3EYOB

Crystal structure of anti-human cytomegalovirus antibody 8f9
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
225
structure length
212
Chain Sequence
QVRLVESGGGVVQPGGSLRLSCEGSGFKFGDHGIHWVRQAPGEGLQWLTVISSDGTDERYTDSVKGRFTISRDNSKNTMSLQMNNLRPEDMGLYYCARDGKYSGLLDYWGQGTMVTVSSASFKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 8f9 Fab
publication title Germline V-genes sculpt the binding site of a family of antibodies neutralizing human cytomegalovirus.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 212
sequence length 225
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eyoB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eyoB01
2A6IB 1MCFA 3L7FB 3L3DA 4LCIL 2W9DL 2YD3A 1JPSH 5JMRA 2LVEA 4FTVD 3DRQB 3OR7A 4KTDL 1A6UL 1LK2B 4RQQA 5TE4H 4LNVA 4L8CA 4IOSD 1ZT1A 3GHEH 4IRJB 2MWCA 5TDNB 3QI9A 3MRJA 43CAA 5JHDB 4MYWB 4FQ1H 1KTKE 1NAMB 3TNMA 5DS8B 2ILLA 4Q9CA 1IJ9A 3VXPB 4F3FB 4YFLI 1EVTC 3TA3C 4DUVA 5T3XE 2Y06L 4HHAB 2ICWA 5ILTL 3HR5B 4NRZB 2PETA 4XNUH 5JZ7D 2VZVA 2IANE 1KGCD 3K8KA 1WT5A 3P11H 3LS5H 4W4OA 1GGCH 1JGUL 5GIRA 2WBJA 4Q2ZB 1MJJA 3LH2L 1A2YB 3SCMA 2FCBA 4NWUL 3C8KB 1G7IA 4BSVB 3MLYL 4LCYB 1JTPA 2MHAA 1U91B 2H1PL 3IDYB 1DDHA 4LKXA 4UT9L 1LNUB 1DN0A 4QGYA 3Q48A 1W2KT 4HH9A 3T8XA 5ESVA 2VKWA 5CBEA 3K4AA 1Q8MA 3GMLA 3VXSB 4OD2B 2BRRL 4ODSL 4K9EH 5D1QC 3ARXA 2Q8BH 2X10A 1CFNA 1QBLH 1XF1A 3HI5H 5JXAL 2XKUA 5DR5H 3P4NA 3H42L 1HHHA 1QFWM 5HGHB 4KMQA 1UQSB 2NXYC 4LRNL 3VH8A 3WIFA 5FOJA 2J2ZA 5DYOA 43C9A 4P9ML 4XWOD 1DN2A 3MA7A 1MHPL 1FO0A 4L8SC 1A9BB 2FGWH 4R0LA 4N0YH 3UTSE 1D5IH 2FO4A 4OCWL 2R69H 5GSRA 4DUXA 2QSCH 1U8PA 4F58L 1YN6B 4GRLA 2A6KB 2JJUA 5J1TC 4N8PA 4D8PA 2QJDA 4FXGA 3DROB 3UTTB 1MI5E 3V0VA 2R1WA 4IHOB 1E4JA 2GIYA 1D6EB 4JCMA 3EDDA 3BKML 3MYZA 2Y7QB 5J3HC 3GSOB 5GHWL 5FECB 5FHBH 4EI6B 1NGZB 5IROC 4M00A 3S34H 5TJWK 1QSEB 4CW1B 5FIEA 1TCRB 3HZYB 2VB5A 5DC0A 1QR4A 1UXWB 5IHZA 1AIFA 5J56B 3HFML 1MHHB 4IJ3C 4M1CC 1RJZA 1RUKH 5AYUL 1MFEL 4KQ4H 1K8IA 3ZKMC 1ACYH 1OT1A 4NQEA 1HHKB 1YJDC 4DGYL 3DVNA 2R0KL 1HIMH 4JO4H 4OM0H 15C8L 4HAGA 3QSKB 3WNOA 3MRDA 5E5RB 1REIA 4E41D 3BP5A 4JO3L 2CO6B 4YDJA 3FFDB 1UXSB 3GI8L 3IDJA 2BJML 1FZKB 1HNGA 3IF1A 3NA9L 3QQ3B 2P5WE 1CVSC 4M6ML 3ZLQC 3EJJX 2FJGA 4LBEA 1UCBL 3ULUL 3BAEH 3TM6A 5TDOB 1U9KA 2WWMD 3A6CL 4KRPC 3VXQB 1RUPH 4M9OA 3GKWL 2Q8AH 4HWBH 4JFQA 1EHLL 4ZO6A 1YMMB 2B20A 4EDWL 4OZFB 3TJEL 5HGDA 5F8RC 4FFYL 5K9KA 3ULVC 2JELL 1TLKA 1P6FA 3O2DL 1SM3H 4ZDHA 4DVRH 3T2NL 1F3JB 5E2UH 5BRZE 1N7MH 5H37H 4BQBA 3T4YA 3GSNB 3AU1A 5M94B 1XCQB 2FWOB 3MLSH 1F11A 1RZFH 1GGYA 4M61A 4XCNB 4R4ND 5I1CL 5EU5B 4HT1H 1QLFA 5DRWA 4CU8A 2OQJB 2GSGB 1JK8A 2WAHA 4HMDA 1HH9A 1YY9D 2QR0A 1H3UA 1KPRA 4LSRH 1N4XL 1SJEB 4QRRA 4ZO7A 4BUGA 3LRGA 2GJ6A 2ORBL 3WIIL 1EUTA 1Q9LA 2WQRA 3EFFA 4NZRL 3PL6B 2PO6C 2AEWA 4EJ1C 1F42A 1WLHA 4KTEH 5C6TL 4LAQH 5E8NB 3QIBD 3CNKA 5D2NA 5MEQA 3DXAE 1KPUB 4H88H 1MIEL 2J8UE 4HSQA 5HVWA 2IH1A 2VL5B 3GMPB 1B4RA 2VL4A 4PRHA 3DLQR 3VXUB 4AYFA 1F2QA 1CN4A 3IKCA 3SDAD 4NNPH 1HILB 1K4CB 3J8F7 4IRJC 2FBJH 4XBGB 5JPMB 4Y19D 3MRCA 3O4LE 3TN0B 4MLIA 5JHLL 4PRPD 2DMKA 1H8NA 1JUFA 4YDVA 3RA7L 1E4WH 4NFDA 4NQCD 3B8SA 4XXCC 3U48A 4LLWB 4ZQKB 1DQDH 4BFEA 4ELMB 4WGWB 1JYXA 3P77B 1KT2B 3QHFH 1A9EA 1TJHL 1MIML 4LPUA 5IVZA 3SO5A 3SE3A 4HV8A 4JFZH 1ACZA 3IFNL 3UO1L 2A9ML 3ZO0A 4F57H 3VD7A 5L2KE 4HD9A 4QF1A 2Q7YB 3BH8A 4L8DA 4KKLD 4L3CB 2CSPA 4P4KA 5A2LH 1GPOL 5SWZD 3RRQA 1IMHC 4JFFD 1JZ7A 4TUOA 3IDYC 5FUCC 4RFOH 4M62H 2DTML 3MROA 5C0AB 4DOHE 4IS6A 4JM2B 5DUBA 5AD0A 1T6VN 3G5YA 3PQYA 2P47B 3STZB 1FZOB 4XH2B 4PJCB 3DPBA 2R56H 2X2YA 4HWEH 3K7UA 1OF2A 2EDQA 3QDGD 3L3GA 5C0FA 2W38A 4YX2L 4LASH 1CDYA 3DX7A 1VGKA 2CDEB 3GNML 1B0GA 5GS0C 5GGTH 2HLAA 5JW3L 4P2QE 3MNVB 1MCPL 3NN8A 3IXTA 3QEGH 1P9MC 4Q6IA 5HDBE 3V6ZA 4CADB 2DB8A 1U58B 3JWDH 3RX8A 4Z7NF 3E6FA 5F9OH 2W65B 4HJ0C 5E8OA 4PY8I 2QADD 5CIPB 1U92A 4FQHA 2YZ1A 3FOMB 4G8EA 4N1HB 1DQMH 5DURB 1AY1L 2YRLA 5JOFA 2D3VA 3I50H 2DBLL 4LPXA 3MBXH 2HRLA 1YMHB 1WEJH 3TIDA 4L9LB 1CD8A 1T21A 3QO0A 2BVQB 3QEQA 3WXVL 2YPKB 3I6GB 4N0CC 1AO7D 5DD1H 1F02I 2LAAA 3A6BH 3BHBB 3LQZA 4WGVB 32C2A 1INEH 1YQVL 4JM4H 3JTSA 4U3XA 3IGAA 4JFXB 1D9KA 4PYHA 4XX1E 2PXYB 3TBSB 3F12A 1IC7H 3UZEA 2B8OT 2ZNWA 3QUMA 1L6XA 4MS8C 1U8KA 4DUWA 5HGGS 1MEXH 1BQUA 1SEBA 4HZLB 3OPZL 3T4AA 1TTGA 4R7NA 4X8JA 1MLCA 1AJ7H 2NY4D 5DK2A 1X5IA 3QIUB 3GO1H 5SWSB 3PF2A 3RWEA 3FO1A 4Y1AD 3T3ME 3U7WL 3MLUH 1IAII 3ARGD 2YA0A 5CJ8A 5HHOE 4ZSOB 1LO2L 1RHFA 2XFXA 4V2CB 2YMXH 5F1IA 1EHNA 2AP2A 4LCCA 5D1ZA 2WINA 2EE2A 3UX9B 2HFGL 4X9IA 5JO5A 4ORZC 4NO0A 1FYTE 2NZ9C 1KTLB 3LN4A 4NZTH 4JB9H 3QDJE 1OW0C 3MRIB 5IMKB 3O0RL 4XHJC 3C5JA 3BKJL 5HDBF 4FFZL 3IKKA 4R8WH 4WRLA 1HCFX 4XMKL 1T0NA 3SQBA 4AIZB 3X13B 4O51B 2XQYG 4I5BB 5DK0A 3MLRL 3F7QA 3MRQB 4OLWL 1LO0H 4W70A 1E6OH 3HLAA 2B39A 4QEGA 2Z4QA 3QUKB 3MRLB 4AL8L 3ROLB 4Y16B 3S35L 3WE6B 1MCWM 3IU3A 4FS0A 2R8SL 4HMCA 3ZTNL 4WTZG 1KIPB 3FJTA 2GKIA 3U4EA 4WNQB 3QNXA 3B4NA 1NFDE 5C7XH 4XZUB 4FN0A 3DSFL 2R4SH 4RAVB 4X9GA 1AXTH 1QLEL 2XQBL 4YE4H 1R5VB 1UKTA 4TOYL 5FCUL 1T1WA 