2FLRT

Novel 5-azaindole factor viia inhibitors
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
200
structure length
151
Chain Sequence
TVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGDERTLVRRNNTFLSLRDVFGKDLIYTLYYSVQAVIPSRTVNRKSTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel 5-azaindole factor VIIa inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/blood clotting
molecule keywords Coagulation factor VII
total genus 32
structure length 151
sequence length 200
ec nomenclature
pdb deposition date 2006-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2flrT00
2LTQC 5GGUA 1ZXQA 4NUJB 1CVSC 4PGEA 4P9MH 4PY7B 3OHXA 1DSFL 5I74C 2FYYA 1GXEA 1RUAL 5HPMB 1WIUA 4WWKC 4I5BA 1G7QB 3J7HA 2BFVH 4KVNL 4NCDA 2ICWI 4WU7B 1E4XH 1FIGL 4FQPA 3FQNB 2IEPA 3K80A 2YD4A 5D1XC 3SKNB 4LHQB 4S1RH 3MRIA 3RY6A 1CBVH 1E6OL 3MC0A 1DE4A 1EMTH 5GGSA 1MHEA 1P53A 1S9YB 1D5XA 1MH5A 4RX4D 5KAQF 5MERB 4K8RC 3NGBC 3KNBA 4PRID 4DAGL 4HLZH 1UH2A 2YOCA 4CMHB 5J57B 3LQAC 1BQHB 5DJ0B 4PJXE 4XNZC 3W2DL 3DGGA 3CFJB 3GJFK 2EDHA 5HI3D 2P48B 3SBWA 5CZXD 5F6IB 5I16A 3SE8H 2DM2A 4JZOA 5ERWA 3CXHK 4QTHA 4ZUVA 5SWZE 1YMMD 2BCKB 3ZSSA 4D9RE 4PRPB 1KN2H 5E4EC 5K9OA 4WFFE 3CCHA 4F2MB 4FFWD 3MXWH 5C0BD 1F42A 1I1AD 3MROB 4OZGF 5KVGH 1QA9A 1SVCP 4HMCA 4RAUA 4FQJL 1ZA6A 5C08A 1UADC 1BJ1J 1CYGA 5SWQA 3PHQB 4M5YL 1N5YH 3GGWB 4DUVA 1CICC 2A6JA 4LK4A 2BSTA 5GIRA 3CH1B 4PJGE 1KJMB 1HIMH 3VE0A 4KY1H 3HI6H 1AD0A 1FL6B 1OPGH 3INUH 3MR9B 3LB6C 1TVDA 1KIRB 2O5ZH 1HOCA 4OD1L 1XCQA 5I71B 4MMXC 3DVIA 3ZDXE 3MPCA 1Y6KR 1EFXA 1UZ6F 1OAYH 4N5EC 4NN7C 3VFRB 1JFQH 1DQLL 4QCIA 1QLRB 3PXHA 4OT1L 2R1WB 3WLWC 3WL9A 2J6EH 4G8IA 4PJ5E 4GQPH 5E5MB 1GGIH 4JPVH 1OTTD 5SWSB 1ZA3B 2BRRL 5HGBB 4WFGD 3CX5J 1PEWA 1H9VA 5D7IF 5C09B 1QLEH 1KGCD 4LSDA 4BZYA 2CK0L 3LKOA 4L3EA 5TE7L 2FNBA 2Q8BL 4WGWB 5DWUL 3CDGB 3F62A 4UAOB 1FBIL 5D5ME 5IROA 2B0SL 1RQ5A 4FTVA 2VUYA 4JFHD 5AD0B 4X98B 1Q9OB 1E28A 4GOSA 4WHDA 3VXSB 4IEFB 3S96B 4MD5B 5I66B 3LS5H 3CZFB 4GAYB 2YUZA 1QBLH 3FO2A 1TJGH 3NIGF 1EEYB 2YR3A 4LCYB 4QRPA 3QA3A 3HUJB 2X4PA 4MNGE 3WE6A 4D8PA 2B4CC 1NLDL 1WLHA 2VO5A 4H1LB 1VKXA 1LVEA 3PP3K 4UDUA 4HUVA 3CFCL 2GSGB 1IT9H 4NZDA 4PJBF 4QRPD 3T8XA 5KS9A 4CVXA 3RVVD 4M43H 4PTUA 4AEIL 3B83A 3CFIC 4AZ8A 3JWDH 4DGIH 3ARED 3VFVA 2XKNB 5D71L 4MA7L 4PJ7B 5C0AB 5F89A 4NO2B 4PG2A 3UTTA 3C6LC 2OJZL 3SOBL 2J1KA 2DQGL 5BRZD 