NY3B 1YNKH 3BP4B 4HUMB 1T04A 3RTQD 5IGXL 1D5ZA 4PLOB 1ZA6A 3GGWB 5EOTA 1UZ8A 1S7UB 5HI4D 2Y5TA 3FO9A 3QUYA 3BN9D 4JJ5A 3B5HA 3FHQA 3OB0K 4GUPA 5D71H 2WUCL 5FECA 4Z7QF 3O6FB 3S35H 4C55A 4LCWD 1O7SA 3LEVL 1L0YA 1NFKA 4L3EA 4JFFB 4C4KO 4AY0A 3EGSA 3WFCH 2HH0H 4WFEE 2MWCA 1MNUH 1YMME 1TCRA 3SJVA 3WHXA 1NGXB 4U31A 2QV2A 1HKLH 3VXNA 1F8TL 1U8QA 5BMFL 2NXYD 3Q0HA 4CN4A 1IVLA 2Q86B 1RURL 5MP6L 3GMLA 3UPAA 2KBGA 3Q5YA 4KVCH 5GHWH 3OX8B 2DBJA 3PGDA 2OTUB 5GIRA 2F8OA 4QOKE 4JM2C 5D1ZD 5CEZH 5K9KB 3O2DL 4MCZB 4AEIL 1HQRA 1Z3GH 3NABH 2MCG1 3ZHDA 2BNUB 2BVTA 4JKPH 2ZUWA 1UFUA 5J1AA 1XZ0B 3GKWH 1KPRA 4F7MA 2E9BA 5K59F 2VDNL 2J5LC 3JTTA 4OM0H 5IHZB 1YEHL 4WVRA 5DK2B 1CDBA 1FZKA 3VH8G 2ZCKH 1INDH 1QSED 4G8IA 2BOBB 2NTSP 3P30L 1QFWH 3EO1A 4Z7WF 1ONQB 2YD8A 2ZPKL 2J88L 4IDJL 3MRCB 3SKUD 4LPTA 5E5UB 3BPNB 3REWA 4C57C 3LOWA 4JY4A 4TNVK 4GO6B 4UDTA 3T2PA 1A9BA 1MHEA 4JM2F 1TZGL 2QADB 3IDIB 4LBEB 3HAEG 3N9GL 3ULUH 1EDQA 2AERT 2YXMA 1CFNA 3ARQA 5CJQL 2YN5A 1FAIL 1KNOB 4OCLC 1P2CB 1R3IL 1DLHB 3N85H 8FABB 4P2CG 3UTSD 4ZODA 4G7VL 4QNPF 3QNZA 4N9GA 1YYML 5EU3B 1OPGH 4FXLA 5I17B 5A2LH 1GZQB 5TFSL 3FMGH 3SDXF 1XGRB 3RNKA 3RZCC 3DYMA 1FZMB 4PJHA 4N0CD 3DYOA 2F53D 5I30L 4QRQB 4JZJC 1QSFA 1YJDH 1LVEA 2O5ZH 4H0HB 4K71C 1UB6B 4XNQA 5LXGL 4Q6IC 3ULSA 3G6JB 3P4LA 3MLWH 1W8NA 1MCWM 2D7PA 5IMOB 2P5WA 3RGVC 4G43B 1GZPA 3S7GA 4X7EC 3FFDB 3PL6B 5CD3A 4KUCF 2JCCE 3FB8A 3CLFH 4Z95H 1C8PA 1NFDA 4FZEH 1IAKA 4MSWB 1JNNL 2K7QA 1H3UA 3OAUL 1S9KC 4UQ2A 2NCMA 2YPKA 2ZCHH 4JFYB 1T1WA 4W6WB 1ZGLA 1OWWA 1U8NB 4JFHE 2DL9A 3VRJB 4JFZH 4ZSOA 3CX5J 1W72B 1WBZA 4WY7L 5IMMB 4AQOA 1F58L 5CJOL 3HG1A 2BNRE 4FNLL 4M1DH 4X8JA 5HYSG 5HD8D 1QVOA 1N4XH 1CFTB 2NZ9D 1KENH 2AI0H 5TQ0L 1U36A 1N6VA 4Y1AE 4NP4L 2ITCB 3WCYA 3QJFB 4I0CC 4XCEA 4Z7VF 5FGBC 1I7UB 2XWTB 2Y7QB 3K1KC 2E27L 4G9DA 2C1OA 3VXTA 1BIHA 4QRSA 2BSTB 3G5ZA 3O11A 4WTZG 4Y4HA 3V7AG 3FO1B 2J8OA 4KDVA 4PRIA 4RGOH 1LP9E 3KVQA 4YHLL 1QFWI 1ZLUH 2R9HC 1OAZH 1NGWB 2LVCA 4KROD 4KAQL 5FYJU 4U1MB 1QR4A 3K1DA 3RWHB 2UZXB 2D0FA 5JUEL 5DS8A 1ZSDA 4APQB 3O4LD 5EO9B 5KOMC 4QRPE 4Z9KB 3TO4B 3WN5C 1X6NA 4OSUH 3S35X 4TVSa 2WBJB 2D7MA 2VWEE 4HPYH 4XXCC 1X44A 3OSKA 4GRWE 2YZ8A 4WUKH 3W39B 3L5WA 3LQZA 2Y25A 4M62L 4G6FD 4LLVB 4E41B 1AQKH 5BS0B 3QRFM 2IF7A 2Z8SA 1D9KC 2LAAA 1YMMA 3AREA 4PJ9A 1MPAH 4GMTL 3MRBA 3U9UB 2W92A 3SEPA 1AD0A 3L1OH 3JV6A 4HPOL 1WZ1L 5J6GB 4DFHA 3IDXL 3CVIL 3TZVD 2BC4A 2CKBA 2NY0D 4OJFL 1IFHH 1NBVL 4ZXBD 3ZKNC 1S9XB 4OZFB 2W0PA 4FG6C 2R8SH 1YN7A 2Z91A 1R3HB 2QHRH 3EO9L 1AQDA 2N7AA 1T22A 4B41A 2XNAA 5DJAB 4KK8D 4QOKA 3HKFA 1K8DA 3KLAB 3HRZB 2VXVL 1Q94A 3PWLA 3MFFA 4P9HH 1BX2B 2CPCA 1IAII 5FHAL 3GI8L 5C86A 3WJLA 1BVLB 1K8IA 3I6KA 4YFDB 3H7BA 2DQFB 5FOBA 1H15B 3ULVD 2ADIA 1S5HB 4NHCH 3ZKXC 2VIRA 4ALAL 4B0MM 4FQ2H 3AGVA 1A1NA 2P7TB 4Q6YA 1NLDL 3AFLA 3C5ZA 5DK3A 4ZAKA 4ACPA 3NAAL 4N1EA 3MRHA 4PRNA 4MD4A 1HWHB 4PJEF 4M48H 1X5YA 1A21A 4N8VA 5JW4N 3BZFB 5D7SL 3FRPA 1OLZA 4NQCB 2AVGA 3ZYIA 2VDRH 3KPSA 3QG6A 2GAZA 1CTNA 3OPZH 4PJBA 4O00A 4K3JL 4K3GA 4LSRH 4X7DC 1P9MC 3GI9L 3BHBA 1NSNL 5ADOH 4P57B 2YEZB 2H32A 2X1PA 1NFIA 4NO2A 3UMTA 2VQ1B 5I76B 4AEEA 1MI5B