2GQHA 1D5ZB 1FO0H 2ZG1A 2HT3C 4RMTA 4NQSB 2ITCB 1CT8B 3CX5K 4C54A 1JWSA 1DEEB 4W68A 3O45A 5EC2B 2PN5A 1OTUD 3QEHB 1VEPA 4UU9B 1JWMB 3SE4C 3PL6C 4JG1H 4OLVL 3MV7A 2XY1A 1BQHG 5MENB 1J0HA 3U4BH 3MC0A 3VXOA 4Z78B 4M6AA 5HYSA 2F19H 3T0EA 2DQUH 3SE8L 1YN7B 3F7RA 4O2EA 1AKJA 1T5XB 1FG9C 3REWA 2G60H 3KPSA 3T3MF 3U7YH 4UQ2B 3TN0C 1CVRA 3ROOB 2Q86A 3SKUD 4BFGA 3UTPD 1ZHLB 4OCYH 4WUUD 5FGCB 5F97E 3KNBB 3MMEA 1CICC 4QT5A 4KJPD 1LGVA 2I9TA 4AJ0A 5HY9A 1KC5L 5C0CE 5FHAL 2NY1C 4FHBD 3MRFA 1A6WL 1TJIL 1NFIA 2WANA 3G6JA 4JEGB 3VFNB 4BH8A 3WNKA 2ZZUT 5DUPH 3U7AA 5CP7B 5ACZA 1KTDB 4LLMA 1KCUL 2X09A 4AENB 3EOAA 1FORH 2ZKHH 4OLXH 1HDMA 2ESVA 2HRPH 3BQUD 5EBWB 3FKUS 1K4DA 1G9ML 1PGRB 4LEOA 4J3XA 4PJIB 2AJXL 4Q0XL 5JIHA 4ONHA 4NGHH 5E8PA 1G6RL 1MQ8A 3RNKA 1X5KA 1CDUA 2IANB 3L5XL 4RZCA 4Y2DB 4GXVH 1R0AH 4MD5B 5EZLB 1VGEL 2GTZB 3M17A 3NFNB 3QWOA 1UACL 3N1QC 1FHGA 1E6JH 2BSTA 1BQLH 3LEYH 3OKEB 1ZTXL 3BP4A 4JM2C 4ZUVA 3HMWH 2R29H 1HQRA 1EIBA 1K8DA 3IFOB 5CKGA 5F7MC 3DUUA 1VESA 4P5TD 3X14B 4YHNA 1OSPL 1IGCL 4JVPA 3OQ3B 1JF5A 4HXAH 1A4KB 2FEEL 1OHQA 5LGJA 4ODWA 4NCC2 1JF1B 3D87B 1VHPA 3Q1SL 5EBGA 3QCUH 3DBXA 3SDDD 4RX4A 2OR9H 3MRPB 4L3AA 3SKOB 3BO8B 1GGTA 2DWDA 4APQA 3IJSA 2C1PA 5C92A 2BY3A 5F3HA 2UWEF 1ZLVK 3BP6B 2ADIB 4M8QB 4ODTL 2VLRE 3G04B 2PUQT 1NANI 1S9XA 1CQYA 1MLBA 1WSST 1CGXA 3IDXH 3AXLB 4G6FB 3U0TA 4L9LC 1CD9B 4WFHD 3UTSB 1NCCL 2UYLB 2V7HB 1NDGB 2HFFA 3GSVA 4NM8H 3UROR 3MUJA 4JR9H 3NFPB 1ZMYA 1AP2B 1YNTB 4GKZB 4R3SA 4UOW0 1OAQH 4OZHF 1MI5B 4YHLH 1IBGL 1NAML 1IGYB 1P7QB 3IDUA 5KJRH 3IVKA 2J4WH 4Z0XB 5T5FL 5F6HI 1BOGA 3OV6A 5ADOH 3WFDL 5KAQG 3OKKB 4PV8B 5D6CB 5EOTA 5LKNA 3B9KB 5TH2B 4GMSL 4NRYA 2D7NA 2XRAL 3DI2B 1G9EA 3CH1B 4IOFC 4ZUUA 4N1CA 1IL1A 3QIUC 1OGAD 4D0DB 1Z3GL 3ZE1E 4RIRB 4ZTPH 1ZHBB 1X5GA 2VDQH 2EC9T 1ZANH 3K1DA 2NYYD 3T77B 4HCRA 4NO2B 4Q74A 2QV2A 3U9PH 4KXZI 4AIXA 1Q1JL 4BKLA 5KS9B 1P4LB 3MO1A 1UA6H 4G9DA 1E27A 1RUMH 4OKVB 3ZKQD 2GJJA 3ZE0E 4OIIL 1J1PL 4HLJA 4XC1H 3WFZA 5EOQL 4PJHA 3WN5B 4KRNA 5GZNC 4PJDF 1OAUL 2VZTA 3BPNB 1JV5A 4UTBH 2QQQA 5FA4A 2XTJD 3P30H 2P5WB 2FIKA 5T33H 1CDJA 2GT9A 3N0PB 4KHTH 3RKDD 1WZKA 1GZQB 2BHZA 3ULSA 4NYLB 1ZT7A 3DX8A 3EDJA 2Z92A 4Z7QF 2VLME 3SOBH 2APVA 5DQDL 4KKAC 2JLLA 4G9FD 1J8HE 3WHXB 3DVGB 4HUWA 5I15H 5I17B 4TSCH 1J0IA 2F8XC 4EN3A 4N8CL 4GW1A 4AM0B 4QOKD 4U33A 1M7XA 1U8JA 3QI9D 1HN1A 2XZQH 4D0BB 2YPLD 1CFVH 1Q9OA 2GY7B 3V5HA 3K4ZA 1DQLL 4RBPH 3OL2A 2VITB 3ZKND 3L3KB 4FQ2L 1SEQH 5IT2L 1ITCA 4FQXD 4JKMA 1Z0NA 1ZXQA 5FO8A 1YDPB 2EDFA 4CUCA 3PGFL 4OF5A 5KG9A 2AKRA 2IBZX 1RPQA 5DI8A 2AXJA 5FUOH 2GFBB 1LEGA 3BZFA 5E5MB 3MCKA 4XVUD 1M6OA 3PV6A 4ELKA 3ARFA 2X4UA 2J8UB 3ZE1F 1KLGA 2WBJD 5I0ZA 25C8H 2Y6SC 3HN3A 4M43L 3NIGE 1SHMA 2VLKB 3WEXA 4LCWB 5FKPA 4M6NH 2BDNH 1I3RA 2BHYA 1KIRB 2ZUXA 4J4PA 3GMQB 3MA9L 5F1OB 3K1KC 3O4LB 1D6VH 3MUGB 1MJ7H 4XBEL 3SKMA 5GS2H 4YHPA 5DHYA 3RX5A 5IHLB 5EUKA 3EFDH 5AEAA 1I1YB 1PAMA 5C2UB 3S4SG 1BFSA 5T3ZL 1A4JB 1PBYA 3OF6D 5DJCA 4M6OH 3FOLB 1DLFH 2KBGA 1S8DB 4YFDB 5C0DA 4B7LA 4YPGB 2FL5A 1Q72H 1EJOH 3RGVD 3IU4L 4Y2DC 3OAZK 4TVPL 4X6EB 3SGEI 1HEZA 4JPWH 2XPGB 1AQKH 4ZD3H 1X9QA 5L2KB 1JTOA 4JQVA 5GRUL 3M1BA 3O4OB 4RISL 2O61A 3K2UH 3P0VL 5E94A 2EZ0D 1PQZB 3LAFA 4HQQH 2GY5A 3FT2A 4JKWA 4U6VL 3QNYB 4U1LB 3IRPX 4X4ME 4GG8A 5DJZB 4LLQA 1J18A 1GAFH 2Z8WC 3HZKB 4JGJA 3FMGL 3TVMA 5DRZA 3ARBA 1JE6A 5MERA 5B22A 8FABA 1KBGL 4POYA 3B9EA 2G5BA 4OFYA 4Q9RL 2ICES 3TV3H 4R4FH 5IMOA 4OAWB 2XWJA 4Z5RA 4JN1H 3X12B 3CVHL 3NIFE 4P2QB 1S9YA 1BM3L 5B4MC 5J6HA 3H8NA 4S1RH 5HYIA 1EA9C 2M2DA 3SO3B 2DM7A 1A6PA 4XPFH 1BQSA 4BQ6A 3MREB 3QUYD 3NCYP 3VRLE 3AMKA 3H9ZA 1F6AB 3B2VH 1V7NH 2ID5A 4DZBB 4NM4H 3MODL 1TJGL 4ONGL 4X98B 1ZS8A 1C1EL 5BS0D 4XP6H 2OCFD 2QQKH 5GRZA 1LE9A 1T89A 4D9QD 3WIHA 5IV2B 1NCUA 4GKNA 4XPHH 4LLYA 2Y07H 3RJDA 1A14L 1TVBB 3ZL4L 3CU7A 4JFHD 3MJGX 4MNQA 4ZUTB 1CK0L 3H9HA 5C2BH 5FM4A 3O6FA 1TMCB 3IS0X 4Y4HB 3B9KC 5I1DB 5ID0B 5L7XL 1PYWA 4ZFOB 1CU4L 3LRSA 5ADPL 4NOFA 1EHXA 3MR9A 5H35B 1IGJA 4V1DA 3ARVA 2DQEL 4GQ9L 5FO7A 2Z0BA 4B50A 5GISH 4X6DA 5J1AA 3ZDZE 4OSUH 4PLKD 5ALBL 1PKOA 1FFQA 5GJTL 4YWGH 5TGBB 2X89A 3UZQA 2M1KA 1DZBA 5HYQB 1V5JA 2CKBL 4HS6B 3MGOA 3TZVA 3ZKSD 2F8OA 4AEHL 3UJJL 2GSIA 5HHOB 3GSUA 1FRGH 2NR6C 1KF9B 1YEIL 1IGIH 2FHBA 4ALAH 1UWEH 2X5PA 1NAKL 1EO8L 3WN5C 4LHUD 1UH3A 5DDHA 5FYLL 3BPNC 2ZSVB 3BDXA 3PNWA 5C8JA 3RY6C 3M45A 4FABL 1OAYH 4NHUA 3PHSA 2EKSA 2YSSB 3QDJB 2WLYA 2DS4A 3MGTA 1IILE 1RHHA 3S4SB 4Z76B 3HE6A 1MCHA 5DJ8B 4OTXL 5IWLC 5HHMD 1LWRA 1PKQA 1G7JA 4OZGA 4JJ5B 4FQCL 4KV5E 5IG7A 2GK0B 3VGBA 1A7RL 3GSQA 1LDPH 3JVGA 3BKCH 5I1LA 5D7LD 5I8CB 1M7DA 4NNYB 1Q38A 2VNCA 3W11C 4UNVA 3ARQA 4OUUB 4YXLH 3MNWB 3N9GL 1CF8H 2ZCLH 1J05A 1RIUH 1N2RB 3WHE1 1R3KA 2DQTL 3CLFH 5ISZD 4GKSB 5DSCB 3PP4H 3FO2B 1NFDB 4UUJB 5IW3A 2O5XL 2JIXA 2YUZA 1P7HL 2EH8H 4NO5B 1NGQL 2IFFL 3ARUA 5BZDB 2ZSWB 4JG0L 1NMBL 1I8KB 4ZXBA 4X7TA 5DHVA 1FGVL 1CLZH 1R24A 3BXNB 5E2JA 4BZ2L 3IB4A 4QXUH 2EE3A 4OFPA 2VR4A 1DUYA 4KH2A 4UINH 4B7IA 3MRKB 1P84J 1RZIB 2O26U 5CSBA 1RIVH 5D70H 5HHVH 2OJZL 2V7NA 4U6YB 5F88A 1FBIL 1CTNA 2NTFB 