3EYOB

Crystal structure of anti-human cytomegalovirus antibody 8f9
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
225
structure length
212
Chain Sequence
QVRLVESGGGVVQPGGSLRLSCEGSGFKFGDHGIHWVRQAPGEGLQWLTVISSDGTDERYTDSVKGRFTISRDNSKNTMSLQMNNLRPEDMGLYYCARDGKYSGLLDYWGQGTMVTVSSASFKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 8f9 Fab
publication title Germline V-genes sculpt the binding site of a family of antibodies neutralizing human cytomegalovirus.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 212
sequence length 225
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eyoB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eyoB01
4EI5A 1IM3A 1IFHL 4Y2DA 5D6CA 4IRZH 2QHLA 2R1WA 1F5WA 4DKAA 3UYRH 2L7UA 2F5BL 3LRGA 3IYLW 3BSZH 4PP1D 4P2QE 1FN4A 5KVGH 5CMAB 1C12A 2OL3A 1KB9J 5DMIH 1MRDH 5K9JH 3BH9B 1FL5A 3DX7B 4FFYL 4WWID 1C5BH 3VI4E 2N56A 4NQVA 5IB1B 3RGVD 1IEHA 4ALAL 5GRJH 4M3KB 5E6ZA 3RTQD 5C3LD 3CLFL 2F53E 1NFIB 3K7UA 4IOSD 3V0VA 4X7TB 5HHMD 3VXME 4MVBD 4Q0XL 3VFVA 5HYSB 4U6VL 3FHQA 5GIRA 1DSFH 4EOWL 1DBMH 3VFRB 4LLVA 4MZ3A 3OL2A 5DGRA 4R9HA 4L29A 1YEGH 4CVZA 1LEKA 4DN3H 5F96L 4JY4A 3IJYB 4OZHE 5E9DB 3X3GH 2O61A 1SY6L 1CXEA 1UXSA 1VFMA 4F80A 2FD6L 5L2KE 3HZMB 3LKNA 4CN1A 3O6LL 1QZ1A 2GITB 3QEGL 2VSDA 5DR5H 2Z93B 4QHLA 3LKQB 1YEJL 2FEEI 3B8YA 1LK3L 4FABH 4ZQKB 4YHML 1N0XL 4LPYA 1S9WA 4JFHD 5JLZA 4YE4L 4LSTH 3FO9B 4JCMA 3O9WD 4JGUA 5FYLD 4AEEA 1OAQL 4Y5YA 3HNTH 3BKML 4QHMA 2VABB 2B39A 4LCUB 5DSCA 1DLHA 2Z8SA 1CICB 2IQAA 1FH5L 3KPSE 3UC0L 4QXTB 4NC1C 4JPVL 3LRHA 3RWEA 1CGTA 3T3PE 2ATPA 5D7JA 1XCQB 4POYA 2Y6SD 3S4SB 1JZ8A 3WJJC 3PGFH 4NRZA 1CDCA 4XXDA 1WFTA 3LQAC 3BGFC 4I77H 3TBTB 4W4NA 2Y72A 3NFSH 1H3WM 4Q97A 1SY6A 1AKJD 2XZAH 2BSRA 3I9GH 4GMSH 4UT9L 3D2UB 4ZPTA 4KI5C 1I7TA 5J4MA 5DK2B 4OI8A 1JK8A 3R8BB 5F7FA 2BX5A 4OIIH 5JMRA 2VDKL 4PG2A 3MV8B 4JO2L 3P0VL 4JPIA 4NO0B 1JWUA 1BZ9B 1AQKL 1WZKA 1MFCL 4MQXD 1EBPA 2JE8A 3B9VA 2FL5A 1NC4D 3M17B 2A77L 5IIEA 5JDSA 3G6JA 5CUSH 1IEBB 1NGZA 2H9GA 4NM8L 1EHLH 3QCTH 5ESAB 4ZPVA 2ZUVA 5FECB 3CGTA 4RAVA 1NBZB 1GPOH 3ZSTA 2AGJL 3KVQA 3KWWB 3SKNA 1DVFD 2APBA 4JKPL 4OZ4B 5IVXA 5HPOA 4FQCL 3UYPA 2X7LB 4F15C 4GKZA 5E6IB 2AEPL 4OD1L 4WU5A 1A7QL 1BFVH 2I26N 5E5MA 4HKBA 1EVUA 4YNYA 4E41B 2DAVA 5F6HI 2VL4A 1OAZH 4KKAD 2AJZB 4DKFL 1V7ML 1T3FB 3DV4A 4JFXA 2RGSA 3OZ9L 5MENA 2VLKA 3MRGB 2CDGB 1NL0H 4EI6B 3QIUD 5DHVH 1SEBA 4ODVL 2F74A 3AC0A 3ARFC 3BKYL 4FMKA 3MODH 2DJSA 3IU3B 3R06B 4HUVB 2A74B 3QNZB 1EUTA 3HC0A 4YXLH 3LRSA 2VDRL 4HUMB 1K8IB 2ITCB 1IGYA 4YHPA 1G9MH 4WW2B 1X5YA 2J5LB 4N8CH 4M1DL 4XNMA 4G8GA 5FF6A 2FO4A 1CTNA 1I9RH 3LKOA 1KXTB 2XZQH 3UDWC 1WZ1H 4PRDB 5I74B 1FNEA 3V7MA 5C0EB 3M45A 4HJGB 4OLWH 4X5XA 1OP3K 2HLAA 5SWZA 1UCBL 3X3FL 3BXNB 4FA8A 2VDLL 3G6JE 3OKNA 4ENEC 5CILH 3F7PC 4HWUA 1FG2B 2Y5EA 3KS0J 3VFTB 3KLAA 2V7HB 4LCWD 2GAZB 1U8HA 1CFQA 1A7BA 1CL7I 1XR8A 1CXKA 3AXLB 4QNPE 2D0HA 3ZYOA 5IVXE 3ARDC 1XIWB 5DMJB 3VGBA 3RWFB 1YEKH 3N9GH 2V9QA 3GSNH 1N64H 2EYTA 3OKEB 1M7IA 1KLGA 4JFEB 4PJ7F 1VGKA 4LSVL 3QUMB 1JGVL 1K6QH 1NBQA 4Y4KC 2AW2A 3IDNA 4UILH 1RZFH 4FG6D 2A6JB 5KSBA 4MDIB 3LY6A 1MCHA 3QPQD 5C0JB 5MENE 1PW3A 4FQXC 2VLKE 1TLKA 2AJ3A 3P9MA 4LDOB 2D0FA 2JB6B 4IHOB 3T2NL 2NW3B 5EO1B 3U0TA 2QSCL 3RWGB 5BVPH 4GQ9H 3AMLA 2WZPD 2F9BT 5C92A 3QIBB 4KKBD 2J6EH 4ISVB 1CFTA 3FB8A 1G7HA 1T4KB 2RJMA 4HHAA 1T66C 5DJ8B 1Q72H 1CDHA 1W0VB 4QGTA 4PJEB 5A1AA 1K2DA 1YMMD 3CFKB 4AQOA 5I8EA 5ITFA 1VESA 5MHSD 3U6RA 3UTSD 4YDLB 4BKLB 3ETBF 5IBTL 1YNLL 3JUYA 4YR6B 4G8IB 4ZOBA 4G8GE 4ZD3H 3W9DA 3H9HB 4XNQB 2P4AB 3S5LB 4MXQD 3MJ9L 3OXSA 1NLDH 3UAJC 2FR4A 3EFDH 4P46C 4KRNA 1NGWB 1MCRA 4EDWL 5DK0B 5SWZE 3CVHH 4LHUA 4N8VA 5AZEL 2HKHL 1F13A 4NQED 1BQLH 5CJ8A 2J8UF 3NOIA 1DBBL 1MQKH 2IEPA 1NAML 4XP6L 5HYJA 1DR9A 1YDPB 4LCCB 3SDAD 3MGTA 3VXSB 1BECA 3GGWA 4L5FH 4DN4L 3OKLB 1NGQL 2BVOB 1RZJC 4KROD 2AV1A 1ZSDB 4MA1B 4D9LL 1F45A 1WUNT 5JTWA 4C58B 1RVFL 4LP4A 4KFZC 3PJSB 1U8PA 4KK6C 4IMLB 1WGOA 5BQ7B 1HSAA 5KSBE 4WV1A 4D0DA 3W2DH 3DX6B 1CTOA 4FZ8L 2P8MA 3HFML 4U1KA 3BD5A 1YEIH 5B4MD 4L9LA 2PXYB 4Z7VB 3LHPH 5FA4B 2WP3O 3DMMC 4BM7A 2OTPA 1ZLSL 1FLRL 4UT6H 4FS0A 3RP1A 4EI5C 1NGPL 2HT3C 5TDNB 4C54A 3G08A 4JQIL 4PGZA 1U3HB 1G9NC 2EXWD 3VXNA 1F11A 4HQQL 1R0AL 5E8DL 5DXWA 1U8IB 1DL7L 4MNGB 3RWJB 1FNGB 1AXTH 5FV1L 2HJLA 3I6GB 1JRHL 3BT2H 1IM9B 4HBCH 4N0UA 1OTUD 2OX5A 1QOKA 1R3IH 2CGRL 4OM1L 1PBYA 2DWEB 4F9PA 2X4TA 2J4WH 1WEJL 1MFNA 4NO3B 3MLYL 3U7YH 2Q87A 5EC2A 2WUCL 5CS7A 1CGSH 1RIVL 1HI6B 1OPGH 4LHUG 4N8VG 5A2FA 5CGYD 5HYJE 4Z7WF 2IAND 1HHIA 5I30H 2DJ4A 2VE6A 2VXUL 1N8ZA 4QRTB 4BSVB 1HHGB 3C6SA 2BCKA 3QJFB 5I2IA 1AIFA 3FTGA 3X13B 2H26A 3SKUD 2AXJA 1SVZA 4G6AC 1I85A 2JJVA 3PNWB 5C0CB 1B2WL 5FIEA 3N50A 4KDTA 2YKLL 4JFZL 1VACB 2A38A 2IAMC 5DQJA 2Q20A 1A1OA 4Q58C 1JZ7A 3B43A 4OI9A 2BY1A 1TMCB 4X6DA 1CT8B 5J6GA 3K2MC 1IEAA 1HSBB 1IGJA 3V6OC 3QUZB 1CE1H 1MFBL 3S97C 1RZ8B 5DJDB 4O58L 2OMBA 4YBQC 4OCYH 1N5YH 4PREB 4BQ6A 2CKBB 5GS0H 5F7EH 4UQ3A 3UTQB 1DLFL 3EO1B 2NY7L 1AH1A 4HKZB 2DMBA 4C83A 4PJ9B 2NY6D 43CAB 2DM2A 4XP9L 5D7JC 2VZ3A 