2FLRT

Novel 5-azaindole factor viia inhibitors
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
200
structure length
151
Chain Sequence
TVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGDERTLVRRNNTFLSLRDVFGKDLIYTLYYSVQAVIPSRTVNRKSTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coagulation factor VII
publication title Novel 5-azaindole factor VIIa inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/blood clotting
total genus 32
structure length 151
sequence length 200
ec nomenclature
pdb deposition date 2006-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2flrT00
3TT1H 4PJBA 3EBAA 5DK0A 3K80A 1A3RL 5CEYB 3NFSH 1GC1L 3SKNA 3D3VB 5IB4B 1YQ2A 1P7QA 4NQEB 4QGYA 4WDIB 1Y0LB 3X12B 2XIDA 5IESL 5EC2B 4NKDA 4YHYB 4XP4H 2VXQL 3H9YA 1VGKA 2NXZB 3O9WC 2IANE 4ZXBA 1JP5A 4WHTB 4PY8J 2ZJSL 3BT2H 3WS3B 1AR2A 1KV3A 1B0GA 4MA8L 4M1CD 1MJ7L 2O5YH 4I0PB 1XMWA 4JJ5B 1QBLL 3VXTB 4I9WD 1IAOB 4HS6B 3FO2A 5HYSG 1FN4B 2X4NB 2R29L 4QF1A 2AGJL 4ODHH 1U3YA 5D1QA 3RAJH 2IAMC 1K3IA 2FCBA 2W0FB 4KTDH 5FO9A 4MD5A 5CZXC 3NCMA 3QUKA 5F7HA 5D5MF 1RZIB 4H8WC 4U1JA 3AY4A 1A02N 3WDJA 1X5KA 4Z7NF 3I02B 2DI9A 1I3RA 1S9VA 2XQYG 1QLFB 1XGRB 3IFLH 2JJTC 4OZFB 4CRPA 3DSFH 2C1PB 1OAXL 1D6VH 2VDOL 1LEIB 3G08A 2AP2A 1T1WB 1U9KA 5KN5B 1MHCB 2CH8A 2V6HA 4PRHA 3P9MB 4PJAA 4JCLA 3BESR 5TQ0H 5C08A 4W4OA 3QJHB 3QZWA 3MRNA 43CAA 1AGFA 4NQDD 2DM3A 3UTPE 4MS8C 2AQ1A 4Z0BH 1JWUA 1MVFA 4M6OL 4PJIB 2FO4B 3MUGB 2V2XA 4XP1H 5C07E 5J1AB 1XGTB 4AENB 1XR9B 4JZNB 4LLQA 5DO2C 2P8LB 3NN8B 4Q0XL 1ORQB 3GSNL 2FBOJ 3DX9A 4MQXD 3JWNC 4PJ5D 3E3QC 3QQNA 1CD8A 2R1WB 2Z9TA 5D2NE 5HHMB 5KSBB 4LHQB 1JYWA 1KJVA 4D9QE 3L3GB 2YOCA 3O3AB 4C56B 3L3KA 4Z7WB 4XI5D 1UEYA 2JIXA 4LKCA 1G7PB 4NIKB 2DKSA 4PJ8C 1A6WH 2EE6A 5GIRA 3T2NH 3Q2CA 2EYTA 4DOHE 4HWBH 3JTSA 1KLUB 2QQLH 1H3WM 3DI3B 1JPGB 4U2YA 4ESKA 2VUYA 4PLNC 4U6HA 1I3GH 1KELH 1QRND 1W72A 4Q6IB 1OWRM 4HFWA 2HH0L 1WAAA 2B5IB 1OB1B 4AJ0A 4DKEL 4LHUA 2OM5A 2BSSA 1KOAA 4Y5XC 2RIKA 5LGHL 1PY9A 2PR4H 4Y2DD 2XZCH 1CLOH 1R3KA 4HPOL 4Y4HA 2DL2A 4JFDD 3ULUL 3IJSA 5D7JC 1U93A 2FX7H 3HMWL 5E8PA 5F7NC 1HH9B 3O0RL 2YD6A 3QEUA 3C87A 4JDTL 2ADFH 4JAMA 3D6GA 1ADQH 1I1CA 1MCPH 4TTGA 3UJTL 4S1SL 3OJVC 1EO7A 1QLRB 4UBDC 3QUZA 1CFNB 1TNMA 2IQ9H 1NDGA 4L5FH 1Q0YL 4NM4L 4V2BA 3PGCA 2WBJB 3E8UH 1J7VR 4KHTL 2OJZH 4OBSA 3B5TA 3NTCL 3ZKSD 1Q9WB 4OLYH 3CGTA 3TIDB 5ALCL 2Z35A 4AIOA 1H3TA 3MNVB 1GC1C 4EKXA 4U49A 2AK1H 1MLCB 2L7UA 1FYTA 2EIBA 3C60A 5B8CA 4YAQB 2QADB 3RVTC 3C08H 1EEZA 4I5BB 1LE5A 3O3EA 4Y5YB 4C83B 1UM4L 4U1KB 4N0UE 4Y19A 1S7VA 4G9FA 4PTTA 1GGIL 4OD2A 3STZB 3HNTH 3ARED 5F1IB 1P6FA 2HTLD 3IDXH 1CL7H 4NJAL 1UH3A 2BERA 3H7LA 3L6FB 3CX5K 5CBAB 2YPKA 5E2UH 2DQDH 3CVHL 3OKNB 4QOKE 2I24N 1YYLH 1CFQA 1T5XA 4Y16A 4PJCE 4O58H 3U9UB 3DI2B 3QR2A 4G42B 1HXMB 4TRPH 1V3MA 1I85C 2R0WL 4LPTA 4LBEB 3S6CA 1G7MA 3HAEB 5FDWB 2EDLA 1M05B 1MHEA 3T65A 4L29B 3CLEH 4ZUVB 1EAPB 1EGJH 1NFDB 4GAGH 1I8IB 1J0YA 1RVFH 2BFVH 1NEZG 4FQXB 4PG2A 1VFOA 5FGBA 1KCRL 1QEWA 5FYKD 4EOWL 4KKCC 3SOBL 1EHLL 2M1KA 5C0IB 1FL6A 1N64L 1A4KB 1PVHA 3W0WE 3PWPD 4FABH 3PDOA 2Z93B 2PO6B 4HAGA 1QNZL 5MENB 1YNKH 2BJMH 3W11D 5E99H 1Q8MA 4DGVH 3BPCA 3DMMC 1DTUA 3IF1B 4LPXA 3OXRA 5DJYB 4W70A 3BPOB 4P5KB 4HK0A 4X4XB 1SMAA 3S4SA 4XCNA 5T3XL 3U6RA 3CH1B 3S34L 1J12A 2NNAB 5T1KA 4BSVA 1H15A 3OF6D 1RUAL 1BQHA 3NAAL 1M6OA 2CUMA 2PNDA 2VDLH 4IOIB 2NX5E 5KVDH 3EJYD 5F1OB 3O8XA 1IC7H 3K2MC 2OJEB 3H3BC 4XPTH 3DYPA 3MMEA 3I50H 3UAJD 3QJFA 2VLKB 2VDNL 1CGVA 5FF6B 4XAKE 3RVWC 3C8DA 4ODVL 2E6JA 1ZGLB 1FNAA 3TM6A 4YPJA 4M4RA 5IBTH 3WHXA 2F74B 1XF4A 2WV3A 5I1GH 3GKWH 5I74B 5FYKU 3WNOA 3NIDF 4PJBE 4FNLL 4JFED 3SDDD 4LNVA 5TH2B 5CD3A 1INQB 1J05A 3TA3A 1ZHKB 2WK2A 3KXFD 4PLJD 3BYTA 5DJ8B 2FD6H 1IM3A 3QUMH 4JR9L 1PD6A 5DGQA 5B3JF 3TJHD 3PXHA 3VGGA 3VWJA 3VFOB 1CD1B 3NFPB 1BAFL 1MCWW 4L3EA 4XZUA 4H0HB 5I16B 4J1UB 1T1XB 5E03A 2OCFD 3ULVC 4WO4D 1I7UB 3IYLW 3TT3H 1WSST 3ULUC 3VFTA 3V2AR 3TCLB 5KVFL 1BOGA 4JPVL 1UA6L 4WY7L 1IGCH 4KJQC 1SEQL 2VDPH 2QQNL 4MCYB 1AGDB 3KPRD 1T89C 3QAZB 4H0IA 1J1PL 4M93C 2ATKB 5MHSE 4AIZB 4BQ6A 3VXOB 1I4FB 1RZ8B 2HLAB 5EO0A 1EX0A 1BBDH 2F53D 4Q58C 1LP9A 2YPVH 4PTUB 3VDAA 4EDXA 2RFXB 5E6ID 4IS6A 4NGHL 5F1SA 4M3KB 5KSVA 1H3PL 3W5MA 2VLRA 2GK2A 5HDOA 4LHUG 4JFFB 4JM2A 4FQJL 1UQSB 4LVHC 3WLWC 4PRIB 1FG9C 4PRHE 4U7MA 1BIIA 3SDCA 3HZYA 4QRPD 3FFDB 4NQCB 4HLZH 3KWWB 3WD5L 2FR4B 1I1FA 1LEGA 2UWEA 4LVNC 4WUUA 3SBWA 5C0CD 2UYLA 1AXTH 5DJZA 4WFED 3NVQA 3S3SA 3L7EA 3PL6A 4JG0L 4L3AA 4M1DL 3FQXB 4CUCA 3B8SA 3SKOA 2DM4A 1FE8L 1Q38A 4OQ1A 2ESVA 4X5WB 3WO4C 3CU1A 2Q7NA 4PJGA 3MLXH 2DTML 1SYVB 1A7OL 4JFXA 4ZAKC 3PIQB 1JIBA 3TO4A 2BRRH 1EUUA 5F7DA 3MNZB 5E2TL 3LS5L 4TTDC 1HDMA 3DETD 4PJDB 3RVUD 2E9JA 2W9LA 4L3CB 4MVBD 2E8YA 5DQJB 1I1AB 3EYFA 3QQ3A 5IVXE 5HJ3B 1EZVX 3BIBX 4LCWA 4NSKA 1FLTX 3DO7B 3QDMD 1TVHB 3RKDC 1I8LC 4D0DA 4E5XA 5IBUB 5J3HD 3JV5A 5L7XL 1K2DA 1J0ZA 5DVLA 5TDOA 2Y36L 5CJQL 5I1HH 2NY0C 3T4AA 2APTA 4JY4A 4MJ5B 4P23B 2VXSL 5ICXB 3WKML 5E4IA 1J8HA 1V7NL 5GGQL 3W81A 9CGTA 2EIDA 2P8PA 2VRAA 3AVEA 4YHML 1CDCA 1UWGL 