5IFAH

Crystal structure of unbound vrc01c-hugl2 fab from an hiv-1 naive donor at 1.82 a
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
219
structure length
219
Chain Sequence
b'QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCAKISGSYSFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VRC01c-HuGL2 Fab heavy chain
publication title HIV-1 broadly neutralizing antibody precursor B cells revealed by germline-targeting immunogen.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 46
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2016-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ifaH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ifaH01
2I60H 4LVEA 4BQCA 1FNSL 1HHKA 4QY8B 2CJUL 3ARTA 4H0IA 3UCRA 4GXVL 3QCTH 1QFHA 4L8DB 4JAMA 4UDTA 1AO7A 5DT1L 3U30B 3GSNB 2WIMA 1HSBA 4TNVF 2JB5L 4I48B 3RGVB 4JZOB 1IT9H 2ICWI 3K8LA 4Z7UE 1Q0XL 4Z7WF 5BW7A 1RZIA 4M7JH 4MDJA 2FO4B 3U4EB 5FO8A 2RAMA 1QSZA 3MRHB 2OQJA 1X44A 1UKQA 5B39A 1HXYA 5L2JA 4HPOH 2HJKB 4XCYB 4M43L 1LEGB 1I3UA 2E6PA 3BE1L 1CZ8H 3CFBA 5JXAH 3SEPA 1U2HA 4TPRL 4MCYB 2YN3A 1F45A 3G6JE 5C0ND 5BV7H 4BH7A 4POZC 4RGMC 2A74B 5I1HH 3LHPH 1AO7E 3PWVA 4NUJB 2DQIL 1XF5A 2A77H 4ZS7L 5HHOB 4Y5XA 3QI9C 3VWKC 2FBOJ 2R8SL 5CJBA 4R0LB 1S7WB 1TQBC 1UZ6F 2CMRH 4X7SL 3T3PF 3LEVH 1WWWX 1BZ9A 2IFGA 2YHGA 5M94B 4TYUA 5E1AB 1B4JH 2MHAA 1U8QA 2DD8L 5C0BD 3BP5B 5D6DC 5D1XB 1T7ZA 1V3KA 2ZUVA 3BKCL 3LMJH 3QNZA 5LGHL 4M6MH 5TPWL 3S37H 1EEYB 1HOCB 5BV7C 3PGDA 1TCRB 5FFLA 3NCJH 4P2QD 2G5BB 1FLTX 3IDJB 4CJ0A 5HVWA 3RNKA 3RA7H 1M7DB 3T77B 1W0YT 2UUDH 4FZEL 1T0NB 4JFXA 3GJEA 1AXIB 4LSTH 4JHAH 4TVPD 2I9TB 3LAFA 2KL6A 2IH1A 2GTZB 3ILQD 4M62L 5FHAL 2AJ3A 4HGWB 3UJTL 1UKTA 2R69L 3SE9L 3MRFB 5HPMA 1XR8A 5I1GL 3MROA 4FQQB 4TTDC 4L8BA 2QADD 3D39B 3WHE0 5CIPH 3ECBA 3U6RB 3LKOB 3DIFA 32C2B 3KYNA 4G6AC 5DK0B 4UUJA 1L6XA 2GW5A 4ZD3H 3A6CL 1QNZH 3U2SB 1P4BL 3NMEA 3G08B 3TH2T 1QSEB 3VWJA 2VR9A 3ZT7A 2LVCA 2B4CH 1OL0A 5J13B 3QCUH 3KLAA 4M5ZL 2WUBL 3LVEA 4YK4C 1KPVA 1A2YB 3HAEA 1FC2D 1NFIB 3MODL 5IW6A 4YBHA 2QQLL 1IGJA 4OKVA 1E28A 1ZT7B 2HT3D 4M3JA 1B0GA 4KQ3H 3ZKSD 3HNTL 2DIBA 1N7MH 4OZFB 4YNYB 4Q7DA 1G9EA 4NQXB 1CICB 1DQLL 3C5JA 3UYRL 3GNML 2B4CC 3H7LA 1FH5H 3LQAH 3PWPA 1NL0H 4JPVL 1C7TA 3MNZA 1YNLL 1CGSH 5GRVK 2DKUA 3ZTNL 1T0MA 1INDL 1Y18A 1JNLH 1U8HA 3CGTA 1E4XI 1RZJL 5FCUH 1RU9L 2VE6A 4XAKE 5FO7B 1WVZA 2D31B 1HHGA 4FQ1L 4ZFFA 2JLLA 1QLRB 5F89B 5GS3A 2VERN 4E5XB 4L3CB 1QLEH 4MA3B 2ATPA 2CRYA 3RWEA 1NQBA 4X6BB 3IFPB 4RMSA 1MJ7H 3LKNA 2V5TA 3QCVH 2Y5TA 5DQJA 4HIEA 1H15A 1BJ8A 4S1DC 3VI4F 5DVMA 2HAZA 2SEBA 2YD7A 1U8KA 2WW8A 4ZAKB 3V5KA 1FGNL 3F5WB 3WKML 3DVIA 3ARSA 2Y7QA 1MHCB 4YFLF 1DQML 4Z77B 1RURH 3CVIH 5DC0A 2I5YH 4HXBH 1LP9B 5CINL 3U9UA 1KENH 4MS8C 2J8UA 5F6HI 1C8PA 1OARH 1FFOA 3GSXB 5CILH 1RFDH 2EIDA 4KZEH 1ES0A 2DBLL 3MCLL 4KKBC 2EZ0C 4ELMF 2FBJH 5EUOB 1RV6X 1F02I 2CK0H 4QTHA 4CN4A 3V5HB 2VMFA 4FQJH 4U6VL 1IC4L 1A4KA 4S0SD 3RJQB 3VXSA 1S7UB 4WUUB 4JCLA 3IDYC 4P57A 1L7IL 4R2GB 2AXJA 1N5AA 2R15A 4WI7A 4BFIA 3OBAA 4JG1L 3MYZA 1KB5L 5D2LA 1IM9B 3DGCR 2APXA 3LKQA 3I02B 5DJ0A 3EGSB 3KLHD 2BFVL 4NJAH 4GG6A 3F6IA 5T1KA 4OGYL 3QRGL 3P4MA 4HEME 1OTTC 4H5SB 3TCLA 3CXHK 1X9QA 3ZMRA 1I7ZA 4LASL 1TJHH 2NZ9D 4LPCA 1K3IA 1OPGH 2DI9A 4WEMB 1OB1B 2GY5A 4YR6A 4NBYB 2GI7A 4OQTH 5BMFL 1OAUL 1QD0A 2DMBA 4D8PB 1TCMA 2GQHA 2XKUA 1OM3H 1U92B 5C0AA 2VL5B 3CVHL 2F9BT 2IAMB 2KQMA 4HZLB 4U6YB 5E8DL 4R4BB 2V5MA 2R23B 5C08B 1W0VA 1KG0B 4W81A 1XF2B 1KELH 2OI9C 2YKLH 3AREB 3TNMA 3VH8A 1IAMA 3QB7C 3V0VA 1CDCA 1I1AA 1MCBA 3FOMA 5C0FB 3SQOH 4PG9A 3EYVA 3GK8L 3SGEH 5D1QC 5MENB 5JLZB 4NQDE 3VFGL 4PGCB 4FFVD 4YWGH 4X4ME 4K9EL 2H32A 4QKXB 5KVGL 5IK3A 3QNXB 1B0WA 5TDPA 3FB8B 2WLZA 4XC1H 3AB0C 1H5BA 2X2YA 1MCOH 4WJ5A 5E8NB 2Q86B 4XAKD 3C8KA 1U6AL 1NUGA 4TUOB 5E2VL 4QGTA 5HHXL 3GGWB 2IQ9H 4X7CC 3MRRB 4AH2A 5I1EH 1NUDA 3KPTA 1A22B 2PXYD 3LS5L 1NCAL 2VAJA 4FXKB 1AE6H 5GGUB 2D9CA 3FQTB 3T0BA 4FP8L 4IOFD 3SKJL 3BGAA 3F58L 2OR7A 5IB2B 1J9CT 1TENA 2BCKA 4LLWA 3PL6D 3VXOA 5DI8A 1CE6B 2PF6A 4MNQB 4KMTL 4OF0A 1TZGL 4M7LH 2H8PB 2VQUA 4L29A 4RFNB 1J7VR 4PJXF 1VGKB 4Q9CA 4MB3A 4LQFH 4KKLC 3I2CL 5IVXB 5EOQH 3U0PB 3ZKNC 1MLBA 1MAML 5JMRA 2ICWA 2Y9RT 4N0YH 1REIA 4HKXA 3S34H 2G60L 4U1IB 4GOSA 1KCVH 2FEEI 4LCWA 1VADA 4F57L 3SDYL 1G7HB 4PB9H 5DJZB 3GIVB 4G43A 3WO4C 1IC7H 3FB7B 4KUCD 3BPOC 2FIKA 1A7OL 4P2OC 3C60C 3T2PA 1D7FA 3HUJA 5CWSB 4F7MB 2VUYA 2PO6C 3RZCC 1CDHA 3QHTC 3CDYA 4OSUH 1PY9A 3PIQB 2QKIB 3HC3H 3PP3H 1FAIH 2ZOKA 4PGDA 1HXMB 4AIZA 3RPKA 4EIGB 5CSZA 4Q9QH 2ZJSH 1QZ1A 5E8PA 4NOBA 1UZ8A 2Q6WB 2BNRA 2H1PH 4GAJL 1VHPA 4KJYB 4GW4B 1HNFA 2WINA 4H25A 2C9AA 2XN9E 3GJFA 3SGJC 3WD5H 3PDOA 4X99A 5D2NB 3S88H 3D2UA 3P0YH 4OJFH 3NTCH 4RWYH 5DYOB 5DRWA 2HFEB 4Q6IB 3ARYA 4YDVB 2PYFB 4EOWH 3GKWH 2C4FT 4WTWA 4XPBL 5DMIL 1KJ3L 3GMPA 4JKPL 1W8OA 3VDAA 2BRRH 2QSTA 2NNAA 1A1NB 2A9NL 1PDKA 2ICWJ 4G8FA 4XMPL 3JWNC 5FUOH 2L0DA 1EERB 2BNRE 2X4NA 3PGCA 4HPYH 4NQDD 3IDGA 3RHWK 4QXGL 1W2KT 4XGZB 2ZSVB 3T4AA 5F6IC 3GDBA 2AS5M 1UACL 2YK1L 3TVMC 1A6TA 4ZMAT 4KH2A 4LNRA 3G04B 1TVHB 3TYFA 