3QFJB 3D85A 5D5MF 1OAUH 1FPTH 2B20A 4XPBH 5D2LB 3OAZK 5T3ZH 4ZUSA 5E00A 3QZWG 2QQNL 3MCKB 2DTMH 1AP2A 4JN2A 4N0UE 4FXGB 4X9GA 4HDIA 4N5UA 3QRFM 3NIGF 4QRPD 2P46B 4YC2C 1VCAA 1NC2A 4LSPL 5CZKA 3P3YA 4AEIL 5TPWL 3HI1B 5F72S 5C0BD 4CDGC 2R4SH 5IHUH 4WEBL 4PRNB 4QXGL 1GGIH 4KWUA 4XWGH 4Z6AT 5J13B 3EJYD 4NT6A 4XWOD 1JNNH 2BC4A 2ZJSH 1RZIA 2IBGA 3KPMB 5CSBA 3VWKA 1W0YT 1SVCP 4JZJB 4DQOH 3QXVA 1N4XL 4J4PD 5FUCC 5AZ2L 1A3LH 1VA9A 3QBTB 4YDIH 3L3IA 3KDMA 4QXUH 1YEHL 1JUFB 3ZT6A 4CW1A 1KC5H 4FMFA 4BH8A 2LU3A 4X6DE 1RK0B 2CLRB 4AENB 4CMHC 2A6KA 1KCUL 4YIQA 3F62A 2EYSB 4Z7OF 5KS9F 5KG9A 4QXWA 4KGJA 1A6WH 3U7WL 3EIFA 3VXOA 4YFLF 3ARBB 1RU9H 5KW9L 4IIQB 3S35H 1OB1A 4ZFFA 5HVWA 4NQDB 3HMXH 1DZBA 2C3VB 2FX7H 4RFNC 3PWLB 5HJ3B 2C3GA 5JUEL 3T4YB 1I9JH 1EJOL 5HHVL 4K7PX 1IQWH 4PRIB 1DQQA 4MWFA 3O4LA 2AJYH 4H26A 1PSKL 1WC7A 4NUJA 2ICEA 2VMFA 4GLRI 1XGUB 4PRAA 5BJTA 2W0KA 3R0NA 4RAUA 2UWEB 1JPGB 3HC3L 2WWMD 3NTCL 4QOKD 1MWAL 2OZ4L 1W0WB 4P23D 2WIIA 3PP3K 4TSAL 2YD5A 1CK0H 5C2UB 4DZBA 1MFEH 4KVCH 2H8PB 4U0RC 1QBML 3EOAB 2FHFA 4NRYA 4L8SA 4PJDF 5EU3A 3ZTJG 5CCKH 4PBWD 1R5WB 3WS3A 1T2XA 3QULA 1MHHB 1R5IA 5D70H 3IF1A 4S1RH 5INDB 1FDLH 4LF3B 1I3RB 3U83A 2Q8AL 1C08A 4N1EA 3QDAA 3P0GB 1N59B 3DI2B 4PJAF 1U8KA 3U36A 1MNUL 2AK4B 1TZIB 4Y1AD 3RVUD 2IQ9L 5F7MC 4PJGA 5F1OB 5D7IB 5GISH 2ESVB 3S36X 4FFZH 2WQ8A 1IVLA 2BRRH 2NNAA 1CU4L 5ENWA 5HHXH 1U8NA 3ARFB 4LU5L 5T1DL 1HXMB 1IBGH 4XNXH 4TPRH 3V8OA 5IQ7H 4YHYB 2QTEA 3BD4A 1JPST 1WFNA 3KS0H 3NN8B 1QRKA 3GNMH 2HTKD 1VPOH 3EDEA 5EZJA 4Z18A 1CF8H 1OTSD 4J12A 4O02H 1BJ1J 5DEFA 2CLVA 4X80H 1I7ZA 2CR6A 3TPUA 3GMQA 1M7DA 5GSVA 1S9XB 2EDXA 1VFAB 5F7HA 1U93A 1W72A 3SCMB 1E28A 4HZAA 4DAGL 4HIHB 5E70A 4U3XA 5ID0B 2O5YL 3BP7A 1S9KC 4Y88A 1FJ1A 4YEEA 3C6LD 4Y19E 2A6DA 3MLRL 1FIEA 3ARDB 4MD0A 3FAXA 5K33A 3RU8H 3M8OH 3TESA 4NWUL 1WQVT 5J89A 4XPHL 4Y4HD 3PGDB 4OCWL 4YWGH 1ZLWK 4MXVE 5FYJD 3KXFA 3MOBL 4U1JA 3FFDB 4L4VB 5LKNA 4PJGE 2CUHA 3WHE0 4HLZG 1MOEA 4J3UA 4TUOA 4YEFA 5B8CC 2C7UB 2FEDC 2DD8L 4MB4A 2XYCA 1WBZB 4OF5A 5FA3A 5DFWH 3TZVA 2ZKHL 2B0SL 2EZ0D 3STZA 3SGDI 1HZHH 3O3DA 1BVKB 4OCLC 4BELD 4N90D 4Z5RB 25C8L 1RAMA 1A4JB 3KYMA 5A40E 1U3JA 1AI1H 3J7HA 2XPGB 5D7LA 5LGHH 1D9KD 4P2QB 3GUTB 1P4IH 4ONGH 3VFUB 3DTXB 3C60A 4LBEA 3PWPA 5AUMA 5L6YH 2G9HB 4XCYA 3NPSC 5C07B 2EIDA 1DEEA 2F58L 3MV9E 4P46B 2D3VA 3I84A 3U4EA 1BJMA 3LQAH 3NFPB 3GSWB 4IEFB 3VXMB 3MO1B 4NOFA 2FH8A 2Y5TB 3CH1A 5IEHA 1JWMB 3P9LA 3VFOA 4ZO9A 5K59E 1QNZL 3F7VB 4O5LH 4F9PC 1N3NB 3F7YA 5IB3B 1RJZB 8CGTA 3QQ3A 2VLME 1FL6B 1PQZB 2FB4H 4YXHL 1ZLVK 4MAYD 4H0IA 5CLTA 4P3DB 3DUSB 2A9ML 2BVEA 4PV9B 2D9CA 3QUKA 5D96C 1IGFL 1AQDA 3TBYB 4P99A 3WFBH 1U95B 3BGMA 4ZFZB 3JWDL 3KXFE 3OAYH 4W70A 3EYSH 3FT4A 4B41A 3ZDXF 2DQCL 4EQ2A 1TJGH 4YFLI 3ZO0A 2M8XA 5KAQF 1T5WA 5FK9B 3ZKQD 1I85C 4D9QE 1YN6B 5EPMA 3X14A 4G42A 3DO7A 2HLFD 4YUEH 3K81A 1KEGH 1JN6B 2DQJH 3O2VH 3SGEI 3PIQB 5C08B 2WMPA 5CBEB 5DVMA 4EI5B 4PYGA 3H9ZA 1IM3B 3MLVL 2F5AH 1T04A 3QHFH 1UM4H 4Y2DB 4DOHE 3RWCA 2R1WB 2BNRD 4RSVA 3KYNA 1F58L 1FN4B 4YAQA 4HXBL 1X6LA 1OAYL 1C12B 4NHCL 4X99A 3PWPE 3TO2A 5D72L 3WEXA 2E6PA 3B9AA 3BPLC 2VN4A 1YC8A 3QSKB 3T4AA 4IMKA 4QTHB 2VN7A 1QKZH 5IR1B 2W9EL 2Z92A 3HPLA 1CLZL 1JGDB 3V0VB 4XTRC 1UYWH 2E9IA 5GIRB 3FOLB 5F1IA 5DA0B 1JNLH 4L29B 1LEKB 1EEZB 3MACH 4YK4B 3CUPA 4NNYA 1HEZA 2OLDA 3BP6A 4AIZA 4IJ3C 3FO2A 3GBLA 5GRWA 3LKNB 1N7ML 1SBSH 2PN5A 1T1WA 3UTPE 5ALCH 1KN4H 4QHLB 1I1RA 4Y4FA 4D0BA 1JGEA 1S9WB 5JLZB 4CBPA 4OZIA 3AVEA 2FJHA 5CEZH 4ZDHA 1NCWL 3VD5A 2XA8H 3QP3A 4Y5YB 3D0VB 3RAJL 4WI4A 2DOCA 3I3BA 5I1GH 1J5OL 3G6AB 2V2WA 3ROLA 4JGMA 3CDYA 4GS7B 5F7UA 2R69H 5KSAD 3MLSL 2Q8BL 3OGCA 2ATPB 2Q76A 3IRZA 5I71C 1Y0LB 3RJDA 1LP9F 1CBVH 1N5AB 4NRZB 2V9RA 4HIEA 4XXDB 4E0RB 1QBBA 4M48L 3KLHC 1OD9A 3OPZH 3H3BC 3MLTA 2I60L 5I15H 2PW2B 3STLA 4QY8A 2QEJA 1LE5B 3RPIA 1JNJA 1I7TB 1NGYA 3MV7E 1GCFA 3BPCA 1A7NL 3SPVB 1OGAE 4IRSB 4P5TC 1JWUB 5IW6A 4X9FA 4OJFL 1RZKL 2FL5B 5F1SA 3WKNA 5IIEB 3G6JB 5HBBA 1WJ3A 1KCSH 3WL9B 2XWBA 1NGZB 2H9GB 2HN7A 3WIIL 1JF1A 4ZPVB 4IRJD 3A6CH 4RAVB 2YD3A 4B53A 3MOAH 2ZCKL 4YHIA 5JW5B 5I17A 4G6FD 3WFCL 3CXHJ 4R3SB 4W81A 1J8HD 2I5YL 2IMNA 4KV5E 1RQ5A 4CMHB 4L8DA 4OZIE 1J86A 1OLZA 4Z7UE 1QSZA 4APQD 3L3OB 5E5MB 3C8KA 1RMFL 2VXSL 4RWYL 3TA3D 2UV3A 3DSFH 1E6OL 3QR2A 2YS4A 3ES6A 1RZJH 3DV4B 4MJ5A 4JFXB 4AT6A 1JI1A 1A7PH 4KVNH 4P2YA 1MI5E 4GKSA 3RWHB 5MENB 1MCBA 2VLKB 4RCAA 1B3JA 4PS4L 1JGLL 2NTFA 4J7RA 2BVYA 1OM3H 1RUAH 2R1XB 1JV5B 5FYLL 3CH8A 4DTGL 1YZZA 4NOBA 4BZ2L 1PX4A 3HC0B 3RGVA 5DS8A 3RTQA 5C2BL 1CXLA 3PABA 1IGCH 4WUKL 1T83C 3KPPA 4KGLA 2EXYC 1JYVA 3MRMA 3NCJH 3ZDYE 2FO4B 5TH2A 3BP4A 1J1PL 5DJ2A 4AJ0A 1KBGH 3LKOB 4R90L 4POZD 4OCSL 3O6FC 1G9NH 3S7GA 1FNEB 5F7KC 2IFFH 1UG9A 4NGHL 2NZ9D 1HCFX 3OKNB 3SDYH 3PL6C 1IARB 2OL3H 5HI3D 4WUUD 5EBLA 1C7TA 4HS6A 3FHAA 3KLAB 3GSQA 1U8HB 1CFQB 4FXKA 2VDPH 2XQBH 4NJ9H 2DYPB 4WVRA 3QA3A 4MQ7A 2EH7H 1UGNA 1PLGH 1JHKH 1BJ1H 1K8DB 1TETL 4EEEA 3O9WA 2AXGA 2E27L 5D9SA 4MA3A 1M7IB 1KLGB 4KK5C 4J8RA 1VGKB 4TRPL 2OTWA 2OTUA 4XPTH 3T8XB 4CN6A 1SBBA 4EDXB 3MC0A 1DUZB 