3LRHA 4JAMA 3DX8A 1IAOA 2DL9A 2VZ3A 4J8RB 5IOPB 1CZ8H 3FHQA 4IOFC 2A6KA 4ZUWB 5D7LB 2HFGH 3UC0H 1BGXH 1NKRA 2VABB 1F58L 5HGAA 4JKKA 1LQSR 5I1HL 4Q6IB 4MXVE 4R2GC 1C5CH 4I9WD 4QHKJ 4QF1A 1WCBB 3DWTA 3V95A 4XTRD 2BNQE 5I8KH 1F4WH 4PV9A 3GMRB 1MAKA 4OF6A 1ACZA 2IFFL 1N8ZA 2HTKD 2X7LB 4POZD 3OTTA 3RDTD 2DJUA 3D48R 3TJHC 3C5ZB 1YEJH 4YO0A 1LWRA 4TUOA 1SBSH 4CN1A 1TXKA 2FBJH 1OTUD 3OGCB 2JCCB 5T1MB 2ZUUA 2UYLB 4KXZI 4PPTA 2ESVB 5IEKA 4JY6B 4LQFL 2Z92B 4G6JH 5F88B 5KSAD 1N2RA 1NFDF 2XA8L 1MCFA 3GSVA 1JWSA 1Z3GH 4M9OA 1BVKB 5CCKL 3STZB 4CU6A 4M6OH 5JIPA 1YEKH 4P4KD 3IFPB 1FYTE 3O6LL 2BX5A 4G8FA 1N64L 3BHBB 4JRYE 1NL0H 2EH8L 3BPCA 1V7NL 4Q2ZB 2XWJB 4QT5A 5HYEA 2XV6B 4JM2F 3MLSL 1PZUB 1REIA 1NGXB 3V6ZA 1BBJA 4R8WL 1N0XL 1T0MA 4ZXBC 2W60A 4ODXB 4UNUA 3T3PE 3RDTC 2IG2L 1UENA 2NYYD 1HYSC 2EE3A 4KI5C 3FO0H 4PRHB 4XAKD 1G7JB 3UC0L 5L2JB 1MIML 1SYVB 3AB0B 5FYJD 4PJCF 1CZ8L 4FG6C 2R0LH 3NZ8B 4HUWA 3MNWB 4PJ8D 1CT8A 4NQEA 2Q6WB 1XGUA 3OPZH 4YHIB 3VFUA 2J4WL 2GJZB 4HWEL 1CLYH 3AU1A 3FCTA 4JFEE 3QDJA 1PG7H 3VWKB 5JPMB 3MLYH 1QNZL 2JELL 4RGMB 4QEGA 2ZJSH 1JPTH 5J4MA 4KGLA 5HI4D 1A6VH 3JBG7 1JVKA 2IPKA 4OCSH 1QVOA 1R5IA 4XNUL 5I1LA 4OCXL 3F7PC 4OD2A 4WWKD 3VGHA 3S9DB 3TBSA 3KDMB 5T1LB 1S7SA 4RFOH 4BH8B 5K9KB 4ZPVB 2DDQH 4U7MA 4JLRB 5IMLB 4YHYC 2ZUYA 1BJ1H 3CFBA 2SEBB 5FOBA 3TO2B 4NZTL 4OLVL 1MFAH 3SKJH 1ZLWK 2XN9D 3HZKA 3D85A 1EHAA 1FSKC 3KAAA 5I15H 2MCPH 3VFUB 1T0NA 3LEVH 5MHSD 5IMMB 1FFOB 3D0LA 2X09A 1TVHB 3ZZ1A 1MJUL 2ADJB 2EDXA 4I0PD 5TDOA 4GW1B 2E9BA 4YGAB 2GUOA 1GGCH 4JFPB 4LAQH 3O8XB 1K2DA 3RY5A 5C6TH 5FYLH 4I48A 2BRRH 5J9PA 1DANT 5L2JA 3TBWA 2HT3C 1S9WA 1CDHA 3FOMB 4RMVA 3ULVL 3GSQB 3HNVL 4ERSH 5EC1B 1D7FA 1P1ZA 3DJ9A 4NFCA 3F6IA 1MJ7H 2V6HA 3PP3H 2AJZB 5E8EB 1NBZB 3B9KD 4Q0XL 1JPGB 1WEJH 5J6HA 1A6TA 1MFDL 4M7KL 4GBXC 5C0IB 2OXGA 4JFDD 3IS0X 3CK0L 4K3GA 5DF0A 3CLFH 4C56D 4J4PC 2NR6D 1FP5A 4P9HH 5BW7C 4X80H 1IC5L 1H8NA 1B88A 4H25A 2P24B 5IB4B 5J8OA 1HILA 4Z7NF 5MEQB 2UY7A 5BOPA 1X4XA 1JWMA 2QR0A 3STBA 2K3TA 2A6KB 1AR1D 4YDVB 3BP4A 4LSQL 4PB0H 4XWOD 3T0WA 4UILH 2NTSP 3VGDA 5CEZH 3DXAA 4P57B 4AENA 4KVNH 1F00I 1CQYA 3HA0A 2GJ6A 1UA6L 5TH2B 3T3PF 3QEHA 1NC2D 3MZTA 4EVNB 1BMGA 1NGPL 1T7VA 4XCCL 3WEXA 3QDHA 2JJUA 3TBTA 5CZXC 3MLZL 1ZA3A 1VGEL 1ZT7B 2OBGA 3VMNA 2EEAA 3H42L 4Q6YA 1U41A 2FL5A 3NCBB 4A6YL 1OD7A 3D0VB 2Q87A 4N0UE 4D9LL 3ESVF 4WCYH 1MJJA 5C0GA 4OFKA 1RUKL 