5FYKL 4FTVA 1KTKE 1N8ZB 1KB9J 1FIGL 3CU1A 1NBQA 1DLHA 1RD6A 3DWTA 4XWGL 1CBVH 4GUPB 4JDZA 4LEXH 1IL1A 1CE1H 1CLOL 2VL4A 5IMLB 5HGDA 5J1AA 3SGEI 4EN3B 5I19H 2YD6A 1KFAH 1D5IL 3D69B 5IV2B 4YC2C 2FEDC 2HFGH 1GGBL 3QHFH 1AQDB 4YUEL 5I8EA 3TBWB 2O5YH 1RI8A 1UVQB 5FHBL 1PBYA 2EXWD 5I73C 3CC5A 1A3RH 3OJVC 3SKMA 2XWBB 4PTUA 3MMEA 3KPLA 1D9KA 3QWOB 4PJDE 1CTOA 1PX4A 1RUKL 3MGTB 1HIMH 3I6GB 4U1NB 4XXDA 3GSUB 4ODBD 4F7PA 3MRIB 4ETYA 3O3DA 5J6HB 2ZUYA 3IFNH 5GGTH 1UG9A 5I2IA 4QOKE 1GC1H 2DLHA 4G6KL 4MA8H 4AK1A 1BGXH 2H41A 5SWQA 2Z31C 2YPLB 1LK2A 1F3JB 4I0PC 2XQBH 4WU7A 2BOBB 2EDQA 1N0XL 3L9RA 1YNKL 2X4UA 4MVBC 3ZKMD 5KG9A 2MQ0A 4D0DB 4X5WB 1WBYA 4KRLB 3PHQA 1LMKA 1MCPH 5CLWA 3SJVB 4JZJB 1MREL 5D96B 3LPGA 1EGJA 4Y4FD 4HAGA 2CIIA 2J6EA 2Y36H 1GC1C 2HKHH 2X4SA 4NDMA 2IPTH 3E8UL 1RZGB 4NPYB 3DYMA 3P40A 5DD1H 3QI9A 3T2OA 3VWKA 1GGIH 4Z76B 3DLQR 3ZKQD 1PSKL 4WUKH 2XN9D 2VR4A 4OCRL 1IAIL 4P5MA 3QULB 5D6DA 1OAYL 4U1HB 5D9SA 1WWAX 4HLJA 3V6OA 4M7KL 4D2NA 1YPZF 5DMKA 4NUGL 2ED8A 3BWUC 1RHHA 1RUPL 1II4E 3LEXB 1G7QB 2DLTA 3BGFB 1BIIA 1NFDB 2V9QA 5C07E 4ZQKA 1H0DB 1D6EA 4YE4L 3TC9A 4Y4KB 4TNWF 4OLWH 2YBRB 5I1DB 4P3DA 2WZPD 2NY6C 1TFHA 2BNRD 2IPKB 5J57B 3CXDH 3H6JA 4AEEA 4G8IB 2AK4B 4MAYC 4RISL 5IKCA 3GZKA 5DJYB 1CD9B 1NFDF 2DN7A 2FX9H 3STBA 1AR2A 4PP1D 4WU5B 2B5IC 1W72A 5DJ6B 5E2TH 2HRPL 4EEEA 4UZGA 1X4YA 3UBXI 1VKXB 3H0TA 3SKNB 4GG8B 3GSNH 3RWGB 4OUUA 4X6DB 3FFDB 5K93A 4PJ9B 4GH7B 1LHZA 2W91A 4G5ZL 5DD6A 4BQ8A 4OV5B 2VXQL 4OF6A 5F3BB 3D0LB 1CDIA 5CEXB 4Q2ZB 3MLZL 1YQVH 5F8RC 4LKCB 4NP4L 3LN4B 5HYQA 1HEZA 2EYRB 4O4YL 3SE4C 5IB3B 5F6HJ 3O8XD 4FFZL 2EICA 4PJ5B 3QIWD 5CAYB 5BRZE 1JWMB 4QXUL 3BXNA 1BP3B 3U30C 2X7LA 3IF1B 4TNVK 2P8MA 1MRCH 4H88L 3RGVC 1ZHLB 2V2WB 4NKDB 2ADJB 4GBXB 4QOKD 2YD2A 4ZPVB 3LV3B 3MJ8B 2W60B 2AQ2A 4ZSOE 2GAZA 2APVA 1L9MA 1S7XA 2ZUSA 2Y23A 4WENB 3D5OF 4QRRB 4BSJA 2MJWA 4ZO8A 3HR6A 5K59E 3UJJH 1RZ8B 1P4IH 2F5AH 4WY7H 4K3DH 3NCEB 1D9KD 2LAGB 5KVMC 2ZNXA 1YEGH 3FT3A 4H20L 4Q74A 1EFXB 3MREA 3KNBB 3HMXA 4R0LC 4F2MA 2ADGA 4MXQC 1GGCL 5F7EL 4CRPA 4LF3B 2I9LB 2E7LA 1D6VL 3U48A 5D1XC 3BRDA 1UM4L 1GOFA 4NO5B 5TE7L 3VDCA 5D7JD 1RJZB 3HNSL 3BW9A 3WIHA 3DO3A 4RMRA 1MH5A 3O2DL 1NGXA 2FH8A 1KCRH 1J0IA 4UDUA 3ZL4H 2E27H 1PG7W 3NZHL 2GT9A 5C07D 1FV1B 4Z7VE 2X9YA 2LAAA 2OTWB 1RIHL 2ZOLB 4UTBH 4ODTL 3IDNB 1YMHA 2VR5A 2YC1B 4TRPL 1OF2A 1ZLUK 5JIKA 1IILE 1UXSB 1ZEAL 2XV6B 3TIDA 5IBTH 4CW1A 4YEEA 4HGKC 2P24A 4Z7QF 3H42L 4J23A 4OLVL 4XI5D 4W4OC 2H2SD 4X6CB 3FO0L 5TJWK 1KCSH 3OKOB 1KB5B 2P7TA 4HJ0D 5F1NA 3MV01 5E9DB 5HYJB 3SN6N 3CLEH 4PJBB 4KTDH 1ZHKB 4TTGA 3S96B 2NX5B 4LOUC 5IMKB 1H3GA 2VZUA 5J13C 2P1YA 2GY7B 5HGBA 1IGCH 2DQFB 2F5BL 5DJXB 1U8OB 5I18L 4U1MA 1L7TL 1VACB 3MOBH 4ZXBD 1NLBH 3CVHB 2DWEA 4NZTL 3F7YA 1K4CB 4OLYH 4LVNB 4G7VL 2VH5L 1NEZA 2OP4H 3BEWB 5IJKA 5I0DA 3AY4C 4DTGL 2VISB 2Z92A 1EXUB 5BRZD 4GFTB 1CICC 5F9JA 4IDLA 1HQRB 4K7FB 3VG0L 1I75A 4X8JA 5GSVB 3RWHB 4JRYA 5JO5A 5EB9A 5C0RH 3TIEA 1Z5LB 5GJTL 2OL3L 1LEKB 1UWGL 5CGMA 3DX6A 3DUSB 5DHXB 3L1OH 4FFYL 3WFEH 2FWOB 1JNNL 2BVPA 1RJLB 4EI6B 1CLYL 1HSAB 2DIJA 3F7RA 4OLXL 1QR1B 4M1CC 1DVFA 3C6LB 2UWEB 3QUXA 4FQLH 4WVRA 5D7LA 5BVJB 4X5XA 4TSAH 3AU1A 4YDKL 3SHSA 3ULVL 2FX7H 2LQRA 1CDJA 1IAKB 5DZOA 2VN7A 1QACA 1WGOA 3FQWB 1NH6A 3L3GA 1ADQA 5CS7A 4N8CH 3O41A 1M1SA 3GMQB 3O0RH 4ZUVA 2ZUXA 1GYAA 4XNYH 4MMZC 2ESVA 2RCSH 2C7UA 1JK8B 1J8HA 3HCVA 3EO0B 4EUPB 3U46A 2UVEA 4HV8A 3P0GB 4NRYA 4N0FA 4ZAKC 1S9YB 3PNWA 5L6YL 5FV1L 2V7HA 3OX8B 1R3KB 2X9XA 4XNZB 4UT7H 3U9PH 4OF5A 3W9DA 1KT2B 3FRUA 3QZWG 3N1GC 3S4SB 3S8WA 4LIQH 4OT1L 3DV4A 3U0TA 2F19H 2VUOA 3WFHA 4PJHE 3NABH 1NGQL 3LRSA 1QRNB 2EIBA 1Q0YH 4PRNB 3SDXB 4HBCL 4PJAA 4Z95H 2UZYB 3WNMA 4RQQB 1A6PA 3VFMA 4OCNC 4NCC1 2ADFH 4XT1C 1EZVY 4F7TA 4HEPG 4P2OA 3C60A 3DVGB 2NY1B 3MLSL 3N06B 5DHYA 3KXFA 3EFDL 2PO6A 5EBMB 3ARFA 4R2GC 5H37G 2F54A 5DVOA 4JFFD 1UENA 1YMMB 1RK0B 2C1OA 4NBXB 4HULB 4KVCH 4Y5YA 4IMKC 3W81A 1N4XL 5ITBH 3BUYA 2O26U 2G9HB 4G9FA 4I4WB 1AD9B 4PJAE 4P4KB 1MFDH 4N8VA 3FO9B 3IU3A 4UNTA 3DRQB 5FM8A 4AEIH 1XF4B 2PW2A 1AGEA 1L6ZA 4XVUD 2NXYB 2M26A 1JP5A 3PE9A 2IAMC 3SCMD 1CL7H 5CJ5A 1NAKL 3AROA 3KXFE 1BBJA 3GIZH 3AREC 3UTTE 5IFJA 2F54E 2W59A 3BH8B 4F58L 1I7RA 1EIBA 2YN5A 2YPVH 5DK2B 3INUH 1KEGL 2DAVA 5A3IC 5D7IB 2OS7A 1T20A 4ZUWA 2BSSB 5ESQA 4P4RB 2NW2B 4C56A 3O3EA 4Z0BH 1MHPH 5I75B 1Y0LA 1DEDA 1FZOA 3LS4H 4R4FL 3UBXA 1NBZA 5TQ0L 2ITCA 3RWFB 4FQCL 2AJZA 3IKCA 3D3VB 4GQ9L 4YHIB 1NGWB 4XP9L 2R0LL 3MLWL 1MQKL 4OCWH 1DEEB 3KPSE 5GGSB 3QQ3A 3QIBA 5CP7A 1QSFA 4G42B 2OMBA 1LEIB 2JTDA 5M7QA 2FJGA 3CH1B 4YFLI 2JCCE 4ZO6A 1XGRA 1E4KA 5F1IB 5BZDA 1QYGH 4NRZB 3KS0J 1T2JA 1C5BL 1JGDB 3T0EB 2D0HA 3HAEG 1ORSB 5HYIA 1YYLH 3EUUA 4EDXA 3O6FB 4RFNC 5IB4B 1DVFD 1JZ7A 5L7XH 1WEJH 3O2WH 4ERSL 4XCEB 2E8YA 3FFCA 5KS9E 4DGYH 1NJ9B 2XRAL 5GZOC 3OGCA 3TBVB 4I3GA 1OD7A 3LZFH 4PD4J 5F21B 1UA6L 2I25N 1HH9B 4OB5L 1C08B 3GSRA 4RNRA 4J3WA 3FT4B 4GW5A 1OD9A 2BSRB 3ARGA 5EIIA 4KXZH 4I0PA 4ODSL 1QSFE 5KAQG 2C3VB 2FATH 1WZ1H 5FYLE 2BOCA 5ANME 1L9NA 3UX9B 5DC4B 3HE6B 3MRMB 4RGNE 3PWUB 2F74B 5LAXB 5SWSA 1KB9K 