2IQ9L 5I1HH 4KK8D 3OZ9H 5D72L 1FFNA 3VU2A 3V52L 4G80B 1T1YB 5IKCA 4ZO9A 2IADB 1NKRA 1SYVB 4GBXD 4G7YH 3SE9L 2IWGA 1H5BA 4FQQB 5DJ0B 5F1KC 1S3KH 5HYJD 1J10A 1BZ9A 1URLA 4F9PA 4CNIA 1XGQA 4XNMA 4MA3A 4XNQB 2NQCA 4PGDA 4FFWC 5KOVC 2OTUB 3U6RA 5EFIB 5C3LD 1GOGA 5FXCH 2AXFB 1JHKL 3RVVC 1T20B 4HCRH 4JFPA 3U83A 2W9EL 3QG6A 2BX5A 5IIEA 5DFWH 4XVTH 1KLUA 2X4SA 1ES0A 3HUJE 1KYOJ 4HKZA 4KPHH 4MZ3A 1L7TH 2HLFC 4Y5VA 3F5WB 3OKYA 5D7IA 3QA3B 2DJ4A 3O4OC 3S88L 1RFDH 2ZUVA 3IDIA 4KV5F 4WY7H 5D7KD 2VXVL 3MOBH 3C87A 3DMMC 1XF3B 4KVCH 4J3OC 5M7QA 4PR5A 2Y4SA 4QO1A 3DVIA 4Z95H 4L3EE 3T2PA 4OCRL 4K9EC 4A2MA 1XF5B 4GAJH 5SX5H 4F8QA 5D93B 1ZEAH 1JGLL 3VWKB 4PJ8B 1FLRL 4LKCB 4X4YB 3FQTB 2CGRL 2WLZA 4EUPA 4RGNB 5IEKB 1WCBB 5L9DL 1L7IL 3MRNB 4HUUB 2GTWB 4ZUSB 1BLNA 4FXKA 4XXDA 5L6YH 5I8EB 5CZVL 1FGNH 1P2CB 3BDYH 4L4JA 3KPLB 4PRDA 1EX0A 1A3RL 4AEIL 3V4VL 4MJ6A 3WKMH 3SO3C 2HG5B 3RVXC 3MOQA 4I0PD 3SDXF 5HDOA 4RA3A 1RZGB 3NCFB 5I1GH 2CK2A 1IC4H 5KN5A 5KSAD 2DKMA 5FYKD 2VLRB 1JWUA 2X4RB 2DYPD 1HHIA 3HC4H 3FQXB 1PZ5A 3PWNA 5FF6A 4AT6B 3BUTA 3T0EE 4EBQL 2YKLH 1QACA 2CDGA 4W6XB 2EDRA 3ZYJA 2B4CL 5DJXB 1UYWL 4NPYA 3ILQD 1UJ3A 4PJ5D 5CCKL 3V5DA 1ZWIA 1QFHA 4K8RD 35C8H 3OR7B 1U8NA 4RQQB 2GCYA 4L8CB 2V5TA 1ZT1B 2A83A 5DC9B 1PW3A 3KR3L 4YJZL 5DMGC 3MRJB 43CAB 2P7TA 3S96A 4Y4KD 4EQ3A 1JZ5A 1EXUA 4XCCL 2VDPL 4X6FA 4J23A 4E41E 4U3HA 3VRIA 3SDCD 4JE4B 2X1PA 4S1SL 2ICWB 1IAIM 3PWPA 1MAJA 3HUJF 4LHJB 1MNUH 3D39D 4F9LC 1QNZL 3PJSA 5E9DA 1CR9H 1T3FB 3L5HA 4OQTA 2ERJB 4ZS7L 2VIRB 1DE4A 4M7KH 3NACH 3THML 2IPUK 2BVEA 3GMOB 5DMKB 5GGUA 3LSOA 2Z35A 3ME0A 5GIRB 1MJJB 3SCMB 5I16A 1G7IB 1RK1A 2YC1A 1JN6B 2MHAB 3S5LA 1KCRH 2R0WH 4LHUG 4LKXB 5KSVB 3EJZC 3VFRA 4KDTA 1DN0B 1FV1B 3WJJA 3T8XB 2A1WL 3ILPA 5ESVB 3L1OL 3K80A 3GMLB 3NH7L 3CCHA 2CUIA 3LEVL 3LKPB 4PGBA 3BWAA 5IB5B 2N7BA 1X5YA 5IK3A 4PRIA 1TNNA 3O3AA 4NBYB 1OTTC 2QQNH 1NGXA 4FG6C 1B4JL 4YDLB 5ICXA 4GW5A 1BP3B 1HHHB 3MV7D 1RI8A 4PB9H 5FUZH 4MA8L 4ISVB 1N0LA 2CH8A 3C60D 3DIFA 3HCVB 3VH8B 3WIFB 1RAMA 3HB3C 2E8ZA 43C9B 4NUJA 4ONFL 4X5XA 3W81A 2AJSH 4UT6H 4CVZA 3UXFA 1GHFL 4HIIA 3QCTL 4PGCB 3D2UB 4Z7WA 2QHRH 4Q9QL 4YGVA 3GJFK 5MHSE 2NLJA 1FZJA 3CPLB 2FO4B 1QFWH 4OUOA 5GSRB 1LK3L 1U8PB 3HNVH 4GRLB 4M1GL 1O5DT 3LKOA 3SDYL 4D8PB 3LKRB 5C09D 3UYOD 5CGMA 4H8WH 2R1WB 2ICWJ 2NXZB 4PRPE 3UTOA 5IB2A 3WIHH 1FNGB 5D71L 1F4WH 3H2WA 1RZJC 1HZHH 2EXWC 4NQCE 4J3UA 3VXNA 4ENED 5DMIL 5F7LB 5JR1L 4C56A 4JQIH 4OLZH 4XP1L 2NZIA 4QGTA 4YDKL 3EBAA 1ZLUH 5IHZB 1NSNH 1AIFB 4TRPH 4O58H 5I18H 4YHYB 4LQFL 5JW5A 5F7DB 4I3RH 5DEGB 2BNQD 2FJFA 1K8IB 3QFDA 4G8IA 4I18A 3BPOB 5EZIL 5FM5M 5F7WC 3FZUD 5GGVH 1YECH 4P23B 1UZ6E 4NQEB 2VE6A 5A16A 5J1SC 3DVNB 4JFFE 4M9PA 1S78D 4KVNL 5I1AA 1EGJL 2IPKB 4TTGA 4WUKH 2FX9H 3MRDB 1LQSR 1UWGL 3BP5B 3TLRA 5CINL 4YDJB 4BSWA 5J9PA 3O2WH 5SWQA 3OAUH 3IDJB 4XP5H 3BEWB 1AE6H 2KUTA 3IF1B 4G6AD 5IGXH 4MB3A 1NLDL 4WW2A 3UDWC 3ARDD 2OP4H 2FJGB 4LGPB 4LBEB 5C0IB 4Y4FB 5TQ2L 1AGCA 1A7NL 5J4MA 1IEBB 4CN4A 3HR6A 4G6KL 3UTZB 4E9LA 1NC2D 5ECJE 2YRPA 2AABH 2QSVA 5D93C 3RWFA 3PWUA 3QB7C 3VWKC 1O0VA 1YPZF 5HGDB 3S9DB 2NY3D 4CU7A 2EDEA 1DVFA 5K9KB 1TTFA 4FNLH 1UG9A 3JWDC 3V79C 1QSFA 1WWBX 5ITFA 2PW1A 3EOYG 3STLB 4OF7A 1JHLH 12E8L 3HMXL 3AU1B 3UPRA 4M61B 1F11B 4EOWH 3O3DA 5GRVL 1QLFB 1T7VA 3IAGC 3DJ9A 2YD1A 1FPTL 1HH9B 4JFED 4TPRL 5HDLA 2VKXA 1MFAL 1KPRB 3CMOH 1R3HA 4X80H 1PX3A 2GJ6B 3FTGA 2M26A 1JPSL 1Q9LB 4XGZA 3EFFB 3LIZH 2O5ZH 5B39B 2EDYA 3UJIH 5TE4L 3VFSB 4PB0H 5D2NB 1WWAX 5E6YA 4KK6C 1U8OA 5DFVD 4HLZH 3C2AH 3C6LC 3FFCD 3OSKA 2IH1B 3EDFA 4WJ5B 4PRHB 5ACMA 5C9KA 3IKCB 1YZZA 2F58L 3N50A 1A7PL 2AK4D 3CFBA 4PV9A 5K33A 4EI5D 5KSBF 5GSVA 3MRCB 5CEZD 4MNGA 4Y1AE 2WP3O 3SGDI 4K2UH 4MJID 5E8EB 4XNUL 5KZCD 3MCLL 3DYPA 1QR1A 4YDVB 1F2XK 3VGHA 3K8LA 1JCKA 4K3GA 4N0RA 3PDOA 4GFTB 3KYKH 5F72S 1JMXA 2EE6A 1S7WA 4Z7VA 3VD9A 1A9EB 5IVZB 3QIWD 4G43A 4BQCA 2DQGH 4HV8B 5JDJA 1CBVH 1WT5C 3T0XA 1WQVT 4WO4D 4W4OC 4OZ4B 4QF1B 5DT1H 1HYRC 3BH8B 4L8DB 2VLLA 3UJTH 5CJXC 4P4KB 3SCMC 3EO0B 3RZCD 3FQWB 1TQCB 5JOEA 3DOSA 3UAJD 4LSVH 1C5CH 3MZGB 4TUOB 2ADJA 2UZIH 2SEBA 5L0QB 3MROB 1ND0A 2WUCH 4IS6B 1MPAL 3EJYC 3MRHB 3G5YB 1X44A 3PQYB 4UB0H 5DUBB 3ZDYE 5AD0B 4CKVX 3L6FB 3ISWA 1OF2B 3L3HB 1CE1H 5C0FB 2D4FA 4NQDD 4QRPE 3RWGB 1T7WA 1VGKB 2QBWA 3Q5TA 2BC4A 4YDLC 4LSDA 3RHWF 5HHQA 2ADGB 3IXTB 3VXRD 3PWJB 3P4MA 3QFJA 4L8SA 2H9GA 5DGQA 3TBVA 4EUPH 1LDSA 4CDGC 3SQOL 3V6ZB 1F97A 4LSUH 4PYGA 3W2DL 3E6FB 4UTAL 1D5IL 1ETZA 1OTSD 5AG8A 5KAQF 3V4PH 2QSCL 2ZOLB 4FQHB 4G8EB 2R15A 4FQIH 5JOFB 4MQ7A 2ARJA 1QSVA 2YBRB 1CXHA 1PVHA 3HAEA 4ZFGH 3G6AA 1QOKA 4JRYA 3MFFB 5IROA 3TIDB 2AJUL 2BP3A 5FHBL 1T21B 1MREH 4GRLC 5HYFA 1BEYL 3S34L 2X4OB 3MX0A 4MNQE 1HKFA 1MFDH 3PGCA 1EMTH 1T6WA 4WUUE 4UIMB 1BWWA 3VWJC 2NXZC 4Q6YA 3HG1D 3I02B 2GITA 3JTSB 3UBXA 3UP1A 3IGAB 5DQ9A 5J7CC 1D9KB 1OWWA 1TETH 2V2WA 4JO2L 3O11A 3F12B 4C83A 4G6MH 4BFBD 2EYTA 5FOBB 1SMAA 4PY7A 2R2BA 4V1DE 1CLOH 5TF1H 1CE6A 1MCNA 4U2ZA 4YHYC 4X8JB 1MLCB 2AI0H 4NZJA 2H3NB 4D2NA 1HIML 1XGYL 4OM0L 1NCDH 1P69B 1S7SA 3BPOC 5ITBH 3JBG7 2VQTA 4P23C 5I0DA 