5F9AC 2AV7B 2YA0A 1L0YA 5DUML 5CEYA 4OJFL 3KJ6L 1ZTXL 3GI8L 3D3VA 5ECJE 5JXED 5IB4A 4YX2H 3FQTB 1FNSH 4NQEA 1W8NA 3X12A 1Y0LA 2R69H 4KRMB 5EC2A 2HH0H 1FO0B 4LMQI 2OR8A 4XP5L 2PYFB 3FO1B 3S96B 4WHTA 2JK5B 5CSZB 2GAZB 3D18B 3WS3A 1NL0H 2Z8SA 1T21B 2X44D 3ULVH 3EOYG 3WHE0 4K7PY 1NC4D 3NA9H 4I0PA 3QEGH 4WV1B 4JJ5A 3VXTA 3DBXB 1IAOA 2CUIA 4HS6A 1QPPA 2X4NA 1AD0B 1FN4A 1WZ1L 1A64A 1KBGH 4K94L 5HHOE 3RX7A 2W0FA 1BQHG 1OAYL 1MHPL 1MRFH 2VDML 1A6UL 4Z18A 3RUGE 1RZIA 4PJHB 4NO0B 4JPIB 2C3WA 3MFGB 5DMKB 1U2HA 3I02A 4NM4H 1DBKH 3CXDL 1U8JB 3NABH 4YLQT 1QLFA 5C9KA 3BRDA 4LVEA 1VFUA 4KK5C 3BKML 1HZHH 1H8NA 4OZFA 3QSKB 4XPBH 2C1PA 3ARFC 4LEXL 4B5EA 2G60L 1LEIA 1T1WA 5KN5A 1MHCA 4KROC 4PR5B 1U0QA 4QHMB 3P9MA 2Y06H 5K9QG 3QJHA 1EMTL 3OR6B 2AABL 3E2HB 4KUCD 1NGQL 2NQCA 3MXVL 1WJ3A 3QNXB 5HSFA 4PJIA 3E6HB 1GGIH 3T1FB 2FO4A 3MUGA 5INDB 5J1AA 1XGTA 1IKFH 4AENA 2Y4SA 1XR9A 5GS3A 3WFZA 3UTZB 2P8LA 3NN8A 1ORQA 2AI0H 2E5EA 2VE6B 3DRQB 4F37K 4HEME 4XCYB 4IRZH 4RA3A 1K6QL 2OBGA 1DANT 2A74B 2R1WA 5GS0H 1TJGH 3ULVF 5KSBA 3IAGC 3ULUF 1VFMA 3MV7D 2Q1EA 1ZV5A 5C09D 3L3GA 3O3AA 5DYOB 4I0CC 4C56A 1QA9B 4Z7WA 5D7KD 4B50A 5T1DL 2C1OB 4X8XA 3C2AL 1G7PA 5GGUB 5CINL 5MEOB 5JMRA 2HT4C 2FX9L 4D3CL 4LQFH 4WWKB 5IK3B 1KLUA 1UWEL 3HC4L 1WC7B 1JPGA 1HK6A 5HXMA 2DLFH 4MNQE 3O41B 4APQC 3REWB 4TQEH 4XAWL 3EOAB 4RWYH 1WQVT 4Q6IA 5GJTH 4OZHE 4YHZL 1B0RB 1N26A 1T03H 4UQ3B 1OB1A 4RFOL 1JPSH 5E0QA 3BP4B 3SGKA 15C8L 4KK9D 3SCMD 5AAMA 1LEKB 3WV0A 4Y4FC 1KN2H 4GMSL 1HSBB 1TZHB 2BK8A 5CP7B 3T3MF 5GGVL 1T7WA 4JKPH 1RUAH 4X4YB 3K74B 3BMWA 1G9ML 1KFAL 2JJSA 1HH9A 3TPKA 2ITCB 2ZG3A 3LAFA 4LSVL 1XF3B 1LO3H 5IQ7H 1QLRA 3IRPX 4KHXH 4JO4L 5CLTA 1CFNA 3QUXC 4IOFD 1RU9L 5B39B 2WBJA 5FCUH 3V4VL 1XGYH 2XI9A 2BMKB 3MREB 4TUJB 4FQQB 3JVGC 4FQHB 2VWEE 3MV8E 1Q9WA 5J13C 5DUBB 1Z3GL 3TIDA 3RNQB 1GAFH 3I6KB 4NFDA 4ZO8A 5ERWB 1RUKH 1CK0H 5CEXB 5C0BD 1S9XB 3MNVA 3LQAL 2X4SB 1MLCA 5FXCH 2BHYA 1T20B 4YAQA 5AD0B 2KQNA 4I5BA 3PF2A 3D87B 2C3HA 4Y5YA 5AAWA 4U1KA 3O6ML 1LP9E 4QXUL 4Y8DC 5DQDH 1PSKL 2ICWJ 4ZYKA 5DT1H 3STZA 2VLRE 3HC0B 5F1IA 4HC1L 2EKSB 3BEWB 5CBAA 2PKDA 2DB8A 2A73B 1BFOB 3OKNA 3FB8B 3WS6A 2YD5A 2DQFB 3U9UA 3ZDYF 1UA6H 4WY7H 2VLJD 4JRXB 4G42A 1HXMA 4D0BB 4LBEA 4K94C 3HAEA 4YGAB 5FDWA 3O9WD 1TPXB 5AG9A 1M05A 1J1PH 3LKOB 2UWEE 4WUUE 4ZUVA 2F19H 1EAPA 1NFDA 1YDPB 1I8IA 1WITA 5SV4A 2ZUQB 3R0NA 4FQXA 5ESAB 3VRLE 1FAIL 1NMAL 3V5KB 3QIWB 1EFXD 2ESVE 2D9CA 7FABL 1A7QH 5C0IA 2J6EH 1A4KA 2AXFA 4NM8L 2Z93A 2PO6A 4JFOB 5MENA 2FH6A 2IAMD 1WIOA 5BV7B 5CZXD 3H42L 1AO7E 3IF1A 1RZKL 5DJYA 4LASL 4P5KA 4X4XA 2A1WH 2AJXH 1IC1A 4QWWD 3CH1A 1VACB 2NNAA 3SDYL 4KJWC 3QHTC 2GCYB 1G1YA 4M6ML 4ZUSB 3KYMB 4OLVL 3VU2A 4P4RB 5FYJH 3ZZ1A 3SGDH 4GMTL 3KYKL 4OIIH 4ZFZB 4IOIA 4M1DH 4Z6AT 1JMZA 1WEJH 1DQJB 3H9SD 2OJEA 3IKKA 5CILH 1MAML 2VLKA 1DVFA 1X4ZA 4X98B 5FF6A 4MS8D 4OZFG 1ZGLA 1ONQB 5JZ7C 3K81A 2DOCA 5EZLA 2F74A 2FLBT 4RMQA 3HE6A 2VDKH 4JFHE 5HHVH 2HRPL 4RAUB 3BPLB 3UTSD 3NCFB 5FA4B 1NC2D 1INQA 3D3VE 3LEVH 1ZHKA 5F7FA 1Q72H 5HHNB 2EZ0D 3MRBB 5EN2A 5DJ8A 1OTSC 1P7KB 5CGYC 3RL1B 1B4JL 4B41A 1JWSB 2XA3A 1P9MC 3VFOA 2Y36H 4ZFOL 1CD1A 3NFPA 2DTSA 5E7BA 1KEGL 3IU3B 4L1DA 2I9LB 2VXSH 2CRZA 1ZLUK 3BN9C 5I16A 4J1UA 3WKMH 1T1XA 2HFTA 4YHKH 3S35H 5T1LD 4N0RA 1SM3L 1I7UA 2EIEA 3TCLA 4BK5A 1G9MC 2K1MA 5FUCE 2NY7H 1WFTA 5DJDB 4OGYH 4YXLL 4OJFH 4ZUUB 1FIGH 3CZJA 1A2YB 5D7LB 1HINL 4M5ZL 1AGDA 3NPSC 4MCYA 5A2JH 1IBGL 25C8H 3ARSA 1PY4A 2FGWL 4AIZA 4D2NA 1J88A 3VXOA 4NNPL 5DR5L 1I4FA 3BKJH 5F9OH 1RZ8A 4XP5H 3V0AC 1Q9KB 5CJXA 4RMSA 1BVLB 4OFKA 2KPNA 2RFXA 5D7JD 2F54A 5DRWB 5BO1L 1BVKB 3TBYB 3TVMD 1KC5L 1CLCA 4JFFA 1U6AH 1OY3B 3IJHB 1UQSA 5J06A 4NUJB 4LFHG 4PRIA 2BSED 5GRJL 3M8OL 3LQAC 4QHKJ 4LL9A 3EGSB 3WUZA 3FFDA 2OZ4H 4GQ9H 3ORJA 4NQCA 1OQOA 1DQQB 3KWWA 4PJIE 1C8PA 2FR4A 4GLRH 5JW4M 2D03H 4ZTPH 3G6JB 2UUDK 1VPOL 1A4JB 4BZ1L 5CBEB 3TEUA 1HHJB 1N7MH 3FQXA 3BP7A 4X5WA 5E9DD 4KPHH 1UJTA 3QPXL 5KSBE 1F5WA 4H26B 5GS1C 1SYVA 4MHHI 1K4CB 1YEKL 3PIQA 1RMFH 3PDGA 1JGUL 4KI5C 1QSEB 4ZFGH 1QFPA 1ZT4B 3BQUC 5J6GB 1HILB 5ADPL 4KK8C 3MNZA 4IJ3B 5LGJB 4PJDA 1BX2B 1YNTB 3VXRD 4L3CA 4NKIH 3EDJA 1I1AA 1KN4L 3NCJL 3HS0B 5HJ3A 3HN3A 2W9EL 4R4FL 2VC2L 1JGVL 3DO7A 3HPJB 2R0LH 5EWIL 3ZT6A 1TVHA 4XCEB 3QXAB 2HT3C 3FT2B 2UZIH 3UXFA 2HYMA 4G6KH 4ONFL 4QRRE 1RZKC 2W0KA 3OG4B 5A2IH 2FJHB 4MJ5A 4P23A 1E4KA 5CJBA 5FO8B 5I66B 5D6DC 5E5UB 5ICXA 4KKCD 4GAJL 3D48R 4XCCH 2FX9H 4XPGH 1HNGA 3HAEG 1MJJB 4D3CH 4DAGH 2X70B 1TMCB 1VKXB 2AV7A 2J12B 1JGEB 1KLGB 3HC4H 3KDMB 3NGBC 1I9JH 3DMMD 2YD3A 2DQUH 4K23H 1TTFA 4Q9QH 3C6LA 4J7RA 2I60H 3FQTA 2ZOKB 1CICB 1HE7A 4X7TB 1FNEB 1O7SA 1QQDB 1ZLWH 4I8DA 1FO0A 4G7VL 1A6VH 5CD5C 2G9HB 3MBEC 3FO1A 5I18H 3QIUD 3S96A 2FEEI 2JK5A 5CSZA 2GAZA 3D18A 2Z8VC 5D93B 2VZSA 4PRPD 3MBXL 1E0OB 1T21A 4MD4B 5IW3A 2H8PB 1II4E 3KJ4C 4WV1A 1R3IH 3GJEB 4TNWF 3DBXA 2WP3O 2ZSWB 1UVQB 1AD0A 4AL8L 5ICYA 2BVPB 1FNFA 1T2QH 1P53A 1LD9A 4G8EB 5SV3A 5J1TC 3FMGH 1IT9H 3ZDXF 5IBLD 5IGXL 3VD5A 5EU6D 1Z9OA 2EDXA 1GIGH 4NO0A 4PJHA 4JPIA 2YA2A 2HFEB 5DMKA 4RZCB 4NO5B 2DQEL 4Q6YA 3X13B 