1MI5B 4JO1H 5IR1B 1A9BA 2EIEA 3ARDA 4HFUL 4PRBA 4HIJA 2VSDA 3FFCE 4LKXB 1JWSB 3HB3C 4HX1A 4YX2L 4QRTA 3CX5J 2YMXH 3MBED 4D0BA 4YZFF 4C57C 1SJEB 5JQ6H 2XA3A 1QLFB 5D2NC 2CLVB 2EKSB 4KZDH 3QDJA 2J88H 5IESL 1DQDH 1ND0A 2EDKA 3L3HA 4HH9A 4JN1H 5K9KA 4FQXB 4Q6IC 4U6XA 5CHNB 2Q8BL 3V6BR 1OT1A 4BUGA 6CGTA 1F4WH 4YHPA 3KXFD 4GMSL 5F97E 5DRXA 3ARFD 3UTTD 3I3EA 3G5ZA 4NKOB 2NW3B 5GS0C 3V4VH 3HFMH 5F7WC 4R7NA 3D48R 4LP5A 3B2UD 4KV5E 5ITFA 2P5EA 3K3QA 5ADOH 4MAYA 1BD2E 5EH1A 3QDJE 4UMGA 1PY4A 1JHKL 3WJJA 4PJEE 1OSPL 2YD9A 1J05A 2CJUH 4CNIA 3X12B 4GXVH 3TT1L 4PIRF 1WUNT 1I8LA 4UQ3A 4OLZL 5H94A 4R8WL 2PUQT 1X5JA 5E4EB 3TO4B 4EN3C 3RPIA 4M8VA 4LLUB 3KPSD 4G8GD 2OR9L 4WCYL 4HIHA 1Q0XH 4PGJA 5B21A 4WV1B 2CH8A 1HYRC 4ZFOA 5FF6A 4V1DB 2BC4B 4KK5D 5C0JB 1FL5B 3DV6A 3VRLF 3W2DH 4J6RH 1HHIA 4M43H 2HVKA 2N56A 4Z7WA 4JR9H 5GJSH 2AXFA 1QRKA 2VLRE 3G6DL 5IEHA 2D7NA 4FFWC 4OZIF 5L8KB 5LQBL 4TPRH 1F42A 1T66C 4U3HA 5HHPB 1A1MB 2DKSA 1NBYB 1ZHBB 5D1ZB 2DQIH 4ZS7H 4JZOA 4XVSL 5KVDL 3HLAA 2EH8L 5AUMA 2BRQA 4RAVB 2R8SH 2APWA 3GBNL 3U4EA 1X5KA 4X7SH 5JW3L 2V6HA 5KJRL 2A6IA 5B3NA 5FYLD 5E5MB 2JJWA 5IFAL 1CQKA 4RGND 5DFVC 3BKCH 5CD5D 4HUUA 4D9QE 5LGHH 4UB0L 5TPWH 3C2SA 4JZJC 1N2RB 5EO9A 5D96C 5C8JA 3TBSA 5EBGA 4LGSB 2CRMA 3CDFA 3FFCD 5HHOA 4CVZA 4FZEH 3GMLB 3V6FB 4HUXA 5IMOB 2DM2A 5HYSG 2ADIB 5EU3B 4M62H 3ARGD 4KXZI 5IGXL 3N1MC 3TYGH 5IHLB 5D1XA 2CDEB 2R69H 3SE9H 2LU3A 1AP2A 4FQHA 4MSWB 1S9VA 4N9GB 3MLTB 3RKDC 1K9TA 1HOCA 3T3PE 5JOEA 2G5BA 4JM2D 3BGFC 1M7DA 3EOBB 1JGEB 5F7NC 4Y4KC 1QEWA 2CPCA 3F7VA 3ROLB 4U2ZA 4ORGB 3L3DB 1S78C 2CLRA 2MCG1 4XRCB 4PRPB 1IEBB 4DGVL 2NTFB 2GTZA 3G9VA 4TQEL 4C83B 4M5ZH 3MJ6A 4PBXA 5A2JH 5T5FL 3MRFA 3B9KB 2JJSA 4RBPH 3MODH 5ESAA 3W9EA 2QQLH 4E41E 1PLGL 1BD2D 4WO4B 4QTIL 3D39A 5KTEH 2HLFD 4W4OA 4O58L 4U3CA 5DQ9B 3KGRA 3V79C 3LKOA 3HNTH 2UUDK 1HHJA 5IVNA 3LIZH 4JFPB 1FVEB 4LRIC 1OP5K 3U7YL 2F53B 1YQ2A 1DQLH 2X1PA 3FQUA 1QSEA 4ODWB 5JDJA 4JE4B 4RMTA 3UYRH 2YXMA 4O2CB 1WZLA 4PJ9C 1ZA6B 2JELH 4WHYG 4JPVH 2GCYB 1T83A 1YNLH 5EUKB 3K4AA 3FTGB 5ADPL 5C0CA 3TN0B 3ZTNH 3OV6A 3C2AH 3GMRA 3CFEB 3IAPA 1ZT7A 1RZJH 3QHZL 4B7LA 2XG4A 4NGHL 5GS1B 4HWZA 4OZFA 2VLRD 3AY4A 4WHTA 5IQ9A 4YNYA 1MCRA 1HYSC 4JY6B 1QVOA 1CICA 3AMLA 5DK3A 3K4DA 1OW0A 2Z8SA 1P1ZB 4GBXC 1FCCA 4ETQB 2OL3B 4JFYB 2C26A 3OJMB 2CDFA 4KRPD 1CVSC 1ZT4B 1FE8L 1QFWL 5F3HB 5GGVY 2CR3A 2XY2A 3CUPB 1A0QL 3HRZA 4QRQB 3S5LA 1ZOXA 1RZJC 3KLDA 4Y5VA 2FO1A 3MV7B 1H3VA 4YHZH 3IS1X 4HUMB 5EBLA 1FGNH 4OI9A 1KPRB 4D9QD 1FPTH 1DQMH 5L0QB 2D31A 2K1MA 3RP1A 3THML 1G84A 5CINH 1QLRA 1LDPL 3LD8B 5KSAD 2YD1A 3ESUF 4ELKB 1IQDB 1JGLL 4X6BA 5HI5C 2DBLH 2ARJB 4ONOA 1TPXB 3MCLH 1JGUL 2EDEA 3RDTB 3MFFB 4JQVC 5IF0B 1QA9A 1MVFA 3ISWA 4U6VH 4ZNEE 1IC4H 5T5NG 5JUEH 4P46B 4JFHE 4NZUH 3ULUE 1XCQB 1MHCA 4Z77A 4NCC2 4DZBA 1L7IH 3T8XA 2FHBA 4DOHB 4JG1H 5J3HD 1K5NA 4G6ML 4K7PX 3OGOE 1KB5H 3MNWA 2A9MH 5L9DH 4LAQL 2BFVH 1VGEL 2YZ8A 5H35A 3IAQA 4TVSa 3QRGH 2X89D 4APQB 5DVKA 4LSRL 3QEHB 2QJDA 4F7CA 4AEHL 4DGIL 1UM5L 1G9NH 2VXVL 3MRJA 2BNQB 3A6BL 4HK0B 2X4QB 2QQQA 1OAUH 5BMFH 4E41D 4WUUA 1CYGA 1ED3B 2XI9A 1D5BA 5E8DH 4ELME 5D6CB 4DWHA 1FO0A 2AW2A 3GKZA 5LKNA 1WZMA 4G7YH 1IM9A 5FA4B 3EGSA 4IMKA 3AM8A 1UB5A 3GK8H 1SYVB 1D5ZB 2NYYC 4H5SA 5GZND 2WBJD 4OZGE 4LCUB 4Y19E 1G9NC 5C6WH 4L9LB 1O5DT 1IGTB 4JO4L 4K9EH 3BSZL 3UJIL 4RFOL 4EJ1C 4O02L 4Y4HB 3IJYB 1JJUA 1SEQH 1WCBB 4YAQA 2IAMA 4LVNC 4U6YA 1MEXL 1XF2A 2AJXH 4QLRA 4YBLB 4NQCD 5DD0L 3JV6B 2XZZA 4UBDC 2AAVA 5EBWA 1U6AH 1F90L 1PYWB 4S1SL 2B0SL 5E2VH 2NLJB 1IRAY 5C0FA 3LKRA 3ZE1F 3LS5H 3PDGA 3MO1B 3V4UH 5LCVL 5TGBA 4FP8H 1RJCA 4JGUA 3SKJH 4UT9H 3ARBD 3H9SB 3MV8B 4K9EC 5F9OL 3TZVB 2VIRA 3ARQA 3N85L 3C6SA 5DMGC 3RX5A 3QNXA 3RWDB 1GIGL 4HQQL 4EUPH 3C6LC 1NCBL 4KMTH 2QSCH 2YRLA 2R2BA 3MRCB 4LAJH 3A6OA 3RWJA 4AEFA 2Q86A 3M07A 5CBAB 4TUOA 3GGWA 2FYYA 2NY0B 5B38G 3RI5F 1YUHA 1SEBB 3I2CH 1OT2A 3QFJE 4MA7L 2FZ3B 3BN9C 2HH0L 4P23B 3EYQC 3RVWD 1KJ2H 5IB2A 4WEUD 4PJGE 1N26A 4NNXB 1IJ9A 4CADB 5CBEA 2D7OA 1CE6A 4MNQA 3SGKC 2V5RA 3PQYB 3O4OB 5SWZA 4NQEB 5JDSB 3UP1A 4Z9KB 4JFHD 5JHLL 1X5LA 4WW1B 3ULUD 4XNZC 4NNPL 1VGKA 2JIXB 4U4BA 2LABA 4YHKL 1S7RA 4YFDB 1ZWIB 4NBZB 5ERWB 2YWYA 2Q76A 3WE6B 2OM5A 3LEYH 2GITA 3S36X 1Z9SA 3JVGC 4GAJH 4U1IA 5JW5A 3Q5OA 1KJVA 1KLFA 4KWUA 4PJXE 4PJFB 1JYWA 3QDGA 1OOAA 3I6KB 4ODHH 3GIVA 2BNUA 3GSQB 2NY1C 3RAJL 2WBWB 3VRIB 2R1WB 1AIFB 1SBSL 4OD2A 2LVEA 1TXKA 1EVUA 3TFKD 3QIUD 5IEKB 2CRIA 5C9KA 1S7VB 4XPBH 4PJFF 5DMIH 1KJ3H 4BSWA 1KNOB 4NM4L 4YO0A 5JQHC 1FNGA 1T80A 1BFOA 5INDB 5J1TC 1MRDH 1S7SA 4KJYA 4XMPH 2VZ1A 2YEZA 4LHJB 3B4NA 3L3IA 1Q9WA 4O2EB 4OCSL 1Q72L 4Y19D 5IBUB 4P4KC 4QXGH 4JN2B 3QDGE 4LMQI 1CD1B 3NIDE 1C5DA 2NXYC 4M61A 2IEPA 2HFEA 4Q6IA 3EDDA 2AJUH 2OZ4A 2PYFA 4G8EB 3VFWA 1X5GA 1FIGH 4I18B 3H7BB 2OR8A 4XWGH 3D18A 3DO7A 1KN2L 4U6TA 4C58B 1CLOH 4AT6B 3HMWL 1X6NA 4TSBH 3PABA 1B0RB 3RWIA 1D5IH 3ILPA 2C3HA 1IEAA 3BUTA 2EIZB 43C9A 4P2QB 3UTSB 4BKLA 1GGBH 4CKVX 3N1PC 1S5HB 4YUEH 5I75C 3G04A 2ORBL 5FHBH 4FZ8L 4J3SA 1J0YA 1N8ZA 2RR3A 1B90A 3MYJA 3D1MC 5MEPB 1RUKH 5B8CB 2PTVA 1N6VA 3QEQA 