3BIAX 3RWEB 1U8HB 2CRMA 2MCPH 1FJ1B 3P2TA 2PYED 2XXMB 3BN9D 3CDYA 4R4BA 5GGQL 4GW4B 3ZDYF 3RPIA 2NNAA 1I8MA 5F1IB 5B38A 3K0WA 3BAEL 1F8TH 2WINB 1P84K 5FYJH 5EO1A 5DTFA 3BZ4A 3V9FA 3HZMA 1RUPL 3BRGC 5JO5B 2Q8AL 3S36H 2JKXA 4NO0B 3G5VA 3KXFA 1CWVA 3C5JB 1UM4H 2VISB 2OR7A 3HUJB 4Y4FC 3WHE0 5B3JF 3ZYIA 1MWAH 1T0NB 4DEPB 5IHUH 5DJYA 3MUY1 1PKQE 5IP4A 5DK0B 5E2UL 1X5ZA 2YXFA 3GBMH 3QXDB 3HLAB 4UIKH 4L3EB 3MLPA 4HUNB 2Z31A 2Z4QB 1PG7H 1RZFL 3TT1L 2JCCA 3NOIA 4M5ZH 1JTTA 3K46A 4HT1L 4UT7H 4KZEH 3IU3B 4WU7A 3LQAC 3Q5YA 4QHKI 1KXQE 4ERSH 4LVOB 1B6UA 3HNSL 4DFHA 3QQ9D 1RURL 5C0JA 5D7JD 5DZLA 4I2XA 1EEQA 4WFHE 5CJOH 2D0GA 4PJGE 3O6FD 2KQMA 4JZNB 1R3JA 1Y6KR 5L8LB 1KYOK 1T1WB 4LLAA 5E6ID 4BUHA 4KTEL 2A6IA 3L7FA 4LAJH 1H3WM 2J6EH 3OKLA 5KVDL 4ZPVA 5TFSH 1VDGA 3O6MH 1GC1C 4G5ZH 3IT8D 1JWSB 4MAYD 3O45B 3VFGL 4BELD 1LK2A 4L4VD 4IRJA 1G7QA 2FBOJ 5TDNA 3RUGF 3D85A 4NNPL 1K6QL 3TF7C 4N1EA 2VH5H 6CGTA 1Z5LB 4WI9A 2OZ4A 2N56A 3VXOB 1TCMA 2G2RA 5D2LA 1Y6MR 1CYGA 2RJMA 3FHQA 5HYSB 4D9LH 3T0EB 2C7UA 1S7XA 3BT2H 4O2EB 3MGAA 3BN3B 5KVFH 4S1QH 1OGAE 4HHAA 4NC1E 1AKJB 1HHJA 1QHPA 1E4WL 3HR5A 1WIOA 5KVMC 3OWEA 3MACH 2Q86B 1EBAA 1K5NA 1QQDA 1R5IA 5TDPA 1X6LA 3QHFL 5IVXA 1ZVSA 3L3IB 3MMEB 4QT5B 3CH8A 1EH9A 3AY4C 2I9TB 1LD9A 5HY9B 2V9QA 4LP5A 1L6ZA 1NLBL 2L4OA 4Q2ZA 4WHYH 4F57L 5BMFL 3MRFB 1NFIB 4ETQB 4LCYA 1X4YA 5C6WH 1JYNA 1ORQA 2UZXB 1LNUA 2ESVB 4DGVH 4MX7A 3RVUD 4LEOB 5ACLA 4ONHB 5E8PB 3RNKB 3WLWD 4RZCB 3X3FH 4P4KC 4Z7UE 3M17B 4I3SL 3QWOB 1TQCC 4D9RD 5EN2A 5TE7H 3T0WA 3VW3L 1W72L 2EXYC 5L0QC 4LASL 1F6LL 3QCVH 3BP4B 2HT2D 5HGHA 4Z8FH 1CFTA 5GGTL 5DK3A 3O9WD 3KS0H 5F7YC 5C08D 4BZ1L 3Q0HA 1K8DB 3T65A 4DN4L 1GSMA 4YHNB 3RNQA 4QOKE 2VLJA 1X4XA 5CD5C 5CMAB 4PJGF 3Q3GA 1OWRM 2R23B 4PJ7F 5D8JL 4M5YH 5LGJB 1AGBA 1QKZH 4DTGL 4PJAE 3W0WD 3IJHB 4OGXL 4CJ0A 3O6LL 2DWDB 2C9AA 3SY0A 4KHXH 4FP8H 2P44B 3JV4A 1WEJL 2Z8VC 3QQ4A 4PBXA 4U0QB 1S9XB 4Y7MA 2V9RA 1MLBB 5BVJB 1OOAA 2Y7QA 3GSOA 5FECA 3CSGA 1FNEB 3T09A 5C0RH 1INEL 3U0TB 1QSEA 4CW1A 3ETBF 1TCRA 3BI9X 4JHBA 5GGVY 1NUGA 1IC7L 3HE7A 3GSVB 2DD8L 4HFUL 1IRAY 1RJLB 1UXWA 4R3SB 3EOBB 1MEXL 3QPQD 3BMWA 1WAAF 1D9KC 1SJVA 2RR3A 2DRUA 1WZ1H 3IVKB 1AJ7L 1A1NA 4OLYL 1BOGB 1WBZB 5FGSA 1HHKA 2H2PD 2JB5H 4PLNC 1VCAA 4NQCB 5EOTB 1YEGL 1ZAGA 3SGKC 3D3VA 2IF7A 2DQFA 3FFDA 1IL1B 4Z7UF 2VDNH 2DQCH 2ED7A 1FZKA 1JGEA 5FYJE 2I60L 1I85A 3QQ3A 2D03H 1YEDB 2HWZH 2CUHA 3JWOH 4M7JH 4WFGD 4JB9L 5TDOA 2R0LH 4H26A 4G9DB 1MFNA 4NSKA 3BE1L 5C07D 1PEZA 2R0ZH 2MNUA 1DBJL 1DR9A 4WEMB 4NQTA 4U7KA 3VRJB 3DV6B 1KG0A 1LO0L 4NKMA 4PRIE 5ALCH 4BK4A 1OAKL 2ZG2A 5FA4B 5DLMH 4PJAF 2FIKB 1F3JA 2GT9B 4DEPC 2VSCA 2ZJSH 1NH6A 1FFRA 1ZT4B 2ADFH 3ULSB 3KDMA 1X5FA 2FWOA 3CFJA 1A7OH 1UH2A 2W1NA 1F4YH 1ZT7B 5EU5A 4YXKH 4IRZH 2OQJA 3BZEA 1SMOA 1MCQA 2R4SL 1A6ZB 3GMMA 4PRBA 2QADB 4LSPH 3DRTA 4GG6E 4LVOC 4CAGA 3DECA 4MJ2A 2YUWA 3C5ZD 4HUWB 5GRJH 5FV2A 1FO0L 4WFFD 4EN3B 4K3EL 4GW1B 4Z7WE 1U8JB 4U1JB 4PJXE 4D9QE 4QWWD 2ZNXA 3OJ2C 5E8NA 2BNRD 4EXKA 5EZOL 2I27N 4ZOCA 4QYOB 4HK3N 3V5HB 1J86A 3VXUA 4JKPH 4ZYKA 1D5BA 1XR9A 5C0NC 5HD8D 3HAEH 5A2JH 2J5LB 2E9JA 5DEFA 3QRGH 4XBGA 5E9DD 5FO8B 3TN0A 1RULH 1LP9F 2G60L 2FEDD 5FM5O 2AKRB 2WUBL 3C5SA 1I3GH 3U7YL 2HFTA 1WWWX 1GZPB 3T0EC 1CICA 1JHTA 4OCYL 3BZFB 4OGAD 3MCKB 1M6OB 1T5WA 3ARFB 1E4KC 2AEPH 3BPCB 1KLGB 4LLWA 3ULUD 3GSXA 3WXWH 1KT2A 3WEXB 4HEPG 5FKPB 3TIEA 1ULVA 3I3EA 1I3RB 1YJDH 2X9WA 5B8CB 4MSWA 2YZ8A 2BNUA 1EDQA 5DUPL 4NQVB 3ZTJH 4XCFL 1DBAH 5AZ2H 4Y1AB 4GQPH 1FORL 3TYFB 3ARGB 3SJVD 2P1YA 1LO3L 3SKMB 2Q7YA 3H7BA 5DHYB 1TQBB 1B88A 2VDRH 5EUKB 4L3CA 3LHPH 4HW6A 2CD0A 1UWXK 2D7TH 1R0AL 5DJCB 5HYEA 1ZVYA 3AREA 4OJFH 5C0AA 5C0DB 4QTHB 3LEYL 2FL5B 2HTLD 4GRWF 2B1AL 2FR4A 2VAJA 3EHBD 2HP4A 1TZGL 3KJ6L 4IOIB 1FNHA 3WS3B 4PJBE 5HHME 2LABA 3M1BB 4HIXL 2O61B 1XEDA 4PJFA 2QTEA 3BEVB 3BISA 2EECA 2XZAH 4GG6F 4HXAL 4K7PL 5D1XD 4FQLH 5D7LE 1VFAB 2HKFL 3FT2B 4RAUA 4KK9D 5T1KD 4OZIA 4MXVE 4GG8B 1KELH 4LLQB 3MUHL 4W4NA 4LSQH 4PJXF 3TVMB 5ISZE 5DRZB 2EIBA 3ARBB 3OHXA 4K3DH 8FABB 1INDH 3MV9A 1OLZA 2G5BB 4GUPA 3H9SD 3S3JA 4QRPB 5IMOB 3ZT5A 2XWJB 4Z5RB 3OXRA 1RSFA 1S9YB 5D5ME 5J6HB 1FDLL 1ZSDA 5IBTL 1DSFH 4QNPE 3ZZ1A 1JZ2A 3I6GA 5F96L 4PGEA 1QRNE 3BHBA 3T1WA 4KJQC 3QIBC 5DF0A 2EIZB 2I07A 2KZ1B 1EO5A 5EOCL 3S8WA 4YHLL 5BV7B 1OAZH 1J1OH 5KJRL 3FAXA 4Z18A 1LE9B 1FAKT 2IPTL 3EZJB 2YEZA 4HEME 4GKNB 4LLYB 2OZ4H 4KK5D 4BFIA 4MNGE 5HYJE 1QO3B 1CDGA 2H26A 4MNQB 3IDGA 2PR4L 3TO4D 5SWSA 1I9JL 4ZTPL 4LSSH 1HINL 4XHQA 4FMFA 2VC2H 3MR9B 1IGJB 4V1DB 3I6LE 3U9PL 3LMJH 2MQ3A 3BQUB 4RGMB 5FO7B 5J1AB 1UA6L 4B0MM 4K94L 1DBMH 3RKPA 3WDJA 4PJBF 4FXLA 3HC3L 5I30H 1OSZA 4KKLC 1KTLA 2HFEA 5IMKA 4AIOA 3W5NA 3H3KA 4JZOA 1I9IL 2AK1H 2A9NH 2HTKD 3FRUB 3MGOB 3TZVB 2EDLA 5KTEL 2FB4H 4UTBL 3BIKA 4AIZA 3MRGA 2GSIB 4MXVF 3P30L 2BY2A 5T33L 5FV1L 2F5AH 3IFLH 3MRQA 3LQMA 4HS8H 4RA0C 2WM0A 1N5YL 4PJ9A 3MLZL 5DDHB 3MRLA 3N1FC 4GAYA 1QD0A 1I75A 3AGVA 5C8JB 3PNWB 2XIDA 4TYUA 4G8GA 4JN2B 1A6AB 4G8FA 2R2HA 5DUML 2EKSB 3B9DA 1I8LC 5D5MF 4MQXC 5IFAL 4DW2H 1Y18A 3HE6B 5IBLD 3SDDB 4WI4A 4RAVA 4LSTL 5F6IB 