3EYOB

Crystal structure of anti-human cytomegalovirus antibody 8f9
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
225
structure length
212
Chain Sequence
QVRLVESGGGVVQPGGSLRLSCEGSGFKFGDHGIHWVRQAPGEGLQWLTVISSDGTDERYTDSVKGRFTISRDNSKNTMSLQMNNLRPEDMGLYYCARDGKYSGLLDYWGQGTMVTVSSASFKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 8f9 Fab
publication title Germline V-genes sculpt the binding site of a family of antibodies neutralizing human cytomegalovirus.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 212
sequence length 225
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eyoB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eyoB01
2P1YA 4K8RL 3DLQR 3LN5B 2C9AA 5EUKA 1QBMH 1NAMA 3GNMH 4OCRH 4APQC 1BGXH 4JN1H 4P2QD 3MRCB 2IF7A 3Q5OA 4L8DB 3EIFA 2MWCA 2E7BA 5IB5B 2G60H 4BZ2L 3DSFH 4XMKH 1ZGLP 1E4XI 2Z0BA 4Z7VA 2P8MB 3G6DL 4POZC 5E5MB 3S36X 1QR1B 4DWHA 1KPVB 5E2WH 4NQTA 1FO0L 2FH8A 5DD0H 5DMGC 2NYYD 1KV3A 4KVNH 4MA1B 4YDJB 4YBHA 4F7TB 4X7TB 1T22A 4FFVD 2YD9A 3PDDA 1F4XH 3VXUD 2ZOKB 5HGAA 3MLTA 3HKFA 3UPCA 3QI9D 2K7PA 2ADFL 2P5EE 4OCWL 4HUNB 4QXUL 4GG8B 4DKFH 5CD5D 1K4CA 4HGWB 4LSSH 3T0AA 3AS3A 2YHGA 3FZUC 4JKPH 3O6ML 1NAKH 2DQCL 3DIFA 3RBSA 1F58L 3I2CH 3ZKQD 4P99A 3UDWC 1REIA 3FQUA 5HPMB 1O7VA 3VI4E 1Z2KA 3QWQB 1U3HD 4FOMA 4IOIA 2ED8A 1UWEH 3ARGA 2V7HB 4PJGE 4U1KA 3CPLA 3ZKSD 4DKEL 3ZE0E 2M8XA 4U1IA 4V2CB 1A6UH 3HAEB 3S37X 3I6GA 3D3VE 4F37F 4RIRA 4U05A 4G7VL 3IXTB 1NCUA 1I8LC 2R15A 2V5SA 4P4RB 5D9SA 1A02N 3WIHA 4H88L 4PRDB 4C83A 4UMGA 4Z7NF 4N90E 1NC4A 1I8KA 3QIUA 3SN6N 3GI8H 4AYFA 3B9KA 3QG7L 4JFDE 3P2TA 1ZHLA 5DSCA 4U1LB 5GGSY 1AQKH 3GBML 3L3IA 4H20L 4OF5A 4P9MH 1HHJA 2CUIA 5EU5A 1KEMH 4ELKA 4PG9A 3UX9B 12E8L 4LLAA 1TZGH 1ZT1A 3L3HB 4LLWB 2W60A 2FL5B 3FCTA 1MFAL 3HZVA 4OD2A 4FQQA 1X4YA 4Y19D 4JLRB 4X6DF 2FDBP 1ZLVK 2XI9A 4MA1C 2VXVL 4NJAL 3IDNB 1PKQA 3E6HB 3LZFL 5DDHB 3QXTA 4XCCH 4PB9H 1TJIL 3ARQA 1G9NC 1MNUL 2GAZB 5E08L 5A2JH 1NBQA 1BFOA 2HP4A 1MH5A 2JJVA 4S1DC 2J5LC 4U6XB 5IB2A 2QSCL 1KC5L 3VG0H 3DVIA 4PJIA 1D6EA 4XH2A 4LAJH 2MKLC 1X5GA 2VZOA 2GEEA 2BVOA 3TLRA 3ZKMC 5EBLA 4YNYB 1JNLH 3MYJB 3SDCD 4Y16D 1GXEA 1MFEH 3TJEH 5IV2A 2P8PA 2ZCLH 3MMEB 3LKRA 5F7EL 4LPUA 4HPOH 1H3PH 4XB8A 3LD8B 4UUJA 4YZFE 1RIVH 3HC0B 4JJHA 4PTUA 5IB1B 4PJ9B 2WZPD 4PLKD 5C9JA 4HCRH 3P0VL 3OF6A 4RGND 4KZEL 3I6KA 3WUWA 2VXSL 5CD3B 3FRUB 1JGUH 1R24B 4M1DH 5CP7A 3V95A 4D0CA 5D1QA 2P49B 4TTDC 3W9EB 3EDJA 4GRLB 2R4SH 2BCKB 5F6HJ 3T04D 4ACPA 1ND0A 4L9DA 1HZHL 1OAZL 3MUZ1 4V1DD 5HD8C 1A3RL 1MCOL 2HTKD 4R4FL 1QHPA 4LK4A 4G42B 3PGCB 4RAHA 2SEBA 1HH6B 5JA8B 4FHBD 1SM3L 4P3CL 5L2KE 3NCJL 1A14L 5TE7L 3CZFA 4YHKH 3SDXA 5D6CA 5FO7A 4UTBH 5E9DA 2WLZA 1NAMB 2YD7A 2VQTA 1F4WL 3LKSB 1FVDA 3FJTA 5IVXF 1UA6H 4IMKC 5JDJA 5IP4A 2FYYA 4AH2A 1W72A 1K4DA 3MXVH 2AJYH 4Z7VB 3I02B 3B2UC 4RMTA 2PTTA 3U9UA 1SEBA 4KK8C 5GJSL 2YUZA 4KV5F 4YXLL 2ID5A 3UO1L 3C6SA 1T22B 1EEQA 3HUJF 3MLTB 4LCCA 2J6EL 1JTPA 4LEOA 4DEPB 1JGDA 3BIAX 2CKBA 2APWA 1G9MC 1QPPA 2OBGA 5HYJE 1NEZG 1WEJH 4FRWA 4R96A 1MQKL 1GC1H 5CIPH 5CGYC 4PJ9C 2BOBA 3Q1SL 4KJWC 3DIFB 3OKNA 2DQEL 4WJ5A 4LFHD 4NRXA 4Q74A 4XPGL 4HWUA 3DMMB 3NIFE 5EWIL 3LHPL 2R69L 1F4HA 4IOIB 1ZLVH 1KFAH 4YHMH 4OIIH 3CPLB 4U1KB 5CSGA 5BVPH 3SJVB 1T0NA 4MZ3A 3A0OA 2R1XB 3CVHH 3I6GB 3SDDD 1UH4A 3HMXL 5LXGL 1KCUH 3VRJA 1G84A 3BD3A 3RVTD 3VDBA 2F5AL 2VL5A 3BT2H 4HLZG 4WEBL 1EMTH 5D9SB 4DGIL 1B2WH 2NY4D 1YEDA 4HK0A 4QNPF 4NQDD 1H8SA 3VCLA 1NC4B 4FQXA 1I8KB 3QIUB 4Y1AE 3I84A 5MI0C 3B9KB 4LDEB 3UTTB 1ZHLB 3QPXH 1EXUA 1U0QA 4KXZI 3RVVC 3MODH 1U93A 4MNHA 1EVTC 4RFOL 5C07A 2UY7A 5EU5B 3Q5YA 4ELKB 4PG9B 4JPKH 3TEUA 2FATH 4ZUVB 1OARH 4OUUA 4K3EL 3SE9L 5D7SL 5HHXL 4HS3A 3HZVB 4OD2B 3LVEA 1J05A 3O3DB 3BP7A 1PKQB 2FZ3A 5BRZD 4JDVA 3BIKB 1LK3L 2H9GA 3PL6C 2E6JA 2R2EA 4PJ5E 4OZGE 3O6LL 4DEPC 1EFQA 1B88A 3B3IB 4PJGA 5FO9B 4FTVD 4Z95L 1R3KA 4HV8A 1IC5H 2XTJB 1BFOB 4PJCE 1MH5B 1IM9A 3UTPE 1NCWL 1NGPL 3NZHL 3RGVA 1P4LA 1G9NL 4PV9A 5IB2B 4APQD 4NJ9H 4F8QA 4PJIB 1D6EB 2K3TA 1OGAD 1VFAB 4MLIA 3VD5A 5TE4H 1MI5A 3DMMC 4MHHG 2B0SL 4X4XA 4X99A 2YPVH 5EBLB 4N0UE 4GKNA 4JFDA 3WFCH 3PWPE 1L7TH 2P8PB 5DMGD 1FPTL 1F4YL 2A9ML 2YA1A 3KG5A 3HTLX 1NANI 4GBXA 4UUJB 4PJDE 4LVNB 4LLUA 2ICEA 3EFFA 4GW5A 2XZZA 1E27B 5C9JB 3GSVA 3QFJD 1PEZA 5E1AB 1I9JH 1ZWIA 1FFOA 3I6KB 3WUWB 5E8OA 3QIUC 4WTZA 3DO3A 3V4UH 1X9QA 3L5WA 4Z7OE 4D0CB 2VH5H 5EOTA 5D1QB 4HJGA 4DGVH 3B5GA 3SGJC 4OM1L 2PYEE 5D8JL 1ND0B 4W6YB 5GGVL 5ABDE 1P7HL 1FP5A 4RA0C 1JPST 3HMWL 3TZVC 2NPLX 3UJIH 3DV4B 2AGJL 5SWZD 5AAWA 5B8CB 1IQDA 4NGHL 1M05A 1HE7A 1S7WA 1YJDC 1ZT7A 1OCWH 4HMEA 4EIGB 1JPFA 1DEDA 1EHNA 5D6CB 1IAIM 2AQ1A 5FO7B 3MACH 5DA4A 3VXPB 4BSVA 5FYJD 4YXHH 3MRMA 1DBML 1CU4H 3MV9A 1FDLL 2FYYB 4AH2B 2Q86A 2UZIL 1W72B 1K4DB 1FNAA 3DROA 4G3YL 1KB5B 1GPOL 4OQ1A 2IPTH 4CN1A 3WNKA 4NQUA 3IYLW 4PBXA 2PTTB 3DRTA 4UQ3A 1SEBB 3U9UB 5HXMA 3O0RH 5DJXA 4YBLB 4JE4B 1A6AA 4KK9C 2YPLA 4Z7VF 1ZLSH 2QHRL 3C6SB 5DK0A 5DTFA 1S5IH 3KDMB 4RAUA 4LCCB 4LEOB 5HHME 1EJ6A 4GT7A 4WWKA 5IBUG 1JGDB 1XR8A 2Q8AL 2YK1H 2CKBB 1SY6L 4U1HA 1QVOA 4KKLC 