3LD8C 4WTWA 5C6TL 3BPOC 5JA9A 4I3GA 1UACL 2O5XH 4P4KD 4CN4A 3HE6D 3MRRA 3RGHA 1IFHH 5HY9A 5MEQA 3U0TB 2DI7A 3TZVC 3QH3A 4O2FA 4BUGA 1NEUA 1AKJA 4PLOB 1T7ZA 2F5BH 1PY9A 1CFTB 3QB7C 1B0GB 3FB8B 4HKJA 1G7HB 3TNMB 4HHAB 5DK3A 2ZG1A 5GXBB 5ECJE 3D39D 1S8DA 2VZSA 3EYFA 3IDYB 5HHME 2E7CA 2X4OA 4RMSA 2IPUK 4FNLH 4WCYH 4OKVA 5GZNC 3CLFH 1XF3A 3W9DB 2G60L 4FQHA 3OTTA 4U6VH 3GMOB 5DURD 4EOWH 2FR4B 1NC4A 4KHXH 3UO1L 3OKOA 4LHUB 4N8VB 3D69B 5F96H 2R2BB 3U30C 1SY6H 3LZFL 4AH2A 5EFIA 3SN6N 1BBJB 5F9OL 2FD6H 4G43A 5GRVL 1I8LA 1DVFA 1D5ZA 3O6LH 3CZJA 5FDWA 5JA8B 2NLJA 5T1LD 4JFHE 1YEJH 2NCMA 4RDQG 1LK3H 1MHEB 3RPKA 2AV1B 4U7KA 2ATKA 2I9TA 1N0XH 1SMAA 1VFUA 1D5MA 4IOFD 5FYLE 1KT2B 5HHQA 3I2CL 4M6NL 3RWIA 5JOFB 1T03L 4YE4H 3MR9A 4L1DA 4QRUA 4M5YL 4OGAC 1HSAB 1OAQH 3BKMH 4WV1B 3UMTA 4LEOA 3SKOA 5IK3B 3F58L 1D6EA 3CFJB 3UC0H 3CX5J 4JPVH 3O8XD 1WAAF 3MGOA 5TQ2L 3F7RA 4L9LB 5J3HC 1AXIB 3BAEL 3JWOL 3HUJA 1QLRA 1J0KA 4YXKL 2GCYB 3P77A 1FE8L 3ABZA 1U91A 4ELMB 1EAPA 2LFGA 4RGND 3LPFA 3SDXA 3G08B 4NKOA 4JN1L 3H6JA 5T3XL 4UT9H 1F11B 1FYTD 4B50A 4LVOB 3W39A 3IFPA 2MFNA 4MCYA 1WBYB 4K9EL 4BA8A 2VDKH 4JO2H 1F6AA 5CIPA 3P0VH 4TYUA 5L2JA 1AQKH 2L4OA 1KJMA 4DCQB 2X4TB 4R2GD 1SYSA 1MFCH 3MBED 4PLJD 5JQ6L 1HYSC 3TBWB 2A77H 1QLFA 1TNMA 1RZ7L 1S7WA 3GBML 2DLGA 4OZGA 4YX2L 1DBAL 3AROA 3T04D 4LCWA 4MJ2A 5L7XL 3JWDC 3MA9H 4NM8H 1MCDA 4P2RD 1ETZA 4TTDD 1HHIB 1U8MB 1N8ZB 5DI8A 3C6SB 2ADGA 4HK3N 2AGJH 5I2IB 1NH6A 3FTGB 2WQRA 3L9RA 2VLJD 4JKPH 1A14L 4NN7C 4JZOB 3WHXA 3EHBD 5F9AC 2AEPH 3RZWA 4CL7A 5DQJB 5GS0D 2Y23A 4OLVH 4Y4FC 2PYFB 3O3EB 2VZTA 3ZKMC 4XMKL 2DKSA 1K3ZA 1LHZA 1OP5H 2CXGA 1V7MH 5HGAA 5J6GB 4JPWL 3OZ9H 4KRPB 3L3KB 4DKEL 4Q9QL 4U33A 1ZLUH 3T0ED 2W65A 3HUJE 4GRLC 4K3DL 1JJUA 4ODVH 3S3SA 1YMMA 1MJJA 1AFVL 1QHOA 4C83B 2I24N 2QQKL 3SDXE 3UTSA 3BPNB 3BW9A 1UVQA 3D85B 2GJJA 3VXQA 1NCBH 5GGRA 5ACMA 4MJIB 3T0WA 2VDRH 4TNWF 2NY2C 5DJ6B 3IAGC 4R4NC 3RVVC 4M1DH 3SHSA 5E00B 2DDQL 5D2NA 5JDJA 1J12A 5EH1A 1AP2B 2YZ1A 4HDIB 3BMVA 3PWJA 4NQEA 2HFEB 4GKNA 5L8LB 1XGYL 1UCBH 4OZGE 3ILQD 5J1TC 2VDLH 1N2RA 4LCWE 3VG9C 1DFBL 2BHYA 3RUGA 2MQCA 4U1GC 3BEWA 3SDAA 4D8PB 4NT6B 4PP2B 5EOCJ 4PTUA 2BC4B 4QRQB 3VWKB 1RZIB 2CD0A 1NMBL 4N0CC 4Y5XB 4QCIA 1ZT7B 4LHQB 4QRSB 3L3IB 5HDBE 5JOEA 1X5HA 3LS5L 1A4KA 1JGVH 1H8SA 1UM6L 4BH8B 1T20B 3S35X 1I9EA 1MCPL 5C0GB 3BX7C 4LSRL 1FVDA 2A6KB 4DWHA 4JPKL 2FH6A 5KG9B 5FUZL 3ZKXC 2CJUL 1JGUL 2QSCH 3AY4A 3VXOB 5BS0D 4KKCC 4FQQA 4GRWE 3WLWD 4HKXA 1YMME 4KJWD 1OB1B 3SE9L 4ZFFB 4HC1L 5MHSE 1I8MA 3JV5A 3UTSE 3NACL 4G7VL 2VLLA 3SJVD 2D4DA 4PR5A 3VW3L 2DIAA 1RZKC 5IBTH 1YNLH 1FZMB 1JIBA 3O4LB 3O3AA 4NUJB 5D2NE 1KFAL 2N1KA 3MJ9H 3L3GA 3RTQC 5I66B 4GJTB 4PRAB 5BJTB 5BZWA 4NQEE 4EDWH 3HLAA 4WHTA 3G9AB 5AZEH 2FX8L 2HKHH 3RVWD 3VXUD 2BFVL 2IANA 1OWWA 4JFYA 4Z95L 2H6PA 1DBBH 3RUGE 1NAMH 4BK5A 5EU3B 4L8SB 4NQTA 5ISZD 3WS3B 4MCZA 4GRMB 3QULB 4EIZC 2MTPA 1AJ7L 3CFBA 1R5IB 1NGQH 4UINH 4PJFF 4EVNB 3NZ8A 4D9LH 1C08B 1VDGA 3ULSA 3L5IA 4OZFH 2X4RA 1RVFH 4YHZL 4JKKA 4QRRB 4FQ2L 4OD3L 1NQBA 2YUZA 1T89A 1KPUA 2APTA 2LVEA 5CKGA 3TJEL 4LPVA 2IC2A 2V5RA 3QWOA 4RX4D 4I0PD 5L88L 1OL0A 1J11A 2FBOJ 3O9WC 3TYGL 5IHBA 3HFMH 2FATL 2NNAB 5ENWB 1CFSA 1MCOL 3BIKB 3KLSA 4X83A 1UWXH 1GGCL 3MYZA 4CGTA 3IDIA 4S2SB 5CP7A 1ZLSH 3NIFE 1FLRH 4GMTL 1X5JA 1P84J 1B9ZA 2GJ6D 1NGPH 5DFVD 3RNQA 1B6DA 5EZJB 4JQIH 3SGJA 3MRKB 5LAXA 1KXQE 2WWKO 5DEFB 4HQQH 1JZ4A 1R0AH 3Q5OA 2CLVB 4GXVL 1DL7H 4HGWA 3TPUB 1EGJH 3GMQB 2OBGA 5J1SC 1M7DB 3N1GC 4QRPA 5E1AA 1JRHH 5GSVB 1LO2L 5DYOA 1WWAX 2P5WD 1BF2A 2D2OA 1U93B 1W72B 5E94A 5FCUL 2CGRH 1ZT1A 4OM1H 3OXRB 5C0BA 3MLYH 1NMCC 2WUCH 2IANE 1OT1A 3EYUL 3WXWL 3BP7B 3IJHA 4MQXC 2KUTA 3TCLB 1FJ1B 1MFAL 4K7PL 1J05A 1I7UA 2A6DB 2DF3A 1ZHBA 4J4PA 3CZFA 5GGTA 2KZ1B 1OVZA 1JFQL 4Y0GA 4BQBA 1EMTL 1A21A 1B2WH 4JFZH 3KXFB 1JPTL 4U1JB 4JDVA 4Z7NE 4TUOB 1X5GA 2DQTL 3RDTC 3TT1L 3ZTJH 1JPSL 5TE7H 4BQ8A 1ZEAL 3GJFA 5FA3B 2H2SC 1CG9A 3CU1A 3STZB 3R1GH 1EO8L 1TJIL 1MFBH 3SBWA 5HGHA 2VZOA 3O3DB 4O58H 1EXUA 3HS0A 1NEZA 2WBJB 3MA7B 1DLFH 2NY7H 3QIUC 5F7YC 3BD3A 5JIPA 2ENSA 3GMPA 2WINA 5D7LB 1D5XA 5EZIL 1H3GA 4ACPA 1QSEB 4PJGF 1U8LB 3C60B 4LBEB 3S36L 4L9DA 2JJTA 2ITDA 4PY7A 4XCYB 3DBXB 1XEDA 2MHAA 5E8PB 1DEEB 4KUCF 1QHPA 4QRPE 2QQNH 3U4EB 3Q3GA 2R2EA 1CXIA 4QOKA 1V3JA 4P23A 1DBKL 2BRQA 5C0BE 5C09B 3BEVB 4LSPH 3DX8A 1YPZA 3CH1B 5TPWH 5IEHB 2OR9L 3RX5A 3EFFA 4HEPG 4JE4B 5FGCB 4R8WL 4WEBH 5TJWK 4QXGH 4ELKB 4PJXA 1TVHB 3LSOA 2NY1B 1PAMA 3F7YB 1MUJB 3NCYP 4NZUL 3WNKA 4XP5L 1SHMA 3U9PL 2UUDH 4JFFD 1JP5A 4YHOH 2KBGA 1N4XH 2SEBA 4ODUB 1ZT4A 5AZ2H 2N4IA 3MRFA 5CJQH 4ODHL 5INCA 4Y1AA 5E7BA 1T0MA 3FAWA 5CEYB 1YEHH 3JWOC 3FT4B 3GRWL 4WGWB 5BMFL 2VC2H 2HFGL 4R96A 1YMHA 5K59F 1T5WB 3LCYA 2MNUA 1KCUH 5EPMB 3X12A 3X14B 4G42B 3DO7B 4FG6C 1RK1B 3GMNB 2DL9A 3E8UL 2FEEL 3QPQC 3U7WH 1X5FA 1XCTA 4Y16C 1MCWM 1G6RL 1T04B 1KJVA 3D87B 3GMLB 5KW9H 3RWCB 5EU6D 3O2DL 4ODXA 1NEZG 1RUKL 4RGMC 4DUXA 4E42A 1F4XL 3VD3A 4K9EC 2Z91A 3DYMA 3CD4A 1S7RA 4EBQL 2EH8L 4UAOB 5JUEH 1MAML 4YAQB 3T0XA 3TO2B 2JTDA 5HHVH 4LLDA 3VG0L 4NRXB 4EUPG 4XXCA 