2OR9H 3ULVD 1MCIA 1GC1H 2EDLA 2RJMA 4Z0XA 4X6CE 5AAWA 1JUFB 1YJDC 2Y4SA 4OLUH 1UVQB 1XH3A 5ANMA 2YUVA 1BREA 2FGWH 1JGLL 5GJSH 1KEML 3GMLB 2CJUH 1PKQB 4H1LA 3DRQB 4U3CA 4JRYB 4UTAH 4QT5B 4PLNC 2MCG1 2C9AA 3PWVA 4Z7WE 3IU4L 5I73C 4XWGL 3NIFF 3CPLA 3EGSA 2VLKB 2A77L 4U1KA 5FYLL 2OP4H 5MEPA 5DDHA 4PBVC 3HZMA 5GHWL 1P7KA 3E2HB 4JZOB 4GW5B 3P77A 3NCFB 4GFTB 1UCBL 1WAAF 2ZKHL 4NQED 3IDYB 3CSBA 3SBWC 3HR5B 1WZMA 3O6FA 4D3CL 4DUXA 2A1WH 3I6LD 3H2WA 1YPZB 2X4RA 4M5YH 5HHMD 3NH7L 1V3MA 3X3FL 4EDWH 4LNVA 1CF8L 4BQBA 1MEXL 1Z9LA 4YJZL 3UCRA 5IEHA 1UZ8A 5BV7H 3BKML 5DMJB 5E2VH 4C83A 2JTDA 4GO6B 1L0XA 4WWKA 1HHGB 4DZBB 4RMSA 4HIEB 1IC7L 2YS4A 3U0TA 3DVGA 2PCPB 2EECA 2WM0A 4J12A 3L7FB 3WFEH 1KBGL 3VE0B 4ELMA 5DHVA 3SE9H 2CPCA 5ID0A 3O9WD 4TNVF 4OZIA 3DIFB 1MIEH 1P6AB 2L7UA 5DS8B 5T5NG 2YRPA 4GG6E 1FORH 3BKCL 5FYKD 3MQIA 4YGVB 3QPXH 4X7SL 1HHJA 4YFEA 5B3JE 3T2NH 5EC1A 4MLIA 1CGVA 4PJHE 3BSZL 3ULUE 5IB2B 4HEPG 3BDYH 2PTTB 2EKJA 3VFGH 1QRNE 4POUB 5I18L 5B38A 4PJDE 3O9WC 4UT7L 5DJZB 4U7SA 3AVEA 1OAXH 4KK6C 2XNAB 5BVJB 2P8LB 1NC4B 4YHPA 1KIUA 2PF6A 1QSFE 4YDKL 4WI7A 4IS6B 1E4WH 4KRLB 1MJ8L 5FO8A 4WY7H 1CR9L 1IC7H 3HE7A 1J1OH 4XVJH 3T4AB 3QA3B 4H8WH 4GKSB 2VQUA 4EBQH 1AGCA 4KZDH 2WANA 5E8DL 3HNSL 5GS1C 3IAQA 2VDPL 4CMHC 3QQNA 5FXCH 5IBTL 3ZKQD 1ZHLB 3BZFB 4HXAH 4MCZA 3D85D 2Y25A 1F4XL 1EGJH 2A1WL 2P42B 2JIXB 2V2TB 1DZBA 1HYRC 5ESQA 5HPMA 1IAIM 4RQQB 3PWNA 3HB3C 2R8SH 5C86A 5KSVA 2FEDD 3WFDH 5DC4B 3BYTA 4Q0XH 3WJLA 1DUYB 2YHGA 3RGVD 3B2VH 3GJEB 4LPCA 4AQOA 2V2XA 1HH9B 3ALWA 3GK8L 1J86A 3EYQC 1NFDE 5L88L 1WBXB 1PDKA 2O61B 4MD4B 3BOVA 5JQ6H 3HMXL 3MRRB 4U6HB 5CWSA 5L8KB 5ADPL 2VR5A 3HRZA 4U0RC 1Q0YH 1U3YA 5SWSD 1JNNL 3PL6D 1U2CA 4M3KB 3VXPB 1VENA 2AJ3B 4HS6B 3V5KB 5B38B 1BJMA 2XY1A 4D0DA 2V5RA 4NO3A 4ORGA 3MLXL 4OLUL 3WDIA 5JOPD 2RHEA 1HWHB 2CDEB 1HHHB 3IGAB 4UNTA 4Y19E 5FUZL 4E41A 3F58L 1ROWA 1FO0A 4ISVA 3OPZL 1AO7B 3L3IA 5DVNA 3TBYB 3V4PH 4MAYA 3VXQA 4RFNC 4D0CB 3RUGB 5HDQL 2CXKA 3EOYG 1UWGH 2R2BB 4JDVB 5EA0L 2WLZA 4JFXB 2VL5B 2EDBA 1V05A 5E1AA 1A6VL 5C9JB 4ZNEA 4P2YA 1TLKA 3EO1A 3J8F7 5LAXB 1N0XH 1H5BB 1QKZL 4HWEH 4PGBA 3FONA 1P7QD 4DEPC 3HLAA 3UROR 3T3ME 4XWOC 5HHPA 1WZLA 5J3HC 3UYRH 3OBAA 2UY6A 1MLBB 2HJLB 2Z31B 4B0MM 3QNYA 1YEIL 5EOCL 5KS9B 3L3GB 3BMVA 3QBTB 1YUHB 5JNYB 2FWOA 4JFED 4YPGA 2VL5A 5JR1H 4NOFA 4GAJL 4JM2C 4NM4L 5C0BA 4HUUB 4ACPA 4NKDA 1YC8A 2WBKA 