4G9DA 3V4VL 1AQDA 4LVNC 3VWKA 3ARDC 5E2JA 3RVXC 3OKNB 3DUHA 3W5NA 1G9ML 1OAXL 3U4EA 3MUGA 2ARWA 4WJ5B 1IKFL 2EDWA 1ULVA 4NRXB 2Y72A 5L2KA 2YUVA 4M4RA 2WQRA 3SOBH 4N1HB 2X1XR 4O02L 4TOYL 5DZNA 4IOFD 2ED9A 3T4AA 1T0NB 3V5KA 3WD5L 2UZYB 2YA2A 1TJHL 2DLFH 3RKDC 4JB9L 2BRRL 2BC4A 2FBJH 3L95B 5B8CC 5C08E 2D7TH 2VL5B 2R1WB 3FQNA 1H3UA 3KYOA 4HK0B 1YEDB 2UY6A 3RRQA 3KJ6H 1CN4A 4JPIA 4KXZH 5BMFH 4FQXB 3TBTA 4XBGA 3QDHA 5CINH 3O4LA 2ORBH 1YMHA 2M26A 5HHNA 4P46A 3VXTA 2UZXB 1MCDA 2AXHA 5JORA 5C0GB 3LMJL 5C07B 1OWRM 1I1YB 4OF6A 4XT1C 3WFHA 4X9GA 5KW9H 1MREL 1UM6H 1GJIA 1XZ0A 4OUUB 4H1LH 3K4DA 4OM0L 4TSAH 4TTDD 2Y36L 4YH6A 2FGWL 1J05B 3DX9A 4CW1A 4YBLC 3CCHA 3TP4A 5I30L 2HKFL 1MCRA 1FGNH 1ZGLA 2FZ3B 4FQJL 1DBKL 4JDVB 2H9GB 1RZ7L 1J8HE 4RZCA 2R2EB 5HD8D 4LCCC 4HUUA 3UBXA 4ELMA 5J06A 1R3KB 3CFEA 4HV8B 2WBKA 2W59A 1IM9B 2MQCA 3TT1H 3RGVB 4GJTB 4D3CL 1PY4A 3QISA 1MRFH 4ETYA 1OT1A 4DKDC 4D8PA 2R23B 2X4RA 1MI5B 1IAKA 2OJZL 4U6VH 1PX4A 4OZFH 4K94C 2EDFA 4X4XB 2DM7A 4M9PA 4PJIF 1Q0YL 5LJYH 3MNZB 1NANH 1RULH 4JFDB 2V2XB 3B2UD 2OLDA 3GGWA 3RIFK 3TH4T 1TFHA 4GBXB 1MRCL 3MRNA 4NKDB 1GGBH 3PWLB 4MAYD 1B6DA 2ICEB 1KCRH 3EFFB 3MRIA 5M7QA 3GMMB 2O5ZL 2FBOJ 5C0CE 3STLA 1X5ZA 1I4FA 4RISH 2R0WH 1FFOB 1ZS8B 3ULVD 3IETB 4FQXC 5E8OB 2I9LA 3L5WB 3DHJA 2DS4A 5EOTB 4HJGB 5CGYD 3E1F1 5K9JH 4KJWD 1XCQA 2R56H 5JW3H 1NQBA 1IZKA 4LCWE 2OSLA 2BERA 1RUML 3O6KH 1KN4L 3ULUE 1ZVYA 2BFVH 3MRHA 4PJCA 1IQDB 4J8RB 1M05B 3PF2A 4HAGA 1S7WB 4GRLD 4JQXC 1JPFB 2GT9A 3VGGA 1QSZA 5FA3A 2COQA 2D03H 4A6YB 4BSVB 4NN6B 5HJ3A 5KVGL 1G7MB 3MV9B 4N0UA 5CKGA 1UEMA 1CGVA 4OLYL 4TPRL 3DROB 3F6LA 4M5YL 3SDYL 1EJOH 3GI9H 1VEMA 3RGVC 2AP2A 2GY5A 3N9GL 4YPJA 4PJBE 5FOJA 2EIZA 5F6IB 4P5MA 4PJDA 5D1XC 3DRTB 4UQ3B 5DJXB 5A2LH 5F89A 4LP4A 4LHJB 5FUOH 4J7RA 1WTGT 1A6AB 4PG2A 5C0RH 2YPLB 4FQ2H 1CDGA 5DTFB 4RAUB 2JJSA 5T3ZL 3C8KB 1MAML 5F9AC 3GSWA 1VACB 4WWKB 1NC2A 1KENH 3QXDB 5GRJH 4LCIH 1T2JA 3M1BA 4U1HB 3NCCB 4GBXC 3RWJA 2EH8L 1QVOB 1BPVA 4G9DB 5EU4A 1BOGA 3QXAB 1AQDB 5BW7C 1T0PB 2ERJC 3VWKB 2VIRA 1MF2L 4WDIA 3MYZA 2DAVA 4NKMB 5EOCH 4BA8A 3MUGB 5BZDA 2J88L 4L8CA 3X3FL 4HAFA 4UU9A 5L2KB 2B4CH 5F7YC 1JWMA 2VQUA 3P4NA 25C8H 2A83A 2ADGA 1MFDH 3T4AB 2CK0L 3KS0J 4WUKL 1DEEA 1HKFA 2BC4B 3N1MC 4PGBA 2OR8A 2P4AB 3LB6C 1CDCA 3ARGD 3MJ9A 3FQNB 1DZBA 5B38G 3KWWA 3KYOB 3BP5A 3RUGE 4PUBH 2YRPA 4JPIB 3ZYIA 2QL1A 4R9HA 1N8ZA 3PHOA 4XBGB 3UYOD 2XXCB 5ENWA 3O4LB 1YMHB 1UVQA 4NN6C 5HHNB 2UWEE 4P46B 3VXTB 3SE8L 5JORB 4ZO7A 3AC0A 4U2ZA 4HFUH 2W9DH 1W0VB 4GKZA 3WFHB 1NC4D 3QIUD 4BK4A 3PXHA 2LAAA 3B9KD 3UTTD 1U9KA 1XZ0B 4POYA 4MX7A 1OB1A 2X89A 5F6IC 3IFNL 4KY1H 1W0YT 4CW1B 1T7ZA 1IGJA 1MHPL 1MUJA 3HNVL 1KB5L 3RHWK 1ZGLB 3IRPX 3F58L 1Z9OA 3ZT7A 3KPNA 2CR6A 2X4OA 4MLSA 4RZCB 4DN3H 4HUUB 5DS8A 3SGKA 1YNLH 2DQUH 4WWKC 4ELMB 1MIEL 1MY5A 1C1EL 3CFEB 2XWBA 3W39A 4JREB 4WHYG 5DQJA 2IMMA 3ZDYF 3C9NA 2H2PD 5AZEL 4L3AA 5HPOA 2KUTA 1OF2A 1S9WA 4JZOA 5C08A 5CGTA 4N8VG 4D8PB 2XTJD 4TNVK 2X4RB 1IAKB 3GHBH 4NDMB 5IESH 1UXWA 2HFFA 3CFCL 4ALAH 4CRPA 1PGRB 3QDGA 4O4YL 5AYQA 2FX7L 3CXHK 1MIMH 5F93C 3C6LA 1TMCB 5T5NF 3GGWB 1P6AB 5DMKA 3MRNB 5BOPA 5BO1H 1ZEAL 3MRIB 3JZ7A 5IOPB 2FX8L 2E6QA 3STLB 4EUPA 4XCYA 1GGUA 5DI8A 1I4FB 1QFHA 2G5BA 2JLLA 3IVKA 4JDZA 4UILH 2F53E 3N85H 1T2XA 2I9LB 4FQPA 3JV0A 4KKLD 2HMIC 3O81A 4XNMA 4P46C 3PP4L 1A3LL 1OAYL 2XY2A 4K07A 1ZVSA 3RVXD 4S2SA 3IDYB 1XCQB 4ZOAA 3OF6D 3WFBH 4YBQC 4YFEA 2OSLB 1ZE3C 1YNTB 3MRHB 1AXTH 2XWTA 2IPUK 4MD0A 4PJCB 2EH7L 5D1QD 2ADJA 2X2YA 3MTRA 1DFBH 4GW1A 2GT9B 4P2RA 5FA3B 1CR9L 1RQ5A 4XNZB 4M1GH 2YWYA 3P77A 4ZODA 3GKZA 5HJ3B 1B90A 2YN3A 5B3JE 4JREC 1YN7A 4PGZA 1WITA 4MA7L 5AG8A 3EO9L 4JRWA 5E9DD 1U8JA 2VSCA 1HINL 2ICWI 1LO0H 4NM4H 1PYWA 4G43A 4WU5A 3BJLA 2EIZB 2C1OA 4KI5E 4P5MB 4PJDB 2AJUH 3HZYA 5AAMA 4TSBH 5F89B 1F13A 1T66C 1MHCA 1KT2A 1NH6A 3LPFA 4I18C 4JN1L 4QXTA 4WEMB 4JVWA 3OQ3B 5M94B 1X5HA 3GB7A 3C09B 1X6LA 1C5CH 2G60L 4DUVA 5D4QA 4OGAC 1CS6A 1NC2B 3DSFL 1UM4H 1LE9B 3EZ8A 4NN5C 3M1BB 3VH8A 1INEH 1YY9C 4ZS7H 5EU4B 1BOGB 3AY4C 1GSMA 4M1CD 5JLZA 5E2WL 3N1QC 2I24N 2VIRB 5DD0L 4DZ8B 2YEZA 4QF1B 5BZDB 1DQLH 2IANA 2R8SH 1TLKA 4L8CB 4UU9B 4RFEA 5I6XC 4PRBA 2YMXL 3OAUH 3P4NB 2A83B 2OMBA 2ADGB 4M43L 3NA9L 2ZUSA 4X80H 4RNRA 3IDYC 3N50A 2FSEB 4QYOA 1OTUC 4BQ9A 2BNQE 1UH3A 1DEEB 4LSSL 1HILA 2BJMH 2N1KA 4PGBB 3KR3L 3TN0A 1JMXA 3I2CL 5JXAH 4OCXH 1TJGH 1RVFL 4BFEA 4ODBD 5TQ0L 2EXYD 3MPCA 1D6VH 3KWWB 3ZE1F 3BP5B 4LSQH 5FYLH 4GFTB 5D96B 1GYAA 4PJBA 1UWEL 4N0FA 1N8ZB 4XNZC 3PHOB 2WBJA 1WLHA 5ENWB 3BUTA 1A6UL 1UVQB 2OZ4H 4ISVA 1U6AH 5E1HB 4KK6C 1XF4B 3VRIB 4FP8H 4GKZB 4FQXD 4LFHG 4OJFH 1IRAY 1W8OA 2E27H 4MX7B 1OB1B 4U6YA 4JVUA 5D2NE 5I1CL 2R0LH 3GI8L 3MNWB 5C07D 1IGJB 1MUJB 5EZJA 2YD1A 4PG2C 3BDBA 3KPNB 2X4OB 4P9ML 3C09C 4XMLH 5DS8B 2JF1A 4NHUB 1KEML 1S9YA 3IJYB 3W39B 2MMXA 4S0SD 4DGYH 1T5XA 1UM5H 4MA8H 1IAII 3QHFH 3R0NA 4ELMF 5I17A 5I8OL 4LPXA 5C08B 1S9WB 4JZOB 2GY7B 2E8YA 3O2WH 4XCCL 1IM9D 1KJ3H 2Q7NA 1UXWB 2DBJA 2HFFB 5F7UA 3RGVD 4JFQA 3QDGB 5BZWA 5ILTH 1CLZH 4U3HA 1OLLA 3KYKH 4GLRI 3C6LB 1ACYH 3VMPA 5F9OH 1ZHKA 