5IB5A 3CFDB 5TFSL 2N4IA 4HKBB 1ZGLM 4Y7MA 5IMLA 3QFJD 4KDVA 5J12B 2QADB 1JMZA 1FLRL 1W8NA 5BZWB 4G6KH 4PS4L 5JMOC 3FZUD 4MB5A 4IS6B 2IQAB 1JRHH 1U3HA 3TBWA 3VRJB 4DUXA 1N0XH 3VXMA 3T0EC 1UVQA 2GSIB 1YNKH 2VLME 1QUNA 3O6FC 1WISA 2R9HC 3OTTA 4PJIE 4GAFB 3QWOA 4RZCB 2W07A 4M4RA 5IJVA 4U1NA 4WWKB 2MFNA 4IRSA 3GSUA 4LPUA 1IMHC 2FHCA 1MREH 3QEQE 5J6HA 1FSKB 2J1KA 3RTQD 1ZS8B 3E8UH 3P9MB 2YPLA 1HZHL 4WDIB 4BSVB 1CFTA 1PSKH 3QP3A 3EJZC 3HE6C 2XKNA 4OCRH 1IAIH 4G6FB 4KQ4L 2XPGA 1V3JA 1K85A 4LLMB 2W9EH 2VDPH 4H26B 1KXQE 4D0DA 4X5WA 1YEIL 5JXEA 1NGZA 4KK9C 2W9LA 4Z7UB 3ZE0E 4M7KH 5I6XB 5JORB 1CIUA 1I9RH 3HZMB 4NQVA 4JFDA 4S2SA 1MAJA 3QDMB 1RUPH 1F11A 5DUML 2HWZL 4C4KO 3MLYL 4NPYA 4KK8C 4YE4H 1PG7X 2UY6A 1JFQH 5C1MB 3OAZH 4FNLH 1HHKB 3NA9L 3AXLA 3JTTA 4AIXA 4Z7UF 3WUWG 2EDBA 4JVPA 1IC5L 3QDGD 3H3PL 4FQXC 1YY9D 3FRPA 4YDJB 4JAMB 4UDTB 1AO7B 4RISH 3MPCA 4N1HB 5FKAA 5CGYD 1HSBB 1NCTA 3LB6D 3MRLA 3CFJA 2XTLA 1RZIB 5IG7A 3G6JF 3LEXA 5FO8B 2HRPH 1NFDA 2OQJB 5B39B 4DJMA 1H0DA 5C3TA 1HXYB 5L2JB 1GOGA 5HBBA 1SJVA 2NR6C 3EYFB 2IPKA 2VC2L 1YPZE 3WFDH 4HLZH 1LILA 1F3DJ 3CFBB 4KJWC 5GS2D 2AK4A 2W65B 2OK0L 4WFFE 3MLZH 4NP4H 1B6UA 4TULH 4BH7B 2FD6L 3PWVB 5EZIH 2J6EL 1XF5B 2BVQA 5ACMA 5FV2A 2GJ6A 2D0FA 2IANE 4LRIA 5EC1B 3RIAF 4QXUH 4NM8L 4MXWL 5HGHA 1BZ9B 4F15B 5E4EC 3SKNA 4GG8A 3TO4C 4JLRA 2MHAB 1U8QB 4PJ8D 4X6DA 4H88H 4PJ9A 1RIUL 2B2XL 3NFNB 4OD1L 5A2KH 3QNZB 1J0KA 3M1BA 4WV1C 1P5VA 3PGDB 5L8LB 4ENED 3LN4A 2VLMD 1R24A 3RNKB 2EYRA 3UPAA 4N1CA 3VE0A 1XZ0A 4WI3A 1CIDA 4JFXB 4QHKI 3VXPB 2H26A 3GJEB 5ID0B 4O5LL 2GJ6E 2FSEA 3IF1A 2IH1B 3CU7A 1Z0NA 3O3BA 5D1ZC 3O45B 2EO1A 4H20H 5HPMB 3NFPA 1XR8B 4ZPVA 3AUVA 3MROB 4L8BB 4P48A 3BP7A 4WGVB 3D6GA 1GGCH 4M3KB 3DIFB 4HAFA 4HWNA 3KYNB 4TUJA 5T1LA 2F15A 4UUJB 1CDYA 2B1AL 1UM4H 4ALAL 3HS0A 3TLRA 1NKOA 4KK6C 1BQHG 5DJ2A 1RZ8A 2EDYA 3KYMA 4X0KA 4CU8A 5IB1B 3RIFK 1Q8MA 5IM7A 2BVYA 3FCTA 1VFMA 4XC3L 4XNQA 2HKFL 1G0XA 2KPNA 1KPVB 1LO2L 2EXYD 2QHRH 5IW6B 4L4VA 1EFXA 2BK8A 3NZHH 4OKVB 4Z78A 2CK2A 3B6SA 3QUZA 3RVTD 1RIHH 3ZDXF 4JQVA 3MOQA 4Y16A 1PZ5A 3MRPA 5GRVL 1RVFL 2PXYB 3HTLX 4F3FA 5DUPL 3C5JB 1IAII 3H42H 1BBDL 1B2WL 3S37X 3PWPB 3FO0H 3FAXA 2UZIL 3MNZB 1AHWA 3PL6B 5CSGA 3PHOA 3Q6GL 3T4YA 4OCXL 3SGDI 1TITA 1UH4A 5DRNA 4RGOL 3W0WE 1AJ7L 1U8HB 2EE6A 1NC2A 3BJLA 1ROWA 3BWAA 3KYKL 3QYCA 5LWYL 2A0LC 4PG2A 3GHEL 3IDNA 1T2QL 1T5WB 2YC1A 2Y6SD 1UXSA 2F5BH 3B9KC 1HHGB 2R1YA 5GRJH 5F96L 4WO4C 5I18H 4WFFD 4ZFFB 1L7TH 5AWNH 4HT1L 4KI5C 4NZTH 5F1SA 3RWEB 4G7VH 2VH5H 1BQLL 4G6JL 2DI7A 1EJ6A 1MJUL 3IDXL 2IAND 3LKNB 3HMXL 3B5GA 1CR9L 2E7BA 3JWOL 5EIVA 4O51B 5E9DA 1NDGB 2Y5TB 5CLTA 3VXRE 4HIEB 1H15B 4Z7QE 1NC4D 4KGLA 4XPFL 5GJTH 2OL3H 5FECB 2EO9A 2SEBB 1U8KB 1UWGH 3V5KB 1GJIA 5JZ7C 4J4PA 2Y7QB 4G6AD 1DBMH 2W0PA 5DJXA 3TN0C 3VFPA 2FIRT 1JNNH 1DBKH 2J8UB 4OLXH 3CVHA 4PJ7F 2PYEE 1UEMA 4D3CH 1GHFL 4QCIA 5GS1C 1ES0B 4YDKH 2HTLC 3ULVH 1EXUA 2X09A 4AQ1B 1FGVL 3WNKA 2VDOL 2APBA 3SDDA 3IDIA 2GJ6D 1MFAH 4QTHB 1EMTL 5GSVA 2ATKB 1A4KB 1NGYA 3VXSB 1E0OB 4P57B 2DM3A 2M8XA 5DS8A 2WWKT 1N5AB 3JWDL 1G6RA 4XAWL 1V5JA 1T1ZA 5BS0D 2V17L 1RK1A 4LHUG 3LKQB 2CQVA 3V52L 4DZ8B 5DJ0B 3K8KA 3LY6A 3EJYC 4GG6B 3ULVC 5CUSL 4GRWH 5I1LA 5L6YH 1XGUB 5L0QC 3P4MB 2DYPD 3FQWA 4MJ6B 5SV4A 4TSCL 3LD8C 3OKDA 1I7ZB 4OT1H 1BVKB 4MNGE 1EAPA 2QHLA 3KYOA 4UT6H 2QQNL 3QUYA 5CMAA 4YR6B 3BGMA 4PTTA 5E5RB 1TPXC 1GAFL 3KJ6H 5C0AB 4HBCH 3RDTC 5KVFH 3BEVA 1CGXA 1QPXA 5EU5A 1W0VB 1P84K 4KRMB 2HT2D 2VDLL 4GJTB 3TNMB 3VH8B 3V0VB 1F13A 4OTXH 4P46C 2V9TA 4PRIE 3MLSH 3QUML 1R3KA 3EHBC 1KXVC 1TNNA 1KT2A 4X9FA 1OGAE 3GSWA 1U3ZA 1YEJL 1I85C 2XT1B 2H32B 4S1DD 3KPOA 5FDYA 5IK3B 4OCYH 4K23L 5TDPB 4JO3L 4HUNB 1N4XH 5GRYA 4PRNA 4X98A 3W0WD 4APQC 3O4LE 4RMWA 4DKFL 1H5BB 4RQQA 2ITDB 2YZ1A 4WJ5B 2YA0A 4K55A 1OGTA 4MS8D 3C8KB 1AXTH 4JFOA 1WAAF 3IVKA 4AH2B 1YC7A 4Y16D 3GMOB 4HS3A 3EYUL 1JF5A 4KKBD 2EZ0D 5DEGA 1NAKH 4ZTOL 2AV1A 5ALBL 3N1FC 4GRMA 5HI3C 1RK0A 3SDAD 1OTSD 2FECL 1ZLWH 3C5ZA 3BZ4A 3VXRD 2BCKB 2DB8A 1AKJA 1I9JL 5CCKL 1HN1A 1S3KL 2G9HA 2H45A 1QHOA 1AD9A 1KEGH 4NNYA 1J0ZA 1F4YL 4L29B 1K2DA 2OYPA 3C9NA 3FO9A 4XHJC 4EDWL 1CVRA 3NFSH 4P49A 4Y4FB 4Y4HC 1EHAA 3CZFA 1MLBB 3KYAA 2ICWB 2OJZH 3PP4L 2PYED 4HG4J 4YBLC 5E94A 4HKXB 4ZOCA 5IFHL 1CGUA 5BQ7A 1CFQA 1UWEH 4R4FH 3DI2B 4LCWB 1VADB 2R0KL 4YHML 4F9LA 1T7YA 4FQCH 3DX7A 5SX5H 1MY5A 4GQ9H 4ONFL 3RY4A 2ZCKH 2FJFB 2F8OA 2IWGA 2R0LH 4AG4L 2FIKB 1GZQB 1PW3A 4HC1A 5DK2A 1MQKH 2R1XA 5TDOA 3TZVC 5GRUL 3MA9L 1EH9A 2XZCL 1MJJB 2ZOKB 4JY5L 4PGDB 4HIXL 1XT5A 5BVPL 5E7BA 4AIZB 2Q20A 3UAJD 4PFEA 2D03L 5D1QD 1K3ZA 1V3LA 2YSSB 4WW2F 5CSZB 5E8PB 1UZ8B 2BNRB 1DTUA 3KPRE 1MIEH 2IMMA 2N7AA 2DQTL 4BK4A 5DJCA 1F00I 1K8DB 3GI8L 2NY0C 2WINB 4H25B 4YHIA 2APTA 2VABA 3GJFB 4PGZA 1OP9A 2LU4A 3CFCL 3PDOB 2XRAH 4X99B 1KGCE 3D2UB 3SDDD 4OZHF 4L5FL 5HVGB 4P23C 2H9GB 5DRWB 1UA6H 4OB5H 1LEIA 5DURD 2IC2A 2MSPA 2NY2D 4OIBA 3BH9A 4ODSH 3GMPB 1T1YB 2NNAB 3O4OC 1C1EL 1JGDA 4YGAB 1CT8A 3T0EA 4G8FB 1KF9B 1S7TA 3D0VA 5GSRA 5IB4A 4PRID 3FAWA 1N5YL 5E24E 4ZNCD 4HS8L 2X4NB 4HFUH 1OGAD 3TEUA 3IDGB 4OZFG 3T4AB 4JQIL 1A6TB 