4QRTB 4LPXA 4LSTL 4TVPE 1AQKH 1G7MA 2WIIA 3TV3L 3ZLQC 2R0KH 2BNQA 4E41B 2ADGB 1OAQL 1FN4A 2Q6WA 2VDLH 1CT8B 4NQEB 5EIVA 4Y7MA 1WEJL 4PJ8C 4FFVC 4C58B 3I50L 3OR7A 1S5HA 3LD8B 2ZOLB 4GRWB 3I85A 1IZJA 2VXVH 1N59B 1CIUA 2DQIH 3QDAA 4P23B 5I1EH 1WZ1L 4HJ0D 5C0CB 1YNTA 3BWUC 5JHDB 3MCLH 3C5SB 4LLUB 4C4KO 2JJVA 5CGYD 1QFWI 2AJYH 3LN4A 2UWEE 1BZ9A 3GMNA 2H2PD 4FHBD 1EEUA 1BFOA 2YBRA 4WJ5B 2Q8AH 3JTTA 1HQRA 3DUUA 3D0VA 2VB5A 4KVCH 5CUSL 1IGFL 3QUXA 4PUBL 4JZJC 2FLRT 2Q7NA 5AZ2H 3ZKXB 1T22A 4NHCH 1HI6B 1FE8H 1C5CL 1W72B 3WNMA 2BSTB 1VACB 1WFUA 1UEMA 4R7NA 3P9MA 2F5BL 1G7PB 4WFFD 2V7HB 1DN2A 1CFTA 3WNOA 4RX4A 2X4TB 3FN9A 4ODUA 2DQFA 2Q86B 2XZAL 5LXGL 2WQRA 3MRJB 3ES6A 2Q7YB 4AIOA 3DUHA 3QUZB 4QHKI 1PEZA 3MRDB 5E6YA 1PAMA 4BFGA 1HILB 2D7NA 3HCVB 3O6ML 4GW5A 5CGTA 2P8PB 1CGXA 1IEAB 4MQTB 2C3VA 4IRJD 4Y5VC 2A6IA 4WUUD 3IDNB 4NZRL 3GSUA 1F4YL 1PSKL 2CH8A 2ICWB 1CU4L 3BRDA 3NTCH 5TFSL 4X6DE 3RNQA 3VRLE 1DQLH 5MENE 1T20B 5J1AA 3Q6GH 5D8JL 2I26N 3FQNA 2CJUL 3HE6C 2AXJA 4HGWA 4XNXH 4PJGA 1DUZA 1I3GH 2FBOJ 2WUBL 3BKYH 3OHXB 3RWDA 5EUOB 3ZYIA 5I1IH 2NY2B 1I1AA 4MB5A 1ITCA 4UBDC 5ADPH 1P84K 1DBAH 2I5YL 1SM3H 1AFVH 3C8DA 4S11A 3MV7E 3DETD 1U8MA 3GK8H 2A38A 1T21A 4P5TD 4L9DA 4Y8AA 4GRWH 5E0QA 4QY8A 5D2NB 4U1GB 1L9NA 5HD8D 5JA9A 5BJTB 4LKXA 4Y4KD 4X5XA 2IH1A 5I1AB 3BSZH 3WNPA 1PBYA 2ED7A 2H6PA 1NEUA 3OAUH 3MO1A 3SDAD 5FYKL 1MELA 3FFCE 4G5ZH 2UVEA 4HFUH 4NKMA 3ARTA 1CGSH 5ACZA 1X5LA 1W0VB 4ZPTB 3EGSB 1T2QH 4XP9L 4YDIL 5JW3L 1JPFA 5EOTA 2R1WA 2X1OA 3WLWD 2P5EA 5T3XH 3WFBH 4UT6L 1K4CA 1RVFH 2XQYK 3O9WA 5EZIL 2HRPL 1FL3A 5AYUL 5L6YL 1CFSA 3KYMB 4LFHD 5DQDL 4RGNC 5KS9E 2CO6B 4P9HL 2VLLB 4N5UA 5BVPL 3RWDB 2QADB 4M61A 1YNTB 5BMFL 5FFLA 3H7BA 1YYMH 5DJXB 2BC4B 4KZEL 1VADA 5AUMB 5GS1B 2YPKB 3WIFB 4QOKB 4HLZG 4OB5H 5JLZA 2QL1A 4Q7DA 4YDVA 2HJKA 4IRJB 1KTDB 2W1NA 1QPXA 5CSZA 4LVOB 5CILL 5DR5H 4KAQH 1FNEB 3DV4B 3GSQA 1D6EB 2VLRB 4ZO9A 3LV3B 3OXRA 5KVEH 5D1ZC 2P5EE 2XTJC 4IRSA 1IBGL 5E56A 4FNLL 1VFUA 4X4XB 5H35B 3BD4A 5KZCD 3MOBH 4ELKA 1EHLH 2ZSWA 4U3XA 1VERA 1SY6L 3TYFA 1D5MB 3O2WH 1JRHH 4L3EB 4R26H 3BD3A 4HGKC 1DFBH 2OR8A 3MUGA 4AJ0A 4X83A 3G5XB 4APQD 5I1GH 1HHIA 4QRRD 3GKZA 3VU2A 1J1PH 1KPUA 4NZTH 4OLVH 5JORA 2BVTA 2HN7A 2WLYA 4GKNA 1UM5L 1E4JA 5DRNB 1XIWC 1S9VA 3I75A 1J87A 4L4VE 4OCMC 1E4WL 1RJZA 3DHJA 2YD3A 5BMFH 3LPGA 3U4EA 1X44A 1L0YA 4OCSL 3F7VA 4ODHH 5IHUL 4CNIA 1JPSH 