5GGSY 4GLRI 1PKQB 4OZGB 3WUWB 1R5VA 2QADC 4HJGA 5CGYC 5I1LB 3MPCA 4XNXL 1M7DB 1CFVL 2ITCA 3TA3D 3U9UB 2F54A 5EC2A 3MFGB 1FIEA 3PV7A 3QEHA 2MKWA 4C55A 1JWMA 1R3KB 4MZ2A 1Q9KA 5EZJA 3TEUA 3I3BA 4AG4L 1DUZB 4L8BB 1NGYB 1Q0YH 2JIXB 2DTSA 2YUXA 2P5ED 4OGYL 4NKDA 2KDGA 3AB0B 3ZDXE 4ZXBB 2J5LC 1CLYH 4X4XB 4X7TB 4HIEA 1R24B 2C3WA 2AJYL 4KI1A 4OCXH 25C8L 2G5RA 3ROOA 4UOJA 4K71B 1ZHLA 5F7EH 2VRAA 3QUML 5F88B 4H1LH 1FG2A 3KNBA 1AR1C 1G84A 3QUZB 3RP1A 2CIIB 4L9DA 4U1KA 4XPAL 5GRWA 3QEUA 3D39E 3ARFC 1D6VL 2IAMA 1H3PL 1MJ7L 3MV11 5D1QD 3OAZH 5JMOC 5FYKL 3S5LG 4YBHA 5CP7A 5AWNH 5B8CC 1C5BH 1MHCA 4J4PC 3TJHC 2JJVA 1U8IA 3JUYA 4ZMAT 1DL7H 2VDOH 2NXYD 1DLFL 3ARGC 3LPGA 1U93B 1BZ9B 3NABH 4Y2DA 4A6YA 1TQBC 3LPWA 4CNIB 1XGQB 4XNMB 2DQHH 1MJUL 4K8RL 3X3GL 5M95B 3RFZC 1EZVY 2W0KA 2ZCHH 2OL3A 2QKIA 2D7MA 2FD6H 4ZD3L 1ZLSL 5E8DH 3OKEA 2F5BL 4GO6B 1QG3A 4JFPB 4DGIH 2J8OA 1EERB 3QFJD 5HVHC 3K2UL 5IIEB 4M93B 4YBQC 1KLUB 3KXFE 1N64L 1MCCA 1J0KA 2X4SB 1ES0B 1T2QH 4HKZB 3K74B 2QEJA 2W0FA 4YBLB 1NC4D 4Y5VB 5F7UA 5D7IB 4O02L 1C5DA 3IDIB 2UV3A 1OGTA 4Z7UB 5E56A 4PR5B 1IC5L 1QUNA 3QXUA 3GJFA 3JZ7A 3TV3L 4R4FL 4YHKL 5DO2C 4R96A 5F7FA 4ZOEA 1XT5A 2WWKO 3TVMC 4EUPB 2XA3A 3ARBC 4S1RL 1ZE3C 5MP6H 3BP6A 4M8QA 1XH3A 1BLNB 2IJ0C 4XXDB 1IM9A 2AQ2A 2APFA 3VCLA 5C86A 1N3NB 4M1CD 3VFTA 3ZDXF 4PRDB 3SGJA 3VD3A 4HPOH 3ZKMD 2K9UA 5BO1H 3UTSA 3RTQD 4GAGH 1HK6A 2UYLA 3B5GA 4P3WA 1NDGA 2UVFA 5CEXB 2VDMH 2CK0L 1BGXH 3NFPA 3QWQB 2Y72A 4N8VB 4F7TA 5KN5B 3QUXD 1EAJA 3B5TA 4OD3H 4XPHL 1QBML 1W0WB 2Y07L 1MI5A 4MXQC 1IGYA 1P7QA 4QXGH 2ZPKH 1HHIB 4JRXD 1PZ5B 3PWNB 2OXHA 5FF6B 5IW1B 5BV7C 4H8WC 2CDGB 2E8YA 1T89C 1AD0B 3WD5L 2EEBA 4NPYB 5D6CA 1KFAH 2VAAA 1J9CT 1ZWIB 2HKHL 1QP1A 1U8NB 4P99A 5LGHH 2GCYB 5IBUG 2A83B 1A6TA 4ODVL 4KJPC 2B1HH 4RIRA 1XGUB 2P7TB 3S96B 1ZHBA 1MFBL 5IMLA 2Y9RT 3AMLA 4R2GB 4NNXA 2C1OA 4Y8AA 4X6FB 3RWCA 3FO0H 4P57B 4HUVA 4Y0GA 1VERA 3VRIB 3ULVD 3K3QA 1GGUA 2CO7B 1VPOH 2VZOA 3REVB 3BQUC 3PWPB 4RGMC 1GIGL 3PJSB 1JNNH 1YEEH 5EU6D 4KZDL 3RGVB 3WN5A 2V17H 1UWEL 3WL9A 2ENYA 1DE4B 2JJSA 4DJMA 3L5WB 1FL6A 2P5WA 3CGTA 4YHIA 3VFUB 2Z35B 2C3VB 5I16B 1OAYL 4MA7H 2HMIC 5A3IC 1T7YA 3S5LB 5IWLA 3I3DA 2IH3A 4MNHA 1IAIH 3TH4T 2PO6D 1MWAB 1RZ7L 4WHDA 3ILPB 5AZEH 3CCHB 4PGBB 3ALPA 4CDHA 3WHXA 4PRIB 1B6DA 3DVGA 1LDPL 1CDIA 3O3AB 5I17A 1QPPA 5L2JB 3HE6C 4OB5H 3TWCH 1NGXB 3SDDC 4AM0A 5BRZA 3G6JF 1MJ8H 4IRJD 4GW5B 5F6IC 4Y5XC 4OFKA 3CFCH 5CUSH 5JHDD 2W91A 3OGOE 1A3QA 3VA6A 4XP4L 1KCVH 3DIFB 2I9LB 1IGFL 2V5SA 4N0FA 4XRCB 1OP3K 4NUJB 3VXMD 4GMTH 2X9XA 5ENWA 3GEWB 4TUJA 4CVZB 1YDPA 1X6NA 2CR3A 4YHOH 3FFCE 2Z9TA 4Z7WB 4UINL 4A2LA 4PJXB 3E8UH 2NLJB 2GFBA 1FZJB 1RIVL 1JRHL 5GGSB 2AK4E 5E5MA 4X7EC 3SBWA 3AS0A 2VR5A 4MVBC 3AB0C 5F1SA 3DXAA 3X11B 5CEZE 4NOBA 1BF2A 3OZ9L 3LKOB 1KIQB 5E2VH 4MJIE 2DQJH 4K71C 1F3DH 2OLDA 1S7TA 2Y36H 4BSJA 4I9WD 3IDMB 3AAZB 2IEPA 3NAAL 3QUZC 3VXNB 4HG4J 3VXSD 3D3VE 5DRXA 4KKBC 3IETA 1A4JA 3W39A 4UDTB 4NC1C 5KANG 1DP0A 5GS0D 4P4RB 2GW5A 5HBBA 5JW5B 5ELIA 5CWSA 4YPGA 4I18B 3QFDB 2EH7H 3CFKB 4F9PC 2DM2A 4X6EA 4YO0A 2VE6B 5A16B 2VSDA 4XVTL 4EIZC 4HJ0D 1G9NC 3EYFA 4JHAH 3KAAA 1L7TL 3EDEA 1IZKA 1A22B 3DMMA 5EBLA 4MAUH 5J9PB 2WBKA 1PQZA 4WY7L 4KVCL 4KY1L 5IBUB 4M93C 4N90D 1BBDH 4U1LA 1NCBH 3FB7A 4DZ8A 4NQDE 1TDQA 4POZD 4YBLC 5GRXG 3ZSTA 1ZEAL 4WW2B 4Y5VC 4XCEA 2EE9A 4NQXA 3RKDC 3UTTD 4N0CD 1Z9SA 2VXSH 1J0JA 2NX5A 3HAEG 4LCIH 4P2QA 3RWFB 3PWUB 3MJ8B 5L6YL 1FL5B 2W9DH 5DVMA 4DK6A 3NPSC 3RIAF 4QTIL 4KTDH 4HUXA 4PP1D 1A6UH 2RCSH 3GRWL 1MCDA 3BSZH 4LPWA 1T0MA 3WKML 4HGMA 1WIPA 1XIWA 5ITFB 2PW1B 2Q6WA 5I1GL 4TUKH 1IC4L 4DZBA 1E4XI 1FCGA 5DJ6B 3HRZA 2Y06H 3FB8A 4QLRA 3HC4L 5ILTH 3ZKNC 5IV2A 1IVLA 4WENB 2BSSA 3QT2A 5TPWH 3ZTJG 1CGVA 1X5AA 1TVBA 1R3HB 5I71B 1CXIA 5T3ZD 3FTGB 1XFPA 2YOCA 4OCSH 1JGVH 3LEXA 4XGZB 4BA8A 1QRNB 35C8L 5JDSA 1JGUH 4KMTH 1NBVL 3LH2H 2F74B 1MCBA 1I8IA 4NWUH 1U8OB 2NZ9D 1MAMH 3SKJL 4R9HA 5I1DA 1NANH 2H1PH 5ID0A 4XHJD 4TVPD 5EUOE 4ZFOA 3RHWK 3SHSA 5B38G 3CFBB 5I1EL 4EEEA 4F9LA 1YMMD 3ARYA 1DBBL 5IF0A 4MNGB 4ZFFA 2BRRH 5HYJB 4ODSH 2PYEE 1CR9L 4R2GC 3B6SA 3V6FB 5T3XH 1QR1B 5HYQA 1IEAA 1KPVA 5JXAH 2P8LA 4TSBH 3JWNC 5CKAA 2V6HA 3PDOB 3V7AE 2QHLA 4YIQA 5F9DC 3G6DL 2MQ0A 1AFVL 5LAXB 4LRNH 4A6YH 1S7WB 4Z7VB 2CR6A 3RGVC 2CRYA 4G43B 5DA4A 2OL3H 4BM7A 2X4TA 4K7PX 1WTGT 2R0WL 4P9MH 1ZHKA 1QFPA 1FYTA 1MHPH 2F53A 2YSSA 5T1LD 4PJFE 3EUUA 4OM1L 3R0NA 2EZ0C 3VGEA 4Z76A 5L88H 4F2MB 3RU8L 5DJ8A 4OCWH 2ADJB 3CSPA 3PL6D 4R7DA 3B3IB 1ND0B 4WCYL 4KXZH 4POUB 2GK0A 4LVNB 4OFDA 1NL0L 4PB9L 2B2XL 3CDFA 5I8CA 3MV9E 3OJMB 3GJFH 2ZUUA 4L4TA 3K2MC 2BC4B 4JHWH 4ZFZB 5HHQB 3V8CA 4OV5B 5DSCA 4AEEA 2AJSL 4OGZA 2H9GB 4UT6L 4JFOA 1U42A 4NO5A 4U7MA 2ZSWA 3P9WB 3HFMH 3IXAA 4WI7A 4L4VE 3RWJA 4JPVL 4K23L 5AYUH 4HJJH 4YZFE 4CGTA 1QFWL 5F1NA 4U0RC 1S9KC 4ZOAA 5LCVH 5J8OA 1KCLA 4R97B 3T0VA 4MQ7B 4DGYH 1FNAA 2R0KH 5EUOF 3B8YA 5HHNA 4JRYB 2X44D 3TFKC 15C8H 2UWEA 1G6RA 4NDMB 2HAZA 4JO3H 5T5NG 4I0CC 1QFUH 1KJ2L 3GI8H 3O6KH 1ROWA 1T1YA 4R90H 3PGCB 2BJMH 3GK8L 3NA9H 4JQIL 4M7LT 4OLZL 3HA0A 4M6MH 3U4AA 3PDGA 4IJ3B 3UEZA 