3KPRB 1Q9KA 1PSKH 1AC6A 3O6ML 3HPLB 2QADD 1MRFL 1WLHA 1ZHNB 4FQLL 4OGZA 3OF6D 4HS8L 2F54D 4NWTL 3QDJD 2E5EA 3LKPB 3HC3H 3NTCH 5B39A 1YPZE 1MWAH 2OZ4H 5F1IB 5D2NC 1IKFL 4TSAH 5CGMA 4P4RB 4QYOA 3C6LA 5C0FA 5DVNA 2PO6C 2EDJA 3SKJH 4YJZL 3FMGL 5DGQA 4PJXE 1QBMH 4J3OC 2EKSB 4NNYB 3L3JA 1HEZB 1QFUL 3BP6B 2I07A 4PB9L 5DUBB 4C57C 5ERWA 4AIZB 5CEZD 3FO2B 1H8OA 2X5PA 4Y4HA 1JF6A 4ZTOL 1FNSH 3QI9A 3SDAC 5KZCD 3O2DA 2Q8AH 3WE6A 1MHCA 1KXVC 4Y1AE 4ZUUA 2OXHA 3UROR 4U49A 5BXFA 1WT5C 3EBAA 3ECBB 2AABL 2E6JA 3QHZL 4OZIB 2OSLA 5HPMB 2IQ9H 5IV2A 3D3VB 2R29L 1U6AL 3VCLA 4Y4KD 4BZ1L 1CVSC 3TYFA 3E0GA 1Z9SA 1I1CA 4X6CA 3WIHL 5J6HB 1KOAA 2A83A 1CU4H 3TC9A 1KIQB 3ROLB 4LU5H 4NKDA 4FQXD 4YBLC 5T1DH 3QYCA 5JQHC 2VIRB 4UQ2A 3VRLE 2Q76B 4U6YA 1D9KA 3TVMD 3C09B 4U7SA 5IKCA 3QEQD 2P5EB 1NPUA 5IHZA 2NY2B 3CK0L 3AY4C 3GSRA 1T66D 2XTJD 2OI9C 4WJ5A 2BSSA 4G80A 3MYJA 3STLB 2EEAA 4KJYB 1FRGL 3KHQA 2EXWC 4JY6B 3RPIB 1N6QL 1NGYB 5GS2D 5D1ZD 1BOGA 4S0SD 4M1CD 4BSJA 1O7SA 3K8KA 3UAJD 5BVJB 2X4PA 5ACZA 1OTUC 3VA2C 4TVPD 4DAGH 5IW6B 3V5HA 4G6KH 4C55A 4L4TD 2YXMA 3GMRA 2O5YH 2EO1A 2G75A 5B39G 4Z8FL 5LXGH 3RZCD 3C5SB 2AJVH 2DL2A 5LQBL 2B1AH 2XWBB 3WIHA 1UH4A 3ZHLA 3MLRH 1JF1B 2HVKA 2Q3ZA 3RKDC 4MAYA 5CGYC 2EICA 4P2OB 4HUKB 3U4BL 4YHIB 5I17B 2JELL 4XPHH 5FYJE 2CO6B 4UDTA 4Z0BL 3ARGB 2E8ZA 5DR5L 1JNHA 2NY0D 1CXFA 4OCWH 3GBNL 1FSKC 3MOBH 3Q6GL 4L8DB 2HH0L 4KK6D 2WSKA 3NMEA 4K3HA 3PXHA 1RPQA 3KR3L 3V6FA 3FQXB 1CL7L 3ZE0E 1DE4A 4X6CE 2ZKHH 2B0SH 2ICCA 3ES6B 4N90E 4PLKD 5HVGB 5IGXL 4PGBA 4AT6B 4M93B 5I6XC 4WTZA 3QUXC 5K9KB 1YN7A 2GY7B 4GKSB 2BNRA 2VLRD 3DURA 25C8H 1XF5B 4HW6A 2XN9D 3DVGB 3EAKA 3SO3B 1U8JA 1LO5A 5SWSD 1ACYL 5GSRA 2KQMA 4HWZA 4RMVA 4Z7UF 3WFZA 4JO3L 1MVUB 3R0MA 2NY6C 4I77L 5IWLA 3NFSL 3RGVB 3WFDL 5GS1A 2PTTA 3W82A 3I9GL 3PABB 2EDFA 2F58H 5C3TA 1CD1A 1J1XL 5HHMB 2R0WL 3KPPB 3S37L 4F8TA 5JXED 3MRMB 2PW1A 4XB8A 1X5KA 5TH2B 3BP4B 5DJ2B 1JMZA 4OGYL 3MMEB 4DVBA 3TWCL 3HC4H 1Q9WA 3FQNA 1GGUA 4UNUA 4NHUB 4GBXC 1QNZH 3FL7A 1CXHA 4QKXB 3HNSH 1N26A 3FQUA 5IB2A 4MQTB 3EJYC 1V7NL 4FXKB 3TNNB 5DT1L 2A9MH 4QT5A 4WY7L 4NJAL 1KJ2L 3QA3B 3ME0A 1IGFH 4UMGA 4BH7B 1CN4A 4J4PC 1R3LB 2BVQA 4YHLL 2VXQL 3JWDH 1FC1A 3IDGA 2IAMD 2ERJB 2DQCH 2YD2A 2OTWB 2OTUB 1KSRA 4QLRA 4O51A 4OFKA 2Q86B 4G8EA 3B9KD 1F3JA 5JOPD 5KSAA 1EEUA 2EDRA 1DQML 1OAZL 2BNRE 3MLVH 4YBQD 5MEQB 5HY9B 4M4RA 3M07A 4PD4J 1R3JB 4M61B 1WFUA 1G7PB 3QH3B 5I1KL 2G2RA 4GG6F 3SBWC 1CD8A 1AKJB 4I3RL 5FO7A 3H9SD 5KVMC 1F58H 2R1YB 4HXBH 1OAYH 4NHCH 2P47B 3MODL 4CADA 5EC1B 2QL1A 1S8DB 3U9UA 1BX2A 3EYFB 1Y18B 1TCRA 4R97C 2X4OB 3QWQB 2W9EH 1NKRA 4OKVB 5FOBA 1CLZH 3GHEH 1XF3B 4LP5A 4A6YL 1NMCB 1HNGA 1KJ2A 2Z0BA 4FQHB 2JJTC 4Z77A 1EPFA 3KYOA 1L6ZA 1NC4B 1SEQL 5E24E 4HJ0C 3V5DB 2H45A 2WWMC 4P23C 3JXAA 2D31A 1NBYB 4IRJA 4AH2B 5EFIB 5KVFL 3O11A 5J56B 4G43B 4XHQA 1DVFB 3EYQC 1AR1D 3CSYB 1BOYA 4LLWA 1J8HA 2X4QA 1QFPA 1Z3GL 4AQ1B 4L3ED 3T65A 2P43B 3TEUA 4APQA 5BV7B 4KMTL 2ATKB 2ZUYA 2I9TB 5DHVA 1M71A 1D5MB 4DVRH 5HHQB 3TA3A 3UX9B 1NCWH 5I1AA 1H5BA 3REWA 4PJCB 4K71C 3RVUC 3B3IA 3RWDA 1S7UA 4LLAA 3RAJH 5D1XB 1J5OH 3U48A 1KN2L 4A6YA 1BPVA 3WN5A 1QSFD 4RDQF 1C7SA 2PYED 3MZGB 3MLSH 2Q8BH 1TPXC 4ZOEA 2DIJA 1EO7A 3P77B 5KVDL 1YUHA 3OJ2C 5ITBL 3B5GA 4GQ9L 1U91B 4NCC1 3RY5A 4M48H 4L3CA 4HS3A 2J6EL 2HTKC 2I60H 3SDXB 1JTPA 2BOBA 1DN0A 5EOQL 3HE7D 5FGBA 1OTSC 1OAKL 3IDUA 2P7TA 5IFHL 2VAAA 1IGTA 4J3VA 4LKXA 3ZYZA 2RAMA 1A7NH 4MCYB 3TIDA 3BISA 1F6AB 3HZYA 3LEVL 4XXCC 5CIPB 5K9QI 3ALWA 3I02B 1KJMB 5ANMA 5SWQB 1A7RL 4WUUA 4O9HL 1S7WB 3QUYB 1BZQK 4LCWB 3W9EA 3WIIH 2CIIB 1ETZB 1FAIL 1IAMA 2NXZD 3C6LC 2ZCKH 4BUHA 1J8HE 1YJDL 4MJ6B 3GDBA 3NCBB 3G5YA 2BVPA 4OQTL 4NQCB 2E7HA 3VFWA 1Z0MA 2X70A 1BIHA 1QYGL 4WENB 2I5YH 3ZE2F 5L8JB 1L0XA 4H0GA 4KK8D 4CRPA 2J6EA 2HYMA 1GRWA 1RMFH 3B5TA 2VXSH 5ELIA 4UU9A 3VMNA 1Z5LA 4P4KA 3BDYL 1E6OH 3EKCA 3HE6A 5HGAB 3ELAT 3N85L 3VRIA 4PYHA 1HH6A 4RGMB 1BD2D 1ZV5A 2M2DA 4KZEH 3QXAB 3U0PA 4GKOA 4PS4H 1JGLH 1YEIL 3IS0X 4H88L 3VXPA 1AGFA 3MRCA 4GRWB 5HHPA 4F2MA 4LCYA 3MJ8A 1NANH 5HI4D 1DP0A 1YMMB 5FYLH 1MJJB 2IPTL 4DTGH 4BZ2H 3D39A 3VD4A 3P4NB 4PRBA 3CVHA 4AMKH 3VGFA 3BW9B 1UVQB 3VXQB 5KANI 5C2BH 3JV4A 4WUKH 4M7KH 1HE7A 4OLUL 4PJBE 5D2NB 5DJXA 1J1PH 1OSZB 2X9YA 2VUOA 4R90H 2X41A 4KMQA 5DTFA 2RHEA 4OCSH 3KJ4C 4LHJB 5ANME 1KEML 1VADA 3RI5F 5C0RL 4WUUE 1UADC 5EZOL 4NGHH 1QPXA 4PJ7A 1N2RB 4GW1A 1T0NA 3WUWA 3RUGB 2CK0L 5T1LA 4CNIA 2YRLA 4KROB 5I30L 1UB6B 4ZUTA 1A47A 3T08A 4FFWC 1TETH 4PJ8C 3S6CA 1FZKA 4AG4L 2E27H 3L7FA 1WCBA 4TRPH 2FHCA 5CHNA 1HQ4B 5FM8A 4OZGF 4TTGA 3K4ZA 5E9DD 1A2YA 3S3PA 5EU5A 2IBBA 3O8XA 5C6TH 1WWBX 2ILLA 3DUHA 1UACH 3KJ6L 1WWCA 2HLFC 1PZUB 4NC0B 5IMLA 1WVZA 1B4JL 3ZSSA 3VA6A 4E9LA 5GS0L 1YEEL 1P7QD 4MAUL 1OP5K 2Y07L 3I75B 3D39E 1I8MB 1F3DJ 1FYTA 1ZLUK 2IPKB 4X7CC 3V95A 2VLLB 4MD5A 4PR5B 3QQNA 2DQUH 2J8UA 1MIEH 2CRMA 5C70A 1JWSA 1X7QA 1RZGA 3O3AB 1Q94A 4BFGA 5MI0C 1XF1A 1CICD 4BJLA 2G60H 3BIBX 2A2QT 1ZHLA 1OP9A 5GS1C 3MBEA 3UTTB 2DTML 1YEDA 2C26A 3LEXA 4JJ5B 5BZWB 3UO1H 2OP4L 2D03L 4WHTB 1YNTA 3MJ6A 4WFFD 4PJ7E 3MRDA 4P2RA 2GFBA 