1QQDA 4L8SA 1MI5D 2HT2D 5JZ7C 3VG0L 4LQFH 2OL3A 3SCMC 5C0AE 1FVEA 4LNRB 3R8QA 4LHUA 4JFDD 4EUPB 4XCYB 5DI8B 2G5BB 1ED3B 3T1WA 3IVKB 4JDZB 1JNLL 4GBXD 2J8OA 3MLPA 1VPOH 2ZCLL 4XNMB 3DNKA 4ODVH 3CK0L 3SPVA 4HPOL 1EA9C 4S2SB 2AS5M 2JJUA 1Z9LA 4M02A 5F7HA 3OG4B 2A1WL 1RIVL 3ABZA 3QUZC 2EZ0C 1KIPA 5HDLA 4AEIH 5EN2B 4UB0H 4HCRL 1J1XH 1RZKC 2XWTB 4MD0B 1U8HB 4HEME 4HZAA 1LD9A 5IB4A 3BRDA 1IT9H 1MWAB 4GW1B 1JGUL 4M1DL 4P2RB 5MHSD 3RKPA 4X7EC 1QA9B 1OGTA 2KBGA 1TETH 3P77B 3RX5A 3TPKA 3C60B 3LSOA 4LIQL 4EI5A 3GMQA 5E0QA 2D0FA 2VLMD 1QSEE 3S3PA 3VU2A 5T1DH 2HT3C 3NBNA 4PR5A 2ZUTA 2R4RH 2Y4SA 4PP1C 1Q9OA 3D39B 4ZTPL 4BH7A 1U8JB 3S35H 1A7NH 2FO1A 4I9WD 1PYWB 4FQHB 4WU5B 1GIGH 4YHKL 3RWDA 3HZYB 3MV9D 1IAMA 4PY8I 4M3JA 3BH8A 5KS9B 1KT2B 3WDJA 3HNTH 4QXTB 2F53A 1WAAE 4LPCA 3QWOA 3INUH 2E7HA 1J1OL 4WHCA 4X8XA 2VKXA 1KOAA 2AJYL 4RWYH 2C26A 2ADIA 2X44D 3VH8B 5DXWA 1PZ5B 2YPLD 1DBBH 5I19H 2AJVL 2YEZB 2YPKA 1OP3H 3Q6GH 4KVCH 5C0IA 4WWKD 5KSUA 2IANB 4TNWK 5EORL 2EEAA 3B9EA 4RFEB 5BVJA 4PRBB 2Z8RA 3H3PL 3GMOB 3RJDA 3VWKD 2W1NA 1S7SA 3JWDC 1FNGA 4QYOB 1C12A 2B8OT 1WV7T 2CRYA 1HILB 1WFUA 4JO2L 5L2KD 2JJWA 3CD4A 4PP2B 3TN0B 5DQDH 4MNQE 2PXYC 1JPTH 1JZ6A 3TBSA 2E5EA 1CXFA 3VRLE 4PJBB 1KNOA 2IQAA 4N0FB 1BFTA 1KFAL 4K7PH 4YHML 1HKLH 2WBJB 5BVPL 3C60C 3SHSA 2GSGA 4ISVB 4Z0BH 3P9MA 1DBJH 1CBVH 1D5XB 3DXAB 1WGOA 4Q97A 4LSUH 4L4VE 2WWMC 3SDAC 3C8HA 1X44A 4LCUA 2HMID 5IK3A 3O4LD 4U6YB 4DAGH 4P46D 1FLRL 3CMOH 2VAAB 1QRNE 2HRPH 3NN8A 5EZJB 4UAOB 3CLFH 3QPXL 1BJMA 5H2BB 4TVPH 1Z0MA 4Z8FH 4OBRA 3LRHA 3MODL 3BDXA 1QFOA 1QNZH 4QY8B 3ZTNH 1ACZA 3ZSSA 1S9YB 4JPKL 1MLCA 5IJVB 3HAEG 1OARL 4OAWA 3P9WB 3STZB 4HWZA 4K7FA 2AK4E 4EVNB 4MXWL 5I17B 1A6ZA 1BMGA 4J3WA 3KLHD 2BVPA 4KPHH 2L4OA 4Q2ZB 3PNWB 1A6TB 4GLRH 3R4DA 3REVB 5JMRA 4JFQB 4Z5RA 5BZWB 5C0EA 1PSKH 1IC5L 4OLUL 4ZFZB 4M6AA 3B2VH 1TVDA 4L29A 2DLGA 1ZHKB 2HJLA 1QQDB 4ZUUA 4L8SB 1YMMB 4NJ9L 3TN0C 2OL3B 5CHNA 4NFBA 5BQ7A 3P4OA 5EU6E 1FVEB 4PV8A 4G6ML 2MQ0A 4BELD 1R3JB 4LHUB 2NY6C 5TE4L 5LQBH 4MDIA 1NCCH 1P5UA 2QQKH 3BRFA 4GG6E 3LRSA 1CGUA 5AYUH 2QR0A 1WZ1H 2WBJC 1YY9D 4N1EA 5D71H 5MERB 3PGDA 3WFCL 3DI2B 1L7TL 1FG9C 3TYGH 4S0TD 1A6WH 5IHUH 3SPVB 1KUMA 2XA8H 3U48A 3U30B 4CMMA 1NFDA 5AD0A 1KIPB 3K81A 1KF9B 5ADPH 1I9JL 5E24E 5ITBH 5IB4B 4P9HH 3V4UL 5ETUB 1OTUD 5DD3H 2EC9T 3C2AH 4UAOC 2VH5L 1OGTB 1QZ1A 1RZKL 2ZCHL 4DGVL 4ONOA 4XP9H 2IFFH 3MFFB 1FBIH 4EI5B 5MENA 2A6JA 5BCAA 5GS2D 4PR5B 3UJIL 3JV4A 1Q9OB 1EO5A 2OM5A 1QUNA 4NCC1 4BH7B 1WFNA 4FG6C 4I3GA 4HLZH 5E6ZA 3FB5A 3RWDB 5KVEH 4KK6D 2BOCA 4YDLB 5CJ5A 3MACL 3BH8B 3T4YA 2EIDA 4ZSOB 3ARYA 5E8PB 4FQ1H 3IKCA 3FHAA 5K9QG 5C86A 5FDWB 3QWOB 3N0PB 1N6QL 4HK3J 5KOVC 5KS9F 3IB4A 2VB5A 4F7EB 4L8SC 4JRXE 2ADIB 5DRXA 2DLHA 3O0RL 1T2QH 4UT7H 3UYRL 2BX5A 1NC2D 5KSUB 4HD9A 1ZLSL 3I75A 1S5IL 3TCXA 2KKQA 3TBYA 1MVUB 5BVJB 2DM4A 4JM2A 2MCG1 2YK1L 5DJ0A 1S7SB 1FNGB 4K3GA 1EDQA 5IROC 1C12B 2ZSVA 3D85A 1QSEA 4ZFGH 3R1GL 5CEYA 2CJUL 3CFDA 2DQGH 1X5KA 1MRDH 2AW2A 3AREB 4WY7L 2OR9H 5CZVL 1EBPA 3UYPA 1KNOB 1DUYA 2IQAB 4PRHE 4NPYA 1PVHA 1J9CT 4EDWH 1CLOH 1NGYA 5JZ7D 4R4NC 4HIJA 4EI5C 2B1HL 5I2IA 1F8TL 2JELL 1MWAL 2ENYA 3P9MB 2DLFL 5J8OA 1IZJA 4Y5XA 5ITFA 2FBJL 4NUJA 1W8NA 4NO0A 3UC0L 3BZFB 4LCUB 4ODHH 1WWWX 2X1PA 3DV6A 3KJ6L 4FXLA 5A1AA 3QEUA 4BQBA 1CVRA 3LN4B 5KAQF 3NN8B 2ZCKH 1P69B 2ORBL 4LOUC 3WLBA 2WSKA 1LE5A 3ME0A 1FC1A 3L1OH 3B5HA 1J1PL 1MPAL 5EFIA 2X89D 4C56E 1XGTA 1RAMA 4JFHE 5D2LA 4NO3A 1U3JA 1UM6L 2CD0A 1MLCB 3GDBA 4HC1L 3OX8A 5L7XL 2P47B 4OAWB 5FUZL 4HWZB 5DO2C 1U8OA 3WS6C 4K7FB 4IHOA 1R0AH 1A6ZB 1IARB 5DJAA 4QWWD 2OI9B 2X1OA 4MNQA 2QQNH 3W0WE 2L7JA 4OFKA 5KSAA 2BVPB 2HT3D 4W68A 3K7UA 2VRAA 1BFSA 4EJ1C 1J0IA 3ARWA 1FORL 5F72S 4Z5RB 3BXNA 5C0EB 4Z7QE 3V79C 1EAPA 5C08D 2FWOA 4XC1L 2VLKB 3BISA 4L29B 5CILH 5I1GH 2HJLB 4ZUUB 1QFWH 3TT1L 1BQLH 2NNAA 3GSNH 4WW1A 4CVZA 2M1KA 5J1SC 1CQKA 4FFWC 5CHNB 2Z8WC 4RMSA 4UINL 4YLQT 1S7XB 3P4OB 3U79A 2O5YL 3QUMH 5F7NC 3QDGD 3SQOL 3AREC 1I85A 4U6VL 3C6LD 3LRSB 5FYJU 4WI4A 1QBBA 2QR0B 3IJSA 3SKUD 1RULL 2EDHA 3PGDB 32C2A 4NZJA 3U0TA 4RCAA 2G75A 3HS0B 4M7KH 1VCAA 1RPQA 5I1EH 4CMMB 1GGBL 3THML 1SBBA 1NFDB 5AD0B 1KCRL 5J6GB 1E28A 1JF6A 4RISL 5IJKA 1OAUL 3V5DA 2NLJA 2AK4A 5CZKA 2P24B 2APVA 3LKQA 1WSST 1AC6A 2Z4QA 1MVFA 3ZO0A 3G04A 2W9EH 5K9JL 5AWNH 2GQHA 2WUCH 1QEWA 2R56L 3NZ8A 5JW3L 5MENB 2A6JB 2JJTC 1NCAH 2VC2L 5CSZB 4M6OH 3EAKA 4N9GA 3JV4B 3QIBA 4P2RD 5DJ2A 4GUPA 2PKDA 5F88A 3FB5B 4JO1L 2DD8H 2OI9C 5EU6A 4XVJL 2BOCB 2VZ1A 3JWOH 3OKKA 4MXVE 2D03L 1DL7L 3STBA 4UDUA 2BRQA 3WUWG 3IKCB 1C16B 3QUXA 4OF0A 1UC6A 5GSRA 4GRWB 4FA8A 1EJOL 3GI9L 5D1ZA 5C09E 3T2OA 5JW4M 1EAJA 5KTEH 1JP5A 5DRXB 2Z92A 4ZXBB 1ERNA 3X13A 2CPCA 2DOCA 4J4PA 1DANT 1KJMB 3ARPA 5FUOL 4WCYH 1K8IA 4FQ2L 3I75B 3KHQA 1SMOA 2PYFA 1R3LA 5I1LA 4XCFH 5SV3A 1AHWC 2I07A 2WW8A 4JM2B 4CJ1A 5DJ0B 2ZG1A 3ULUD 4X9IA 1DSFH 3ULSA 3EJYC 3OXRA 2IAND 2ZSVB 3D85B 4YE4H 3WFEH 1CZ8H 5CEYB 2NX5A 3CFDB 4XPBH 5DC0A 2EICA 5FEBA 3TM6A 3X11B 2O61B 2B4CL 1DUYB 2HKHH 4NPYB 3NCYS 1NGYB 4BUGA 4HIJB 4NZRL 1QG3A 1MFDL 3TN0D 4JPVH 2DKMA 2IH1A 