1TETH 1HH9A 1C08A 1SY6L 3CDGB 4LNRB 3O4LD 2BSRA 4PJDB 6FABH 4LARL 2R2CA 2MWCA 1FYHB 1CXEA 3ZKND 5IESH 1IGFH 3PWUA 4JDZB 1V7MH 3RVXC 1IL1B 3BX7C 4QOKB 2Q8BH 1UADC 5HGDB 4HUWB 1KULA 4QRUA 3L3JA 3FN9A 4PJDF 4GMSH 5FM4A 1UGNA 1QSVA 4R90L 4GW1A 5EOTA 4JY4A 2HFTA 3WFCL 3CSBA 3WLWD 3RZCD 2AJVL 1SJEA 3CC5B 3SKMB 5DLMH 4PTUB 4XP4L 3MMEB 3KPLB 1D9KB 3WO3B 5C0NC 1T03L 2VXTL 4WFGE 5GHWH 3SBWC 4QHKJ 4Y1AA 1UQSA 1RQ5A 2W38A 1OSPH 5I2IB 5HHME 3S9DB 1O0VA 4I18C 4OGXL 5SWQB 3TT1H 3D87B 3WLBA 1FBIL 2JJTC 4WU7B 1ACYH 4OLZH 4DEPB 1DSFH 5DDHA 1JL8A 1T6VN 4R8WH 5D7JB 1YEFL 3L9RB 4XVTH 3JUYA 3D9AL 3WDJA 1AKJD 4JHZA 1CDBA 4RMQA 3R06A 4R3SB 4WCYH 2FGWH 3UO1L 1A7PL 3K80A 3PHQB 1T2XA 3BJ91 1AC6A 3HE7D 5C07B 1JTTA 1MQ8A 1DUYA 5D7SH 2CIIB 4XMLL 2X4SB 4NDMB 2WQ8A 3SE3C 3ILQC 3G6DH 3KPRD 5B8CC 5LQBH 2DMKA 1OAQL 2DQCL 2A73A 2KZWA 2OTUA 3DROB 3TVMD 3FN0L 5D5ME 4JVWA 4P5MB 2QADC 5J12C 1KGCD 4HH8A 4OF3A 1U3JA 3OR7A 3OF6A 5KVDH 2EH8H 1KN4L 2EDTA 5D9SB 3GBNH 4FMKA 5DMKB 2VDKL 5JW3H 4NOFA 1RHHB 3PF2A 1NUFA 1OSZA 5IFAH 4A6YA 1BIIB 3MA7A 1D6EB 5F7LB 2X1XR 4GAGL 1X6LA 4WWKC 2OJEB 4GKOA 4P3DB 4RAUA 2PN5A 5HHPA 2FEDD 2VLKE 1NBYA 1FSKC 4B41A 1DBBL 2GKIA 3QH3B 5IKCB 1INQB 4KMLB 1Q1JL 5C09E 4OZIE 1DQTA 1MOEA 5B3JE 5BRZB 1OAKL 1IAOA 3ALPA 5DZNA 1W72B 5JW4N 5IGXH 2HN7A 3EDJA 1DLFL 3E0GA 2NY5H 3H0TB 4TOYL 3REVB 1A3LH 2Z31D 4HCRA 4KKAC 5I6XC 1TZHA 1FNEA 1LE5A 1N2RA 5DD6B 5LBSL 2AGJL 2IBBA 2WM0A 5CJQL 5CJXC 2X4PB 3GSVB 4MVBD 4JREB 4ZFOL 2BJML 5DSCA 3D85A 5HYQB 1HEZB 3BP6A 4TQEH 1S5IH 4KDTA 3QUKA 1BJ1H 2CDEA 4WFGD 5T5FH 3UTOA 4YH6A 1QBML 2QEJA 3BXNB 1Q94B 4BM7A 5IT2L 3I3BA 1XGPA 1PLGH 4N9GA 4U1JB 4QTIH 4O58H 4M6OL 3O2DA 5HHMD 1BF2A 1FVDA 5BW7C 2GAZB 5HHVL 1U91A 4KJQD 4JKLA 1XIWD 4XRCA 4C83A 4DAGL 2AK1L 2P47B 4CVWA 1NSNL 4CMHB 1U8LB 4M1DL 4PLKD 3SE8H 5ADPH 2LU7A 4D9LL 4WO4A 4HXAL 4MHHG 3L7FB 2RJMA 2NY6D 4PLOB 4NFBA 3MREB 5KN5A 1X4ZA 3DVFA 4JFPA 3HG1E 4LHUD 4F2MB 2ADGB 5I30L 4F15C 1WQVT 4ODWA 1MCWM 3MGOB 4HWEH 1GRWA 4GKSA 3WBDA 3GMNA 1KCLA 3JZ7A 5L88L 4Z7VF 4RBPK 4P5TA 1FL3B 1HILB 3BW9B 4ZFGL 1FE8H 3KLHC 3TN0A 1NGXB 3O9WD 1A0QH 3LKSA 1VEPA 2DQUL 4UDUB 4QHUB 4R26L 4M02A 2DQHL 1RULL 4YDLB 2HLAB 1ZTXH 2GT9B 3N9GL 2NZ9C 4JY6A 3DX8A 1GPOL 1IBGL 1URLA 1YMHB 1LDPH 2VLKD 1OF2B 1P1ZA 3TIDB 3HAEH 4CW1B 4ETQA 1JGLH 4JFYA 3QG7L 5EU6A 5BJTA 2L7JA 5C09D 3VGAB 3WJLA 1XR9B 4WTZA 1JGUH 1IZKA 3CUPA 2VAAA 3JSSA 4QRQA 3JUZA 2OX5A 2P7TB 3TV3L 5D71L 3RGVD 4JM4L 1J1OL 2ZUTA 3RX8A 4FFVC 1A64A 1KPRA 4R97B 3F12A 3IFLL 3Q1SL 5E03A 5HGBB 3VFTA 3OKKA 4G6MH 4ELKA 3BDYL 1IQDA 4LAQH 1J0JA 4JJ5A 4U1MB 4J8RA 4JCMA 1VGEH 5MEOA 5F93C 3M17B 3NPSB 3QQNA 2DWEB 3EDKA 3ME0A 5EU6E 3F7YB 4LSRH 4KKCC 1NEZB 1I3VA 5HGAA 4AEHH 4DGIH 1UM5H 1NFKA 5IVZA 2PXYC 1FYTA 3DNKA 5ICXA 2DICA 1R6VA 2XY1A 4GRWF 3A6BH 4JDTH 1EHXA 4C59B 4X8JB 1JHTA 3VG9B 3TIEB 2A6DA 3B9VA 5FM5M 1WLHA 3PL6C 3DX6B 3T0DA 2QR0A 2BVPB 2XNAB 2RHEA 1JF6A 3ULUL 1DVFB 1UFUA 3QUXB 4APQA 5I15L 1Z0MA 4X5XB 4DW2H 1J5OH 3AU1B 2R0WH 5I8KL 3CNKA 3DUHA 4PRAA 2XFXA 3L5XL 4JO4H 2BNQA 1AGDB 5HDQL 4HK0A 4RFOH 1KIRA 2X4QA 5EUOE 4ZUVB 4NKIL 4JZNA 5EO1A 2C7UB 3HG1D 1F90H 3HCVB 1I9IL 1CG9B 2B0SH 3U46B 5AG9A 3DHMA 1U8NA 4NRYB 3WHXA 4DFIA 4PJHF 4N0FB 4LCUA 3DYOA 5LCVH 3PNWB 1PFCA 2V7HB 5F9OH 3N85H 4HHAB 3W9DB 3FRUB 4LNVA 1AFVH 1BWWA 1LGVA 4HQQH 3DV4B 1WCBA 2DLFL 1NCBH 3KVQA 4IJ3B 4YHLL 3WFHB 4Y88A 3LRSB 5JOFA 4UQ2A 4JB9L 4PJAB 5GRWA 4CAGA 1PYWA 4RWHA 5CKAA 4H1LA 4XH2A 3VFMB 4XP6L 3S36L 3U79A 4MA7H 4X4XA 4UI2A 5C08E 3VFSA 3MO1A 2HH0H 3DHJA 5DHYB 4DKAA 3ARVA 3KXFB 3ARFB 1AXSA 3SY0A 2F54B 5C0GB 3RWDA 2ZPKH 1J87A 3F6LA 1QBLL 3PV7A 1CLCA 3ZE1E 1QFWI 1L4IA 4Y5YB 3MRCA 2K9UA 3DSNA 4MJIA 2YS4A 5JHLH 3ZHLA 4LPWA 2DLEA 1NANH 5E6IA 1VFAA 3TESA 1J1PL 4HIIA 4G9FB 3HPLA 5I1JL 1ZXQA 3NCYS 3BT2L 4N8VB 1P9MA 1XH3A 4M1CD 2H32H 4MJ2A 1CD8A 2PW2B 1BFSA 3JBG7 1AGEB 4OFYA 5T33L 4K8RL 4OIAA 1BBJB 1Q38A 1AD0A 1N6QH 5IFJB 1J8KA 4N0UA 1KPUA 5FUCC 3MOAH 1I7RB 3OKMA 4LSSL 3RAJH 1F58L 2YR3A 3T08A 1SBSH 3G5VA 4LL9A 3DECA 4MJIE 1MWAA 3MFGB 3TPUA 4YHOH 1ZWIA 3BAEH 4NO0A 4NM4H 5ICZB 1T20B 4ZODA 3RHWF 2KDGA 2VZOA 2YRZA 4LQ1A 5KSBF 4ZUWB 2EXWC 4U31A 3VU2A 4PV8A 5ESQB 4ZAKD 1H5BC 3O3EB 1U93A 4PJFA 4X7DC 4BH8A 1Y0LB 3OPZL 4HFWB 1FZOB 4OCSH 1Q72H 3AMKA 3UBXB 1NBZB 2QBWA 2ITCB 4Z8FL 2JCCF 3GSQA 2DBJA 2Y06L 4Q9RL 2AJZB 3VRIA 3IKCB 1J1XL 1AIFA 1LO3L 1D5XA 5IEKA 2X4OA 1AC0A 1GH7A 3QQ3B 3QIBB 5CP7B 1QSFB 1JCKA 2FJGB 1LDSA 2YD5A 1SMAA 3NPZB 3V7AG 5KS9F 1XGRB 1KN2H 5BZDB 1JZ3A 3G5XB 1JZ6A 5KSVB 4R2GD 4ZYKA 4O2EA 4EDXB 5DJ8B 4M00A 4XZUB 4I8DA 4B7IA 1CD1A 1LK3L 4Y4FC 4MNHA 1QPPA 3FFCB 4G8EA 4N5UA 3OGCB 5D7KE 5IW1A 2EDWA 3IJHA 5T3XE 4FZ8H 2D7PA 1T7XA 5D2NE 1PEZA 4HWUA 4RNRB 3H7BA 3ARGB 5C0BA 5EIIB 3ZE2E 2JJTA 4YFEA 5TFSH 1EAJA 2BOCB 3GJFH 3BQUA 4AT6A 2EC9T 2UY7A 1JWUA 4OKDA 5C08D 1QFUL 3BOVA 4LP4A 3REWA 1VPOH 1K4DA 3L95A 3ARED 3QA3B 4QO1A 4PS4H 3ET9F 1A9BB 3BFOA 4P2QA 4LHQB 3ARDB 4PRBB 5D72L 2XZQL 1DANU 3OWEA 3EO9L 4HIJB 2FGZA 1RZKL 3VD5A 2PNDA 1I8KB 3CCHB 3MUJA 3IJSA 5A3ID 5IQ7L 5B8CA 1FZKA 5LXGH 5HY9A 4M1GL 2MMXA 2BY2A 3PGFH 5IMMA 4JM2F 1CDUA 