4CU8A 1EXUA 2AXFB 2NY3D 4LQ1A 1J8HE 2YD9A 3P4OA 3V4UL 3ARRA 5F21B 2YPLA 4S1DC 1N3NA 3UZQA 5HXMA 2GITB 1RZIA 3G5YA 3S5LA 2AV1B 2O5YH 2SEBA 5FOBB 4D9LH 5KZCB 4RAUB 1AJ7L 1U8OB 1RZ7H 2XTLA 3VRIB 2ICWA 4UTAL 4M1DL 1KLGB 3GM8A 1RIVH 3SDCD 1AXTH 3H9SB 5GSVB 3VA2C 1C5BH 5DFVD 4LSUH 4UQ2A 1F5WA 3AC0A 5TQ0H 5DJ8B 1KACB 1RMFH 1A7NH 5EU3B 2EH7L 3QJHA 5DUML 3PP4H 4KMTL 3QIWA 1G6RA 3BW9B 2VZSA 3HPLB 5E2VL 1YN7A 5F1NB 1JYNA 1IAKB 3PWLB 1LO3L 4L29A 1WBXA 2AK4A 4P2QE 2HLFC 2X4NA 3AS1A 2YKLL 3JTTB 3HR6A 4LIQE 4HKJA 5JXAH 3IFPA 1F8TL 2NY3C 2AXGB 1YEGH 3QNZA 5HHME 4HWZB 1EAPA 1HSAA 1G7LA 4MD5A 5D7JD 5C1MB 1B3JA 4JM4H 5JXED 2HP4A 4C56A 3ZKMC 5KS9F 1JMXA 5CJOL 3MV8E 1NC4D 3ARBB 1T0MB 2FHCA 4JFDA 3MXVL 1ZV5A 5F7NC 5CJQL 3DNKA 4PY7A 1B0RA 2XWBB 1SJXA 4HBCH 3FB8A 2BNRA 1JNJA 4HS3A 4XWGH 1CF8H 5I9QC 3RA7H 3KYKL 3QP3A 5INCB 1SM3L 2ARJQ 3MJ6A 4LSQH 4PB0L 3LN5A 3MTRA 4PGCB 5TDNB 3E6HB 4G6KL 3ME0A 3GMNB 4FQXA 3UEZA 3GB7B 3DX6A 2G9HA 5L2KB 1X3DA 5DZLA 1GL4B 1YYLH 5T5FL 3O2WL 5GSVA 2R4RL 2R2BA 4JDVA 4P5TB 3QUMB 2P5WD 1SQ2N 3IFLH 5HVHB 2CUMA 5FYKU 3T1WA 3B9AA 3EOAB 1MFNA 2P8MB 5L0QB 4OZIF 1PGRB 5GJTH 1H3VA 5HHPB 1NCDH 5D7KD 4ZS7L 4S1SL 3QDMD 4P4KC 43CAA 3TVMB 4MDJB 4JAMB 3RZWA 1NQBA 1QFPA 4RWYH 2YD5A 5HHNB 1H5BA 2HVJB 5H8DA 5TF0A 4KPHH 4LLYB 4H5SA 5ID1B 2F54A 1DJSA 2EDDA 2XKNA 3QZWA 4PBWD 2GCYB 4D2NA 1O5DT 2RBLA 3RWIB 3V6FB 4ZAKD 5JUEH 3VGAB 4JHBA 1YYML 4JFQB 1MUJB 5GS0H 3HNTH 3I9GL 4JY5H 2AXHA 4IOIB 4P4KA 4F7CB 2DQTH 4Y88A 2ITCB 5JORB 3W39A 4Q97A 3U0PB 1YNLH 5GRJH 3C60D 1PX4A 1YY9C 2AKRA 1BECA 4Y5XC 4A2LA 5E08H 5KSAA 2BNRB 3N0PB 4FQLH 1F2QA 3LS5L 4P2RB 4F7MB 1QOKA 4U6VH 3SDXE 1KCLA 1CD1B 5CEXB 3OKDB 3OKLA 2BHYA 2JIXA 2DLGA 1BM3L 1D3CA 2R1YA 1BZ7B 5FYKH 3H0TA 3CJJA 2YUWA 4Q9BA 3BZDA 5J12C 4MNGA 3JWOC 4NDMB 4YX2L 3C09B 4QRPE 1LDPH 3OB8A 4WO4B 2VLKA 4HJGB 4G9FE 5DD0H 1DUYA 3BGFB 1RJLB 2R9HC 1HZHH 5EU5A 4X99A 4ZDHB 2FIRT 1OGAD 3LPFA 5BXFA 4H88H 2KPNA 5C8JB 5MEND 1G9MC 1VFMA 2EXWD 2IGFL 2CUHA 5EU3A 3V2AR 4FQCH 2DM4A 1CLOH 3VWJA 5J11B 4RGND 4HV8B 4FS0A 4LMQE 4LPTA 1CLZL 2EDTA 3CK0H 3H7BB 2OQJA 4U6XB 4WRLA 1CICA 4RCAA 4B53A 4Z95H 3UYRL 3O9WB 3RA7L 3D9AL 4X6BA 1U3HA 4BH7B 2CKBH 3GKWL 3KYMA 5DJDB 5LQBL 5KSUB 1P7QA 4LFHG 3WKML 5E24E 1NL0L 5DRXB 4NQVA 3FO2B 3MLVH 3IFNL 5DO2C 5TFSH 1JTOA 3ROOB 1Q9KB 1G6RH 3JV6A 2NZIA 4PRBA 4F15B 3NPZB 2V9RA 4X5WA 4WI2A 2P8LA 4U3HA 5GGTH 2FX8H 4KQ3L 1AC6A 