5I2IB 5D6DA 3OXSA 5I0ZA 3UTSA 4Y5XB 3VMNA 3VG9C 5GZOD 5IGXH 4NO0B 5JHLH 3L7FA 4QRPE 1HDMA 4NQXA 4C4KO 1KIUA 2WBJD 5DMIL 3WBDA 4QRTA 2XPGA 4PGCA 4JRXA 1WZKA 3DV6B 3QEUB 4NOBA 4WEUD 5ICZA 1WWCA 1OTSD 3MO1A 2HWZH 1KXQE 1V3JA 3WLBB 1LE5B 5ECJE 3OAYK 2YZ1A 1UT9A 5EFIB 4MSWA 2VWEE 1XGTB 1P5VA 2W9DL 3RL2B 5GGQH 5D2LB 4NO3B 5HSFA 3OX8B 2MPAL 1BWWA 4XP6H 1U8OB 4ZXBC 1H8OA 4KY1L 1ZKAA 1JYVA 4M62H 1QD0A 3IAQA 3BPLC 1F2QA 5C0BB 3L9RA 1JK8B 3VD7A 4DFIA 3V7AE 5DJAB 5DQ9A 4MNQB 5KSAB 3FB6A 4W81A 4JVPA 1G7IA 1A5FH 2DQUL 1CF8L 3EW3B 4JM2C 1JHLL 1IEHA 3U83A 3BXNB 2VQ1A 4MDJA 1Y6NR 2C3WA 4W6XB 5IQ7H 2FWOB 1EGJA 1ITBB 1WIOA 4WUUE 3S3SA 4PRAA 2C4FT 4XPHH 2NNAB 4WI9A 4WW1B 4Z7WF 4CVZB 4QCIA 3U1SH 1FYTE 4Q6IA 1FZOA 3B43A 2ENSA 4YHIA 3FMGL 4FXKB 3VWJC 3EDEA 1JRHL 3F12A 3D25A 1I1AA 4NQVA 4M48H 4B41A 4HG4J 4ALAL 3PDOA 3IJSB 4E41A 3U0TB 5TGBA 2G75B 1X3DA 3ZL4H 4Y2DA 2ZNWA 2AJXH 2GJ6E 4LHUD 4Y5XC 4Q7DA 5BO1L 4QHUA 4FABH 3NACL 3ZHDA 4JHZA 3U7YH 2D3VA 1E28B 5ELIA 3CVHA 3V5DB 4UILL 3N85L 2KZWA 3D0LA 4I4WA 3LKQB 3T0EE 1NFDF 4HWNA 5DFVC 2HJFB 2Z4QB 5F70A 3FN0H 3W0WA 5FK9A 3G04B 2DKUA 2PF6A 1CD1A 3VGEA 3NAAH 4G8FB 3WFBL 1QEWB 2EDDA 4HH8A 1YEHH 4EOWL 3N06B 5IFHH 5D7LB 4N9GB 5DJ2B 3QIBB 5EG6C 1AXTL 2EE2A 9CGTA 3D48R 3C5JB 4R4ND 2VYRE 1WC7A 4OZ4A 5F88B 1N0LA 4EI5D 5EU7C 3FFCE 1VFUA 2BDNH 5C6PB 5J57B 5EU6B 1NUGA 1Z0NA 4M1GL 3OKKB 3Q6FA 2YS4A 3S3JA 4WTZG 4BJLA 1Q9LB 3QUXB 3MJ8B 1UQSA 3MV8B 4JY5H 3FAWA 3QA3A 5GSRB 4WI6A 2WINB 4X0KA 5E6YA 5FKAA 5D1ZB 4KH2A 4NQEE 5KSVA 3ALXA 1LO0L 2IALA 2V7NB 1URLA 4LOUD 4WFFE 2VR9A 3GRWL 3UEZA 2AJUL 2F53D 3X13B 4DVBA 1KIQA 4YEEA 4GRWF 4TSBL 2DQJH 2WM0A 1FV1A 1I9RH 1K8IB 3Q48A 5F7WC 2PYFB 1R3LB 5I1LB 1S7VA 2RQ8A 2WIIA 4Y5VA 1C5CL 4G8IA 5INCA 4ODTL 2JE8A 3E8UH 2X70B 4CUCA 3OAYH 3RNKA 3QG6A 1INEL 4F2MB 1E0OB 1F00I 3ULSB 3OXRB 3WNNA 1MCIA 5BJTB 4Z7UA 4XWGH 3ROOA 3E6FA 1MHEA 2NX5B 4G6JH 5DFTA 4JM2F 3VXMB 2Z8VC 1DQLL 5IJKC 2R8SL 3V7MA 4MJ4A 1DBAH 4XHJD 5DJ8A 3MGAA 3QO0A 1FCCA 3OAUL 4IMLA 4F80A 4P0DA 5IG7A 3MRRA 7CGTA 4X80L 3SBWC 4FFWD 1CYGA 3VE0A 3OXSB 2VSDA 5L8KB 1Z3GH 5GGTL 3UTSB 4LVEA 3V0VA 3T3PF 4OCXL 1TJGL 3DX6A 5E8DH 4I5BB 4NQXB 2FECL 2K1MA 2QTEA 4YUEL 1D6VL 4QRTB 2XPGB 4PGCB 3RQ3A 2CIKA 4M3KB 3C5SB 5ICZB 4AMKH 1YYLL 3ZT6A 2XZCH 3DGGA 3ARTA 4F37K 1NEZB 5HI3C 1JN6A 2DI9A 1U6AL 3QUXC 4QXWA 3EYVA 1M7DA 4MSWB 4AIXA 4FQIH 4JR9H 1T6WA 1F90H 4OJFL 3G6DH 2E27L 4P3WA 2BY1A 4U1SA 3TA3A 3QEQA 2XZQL 4PJHF 1H0DA 4ONFH 4J4PC 5D2LF 1F11A 1XGPA 5DQ9B 3FB6B 1RY7B 3PGFH 3GEWB 3K2MC 3SE3C 4HIEB 4KQ4L 1G7IB 1U42A 4HWEH 2ADFH 2KQMA 2VQ1B 4MDJB 4XI5C 2AK1L 1MEXL 4DGYL 4UV7H 1UM5L 5IR1A 3O6MH 1LNUA 4PRAB 3QHFL 1QLFA 1FH5L 4QCIB 1DCLA 5HGGS 3NIDF 4Q6IB 4KTEH 1EHLH 4XVSH 4YHIB 3O2WL 5TDNA 1GAFL 4WV1C 2KH2B 1ZV5A 3F12B 4XVTL 3D25B 1I1AB 2VLKD 1KJ3L 4HUWA 4NQVB 4OGYL 4DKEH 1C7TA 3WYRA 2MTPA 4MJIE 3PDOB 1CLZL 4E41B 2EKSB 3P11H 1HNGA 5D6DC 5TGBB 4Y2DB 5F9OL 1X5IA 1H5BA 4JFEE 3HR6A 1I3RA 1WCBA 3I50H 1NGZA 4QHKI 2B5IB 4H88H 2NXYC 3ALWA 1BM3H 4HUKB 1WT5C 3V8OA 3O41B 1JMZA 1J0HA 3CVHB 2FJGA 2DQHL 3B6SA 2UUDK 1JZ2A 5ESVA 3GBMH 1VPOL 4JFFA 4LSTH 4ODVL 5FK9B 3KAAA 1DTUA 2CIIA 2JB5H 1U8KA 1A0QH 4XPFL 4AEIL 3EKCA 1FQ9C 1J1XL 1FL5A 1MFAH 4Q0XH 2NY2B 4WUUA 3BD4A 1QSVA 1J11A 1RUKH 2ESVA 1WC7B 2VXVH 4OZ4B 1XGYH 2CDGA 4ORZC 3SEPA 5MEND 3EOTH 4MGXA 1TETL 3RZCC 4KRPB 4ONHA 2NY0B 3ARBA 1QHOA 1RJZA 3HRZA 4HZLA 5ERWA 1X5YA 4UT6H 4KMLB 4Y8AA 1UQSB 4AQOA 2R4RL 4HKBA 1P4IL 3QA3B 3QWRA 1KC5H 1IC4H 4LHQB 4X6FA 3S35L 1A7NL 2IALB 2F74A 1GIGL 3EOAA 1J12A 1AI1L 1EEYA 4DVBB 2NMSA 3C8DA 4BQ6A 1FV1B 4Y7MA 1I1AC 3BW9A 3HG1A 4BUHA 3CFKA 3T0EA 2WIIB 4NQSA 3INUL 2GTWA 4Y5VB 3UTZB 5INCB 5DMYA 2HN7A 3LN9A 3WEXB 4Y2DC 5CBEA 3WXVH 3QG6B 5F9JA 5FV2A 3V52H 4OZFA 1DBBL 1XF2A 4OLVL 1MAJA 4Z7UB 5I19L 3ROOB 4P4KA 1MHEB 3Q6GL 4KVCL 4C4KT 1VA9A 3VD3A 4J1UA 2YUWA 1P53A 3VXSA 4JM2D 1G6RH 2DMCA 1KB9J 5C1MB 2DQFA 5JXEC 1F3DH 4N0YH 3FFCA 1SEQH 3D85D 1P9MA 3QO0B 1QSED 3AU1A 1S7UA 1Y6MR 4IMLB 5IG7B 3MRRB 4G8GE 1IVLA 1HZHH 1OAZH 4KKBD 3VE0B 3O9WA 5GRYA 2VDLH 1QPXA 1FFPB 1A3RH 1FHGA 1MCOH 4FXGA 1BIIA 4K23H 4R4FH 1AY1H 1I9IH 1KLGA 1MCEA 3ECBA 2P46B 3V0VB 3WKNA 3DX6B 5FGBA 1JPTL 1SM3H 3O2DH 2PN5A 4NQEA 1NCDH 3PE9A 4IM8A 2CIKB 3LH2H 4CGTA 5IBUB 5E99H 2HLAB 2VXQH 1HKLL 3ORJA 4WFHD 1KN2L 4KRPC 2NY0C 1JN6B 4NO0D 1V3MA 4Z0BL 4DK3A 4Q9CA 4G6KH 5JPNA 1CCZA 1CBVL 3BMVA 3EYVB 1M7DB 1UENA 4P5KA 3ZKNC 1BQHA 4LSUL 3RWHB 4N8CH 4PJEE 3SY0A 3NOIA 2GHWB 4H0HB 4OCNC 2J4WH 3HI6H 5DFVD 2X7LA 4U1SB 3OR7B 1SYSA 2JCCF 3TA3B 2DWDA 3QEQB 4WHTA 6CGTA 4NQCA 4DAGL 4YDVA 2YUXA 4YXLH 5E4IA 3EO1A 3UO1H 5I75B 2DJ4A 2HRPL 2EEDA 3TESA 1XGPB 2EO9A 3ZDXF 5FV1L 1GZPA 4Z8FL 2BY3A 3F5WA 2OXGA 2UUDH 5FYLE 4Y5VC 4EQ2A 3ZTNL 4YFLF 4GW4A 3LV3B 4K55A 1P4BL 3GHEL 1PD6A 1M4KA 4IJ3B 2BHZA 1Y0LA 4MNQD 5KSAD 5DHYB 5IEHA 5JDSB 4MWFB 5IR1B 3Q1SH 1LNUB 1OY3B 1QLFB 3RL1A 5ACZA 4NC1C 4H26A 4ZNEA 1LEIA 2VDNH 1ROWA 2Y25A 4U1NA 4XPGH 3TV3H 5TDNB 5DJ6A 2OS7A 3LHPH 2R69H 2DJUA 3SKMA 1E4KA 4HUWB 4YQXL 4NC0B 4UT9H 1PSKL 1U36A 3WMSA 3B2VL 3UPAA 1D3CA 1G0XA 2VITB 4DUXA 3QIWC 2W38A 5K9QI 