1U8JA 4H20H 1OM3L 2WUBH 1YUHB 3LOWA 3FT3B 3T3PE 3BKYH 4Y4KB 3CDYA 4OKVB 4XVUC 4O00A 5EA0L 3EIFA 5EOCJ 1MWAB 2I9TB 2PETA 1IAII 4NDMA 3TYGH 5CJOL 4PR5A 4QHMA 3BHBB 1NFDE 1E4WL 5D7SH 3T0ED 3OR6A 1W72L 1DL7H 4PY7B 3SJVB 1NLDL 3IJYB 5C7XH 5L88L 2HKFL 2F8XC 3QNXA 3H7BB 5HGDB 2G5BB 5F3BB 1PSKH 3E6HA 3LRHA 3MRJB 4CN6A 2COQA 3QI9B 3UTQB 3ULVD 4XMKH 1AQDB 4MDIB 4O5LL 4UMGA 3RU8L 5IB5A 1E4XH 3T0AA 3UTZA 4BA8A 2VE6A 4MXVF 4P4KD 3DRQA 1PZUB 1G0XA 5ESQB 4XCYA 1F02I 4YZFF 5LKNA 5E8NB 2Y1VA 2H2SC 3ARBC 3BRGC 5KSAC 3EO9L 2YD1A 3B9KD 4L9DA 2FJGB 1D6EB 3GHBL 1MY7A 3WJJA 3N06B 1MQKH 4PGJA 4OCRH 1QA9A 4HGKC 4Q74A 1EEYB 3PQYB 3G6AB 5GGUA 2XQYK 5MEOA 3QDGB 4PBWD 4C59B 5KVEL 1U3HC 4GJTB 1FAIH 1U8PB 2HN7B 3VI4E 4WWKA 5LXGL 5CWSB 4ODSL 5IK3A 1WC7A 4KGLA 3HMXL 1BD2D 5JOEA 4NM8H 1YEGH 3BD5A 3O41A 5L2JB 3REWA 3RL2B 3OWEA 2YWZA 3EOAA 2XPGB 4TYUA 2DLTA 1OAKL 1RZ7L 1TJHL 4IRSC 1OAUL 1B0RA 4UQ3A 4P2OB 1RJLB 4BZYA 2CRIA 3V6OA 4EI5B 3BP4A 1JPST 5DHVH 3IFPB 4HUVB 1LEKA 1HSBA 1TZHA 2ZPKH 5CP7A 1AHWB 3S88L 5TDPB 4P59H 1UM5H 5C92A 3N85L 3OXSA 4H1LH 3QWRA 4X4YA 4ZNEA 3AUVA 4DZ8B 3PP3H 4ZXBC 4ZAKD 5GS0D 5DC9B 1FDLL 4XMLH 2ITCA 2DQTH 3FQWB 5SX4H 4HV8B 3L3DB 1XF3A 4NKMB 2I26N 5C6WH 2M26A 4CVZB 1INEH 2X1WL 4PBVC 3C2SA 3O2DA 5B39A 4KI5F 5D1QC 4CNIB 5EBGA 1N59A 2F5BL 2BMKA 4TUJA 3SKMB 4FQQA 4WFHE 4PYGA 3AY4C 4FQHA 2HRPH 4MAUL 1YMMD 5DUBA 1WTGT 4HKXB 3RKDD 4LLMB 3RNQA 2BNQD 2B0SH 3I6KA 5ERWA 4OGAD 5CEXA 1S9XA 4X7DC 5D8JL 4L8CB 4GRMA 4WNQB 4KMQA 3VFSB 4NO3B 2X4SA 4IDJL 3TC9A 4CMHC 4NN5B 5BS0E 1T20A 1MI5E 2DYPB 1B4JH 1DN0B 2JJWA 1C7TA 2YD8A 4O4YH 4OT1H 1HH6B 1XEDA 1SJXA 2F54E 5SWZB 3HC0A 4MXWH 5IBUG 4W4OC 2EKSA 3BEWA 4K3JH 2A73A 4YBLC 4W6WB 4PRIE 5LVEA 3FO0L 3LMJH 3FB8A 3IDIB 2DQFA 4JRXA 1KNOB 1T4KA 3EFFA 4D0BA 1OGAD 4OCSH 5BJTA 4UTBH 3CFKA 3A6BH 1NAMA 3QEQD 12E8L 2YK1H 4Y1AB 5KJRH 3LKOA 1YDPA 5HPOA 4DEPB 2XY2A 1AJ7H 2NXYC 3I85A 5AUMB 3W9EB 3WFBH 4WI6A 4HXAH 5ESAA 1JNLH 3H6JA 3V5KA 3JWDL 3QIWA 2CJUH 2W59A 4GRLD 3HI1A 6FABL 4JFOA 1S3KL 4HWZB 1DBAL 1A5FL 5GRJH 5DZNA 2ZNWA 2DIJA 2ZUWA 3BVNB 5ISZB 3MO1A 3DHJA 5TGBB 3GMLB 1VACA 1OTUC 4KK5D 4R2GD 3QDAA 2GCYA 1SBSH 3K2UL 2GUOB 4ZUSA 4X5LA 1I9RL 1YPZB 4FQIH 1K85A 3KYMA 4OZGB 4P4RA 3UO1L 5E70A 3IB4A 1IGMH 4ZFZA 4U0RC 1L0QA 3P4NB 2NY4D 1DQJA 4RGNB 1S9YB 3PGFL 4IRJB 4Y4HC 4WI3A 1FZKB 4FP8L 1ERNA 1ZT1B 3IFNH 3WIHH 5K59E 5JUEH 1DUZB 1ONQA 4YEFA 1KJ3H 2J3SA 4I48B 2AJSH 4NCC2 1CXIA 3O45B 3QUZC 3FONB 4RAUA 2P48B 1BGXH 5FA4A 3EZJB 1J18A 5HHNA 2FDBP 2W9DH 4P2RB 5L2KD 5JORB 1CI5A 4EQ2A 4BUHA 3VFVB 4OCYH 3RL1A 1P7KA 3ILPB 2QQQA 1JWSA 3K1DA 5I1AB 3KPTA 2CPCA 4V2CB 1G6RB 3EFDL 1EH9A 3KVQA 3IU3A 1HHKB 1RZFH 2I9LA 2GK0A 3C60C 5B8CC 1DBBH 3NCYS 4NHCL 1I1YB 5F8RC 1OP9A 3MLYL 1S7RB 3DX6A 4JB9H 1E6JL 1N8ZB 1OCWH 3G5VB 4M7ZB 2AK4D 3AMLA 3UZEA 5DJDA 2IPUK 1MCKA 1T66C 4ZUUA 3KPQB 3VXUB 4MX7B 1A2YA 1IZKA 4AMKL 1LO4L 3EDKA 5D7LA 4OCNC 4PB9L 2H3NB 4PJHE 3RGVD 4Y16C 1P5UA 1B88A 2FBJH 4NWTH 1CFSB 2YUWA 4MA7L 4G6JL 5KBNC 2LABA 4OGXH 4ONHB 4TVSa 4I77L 4LDEB 1Q9KA 5FYLL 5DRWA 2IMMA 4PJBF 1BVKA 3H0TB 3RWEB 1RHFA 3TBYA 5IVZB 5KTEH 1HQRB 5IJKA 1A1MB 5LBSL 4A2MA 3IJHA 1AFVL 4NUJA 4PG2C 5FGBC 5C9JB 4S1RL 4HH8A 1NBQA 1NMCC 5GRUH 3KLHC 4XNUH 5SWQB 3EGSA 4L4VD 5EU7C 1GZQA 3BKCL 5SWSD 1DQQA 4MAYD 1EIBA 5GJSH 5D71H 3CIQA 3DIFB 5FYJU 5CBEA 3BD3A 1HHJA 3OQ3B 3WDHA 1NUNB 4HIEB 4TOYL 2CIIA 1WBYB 4H0GA 1Q0XL 4ZQKB 5B39G 4H26A 4RFNB 1K4CA 2ICES 5DUPH 5EA0H 4O02L 3GO1H 5DZOA 2P43B 1QSEA 1SJEB 4LDOB 3MODL 4JJHA 1GL4B 1YEIH 3O4LB 3O8XC 3THML 1PLGL 2VISB 1P4IL 5J6GA 1HILA 3P11L 1NLDH 2QL1A 3ARXA 4TPRH 1BP3B 1YMHB 3NH7H 4NJ9L 5LGJA 3BZFA 1BX2A 1YNTA 4G7YL 1NKOA 4G6AC 4FTVD 2JKXA 1BFSA 3RU8H 3HS0A 2FX8H 2CO7B 4KRPD 2D4FA 5D1XB 5DJ2B 4M1GH 4AEIH 3HPJA 4PJAF 8CGTA 1RY7B 5MI0C 2GI7A 4XCEA 3QXAA 2PYEB 4NNXB 1UYWL 3FT2A 1CFVH 5IFJB 2NY3D 5C3LD 3OZ9H 2OTWB 4S1DC 4LKXB 3TA3C 2FJHA 1JGDA 3ZKQD 4DGIH 5FO8A 5I66A 1XIWB 3F7QA 3AROA 4ZNEE 3EYUH 3VWJC 3MV9E 2ZKHL 1MJJA 2X70A 4N8VB 4GG6B 1F13A 1JGEA 4NHUB 1KLGA 1CG9B 5DD5L 3KDMA 4HBCH 3Q1SL 3JUZA 1AQKL 5EOCH 3CMOH 4MLIA 3JUYA 4BSJA 2VITB 5HGHB 1VCAA 1J10A 1TJHH 4I3GA 1CICA 2Q8BH 3QH3B 1FNEA 1QQDA 3I2CL 4XWOD 3WNLA 1INDH 3KLAA 4HQQH 2G9HA 3ZHKA 4O2EB 3LEXB 3ARDC 3OPZL 4HAFA 4Y89A 3T1WA 2CK0H 2B4CL 5F7EL 1JHLH 4H25B 3WFCL 3NBNA 3OHXB 3VGAC 3GSOB 3O6KH 3UC0H 2H8PA 4HLJA 3Q5YA 1UXWB 3GJEA 1WAAF 2ZSWA 1UVQA 2BVPA 2NY6D 3IDUA 1VESA 4G8EA 1IAMA 2AJYL 5JZ7D 1J9CT 3O6FD 4JPWH 4JM2C 4GW5B 3HE7B 2YN3A 4UDTB 2EDTA 2HFEA 4F58L 4RZCA 4FQ1L 4NO5A 1A21A 3SDCC 3X13A 2QQKH 3OAYK 3MRGB 4UT9H 4ZD3H 2IAND 4F9PA 4Q97A 3WSQH 5C0EB 1YUHA 3WNMA 1GGUA 5F96L 4WIQA 1OTSD 3NIFF 2DWEB 1BREA 2Y6SC 4OKVA 2Q76B 2YPLE 3G5XB 3PL6C 1MWAA 2FLRT 4PY8I 4HJGB 3MOBH 3BHBA 4GUPB 4J3TA 3BN9D 3ZKXC 4XBGB 3SJVA 3LS4L 4OQTA 4OLXH 3H7BA 5HGDA 4LSTH 2G5BA 3TO4C 5F3BA 3MRJA 3QI9A 3UTQA 3VI3F 4RCAA 4G6FD 1AQDA 3IAQA 5FIEA 5D7IB 4DKFH 4M7JL 3OMZA 1YECL 1AC0A 3QDJB 4LRNL 3BDYL 5FM5O 3FO0H 4TUKL 1C1EL 4I3SH 3ZLQC 5E8NA 2ED7A 1KPVB 4H88L 3VGDA 3LZFL 1D6EA 5LQBL 3EDDA 3MQIA 3RX8A 3VA2C 1EJOH 3PQYA 3G6AA 