4OQ1A 5C0AD 5I1KH 1NSNL 3UBXB 4FQQA 4JM2D 5DQ9B 5I18L 4BH7B 4WU5A 3EYSL 2YA1A 3O11B 3GHBL 5B3NA 4C83B 3GKWH 2EYTB 2PCPA 3BFOA 4PY7B 4XNQA 5GGVL 1YECL 1HXYA 1JZ6A 4LRIA 4EDWH 2OTUA 5C0CA 2AXFA 5F9WB 1OM3H 3UMTA 4WUKL 1EJ6A 4I18C 1KJ3H 1S7SB 2JELH 1S5IH 4WFEE 5CEYB 3T2NH 3S7GA 1ZLUK 1PLGL 1I9EA 3NCJL 4D9RE 3OAUL 3F5WA 1CD1A 1U8QA 3MV8D 5I1CH 2V2TB 1SJXA 4DK3A 2XKNA 4WWKA 3CX5J 3RPIB 1N6UA 2P45B 2NNAB 5C08E 4KRPB 1RMFL 5DURD 1I8MB 5JA9A 1RK0B 1I7TB 2X6MA 5EO1B 4M7LL 3BZ4B 3HZMB 1VA9A 3MLXL 4WI3A 4P5MB 2AABL 4ZTOL 4LKCA 4WW2C 3FQTA 2ORBH 1NCAL 3G5VB 3WIIH 2E5EA 3CXDL 3KXFB 3TCLB 3AS1A 5IEKA 1WCBA 4NZRH 4WEBL 3PHOA 3MRNA 5C6TH 2GTWA 3W0WE 4DCQA 1BOYA 4I0KA 2VJXA 4FNLL 3KYOB 4PJDA 3SGEH 4YZFF 4ZPTB 4NUGH 2PXYD 2Z31B 2DI7A 3U79A 3RDTA 2HT4D 2I26N 1HYSD 2HG5A 4XBPA 4JFDD 1WZLA 2F54E 2IMNA 4XVSH 1FZMA 4WU7B 1HWGB 3KYNB 5JHLH 3QPXL 1G7MA 1R5WB 4IOFD 3TPKA 2VLRA 4I2XB 3CMOL 3O8XA 3QIUD 1T7ZA 4AT6A 5SWSD 5INCB 3FAWA 2O5ZL 3LIZL 1R3JB 2DQIH 3C6LA 2ATPA 3OKLB 1YEJH 4ZPVB 1MIMH 3C2AL 5I71C 4UMGA 3UO1H 3VG9B 1YEFL 3OKDA 4XTRD 1KN4L 1G7QB 4DQOL 3D85B 4XC3L 4ACPA 2RBLA 2G2RB 4IRSA 5D2LB 2E7BA 4HWZA 1MVFA 1GPOH 4K2UL 2C7UB 5BOPA 1S7XB 1FC2D 2DTMH 1HHJB 2A74A 3WYRA 4PBWD 5IFHH 1T66C 2IG2L 1INQB 3O3UN 1T3FA 4OZFG 2VXQL 5EB9A 2VIRA 1HNFA 1K5NB 1QQDB 1R5IB 1FNFA 4PLJD 3GIZH 5INDA 5TDPB 4WFGE 4PBVC 5IVXB 2H32A 1ZVSB 4Y16D 5IJKA 2K7PA 5ID1A 2DQGL 4KKAD 3GMOA 3MBEB 5DMKA 4OD1L 4LARL 3EYUL 4IDJL 5K93A 3NPZB 3BESR 1O7SA 2CLVA 1LD9B 3KLSA 5C07E 5CJXA 1CBVL 3CAFA 1JN6A 2YS4A 3IDNB 2OJEA 2E7CA 1ORQB 3JWOC 3TH3T 5KSVA 3OR6A 5MI0B 4MX7B 1FV1A 1E0OB 3EO1B 3LKPA 4UB0L 5IB5A 3BRDA 4NZUH 2DBLH 2VTFA 1MRDH 5JXEA 1NBZB 4TQEH 5EN2B 2P42B 3WNPA 4TNVF 2HYMA 5HI5D 1CFTB 1I1AB 5MEND 1RZKL 2C3XA 4LVNC 2DLHA 2NY3B 5HI3C 4ISVA 5CSGA 3WXVH 3T65B 2DI9A 3HCVA 3L9RA 4LSUL 3RNQB 1YQVH 2XG5A 3P4OA 2VLJB 4PD4K 1J8HA 4YAQB 3Q3GB 3CD4A 1JYWA 2Y6SD 3PG2A 2BNRE 2D7OA 1AGBB 3V4PL 2WIIA 4PGCA 3D2UA 4AH2A 4MXWL 4KI5C 2NY5C 3CPLA 4ZFGL 3SY0B 3G08B 1WVZA 3QHZL 3JV4B 3GMNA 3CDCA 5E6ZA 1CS6A 3RWHA 5D7SH 2R1XB 3LKRA 3QQ4B 1MREL 3VWJA 4R97C 1UM6H 5JTWA 3U7WH 3RGHA 1MFDL 1FNGA 1DQQB 4MD0B 1ZOXA 1LO2H 4U1NA 1NCWH 3FFCB 1WBXA 2IAND 3U2SB 1X5LA 3ULUE 3B83A 7CGTA 3HE7B 2AK4B 1NJ9B 2HFGH 2RQ8A 2PNDA 3CC5B 2EIEA 1AQDA 3JV6A 2Z91A 4H1LB 4EI5B 3G5XA 4Y88A 3MRBA 5F7DA 5TF1L 1J8KA 5DEGA 4Y89A 4MJIB 1T0PB 5CFHA 1RY7B 3BKJH 5DFTA 2KPNA 4FFZH 2AI0L 3TNNA 1ZVHA 1A1NB 1PD6A 4P23A 1NCDL 5GJSL 2WBWB 4X7FC 4D94A 3MLVL 3MLRH 4AMKL 5SV3A 3RL1B 3BX7C 2IPKA 5EULV 1G0YR 3D3VB 1DTUA 5F9WC 3F65A 4OQTL 1L9NA 2DQFB 4F33A 3S35H 3CVHA 4ODUA 1F8TL 4WO4B 3SN6N 3BEWA 1JGEB 1JRHI 2FX7L 1IM3B 5B4MD 1U36A 1L0YA 3S36L 3CLEL 3DSFH 1K2DA 5C0IA 2NTSP 2NCMA 3INUL 4Y4FA 1KB9J 3RZCB 1MQKH 2XQBH 4UNUA 1IEBA 3WSQL 4H26B 3UTZA 3VFWA 4TOYH 2XKSA 4NSKB 3SKNB 4NWTH 5F89A 2Q87A 3LCYA 1KCSL 1KG0B 4N9OB 4ZAKA 4NKMB 4HG4K 3UTSD 4X4MA 4NP4L 4NQDB 4XWGL 3H9SE 1S7UA 1GJIA 4P48A 4UT7L 1K9TA 4W81A 5BW7C 4GOSA 3STLA 5FFLA 4ERSL 2XWBB 3LB6C 3KDMB 3CFJB 1MI5D 1IKFL 5L8KB 2Z31C 3BZEB 1L9MA 3GMMB 3KLAA 4PRBB 4CJ1A 2AERT 5CJOL 5IB3A 5BQ7A 2XN9E 3BW9A 3DRTB 3B9KD 1ZLWK 1Y0LB 3OXSA 4Z7NE 1TXKA 4EVNB 1GGIH 3VI3F 3O6ML 3ULUF 2A77L 5B39A 4GXUM 3VGGA 3VFSA 4NBXB 5FHAH 1JZ3A 1BIHA 4P5KA 3BD4A 2VH5L 4J3WA 4WJ5A 1L0QA 3X17A 4HUMB 2MPAH 4ZYKB 1D5BB 1XR9B 2CJUL 1RJYB 4JPIB 4Q0XH 2AJXH 1RZJH 5DEFB 3VG9C 1WUNT 3BT2L 4OF3A 3QG7L 1G6RH 4P9HL 2WV3A 4U1GB 2W0LA 4S1DC 3C5SB 5E8EA 1VGEH 5F7HA 5I1IL 4HX1A 3MACL 1CICB 2B0SL 1JHTB 3I84A 3AY4A 4JY5H 1T5WB 4WW1A 2VZ3A 1CXLA 3A0OA 2NY1B 3DO3A 4H20L 3QO1B 5EUOB 1CL7I 3GSXB 1AI1H 3TIEB 4MSWB 1OSPH 1IGCH 2BNUB 3ZKXB 2MQCA 3LPFA 1G0DA 5D4QA 4DGVL 5KSUA 1S78C 3MBEC 4OZ4A 3H7BB 3WDIA 3Q1SH 3W11D 4PS4L 3EO0A 2HJKA 4LPVA 4P46A 3Q6GH 3FQWA 1JVKA 3X3FL 1T22A 1ZA3A 3AREB 2E27H 5MI0C 2I5YL 3MRHA 2DLFH 4JGUA 3TBWA 2XI9A 4U1SA 3L6FA 3QCVL 4X9FA 5D6DA 2FR4B 2E7LC 4ODTH 2C4FT 3L3HA 5JLZA 1M4KA 5IW6B 3HI6H 3LZFL 3BKYL 3RWGA 5J6GB 6FABL 3KPRA 2NX5E 4PJFB 2ADGA 3PWJA 1I1AC 3LVEA 4UILL 3LN5A 3TYGH 5IESL 1IFHL 2X70A 4M5YL 2NY3C 4RAUB 1CFQA 4OZIB 1QKZL 5C0BD 1FH5H 3S3PA 3WFHB 1IBGH 4F7EB 2XXCB 3OHXB 4KC3B 4PY8J 1A64A 2ZOLA 3MV9B 5T5FH 2VLKD 4LCWD 4GUPB 5E2WL 3WFDH 2YBRA 5EO9B 3OXRB 2BRQA 3O4LD 5E6IB 4Y8DC 4GMSH 3MFFA 2OM5A 1ZSDB 2FJHA 1B0RA 1CFSA 2A6DB 3NBNA 5C0RL 4MAYB 2X4OA 5EU4A 1Z3GH 4L4VB 4OI7A 1Q94A 3R8BB 5FA3A 4PGEB 4UIMA 4FFWD 1G6VK 3O41A 5JPNB 5I9QB 3LV3B 3RVVD 3I02A 1CI5A 1DFBL 2I07B 3SDXA 3KPQA 1JPFA 1Q1JH 1AGFA 3B5HA 3QISA 2CLRB 3VFMA 3AC0A 5FOBA 3DETD 3HE7C 2HLFD 3EYQC 1TZIB 5L2KD 2YEZB 4EI5C 5DEZA 4NCC1 3SGKA 1LE5A 4BFIB 3BVNA 4KU1A 2H3NA 1BD2D 1HKLL 2H26B 3DUSB 3IDGB 4DFIA 4JFYA 1RUQL 1U8HA 3U0PA 1U3JA 2DQCL 1FJ1A 2YWYA 4FMKA 4JDTH 4GW4A 3H6JA 5HGAA 3QULA 1CG9A 2H32H 3JWOL 2H8PA 4M7JL 4DN3L 5F9JB 5F3BB 2R0LL 4WO4C 4JAMA 5A2IH 2R4RL 3QZWB 1I85C 3DO7B 5LVEA 1OSZB 2OXGA 3KPTA 1BFOB 2F53E 2YPVH 4N8CH 2HFEB 1PSKH 4X0KA 1IKNC 2VISA 3HUJA 4JZOB 3RZCC 1R3IL 1BIIA 1RIHH 3BIKB 5ALCL 3MRGB 5DD5H 5DLML 5EWIL 4LPCA 5LJYH 2HJFB 5F7NC 4JRWA 3QXDA 4L3EA 3BD3A 