4ZFOA 3ARBA 3G6AA 3FT3B 4HIHB 2CRYA 2NR6C 1I3GL 5IMOA 4UZGA 5MERA 3VXNB 3DX7A 2G60L 5DA0B 4UOW1 2H41A 3U6RA 3MROA 5JO5A 5TF1H 3OR6B 1FVCB 2MQCA 3FB5A 4KDTA 3N06B 3T4AA 1IGTB 2VDQH 1IC4H 1YEDB 2W0LA 2CLVA 1XGQB 4ZO7A 4JY5L 2MQ3A 2C3HA 4XCEA 3M1BA 3MRLB 3T0ED 5J6GB 1DUZB 3KWWB 2DLFL 5DUPH 3MACH 1EERB 4JEGB 1CDCA 1EFXD 1V7ML 4JG0H 1MSPA 2WV3A 5F3HA 1U8PB 1UH3A 2W07A 4UI2A 3B2UC 4H1LH 2BVUA 3MLSH 1IQDB 5GISL 1KJ2L 2ZP0T 3B2VL 4OIBA 3UZEA 4MZ3A 1P2CA 3B8SA 3GMLA 1TZIB 1G7IB 3NFNA 4WI5A 2DTML 1R3IH 4XH2A 1DQJB 3UAJC 1LK3H 4LIQH 2JK5B 4ZO8A 5GZNC 4XP1H 2BJMH 2OJEA 2V2WA 3JTSB 3OMZA 3NCJL 1LMKA 1G6RL 3MMEA 3MCLL 3BQUB 3EYVA 4HT1L 1TTGA 3U4EB 2A2QT 3CFCH 3VXTA 2DLEA 3L3OA 2DBLH 4C83B 4JZJA 1BFTA 4PJCB 5E94A 1A2YB 2NTFB 4O9HH 3V6OA 1J8HB 4L8BB 4PD4J 3AM8C 3AREB 5JO5B 1P5UA 2HFFB 4MWFA 4NO5B 3VWKD 1DE4B 3MRJA 1HQ4A 4MSWA 1BP3B 3TT1H 3GMOA 5FA4A 5F7WC 4MJIA 1I75A 1FVDA 1RFDH 4X7TA 1G7PA 2BDNH 4XCFH 5FO7B 2PO6B 1CLZH 2Y6SC 4CMMB 4EOWL 3E6FB 3VXRA 1CICD 2H6PB 4NN5C 1ODAA 2PW2B 3W9EB 4DW2H 5KVEL 3KDMA 3RVWC 2XY2A 3QUZC 4NPYB 15C8L 5E8OA 3TNNA 1NMCC 4U1SA 1QVOB 1VACA 3C8HA 3IT8D 1DBBH 1EAPB 2APBA 4FMFA 2G2RB 4Z78B 1RHHB 3VWKA 3KGRA 1KN2L 4LEXH 4YDJB 1FNEA 1GOHA 1HK6A 5EB9A 4XP6H 4RNRB 1SJEB 4U2YA 2FEEI 3VFSA 2XWTA 3MV8B 4Y19B 1DBJL 4YHOH 1AHWB 5D5MB 1JZ2A 3H7LA 4LBEA 3VD5A 5BCAA 1U93B 2A0LC 4OCWH 3WUWB 5E7FA 1A14L 1MRCL 3OGOE 1LP9E 2WZPD 2P1YA 2APFA 4DAGH 1VEOA 1YMME 5SWZA 5F6IC 1DCLA 3UDWA 2K7QA 4GXVH 3BISA 3LY6A 4BQ8A 3EFFB 2FJGA 2DMBA 1YNLL 3RRQA 3HS0A 4APQB 3VRJA 3HN3A 3F6LA 2ADFL 3SDAC 3LRSB 1L6ZA 3WFEL 2VH5L 4PJGF 3U82B 4F9LA 1RMFL 2ZG2A 5KVFL 4L4VA 3QH3B 2AXFA 4NWTL 4W4OA 4EI5A 1JWSB 3TYGH 5DRZB 3U4BL 1RIVL 1EDQA 4TOYL 2CK0H 4P2OD 4ZFZA 5TE7H 1FZOB 5JXEC 3DTXA 2V5MA 1I85C 3ZT5A 3MOAH 4OKVB 1QUNA 4HF5L 3FQTA 4F9PA 4F80A 3TA3B 1AGFA 1I3RB 2W65A 3ETBF 5D7IE 3TA3C 4JO3L 2H8PA 4YEFA 2XZQL 5EC2B 5I8CB 1KG0B 2VE6B 4OFPA 3DO7A 1NUGA 3HRPA 2QADD 4JANB 3S36H 4UAOC 3EOBB 1HNGA 2PR4H 5IF0B 4NRYA 4Y4FD 3O3BB 1ZAGA 1RZ8A 5FYJU 4UNVA 2E7LA 1FDLH 3FTGB 3T65B 1CWVA 3LMJH 4L9LB 3SQBA 3P4NB 3GM0A 5JHDD 2UZYB 1H3TA 4KAQL 4OV5A 2EDJA 12E8H 3DSFH 3RGVC 2VDRH 4TOYH 3L6FA 4PJXF 4G7YH 1G7HA 3NIDF 4DVRL 2CDEA 4HUNB 1K5NB 2X4OB 3AAZA 1KTKE 2DKUA 1TQBC 3M8OL 4NFDA 5C0CE 1S78D 3U36A 2X44D 3IDNA 4Q9CA 1R5IB 4ZQKB 2LTQB 4NBYB 5LGJA 4R4BB 2W9LA 2E8ZA 3SCMC 5DLML 2XIDA 3BWAB 4JFPA 