3LZFH 3R8QA 3AB0C 2H6PB 4DKDC 3NFNA 5CP3A 3QNXA 5F9OH 2X4SA 1QRNB 5EA0L 4ERSL 5A16A 3D2UD 3OV6A 3WUWG 4WGVB 2VLJA 4MCZB 3ARQA 4JO4L 2ZJSL 5C7XL 4X9IA 4MNHB 3ZL4L 4FHBD 5F6IB 4DQOL 3MUY1 3I2CH 2X4RB 4M6NH 2V5TA 4LCIL 3MCLL 4Z0XA 4I3SH 1T03H 4CMMB 4AL8L 1KPUB 1KG0A 5J9PA 4M5YH 5I6XB 4BSWA 4RAHA 1JVKA 2NY3D 3FQTA 4NC2B 5JR1L 4HZLB 3T0EA 2W0LA 3DRTB 3S3JA 3F58H 4AIXA 1ND0A 5EU7E 5I8OL 1KNOA 3IGAA 5TQ2H 5I1LA 1CFSB 1RUQL 3IU4L 3BAEH 4UIMB 1BBDL 4YXKH 3IDIB 5CSZA 4RGNE 5KSAC 1FE8H 4OFDA 1AY1L 1RU9L 3EDFA 1NDMB 1XMWA 3VDBA 1BZ7A 1FYTE 3HMXL 4JN1H 5T3XH 1EHXA 5LAXB 2J8UE 2ORBL 4Z7WA 4HGWB 1Z9OA 1H9VA 4XVUC 4N0YL 5E1AB 1CLOL 4K9EH 2V5MA 4A2MA 1LD9A 3LQZA 1ZT1B 3O4OC 4TNWK 2OQJB 5C0BB 5JQ6H 5DJYA 1PDKA 4LASL 4P2RE 3GBMH 1RZ7H 5HGBA 1DBAH 1AHWB 5L7XH 3WFHA 1S7SB 4IBLT 1J05B 1FG9C 4V1DD 1KENL 1I7UB 1ZHBB 2VLJE 2VR4A 3CZFB 5DUPL 3NGBB 5DZOA 1RSFA 3C9NB 3MROA 4IRJC 5IB5A 3DHJA 1UA6L 5IF0A 1A14H 5IQ9A 5D70L 4S1RL 3M1BA 5IMMA 1FDLL 3O3UN 3FOMA 1TDQA 5IESL 4MZ2A 4UNVA 3HMXA 4JDVB 4X6BA 4APQC 4XMKH 3DHMA 5E8NA 5FKAA 4CVXA 3T0EE 5IW1B 5KSVA 5D5MA 3GJFB 4WI2A 3TA3C 4DKEH 5BS0A 1XR9A 1WK0A 1S7QA 1H5BC 4FFZL 2UVEA 4K3DH 1EXUB 3HS0B 3LMJL 1NEZB 3QISA 3EJJX 3I6LD 2FZ3B 1YECL 1F42A 3RX7A 1UJ3A 4BQCA 1XIWD 4JREC 2GQHA 1HKLL 4OF3A 1AFVH 3WN5C 3SJVA 1INQA 1U58A 2MQ0A 1JTOA 2QQKH 4JFED 4EIGB 4F3FA 2WINB 1D5XB 4DUVA 1KB5L 4JHBA 3MLWH 1UWXK 5T5FL 3VGHA 1Z6JT 4Z7NF 3CCHB 5L0QC 1L7TL 3BJ91 2ITDB 5J12B 4PY7B 4Z7WE 4O02L 1U8OA 4Q6IA 5FYKU 2DDQH 4PGEB 2J8HA 2HFFA 2MQ3A 1QQDA 3O0RL 4X80L 2DLTA 1CFBA 3UTZB 1QBAA 1FO0L 5FGBC 2ZG3A 4QOKB 3VXUA 3SOBL 1F97A 4U6HA 5FB8A 3FO1A 4P5TD 3QIBD 2YWZA 1AGBB 5CKAA 4POZC 3DX8B 1YPZB 1XGYH 5JPNB 3IRPX 3EFFB 4NZTL 2ICES 2V7NA 4TNVF 4NN6B 2H41A 5ISZA 1DFBH 1HIML 3LSOB 4YPGA 4YH6A 5I1CL 1NMBH 5KS9A 3QXWA 2SEBB 1ZT4B 3BUYB 3M8OL 3ZKND 4Y19D 3DWTA 2CO7B 2A0LD 4Y1AB 5INCB 1T0MB 2CRYA 4I0PA 4RX4A 4YFDB 3LS5H 3X11A 3TN0B 5J1AB 1UM6H 1MCPH 1YMHB 4LVNC 1DANT 3MRJA 4LSRH 4NYLA 2I9LA 3VFSB 5D5ME 1O5DT 3MLZL 3E2HC 4JPKH 4WW1B 1TQBB 5BS0E 5FUZH 4H1LH 3SE4C 4ETQA 3N1QC 2CJUH 1JGUH 1A6AA 1FO0A 2V2XA 5ESVA 4XPFL 3HE6C 2GJ6A 2GK2A 2H3NA 4KUCD 2A9NL 4ODXB 3NIGE 3SE9H 4E42B 5DJAA 3EOTH 4HC1H 3SJVE 5HYEA 3BRFA 3JZ7A 2Z91B 3P4OA 2JIXD 3QRGH 3VW3H 2GUOA 3ESUF 3QDME 2FJGA 2BHZA 1QLEL 2P5WA 1WCQA 4C4KT 5D6DA 4DZ8B 3NABL 4PJDA 3IVKA 5K9OB 4OF0A 5GGSA 2VJXA 3RHWF 2EXYD 1KFAH 1ZGLA 2PXYD 3VXUE 3CFCL 1T0PB 1YJDC 2XQYG 3O6FD 1F4WL 5B39B 32C2A 1A6UL 1NMAH 2FX8H 4PJAA 2BFVH 3O81A 4QYOB 4Z95H 5DJCA 2GTZA 5TQ0L 5ISZE 2B5IC 3PL6D 3DIFA 2XG5A 4LARL 4FXLA 1U3HD 3L3JB 1HILA 2I07B 3L5XH 2FRGP 3KGRA 4O5LL 4KK9C 5I1EL 1MCEA 4OF6A 5HSFA 4Z7OE 4Y4HB 2MMXA 5KS9E 1AJ7H 5CJXA 4UUJA 3QI9B 1KIUA 5F8RC 2VR5A 3P30L 5DD5L 3WE6B 1MHCB 1ZVHA 3DGGA 4YHZH 4MA7H 4ZSOA 2XRAL 4FQ2H 5TDPB 1G7QA 1NUGA 4IOFC 3TJEH 2UUDK 1A0QL 5IV2B 5L88H 5C8JA 3VCLB 3MNVA 3AAZA 3IAPA 3TYFB 3WO4C 2HFTA 4QHNB 1ADQL 1Q9LA 4X6CB 3TYGH 5J7CC 2A83B 3G5VA 4JG1L 1MCOH 4HFWA 4NKDB 2UY7A 3GSVA 4WI6A 2R8SH 2GJ6E 4M6OL 2CDEA 2B4CH 1IRAY 4GMTH 5EU7C 1D9KB 3QQ9C 5IKCB 1S3KL 1E6JL 1LNUA 2XICA 3GSRB 4WJ5B 2GYSA 4NNXA 3RIFF 5I16A 3NCEB 4RGNC 4G80B 4CKVX 3MYJB 1P7KB 2JCCE 2L0DA 1J8KA 1HHKA 2P5WE 1P6FA 2GKIA 4PJDE 2G5RA 2MKLC 3QUZD 3VFNA 1Q1JL 3INUH 1MQ8A 2GTWA 3F8UB 1ACZA 5IFAL 1BOGB 2COQA 5FCUH 4Z78A 3VRLF 4ODTL 5ACZB 1IQDA 1WFOA 3V5HB 4R2GC 3EYUH 2G75B 4PLJC 4YGVA 4TUJA 1MFAH 1Z2KA 1HDMB 1J0JA 4K7PH 4EUPH 3QFJD 3TLRA 4JFFA 5EBWA 2HVKB 4MAYB 2DQDL 3UPRA 3WDIA 3ARZA 3GO1L 4WFGD 1JFQH 3JBG7 1EMTH 1SBSL 3B5HA 4UDTB 1KN4L 5DVOA 4ZSOE 1JNHB 4ODSL 1ZHKA 4GO6B 5BOZG 1JPTH 4KHTL 1B4RA 1F4AA 4W68A 3EHBC 5FEBA 4OGAD 1DDHA 2B2XL 1FAKT 2GSGA 3V5KB 5GS0C 2DQTH 3TT1H 5CEZL 1JPSH 3V6FB 3QAZC 3C8HA 3NBNA 1TITA 1EO8H 1TJIH 5BO1L 4PGBB 1P4LB 4FN0A 5I1GL 3DVFA 5EU6A 2BNRB 2RQ8A 4AEHL 4ZFOB 4U3CA 1U8JB 1LO5B 2LU7A 3CLEL 5D93B 2MSPA 3DO3A 4RMTA 3BHBA 5DLML 5GSRB 4MX7A 3O41A 3QXTA 4U05A 4JDZA 4KRMB 3OPZL 4NO2A 3FFCD 2PTTB 3ZE0F 3QIWB 2VQUA 35C8L 3OF6A 1AE6L 2F54A 2AEQL 3QDJA 5E95B 1FFPA 3B9DA 5D1QB 3ARBD 4ONHA 2FHBA 4LLYA 4LL9A 4DVBB 2XWTA 4NSKB 3FQNB 2OR9H 2PUQT 4F7MA 4R8WH 1N6UA 1CD9B 3D25A 3TBVB 1OGAD 4JLRA 3ILQC 4JFFE 1XGPA 2CRZA 1G84A 4NZUH 3VXTB 1SMOA 4XP5H 4PRID 3U9PH 4ZAKB 5IB2B 1S5HA 3RFZC 4CJ0A 4LLMA 4ODWA 2V6HA 4OV6F 4TVPL 4ODHH 1P5UA 5GGUA 7FABL 4Y4KA 1AO7A 1U2HA 3CVIL 1A5FL 3GRWH 5BMFH 2NR6D 5IG7A 2HFGH 1JYXA 3C5JA 5I73C 4XNZB 2YC1B 3PG2A 1KPRA 1INDL 3MGAA 4FQXA 1XF2A 4G8EB 5EUOF 1F3JB 2AV7B 2KPNA 3E8UH 5KSAB 5DD6B 3PDOB 3MRLA 2CUIA 4WO4D 5EU6E 4BYHA 4L8BA 3CSBA 3RNKA 1ONQA 3TVMA 1G6RH 3OKMA 3QEQA 4GRLD 4PJIA 4PGDA 2Y25A 2G2RB 5ADPL 1RUKH 5FO7B 4NO5A 6CGTA 1Y6NR 2EH8H 4KJWC 2AK4D 1MAMH 4UZGA 4CADB 1HQRA 3GEWB 4JFPB 3VG0H 5D1ZA 3U9UB 4QF1A 1KJ3L 4M1GL 2F54E 3O6MH 3RVVD 1KLUA 3QDJE 1MRFH 1WICA 2CKNA 2E9JA 3PGCA 5GRZA 4NWTH 5C86A 3SDCB 3HN3A 4L4TA 1UWGL 4ZXBC 3H7BA 4JO1L 5DMYA 2YPLD 4Q6IC 3KYOB 4ZO8A 4X6EA 1UQSB 1KBGL 2M1KA 5A2KH 1IKFH 1A3QA 3HI5L 3MOQA 5LG1A 5LGJA 1R5VB 1PKOA 5CEZE 3FMGH 2IFFL 3PWNA 2ZSVB 1QFUH 1T1ZB 4M8QA 1KPVA 4XRCA 2FWOA 