4PJ9B 4KKCD 1A7OL 4GAYB 1CCZA 4FQ2H 4YXKL 5IT2H 2NY0B 4G8GB 4L4TE 4G8FB 3EZ8A 3PGFH 2R2HB 5E0QA 4RWHA 4P0DA 4W6YB 5IVNA 1P4BH 2D4DA 1Y18B 5GRJL 3OKNA 3VDBA 1XF2A 4RMSA 1FSKB 2X4PA 1NQBA 3EYOB 1CDBA 4JZNA 4M43H 5F7KC 1OTSC 4HJGB 3L3OA 2VABB 4Y4HD 3UZVB 4FFVC 2JJWA 2P8MA 1F3DJ 4L1HA 2F54B 4JRXE 4M1DL 1JZ4A 4Z0BH 4XBEH 5CSZB 1SBSL 1YYML 1CTOA 1Q9KB 5EZJB 3QRGL 2UWEE 1Z5LA 1MF2L 1RULL 2BERA 3BWUC 2Q1EA 1I3GL 3VE0A 1YY8A 2RGSA 4NKDB 5CD3B 5FKAA 1E4KA 1UM5H 4WDIA 4HIEB 1FC1A 5HHOD 3IU4H 2EDWA 4U1GC 1NUNB 2AEPL 2EO9A 4HGWA 1HXMA 3ESVF 5IB1A 1UWXH 5GRUH 1YJDL 4QY8A 1FG2B 2AJZB 3D5OF 3L3IA 2X7LA 1FNSL 3EO9L 3ESUF 4U1KB 4OZHE 1JMZA 1DBAL 5AZ2L 3QEUB 2IAMB 3NCYS 1QRKA 3QDJD 4E41A 4DAGH 4ETQA 5BJTA 2VDRL 3T0BA 2XYCA 1OTTD 3LHPL 3TO2A 3QDMD 2I25N 3ARTA 1MHCB 3ZKXC 1U8IB 5IR1A 2COQA 1WJ3A 4OJFL 3UCRA 1KBGH 3RL2B 4A6YB 1H3TA 4Q9RH 1N6QL 5EIVA 1V7ML 3GBLA 3CVHH 2OL3B 3VG0L 2QKIB 3BYTA 1I9RL 3SGDH 1F45A 3AREC 4UDUB 1A7QH 3AROA 3K81A 4XMLL 1B2WL 4U6TA 4CBPA 3ULVL 2CIKA 2W0FB 3H3PL 1JPGA 4HBCH 5CMAA 1A6VH 3MODH 1C5DB 1TJGH 4Z77B 4ONGH 1OGTB 2R23A 4LSQL 1BVZA 1OQOA 3Q5OA 2KL6A 4P2CG 4PJDE 1C1EH 4CU6A 1OD7A 4K3DL 1INDL 4NQUA 3IJHA 3GJFB 3LQAH 1H15B 2CRIA 4R96B 3HPLA 1A14H 4P2RE 3GM0A 2KZWA 3ZL4H 3VXME 4D3CL 1DQTA 2ZCKH 3QQ9C 4Z7QE 1EFXB 1XH3B 4LIQL 4U05A 5BVJA 1YPZA 2JJTA 1NMAL 1IM9B 4GS7B 2CRZA 3VCLB 2DIJA 5CILL 1BQHA 3QIBA 3VFTB 1OQXA 3KPPA 2E6PA 2DAVA 3EDKA 1FNEA 2AV7A 5E6IC 4B53A 1GC1H 3FONB 4E5XB 3I2CL 1Y6NR 4GQ9H 3O3EB 1U95B 4MAYC 3SDAA 1OAZL 1J1OL 3ULVF 1RJLA 1EGJA 1O7VA 4Y19A 3EOBA 3DVFA 4F7TB 4E0RA 5F93C 3VMPA 4I9WE 5I9QC 2OZ4L 1ZK9A 3VXSE 2CKBH 4PRPA 1OAXL 3WO3B 5T1MB 3EIFA 4ODXB 1LO4H 1WBZA 1U3YA 2VYRE 5IFJA 1YEIH 5F6HJ 4XAWH 4NQCA 1NAKH 1EO8H 4G3YL 4JO1L 2VAAB 5CLTA 1WV7T 4CVXB 3HNTL 5FYLH 4KJYA 2O5YH 4MMZC 1JYVA 4FABH 1HCVA 1A6TB 1IGML 2ARJQ 3NTCL 3VWKD 1FAIL 1FVDB 4PJ8D 2NY6D 5IMLB 4NNXB 2C1OB 4Q58C 1YEDA 1U0QA 3RWCB 3V7MA 1YNKL 2BFVL 4I77H 5I30L 4HUVB 4RGND 2BK8A 5KSBA 2CMRL 1FIGL 5SWZA 2BVTA 4JFFA 4FQCH 3FRPA 1A7RH 2XA8H 3H3BC 4XP9H 3RVUC 3HMXA 1X3DA 3D48R 5ETUA 1VB9A 2NW2A 2F5AL 3QJFA 1ONQB 3DV6A 3VRJA 2FLRT 4HS8L 3WL9B 3N9GH 3QDGA 2CXKA 3UTTE 2BVPB 1S9WB 2DQTH 1FL6B 4YHIB 2CQVA 5GS0L 1I8LA 3ARPA 1XGPA 2DBJA 3T0DA 4N5EC 1ZT4A 4MHHG 5A43C 1IARB 5D1XB 2VLRD 2IH3B 2QSTA 4MNHB 4PJ9C 1T1ZA 2DQDH 5T1KB 3V8OA 4JG0H 2J1KA 1A6ZA 1FGVH 2NY0C 1YYLH 5DMYA 2DKUA 5LWYH 4OIBA 4X6CE 2OJZH 5IM7A 3JV0A 4MGXA 3ZT7A 2IQ9H 1Z9LA 5BRZB 4U1JA 5D72H 1UGNA 1FSKC 4DKEL 2RAMA 4XPBH 3BJ91 2Y5TA 2NY2B 4XX1G 2O93L 2VXTH 1U8MA 1FVCB 4QYOA 1Q0YL 4X5WB 2WMPA 5JA8B 5T3ZE 2BVUA 4N0FB 2AXGA 1KB9K 3SE9H 2VN4A 2AEQL 2XN9B 2L0DA 3GGWB 3BD5A 5ENWB 4TUJB 1NEZA 1CLYL 3BMVA 3BZDA 4QHNA 3OGCA 3QAZB 1G7HA 4RSVA 4CRPA 5BXFA 4TVPE 1GZPA 1P4IH 2RB8A 3WS6A 3CK0L 5AYQA 1JHKH 3V2AR 3DXAB 2W9EH 3BPCA 4RAHA 4YDIL 5CAYB 2DLIA 5IQ7H 3SCMD 2FLBT 1NCNA 1AXSB 5B8CA 2VDKL 3RIAK 4NQVA 2X4NA 5AWNL 1A47A 1S7TB 2H2PC 3DHJA 4Y1AA 3S88H 3TYFA 5IUSA 2BXZA 3ARGA 5CBAA 2VXVH 1DL7L 3V5KB 4I8DA 1F4XH 3EAKA 2IAMC 5JUEH 4OCRH 2IQAA 3NABL 5DRXB 3IETB 3S36X 5GZOD 3W39B 1DCLA 1JGLH 4MCYB 3H9YA 4NKIH 3VFVA 1FLRH 2ZCHL 1IQDA 2EYRB 2FD6L 1GVIA 5CWSB 5E8DL 4QTHA 2E9BA 5H37G 1L7IH 4DGIL 1SY6A 4YO0B 3PIQB 1J0YA 4IOIA 1N0XH 3WS3A 4JQXA 1MCEA 3EYFB 4WV1B 3BEVA 3LN9A 3DMMB 5EBLB 4OBSA 5FK9A 1UFUA 4X6CF 1VFAA 4QRQB 5BOZG 4DZ8B 4GSDL 3FB7B 4DOHB 2EDJA 1EV2E 4LL9A 4OLEA 2W9LA 4RDQG 4XCEB 3AS2A 4GRLD 4NQXB 3GSNL 3O2VH 1BREA 2FATH 5T1DL 3B43A 3FCTA 3LOWA 2X40A 4LNRB 4QRPA 2NXZD 3MXWL 2B4CH 1T83C 3E1F1 4LEXH 3P9LB 2NX5B 4LVEA 1UB6B 5CCKH 4H0GA 1QTYT 4ESKA 4UBDD 1MCOH 2DMCA 1EFQA 1BZQK 3G5ZB 4HUXB 4RFEB 4ELME 5CJ5A 3FHAA 1FL3A 1T0MB 3KR3H 3MV01 4GAGL 1XIWB 2Q6WB 4NZDA 4XCCH 4K7FA 4GS7C 1BGXL 4W6WB 1U8LA 2EIZA 4S1SH 3SGJC 1I7RA 4JLRA 3HRZB 3FB8B 4QXGL 4NQED 2ZPKL 3C08L 5BVPH 4H0HB 2C26A 3F62A 2BSSB 4FQJL 2XT1B 1JPTL 1QO3A 5HHPB 3THMH 4PJCE 4WUUA 1S7QB 3LEXB 2VQ1B 4U49A 5FYLE 5JDSB 3AS3A 5GS1A 4OGAC 4HFWA 2APTA 1I8IB 1AGDB 2ZUQB 5JNYA 3CUPB 3ULUC 5I8KL 3RUGA 3GDBA 3FO0L 1JNLH 3BQUA 3L1OH 1KLFA 3LEVH 5IF0B 4ZFFB 1CLCA 2OMNA 3ET9F 3MV8E 3B6SB 4DKFH 3R0MA 2V17L 2R9HD 4NN5B 1OP5K 1B4JH 1IAKA 1IEAB 1KPVB 3FRUA 1EEYA 2P8LB 4YUEH 3OX8A 4YIQB 1MY5A 4MA8H 5DVNA 4G7VH 1VADB 1EZVX 3L7EB 2HTLC 1NUFA 4MA7L 1JNJA 3EHBC 2K3TA 1A1MA 3OAYK 2X4TB 2KQNA 2JJSC 1JFQL 3QXAB 1ZHKB 1IAIL 2G75B 3T0AA 5DD0H 2X1QA 4LDOB 1FYTB 1A6AA 4JN2A 3WFEL 1GHFH 7FABL 2F53B 3KPRE 4QRRD 2Q7NA 3PWLB 2A0LD 4F8TA 3U0WL 3B2UC 5I19L 2GJ6D 5D1XC 3SDDA 4ELMF 1J5OL 3MOAH 4JFDE 1LK3H 4Y5XA 4OB5L 4R26H 4R7DB 3TWCL 3WUWA 1OP3H 4M1GH 4LU5L 3SDYH 4HIHA 1VKXA 4G6JH 3VD4A 3CZJA 4PRHD 1V05A 5JW4N 3U9UA 3PABA 4L4TB 5CJQL 4X4ZA 5A1AA 3D18A 1H3XA 4YHMH 1DUZA 4L8BA 1NGYA 2NY2C 4JFOB 3T1FB 4JM2F 4ZSOE 4YHOL 1XGTA 4LF3A 4PJGA 4FTVE 3IXAB 4PJCF 2DM4A 4LQFH 3P3YA 3E8UL 4PJ7A 4WHCA 3RWJB 4LFHD 4ZUWB 4X4XA 3QUXB 5KANI 5F1NB 1N5AB 2ZUWA 5EORH 4UI2A 3SDXE 4KUZL 3QAZC 3D9AH 5HHNB 4KVNH 1EGJH 1IE5A 3RVTD 3QUZA 2UWEB 2CIIA 5E7FA 2IBGA 1G6RB 2BSED 3SBWC 2Y36L 4NHCL 5CINH 2EO1A 1MH5A 4JREB 4P4KD 2OYPA 