4H0IA 4LSVL 2B39A 4EZMA 4LLDA 3CC5A 1W0WA 5C09E 4KKAD 4JO4H 4JFEB 4TRPH 5DK0B 3TVMD 1U8LB 4BUGA 2ADFH 3PWPE 3CDFA 4KJYA 4WHTB 2IBZY 2A74A 2P43B 3QIWD 4ZPVA 3VFNA 3FT4B 3MRBB 1DVFB 1JNHB 1R3KB 1N2RB 3VXMB 3W2DH 5TE4L 1HNFA 4GMTH 1AJ7H 2CLRA 2X70A 3E6FA 1OSPH 4K7FB 2JCCA 1UJ3A 4ZOBA 4LKCA 4PJIB 3GMOB 3NA4A 4U4BA 4XP4L 3WL9B 4BELD 1KJ3L 1MY5A 4QXWA 5D9SA 3QEUB 4JQXA 4C59B 2QJDA 1MIEL 1A6AA 1VDGA 5IHUH 1W2KT 4J3WA 1FC2D 4ZS6C 1T5WA 5HYQA 1D5IL 2WBWB 3FQWA 1KBGH 5JDSA 3RVUC 2FB4L 3L5IA 4ZQKA 1JP5A 5F7DB 4GRMA 5I1IL 2Z92A 4KJWD 1UACL 3UPAA 2L4OA 5J1SC 1WIOA 3LZFH 2HH0L 3S34H 4YHKL 1HHJB 1BBJB 5FK9A 3IJYA 1QSFA 4PS4L 3CSGA 3X12A 2BDNL 4XCFL 3A0OA 4QRRA 1CS6A 3CIQA 4TSAH 3LD8C 5DSCB 1UH4A 3WSQH 1DBKH 3IDJA 1WFTA 3HE6D 1BD2B 3L7FA 4O58L 4G9FD 3QG6B 5DHVB 2WWKO 5C3LD 1CXIA 4MB4A 3VA6A 3KWWA 2NY4D 4XPBL 1VFAA 3B9KB 4Y5YC 2WNGA 4LOUD 1QTYT 2HT3D 5JHLL 4KI5D 3ULVE 3UX9B 3NCCB 4MA3B 5EFIB 3ZDZF 3MOBL 1S7XB 2OS7A 4K8RL 3VG0L 2F58L 2J5LC 5C07D 3D5OF 4JGMA 3U30C 2BSED 1NFIA 4WV1A 4H8WC 2ZSVB 5GISH 3O8XD 3TYFB 3NIDE 3KLAB 2ICWJ 3OZ9H 4XPGL 2Y9RT 5I75B 5DQDH 5IHZA 3BP6B 5FDWA 1WCBA 2VXSL 4W68A 3MRCB 2VDQL 5EBLA 3O6MH 2BNUA 1J9CT 1F3JA 4ZOCA 4I18A 2VXTH 1S9XA 2HFTA 1MHCB 1VFBB 5F6HI 1A5FH 1UG9A 1RZFH 1XF4A 2A9MH 2PETA 2P49B 4HEME 1P7HL 4KGJA 4LLAA 3U0WL 2UWEA 3SDYL 4QHMB 4DFHA 4MA8L 4PTTB 3MRMA 1Y6NR 5ACMA 4JPIA 4UTBH 1T66C 1T7XA 1NAMB 5CZVH 1FLTX 1UXWA 3IJHA 1NBYA 1XH3B 4RFNB 4JG1L 4I9WE 4ONHB 4KDWA 1J5OH 2K7PA 4CADA 5GS2H 3OF6D 3NMEA 4Y1AA 3C2SA 2AJ3A 5K9JL 3CDGA 3L3HA 3L3KB 1AY1H 5DO2D 3W0WB 1EX0A 1NMBL 3N85L 4ODXA 4WFEE 2D2OA 2X4UB 2HTLD 3CSYA 3G6JA 3RY4A 2EH8H 2WP3T 1UM6H 1XGRB 3MFFB 4NCC1 5B38G 4RNRA 3P0VL 3GSNH 1K6QH 1NMAL 4XXCC 3EBAA 3MRPB 3ZTJG 5I1JL 4XBGB 1GCFA 3WUZA 1RHHA 3U2SB 1ZHKA 3OKEB 3W0WD 1Z3GL 5CJXC 1A7BA 5CCKH 5ID0B 5FYKE 3DSFL 2A73B 4HC1L 4MQSB 4IRZH 2AW2A 3VXSA 2L7JA 2F53B 1A9BA 1JGDA 1ORQB 5D1ZD 5I1HH 3TBVB 3KLAA 5EBLB 3FT4A 2Y06H 3KS0J 5DD1L 5IB1A 1NCWL 3HI5H 1M7XA 3VD7A 3S88H 2DTMH 1L6XA 2RCSH 3TT1L 2A9NH 5LKNA 2W0FA 1VFOA 1MHEB 1CTOA 3MREB 1PFCA 3ZTNH 3IAGC 4XZUB 1BBDL 1IFHL 2D03H 4MJ5B 3QJFA 3DV6A 5E5UB 2GFBA 2YUXA 1G9NL 2ESVD 3RL1B 3UO1L 4PBXA 4L8SA 3BI9X 4JCLA 3QULA 3AGVA 4RFOL 2R0ZH 4ZMAT 4KJPC 3CNKA 3V8OA 2GTZB 4ALAH 4XNUH 5F9OH 2A6JB 1X5FA 1C7TA 5B22A 3JV4A 3SDYH 1QSFB 1JYWA 4J1UA 1I1YA 3KHQA 4HKBA 2AK4E 4P2QA 4YFDB 1PJ9A 3RIAK 