5ALBL 5C0AB 3TN0B 4AYFA 1YJDL 3S5LB 3QDGA 5IB2B 3U82B 4D9LH 2X09A 1SJVA 4HG4K 2OI9C 1U8PA 2HN7A 3SE4A 5I17B 4XNYH 5CWSA 2VLLB 4E0RB 3UTPD 3EJZC 5JA8B 2VJXA 1FFNA 3I3BA 4K71C 5L2JA 3RL2A 3T09A 5C07D 2XPGA 2YUVA 3VMNA 3U7WL 3IGAB 3B8YA 3Q6GL 5BZWB 2ADGB 1RJLA 4P2OA 4BQBA 3DXAE 3RBGA 3N50A 3EJJX 4M9PA 1MFBL 4EI5A 2A0LC 2B2XL 3IFPA 4HBQA 1A7PH 2P5WE 4HUVA 3MUZ1 1MCIA 3B9AA 3RIFF 1ZVSB 4D9QD 4U6TA 4YHYC 1AHWA 3TFKD 4JY5L 3L5XH 1MNUH 3UO1H 2NXZC 4MGXA 5CUSH 2R2HB 4DZ8A 3LDBB 4JN1H 2M2DA 1S9WB 1ZWIB 3FQWA 4JFZL 4GKSA 3EYVB 4HV8A 1A7RL 3L3DA 1KUMA 1PDKA 2EXYC 4NKMA 4P5MB 4I0PC 3BQUD 2R2CA 4GAYB 4CVZA 4UIKL 1Y6NR 2DS4A 5FUCC 3K46A 5HYEA 4OCMC 4CNIA 5IMOA 4HS3B 1CF8L 2FB4L 2OSLB 3SKMA 2XT1B 1RV6X 3BISA 4IIQB 3FCTB 1BLNB 4HKXA 1J0HA 4LSPH 1CVSC 5HBBA 3UTTE 2YMXH 4L8CA 4WNQA 3VFSA 2J4WH 3RWCB 1Z9MA 2VUOA 4NO3A 3OV6A 1CU4L 4JEGB 3W39B 4UINH 2DYPA 1DN0A 4Z7UB 5HI5C 4NOBA 1KLFA 1IEHA 5K9KB 3QA3B 3L5WB 3MLSH 5SWZA 2OK0L 1AKJD 5GISL 4P2CG 5K33A 4NQDB 5F7MC 1JRHH 1OLZA 3TH2T 5GGVY 2AQ2A 3QRGH 1PX4A 3FHQA 3IDIA 5GGSY 1KNOA 5T1MB 3FTGB 4PREB 1KCSH 2ICEB 3VH8B 5CS7A 1UH4A 1BEYL 4Y1AA 4PJ5B 3H3PH 5DFVD 3HUJE 1LO2H 5AUMA 4N0YH 2BZDA 3W9EA 3WNPA 5E08H 1RAMA 4OB5H 4BZ2L 4EEEA 1PG7L 1TENA 4XH2B 4YDJB 1VFBA 1S78D 2BNRB 2NY2D 1ES0B 4KTEL 1UWXH 1UWXK 1GGCL 4R90L 2Q7YB 3X17A 4HWZA 1QSEE 4M03A 4QOKD 1KXQE 4WWID 1LP9F 5DGRA 1CDUA 4ODTH 2RAMA 5IFAH 4YK4B 3BVNA 5ISZA 3OGOE 1QRNB 1JZ2A 5TGBA 3GMLA 4POZD 4Q6IC 4X4ME 5IR1B 1G6VK 3VGFA 3ZE0E 1B6DA 2B5IC 4JM2F 4ZMAT 3Q48A 2GUOA 3WXWL 4PBXA 1YPZA 2MQCA 4MQ7A 4ZPTB 3QG7H 2F8OA 4PIRF 1CN4A 4N1CA 3SGKC 5I19L 3NACH 3L3HB 4RGOL 4NN7B 3E1F1 4Y2DB 4Y5VB 5C6PB 2MQ3A 1S9YA 1TQCB 2YZ1A 5BRZA 3PUCA 2N56A 4JFDB 4IRJA 3N1PC 1FZKA 3W0WD 4O02H 1ZT1A 2AQ3A 1QFWL 1CLYL 2JJSC 2NY1D 2UWEF 1R0AL 3P77B 2X9XA 4P3DB 1DUZA 2GEEA 3FQUB 4R4BB 1YY8B 2BSTB 1P4IH 3N1MC 4BQ8A 4XVSL 5FK9B 4KVCL 2GIYA 4I48A 4PJGF 4KQ4H 4Z7QE 5FA3B 35C8H 3FONA 4QRSB 2DM7A 1MCLA 2NZ9C 2WBJC 2IG2H 4NCDA 4P2RA 5KSAD 3ETBF 3T2QA 3VFVA 3LPWA 1F4YL 1R6VA 2MCPH 3ILPA 3U7YL 1OD9A 1MFAL 2NX5D 5I1AA 1WZKA 5BCAA 3TJEL 1QVOB 1HHKA 3UJJL 1U3HD 4Q9RH 2O5ZL 2NY5H 2QADC 1BZ9B 2YUZA 4MMZC 4XAKD 5GGTH 5I1LA 4XTRC 3HFML 4Y5YC 1I1YA 1QSFB 5FHBL 1S7RA 1F97A 3GHEL 4YIQB 1N8ZA 1TDQA 4FG6C 1HNFA 3LKSB 3G5VA 4I2XB 1SY6H 4ZNCD 8FABB 4IRSD 2YRZA 3QPQD 3RPIB 1U36A 3BSZH 1FZMB 3KPQA 3VXUA 4MX7A 4P49A 3LQZB 2ZUVA 4W81A 2H3NA 4DCQA 5ILTH 5J7CC 3WS6C 1P7QD 5AEAA 1A6PA 1CFSA 4X7EC 1MCBA 1F3RB 1GPOH 1UT9A 3M07A 4E41E 3RWEA 4O2FA 2OR7A 4HK3J 4ZXBD 3MC0A 3RVVC 3FHAA 1IQWH 5IVZA 1FH5H 1HQRA 2E7CA 3ES6B 3P40A 1FRGL 1A1MA 4FQXC 2OXGA 5C9JA 5DJXB 1P7HL 5SWQA 4PGZA 1LK2B 3PWPB 1ZGLM 4NYLB 2PO6C 5T5NG 3EYSH 3NPZB 4HMCA 1S7TB 3SGDI 3TBVB 3DUUB 3DIFA 3CC5A 2ENYA 5GRVK 4KXZH 4WUKL 2Q6WB 4MZ2A 3BPOC 5MHSD 4JG1L 4HIEA 5KOVC 4LSSH 4P9ML 3G5ZA 4YHOL 3TV3L 1WBYA 1AXIB 1JHKL 1N5YL 4MZ3A 4XP6L 4M62L 3NIGE 2LQRA 3HI5L 3QISA 4ZQKA 4Z5RA 2YBRB 5F96H 1FBIL 1CGXA 5GSRB 5FKAB 3GNML 1QKZH 4LIQL 1SJEA 3O4LA 1YEEL 1G7QB 1CGYA 2VISA 3QDGE 4PRHD 3O6LH 1YMHA 2CDFB 1R24B 2BXZA 3FO9B 4POYA 1FO0L 1P4BL 1RIHH 5L0QB 3C8HA 1TQBB 4S1QL 1KJ2B 5D1XA 5DJ2A 4ERSH 1L9NA 5I74C 2XZQH 3O4OB 2PYEA 3PWUB 4M5YH 4NNXA 3SDDB 4XNQB 1F4XL 5IFJA 4H88H 4PJIF 5I1CH 1U92B 4F9LA 3RJDA 4LKXA 1HWHB 1E6OH 2NXYD 3KXFB 3MGTB 5DZLA 1I7RA 3HNVL 5HGAB 1ZA3B 4DKAA 5CCKL 1XIWA 3VW3H 1XF1A 2BVEA 2WUCH 2JIXD 5DK2B 1LO0L 1S7UB 4N8VA 4GG6A 4NHUA 5KSBF 1D5IL 1CG9A 5E00B 4XCFH 4HKZB 2AXGA 4GFTB 4M8QB 2PW2B 3B4NA 5M94B 1WZMA 1ZANH 1RD6A 5HGHA 2VITA 4WO4B 5H37G 3VMOA 4Z7WF 3S36L 1U3JA 5HDBE 4ALAH 4OLUL 5DWUL 3QH3A 4ZTOH 5I71B 4EUPB 4K2UH 1CFBA 1KIUA 3IKCB 2D4DA 4O2EA 3LEXA 3KPRB 2J5LB 4LHUD 3PP4L 3QAZC 4H25A 3K4ZA 3OHXA 5IEHB 4Z0XB 2IPTL 3GSOA 2GJ6B 1I1RA 3KLDA 4NZUL 2Q8AH 4LVOB 1UXWA 1HSAB 2F53B 5HVGB 5CJXC 1S7SB 1V3LA 2OX5A 4MB4A 5TF0A 1J1OH 1RZJH 5F7YC 4AEEA 3GSNA 4JFZH 3RQ3A 2VYRE 1KYOJ 4GLRI 3BGFB 2HMIC 3V6FB 1T5WB 3I9GL 4GW5A 1F90H 3HE7A 1CZ8L 5SWZE 4UDTA 1FFPB 4UIKH 2XRAH 3MRPB 3DROB 4M6NL 3QUZD 4JCMA 3HAEH 4QRPB 4JDZB 2W1NA 3MRGA 4HJJH 3RJQB 2Y9RT 1SHMA 3AS1A 1VEOA 5C0EA 5C0CB 5TQ2L 4JVWA 1MJ8H 3RWIB 4PUBH 3DJ9A 3MJ6A 4TSBL 4CU7A 2DWEA 1KGCE 2Q76A 4B7LA 3G5XA 3VA6A 5GRXG 3LKPB 5F72S 4Y1AE 2VZTA 2DLIA 4HJGA 3M17B 4P3CH 4GUPA 3BP6B 2YRLA 4F7PB 4XBGA 1JTTA 4WGVB 4NC1E 1EVTC 4KZEH 5HHOD 3A67H 1MLBB 3C9NB 1G9NL 1YEJL 2EDBA 5DTFB 4DWHA 2J8UB 5DA0B 2AJZB 3QDJA 1OSPH 1T66D 3ME0A 4UV4L 4GW1B 5EB9A 5ANME 3MRKB 4IMKA 3QCVL 5ITBL 4OIBA 1I1AC 1KPVA 1KSRA 4IOSD 3JWOH 3SKUD 5ISZE 4YDIL 1T89A 1FYHB 1QD0A 2UY7A 4OD1H 3GRWH 5I8KH 2D7TL 3NZHL 5CEZE 5C0AA 5I8OL 1YPZE 3S5LA 2XACC 4XPAH 2ORBL 5IB2A 5JQ6L 2Z8RA 3MXWH 2QSVA 2RR3A 4BZ2H 5I17A 3O2DL 4JREB 3JV0A 1N0LA 2VLLA 1E4KC 3FB7B 4P23C 3TPUB 4E0RA 3R06B 1HIMH 4N5EC 5BRZE 3QXTA 5AWNH 1Z9SA 1M7DB 2ZCLL 4HS8H 4FQLL 2A9ML 1EZVY 4QYOB 1FV1A 3GJFA 5C0GA 1NFDF 3IGAA 3RZWA 2ADGA 4NP4L 4KAQL 4KMTH 3I3EA 3K4AA 5DD6B 3DRTB 3C6LC 3QCTL 1ZVSA 3HNSL 4M43H 4R9HA 1F4WL 5T1KD 1UG9A 4HCRA 5HYQB 4P2RE 2R2HA 1F45A 4AEFA 1L7TL 1BZQK 1L7IH 2BX5A 2OR9L 3E3QE 4LAQL 