4JKMA 5F3HA 4RQQA 4Y5VA 2VKWA 5KAQG 4K3JL 4ZTOH 2DQFA 4LLWB 3QJHA 2X4QB 5C0IB 5T1MA 3B2UC 3T65B 1FV1A 3RIAK 2AJUL 4APQB 5DHVB 2AABH 1M71B 2VAJA 5ACLA 1YY8B 3QHZH 1LP9A 3QHTC 1F90L 1P84K 2R29H 4FFVC 4BZ1H 5I1AB 1L9MA 1H5BB 2X2YA 3REWB 1BFOB 1G6VK 1KCRL 1NCCL 3RWDB 4I0PC 1S7UB 2PCPA 1IILE 3OB0H 3WIHH 4OD2B 2VLRA 3MREB 2XN9A 4NKIL 4U1MA 2ED7A 5FO8A 3QEQE 2O5XL 4PJIE 3KPSA 5SWSA 1U36A 3VJ6B 5JORB 2XTJE 4P59L 1H3TA 2CMRL 4NUGL 2W60A 1UENA 3C5ZB 3CK0H 4HS3B 2XTLA 5GGVL 4OB5L 1U2CA 5CD5D 2EECA 1DN0B 1S7VB 4U1SA 5DFVC 5IVNA 5H37H 2BNQB 1FRGH 3E6HA 4NPYA 3OX8B 3V4UL 5JXEA 1DUYA 4RFOL 1N6QH 4F57H 1KCVL 1F2XK 4I48A 3WSQL 2AS5M 3T1FA 1YYLL 4I0KA 4LKXB 5J57B 2VUYA 4TVPE 1QPPA 4WCYL 2NXYD 4FNLL 3TIDB 8FABB 3SGKA 4L4TE 5D6DC 4JKWA 3RVXC 4L8CB 4XH2A 1MAJA 3LV3A 5ANMB 5HGDB 3KNBA 3L6FB 4WUUB 4LVHC 4KHXL 1MEXH 1P69B 4Z8FH 3GSNB 4DEPC 2MCPL 5LQBH 3W9EB 3V6ZB 1GOFA 5C07D 5IFJB 5EG6C 3OHXA 3U4BH 1CGYA 1FORL 3EYOA 3G5YB 2BVPB 1X5IA 2JELH 2X70B 3AREB 4Z0BH 4QHUA 5FAAA 2IAMA 4U1LA 1TZHB 3GBNH 1HOCA 3Q6GH 1LP9E 1H3UA 3C08L 5CJXC 3DLQR 2YMXL 2HH0H 3BQUB 3IFLL 4BFIA 1SYVA 2WW8A 3B9KA 3JTTA 5T33L 1HXYA 4UU9B 3V6OA 1Z5LB 3KR3H 1CL7H 4LQFL 4P4KB 5JIIA 1OHQA 1RJLA 3SDDB 2ARJA 5ICXA 2N7BA 2VLRE 5IGXH 4OUOA 3VRIB 1UJTA 2XN9E 4U1NA 1HH6B 2K9UA 4K94L 2RCSL 5SWSE 4HUXA 1T7WA 3U0PB 1L9NA 3V0AC 1AR2A 3H9SA 3SE8L 1AGFB 3MRCB 4G9DA 4HH9A 3CDCA 4F2MB 3MJ8B 4K3EL 4N68A 4JR9L 3DUUA 4ZS7H 2VL5A 1ACYH 4WU7A 3U7AA 5IB4A 3QG6B 3CVHB 4JO3H 3U2SA 3WFDH 5DRXB 3JV4B 1J1XH 3QO0B 5H94A 2R0WH 1GGYA 3S37H 1NSNL 5C08D 4XCFL 3NZHH 3PHOA 2R0KL 5JHDD 5IOPB 1ITCA 1LMKA 4OGYH 4Y2DD 5DTFB 1MCKA 3TWCH 4WWKC 4FQ1L 3ALPA 4JRYD 3BP5A 1VADB 4NNPH 4S1SL 1CLYH 4PJ7B 4OV5A 1X5ZA 4UBDC 4NKMB 1KIRA 3WUWB 3ZT5A 2YPKA 1PG7W 3L3HA 2XOTA 3EUUA 4S1DD 3MA9L 3WUZA 1V7NH 4L3EA 5I75B 3ZZ1A 5I76B 4WNQB 4CNIB 1VGEH 5DT1H 4I13B 4WY7H 5LCVL 5MEOB 4PJBF 4NJAH 1KJ2H 2Y9RT 4JM2C 2DM3A 5F9WB 4YHLH 2VXQH 2YD7A 1FZKB 1I3VA 1UZ8B 1EAJA 3TIEA 1H3XA 5CHNB 2NY5L 5JOPE 3V6OE 1TFHA 5DJ0A 1QEWB 1A2YB 1KTRL 1X4XA 3RDTD 5I1IL 4WI7A 4OLVL 3O8XB 2H2SD 1QSFA 1CGWA 2PYEA 3GB7A 1DQMH 3RQ3A 3D0LA 4YLQT 2HT2D 2IADA 4HPYH 5EO9A 5IMLB 1W8OA 5I1KH 3H9SE 3NH7H 3BVNB 2X4UA 4R0LA 2CDFA 1NDGB 1XH3A 4RGNB 2CRIA 4Q9RL 4I3RH 3AMKA 3BOVA 3HE7A 3MNZA 5SX4I 5I1HL 3VGAC 2CLZA 1FYTB 3VWJB 5DDHA 3MRHA 4MD5B 4AK1A 2W9LA 5DA4A 1FFRA 1JWSB 1NCBL 1Q94B 4J1UB 4A6YH 1FGNL 1ZHLB 2QADC 3MBEB 2D7OA 1YEDB 3LEXB 4Y2OA 1SEQH 1MAKA 3HRZA 1J18A 3DV6B 5ADOH 1OF2A 3K1DA 3MRDB 2WAHA 1LEIA 2GFBB 4JFOA 4H0HB 3MPCA 5KVFH 5A16B 4O2CA 1PZ5A 5C0DA 5FUCE 4L3EE 4WEMB 5DMKB 3NCMA 2BSTA 1Z3GH 1WAAA 1YYML 4U1IB 3WNMA 1JYNA 1X5LA 1G1YA 1MSPA 4KMTH 2YR3A 2FJFB 2UYLA 4IRSD 5C1MB 3QAZB 4OI7A 4Z0XB 3KHOA 3KPLA 1KG0B 1R3HB 4OCNC 5A2IH 4BSWB 1BD2A 4R7DB 1QSFE 2PYEE 5GGRY 2DQHL 3T0EB 3QEHA 1NBVL 1KN2H 1TQCC 1KNOB 5T3XD 4M03A 4N5ED 1VKXA 4Y16D 4JRXD 1K4DB 1OW0C 2Y36L 3W81A 2HJKA 3TF7C 1S9VA 5KVDH 3IXTA 5ITBH 3MJ7B 2HMIC 3L7EA 4Z76A 3TVMC 2AP2A 3NCFB 4X5WA 2WP3T 5EOQH 2XTJC 4GAGH 3K3QA 3MQIA 1ED3A 1NCNA 4MNQD 1OAKH 5IFHH 2EIEA 4KTYA 3HI6L 1KYOJ 3QCVL 2ZUQC 2C4FT 5D1ZC 1LD9B 2J88L 1A6TA 3BKJL 3LQZB 3LEVH 4KJPC 5E2TL 1A7RH 4M1CC 4WRLA 3U46A 4O9HH 3TJHC 2EE2A 4PY8I 1AD0B 2PO6D 3BH9A 1XGQB 3BE1L 1MHPH 5C6WH 3WFHB 1FAIH 3LDBC 3RZCC 1RUPH 4X7TA 1YJDH 3VE0B 4OQTH 3MROB 1WAAE 5IB5B 5IF0B 1QYGH 1EIBA 1XF4A 3L5HA 4Y5VC 2O93L 3M1BB 1PD6A 4UINL 5IMMB 3FOMB 5GRVK 3IJYA 5E9DA 5B8CA 2NY0C 4X6BB 1LO0L 3FQRB 4V2CB 1CDUA 5E8NB 3BDYH 1BD2E 5FKAB 3HZVB 1BQHA 4CDHA 3N85H 4PGCA 2NZIA 5BS0B 1P1ZA 1F4YL 1XR9B 4CAGA 1S7QB 4MMZC 4PLKC 1G0YR 2ADJA 4ZQKA 1EHAA 1P7QA 1T6WA 2DYPD 4H88H 5B21A 1Q8MA 3MJ9A 3CSGA 3EDJA 4M00A 3QQ4A 4PUBL 3BZDA 1UJ3B 2IH1A 1ORQB 2IPTH 1AGDA 1INQB 1U58B 4HV8B 4PV8A 4LCUA 4M7ZC 1CI5A 2Q3AA 1RUML 2RFXB 3MBXH 4P2CG 1CICA 3U79A 2GSIB 4PFEA 5ICYB 1NAMA 4UOW1 1U8OB 4OLUH 3QZWA 5I1DB 1GOGA 2HFFB 1WIOA 3K46A 3FN3A 1EGJL 3KPQA 1LDPL 5JXEC 2D9QB 3QDGB 4S1QL 3VXUB 1BVLB 3TBTA 3TGXA 1KEMH 4U6HB 5FB8B 3FO1B 3S88L 1XFPA 5C0RH 5ID1B 2VZVA 1CGVA 4OZFA 2DJUA 3GIZL 5EZOH 5A2JH 5HVFB 3SGKC 3D2UA 2H32B 2FCBA 5ISZB 3IETA 3TP4A 1W2KT 3SQBA 1A1MA 2CK0H 5DK2A 1P4BL 2QQQA 4NKQB 3RKDD 4YPGB 2Q7YA 4GLRH 1ZA3A 4AM0A 5HDQL 5KS9B 1BZ9A 4W6YB 3QFDB 2XKNA 5C0ND 2W07A 1X5XA 4PD4K 4AG4H 4I0PB 1FGVL 4UDUB 5E9DE 1QFOA 3X11B 1CIUA 1HHHB 2DQIH 5ESAA 1J0ZA 2ZCHL 3MRJB 1GOHA 5FECA 4LAJH 5CP3H 1NBZA 4R26L 1J0HA 1MREH 1E4JA 3KJ6H 3KWWA 5TE7L 3T3MF 3B9KC 3HR5B 3F65A 4J3SA 1BQHG 3QUXD 1EGJA 4K7FA 3R1GL 3UXFA 1B4JH 2V2XB 2GJ6B 4G9FB 2H3NB 1YEEH 4MAUH 1MCWW 2Y07H 1I1AC 3A0OA 5DJAB 1WBXB 3Q0HA 2APWA 3P4OB 2N7AA 1E27A 4BQ9A 4KUZH 4JJHA 2GUOB 3V8CA 5C9JA 1BQUA 4WDIB 5KTEL 2CDGA 2NTSP 4EI6A 3GZKA 4NQSA 4PJDB 4LVHB 5I8KL 2WV3A 2Q1EA 2OJEA 4XNUL 4WFFE 3HAEH 5KOMC 3IU3A 2HG5A 2OP4H 2D03H 4PJFA 2A74A 3QUML 4XMPL 3QNZA 4PJAB 2WIMA 1IC1A 4GBXD 3UCRA 3TT3L 5A43C 4V1DA 2GTZB 4OZFG 3DIFB 5ILTH 5EA0H 4ERSH 3MTRA 1CIDA 5E2WH 1HILB 1QR1B 1I4FA 3GSXA 4JO4H 5C7XH 4JHWL 1AR1C 2H2PD 4UUJB 3ILPA 4AYFA 4YHOL 3ZL4H 2L7JA 4PRHD 3DGGB 1I8IB 4K94C 5IP4A 4ZSOB 4UT7H 