5JIPA 5FXCH 3QDJB 1ND0B 3L3HB 4HH9B 5K9KB 1TJIL 3EOTL 2GUOA 2IBZY 3OKLA 2OZ4L 4PJEB 4U6XB 5C70A 5MP6L 1U2CA 1MFBL 4IS6A 4P3CL 5A2LH 2HG5A 4X80H 3HC0A 5DRXB 5HGGS 3ZDYE 1SJHA 1TIUA 5J0BA 1IE5A 1JPST 3G5ZB 4KQ4H 2ICES 4NC1E 1HWHB 5FUZL 1NCUA 2DTSA 2DKMA 4YDIL 2H2PD 2WMPA 4R7NB 1NANI 4KY1L 1OP3K 3WIFA 1UH3A 2VKXA 1ZS8A 5DUMH 2HWZH 1X7QA 3MLYH 3FO1A 2VOTA 3OHXA 3P9MA 4HK3N 2VJXA 3ZKXB 4BSVA 3NA9H 1YECL 5EU7C 4CNIB 4LCYA 3EFFA 1MCWW 5GZOD 2MKWA 4UQ3B 5F7UA 4H26A 3QZWB 3HPJA 4J3OC 1KC5L 1NMBL 3MRKA 5MEQA 1FORL 4Z7UA 4KRPB 3RPIB 3BPLB 3O2VL 1KJMA 1NGPH 2F8VA 5ABDE 2D4FA 3SKUD 4HIHB 1MF2L 3AVEA 4KGJA 4PB0L 3KG5A 2OCFD 3IXAA 1WSST 5DR5H 1NLDL 5FF6B 4ZFOB 1B3JA 1T21A 3DV6B 1O7SA 3RL1A 1HHIB 3IXTA 1K6QL 2HVKB 1D9KC 4X9BA 2VC2H 4MA1B 3SJVE 4LVOB 4Z7WB 1MCJA 2AXFB 4MDIA 3G6JA 5IEHB 4HJJL 1MY7A 4YDJA 3GRWA 1KBGH 4EUPG 2OK0H 1NCWL 4RA3A 3HB3D 1EGJH 2FD6H 2GJJA 5D7KD 2J6EH 5T3XD 5CZKA 3HLAB 5AUMB 3M45A 4Y2OA 3VFRA 5A43C 3HI1A 2DTML 4DEPC 3S4SG 5D7JC 1ITBB 1IT9L 2A6IB 3S97C 3R8QA 2XXMB 5JA8B 3EYFA 1RIUH 1V05A 2B2XH 5D70L 4OD1H 2VQ1A 4HUUB 3ALXA 5D93B 2W65A 4P2RA 1IGYB 4XNMA 1KEML 3OB0H 5EO9B 3DETC 5C8JB 2F8XC 3TBSB 3PV6A 1ZSDA 3WXWL 3GMMB 5E2JA 1BOGA 4CVZB 2FH6A 4MLSA 2DWDB 5E2UL 5I1HL 4HUXB 5EC1A 5TQ2L 2A77L 1MJ8L 1A02N 4DK6A 2HTKC 3CK0H 3QNYA 4GMTH 1AP2B 1BIHA 3NFNA 4FQHB 3LEVL 3BQUD 1S9VB 2PCPA 1SM3L 5DD3L 3V6OC 2Q7YA 1P7QD 4FXLA 4HJ0C 3OKNB 4MAUH 3LMJL 4P2RE 5BOZG 3BO8B 1W72H 3QFDA 4ALAH 1FCGA 1S9XA 5I1IL 4CBPA 2WBJB 3VXPA 5ID0A 1QEWB 3F7VB 3NCJL 2CLRB 5DUBA 4UV4L 5E99L 1HQ4B 1HH6B 3T1FA 3O45A 4XPHL 2HKFH 1RJYA 4JHAL 1LO2H 5ESAB 3W9EB 4JRWA 1T66D 1BJ1J 4ZPTB 1HHJB 2HMID 4RRPA 4WEBL 3TNNB 5FK9A 1CXIA 4LPVA 2AXHA 1ZA3A 3K2UL 1T04A 4JANA 4MJ5B 5DUPH 3FQUB 4MJ4A 1N64L 4BFEA 1A5FH 4PRHE 5IB1A 1BBDH 1B2WH 4ZD3L 5FDWB 1QNZL 5FA3A 3A0OA 2UZIH 43CAA 4QRRE 2YOCA 1J88A 3Q6GH 4JREC 1S8DA 4OCXH 5C0CB 3CDCA 5MHSE 2G2RA 5DFVD 4RGOH 1JZ5A 1DP0A 3GMRB 4WI2A 4YXKH 3O81A 4PJCF 3KYKH 5LWYH 1KYOK 1MCEA 3BZFA 3GHEH 3SJVD 1UEYA 5F7YC 4HWZB 5IQ9B 4WHTB 1I3GL 5CP3A 5DA4A 2PXYA 1QVOB 3K46A 5F96H 2E8ZA 1MIMH 4HT1H 3X3GH 5KAQF 2R29L 3WSQL 3WN5A 5ACZB 4G6JH 1BQLH 3P4LA 3ZDXE 2CDFB 1FN4B 3IDXH 1MJUH 3LPWA 3PL6A 4J2XA 3HMXH 4S10A 4M5YL 3JWOH 2HVJA 1FH5L 1VCAA 3LQAL 1MELA 3HRZB 2WWMC 3S5LB 1V8HA 4Y5VB 1HK6A 4PP2B 4KJPD 4JHWH 4XX1G 3U7AA 1T5WA 3NACH 5EBLB 4CMHC 3WIHH 1Z9MA 1JNLL 1HKLL 3MSPA 2GIYA 4OLUH 4KC3B 5FCUL 4OCMC 2AERT 4PLNC 4Y4KD 2W1NA 1O7VA 4IM8A 3B2VL 3ULUF 1S78D 1GHFH 3TA3D 2XACC 3JWOC 1U95B 1QLEL 4O51A 1NDGA 1S7QA 3RWCA 5J7CC 2E7LC 5E70A 1CI5A 1E4WL 1EMTH 5EC2A 1QA9B 5EDXA 4NKMA 4UU9B 3WKNA 5FECA 3DUUA 4X8XA 4ELMB 1BX2B 4ZDHB 3T0VA 3MRDB 4DZBB 3T8XB 5D4QA 3GO1L 4PJBE 4CJ1A 3JWDH 4XAWH 3ZYOA 1ZT1A 2NX5E 1K5NB 3UZQA 4P2RD 3GM0A 3MNWB 3IETB 4LMQE 1C7SA 3V52H 2V2TB 3CLFL 1PD6A 1RURL 4YDLC 4BZ2L 5HSFA 2I5YL 4HXBL 3OAYH 3OXRA 5H35B 2ZSWA 4TSCH 4F7CB 3FB6A 4XVUC 1RFDL 4KZEL 3RY6A 4ESKA 3OJDB 4MD4A 3MRJB 2ATKA 1FC1A 4PJ7E 2QQNH 1X4XA 4U1KA 4X4ZA 4PJ5D 3VGAC 1GAFH 2W0FB 1A6AA 4OZGF 1D5BB 1HYSD 1FO0B 1M7IA 3JWDC 3WNNA 5D2LF 2VDLH 1PEWA 4DZ8A 3CFIC 4GBXD 5LG1A 3LRHA 1UB5B 1MNUL 1MFEH 4R97C 1XGUA 4NQDA 4UILL 4XTRC 5DO2C 3TBYA 3AAZA 4MJ6A 4PRHD 4X4MA 1BVKA 4J3TA 1DCLA 5I17A 3S98A 2UWEE 5E56A 1YEJH 4QRRD 1QQDB 4R6UA 1G7JA 5MHSD 4K23H 4JO3H 3NPSC 1MHEA 4YAQB 1EJOH 4AENA 5HHQA 4DKFH 4GLRH 4OV6F 5IJKC 4OQTL 4HLZG 1UXWB 3OZ9L 2P8PA 3R1GH 5EBWB 3QFJB 1MCDA 1ADQH 3RBGA 2GFBA 3LKRB 1P7HL 5GISH 3VG9C 4QGYA 1KELL 4GKZA 4KAQL 2EDJA 4ZTOH 2Z8RA 5INCB 5TGBB 2FLBT 3SQOL 4L8CA 2WQRA 2VIRB 1A7QL 3C6SB 5E0QA 3BIKA 1G6RL 3T2QA 5HYSB 5IOPB 1FDLL 1DVFC 3QUXC 2HP4A 4YWGL 5CCKH 2ZZUT 1YN6A 1WIOA 1DL7L 2BDNL 2R2BB 2ITDA 1H3XA 4QHMB 3RWJB 1KCUL 1YEHL 3MRBB 4PJGF 3PUCA 4XC1L 1OY3B 4EDWH 2FYYB 1YUHB 1QRNE 3GMOA 3STZB 1RY7B 2QSVA 4OQ1A 4OCLC 4P9MH 4PV9A 1M6OB 4BFBD 4NN6B 4PJXB 4NC2B 4U49A 5IFHH 2IQ9L 5J9PB 3ZYJA 1CFSB 4YHMH 1AE6L 4DCQA 5CBEB 5I8CA 1WAAE 2ARJQ 4AG4H 3JV4A 3KDMB 5SWZB 1NAMA 3HZVB 3PJSA 1WWBX 1YMME 4UOW0 2A1WL 2ZUQB 4JGJA 4LDLB 5HYJD 3HZYA 4Y4FA 1S7RB 2Z4QA 3Q6FA 3FT2A 5JHDE 2NX5D 5E6YA 4IJ3C 5JPMA 2Q76B 2D03H 3DGGA 4EBQH 2NYYD 4LRNL 2GITB 5JW5B 5EOQL 1KJVB 1MLCB 2DQTH 2XN9A 3UPRA 1BZ7A 3QDGB 4M03A 2FJFA 3V0AC 3S34L 2BNUB 3CFCH 1GZQA 4HUVA 3KS0H 2E5EA 3ARFC 4OD2B 1J86A 1MJJA 1T0PB 4XWOD 4X7TA 3MLRH 3CSYB 4BSWB 4YO0B 4I3SL 1FNGB 3NIDF 1C1EH 2YSSA 4Y5YC 1BFOB 2P46B 3MJ9A 1S7SB 5D7IE 5GGVH 3B2UC 5SX5K 4ZUSA 1K8DA 4CMMA 2YEZB 3L3IB 3T0WA 4HS8H 5DMGD 1Q9WB 2ZJSL 2BHYA 2DL2A 3C6LD 1CN4A 15C8L 1QFPA 1WIPA 2H9GA 4LPXA 1C5DB 4RX4D 4M61B 4YGVA 3WD5L 5TE6L 1IKNA 3VFWB 4KTEL 3NIGE 3P0YL 4OJFL 4BZYA 3D3VE 2O5ZL 3NTCL 3U0WH 3ORJA 3QISA 1YA5A 1T1YA 1LD9B 4OD3L 4OZHE 3T04D 3BN9D 5C86A 3D18B 3DO7B 3U83A 3H9HA 2VWEC 3MUY1 4HC1L 2AEQH 1TQCB 3PABB 2XQYG 3RWIB 2HYMA 3ILPB 4KK5C 1JMXA 1IEAB 2DL9A 4R90H 3TBTA 43C9B 3FMGL 4O00A 1MCQA 4BKLB 3G6AA 4HPYL 3O8XA 4N0RA 3CDGA 3O6KL 1I8MA 1KLUA 4LSPL 3QIWA 4PJDA 2AJVH 4IRJD 3EAKA 2VQTA 2P4AB 1A7RH 5F7DB 3MYJB 4GLRI 3EKCA 3M8OH 4XPTL 5IB5B 3QEQB 4OGAD 1QTYT 1QRND 4QOKA 4HUWA 4PJIF 