4XVJH 2ATPB 4BKLB 1T7YA 3EYVA 5IB1A 2R8SL 3O8XD 4P5MA 1HYSC 4WV1C 4MNQD 1ZVHA 3LH2L 5CP3H 4GAYA 4NKQB 1MPAH 3VGBA 4G6AD 4OCXL 2FATH 3KS0J 4HS3A 4FFYL 5F71A 1I9IH 2OSLA 5I30L 4WTWA 1MFEH 4IIQA 1I3UA 3FCTA 1BLNA 4MCZB 1JYNA 5EBMB 2CR3A 3MRRB 3VXUE 1LK3L 4BFEA 2APBA 4PP1C 1IFHH 1GGBH 3RWCA 4PG9B 3TA3D 1VERA 3MLZH 4ONOA 3W39A 4Z7UA 3UYRL 5BV7L 3RHWF 2X5PA 1Q9LB 5K9KA 1E4XI 3QA3A 3L5WA 3ZT5A 2DQCH 2DQJH 4N68A 3UJJH 4P46B 4L4TA 4QHLA 1MIML 4LLYB 4NQDA 3E2HC 3VWKD 4N5UA 4AH2B 2RB8A 5T5FH 2FEDC 3SKJH 3QFJB 4Z7VA 1NMBH 5T1MA 5FOJA 3V7AG 3FTGA 4PREA 4HW6A 2ICEA 3MV8D 3VH8A 4YGVA 1IILE 3X3FH 3RWHB 3S98A 5AZ2H 2A6DB 2QJDA 4FS0A 3F5WB 1P4LB 1KJMB 4HKBB 1RUPL 1UC6A 3MV7B 4OM0L 3QP3A 5C09B 2VDQL 3BGMA 1XT5A 4XH2A 3WJJC 4YDJA 3ULSB 2BNRA 5CZVH 1ES0A 1H8OA 2Q7YA 5EOQL 2R9HD 1R3HB 2K3TA 3ZE1F 1DDHB 4DUXA 4LSRL 2DBJA 4WWKC 2ICWI 4DN3L 4HWNA 4WTZA 1Z2KA 5IEKB 3SDCD 1QRNA 5T3ZE 5CKAA 3PHSA 5DLMH 4DFIA 1FNGB 4XPFH 5IR1A 2R2EB 1CLZH 2CR6A 2JB6B 4ZPTA 3V6OC 5SX4I 4WUUD 1PYWB 3SCMB 5DRZB 2HT2C 2WWKO 2Y6SD 3L3HA 1U8IB 4K7FB 3WKNA 2PYEE 2F58L 3PL6D 4Y2DA 4Y5VA 4MNGE 3G5YA 2ESVD 2ILLA 4EDWL 4JFDA 4ZPVB 4CMMB 3T2PA 4Z8FL 3G04B 2WP3T 3B6SB 3P77A 1Q9OB 1DQML 4P3DA 3OKDB 3FQUA 4JFPB 4KK6C 3RWFB 4R4BA 1ULVA 2RQ8A 4GSDH 1YY8A 2BSTA 4LP5A 3V7AE 2ERJB 4LCIH 3PXJA 1AO7D 3O81A 5FK9A 3WFDH 4XXDB 2ZCKH 4GG6E 1KPRB 1U8NB 3V4PH 4UB0L 2EH8H 5FA3A 4QRSA 1GSMA 2DQHL 32C2B 1NUFA 1HHHB 2YN5A 4G3YH 4W6XB 5ESVA 3UPRB 4KVNH 4OLWH 3HRZB 2DAVA 4R97B 4LGSB 1F4XH 4X5XB 1FLRL 2EH7H 1RULL 2X4UB 4PJDF 5C0BB 5A3IC 1QVOA 1QSZA 1ZEAL 4KZDL 3I6GB 1ACYH 4DUWA 1F00I 5CCKH 4P9HH 1BZ9A 3EJZD 2MOVA 2XOTA 1TZGL 4G5ZL 5FGCB 5JHLL 1QSFA 2D3VA 2D7QA 4DKDC 2GQHA 4YIQA 3BE1H 1GYAA 3LKSA 4I2XA 8FABA 4X80L 3RPIA 5L9DL 3S5LG 4JFHD 1FZMA 4B0MM 1PX3A 4XMPH 1S7XB 5K59F 3LQZA 4HUNB 3MLVH 4MSWB 3CVIL 4HIXL 2A0LD 2Y5EA 3D3VD 2AEQL 1QO3B 5DWUH 1X5HA 3O2VH 5GZND 5FDYA 3MR9B 4UV7H 1G7JB 2FNBA 1TPXC 1N5AB 4OTXH 1EA9C 3STLB 1N6QH 2IPTH 1IL1B 3ES6A 4PJ7B 5FEBA 2YD7A 3B2VL 2ZUQC 1P1ZB 3LIZL 3LN5B 5LWYL 1EFXB 4I0PD 4JLRB 2Z31B 3QIWC 1T7ZA 2J88L 5DJXA 1OARL 1QFUL 1UCBH 1LK2A 3PWPA 5KW9H 1T2JA 4NYLA 3S97C 3VG0H 4UU9B 1N2RB 3MLWH 4KJPD 5BV7C 1PQZB 3TBVA 3QUXA 3DUUA 5IT2H 2Q6WA 5AZEH 3ISWA 1BIHA 3C5ZD 5KOMC 5L6YL 1D5ZB 3ULUE 2A77H 2RCSL 2YKLL 5E94B 4ZO7A 2JCCB 2A6IB 2YBRA 4PS4H 2Q87A 5GSRA 3VFGH 5FKAA 1H3GA 1MEXH 3VXNB 4PJHF 3CH8A 1G1CA 5IROA 3SQOH 2B1HL 3H9SB 5IMMB 1G7QA 5FUZH 4X9BA 2JELL 2CDFA 4QHNB 5K9JH 1R24A 3SE3A 5M95B 3FO9A 4RA0C 2XWTA 5FKPA 5FFLA 3S8WA 4GXUM 5I15L 5I1EH 4QHKI 2WMPA 3TCXA 1KJ2A 5D72L 3V6ZB 2O26U 3ARGB 3PWUA 5IHBA 1AIFB 4GW4B 3SDDA 1BWWA 1QR4A 1IC4L 4XNQA 2R4SH 3BPLC 1UKTA 4JQIL 1U92A 3T3ME 5IV2B 3RVXC 4YDIH 3C6SB 1KENH 3MGTA 5HYJE 1GXEA 3OAUL 1BFVH 1CD9B 1ZA3A 5HGAA 2XYCA 2D7TH 4LEOB 5I1JH 5I8OH 2C5DC 2FZ3B 3VH8G 2VKXA 5DK2A 1S7UA 4MWFB 1CQYA 4I3RH 5BVPL 4GT7A 3PGDB 4MA1B 3INUL 5E2WH 5E00A 3E0GA 4NQSB 4LSQH 4HKZA 2G5RA 4M8QA 2PW2A 1VEPA 5T1LB 4OBRA 4OCWH 2A9MH 4WO4A 4ZS7L 2OL3H 1CGSH 1S9KC 4XC1H 4EUPA 5IQ9B 3IKCA 4KAQH 3OAZH 3OAZK 5EFIB 2QSCH 1MWAL 4NZTH 3KPRA 1KCLA 4QRRD 4F57H 2HG5B 4WTZG 4OQTL 5IEHA 4Z0XA 4LFHD 2GJ6A 5J6HB 5IVOA 43C9B 2K7QA 4FMFA 1HSAA 2F53A 4XNMB 1S7SA 4KUZH 3TVMB 3LVEA 3MCLH 4Z7UE 4DZBB 5IJKC 3V6FA 1T5WA 3RZCD 2PW1B 4ELMB 1QRKA 3BDXA 3ILQC 3QUMB 4LCYB 3V95A 1FFPA 4L4TE 5T3XE 3MRPA 3DROA 5DC4B 5IHUL 4QRPA 1NAMH 1A6TB 4NQDE 4JDZA 3HLAB 2H32H 2NZ9D 2VKWA 4R4NC 2GTZB 3ZKND 1CDHA 4ETYA 4ELKB 3LV3B 5C0CA 1NBYB 4Z7VE 5E1AB 3DUSB 2C4FT 2L4OA 4QGTA 2VLME 3RWIA 4F7EB 3LKPA 1EHNA 4WU7B 2H26B 1HKLL 4GKZB 5E9DB 2EECA 1WVZA 1ZA6B 3M17A 4DVRH 3BP6A 2GTWB 2I5YL 2IQAB 4F7PA 4R8WH 5LGKA 4XTRD 2PF6A 1ZE3C 3HC3L 2FIRT 3HTLX 4F33B 1MLBA 3C9NA 3P30H 2BNRE 1YQVL 2C26A 2LE9A 2IFFL 5DTFA 5E8EA 1UJ3B 2J8UA 2WLYA 4GRWB 2AJZA 5DVOA 3VD7A 3SQBA 2MFNA 4GW1A 3DO3A 4IJ3C 1Z6JT 3MRKA 1RUML 1CTNA 3KLSA 1CBVL 2BOCB 3D39E 1NFKA 3WUWB 3U9PL 4M7LH 4OGZA 2P5EB 5A2KH 5F7UA 1IAIM 3KS0H 2Z92B 1RUPH 3RVVD 4XP9L 5D1ZB 1B3JA 1WLHA 3RFZC 1XCQB 2P45B 1CXLA 3ET9F 3TPUA 3FB7A 3ARPA 3R06A 4RSVA 3GEWB 4DK6A 1JPTH 3R1GH 3BZEB 4JHWL 1LO5B 4QYOA 3ALWA 2PO6D 3KYNA 5EZIL 3AS2A 4BH7B 1MFCL 4NUGH 1B2WH 1L9MA 3CK0H 3DRTA 3Q5OA 3RKPA 2C3XA 1CICC 3VFUB 5I76B 3QUYD 2D0FA 4FZ8H 3MRFB 3DHMA 1FPTL 2V5RA 3LKNB 3QIUB 4X6DB 2BY1A 3L1OH 4YDKL 3EHBD 3VXSA 2F58H 4PRPB 5D93C 2LU7A 2ATPA 4BKLA 4EDWH 3MUHL 1JF1B 5DF0A 3RDTB 4UAOB 3BZ4B 1VGEH 1DVFD 4TN9A 2APXA 1OPGH 4JN2B 3AS0A 5GRVL 2AEWA 4UT7H 1QSFE 4UILH 5GRYA 3WEXB 5DVKA 2C4FU 3CLFL 4HPYH 5EU6B 3MJGX 4PFEA 4PLOB 4I2XE 3R8QA 2YD4A 4MCZA 3HE6D 1ZAGA 4DN4H 1RIVL 2GSIB 3EOTL 3GI9L 1MFDL 3MOAL 4K7PH 4PG9A 5EUOB 3RY5A 1C08B 1URLA 3PDDA 3S3JA 5DJ6B 2AJUL 1NBVL 4ZSOE 4QXTB 1Q9LA 4Y4KC 2SEBB 4Z95L 4P46A 3T0EB 4LLYA 1NCUA 4K8RH 3S37H 3D85A 3SE9H 4PGDB 4A6YH 3RIAK 3QI9C 4UT6L 1I3VA 3QFJA 4WFHD 3FQNB 3QG6B 5DFTA 4UTAL 4P4KB 4O9HH 3RWHA 4MB3A 2A6DA 2P47B 4NOFA 3F5WA 2Y23A 1P4LA 1KJMA 4HKBA 4ACPA 5JIIA 5BS0D 1MI5D 3ZE2E 4MXQC 4P99A 3B9KB 4N90E 2B1AL 3MLUH 5C09A 5FUOL 1OAZL 2DJSA 1FCCA 2V17H 3ULSA 4EUPG 2O5XH 