2JK5B 3GK8L 1G7QB 1AXSB 4LCIH 3MCLH 5CJQL 3G04B 4AL8H 3SQOL 1FG2A 3OR7A 1VEPA 5C8JB 3MNVB 3MRIA 2J7LA 2VC2L 4K7PY 5JR1H 3UJTL 1GHFL 1Q9LB 2NQCA 4P9HL 2A6IA 1FFNA 3AXLA 5I8OH 3WXVL 3G5VB 3HZKA 1RUQH 3D18A 3IU4H 3FB6A 3OR6A 1BBDH 1XIWA 3F6LA 3RWFA 4LPXA 5D71L 2CDEB 4OF7A 3BGFB 4HCRL 4JFEA 1BLNB 3LKRB 1AY1H 1T5XB 1VERA 1C8PA 2IG2L 1M6OA 1FIGL 4I2XB 2E7LC 4HLJA 4MDIA 4GAYA 4NNXB 4R0LC 3RKPA 5I16B 3SGDH 1WZLA 3Q2CA 2QV2A 1HHKB 2ORBH 3HE7C 5F9JA 4U4BA 4N1HB 4N0YH 2NW3A 1P2CA 5TF0A 3WCYA 3RWGA 3VFNB 1EV2E 1CLOH 3OKKB 1PX3A 1CDJA 3I50L 4P5TA 3QIBA 2GTWB 4G3YH 2NY4D 3QEUA 4XX1E 1T4KA 4PJFE 5DJ8A 4OLEA 2AI0L 5JZ7C 1W0VA 4HJ0D 1IQDB 3BO8A 4XX1G 3EO9L 1GH7A 2YRPA 4LASH 4KQ4L 4V1DE 4YGVB 3PP4L 4UV7L 4TUJB 3JTSA 2KKQA 4JFFB 4MJID 1KENH 3SKJL 2JCCF 5GS3A 1FFQA 2NY5C 5GHWL 4XNQA 2ZNWA 1TTFA 4NN5C 3EYQD 5DUPH 3S5LA 3UPRB 3AS2A 5BCAA 2NXZC 4Y19A 4D2NA 3DOSA 4PTTA 4HG4J 4OT1L 1UA6H 2HRLA 4F15B 4HCRA 5HXMA 1FNSL 5DK0A 5F1NA 2ED8A 4XAWL 2AXFB 3ET9F 5IESH 1ZHKB 1PYWA 2P42B 1PY4A 4KK8C 5F7WC 2YD9A 1CS6A 1DDHB 3WDHA 1GXEA 2GT9B 4WI8A 1YDPA 2CQVA 4ODBD 1RIUL 1F6LL 3I6LE 4HULB 5EU6B 1NJ9A 5TDOA 3LMJH 1ZS8A 4JFEE 1YECH 4NFBA 3TO4C 2JIXA 3PJSA 3FT2A 3BRDA 2W0PA 3W0WB 3F7QA 4OLZL 1HKLH 2DTSA 4MSWB 5IMOB 3IXAB 5BQ7A 3HG1B 1MH5A 1MWAA 2OZ4A 5HI4C 1L0QA 1KB5H 4DFHA 1OAXL 4M7LT 5T5FH 4RBPK 2OS7A 1KCLA 3SGEH 1L7TH 1UT9A 5E7FA 1T83A 3ARVA 4JDZB 2XI9A 4XBGA 4NO2B 3CDGA 2PXYA 1T1XB 4Z7VA 2VR9A 5FA4A 3O0RH 5DEZA 5LBSL 3O6FA 5DD3L 1FO0H 1KIPB 3MV9A 3OAZH 1LK2B 4ONHB 3SOBH 1JF5A 3PWUA 4NCDA 1G7JB 3GJFK 3MRPB 1X44A 3PL6A 3UBXB 4FQIL 3GKWH 4LGRB 1U3HA 4NZTH 3T0DA 4V2BA 4ORZC 1ZWIA 4F7MB 4G6KL 1U8IA 4JLRB 2YSSA 1GGBH 1HIMH 5GJSL 1XGPB 1S5IL 3ORJA 1YEFL 5LXGL 3I6GA 4NZRL 4KQ3L 2AJVL 5EULV 3DVIA 2B1AL 4LLUB 5I1CH 3O4LD 1S5HB 3L1OL 2XY2A 3GHBL 2CKBL 1NCDL 3S5LG 4HAGA 2ZOKB 2DWEA 2V9TA 4LK4A 3BWAB 2HT4C 4QHKI 1T22A 4YDJA 1RY7B 3W5MA 5GGUB 3CFIC 4Y4KB 1AO7B 1G7IB 3OAUL 1EK3A 4X4ZA 4XVSH 2YEZA 1FZJB 5LVEA 4LMQI 4JFDD 1JTTA 1NUDA 3MLZH 1KPRB 5TE6L 4FQXB 1XF2B 1RJYA 1A6PA 4JM2F 3ULVL 3X13A 3G9VA 3ZMRA 3GSOA 3MRLB 4L8BB 1KELH 3RNKB 1ONQB 2JKXA 3PNWA 3F6IA 4XPFH 3OKMB 3IAQA 3QEQB 4B7LA 1PGRB 1VENA 4PGDB 2A9NH 4DFIA 4K8RL 2R2HB 3GIVA 2QKIB 4QRRD 4PPTA 1CT8A 4U2ZA 4CUCA 1FZOA 3MXVL 2YUXA 1HQRB 3QUZA 1KTKE 1QLEH 1RZ8A 5DJDA 2UY6A 4QF1B 3NABH 4Z7VE 1WF5A 1T7YA 3GMMB 3H0TA 5DRZA 4O4YL 2F19L 2O26U 5E08L 1CICC 2EE9A 4F7EA 3CFCH 2F53B 3H7BB 1F4WH 5DVKA 4X6EB 43CAA 4XCEB 1A6UH 2ZP0T 1CFNA 3NCYS 5T1KA 3QFJA 5LGJB 3HC4L 5TQ0H 4MHHI 4LARH 3PWNB 5LGKA 5AWNL 4OZHB 1KPVB 2GW5A 4P5MA 3JV6B 1C5CL 4WI5A 3CXDL 5I1EH 5F3HB 3TFKC 2DN7A 3HNSL 4LPCA 1NFKA 2DQFB 2C1OA 3QJHB 5L2KB 4XB7A 3P30H 5DD5H 4RMQA 1FV1B 4FFWD 4PJ8D 2XRAH 3HI1A 2QR0B 1ORSB 3B6SA 1A0QH 3T2QA 3Q5TA 5J0BA 2OYPA 4KI1A 1ADQH 1K4CA 3CC5A 2PCPB 2VISB 2NY3C 2R2CA 4JG1H 2VLRB 2FNBA 1E4KA 5EUKB 1KTDB 2A1WL 3DMMB 5FKPB 4G8FA 5DC4B 5FO8B 5E0QA 2CPCA 3KPSB 15C8L 4M6OH 3P40A 3JSSA 4KY1L 2FECL 2DWDA 3QCUH 2MCG1 1S3KH 5D6CB 1E6JH 5JW4N 2CLRA 2CH8A 3FFCA 5E6IC 5DRNA 1QFHA 4U1SB 5HHOD 1S7XA 4AEFA 4E5XA 3VXRD 3E6HB 2OL3B 4NPYB 3ZKSD 4DJMA 2NYYD 1DUYB 3HMWL 4XCNA 4UTAH 3IKKA 3ARBA 1Q1JH 1FL5B 4I48B 5AD0A 3T1FB 1B0RA 4NQVB 1MFDL 5IFAH 1IAII 4NDMA 3GHEL 2WBJD 3MV7A 4PJIF 1J88A 4ODTH 3WD5L 2P45B 2OR8A 5L9DL 4XH2B 4PBXA 3VFVB 3LV3B 1OGAA 3QFJE 3KNBB 1I3UA 1INEL 2YRZA 1Z9LA 4LLVB 4Z7QF 3NVQA 4PRIA 1QSED 4CVZB 1GL4B 2APXA 4JY4B 4WFGE 2O61B 1ZKAA 2DQDH 2YBRA 1UXSB 5FYKD 2V17L 3OHXB 3GO1H 1OARL 4LAQL 2V2TA 2EDDA 1FLTX 3P9WB 4H8WL 4QWWD 2LABA 4WW2C 2J5LC 2UWEA 4QHUB 4FP8L 1W0WA 2IAMB 4U1LB 1E4XI 4ODSH 5GZOC 3W11C 5C09D 1NCAL 4KHTH 3ZE1E 1NFDF 5I74C 4DVRL 3B9KB 2B2XH 1HXYB 4Z7UA 1BHGA 3ARRA 4WO4A 1UXWA 1RJLB 1YQ2A 3PQYD 2ARJB 1UH3A 5ICXB 3VFPA 3E3QE 1FCGA 5BO1H 2VDNH 5MP6L 4GRLA 4QHMB 5DSCB 4U1NB 5JO5A 1DLHB 5DMGC 1I3RA 3IKCA 3H7LA 4AEHH 2IQAB 2K7QA 4HUXB 1N59A 2Z9TA 5JW4Q 1FNAA 3S37X 1MI5A 3H9SB 5B38A 3RWEB 4G9DB 3G6DL 2AK4A 1TZIA 4HH9B 2NW2A 5D7JB 3CLEH 2LV4A 4TSCL 3E1F1 4EZMA 2VL5B 5DLMH 1XIWC 12E8L 2AQ1A 3FFCE 3AM8C 5IB4B 2XA3A 4RWHA 2YA0A 1OSPL 1U92A 4JB9L 3VFMA 1ES0A 3U2SB 2BSRB 3C8DA 35C8H 1HXMA 5H94B 1AE6H 4ZPTB 4TQEL 4XVUD 2AEQH 3PWVA 1ZTXH 4YC2B 2YPLA 4AZ8A 5K9QG 1JK8B 5JPMA 3P11L 3HPJA 4J3XA 3BP5B 3DETD 4JPIB 3QIBC 4IOIA 2OR7A 4M7JL 4PRIE 2ZUXA 3MUGA 2WLZA 5JDSB 5GS2H 1VFAA 4DGYH 3KPRD 3UJIL 4YDLC 3B8SA 2EDWA 2UWEE 4P9HC 1MLCA 4HUUA 4TVPH 5E03A 4HIHA 3SKNB 1ZLVH 1TJHH 4ZUVA 7FABH 4GG6A 3ZKNC 5IVXB 5EIIA 3CVIH 1A5FH 2A0LC 2EE6A 3RRQA 3TIEB 3LAFA 4GKZB 4WU5B 5DJ0B 1INDH 4HKBB 2XNAA 1NUFA 1R3KA 5CINH 4YNYB 1BM3L 1QSFB 2JJSA 2J8OA 3GB7B 3CAFA 3JWNC 5MEPA 3D0LB 3REVA 1A7OH 3N1FC 5HYQA 3MV01 4KH2A 4YZFF 4HUWA 4LCCC 4KZEL 5ADPH 4R0LB 2CDFB 2AK4E 3CMOL 4GH7B 1SEBB 4RFNB 5B38G 2V5YA 3HE7B 4B7IA 3MNZB 2F74B 2IWGA 4MA1C 2E9WA 4JM4L 3OWEA 3LVEA 3D3VD 5DDHB 1BVKA 4AMKL 1KJ3H 5TF1L 4M1GH 2LAAA 3LRSB 4YO0A 1IC5L 2YPLE 4PG9A 1IGYB 4YHPB 4M7KL 4XNMB 3PXJA 1IZKA 4G8GB 4LEXL 1UWGH 5FF6B 2YZ8A 4JO1H 2PXYC 1DCLA 3IDXL 3HRZB 3HI5H 3WFEL 3GUTA 2P5ED 5I19L 1OF2B 4X0KA 1BGXL 4U0RB 