4F37F 3QIBC 4OI8A 1FHGA 1R3JA 4LEXL 2VZVA 4OGXH 4NWUL 5T5NF 1QP1A 2B1HL 2DDQL 3DI3B 1E4KC 1FBIH 2NY1D 5I19L 1MHHA 1U3HB 2FECI 5CD5C 1MI5E 2FR4A 1YEFH 3VXMB 3D9AH 1CFVH 1CK0L 2AEPL 2HFGL 1YMMD 2RQ8A 3QHFL 4GXUM 2O5YL 3UO1H 5IJVB 4IRSB 4ZUUA 2CKNA 4QT5B 3TJHC 4F33A 3HI5L 1A3RL 3MNVB 2E9BA 5JHDD 1JV5A 3WUZA 1HIML 5FCSH 3QO0A 2QLVB 1OWWA 4P4KD 5KBNC 2BVOA 3ARGC 3ZE0F 4CDGC 3SQBA 1OAQH 2DQCH 5GGTL 1CFTB 2VXUL 4HJGA 2NXYD 5D7JA 3AFLA 2XKNB 4PGEA 4X7EC 2BSTA 4PRDA 2XPGB 4IBLT 2XQBL 4R3SA 1NGZB 1T1XA 1Q9LB 1JI1A 3ARDC 5EORL 4H8WL 5EZLA 3TT3L 4NQVB 2VDKH 4JFDB 4N5ED 4XNXL 5C07A 2EKJA 4S2SB 4MQ7B 3K2MC 2GJZA 4O9HH 1F8TH 1F11B 4QHNA 3BHBB 4GAGH 1YPZB 1AI1L 1RZ7H 1U8JA 3AXLB 3JTTB 3DROA 5LGJB 1LE9A 1DBBH 3C8DA 1J10A 5A2IH 4JFEE 4WUKL 5FKAB 2IALA 1Q1JH 1RZFL 3UDWA 4B0MM 2GSGA 3DJ9A 2IANB 3LQZB 5EOCJ 1TVBA 3ZDZE 3D3VD 1QG3A 3MRLB 3CFJB 3E3QE 3O11A 4ZO9A 3BI9X 4Y2DA 5IG7B 5HVHB 1G9ML 1DLFH 1V7NH 2OJEA 1AQKH 3H9ZA 3GHBH 5BOPA 5LBSH 1E27B 2AGJH 5HJ3A 5E2WH 4ZXBA 4M9PA 3QH3A 3O6FD 1INQA 2JB6B 2HA1A 2BJMH 3WJJC 1F2XK 2Y5EA 3ZKXC 1P2CA 5BRZA 2BVQB 4NQTA 4AQOA 2P42B 2GJ6B 4PUBL 2CXGA 5EG6C 2A6KA 4XNUL 1I8LC 5ALCL 5HGHB 2A83A 2YD3A 4XMKH 3REVA 4JLRB 4KRPC 3BPLC 4ZSOA 4M6OH 5E2TL 4QNPE 2VO5A 3EJZD 2X4PA 3GSNL 2O5XH 3M1BB 1ZLSH 3HE6D 5F7HA 4ISVA 3GSVA 5HHVH 1CFNA 1MI5D 4U2YA 5L8JB 1BQSA 3S35L 3MBXL 1R24B 2XICA 1BVLB 4KK9D 1ZVSB 5DWUH 4MA1C 4A6YL 4LVOC 1XZ0B 3VE0B 1KXTB 1JBJA 2DYPB 4DAGH 2AK1H 2H26B 3MACL 2C4FU 4M1DH 3SKOA 2FSEB 3RZWA 1Q94A 5DJDB 3MV11 3EO1B 4HXAH 3O3BB 4U1JA 4DN4H 4GS7B 3NFPB 1YDPB 1MSPA 3UYOD 5IBLC 3BP7B 1P7KA 2Z0BA 1FRGH 1MRCL 1HE7A 2YXFA 4FQXD 2N7BA 4XP5L 4TUJB 2E6QA 4OAWB 5T1LB 4L4TE 2ZG1A 3V5DA 3FQRA 5FGCE 3HS0B 3BPNB 1MAKA 5D93C 5DJ2B 5T3ZL 1XCTA 3KYMB 1UCBH 4HCRL 4X0KB 4ZFGH 1U8LA 3WDHA 3CX2A 5IM7B 3FCTB 5GIRA 1HI6A 4XNQB 4Z7VA 2DQUH 4WY7L 3L7FA 1R3HA 4R26H 4L4VB 1RULH 1OQXA 4I3RL 3N9GH 4Z78B 1YEGL 3B6SB 3QUZB 4KJWD 2MKLC 3BISA 1I4FA 1IBGH 3MGOA 1FVCA 4KROD 1AGBA 4Y16B 1PZ5B 3MRPB 1NEUA 4F3FB 1H9VA 4JFFA 4JFED 1FL3A 1HILA 3GBLA 2F53E 2DLGA 3SDAB 3VXUA 4X9IA 4AYFA 5IBUG 4AM0B 1AHWB 3TO4D 5DHVA 5L2KE 3HN3A 4QHUA 3PHOB 2VDRL 3QPXL 5F9WB 3T4YB 3TV3H 2WBJC 5DRNB 1J12A 2AQ3A 2HLAA 2NY4D 4JM4H 1WCQA 5D8JL 1NC2B 2CDGA 3BWAB 3IFLH 1LNUA 3Q1SH 2M1KA 3BDYH 2JJSC 4EXPX 2R1YB 3SCMA 3W11C 4HS6B 2PYEB 4UTBL 5J56B 3KPQB 4IIQA 1AH1A 1XR9A 5ILTL 4LCIL 3EYOA 4JFFE 3ZHKA 5ICYB 3VXUE 4OZFH 5D1ZD 3WS6C 1T3FA 3QQ9C 2EEBA 3TJEH 4Y2DD 4MXVE 1T7VA 2B8OT 1SMOA 2VLJE 4W6YB 2VTFA 4ODVL 5E1HB 2EH7L 1T83C 3MV7E 1BFTA 4YJZL 4DKEL 3VFPB 1WFUA 4KK6D 3S7GA 2RGSA 3ULVE 3M17A 1IGCL 5I15H 1UYWL 2HJFA 4QCIB 2D7TL 4FOMA 2J4WL 3ZSTA 1RUML 4MNGB 3L5XH 3SDDB 1JYNA 1DN2A 3IDIB 1OW0C 2R4RL 3QSKB 2OP4L 3VJ6A 3QUMA 3B9EA 2XZAL 3RVWC 3FONA 3P0VH 3BRFA 1U58B 2GYSA 5HVFB 3DXAE 4NKIH 1NGYB 2NY2B 2XTJE 3AS2A 1T5XA 5DS8B 5GGRA 1G6RB 2XNAA 4GRWE 1T1ZB 3U82B 4ZTPL 1JIBA 1RK1B 1MCLA 2ICEA 4Y5VC 3RY5A 4PRIB 4L4TD 1BM3L 2WP3O 5EN2A 1M05A 3CXHJ 3MV9A 5I1LB 1AGDA 35C8L 3TWCL 5IWLC 3P4NA 3QO1A 3OKDB 4EVNB 1Z6JT 4PJHA 2DLFH 1EAPB 2FX7L 3KYOB 1GSMA 3QUYB 5CMAB 2OBGA 2A0LD 4PRPD 4D0CA 3BGMB 4PTTB 4BUHA 4GKNA 5J4MA 1I8IA 1UWXK 5ESVA 2R2HA 2COQA 3BEVB 3B9KD 1CG9A 5EU5B 3O0RL 1YN7A 4XNYL 4DVRL 1F4XH 2DOCA 5KVEH 2D9QB 2J8OA 5HDBE 4JRXA 5F44A 2F53D 4HHAA 1FO0H 2XXCB 3MV9E 3X11B 2FHFA 1QBLH 3GSWB 3V95A 5L2KD 3IB4A 3KPOB 3MBEA 4UT7L 3VW3H 1T1WB 5I1AB 1KLGA 3DSFL 3I9GL 4X98B 5JZ7D 3T2NL 1XGQA 1J1PH 5F1OB 3BT2H 1OGTB 1Q0YL 2WIIA 1DN0A 4NHUB 4JFOB 5AZ2L 3IVKB 2AEWA 3KR3H 5B39G 3MRNA 2IADA 4HS3B 3UTTA 5BO1L 4K8RH 5C0GA 5DEGB 2ILLA 5FYJL 5CZVL 2HFFB 4JRXE 2Q8AL 2OXHA 4FG6D 2AV1B 4I0CC 4GRMB 3VXUD 2OSLB 3SDCA 3C5ZB 2VDQL 3DTXA 3AM8C 2X4TB 3BZ4B 5J6GA 4FQ2H 4LSSH 1AKJB 1ZANH 2X6MA 3BKYL 1DQQA 3H9SE 1PQZB 1HNGA 4NT6A 2VLJD 4NNYB 4RFEA 1K2DB 3C9NB 3HE7B 3MV7D 4DQOL 1PZUB 2E9IA 1X5HA 4L3EE 3CZFB 2WSKA 4FMFA 3EJYD 1XMWA 3ULVD 2A6JA 4K8RC 1FFPA 5E94B 4BZ1H 1I7UB 1Y6MR 5BQ7B 3OPZH 5ISZE 1CFQB 3UXFA 4XPGH 3BZDA 1CL7L 3DX7B 2KZ1B 3BDBA 3KPSA 4G8GA 4S1RH 5TDNB 2ZP0T 2R1XB 1SBBA 3DXAD 5TDOB 1KIUA 3BD4A 2JCCA 3BIBX 3PQYE 5ICZA 2XTJD 1X3DA 4NQEE 1WITA 4P46D 4J3XA 4I2XE 1SY6A 4CU6A 1KUMA 5KANG 3EHBD 4HFWA 1WT5A 2EDLA 5KS9A 5DJCB 1LK3H 4IHOB 5KSBE 1G1CA 4U7KA 4LVHB 4RRPG 2VABB 2QL1A 4NN6C 2H6PA 3P9LA 5I1KL 4G8GE 4NJ9H 1BLNB 2XWTB 5FB8A 5ANMA 4M48L 3BH9B 1X5XA 4OIIH 2ID5A 2YA2A 3G5XA 3ARZA 1CT8B 5KSVA 5DJ8A 1E6OL 1S7TB 3J7HA 3D0VB 5GSRB 2ZUQC 4XZUA 3BVNA 4CVXB 4MLIA 5J11B 1FQ9C 1QYGL 3V9FA 4EQ2A 3QPQC 4KPHH 1KTLA 1MWAL 2IBGA 1DFBH 3QXWA 5D72H 3MV9D 4X6FA 3O2WL 2WLYA 4NZRL 4IOIB 5CJ8A 3RRQA 5IQ7H 1YY9C 4M1GH 3QXAB 3HNVL 1ZHNB 5E7FA 1FNFA 3KPMA 4IDJH 2WP3T 2AJSL 1TJIH 3EOTH 5IHBA 3VD4A 2OZ4H 5T3XL 3QA3A 3B9AA 3GI9L 5MP6H 4R4NC 2UVFA 4QRUB 4JM2A 3L3JB 1MFBH 2UZXB 4P3CH 1M71A 1H3UA 4JRXD 5AZEL 2NXZD 5AD0B 4M4PA 1HWGB 4K2UL 1RZKC 4GW1B 5EOTB 4JO1L 1I8KA 1FJ1A 3CCHA 4JY4B 9CGTA 3T3MF 4JDVB 2CLZA 4U7MA 3MV8D 3H9SD 5FUZH 3MLXH 1H8SA 4KFZC 3GJFK 5GS0H 4MCZB 4YDIH 3UTSE 3KWWB 3MJGX 1I1FA 4V2BA 1UJ3A 4EQ3A 4KY1H 1BD2A 5GPRA 1ZAGA 2YMXL 2P45B 2RFXA 