4PPTA 2F54D 1U91B 4TULH 5K9QI 3B2VH 3FFCD 2ZG2A 1R3HA 3KPSB 4LARH 3IDYB 4AQOA 1DDHA 5TE6L 3SE4C 5LWYH 3K3QA 2J88H 3KHQA 4PRID 5HVFB 1J1XL 1CYGA 3GSXB 3S7GA 3U4AA 5IEKA 2P8MB 1FNGA 4RBPH 3V52L 2R2EA 4YFLF 1A9EB 1G6RL 2DQGH 4P2OC 4CKVX 3HA0A 2JB6A 4ODUB 4DW2H 5T33L 1A0QL 4J23A 4EI5C 4QO1A 1B4RA 1PYWA 3SCMA 5DRZA 4K7FA 1U8IA 1I7ZB 2RCSH 4LQ1A 3LD8B 4ZUWB 1AHWC 4ZPVA 3LN4B 4CMMA 5B4MD 5IW1A 2E9IA 5TPWH 1PJ9A 3G04A 3B6SA 1Q9OA 5ABDE 3OKDA 4JFPA 4GBXD 4G8IB 3RWFA 2Y5TB 3RA7H 2PUQT 1WWWX 2JB5H 4NQVB 4ZOBA 5DJ0B 3QHZL 4XXDA 5I1IL 1KPRA 1U8NA 4XNXH 1PKQB 1BJ1J 3QNYB 3FZUC 1RUQL 5I15H 1C5CL 1HHHA 1MIEH 3F58H 4QTIL 4HWBA 2VH5L 3EKCA 1IAIH 5D72H 5DFWH 1ED3B 3UPRA 2HTKC 3HRZA 5DSCB 3TBTB 2D7NA 1OF2B 3CNKA 3TWCL 1GJIA 3RY6A 1CDJA 2BNQB 4X5XA 2X4UA 5C0BA 1KEMH 5DMIL 1ETZB 3I6GA 3ZE0F 5EC1B 2YWYA 5EPMB 1MRDH 4NN5C 4P23D 2GJ6E 1F2QA 2DD8H 1MREL 1FGNL 4ODBD 3A6CH 5F9DC 4HIJA 1JGLL 1I8KB 5HDQH 3T0VA 3I84A 3ZDXE 5TJWK 3BWUC 3I6LE 3T0WA 1DBJL 4M02A 1S7XA 3FJTA 2VXUL 4P2QE 4XC3L 4MSWA 3W5NA 2Z8WC 1Z0MA 3C6LD 2D2OA 1EV2E 3MR9A 2BSRB 4GKOA 4Z7QF 4JPKL 1G7JA 2I25N 3QEQB 1N5AA 5F97E 3MACL 2PTVA 3L7FB 3STLA 1IL1A 4PJ7A 5T3ZL 1G0DA 3JTTB 4DEPC 1J86A 4OUUB 4NC1C 2AJVH 1P1ZA 3ABZA 3LN5A 4JLRA 4XPHL 2Z31A 1HYSD 3R0MA 1QUNA 4XXCA 1NCWH 4GRLB 5DEZA 1GHFL 4UU9A 1N2RA 1Q94B 1NCCL 3LKQB 4JRYD 1PQZA 1CE1H 4BH8B 4MXVE 1YN6B 1WCQA 2VN7A 3V0WH 2J2ZA 2B20A 3J7HA 2J8UE 4YZFE 4L8DB 3MA7B 1IGIH 1KPUB 3K0WA 1D5ZA 5F88B 5F8QC 5E4EB 4PP1D 1FORH 3RI5F 5E94A 4R2GB 3EOBB 1J5OH 2JCCA 2A6IA 2YRPA 2MHAB 3VXNA 3U4BL 2VAJA 5HY9A 5JHDB 4F15B 4WFFD 4RQQB 2NY4B 1CR9H 3H9SA 4RGNC 5IMMA 1RIUL 2BDNL 1MRCL 2I5YH 2IEPA 5KVGL 4IRJC 1NGPL 1YC8A 4QHNA 4QXGL 1BM3L 3DPBA 1EGJA 1NLBL 3GBNL 3TO2B 3HG1D 1F3JB 3V6ZA 4PJ9B 4EZMA 4LPCA 1OL0A 2PCPB 3ARGA 1IM9D 1NGWB 1I9EA 1AIFA 4GW4A 1CBVH 4KJYB 1KB5H 3BI9X 4JO3H 3L95B 5ADOL 4FFWC 1MAKA 5IV2A 3IDNB 3C6SA 5E2JA 3CFCL 4JANB 5D96B 4LEOA 3OKLB 3EO0B 2FZ3A 2QEJA 3VRIB 1XF5B 4MWFA 3NIGF 3VXSE 2XG5A 3LPGA 1RFDH 3SDAD 5JW3L 3MNWB 4WEMB 1ORSB 4NQSA 5DMJB 1JJUA 4WWKD 3STBA 3GUTB 1MOEA 4HXBL 4YDVB 4WCYL 4K9EH 5T1LA 4G6MH 4QTHB 4KI5E 1MJUH 2XQBL 1H3XA 4YE4L 5J12B 4M7ZC 3HI6H 5TFSL 5IQ9A 3DURB 3MCG1 4HWEL 1HXYB 1XGPB 5EFIA 1J11A 2WQRA 3NCEB 4QCIB 4JO1L 3RGVB 2HG5A 1RI8A 4F7MB 2CGRL 2FECI 5J6HA 3IS0X 5DD3L 2IMNA 43C9A 3UBXB 1H3VA 1N0XH 1Y6KR 1F11B 4OI8A 4XNMA 3MGAA 3QWRD 3BXNB 1NCBL 1J0IA 3MV9D 3TNMB 2DMBA 3RTQD 1DQDH 1SBBA 3TVMA 4DZBA 1D9KD 2IC2A 1GGTA 4KXZI 3UZVB 5IFHL 2KZWA 2PW1A 1NSNH 4JQVA 4ELMA 5C6TL 3QUMA 3FN0L 4OFDA 2QR0B 5I75B 2FHBA 4FXGA 2NPLX 5JR1H 4NN6B 3QCUL 4F8QA 3GBMH 5IM7B 4N8CL 4EBQL 2AERT 5T5NF 4L4VB 3BEVA 1A6TA 2CKBH 5SWSB 3HLAA 4MAYB 3U0WL 5I1KH 3X3GH 2D7PA 3MTRA 4MYWB 2GTZA 4M61B 3CDCA 3CLFH 3DVGB 4JM4L 4LLDB 4ELKA 3LV3A 3QFJE 1PFCA 2JF1A 1TETL 5E1AA 3DUSA 2G75A 4P5TB 2CD0A 2VXVH 2HJLA 1RIVH 1YNLH 4YHIB 5HDBF 3MJ9H 4F7EA 3HMXA 5E8DH 4WU7A 2H26A 1JNNL 4GKZA 5E9DA 2XN9A 4C54A 4OD3L 1ZA6A 2R1XB 2GTWA 2IQAA 3FAXA 1FNLA 2RGSA 4L1HA 4MJIA 4F33A 4U6VH 2R0KL 1CS6A 5E56A 4XBPB 2R56L 1RURL 1UJ3A 3GGWB 1T6VN 3KYOA 2E27H 1A47A 4I13B 3VXMA 4H8WH 3MCKB 1S5IH 2QHRL 3EO1B 5CEZH 4HCRL 1BFTA 5E2VL 2BOCA 5BMFL 5HI4C 4KRPB 1S7WB 5LCVL 5D1XC 3AU1B 3D2UD 1K3ZA 2OP4L 2YPLD 2P5EA 1SEBA 3M1BB 5DRXB 1JFQH 2NY3B 2Z92A 4ODXB 3WXVL 4X9GA 5D1ZA 1A7NL 4F9LC 2B1AH 3B5HA 1XCQA 3BWAA 2CDGB 1MCFA 5F1KC 1IGFH 2D0HA 3GIZH 3QIWD 2D7MA 1PEWA 4RMVA 4U3XA 4E42B 1ZHLB 1XIWC 3TESA 1IARB 5GHWL 2VR9A 1OQXA 3BZEA 1LO5A 3ARUA 1T0PB 5F21B 1UACL 3ARRA 3P9LB 4HUWB 1W0WB 5J89A 3PWNB 2HFGL 3HB3C 5I76A 3VFUA 4ONGL 1EBPA 2BOBB 3LKNA 3AFLA 4GKNB 4WU5B 2DQIH 4YUEL 1JZ5A 3QIUA 4X6DA 5F6IB 1MCJA 2YXMA 3WNKA 1UKSA 3P0VL 3HCVB 3PG2A 1JF1A 3RDTA 1AE6H 1FQ9C 4U1MB 3BZ4A 4JHAH 4KKAC 4NWUL 4HJ0C 4NZRL 1YPZF 2NR6C 4PJFB 1NKRA 2NY6B 4GOSA 4JN2A 4R96B 5FGCE 3O6FB 2W91A 1QYGL 3WEXA 2R0ZH 2BVOB 3DXAD 1YEFL 5C2BL 3HE7C 5EU6A 1FC1A 1B0WA 4R26H 4OLEA 5IMKB 2ZNXA 2P5WD 3PNWB 3ZYZA 4KQ3H 3FOMB 2Y72A 2GSIA 1WFNA 5EUOA 2DBLL 5MEPB 1EBAA 3RVXD 2IANB 4V1DE 4XVTL 3B9DA 2UZXB 5F3HB 3QZWG 1N4XH 4I18B 4QXTA 1SJHB 3OL2A 2VMFA 1YEHH 2SEBA 1ZLSL 2GYSA 5C0NC 1IQDB 3CXHK 3T0EA 4JQXA 5CFHA 2DMKA 4PJEB 3H9ZA 1A14H 2WANA 1JBJA 4PGDA 2D7OA 3DWTA 4G6FB 4HH9B 2W92A 5GRZA 1LHZA 2AEPH 2DDQH 3TZVD 1SMOA 4ZS6C 3FQNA 1MCEA 3QG6A 4G80B 2VXUH 4P4KA 1FGVH 2H1PH 5ID1B 1WWAX 1KIRB 2XFXB 3QIBB 3UTTD 4IMKC 3BH8B 2HAZA 1A3RH 1GC1H 2Y07L 3B3IB 3B9KA 3WLBA 3ARDA 3KR3L 1BJ1H 1VENA 2OTUB 3P3YA 2ADJB 5CSGA 4BK4A 5IESH 2JCCE 4QT5B 2VXQH 1U91A 2XXCB 3TN0C 5T3ZH 3HZVB 2CLVB 2VIRB 3KPSA 3GSVB 4XPHH 2ZJSH 1FG2B 2XZZA 3H9SE 3SE8L 3D69B 4DQOL 4MA8H 1JZ8A 4R6UA 1MJ7H 3GSXA 5C07B 2P8MA 1QBLH 3MGOB 2O61A 1A9EA 4PJAE 2R29H 5C08E 5F9WB 2AGJH 4K8RD 4ODUA 5FM5M 1OGTB 5D2NB 3T77B 1OAQL 2ZUUA 5FM8A 3CSYB 1I7ZA 3QO0B 3RP1A 5DMYA 3RRQA 5DXWA 4ZUWA 2VZUA 4HF5L 4WI7A 3GSQA 5HYSB 4FQCL 3VDBA 5DURD 2APVA 5C8JB 3ZO0A 4C4KT 3LDBC 1RHHB 2XA8L 1A3LL 4G8IA 2Y5TA 2BDNH 1QSED 2MPAL 4DOHB 1OAXH 1R3LB 4J6RL 4NQVA 2VDOH 4Y8AA 5DJ0A 4G8FA 4D8PB 5CJ5A 3DYMA 1NBZA 1PKQA 3EAKA 5EUKB 3QNYA 3X11B 