4NN5B 4YFEA 2G9HA 5C07A 4X5XB 2HLAB 1IJ9A 4JFOB 5SWZB 2HKFL 5AG9A 2GHWB 3VD9A 5F71A 4N0RA 4U3HA 1PZ5B 1U3HC 5C0DB 1UZ6F 4S10A 2IH3A 4K3JH 3NFPA 2H1PL 3UZEA 1QFWI 1JHLH 2BSTB 4PJHF 1XR8B 2Y5TA 2AJUH 4LFHD 4GG6E 4O00A 4UB0L 1RI8A 4I9WD 2AK1L 3S98A 4M9PA 3WMSA 1F90H 3KPLB 1N3NA 2EYTB 1RJZA 1X4YA 1LILA 5HVHC 1NCCH 1KCRH 3HNVL 2RIKA 1FL6A 1PQZA 2FLRT 3IDNB 3QEHB 5KSBB 4NKIH 4P2OD 4JCLA 3TBYA 1VKXB 3H3KA 1U95A 2WBWB 5C0AD 4ZFZA 1I3GL 2AJ3B 3P9MB 4P59H 2CMRH 4L4VE 1H0DA 3ARGD 2HJKB 4NUGH 1S9VB 1FNHA 1DANU 5FK9A 4Z76B 5GGVH 4OB5H 4N0FA 4WHCA 4X5WB 1EEQA 5T5NF 1JN6A 3V4UH 1K2DB 5C08A 3RY6C 4RFOH 5TFSH 5CBEA 1ED3B 5I8EB 5ITFB 1K3IA 5JHDA 1KCVH 3U6RB 3WSQH 2DQUL 1MIEL 4ONFL 1YYLH 4PJ5D 5EIQA 1F2QA 3QUZC 4JRYA 2ZPKL 4X4XA 1A6TB 1IZJA 3EJZD 2VOTA 5H2BA 2D7NA 3U46B 3OXSB 5AYUL 1VFOA 3CU7A 3L5JA 3HA0A 3PDDA 5C07E 2MCPH 1CQKA 4HPOL 4PJ9C 2VH5L 5ALBL 4QTHA 2KZWA 2AQ2A 5IR1A 2VYRE 5IJKC 5DD1L 1IAKA 5CBAA 5IROA 1LE9A 4KK9D 1JGDA 5HYJB 1Q0XL 1MIMH 1FORH 3FOLA 2YXFA 3BUTA 3ULVC 2D7PA 3MGTB 1XF4B 3GGWB 4YDVA 3T0AA 3EOBA 1KCKA 1D3CA 1EEZA 3C08H 2VXTH 5L8KB 1C16A 5B8CB 1E4WL 2YMXH 3RDTA 3IFLH 5T33H 4K8RC 4I3SL 1U8PB 4LQFH 4HGMA 2CSPA 4JHAL 2P49B 1BQHB 1GIGH 3UZQA 2ZWLT 2W59A 4PGCB 1BFSA 1P1ZB 3MFFA 4D0DB 4K94H 5J13C 3ULUD 2RCSH 4LKCA 2P8MB 3QIUA 2ADJB 3BGAA 4U1KB 1P7QB 4JZJC 3SE8H 1OCWH 4NBXB 3E3QC 3EZ8A 3RJQB 1E4KC 3QQ4B 4TSBL 5DF0A 4K3EH 4JR9H 2EYRA 3QQ9D 2IH1B 1ZVSA 4WFED 1AGDB 3G5XA 5FM4A 3D0VA 2LQRA 3NPSB 4PV8B 2EEBA 3I3DA 4GG8A 5C08E 1BEYL 5SV3A 3G6AA 2E6QA 3MSPA 5E2VL 1FFOA 1NAMB 1IMHC 5JHDE 4NBZB 3VXNB 1NSNH 3QZWB 2J1KA 4XCFH 2QSVA 5I1JL 3IDJA 1Y0LA 4JRYE 2R0KH 3KPQB 1N5AA 2HJLB 1L7IL 3ZT7A 3ROOA 5F7NC 4E0RA 4OQ1A 1IGIL 4N0UB 4FQ1H 3ZE2E 3ARBC 1A9EA 3K2UL 2WUBL 4S1SH 2Q6WA 2PW2A 4OZFB 4IIQC 4OCMC 43C9A 1DJSA 5EC2B 1LE5A 1NAKL 3IETB 5E56A 1A1MB 2Q7YB 1ZA3B 1SM3L 3BZFA 4AM0B 1N6VA 5D96B 1K85A 2VE6B 3SPVA 5LCVH 2JB5L 4IRSA 3F5WA 3IFOA 3NAAL 4LOUD 4LPWA 2BCKB 1AIFB 2BSED 2XKNB 5EN2A 5BOPA 3JVGA 2H26B 4RMUA 4X9HA 4PGJA 3LS4L 2NY3B 2NY5H 3WL9A 3RA7H 5CZVL 1U3ZA 5EO0A 1IAIM 2NR6C 5I1IH 2WNGA 1A1OB 3OQ3B 5JW5A 4X6DB 4XBPA 4Y16A 4JRXA 2AERT 4KMLB 2LAGB 4HJJL 1IEAB 3T77A 5JW4M 4Y7MA 1IGJB 4R3SA 4K7FB 4WO4C 2DKMA 3PHQA 3MJGX 4Q9RH 4POUB 1CLCA 4MA8L 2DB8A 4UQ3B 3L3OA 5F7LB 5I1HH 1G7MA 4P57A 4O2EA 3WO3B 1E27B 3FO0L 3BPLB 1XT5A 4MNQA 5ESQA 3MLWL 5C9JB 1QR4A 5D1XD 3RWHA 3IFNH 4NQSB 2BJML 1FGNH 1C1EL 1FVCA 1FQ9C 4ZUSB 2OJEB 2NX5D 2ZSWA 4JN2B 2R1XA 1JV5A 2HG5B 4PJFB 5JIKA 2FDBP 2PO6A 3BZ4A 4H8WC 4BZYA 4YHYC 4S0TD 1NCUA 1NC2B 2PETA 4IJ3B 4V1DB 5EDXA 4JQXC 2B7DT 3BYYA 2QQLL 5DQDL 1CR9L 1I4FB 3OKDA 3KLDA 3ZYJA 3GSXB 3QNYA 1DBJL 3GI8L 3G5ZA 1YYMH 1WT5A 3ILPB 3P4MA 1HH9A 2DLFL 1T21A 5HYIA 2DBLL 3ZHKA 1TXKA 3SCMC 5F1KC 3OR7B 3KDMB 4XVJL 2BERA 3BZEA 2B1HL 3DROA 1JI2A 3QUYD 4HT1L 4CW1B 2ARWA 2YD4A 3MRIB 5T3XE 2Z8WC 1IGMH 2DQHH 5A3ID 1NBVH 4JRXE 2A6IB 1FFNB 1QBLL 2DYPA 1G7LA 5CJOH 3HZKB 4YIQB 4L1HA 3D18B 5I71B 3FB6B 4F7TA 5KJRL 3OR6B 4NQCD 1K8DA 2Y36H 3V4VL 2JJSC 3E6FA 3T8XA 2E8YA 1M6OB 5HDOA 4EDXA 3PDGA 1DUZA 3EOTL 4MNQE 4GAYB 3WJLC 5CD5C 3QRGL 1GYAA 1MCNA 5IBLC 5F9JB 1LQSR 3O6KL 2VDML 5CAYB 1P2CB 3HI6H 1DQQB 1BJ8A 4MWFB 3QCVH 4JAMA 4H26B 4KTDL 2WWKT 4P5TB 5AYQA 1WC7B 5CZXD 1BP3B 2J88H 3BKJH 3QEUB 3QDMD 4ZXBD 1B0GA 1VFBA 2ICEB 2NXYC 5E2TH 3TNMA 3BO8B 4XMLL 4RAUB 5EBGA 1UKQA 2AQ3A 3W5NA 1QD0A 3BE1H 4YHKH 1NMAL 2WIIB 2HA1A 4TULL 3JTSB 4DZBB 2LVCA 3EW3B 3MLUL 5I18H 3L5XL 4GW5A 3A67H 4NRYB 4Y19B 4H1LA 4PTTB 3LKSA 3GMOA 4OCRL 4OSUL 2W9DH 3B2UD 1I7RA 1S7TA 1WV7T 5FFLA 3IF1B 5F1NB 2X1XR 3D69A 2R2BA 3QG7L 3VD7A 1PYWB 4DK3A 2Y4SA 4MA7L 2EDTA 4HC1A 1LO0H 1U8KB 1BBJA 3U36B 4FFVD 1GJIA 4WI3A 1J10A 1UEYA 1LEGA 3CIQA 3QUXA 4PJGB 4WW2F 2HRPL 2BXZA 1F4YH 1RHHA 2X4NA 4M4PA 1MHEA 3QO1A 3N06B 5GGSY 1NJ9B 5TDOB 1DEDA 4HAFA 1ZS8B 1U8NB 1KT2A 4D9RD 2Q7NA 1CGXA 4PUBH 5F88A 1UCTA 5JOFA 2JIXB 3FT2B 4MS8C 2R8SL 3MLXL 3GSUA 2B4CL 1GAFL 1S9YA 1MH5B 1MWAB 2DMKA 4JDTL 2EDQA 2LE9A 1QFWM 1RUMH 5IK3A 3CFJA 3I85A 4XBGB 4WEUD 4OFYD 5M95B 3CDGB 1H15A 2X9WA 2YUVA 5FM5M 1CYGA 1I7ZB 2GCYA 1X5AA 1P6AB 3O6FB 1LDPH 3MV9B 2K3TA 3PE9A 3OSKA 3INUL 4NM4L 4S1QH 4ELMA 3RVXD 4P5KA 3ARSA 3HB3D 3PWUB 4GBXA 3S88H 4Y2DC 3MUJA 1UC6A 3PL6B 3GIZH 4M6ML 4XVTL 1E28B 2R0ZL 3V9FA 1ZWIB 1X9QA 4HMDA 2ICWA 2QHRL 4U6XA 1JZ6A 2XKSA 4EN3D 2YSSB 1P4BH 3UJJL 1JZ3A 3LH2L 1UM5H 1WBYA 5B22A 4S1DC 3NPZB 5HDQH 4MD0B 4FQJL 4PRHA 5EORL 4DCQA 4YDJB 1T22B 4H1LG 5IROC 3UTTD 1G1CA 5HVHB 4LSSL 2D0GA 1ZVYA 3TBWA 1FGVH 4HF5L 4K3GA 1A02N 3WKML 4R4BA 4PJEF 1KF9B 1NKOA 1U41A 3DX9A 3LD8B 3ZLQC 2YEZB 3BPOB 2ZCHH 1NCTA 1U8MA 2XQYK 4R26H 3DGCR 1QRND 4YK4C 1OTTC 1RJYB 1TNNA 2VXVL 1PG7X 3TZVB 3GSOB 4M7LL 3IT8D 4JZOA 1IC4L 3U0WL 2HT2C 4J2XA 3TV3L 3GIVB 4HBQA 2PYFA 4UIKL 4DOHB 1T1YA 3O3EA 5EZLA 5J8OA 3KYMB 1HYRC 1FZOB 4RGOL 4X7SL 4F7PA 3BH8A 1KV3A 4FQPA 3L3KA 4EUPA 4HWEH 5KTEH 5AUMB 3PWPB 5HD8D 3L95A 4Y5YC 2BVUA 3H0TB 5DRZB 2FLBT 5I8KH 1WIUA 4LSQL 4XNUH 4ELME 4F7EB 4GS7C 1CZ8L 4WWKD 3QUMH 4HXAL 3U30B 4XMPH 1CFNB 5T1KB 3TT3H 4MJIA 5DJ6A 3P9LB 4UBDD 5EB9A 3VFOB 3QPXL