2LABA 1YEIH 1I3RB 4LSRL 1XGQA 1NGZB 3WJLC 3OBAA 4WI3A 5LQBL 1NKRA 1NCCL 2QQKL 3V5HA 4JFOB 2DYPB 4PJAB 4CN4A 1UJ3B 4J3OC 3B6SB 1WZ1L 1DUZA 1JF1A 2DF3A 1C08A 5ESVB 3KPSB 3ARSA 4JFFB 5IHUL 4RFOH 2CIIB 2XA8L 3MRBB 4TYUA 5DT1L 1TTGA 2AK4D 4L3EE 3BGMA 3DETC 4K3EH 3SE9H 1T89A 5D7SH 1BJ1H 1FL5B 5ADPL 1JCKA 2WV3A 4WUUB 2I5YL 5ITBL 3GKWH 3UXFA 2ESVB 5CS7A 1JE6A 5I75C 4P9HL 5ID1A 2IWGA 5DD3L 5JTWA 2CDGB 1LGVA 1VB9A 1LK3H 3KS0H 4XP9L 4EUPG 1MFCH 3QIBD 2E6PA 4ONHB 3ARBB 4HBCH 4JDTH 4RX4A 1RJZB 3HRZB 3RJQB 5KSBA 5BV7B 5ERWB 5JW4R 3BRGC 2XN9A 4PYGA 1TITA 4HKBB 1RZGA 5AZ2H 1FC2D 1LO4H 4IJ3C 5CFHA 5EU6D 1G9NH 2LV4A 3VFMB 3BKML 3QBTB 4X6FB 4MA3B 1G1CA 4CBPA 2F74B 3ARRA 5HI3D 1RJLA 6FABL 3EOAB 1Y18A 4PBVC 1EEYB 3VXOA 5KVEL 4JHWL 3QUXD 1RU9H 2DQIL 5CJOH 5I1IH 3KPLA 2FLRT 3MV01 1KXVC 3D69A 3F7QA 3JTTA 4FQ1L 4M5ZL 5D1ZD 3BW9B 3HG1B 1A7BA 1A9EA 1Q8MA 3CFKB 4PYHA 2D7MA 4NQSB 2GTWB 4CNIA 2HN7B 4L4TE 5JIIA 5CBEB 4WFED 4J4PD 3AUVA 2VLRA 5F9JB 1WBZB 3U7AA 3HAEH 3VFPB 1XF2B 5HDQH 1IGTA 2BNRE 4P4KB 1SBSH 3OKOA 5LAXA 2X4UA 4J1UB 4LPWA 3VXSB 1INQA 1UJ3C 1B0RA 1NCBH 2XRAL 4AEFA 4PRPA 4XI5D 5A2FA 1GGIL 2DQFB 5HYSA 4Z7UF 4R6UA 3AU1B 1S7UB 3FT2A 4JZNB 4WW2B 2NX5D 5GGVH 3KPPB 3O9WB 3BOVA 4YHOH 1NGXA 3OV6A 4QOKE 4FXGB 1BIIB 3P4MA 3V6OA 1KLGB 5C0ND 3ECBB 4OQTH 4KGLA 1MRDL 3O45A 3B83A 2EDJA 2DTSA 4G9FE 3VH8G 1KEGH 2VR5A 4NQEB 5H37G 3X3GL 4AY0A 1YYMH 5CWSA 2OR9L 4OLXH 5L0QB 4OD3H 4D0DA 1FFNA 4GKOA 3UTSD 1T4KA 4EDWL 3QFDB 3L5JA 3ARBC 1DBMH 3S5LA 5BV7C 5JPNB 1K3IA 3GBLA 3CUPB 5KG9B 1AIFA 4P5KB 4G3YH 4DZBA 2NY3B 1BQHB 1GRWA 3SY0B 3AGVA 1MCNA 1BD2B 5JOPE 1SYSB 4WHTB 4NQCB 4YDVB 4I77H 3QSKB 1BZ7A 1PG7H 1A47A 4YHZH 2QLVB 3FKUS 4CN6A 3O2VH 5I73B 4EI6B 5C7XH 1ES0A 3ZDZE 1GZPB 4HKZA 3F5WB 4OF3A 5BOZG 4RGMB 4H25B 4KKCD 4TUOB 4BFBD 1X6NA 3VXNA 4GW4B 5TH2A 2FHBA 4HWBH 3V4VH 1Y0LB 5EPMA 1ZTXH 2AKRA 1R0AL 3GJEA 4P4KC 1G9MH 1OAXH 3RL1B 4HUXA 3K74B 5KAQG 4H26B 5DUBA 5M95B 2CO6B 1LEIB 2QQNL 4U1NB 3FQWB 3IFPA 1YPZA 1TZIA 4GQ9H 3SKMB 4MXQC 3KJ4C 4MQXC 1P9MC 4O02H 3RAJH 3AFLA 4TOYH 3FN3A 4WW2C 2P48B 1TJHH 1K85A 4TVPE 1G1YA 2BRRH 5CILL 1QFWL 2RCSH 3GSNL 4U31A 1EZVY 4X9FA 1I1AD 3MLUH 1D9KC 5GJTH 5CEZD 3I9GH 4IRZL 5CSBA 3QUML 5JW4N 1J0ZA 4PY7A 2LAGB 4E41D 2R0KH 4U1MA 3V5HB 3TVMA 5L0QC 2R1YA 3QNYA 4Y2DD 1DUZB 1H3VA 1I7RA 1JF1B 1NEUA 2VLJE 4AK1A 3HC4H 1OQOA 4M7KL 4PJAF 1LP9E 4U3XA 4ZFOL 1NAMH 5I1EL 2NY3C 2DM2A 1MREH 3MBEA 3BGMB 5FHBH 3DI3B 4WIQA 2OZ4A 2Y36H 3W0WD 2DM3A 5BS0E 2KDGA 1LO3H 1AXIB 5GISL 5ID1B 3MGTA 3I3BA 4Z18A 5D5ME 4ZFFA 5I73C 2AXFB 2ZKHL 2DLIA 4LHUG 2FLBT 1MSPA 3O3BA 2QKIA 3BPOB 4Y19B 5AWNL 4RGMC 2F54A 2HTLC 1YUHA 2NY2D 2WUCL 4URTB 5KSBB 2XN9B 1NCAL 1U92B 4M6OL 5HVHB 1FGVL 1RZGB 5DVOA 1EX0A 4D3CH 3QI9C 3QPQD 4KRPD 3G6JE 5FM5M 4FZ8H 5CD5C 1Y18B 3JWOL 3BN9C 2LVCA 5B39A 5DA0B 3ZKND 3D69B 5FA4A 5CGMA 1OAKH 3LDBC 4ZDHA 3P4LA 2DB8A 2NW3A 1A9EB 5GZNC 1I7UA 3FO2A 4CNIB 2MFNA 4PREA 3B8YA 3MLYH 2VLRB 4Y16B 5HDBE 2JK5A 1Z6JT 2X5PA 2D7OA 3ARXA 4G8EA 5E2VL 2P5WA 3OKOB 5LAXB 4MS8C 1CVSC 3QULA 4WCYL 5KOMC 2GJJA 1INQB 2ZSWA 1B0RB 5IHBA 2DKSA 1F6AA 3OHXB 2Z9TA 1PEWA 4N9OB 4PRPB 4UIKH 3WIHH 5HYSB 4XCFL 4NNYA 3IDGA 4N5UA 2DL2A 3FT2B 4I2XE 5ANMA 3QAZB 1DSFL 1INDH 4K2UH 4MB3A 4YE4L 4OFYA 2OQJB 2YRZA 3RPIA 3OKDB 3Q5TA 1CZ8L 4L5FL 5E56A 4XTRC 5FYKH 1T89C 3KPQA 1VESA 2R2BB 4XPBL 4WW2F 3O45B 3AS2A 1JZ7A 2WNGA 1JGEA 3DBXA 5K9OA 3BWAA 4NZUH 5CWSB 4M93B 4D0DB 4ZPTA 3ZMRA 1YJDH 4X5XA 3CX5K 5EC1A 1RK1A 1A6VL 4JPVL 4E42A 3S5LB 3OZ9H 2C5DC 4OSUL 2OTWB 1AO7E 2A6IA 4OLYH 4TPRH 1AIFB 4M5YH 2X10A 4DZBB 3U2SA 1J8KA 5I1AA 2OTUA 5FGCE 5JHLL 5JO5A 3OL2A 1JI2A 4F9LA 3HPLA 1NKOA 8FABA 4PJ8A 3L6FA 1BZ7B 1OLZA 3LKPA 1CGTA 1ZA6A 2XKSA 1N3NA 2BNRA 2ICWA 1NLDL 2HWZL 1ES0B 5T3ZH 4GXVH 4HKZB 4L4JA 1MAMH 3A6CL 3TA3D 3QEQD 5J12B 2J8UA 3CSYA 3T3MF 3RBGA 5TH2B 4U0RB 4MVBC 3SDCC 1ZSDA 4Y16C 2XG5A 1KPUA 4DOHB 1YEEH 2VZVA 5EPMB 2AKRB 4M62L 1QP1A 4HUXB 3JTSA 3CH8A 1TDQA 3QDME 2FX9H 1F97A 1XCTA 2RR3A 3MR9A 4XMPH 3IFPB 1YPZB 4G9FA 4PLKC 3MV11 2VDMH 1CDIA 3WO4B 3EO0A 5DF0A 5IQ7L 4CMHB 4ZQKB 1NDMA 2I9TA 2FIRT 1RUAL 4M9OA 3V6OC 2DLTA 2YXFA 3FB8A 2PR4L 3SO3B 4BKLA 3ZYOA 4PY7B 2R2CA 3M07A 3PABA 3OB8A 3G5ZA 2LU4A 2HTKC 4U1MB 4M93C 1Q9KA 2R1YB 2FCBA 2RIKA 3QNYB 3RY4A 2P8LA 1KJ2B 1I7RB 4EBQL 1ORQA 4NYLA 5I8EA 3SE8H 4K9EC 4LQ1A 4M7JL 2AJXL 2EYRA 1D5BA 4X83A 4FABL 4JCMA 1QLRA 2DICA 3QDAA 4RMWA 3MBEB 4CDHA 4OGXL 1DP0A 3MRKA 3U7YL 4F58H 1T1YA 1UWGH 3IFNH 1KSRA 4GOSA 2HVJB 3RFZC 4JFFD 1W72H 4RQQA 4ZAKA 3MGTB 3HNVH 1KB5H 3KYAA 4ZFFB 3FN0L 4XP1H 4MB5A 5D93B 2IMNA 4QGTA 3O3BB 5F1KC 2QKIB 3VA6A 2F54B 3NAAL 5EH1A 5J12C 3WNPA 1YUHB 3T1FA 1IMHC 4WUUD 5BRZB 4U0RC 3FQRA 2ESVD 5IFHL 4WI8A 2EYSA 1KYOK 3CSPA 1PG7W 3RY6A 1OQXA 2CKBH 5KSBF 3ARBD 3E3QE 2GI7A 3TCLA 3PJSA 4NSKA 2XXMB 1LEGA 1P84K 5FA4B 5D7IF 4Z9KB 4ZDHB 2KQNA 3QWRD 4XAKE 4GAJH 2NW3B 4OCSL 2FX7H 2OP4H 4Q9RH 4BZ1L 4JY5L 3WO4C 5FKPA 5IBLD 4PRIE 1A6PA 3FO2B 4PJXA 4K94H 4PREB 2DN7A 4NUGL 4NO5A 5JIKA 2A74A 2V5YA 4G8EB 2P5WB 1KG0A 3CGTA 3HG1D 3SO3C 3T0ED 5FHAH 4QRRA 1VENA 4Y8DC 2DQJL 1U95B 1I9RL 2ZSWB 1F6AB 5GS3A 