4JVPA 5EORL 1IEAB 1ED3A 4M6OH 5I9QC 4YQXL 5DSCA 5JW4R 3TBTA 4KC3B 1OF2A 3ECBB 4IIQC 2BNQA 1EUTA 5FYKL 4Q0XH 1ETZA 3GSNH 3OKMB 3GSRB 2VR4A 1BQLL 5EC1A 5F1NB 3BPNB 5EPMA 1X5XA 1WAAE 4Z77B 3QHFL 5DHVB 2CLRB 5EULV 1FL5B 4XNZB 3HHRB 1DQLL 1AGBB 1FAKT 3KPLA 1OTTD 1I8KA 3U2SB 1AKJB 3SGEH 4N1HB 3T04D 4H1LB 3VFWB 4ELME 1T1ZB 5TF1L 3LHPL 1DEEB 2ADIA 5DEGB 4MJ6A 3ROOB 1CICD 1U8QB 1V3JA 2BSRA 4HWEH 4GG6F 1DSFL 1WCBB 1QACA 3QEQA 5TE4L 4MQXC 2CRYA 3NIFE 4PV8B 4WDIA 4DTGL 5IP4A 3L7FA 4WJ5B 2X4PB 4YHNB 2VL4A 1JHTB 2PXYB 3JTTA 4DKEH 4OUUA 2K7PA 1AR1D 5J0BA 4MQSB 2XN9E 5LGHH 4CVXB 4N0UB 1T83A 2NY2B 1KJ2L 4XI5C 2GFBB 3VI3E 4HPOH 4GRLA 1C5BL 4N1EA 3ULUH 4TUOB 3S4SG 4MJIE 1Q94A 3LKQA 1O7VA 3U0PB 3U1SL 4U1GB 3HMWH 4LLVB 1FYTE 4HKJB 1YN6A 4LOUD 3O0RH 3SO5A 4JDTH 2A38A 4QOKB 2YD9A 4CJ0A 5JW4N 2VO5A 4L8DA 2H2PC 3MA7A 1KPUA 4GRWE 4PJCB 3L5JA 5F89B 3VXME 3HPLB 1O5DT 3V4UL 4Y19E 4YK4C 1V7ML 3UJTH 4G9FE 4S1SH 3QRFM 5F88A 4E41D 3EOBA 2EDNA 1Q0YH 4Y7MA 2MHAA 2HWZL 1FVCB 5JHDA 1WIUA 4KHTH 3DTXB 4RAHA 4AY0A 3LEYL 1XGRA 4RQQA 4NN7C 2P5EE 4Y2DC 4Y5VC 5H94B 1DUYB 3NTCH 1ND0B 1O0VA 1TQCC 2EYSB 1AI1L 4OLZL 3GJFH 5D4QA 5ALCH 1IEBB 3W0WB 4WI5A 3U46B 5DD1L 2NY1B 1WWCA 3GMNB 4HIIB 3TO2A 1ZLVH 3CDFA 1ZLVK 2IBBA 1IC5L 1T6WA 5DJCB 1F3JA 3HZKB 3V5DB 5DD0L 1MCOL 2DKUA 1UM4H 4PJ9A 3MV11 2PCPA 4X4ZA 2J6EA 2ZUSA 1NGWA 3AS3A 3OR7B 2ZZUT 5EU7E 3L95A 4NJAH 4JZNA 1DP0A 3IDNA 4M8VA 1MHHB 3NOIA 2C7UB 3CVHH 4MXQD 3T8XB 1NAKL 5D7IF 4OZ4B 4JANA 1NCAL 4M7KL 3WIFB 3OKLA 3D0LB 4LLWB 1TITA 3EO0A 2A6JB 3OBAA 5D70L 3WXVH 4CU6A 2A6KB 4XBEL 2N7AA 2R0WH 1XF5A 4X6DE 3QDGD 1WV7T 2CMRL 2AKRB 2BY3A 3MZTA 5HTSA 3MNWA 1ORSA 1KCUL 3GUTA 3RPKA 4YDVA 4L9LB 4BFGA 4QTHA 2FGZA 1KCRH 5ACMA 4EOWH 1WISA 3SOBH 1EHLH 1F58L 1N64H 3DURA 1HXYA 4N0CD 3IVKB 3QT2A 1QNZH 4QCIA 3ARQA 2HA1A 5JOPE 2VAAB 4EIGB 3SKNB 3BFOA 4X83A 3RGVA 3IT8D 1NEZB 3IU4L 1FVDB 1IGTB 3N0PB 4DGYL 3N9GL 4YUEH 3UBXA 5T3XH 3S34H 5EUOE 3BXNA 3TNMA 4HULB 1KTLB 1FL3B 2LFGA 4I1NB 3RWJB 2X9YA 4J4PD 4UNUA 5I8EB 4NWUH 5JXAL 2FEEL 1XZ0B 3ZTNL 3NAAH 2QR0A 2V9QA 4NZRH 1JMXA 1U95B 5IM7A 5CAYB 3FO2B 4L4VA 2VDRL 5SWSA 4MAYA 2VDNH 4M61A 3DVGA 1TTUA 3W11C 4L3EE 4LLDA 3QUKB 5CIPH 4ODVH 1HHGB 2IBZX 1ZXQA 1KCVL 2MTPA 4P5TA 3VGHA 4YHIA 4YHLL 3CFDB 2WWKT 3BAEL 1HWGB 4X99B 1R5WB 2FHCA 5ACLA 2R1XA 2HFFB 4FNLH 4RMUA 2NMSA 1MFNA 2DYPD 4AT6B 5IROC 2EC8A 3EJYC 4J3OC 4Z76B 4CDHA 4JR9H 3V6BR 2DN7A 2X89D 1W8OA 1W2KT 4TSAL 3V9FA 5E95B 2EDDA 4C83A 3KPSE 3MCKA 3SE3C 2EDOA 3EO1A 4Z7UF 1BAFH 1UADC 4PB0L 1JNHB 3L6FA 1TQBC 1S7WA 3AU1A 4O51B 5D6CB 5EOTB 1KGCD 5KVFH 3O4OC 4GG8B 3QWQB 2OZ4A 3M1BA 4JPVH 3SDDC 5DRXA 4Y1AD 3C09B 4ODXA 1SEQH 2Y07H 1PAMA 4LPVA 3WFEL 2CDGA 2QQNH 4JKWA 4PLJC 4Z7VF 4KRLB 1JUFB 4YXKL 4L29A 4E42A 1ZHLA 3L3KB 2BY0A 2BRQA 1EO8L 3F6LA 2FO1A 3NCYP 3KGRA 5JNYB 4U1NB 1OW0A 2MKLC 4NGHH 5MP6L 2YHGA 4PJGE 2DRUA 1H3PH 4WW2B 3TT1L 3NFSL 4EN3B 4FQJH 4HUWA 3P9LA 5IVXB 1W0WA 4WO4C 1PKQE 3PWNA 5ISZD 1JZ3A 5FYLE 5I71C 2BOBA 1A1OB 4GKNA 4WU5A 4XP4L 5TDNB 2F8VA 5CEZD 4X7FC 3WD5H 2J5LC 3B5GA 5KZCB 3HCVA 3BT2L 1PEZA 3BW9B 2B8OT 4HSQA 3NZ8B 4LCWE 4LVOC 4U1MA 5BRZD 4IRJD 4JG0H 3CFBB 1FE8H 4JZOB 4PJFA 1RQ5A 3K8MA 2CDEB 4R96A 3ZKMC 3QEUB 2DTMH 1A7OH 3O6FA 3BGFC 4ODHL 3RAJL 2XKUA 4KTDL 2HVKB 4UQ2B 3L9RB 3PNWA 1J8HE 3FOMA 3QXVA 1FP5A 2EEDA 4CL7A 5JW5B 5E2TH 4BFIB 3LS5H 3FAWA 5MEPA 5DO2D 3WJLA 4P2RD 2HLFC 4R3SB 3IFLL 5F3HA 4I18A 4CW1B 3DSFL 5TH2A 2BVQB 4NQEE 2GJZB 2VOTA 2QSQA 1IQDA 2HJFB 5L7XH 1EXUB 3FQRB 5TQ0L 4PJ8D 5CJQH 5HHOB 4PJEA 1DQLH 3Q0HA 1JYXA 4F2MB 4Z0BL 4XGZB 4HH9A 1ZHBB 3RUGB 5D2LB 4G80A 4XP1L 1V7NH 5GGQH 5ID1A 3VXUD 1KIRA 4YHMH 4C57C 5DS8B 1UWGH 1AGEB 2NTSP 3QIBA 3RVUC 4MVBC 3BH8A 5IKCB 1KB9J 1CFQB 5DUMH 4BQCA 4U7SA 2V2TB 3KJ6H 3GMPB 1ZTXH 3B3IA 3GI8H 4F7CB 1H0DB 2OTUA 5JIPA 4MDJB 2ADJA 4DTGH 3ZT7A 1A3QA 2ATKA 4QT5A 5DJAB 3HZVA 2HLAA 2CLVA 5JHDE 2VIRA 4PTUA 3V8CA 5EIVA 3OJMB 1T22B 4JREC 3BYYA 3T2NL 3D69A 4KY1L 3MUJA 4HWBL 1RK0B 2QQLL 3CZFB 3UBXG 5C07A 4IEFB 1NCTA 1I3GL 3MGOA 1VFAB 2AVGA 2ZSVB 1WZ1H 4UBDD 2NW2B 4K94H 3F7VB 1OGTA 5D2NA 3T77A 1OAYH 1MHPH 4Z7OE 2VDMH 1A6UH 3CSYA 1UM6L 3QO0A 2V5TA 1ZT7B 5HYSA 2XZCL 1CLOL 3CXDH 4OFVA 1N3NB 5C8JA 4FMKA 5JIHA 4KU1A 2GSGB 2FX7L 1RHHA 3U83A 3BKMH 3D5OF 3MSPA 1C16B 2JE8A 5HHME 3ZE2F 4LEXH 2ADFL 1R3LA 3RVTD 2G60H 4D8PA 1ADQL 5I1DB 4MNQB 1MCPL 4C56E 2EO9A 5T3ZD 4Z7WE 1VA9A 5FYJE 3X11A 4OZHB 1Z5LB 4YFLI 1EMTH 2AABH 4L5FL 1NGQH 1IEAA 3MXVH 4N8PA 5CZKA 5HI4D 3WHXB 3E8UL 1BOYA 4TNWK 1XF4B 2OJZL 4UDUB 3ECBA 2G2RB 5DQJA 5GPRA 2PYED 4EI6B 4OLYL 3OKMA 1DLFL 3GSRA 5D9SB 5F1NA 3L3IB 1K6QH 4Z77A 2AK1L 5DHVA 3GBLA 1MAJA 2QHLA 1FL5A 4CU8A 4AQ1B 4CDGC 1AGBA 4J8RB 1X5AA 2CMRH 3U2SA 4P46C 5DRNB 1LGVA 3ZDZF 4H1LA 5T1DH 3C2AH 4NKOB 5CINH 3Q5TA 3VWKB 1XR8B 3VFWA 3H8NA 3IDXL 1CL7L 3P73B 1T1ZA 2IF7A 4D9RE 3WCYA 1DEEA 4NNYB 5E2UL 2DQDL 5DEGA 1UWEH 2XWJB 1YYLL 4ZO6A 3HB3D 1HYRC 1BOGB 1U8QA 3ROOA 4NFCA 3MV8B 4JRWA 3D25B 1WCBA 3SDXB 4AG4L 4XAWH 1HHIB 4PV8A 4YHZH 4MB5A 4WJ5A 2NYYC 2X4PA 4YHNA 1ZLWK 4LPYA 2PXYA 4RFOH 3CLEL 3NFNB 1EGJL 4GAGL 3DARA 2PYFA 1CTOA 3ARWA 