4Y1AB 1MFNA 4PJEA 4L3ED 5JNYA 1A4JA 1UQSB 4ODUB 3FB5B 5HDOA 1JGVH 1CF8L 3I50L 5ISZD 4LLYA 1EDQA 1N6UA 4EI5D 4MQSB 5DVLA 4IMLA 3ZYIA 3RBSA 3WLBB 4W4NA 3E6HB 1F4WL 1QBBA 5DDHB 1NMBH 3SDCD 1TQCC 3PWNA 3R06B 1MPAH 1FG9C 3O9WB 3PQYD 3ELAT 3V4VL 4EKXA 1MF2H 5C6TL 2MNUA 4PB0H 2BVEA 3HFML 4NQED 5JPNA 3TM6A 5CEYB 3RUGE 3PXHA 5D5MF 3LPFA 4H0GA 2VLRA 1DUYB 1E4JA 2JIXD 4AL8L 1FNSH 4TVPL 3LKPA 1K6QH 5ADOL 4PY8I 4Q97A 3RU8L 4HJJH 2VLKB 3FN3A 2A73B 3ESVF 2GK2A 1ACZA 2OTUB 3QZWA 1NCWH 4E0RB 4R9HA 5DT1H 4F37K 5C09B 2PW1B 2JB5H 3PHSA 4OZIB 3OR7B 1UH2A 3OAUL 1A9EA 2BP3A 3AGVA 3DBXA 1U3HC 2DTMH 2NY3B 3Q5YA 4L1HA 1F3DH 2ZWLT 4ZOBA 3RVXD 1WBZB 2CO6B 1OSZB 4A6YB 1C5CL 3MA7B 5D70H 3EW3B 3IDUA 1VFOA 3BE1H 4PLJC 4ZOEA 4BQ9A 3QDME 5B3JF 4IRSC 4RAUB 5KSAA 3W2DL 4J6RL 5A16A 1JPSL 2EXYC 4PBVC 4JR9L 1KEMH 5GJSL 7CGTA 5ECJE 1WTLA 3QBTB 2Y07L 4LSVL 3VH8G 3WXWH 3C08L 3EBAA 3RVTC 3NIFF 2NPLX 1SYSA 2E6JA 2UYLA 4J1UA 4ZUTA 3QXUA 5E2UH 3ES6B 4U1GB 3C5SA 2W9DL 4HWBL 5TQ2H 1MJ8H 4YPGB 1IAOB 2KUTA 3ARXA 1A6ZA 2IJ0C 2DD8H 3H2WA 2HN7B 5I16B 4HK3J 2E7MA 5JXEC 1H8NA 4S0TD 1SM3H 1SVCP 5DD3H 3O6LL 1CWVA 1XGTA 5GGRY 1JNHA 1JPTL 1TZHB 1FNEB 4HF5L 1IGYA 5E6ZA 4G9DB 1LE5B 1WWCA 3RIFF 1BECA 2AVGA 3GMMA 2X89A 1T89A 5I1IH 2DWDA 4YBQC 2Y6SC 1NMAL 5DSCB 3D85B 2VSCA 3UTSD 1RPQA 1R5IA 3BKJL 3ZT5A 3BP4B 4UV4H 3BP6B 5E99H 12E8L 1INEL 3Q3GA 5FHAH 4E41A 1OP5H 5GXBB 3UJTH 3QUKB 4XPHH 2Z93A 3GRWL 4LFHG 5I1GH 1VENA 1XGPB 2AJYL 4HZAA 3OB0K 3U7WL 3OKNA 3TYGL 3HG1B 8FABA 5CZXD 1ETZB 1FVDB 4WEBH 5HVHC 1WTGT 3BO8A 2L4OA 2VDML 4P59L 3HZKA 3A6CH 1P4BH 3K2UH 2WBJA 1U91B 1N64H 1A7BA 1G7LB 2GK0A 5HD8D 2ZG2A 3DYPA 4QWWD 3UTPE 2FLRT 2XA8L 1HQ4A 1HH6A 2WUBH 25C8L 3DMMD 1VFBA 3ZYZA 1MFCL 4NQCA 3EZ8A 4JQXA 5DZLA 4WWKD 1BAFL 4ZPTA 5IHZA 1OAXL 1P69B 5KN5B 5ID1A 3TNNA 4QEGA 1U8PA 1I3GH 5KTEL 2Z8WC 2Z91A 2ZCLL 3QEUA 3WS6A 4MJ5A 3ZZ1A 4PJCA 1SJXA 3LIZL 3GNMH 4GKSB 3GMNB 3ARBA 4X6EA 1RHFA 2R29H 5HHNA 3WSQH 5FDWA 4P5TB 1X5IA 1KTDB 3NCFB 4G6FD 4HKZA 4M5YH 2JELL 4HDIA 4N0CC 1INDH 1XF1A 3LKSB 4TUKL 2CKBA 5DC9B 2P44B 4KKAD 1PKQA 1RU9H 4NQCE 3ROOA 2AXGA 3C2AL 2DF3A 2BY3A 3QDMD 1HKLH 1Q9KA 3DX8B 4FQ1H 3BIAX 5FIEA 4B50A 4K94L 4OI7A 4GS7C 3JTSA 4PR5A 4OLEA 3X14B 4LCCB 4PJCE 3B2VH 5EU6B 1OAZL 5ACZA 5BJTB 4ONHA 1FN4A 3V8CA 4Q0XL 2HT2C 4NSKA 1U8IA 3LQAC 1AO7D 4P2YA 2MTPA 4ZNEA 2VAAB 3OQ3B 1E4WH 4PP2A 3BPNC 3WL9A 2DJ4A 3PWPE 3FOLA 3CJJA 1OQOA 3WKMH 3OXSB 1PKQE 3F12B 3MRQB 4XXCA 5IWLA 3GO1H 4YHZL 4YHNB 3L7EA 2WV3A 5JW4Q 2P8LB 3OMZA 3VFTB 3OKKB 5IIEA 1FPTL 3CLFH 4BZ2H 4JJ5B 4N8PA 4J8RB 5MEOB 3QUZC 4UIMA 1U95A 2D3VA 5I76B 2CXKA 5DGRA 3SPVA 5HGAB 1K8IA 1ZVHA 5I8OL 4Y16C 1MRFL 5IVZB 3EOYG 4F9PA 2DIAA 1FYTB 4Q6YA 3BRGC 4UU9A 5ICXB 1WK0A 1M7XA 3QIUA 4ELMA 4OM0L 1BX2A 5EWIL 4ZDHA 3SDAC 4BYHA 3MRDA 1JHTB 1OTSC 1LP9F 3HR5A 2UV3A 1VEMA 3N1QC 2A6DB 5JUEL 1AHWC 4NZUL 1WZKA 1NCDL 2CSPA 4GRLA 5F9WC 4FRWA 2QR0B 3IETA 2V2TA 4ZFZA 4OZGA 2PTTA 1MNUH 4Y19A 4OGYH 3JV5A 4UILH 5EUOF 4PG2C 4KVNL 1NBVL 2A9ML 5L9DL 4K3EL 4PRAB 2J8UE 2XFXB 3IDMA 5C0DA 3OJDA 3UTPD 4LASH 1XGYL 4WFHE 5MERA 2H3NB 5B4MD 1KIRB 3BZEA 4KTYA 4PYGA 2W0FA 4MD0B 4X4YA 1G7MA 1G9NL 3CVHH 5C7XL 1PKOA 1WIUA 2X10A 1JZ8A 4JZNB 1ZLVH 1CTNA 4OBRA 5EO1B 3OAYK 5EA0L 1P4LA 3OZ9H 3VXSE 2J5LB 2X41A 4R7DA 5EZJB 1TTFA 2EYTB 1XF3A 1U8NB 4G7YL 3WHXB 5H8DA 4KAQH 5K33A 1TTGA 3Q5TA 4QF1A 3VFGH 4J4PC 1LQSR 5D2LE 2IGFL 1QQDA 3UAJC 1A7QH 4HD9A 3MLUL 2CRZA 4QRSA 5KVGH 2J12B 4GG6E 1G6RH 1FNLA 4OF8A 3VWJD 1FDLH 2MPAL 3WNLA 3DX9A 1DL7H 2BDNH 3RQ3A 1H8OA 4L8SA 1KCUH 1UXWA 1YEHH 4UQ2B 1B9ZA 4F7EA 2VITA 4LBEA 5JOFB 1SEQL 4MZ2A 5DTFA 3SDDC 3QFJA 4H1LB 3B83A 4XH2B 5HHXH 4P2CG 2AJXL 5C0AE 3E6FB 1NCAH 4X4XB 3VFSB 2NY2C 4PJGA 4KKCD 5INCA 2ARWA 5IUSA 2BMKA 3F58H 2P48B 2V2XA 1AXSB 1HKFA 3SY0B 1R5WA 5FUCE 1YJDL 3MX0A 5KZCB 2WUCL 3V4UL 5HYSA 2AABL 5IOPA 3F8UB 2EDDA 4CL7A 3B8YA 5HTSA 4UT9L 1TZGH 3PWPD 4CUCA 3BN3B 4QHMA 3G9AB 3MRBA 4MJIB 2DQJL 2A1WH 3L6FB 4JPIA 1AGCA 1YNTA 3U4BL 1Z2KA 5E6IB 1VFAB 5FEBA 2QSCL 4HIIB 1L0YA 3HPLB 3WHE1 3STZA 3OJ2C 3RTQA 1G7PA 1MAMH 1XH3B 4KHXL 3GUTA 4MD5B 3QUYC 4NWTL 4XHQA 1M6OA 4YEFA 5CEZE 4LRNH 4PJXA 5J9PA 2G60H 7FABL 2NMSA 1CFSA 4F57H 3SDYH 1EO5A 1AD0B 4LLVB 3V8OA 1A14L 4C55A 1Y6NR 2O61A 1KJ2L 1JPGA 3VFUB 4N0UB 3KDMA 1KPUB 5JW4R 1A7OH 3HZVA 3OKMB 2RB8A 4YIQA 3G5VB 5IVXF 1MWAB 3TPUB 2Z8VC 4NO0B 1MCKA 4I3SH 3WLWC 4JFZL 4Z0XA 4PV8B 1MLCA 2D4DA 4OFDA 1U93B 4BH8B 1FFNA 1BMGA 3LEYL 4U6HA 4CDHA 2HT4D 4PY8J 4WFHD 4LLDB 3TH3T 2K7QA 3MC0A 15C8H 1N3NA 4ODHL 4YQXL 2MQCA 4LCWE 1D5XB 3IFOA 1WBXA 3MXVL 4JO2L 5TE6H 4N68A 4KTEH 1VEOA 3EZJB 2X4OB 1IKFL 2O5ZH 3CSYA 5EU4B 1EA9C 1JPFA 4JKPH 1S9KC 3C5ZC 2A9NH 3HUJE 4OD3H 3VXSD 3P3YA 4Z18A 4GRLD 1EX0A 4HC1H 1EHNA 4ZYKB 1NAML 1TZIA 3T65A 5TH2A 1MRDL 1HHHA 3Q0HA 3HE7C 5K9OA 3ZE2F 4MNHB 3FMGH 4LGRB 1J0HA 1UACH 2YK1H 3PP3K 5T1KD 3O6KH 5IW1B 4LSPH 4JKWA 3IJHB 2IPUK 5FYKH 4NHCL 2AJUL 4F9LC 5FGBA 3S6CA 1LD9A 3MLVL 5C0BB 4I5BA 4WIQA 4PJ8A 4XPTH 2VN4A 4PD4K 1P6AB 1FNHA 5C0AD 5C3LD 5C9JA 3BQUB 3KPPA 3WEXA 1JWUB 3N50A 1P7QB 4Y0GA 5T1MA 3REWB 1K4DB 3L95B 5DMJB 1YEEL 4I77L 1UB6A 4NWUH