2NY4C 2DTML 3AAZA 4NNYB 2J8HA 3IDGB 3MRGA 2R29L 3W5MA 3E8UL 4P4KD 5ANMB 1PW3A 2O26U 3VJ6A 3IAPA 4G80A 4Y4HA 3VXSD 4R90H 1NUDA 5KANI 3OPZH 3RPIB 3MBEC 4JHBA 4J3UA 4XWGL 2X4NA 3ZZ1A 5DJYA 4MXQD 4XWOD 3ZE2F 2OYPA 3G9AB 1TENA 3FFCD 4MQXD 4WHDA 3PQYE 1VGKA 4MZ2A 4NWUL 1C5DA 3LEYH 5GIRA 3DBXB 1A9BA 1H15A 5K9OB 1YZZA 1DBAL 3O9WD 1IAOA 4B7IA 1IGIH 5I8CB 2X4PA 4YHYB 1ORSA 4X5XB 3ETBF 5EC1B 1RK1B 1RUQH 2ZUVA 4E42B 15C8L 2A6IB 4NQED 4MA7H 1LK2A 5I1AB 2OTUB 3GMRA 5IW1A 1SJHB 5E8DL 5JO5B 1J0JA 3HPLB 4OCLC 4CL7A 3EJJX 4NM8H 4JFYA 8FABB 4OLWH 4PJ8B 3L6FB 3SGDH 4AMKL 4F33A 1ZA6B 2XT1B 1N3NB 4JAMA 2XZCL 1CFQA 2ICWB 3QQ4A 1X5AA 2NY3D 5HHPA 1H3GA 1BVLA 2BHUA 4J3XA 3FHQA 1BD2D 4OZHF 2J3SA 5DVLA 4JFZH 4FQIL 4NQCD 2J8UB 4LGSB 4QHNB 4JR9L 1F90L 1JUFA 1L9MA 4J2XA 4GXUM 1FAIH 1ZSDB 1KPUB 5FO8B 4XNQA 3S37L 2EDTA 3MRDA 2XFXA 1HI6A 4ONFL 5SWQA 2HTLD 3JTSB 4IBLT 1T7XA 1ZHBA 2Q6WA 1XCTB 3MR9B 1RD6A 3PGFL 2YMXH 3GSOA 1I8IA 4WWID 4HWEL 1U8QA 3NA9H 4M43H 4OFPA 4M00A 5IT2H 2X1WL 5DWUH 3EO0B 3U4BH 3RGHA 1YPZF 4GAYA 1J5OL 2APBA 4UV7L 3BN9D 2I9TB 1AO7A 3KR3H 4ZOBA 1RVFH 3QT2A 3L7EA 5TQ0H 4DW2L 1BVZA 4KTEL 3FB8B 4BKLB 1EHLL 4XVSL 5GZND 4HDIA 3MLVL 3PABB 3D0VA 2VAJA 3DOSA 3BJ91 3QZWA 2P8LB 3P30L 4YHYC 5DC9B 1FIEA 1ORQB 4NYLB 2ZNXA 3P11L 3EDFA 1FJ1B 5DYOA 2EYRB 1D5BB 4MS8D 2VTFA 3KXFE 4A6YH 2MCPL 3I50L 1IFHL 1XGUB 1A64A 2DIJA 4OZIA 3MRKB 1BM3L 1JNHA 3G5YA 1T1YB 3QDJA 4AIZB 5I1CH 3BZDA 3WL9A 2W92A 4ZAKB 2EE9A 3EYQD 1U8NA 3VFWA 4GRMB 3DO7B 4LSTL 5J7CC 4QHLA 3H9HA 4XTRD 4X6CE 2JB5L 1RFDL 1BX2B 3EHBD 2NTFA 5F1NA 1AD0A 3T1FB 4NZDA 1A0QL 3QNXB 3FQRB 3FB7A 1RIHH 4ZYKA 3C08H 1MQ8A 4Q0XL 2V17H 2O5XH 1V5JA 5FUCE 5CJ8A 1L0YA 1KCKA 4KMQA 1RUKL 5I8OH 2EE6A 3TCLB 1XGYL 4RX4D 1Z9SA 3PJSB 1CIDA 2VR4A 4XP4L 5EZOL 2XN9D 1FVCA 4GKSA 3FO0L 3EOTL 1T7VA 4TULL 1LEGB 3QQ9C 1DJSA 1S9VB 1IE5A 4P5TA 2FEDC 4P2QE 3FT3B 4UT6L 3MFGB 3J8F7 1L0QA 5IVZA 5CP3H 3N1FC 1M1SA 5IB3B 4PJXB 5CCKH 1N59B 5CJQH 1IC4L 4IOFC 4NO5B 3W9DA 2ICCA 2DIBA 4PLOB 5TF0A 2XG4A 2A74B 4M8QA 3JVGA 1CDBA 4QRRB 3LY6A 4MAYB 2EDEA 2GCYA 1PBYA 2YXMA 4MVBD 1HCFX 2VLRD 4F9PA 3CZJA 3L3KA 3H2WA 3VXUE 5H94B 2J7LA 3CK0H 3AAZB 1WWAX 3R8BB 3MRGB 3QUMA 3WXVL 3VJ6B 2H26A 2A1WH 4G80B 4Y4HB 4JQVA 3NIGE 3V52L 1E4JA 3K8KA 2F5BH 4PRPD 2AXJA 1L6XA 2X4NB 3HB3C 5DJYB 2VDQH 4JY4A 1BIHA 3W2DH 1VGKB 4QKXB 3CC5A 1A4JA 1OWWA 1G6RL 5GIRB 4O5LH 4ZAKC 1A9BB 4PD4K 5IHLB 1NUNB 3NH7L 2BVEA 4ZFOA 2WWKO 4N0YL 1IAOB 1SEQL 1UACH 4M8VA 4YO0A 2ZG2A 2X4PB 4LIQH 4BFIA 5GRWA 1ORSB 5KZCD 2OK0H 3VGAB 2VDLL 2CRZA 4UOJA 4E0RB 3F7RA 1WBYB 4WTXA 4K23L 1LK2B 1AY1L 1I9IL 1QR4A 4PRIA 4U0QB 4ZTPH 3WDIA 3GMRB 5IW1B 4QTHB 1DQQA 1WF5A 3O2DL 4AJ0A 1NCDL 4F7CA 4JFYB 3LH2L 1BVKA 5EUKB 5E99L 4BZYA 3TGXA 4F33B 4RFNB 5GRVK 2VXQL 4JAMB 1CFQB 1BHGA 1DLFH 3QQ4B 2PW1A 4NRYA 5HHPB 1BVLB 3RWGA 1D5ZA 1HHGA 3LQAC 4G6KL 2CMRH 3H0TA 3MNVA 1J1OH 5HYIA 4N8CL 1JUFB 2J4WL 3HI6L 4LAQH 3V6FA 5B4MC 4Z6AT 5IM7A 4XNQB 2CRIA 1UYWH 2AJVH 3MRDB 3O6FA 1HI6B 2J8UF 2H41A 4P49A 4XZUA 5SWQB 4MAYC 4JPWL 5EORH 2Q6WB 3WFDH 1CFBA 3WN5A 5HGAB 4DQOH 3GSOB 3H3PH 1I8IB 4PJ7E 1CXEA 1U8QB 3ULVC 3LD8C 4PJFE 4ZPVA 3G9VA 2NTSP 3WIFA 2FHCA 1A4KA 2ARJQ 4Y2OA 1K4CB 4GAYB 4JKWA 1B4RA 5HGBA 1OP9A 4JO2H 1HN1A 3KPRA 4PB0H 4HG4K 1LQSR 3HNSH 1CICA 3CMGA 4NBZB 3L7EB 3FQUB 2YC1A 5FGCB 2VDNL 2AABL 3TV3L 5J6HA 1L4IA 5MP6H 3FTGA 3VI3E 1OOAA 4PFEA 3NFPA 3GZKA 3ARGB 3OAZK 4ODWA 3KPMA 3QZWB 1TTFA 4GRLC 1NFKA 4U1IB 1UXSA 4UT9L 4X5LA 5GS2H 1FLTX 1JNJA 4LASH 1JGVH 3VGAC 4RIRB 4JHAH 5DYOB 4S1SL 3T09A 3TPUA 1DVFA 3TVMD 1YEIL 5DRNA 2N56A 3NPZB 5SWSE 4OZIB 5J1TC 4CU6A 4C83B 1JNHB 3G5YB 1AD9A 3QDJB 1FLRH 4HS8L 1ETZA 5FYJL 4RGNE 3WL9B 1T7YA 4RFNC 5FYLD 5EUOE 3AMLA 5HHVH 5EOCJ 3VFWB 4D9RE 5DSCB 2GIYA 3PV6A 4P3DA 3L3IB 5E6IA 2E9JA 3AROA 3MBED 2BVYA 4QHLB 1HHJB 3RIAF 4GO6B 5F1NB 2NTFB 1AD0B 3OMZA 4TRPH 3FB7B 2P5EA 3RY5A 1ZT1B 4EZMA 1CFTA 2XYCA 2W60B 4V1DE 1NSNH 3FCTB 4L1DA 4X5WA 4FQQB 4MXWH 3GKWL 5CUSH 2F54D 4I8DA 3F7YA 1ITCA 2J2ZA 1FVCB 2DRUA 4GKSB 4KDVA 1MFCL 2C3VA 5IFAH 2W07A 4HBCL 4JDTL 1QBAA 2X9YA 4P5TB 2ARJA 4HT1L 4OLUH 1QO3A 1ZLWK 1A7QH 5IVZB 4OB5L 1RK0A 5AZ2L 1LO4L 2ITCA 1DDHA 3D3VA 3MLSH 1U8LA 3ZYJA 3OGCA 1ZOXA 3W9DB 4XH2B 3KXFA 4G6MH 4D9LH 2FH6A 4M8QB 1AKJA 1RU9L 5CJOL 4PJXF 5I1IL 5I16A 2AEQH 5A2IH 3HFMH 4RMUA 4EIZC 4R0LA 3LPWA 1KCVH 2BVOB 3ARGC 2GCYB 4D9QE 3MJ9H 5CJXA 5IV2B 3VMOA 3S35X 3LKRB 4ESKA 2P5WD 4HUMB 2RAMA 2H26B 4X6CA 4PTUB 3UTOA 3EOBA 5C9KA 5HDQL 1SBSL 3ULVF 4JY4B 2XNAA 5DLMH 1JF5A 5KBNC 3ZTJG 3CC5B 1A4JB 1NCBL 2QV2A 2E7LA 5IQ9A 3B9KC 3BEWA 1ADQA 4PLJC 5DEGA 5CP7B 1ZVHA 4LRIA 2ZCHH 1RZKH 4OFYD 5E94A 4WENB 4YO0B 2PW2A 4BFIB 3QO1A 3ALPA 5JIHA 4R7DA 2NZ9D 4YHOL 1UB6A 3MUY1 2EIBA 4O58H 1QFUH 1O0VA 5MEQA 4B5EA 3ISWA 1WZLA 7FABL 4OQTL 4OD1H 2VO5A 2SEBB 2WQ8A 1VSCA 1MCWW 1DQQB 5K59F 2V2TA 5FDYA 1KEGL 3CZFB 3SDXB 4F7CB 1YYML 4OLXL 4OD3L 1BVKB 4NQDE 2AI0H 5E9DB 3BQUA 1CFNA 3DARA 2CDEA 4Z7NE 1TQBB 1FVDB 2ATPA 2H2PC 1WZMA 4NRYB 3KLAA 4M7LH 5FF6A 3RWGB 1D5ZB 1JBJA 1HHGB 3OAZH 3NFSL 1N6QH 3U4AA 2XTJC 4M61A 2DQTH 4LP5A 4K3JH 4PJ8D 5L8LB 3KNBA 3GFUA 2ZUUA 