5EU3B 1HI6B 3AFLA 4EDXA 1OGAA 3TO4C 1W72A 1NLDH 2EXYD 1KGCE 1I1CA 4WVRA 4HKJA 1X5HA 3PQYD 4WU5B 5E08L 4U4BA 3HI1B 1U93A 1A7NH 4J6RH 4G6KH 1IQWL 3KGRA 3N85H 2PCPB 2YR3A 2YD4A 1HXYB 4NO3B 4OZHB 1WAAA 1VENA 2I24N 1U2CA 1X5XA 4EZMA 5C0CB 3MJ7B 5HI4C 3MNZA 3UTQA 3VH8G 4LVHB 3HMXH 2J12B 1NCBL 1CD1B 1U8QB 5LQBH 4WV1C 2XKNB 4WWKB 2BY0A 1BZ7A 1OARL 5ICZA 4Z7UA 5MENE 5E24E 2HH0L 2CPCA 4XCYA 4GKOA 1FPTH 4HUKB 5LBSL 4YQXL 3GKZA 2VO5A 4TPRH 4NJ9L 1MRFH 4ODHL 2DF3A 2VXSL 1DBKL 4TTDC 5DD6A 1A0QL 2VDLL 3FN0H 5HHXH 2VQUA 5IBLC 3QEQD 2RCSL 3PHOB 5FGBA 4QOKA 4DCQB 3BSZL 4JZJB 5FGCE 1TENA 3C2SA 1N3NA 3IFPA 4PJDB 3OG4B 2YPLA 1DANU 3CX2A 1D9KD 3MXVL 5MEOB 3MRRB 4TUKL 3RDTB 5K9JL 4PJAA 2F58H 1A7PH 1KOAA 4XBPB 4OCLC 1WBYB 4H5SB 4OT1H 4P2RB 5CEXA 1FZMB 3VXMB 4UAOB 4FQXA 1XIWC 4LK4A 4NC2B 4N8VA 2V5MA 4PJIE 5TPWL 1G7MB 1B90A 3MCLH 5CZKA 4XPTH 5GS2D 1W0WA 4PJEE 4UOW1 3O8XB 1XAUA 4KKNA 3VA2C 5IW1A 2YUVA 5C70A 4OCSL 1JGVL 3D25B 1HH6B 1AD0A 3OKMA 3P0YH 5I76A 4KMTL 3C6LB 2ATPB 3WNMA 1N8ZB 1MAML 3ORJA 2FEEI 3E3QE 4TNVK 1T04A 3O81A 3I85A 2UY6A 3OKDB 5D1ZD 3CZFB 3VI4F 5CLWA 1BFVH 1XGUA 3CXHJ 4IRSB 4NO0D 4HWZB 2ZUQC 1IT9L 4P57A 2ZUYA 3OF6A 1CIDA 2HVJA 5T3XL 2NY7L 1F58L 1MPAH 1LP9A 3REVA 2A74B 5JQ6H 1FNLA 4TSBL 4I3GA 5IJVA 3KLHC 2R1YA 4MQSB 5HVFB 1UVQA 3RGVA 4K55A 4L3ED 4A6YL 5INDB 3B9VA 3KPOB 2H32B 4NN5C 3NFSL 5ID1B 3GSWA 2OL3L 3L5WA 3C8HA 3ARZA 3VFUA 2CLVB 2JK5B 2C3VA 3SQOH 4BK5A 5JIIA 4LLUA 1KENL 1SY6H 3C9NB 3FQUA 3W2DH 3QBTB 1F90L 2OJEB 4UTAH 5L88L 3OR6B 1MWAA 4KAQH 1B9ZA 4HGKC 2BY1A 3NVQA 3KYMA 3CFIC 3IAQA 1RVFH 4RMUA 5C0ND 1KN2L 5L2JA 2XZZA 4JDVA 4NC0B 2UUDK 5ESAB 5FYKU 5B39G 2AJUH 3I9GH 4QRUA 4LMQI 2H45A 1BEYH 1SYSA 3NZHL 4JHWL 2UY7A 1ADQL 3IAPA 4PJIF 3L5JA 3L9RB 3T0ED 5EA0L 2I9LA 4PJEF 1S7VA 3QUYA 4HULB 3P4OB 5A40E 5HDQH 4XRCA 1J8HB 4GG6A 4MA1B 1YPZE 1AKJD 3UPAA 5HGBA 4JO2H 4X6CB 3KPSD 4HJJL 5DJAB 2JF1A 2EDBA 2WIIB 2J6EA 3W9DA 4AH2B 5LCVL 5BS0A 2FYYB 2H6PA 3RTQC 1WFUA 4OLUH 4PJXA 3GBNL 5KS9E 5GGSA 1HQ4A 4LFHG 3JUZA 1XGYH 4Y19E 3GMNB 3X11A 3QUXC 3RWHB 1KIQA 1CGYA 4GLRH 5BV7H 1QFUL 4HXBL 3EW3B 3VWJB 3O6KL 2ATKA 4YGAB 4J3SA 4R90L 3LKNA 2ESVD 1EBPA 1AD9A 2RFXA 5GGQH 1G9MC 1KCKA 3IDMA 3AAZA 5AUMA 5C9JA 4U1NB 5I1KL 2AQ1A 4CMMB 1WBXB 3S37H 2D9QB 2ZUSA 5C0EA 4JREC 1MFCL 5DC4B 2EYSA 4UDTA 1AQDB 3JV6B 2Z91B 4WI8A 5TE6H 3G5XB 2OR8A 4P4RA 3MRBB 4YEEA 3RJQB 3AM8A 5HJ3A 1YEHL 1JP5A 1OM3L 3CFKA 3TNNB 4YFEA 3I75A 1KJ3L 5KSBE 1M71A 1S5IL 5SWZE 1DLHB 2HJLA 4LRIC 4N9GA 5KW9H 3DUHA 4TSAL 1ZGLP 3TT1H 5SX4I 4K3JL 2A6JA 1Z0MA 4F33B 4LHUA 3QDGE 4RX4D 3CVHB 3ALXA 3HNSH 4ODUB 4LVHC 5E1HB 3RWIA 4C4KO 5CHNB 4APQD 1EK3A 1RURH 5T1LB 5HXMA 2YK1H 4CVWA 1J1XH 1K2DB 4WWKC 5EDXA 1V3KA 1YNLH 1FYHB 1JPST 2BVYA 4PJBA 3VFWB 4UV4H 3UC0H 4O4YH 5C0BE 4KJQD 1H0DA 1UEYA 5KVDH 3MJ8A 3SPVA 1FL5A 2Z93A 2JB6B 3BIBX 5F89B 1QYGH 4XI5D 4ZAKB 5D7LA 3VFGH 4ZS6D 4NUGL 1JZ8A 5MHSD 3DGGA 2VLKE 2Z8SA 4LCWE 4P2OB 1KSRA 1S7UB 3QNZA 1K6QH 4JZJC 5ISZA 4XVSL 5KS9F 3MLWL 1XR8A 3RBSA 2DDQH 2WWKT 3BP7B 4HF5L 4KJWC 2X1XR 3KWWB 5DJ6A 3WV0A 4UV7L 3RDTC 2LVCA 4QHUB 1AO7E 3BOVA 3KLAB 3P0GB 5D5MA 5IB3B 3N06B 5BQ7B 3BW9B 4UAOC 1T03H 1U6AL 4I13B 2DQIL 3OXSB 1YEJL 5DD3H 2DWEB 1I3VA 3O8XC 1QRNA 1P5UA 1CGSH 1NLBH 2F74A 3GHEL 5BMFH 4P5KB 2MFNA 4FQ1L 4ZNEA 2EDXA 2GUOB 2CKBB 5DJ2A 1GGBH 1BD2E 5GRYA 3CSYA 1EEZB 2YD6A 3OTTA 4GBXA 1BVLB 2VN7A 3GI9H 1NDMA 3FT4A 5HYJA 5IFHL 4MCZB 4IRSC 4HX1B 4I3SH 3V6FA 5SV4A 3OB0K 1TVHA 3VW3H 5E4EB 4XB8A 1W72H 3GIZL 4KMLB 4WW1B 3ZT6A 3P11L 3LS5L 4BZ1H 1GGCL 4MQXD 5LAXA 1MCKA 1KACB 4DN4H 4M8VA 3KG5A 4HK0A 1BVKA 2XWTA 4X8XA 3TGXA 1G9NH 3QRFM 3HPJA 2VWEE 5H2BA 4PPTA 5CGTA 5IJKC 4JY4A 5KSUB 3MV8B 3R1GH 5D8JH 1V3LA 4PREB 4JDZA 5CGYD 4S10A 2NMSA 4DTGH 2HJKB 2J8UF 1TFHA 4P46B 4NZUL 4K9EL 4EN3D 4F2MA 4OGXH 3O6LH 1T22B 3LKSA 1ZA3B 2Q8BL 1MRDL 4TQEL 2QL1A 3B3IA 1QBLL 2FHCA 4POZC 2IGFH 3HI5L 3TBWB 5MEPA 4U1SB 5DR5L 4KROB 1XCTA 1CDHA 2H2SC 5JLZB 1YC7A 2X42A 5JXEC 4LLDA 3GJEA 4OV6F 3KPRB 4ZFZA 4KUCD 3BDBA 4HH8A 2DN7A 4OV5A 3LN5B 5E99H 4QCIB 5B3JE 1MCIA 4PP1C 2X70B 5ICYA 2DD8H 4JFDB 3BUYA 4HFUH 4I0PA 5HYSG 1CFQB 1KULA 3HTLX 1AR1D 2FGWL 4RWYH 4KQ3H 4N0YL 5H8DA 1MHEB 2YN3A 5I8OH 1U3HB 3MJ9A 3ARFD 4MA1C 2R69L 5KSAA 3RVWC 3W82A 1AC0A 4OLYH 4ORGB 4U7SA 2DYPA 4QRSB 5D7SL 3DSNA 4J4PD 3FQNB 1QFOA 3TJHD 1YEGH 1UM6L 4PJ5A 1BECA 4NDMA 2FJHB 1B0RB 1CFSB 1NCWL 4PRAA 4FTVB 5EU4B 1NCTA 1S5HB 3UTPE 1Q94B 4NBZB 5FA3B 3PP3H 3O41B 2I60H 1HHGA 4Y4KA 4RFNB 4BH7A 3SDXB 2FSEA 3KPQB 1JPFB 1ZA6B 4FA8A 3NA4A 4RGOH 1RUKL 1AGFB 1DQJB 3F7PC 4YBQD 4KQ4L 1OL0A 3SDCA 4ZFOL 3DTXB 3VFMB 1ACYL 1FE8H 3BE1H 4X9BA 3RUGE 3QDME 1DBJH 4EQ2A 3D0LA 1G7PA 3D39A 3V0AC 1LE5B 2NW3B 3BVNB 4U1HB 2BVOA 4JO4L 4JFYB 1OAKH 5IEHA 4LLVA 4LOUC 4M3KB 5CEYA 5DO2D 3U0PB 4BQ8A 3IRZA 2V2TA 3TVMD 2ZOKA 3ARBD 3G9AB 1F4AA 3U36A 3KVQA 5HGAB 4YHZH 5GGRA 3QULB 4AQ1B 1CG9B 1RK0A 2H8PB 2WQ8A 4OFYD 4QRPD 2Q3AA 1I7TA 1MQKL 4JANA 3CVIH 4P5MA 2FH8A 4YH6A 4HWBL 4JAMB 4RMVA 5L8JB 4ETYA 4K3EH 4NWTL 4X0KB 3TCLA 1GYAA 1SQ2N 2BOCA 1BIIB 3E2HB 5FDWB 5BW7A 4NJAH 4HC1A 5EZOH 3KYOA 1FQ9C 4J8RA 5HPMA 1SM3L