4LHJB 1RVFL 15C8H 2BFVL 1HI6B 4OF3A 4CVXA 4N0UA 3UYOD 4HJ0D 4GMSH 5EDXA 2GFBA 1JWMB 4GS7B 5GGVH 3S35X 4TUOA 3HRPA 3U0PA 3GB7B 4FABL 1G9MH 1KFAH 1LE9B 5EU4B 4LLVA 1YNKL 2BJML 4HKJA 4QXWA 4QOKA 3HE7D 5E99L 4DGVL 3RVWD 1UGNA 4PJCA 5F89A 3IRZA 3HPLA 4LSVH 5C71A 2ITDB 1TTGA 4JO4H 3U79A 1RU9H 3TYFB 1EK3A 4WUUB 2UYLB 3V4VH 1FVCA 3H9HB 1U58B 2EDEA 3DTXA 4KK9C 3SCMC 3L7EB 2VDLL 5H94A 1DUYA 1ND0A 5KVDL 2EYSA 1Z3GH 2ID5A 4FOMA 5C0ND 1IC7L 5IJVB 2V9TA 1RPQA 4XPTL 1IEBA 3W0WA 3U46A 4GO6B 3I50L 4RX4D 2QTEA 3LQAH 3GMNA 4HIIA 4CN4A 4J3XA 5DJCA 2Q3ZA 5IWLA 3V5DA 5SX5H 5EO1B 5SX5K 2ERJC 1AO7B 2GJJA 3O6MH 4QXUH 5IBTL 3HR5B 2DMCA 3MJ7B 1YN7B 4OV6F 3OR7A 3GKWL 5CSBA 3T1FA 5I1GL 5F70A 5ID0B 3ULUD 1YC7A 5INDA 4OF7A 4HC1H 4C58B 5MENE 4KJQD 1MHHA 2C7UA 3T8XA 4JKKA 5HVHB 4OZ4A 2J8UF 4NSKB 1OD7A 1MCHA 4R97C 3WIFA 4TNVF 2A74A 3D0LA 4LLWA 2F5AL 2A6JA 3RY6C 2W0LA 3QUML 2A6KA 1K2DB 3S9DB 3N1QC 2AKRA 5DYOA 1KT2B 3T4AB 4BFBD 3DX8B 4CVWA 2C1OA 4OF0A 3LQMA 1JF6A 4L9LA 5EBLB 5C0JB 1NMAH 4PJFE 7FABH 3TT3L 3WLWD 4YXHL 1JCKA 3WIHA 2IH3B 3BJ91 1IGCL 2VLKE 1F4AA 3IVKA 3TBWB 1CWVA 2VAAA 2VDPL 1NEZA 1FVDA 3H42H 5HYJD 1IGTA 1RZKH 4UOW1 4ZO9A 4LASH 1S8DB 3VG9B 1T0NB 4JHBA 1PGRB 4CN1A 1BBDL 2ZCHL 5I0DA 2YPVL 3SDYH 3GK8L 2EE2A 1KTLA 1PG7X 1CDIA 1FL3A 5FHAL 4M6MH 3RWJA 4OLVH 5I8EA 1XZ0A 4GMTH 3KYKH 2YS4A 5GGRY 3PP3K 2M8XA 3UDWA 2Z31C 1U95A 1MF2L 3G6DL 3BIKB 4XXCC 2APFA 1MAMH 4PJEE 2KBGA 4TTDD 1HHGA 2GHWB 4RFEB 1KTKE 3C5ZB 5M7QA 1AXTL 3CFDA 4QWWC 1L6ZA 3MREA 4X99A 5HDLA 1QFHA 1R5WA 3MYZA 2HFFA 1AH1A 1I7TB 1T3FB 3MLXL 1QBAA 4AT6A 1T1YB 2FHFA 3PE9A 1CXFA 2VR5A 2NY0D 3QQ9C 4Z76A 3ZE1E 5AD0A 2BRRL 1UKQA 4L4TD 5T3XD 4W6YB 3VRJB 1KEGH 2VSDA 3K8KA 1JNHA 4JFFE 4ENEC 2PTUA 4O51A 5GZOC 1BFOA 1OWWA 1SM3H 2VLMD 5D6CA 5EOTA 3ARGC 4H1LG 4GG8A 1BQUA 4KUCF 3U48A 4EVNB 5FB8B 2NZIA 4YXLH 4NQCE 1XH3B 1HINH 2EZ0C 2H6PB 4M5ZH 2WZPD 1IBGH 5I1HL 1JUFA 1IGJB 2FGWH 1CIDA 1KIPB 4LPWA 4NNPH 5DR5H 3VE0B 2BNRD 1X5JA 4YDLB 5JNYA 2X6MA 4U1NA 5BO1H 4MA1C 1IZJA 1KC5H 4KY1H 4WW2A 3QEHB 1GZPB 3WYRA 2H2PD 4EN3A 5IVXA 1CFTB 3D39D 3WDIA 3JZ7A 2YUXA 4YX2L 1FNSL 3M8OH 2R69L 1A1OA 1BECA 5TDNA 1BJMA 1JK8B 1U41A 4PJDE 1T0MB 4U1IB 1UM6H 5HD8C 4QRRB 1MCSA 2GKIA 1L6XA 4MJ4A 3FOLB 2VQUA 1NL0L 1VPOH 3BW9A 3C8KB 4BZ1H 1WFOA 3NZ8A 3ARFD 3ULVL 5L8JB 3NA9L 3CFBA 3QEGL 4JZOA 1KB9K 3TVMC 2CDEA 3ZYOA 3QPXH 4KROD 1KBGL 4WHYG 1YEKH 3RZCB 3GZKA 4JQVC 4X98A 1JGUH 2HVKA 3DECA 4UQ2A 1X5FA 4NZDA 1MRFL 2RHEA 3L9RA 5FOBB 5K9OB 1BMGA 5ADPH 1DBKL 5JW5A 4BFIA 4JO2L 1EVUA 3RWGB 3FN9A 3NABL 2YSSB 5CKGA 4AZ8A 4LIQE 4ZOEA 4R3SA 4ZOCA 2VXTL 3GM0A 1HZHL 1KN4H 3NCJH 2D31B 4CW1A 4XPBL 1AC6A 1TXKA 2BVQA 2VC2H 2W9EH 4R4FH 1JYVA 1JGVH 5ENWB 1DLFH 2XZAL 2GJZA 3MRBA 1IVLA 5EWIH 3P4OB 1D5BB 2ZG1A 2CXGA 2HJFA 2Y06L 1EXUA 3FQRA 1EJ6A 4ONFH 5HHOA 4PRNB 2XV6B 2HT4D 1QSFD 4F2MA 4F80A 3CUPB 4XGZA 1ZHBA 3RUGA 4GAJH 4ZYKB 1UJ3C 5D2LA 1D5XB 1IKFL 4EIZC 1J0KA 5GSVB 5DS8A 4APQD 5FO7B 1AGEA 2AI0L 5IKCA 4IRZL 2P1YA 2V2TA 3GMPA 5GS0L 1TJGL 5J56B 4F7CA 2XY1A 4AG4H 4UOJA 5MEQB 5EG6C 1H0DA 4N0FB 4MDJA 4QY8B 1U8OB 4U1SB 5DJAA 3DSNA 4G8GB 4G7VH 4Y4FD 2H41A 3FB5B 5D1ZC 1BVLA 1T22A 4LQFL 4OI7A 5B3NA 3MBXH 4WI2A 1AGCB 1RK0A 3EW3B 4RNRB 3CZFA 4P57B 4PGCB 4IMLB 1CXHA 2AXFB 2DLFL 2EDRA 4TQEL 1VFAA 4LSUL 4PJ7F 3JV6B 1E28B 5B21A 4AL8H 4RWYL 2E6QA 2ZSVA 5GJTL 2NW2A 4L8SB 3S36X 3A0OA 1T03L 3QUXD 2W65B 3F7VA 4Y88A 1JPSL 3IFOB 4OFYD 4Q2ZB 5IGXH 3L5IA 4XB7A 5FCSH 4N90D 5BOZG 3QUYB 3GFUA 3G6JA 1B90A 1ZT7A 1KN2L 1A4JA 2DQEH 2XICA 1N3NA 3MLTB 3V5HB 4JKPL 2WWMC 2Y7QB 3QIUC 2GSGA 1GOGA 2EO1A 1OM3H 1C16A 4X0KB 1K4DB 5KS9B 3RDTC 4M48L 4UAOC 1UEMA 2KQMA 5I1DA 4MNQA 2IPUG 3AB0B 4KFZC 2JCCF 1LO3L 4AIXA 1CD0A 1DVFB 4HUMB 5CJOH 1MSPA 5IQ7L 1BHGA 1E4WH 4KHXL 1Z5LA 4OZHA 2XG4A 1ZT4A 1W72H 5L88H 2HKFH 5DEFB 3GMMB 5FCUL 5EZLB 1XGYL 5IBLC 3WNNA 4UDUA 3CSBA 2G2RA 4XB8A 2XTJB 3HE6B 3JWDC 4O5LH 4EI6A 2XKNB 2ZP0T 1GAFL 5D9SA 1RUKL 1CK0L 3L3IA 5I73B 2AV1B 5EN2B 3VMPA 2F5AH 3V6OE 2OMBA 3EO9H 3JXAA 1LDSA 3GHBH 4J8RA 1BQSA 5DRNA 5DQDL 3MRHB 4NKOA 4IM8A 5DT1L 3T0EC 1ZKAA 3VWKA 1XR8A 4JQXC 4X6BB 3P73A 5KVEH 2WNGA 1VKXA 4NNYA 5LXGH 1KXVC 4ODSH 2FJFB 3LRSB 2XWJA 2OMNA 3HMXH 4YXHH 5L8LB 5DK3A 2E8ZA 2EDFA 3FT4B 3MV8A 3D25A 4P4KC 1X5YA 3SDXA 4CJ1A 1HHIA 5IHLB 1OAKH 1RZ7H 4YPGB 2ZOKA 1OAUH 2CRMA 4X7TA 2DJ4A 4U05A 2MJWA 5BS0B 4KJWD 1MI5B 2F19L 3NFNA 1NANI 2GJ6D 3B9KC 3MLPA 1HI6A 2ZCHH 3GK8H 4GRWH 2F54B 5ELIA 1JWMA 3S88H 5FHAH 1A7QL 1X4XA 4MD4A 3N85H 2J6EL 3ZKMD 3FFCB 3GB7A 5GGRB 3I6LD 1LE9A 5EU4A 3IDYC 4P2QD 4FHBD 1FDLH 1HEZB 1MF2H 3G6DH 4WTXA 4RMRA 1DFBL 3IXTB 2A1WL 2AJXL 1CXEA 2ITDA 2L7JA 1VEMA 1X7QB 5HPMB 3TYFA 4ELMF 2IPKB 2FIKB 2HLFD 1F6LL 3OGCB 3VCLB 3H9HA 1JN6B 1U58A 2F5BH 5FYJL 2P46B 4OIIL 4MAUH 3BP7B 4JRXE 3LD8C 1WEJL 5IJVA 3FT3A 4M9OA 5CGYD 1WBXB 4Y4KA 5D8JH 1FJ1B 4AK1A 5CILL 2I9TA 5GS0C 4UIMB 4IDJH 2BXYA 4GBXB 4FRWA 3RIFK 2LVEA 1U8MB 3AC0A 4PRAB 1U2CA 2HVJB 5EO1A 1TIUA 4PY7A 1AO7A 3IJYA 3T2OA 3HR5A 4TVPE 1NDMB 4HT1L 3MJ7A 1YN7A 5ID0A 3LPFA 2VDKL 4NC2B 4MDIA 4YNYB 5HHVL 4F3FB 1AP2B 2V5YA 4PV9B 4YR6B 2X1XR 2W60B 4P0DA