1V7NL 1JPSH 2BNRD 3EJZD 4K7PX 3V6FB 3LQAL 5IFJA 2PUQT 2V9QA 4I77L 3O6FB 1MJ8H 3UYRH 3JVGC 1PG7L 4U1GB 4XZUB 4YHZL 2NY5C 3O2VL 5C7XL 1DN2A 1CXLA 3WN5B 4X6DE 4Y4FA 4KUCD 1MFNA 5GGSA 1DE4A 3V8CA 4ZPVB 4HWBL 3WIFB 4J23A 1S7TA 4FTVE 3UROR 4R96B 5KVMC 3R1GH 2N7AA 2CJUH 2H6PA 1ZTXL 2BOBB 4G9FD 3KPRB 3QQ9D 1CICB 3JWDH 1I8MA 1CGXA 2Q8BH 1CTOA 2FEDD 4WY7H 3X14A 4GQ9L 5J6HB 5CZVH 3FTGB 5DVMA 3NFPB 5ISZE 5D1QC 3ES6A 3RAJL 4ODWB 3KPMB 2K9UA 3ZSTA 4ERSH 2CGRH 1UXSB 1GGYA 2B1HH 1F8TH 2JELH 1MWAH 2I27N 1RZFL 3VRJB 1NL0H 2FJHA 2RCSL 3TPUB 3R06A 1DVFB 1HNFA 1ZLWH 4CVUA 3UC0H 2M2DA 2UVEA 3MLUL 4MCYA 4R2GD 5GJTL 3I9GL 3TH2T 5HI5C 4G7YH 1AD9B 3VFNA 2VDKH 2R0KL 3VCLB 5D70L 3GUTA 1ETZB 5DD5H 1UEYA 4OZIF 1TQBC 3PV6B 1EXUB 1EUUA 4P3DB 5KJRL 5E6IB 3HC4L 1J1PH 3HB3D 1U93B 3IU4H 1MPAH 3PWJA 4MNHB 5DK2A 4P23A 3KPOA 4KAQL 2MHAA 1NAML 4XVUC 3DVGA 3QUYA 4OLEA 3O3AA 1RZJC 4ZAKD 2P5EB 4RGOH 4HC1H 5HYJA 1CFTB 5L7XH 3U0WH 5FUZH 5FHBL 2Y6SC 4HS3B 4X5WB 5I1JH 3O6FC 2NXZB 1LO3L 1RIUH 3BP7B 4HFWA 3IF1A 4M1CC 3F7YB 4GMSL 2QJDA 4W6WB 3WN5C 2XA3A 1UCTA 2C3VB 2CLRA 1FORH 1IC1A 2BVTA 4IIQA 1FO0A 4PJGB 3BAEH 4TVPD 2D7NA 2ARJB 2QSVA 4J3TA 4XC1H 5IVXE 1D5IH 2ITCB 1DDHB 3LAFA 3D3VB 2R39A 1P4LB 4PV9B 1U8LB 3OGCB 4N0CD 4MJ6A 1CICC 1SJEA 4UINH 3KXFB 3CXHJ 4I3SH 4FZ8L 2O5YH 1TTUA 3CDFA 4O9HL 3SQOH 5SWSA 1AKJB 5GS0C 3S98A 5I16B 2LTQB 1S9KC 4X99B 4R0LB 1OAKL 3GJFA 4GKNB 2EXYC 4KV5E 4Y1AA 2WWKT 5B4MD 5SX4H 1JRHI 4LL9A 1I1FA 1VEPA 3HUJE 2XOTA 3MLYL 2X09A 4QRRD 3THMH 4KGJA 3QCUL 1DVFC 4LLUB 4U7MA 3WKMH 4GW5B 3EOBB 3GSVB 3H9SE 3VFSA 2CLZA 1ZWIB 1IEAA 2Y06H 1OAUH 5DHVA 5IQ9B 3BEWB 5DEGB 5HYQA 1MCKA 4NP4H 4UIKL 4Y4HD 3WIHL 5CAYB 5EB9A 5C6WH 1OPGH 2PW2B 1T1ZA 2EYTA 4PJ5A 4KKAD 4P2CG 1S78D 4OZGA 1INDL 1OW0A 4K2UL 4R7DB 2VC2H 1UB6B 1P7KA 4YDIH 5MEQB 1CGSH 3PG2A 5K93A 5FYKL 3IFLH 5EO9A 4GSDH 3CDGA 1ZT7B 5F9WB 4JO1H 2AV7A 4NZUL 1BF8A 5EULV 4XVJH 1TVHA 2XICA 3BQUB 2CDEB 1DL7H 4QNPE 1YJDL 3PIQA 4YHNA 3MRMB 3KLAB 2G5RA 4RDQG 5TQ2L 3BVNA 3OZ9L 2CLVA 3SDXF 3ILQC 2FJFA 1KIRA 2Q86B 3PWPA 3FO1A 4UI2A 1A22B 4NBXB 4J6RL 1LDSA 1RMFH 3WDHA 5FGRA 4JN2A 3IDXL 1SQ2N 1IKNA 5F3BA 1FNEA 2A73A 2HT2C 1QFWM 3GSXA 2V2WA 4X8JA 1JPGA 5DK0B 2OL3H 4GXVL 4Y4FB 5J0BA 1JL8A 4N0RA 2WK2A 1UKSA 2FD6H 3WCYA 4WNQA 5GGSB 1DE4B 1XR8B 5CJBA 2PYEA 3MLZH 1S7TB 1YEEL 5L88L 3LOWA 5AUMA 4KUZH 1R3IH 1KXTB 2ICWJ 4FQLL 5DD1L 1BQHG 5C2BH 3U4EB 1I8MB 2AV1A 5T5FL 2ILLA 2VABA 4LCYA 2FX9L 4JFPA 5E2TH 2H32H 5JOFA 4XMPL 2E7LC 1EH9A 4TUKH 1UH2A 3NABL 3ES6B 4HGMA 1FAKT 2VDML 4Y4KA 1AO7D 2OJEA 4NZRH 3V5KB 3IT8D 2K7QA 2FJHB 2IFGA 5DURB 5DMIH 3HPJA 5D7JA 3VFNB 2FECI 3TBTB 3BQUC 3OJVC 1NFIA 1C8PA 5A3IC 4KJQC 4PPTA 3UAJC 4TQEH 3PWJB 3O2DA 5DK2B 3TO4A 4P23B 3QDJD 3KPOB 4JQIH 2MHAB 4JM4L 1MLBA 1E6OL 1VFBA 1G7LA 3O3AB 3QUYB 4QRSA 4PLJD 4FNLL 2EDYA 5HYJB 5ESAA 2MPAH 4F58L 1UWGL 3MLWL 3U36A 1G9EA 1W72L 3DX9B 1FYHB 1NMAH 1RURL 3LS4H 3CCHB 1RZJL 3T08A 3IU3A 1MJUL 2A9NL 4HFWB 5F7LB 4XP1L 4C55A 4Y4FC 3UBXB 4ZUWA 2CLRB 1NPUA 1CF8H 3MRLA 4IIQB 1FO0B 5ISZA 1JHLH 3W81A 1UCBH 2OMNA 1QFPA 3SKJH 4HUVA 1YA5A 1N6VA 3VI4F 3VWKC 2J6EA 4MJ6B 4PJGF 1KBGL 2CKBL 1SJEB 3QEGH 4NT6A 3ZE0F 1T6VN 3FMGH 4P5TD 1MCSA 1JRHH 1Q72L 1KELL 4XPAH 4KK5D 4R7NA 3GJFB 4HKXA 3LPGA 4Y1AB 1UZ8A 5DRZA 4GAJL 2IQ9H 3M45A 2OP4L 4Q9RL 1NCTA 4Z7VE 4UV4H 1I1FB 2MNUA 4XX1G 3S4SA 4K94L 4ZG1A 5EDXA 1JTOA 3VA2C 5DJDA 3NACH 4GXUN 4LLQA 3SO5A 3UDWA 4RBPK 1Q1JL 3BO8A 5FHAL 3T65A 3VFSB 2CLZB 2OR7A 1IEAB 4DTGL 5DHVB 1ZK9A 3HMXA 4W70A 4QHMA 5HYQB 3VFUA 5F1IA 1J8HA 2EYTB 4PJ5B 4K8RC 4P23C 4OZGB 3F8UB 4R90L 4EOWH 2WIMA 3OPZL 3QUYC 1I8LA 1VGEL 4P48A 1EO8H 4KFZC 5EO9B 5IVXA 1BBDH 3CDGB 3EOYG 3LEYL 4M6MH 2VE6A 3SJVE 1TVHB 4YDKL 1IGIL 2QEJA 1HSBA 3PIQB 4YHNB 4B53A 1RUQL 4L8DA 3KLHC 1B9ZA 4IIQC 2VISA 4N0UB 3BVNB 2CLVB 1FIGL 1YEGH 5HI5D 2FJFB 5HYSG 1KIRB 3PWPB 3FO1B 5LKNA 5HI4C 2IBBA 3HUJA 2PO6A 4L9LA 3OJ2C 1QBLH 3GRWH 4NM8L 3UTTE 4OLWL 1IC7L 4YDJA 3QR2A 4JN2B 2LU7A 3DURA 5F3BB 1FNEB 2A73B 5C0CA 3GSXB 3H9SA 5FYKE 5GRXG 2V2WB 4XVUD 4X8JB 1JPGB 1S9XA 1EK3A 3MOBH 5HHQA 4YZFF 2A77L 5LCVH 3GSWB 2Y6SD 4JFZL 4WNQB 4ODTH 4XXCA 3O6FD 3L5HA 2EDKA 2PYEB 1FAIL 3RWJB 3A6OA 1X4ZA 1NGQH 3S5LG 3EDKA 4LCWA 2IBZX 3CVIH 1PKQE 5F96H 4Q6YA 4WDIB 4UNTA 2AV1B 1CL7H 2VABB 1T04A 2Y9RT 4JFPB 3BGFB 4LCYB 4PY8J 1MOEA 5JOFB 3FAXA 2V7HA 1DANU 5H35A 1JWMB 4HIXH 4OFIA 3N1GC 2C3GA 4Y4KB 5DJZA 3KPRD 4R3SA 4QXGH 2HT4C 1CICD 5IT2L 3DSNA 5DWUL 1F6FB 3U4BL 4PJIE 5GGTH 3TWCH 3V6ZA 5T3ZE 1ZLUK 1A7RL 5GS0D 1WIUA 3CFIC 1KJVA 1XAUA 4YUEH 3RI5F 2VLLA 1JI1A 4HEPG 3HPJB 2CR3A 2WLYA 1AGCA 1YYLH 3B8SA 1NFIB 3HE6A 1DVFD 5FAAA 1PY9A 4CADA 2AXGA 4RWHA 4FZEL 2DQDL 1OL0A 3TO4B 2EIEA 5HHMB 1WWBX 3PHSA 4A6YL 1MLBB 1B6UA 3I85A 4NCC2 1VFBB 4QRSB 1G7LB 1OP3K 2BNUA 3RVWD 3HI5L 5ESAB 2XZQH 4FS0A 5F21B 3BPCA 5E6ID 3U36B 4GRWH 5F7MC 3E6HA 2Z91A 3UPRA 5TFSL 2ZJSH 4YIQA 4RBPH 1QRKA 4LSVL 2P5ED 2JJSC 4KQ4H 2FR4A 1IEBA 3MRLB 4LBEA 3VFGH 2NXZD 2XWBB 1RIHL 2AK1H 3MC0A 2HFTA 1MEXH 5DQJB 4HUVB 5FCUH 3C08L 3VGDA 2VJXA 2V17L 2O5XL 3C9NB 3NIFF 1FH5H 4OGZA 5C71A 1OF2B 4MQSB 3ILQD 1GAFH 1SY6A 3RUGA 2E7CA 4XVTH 5GRZA 1UJTA 3FL7A 3MYJA 2BY2A 2YD4A 3L3OA 4OGYH 1J0YA 4GAGH 4R7NB 4ENEC 2YSSA 2H3NA 3D3VD 4HKXB 4NOFA 5E2UH 1H9VA 4G6FB 4KQ3H 1UZ8B 3V2AR 5DRZB 4IOSD 5MEPA 3NMEA 2Y1VA 1GL4B 3KXFD 1D5MA 2UWEA 4QT5A 3S4SB 5CCKL 5CJQL 1AKJD 5DMKB 4G5ZL 5IB1A 3MA7A 2RGSA 4PJ9A 4N90D 5DJDB 4I48A 4LLQB 4LVHB 2C4FU 1SYVA 3BO8B 1DQMH 5D96C 3T65B 1EV2E 1K6QH 3DVNA 2DDQH 2DQHH 1V3LA 4DCQA 4HULB 3W9EA 2EO1A 1HOCA 2BCKA 5F1IB 3MUHL 1ZVSB 2APTA 1J8HB 2E9WA 3TO4C 2XQBH 4LMQE 1N26A 3GBNL 1IM3A 2RBLA 4XPFH 1A1NA 2F5BL 3PGCA 2VDQL 1A2YA 2ADJB 3W2DL 3U9PL 4OZGF 5T33H 4O5LL 2VE6B 2VXTL 2BY0A 3PV7A 1UACL 3LKSA 4PJCF 1W0WA 5EIVA 1HSBB 3SGKC 2AEWA 4QWWC 2OK0L 4QLRA 2VISB 3MXWL 1P4IH 1YN7B 3BP6A 4YFLI 1QKZL 3HUJB 3BQUD 3I02A 2PO6B 1JVKA 5A3ID 4L9LB 4KJQD 4G43B 4R97B 1ZLUH 2C1OB 3UAJD 1AI1H 1BLNA 3TNNA 1L6ZA 3DURB 5C0CB 3FN9A 3H9SB 1DLFL 1MHCB 3PL6A 3K4AA 5C07E 1S9XB 5FM5O 2XKUA 3GB7B 3VFTA 4PJDF 3OSKA 4ZTOL 5HHQB 2CMRL 5A43C 5JIPA 3LEVL 3C6LC 3H9ZA 2J5LB 4LAQL 2IAMA 4LCWB 5JLZB 4OLVH 1XF1A 1UYWL 4OIAA 4Z7OF 4Y4FD 4LVHC 2LVEA 1E4WH 5TDPA 3ZDYE 3DMMA 3SGEH 1BF2A 1T04B 4FFYH 3WFDL 1BQUA 2D4DA 5H35B 4DQOL 5IVXB 4KDWA 3SJVA 5C92A 4WVRA 2P45B 1KTDA 2R1XA 4R3SB 4RNRB 5DJZB 3BKYH 1T1WA 4OTXH 4X9HA 3V6ZB 4PB0L 3HNSL 1BEYL 1WBXA 1KJVB 1MI5E 4AQ1B 3BPNB 1T0MA 2DBLH 2VLLB 1IGFH 5TPWH 5I76A 5MP6L 1SVZA 1AGCB 1RSFA 3UTTA 2CXKA 3PWNA 2Y5TA 1BECA 1LO2L 5KVFH 1KN2H 3HE6B 1Q9WA 3SGJA 3PWVA 3JWNC 3W11C 4CADB 5DURD 4LASL 2AXGB 4JGMA 2H45A 3U7WL 1JGVL 4MHHI 5E70A 4JHAL 4U4BA 3TZVA 2C7UA 4NNPL 2FIKA 2OTPA 1NLBH 4ZUVA 3MQIA 1L0XA 2BNUB 2PO6C 5J89A 1CXIA 1HEZA 4DJMA 4KRLB 4L9LC 4UNUA 4R97C 4P59H 3O3DA 3BPCB 3QP3A 1NBVH 4ZO9A 2Z91B 3UPRB 4K8RD 4P23D 4WGVB 3BIKA 4YIQB 5HHVL 2Z31A 5D72H 3QUYD 4NKQB 5I18L 5MHSE 1UG9A 1N6UA 2FR4B 5HYJD 3B3IA 3F7PC 5FO9A 1IEBB 1JNNH 5F9DC 4XXCC 4LBEB 4MMXC 1P4BH 4TRPL 2VLME 3GHEH 1FNSL 4ODXA 1MJ7H 2HYMA 1NSNL 1T5XB 5IMKA 2BNQA 4X7SH 4B50A 3ULUC 1VFAA 5CUSL 4EXKA 4I9WE 4K3HA 3RUGB 3MV9E 4XAWH 5LWYL 5HI4D 3L3OB 5IFAL 4YQXH 2YSSB 2H3NB 4YAQA 5MEPB 1A7QL 4R26L 1D5MB 2UWEB 4QT5B 1T5WA 5JHDE 5SWSD 3UJJH 3MLSL 3ARDA 3MA7B 4G6AC 4JG0L 4LSRH 1E27A 2YWZA 3SE4A 4I48B 3BPNC 1QFWI 4Y1AD 5E1AA 2YPLE 3OJMB 4D9LL 2IC2A 2R0ZL 4TVSa 5EIQA 1SYVB 5GZOC 4D9RD 2AEQL 5D2NA 1KCSL 2WBWB 3DVNB 3HFML 1T21A 1KCVL 3TO2A 5TF1L 4DCQB 1WK0A 2GW5A 1CE1L 3MJ9L 4AL8L 3HE6C 5GRVL 1HOCB 4KTDH 2X42A 1X5JA 1OTSC 5DT1H 2D0HA 3L5XH 3DV4A 1IM3B 5B8CA 2XIDA 2XKNA 1A1NB 4X7DC 2EXWD 1A2YB 2I5YH 5DLML 4F8TA 1LD9B 4AEHH 2HT4D 1U8MA 4PJ5D 4YFDB 2AEPL 5MI0B 1JYXA 3VXPA 4KHXH 2Q7YA 2C3HA 3ZE1E 3T0BA 1W0WB 3LSOB 2ZUWA 4YGVA 3GMQB 1E4XH 2BK8A 3UTPD 1XF3A 2W65A 4ODUA 4WI5A 4O58L 1QFUL 3X17A 2HLFD 1KB5A 3BP6B 4I0PA 4OD1L 3BKMH 1OM3H 3DVFA 3LQMA 6FABH 3O3UN 1BLNB 4JHWH 2DQIH 3O4LE 5EC2A 5C0AA 3TNNB 4D9QD 1EGJH 1LDPH 2AI0L 2H1PL 3DUSA 4U2YA 3PWPD 3KDMA 3PL6B 4M5ZH 4M7LL 4FMFA 2F53B 4CDGC 3VFTB 1AGFA 3JBG7 4XNYH 1J7VR 2DQTL 3CU1A 4K3JL 3M17A 4IEFB 1HIMH 1JPSL 4LIQE 5GGUA 5CEZH 3DUUA 2IAMB 1V3KA 1MJ8L 2YPKB 1IBGL 4C54A 1UZ6F 4WU7A 5C0IB 4XCEA 5TDPB 2XRAH 2J12B 2P43B 3CU7A 2PYED 4PGJA 4ELME 1GGIH 2UV3A 1CFVH 3ULUF 5CZXD 1CIUA 1KTDB 2DWEA 2QSTA 5ALCH 3U30C 1HHIA 1G6VK 1T1WB 3L95A 2VXUL 1OSPL 2R1WA 1JWUA 1VHPA 4ENED 3JWDL 1WBXB 3VGFA 1T0MB 4Y4KD 3TBSB 2Q8BL 3X3GH 1IGYA 4ONGH 5I76B 3D5OF 2ZPKH 2MKWA 4PGDA 3PWNB 2Y5TB 2VDOH 4ERSL 2CGRL 1Q9WB 2GSGB 3PWVB 5C0GA 1I7TA 1N7MH 4MNGE 1I1YA 4OKDA 4PJBF 4Z76A 2B39A 5DEFA 1WAAA 5D7JD 3MOAH 1NL0L 3TZVB 1AFVL 2C7UB 1XFPA 1RJYA 2FIKB 2HA1A 3WLWC 1HEZB 5IK3B 4G7YL 2VDKL 1AGDA 4JQXA 3U0PA 1N2RA 2A0LC 4YDLC 5DD5L 3ZTJH 3TO4D 4MQTB 5HHMD 4JO4H 2Z31B 3QHTC 1T20A 3IU4L 4IRSA 5I9QB 3RA7L 1FFRA 3BN3B 3O11A 3GO1H 1OSZA 3QZWG 4LKXA 2GFBA 3RP1A 4RGOL 4GMTH 3BD5A 4JGUA 4ODXB 1CWVA 4DVRH 3U0WL 4H8WC 2IAMC 2BNQB 5IMKB 1N4XH 3EYSH 5I1JL 4UTAH 4WTWA 5D1XA 1DQDH 4AG4H 1RIUL 2X9XA 3P73A 4Y5YA 2R23A 5ISZD 1NUFA 1EPFA 3KGRA 5DVKA 2YD5A 3MNZA 4POZD 3ULUL 5F6HI 2V2XA 1F2XK 3BAEL 1YEKH 3TF7C 4YAQB 3K80A 2NY7H 1CDUA 4XHJC 4FMKA 3WSQH 3RUGF 1T5WB 1D5IL 1AE6H 4NKDA 3VW3H 3PWLA 5BW7A 2GJZA 1XMWA 3ARDB 3B5TA 4JKKA 4OI7A 3VD9A 4L4VA 3GMMA 1H3XA 5BQ7B 4I3SL 2NZIA 4G6FD 4IRZH 4PV8B 2AVGA 1ZS8A 2UWEF 4MDIB 3EGSA 3IETA 5J4MA 1T1XA 5D2NB 4KI5C 5EOQH 1T21B 4C58B 3TO2B 4M7LT 1QRNA 4ZNCD 3OR6A 3K2UH 5I1HH 3IJHA 3FZUD 5DR5H 5B3NA 1BP3B 5LGHL 4MCZA 3CH1A 1UGNA 1F45A 2XKNB 2VL4A 3WKML 5FGSA 4J8RA 5BXFA 3QHZH 2Y06L 1EIBA 2ZUYA 3Q0HA 1W2KT 5GISH 1J8HD 1U8MB 4LPYA 1TNNA 4NP4L 2ZKHH 4A6YA 2Q7YB 4I0CC 2Z31C 1OPGL 5I9QC 1G7MA 1RV6X 4YGVB 2MQ3A 3DGCR 1ZAGA 3HHRB 1XF3B 1R5IA 2W65B 4ODUB 1VKXA 3GSQA 1FGVH 4YDIL 1CGSL 3IFLL 4I0PB 4GSDL 5JHDA 4HF5H 1N5AA 1U8PA 2VUOA 5ICYA 4JRYE 1YY8A 3CX2A 4ORGA 3T77A 3W11D 3D9AH 5EC2B 5C0AB 5DJCA 4LGRB 4IS6A 3DUSB 3T4YB 4GG6A 3HC3H 3C8KA 2PO6D 1VACA 1GGCH 1QYGH 3QXDA 1AGFB 5T1LA 3UCRA 5C3LD 2JIXA 4FN0A 3KYNA 3M17B 4R8WL 3QXAA 5C0CD 5GGUB 3H9SD 3DUUB 1JFQL 1I3GL 3RWEA 5ACLA 1JZ5A 2AJZA 1U2HA 2E8ZA 3D18A 1RMFL 5E2VH 3SE4C 4NKMA 1XGRA 4WU7B 4XCEB 2X05A 1L9NA 5CP3A 5D2NC 3ZKXB 4S1DD 2OL3L 4HXAH 4XGZA