4OBRA 2VDOL 3DYMA 1MI5A 3SKJL 4MNQD 4BZ1H 3SO3C 3OKOB 3MUY1 4NKIL 1N6QH 5FK9B 4EDXA 2YPLD 5IW1A 5IVZB 5IVXE 4PJ9C 1BAFH 1HEZA 3JVGC 5IP4A 4ETYA 1EV2E 5HYFA 5FECA 1SJVA 4F7TA 5JPNB 2NY2D 3O3AB 5IROC 5IW3A 3BP5A 2ZUXA 3NZHH 1S9WB 1A7OH 2NXYB 3AROA 4Y89A 5ITBL 3O3DA 4PG9B 1AQDA 2UVFA 4JQVA 4NUGH 4PY8J 2LVCA 3KVQA 5EU4B 1PYWA 2NW3B 4FP8H 3WS6C 3FHAA 4MNQA 4XP5H 4ZS7H 5EN2A 2HFEA 3UJIH 1CLYL 4G42B 2F54E 5C6WH 3VG0H 4KUCF 2L0DA 4IMLB 4OD3H 1RIUL 3PUCA 1BLNA 1BX2B 1I7RA 3PQYD 1T83C 3KR3H 3VDAA 3TNMB 4ODWA 1Z9SA 2GJJA 2W0PA 4I2XB 1U95A 5ICZA 1KENL 1NSNH 4MJ4A 3HI5L 3TA3D 1MFBH 3CMGA 1PD6A 4IMKA 4TSBH 5CLTA 5FUOH 1XGTA 2FYYB 3MCG1 1OTUC 2ZNXA 5IQ9B 5FV2A 4R4NC 5E8PA 3Q2CA 4JQXC 5IW6A 3TN0B 2Y5EA 2APTA 4FQ1H 3CC5B 2I9LB 3NFPA 3GSRA 4KK8D 4OLYL 4J3TA 2X5PA 2GK0A 1FLRL 1P4IH 5DD6A 4K3DL 5J56B 1NUDA 5IM7B 3MGOA 3R8BB 5CLWA 3VXMD 3PWLA 3GJFH 1OSZB 2IAMB 2ZCLL 4O9HL 1AGEA 4GW4B 4RIRB 4Y2DA 1NLBL 2X41A 2XA8H 1TPXC 4TTDC 1I1FA 5C07E 4C56E 3KPMB 1XF5A 4XPTH 1L0QA 3TNMA 3VWJC 1P9MA 5EU5B 2I25N 3EYFA 4M00A 4JPIB 5B3JF 4HCRA 1A7NL 3S37L 2OLDA 2R23A 4UTBL 4J4PA 4NC1C 1NGPH 4XCCH 5HHVH 1AXTL 3Q6FA 3RDTB 3UTSE 3FTGA 2BVYA 2NCMA 1KEGL 3SOBH 3JZ7A 3MODL 5IFHH 1Q1JL 4KROB 4WW2A 1NC2A 5FO9A 2HTKC 5FM5M 1F6AB 4ZAKC 5CJBA 2AJVL 1T1XB 5D7JC 4CUCA 4Z76B 1JGEB 1KG0A 2VE6A 2H1PH 5CINH 5I30H 5DRNA 4GH7B 2DQHH 3BT2L 1FJ1A 3T2NL 4KTDL 3GHBL 5KVDH 5DFWH 3TFKD 1MCPL 4LP5A 4M1DH 5HI4C 3DSNA 5FAAA 4Y4FC 4H20L 4P5KB 1W72H 5M94B 4L8BA 5D7LD 2FECL 3GSWB 1DDHA 1HDMB 3QRGL 1I8MA 4UU9B 3ROLA 4P3DA 1OARH 2VDMH 3PJSA 3CLFL 5EFIA 1MCHA 1QO3B 1NDMA 4LGRB 1L9MA 4YXLL 4Z7VB 1ZTXH 2ZKHH 1LK2A 5IHBA 2D7MA 1FZKA 3IXTB 1UWXK 2AGJH 2DQDH 4H26A 3L5HA 3AS2A 5EWIH 3QG6A 1YYLL 2XYCA 1OAZL 3H9YA 3QPQC 3EHBD 3OX8A 2IAND 1FO0B 5FKAA 5HHNA 3LPWA 4YBHA 5EZJB 4XZUA 3EYFB 3RHWF 1MCWW 3C2AH 4PRHD 4X6EB 1HHHA 3IGAA 1GRWA 5DZNA 1ZS8B 2OI9C 3FQRA 4JY4B 3X3FH 1LILA 2R8SL 3I3EA 1EHLL 5BOZG 5CP3H 3MYZA 3NZ8A 2YEZB 3VFMA 1CXEA 1WIPA 2B2XL 1MLCB 1MPAL 4CJ1A 5F3HB 3MXVH 1C08A 4FXLA 1G7JA 3T8XB 4NM8L 4BA8A 3WFDL 2DL2A 3OXSA 1AE6L 3VFVB 1MWAL 4S10A 3C09C 3PXJA 2FB4H 4D8PB 1HKFA 5DJCB 1OQXA 3D2UB 4MCYB 3D25A 3CSPA 4K9EL 4UDUB 4HUVB 1I1CA 2JF1A 1QFOA 5D9SB 3HC0A 5C6PB 4LKCB 4PJIA 1RUQH 1NDGA 4OGXL 4P3CH 4P0DA 2PYFB 2BY1A 4PJAF 1YA5A 2X4UA 3CSYB 4XPAL 1UXSB 1RJYB 2H1PL 4GLRH 1U8IB 2MWCA 3MBEA 4C56B 2EC9T 3ARFB 1NCNA 1UGNA 3C5ZD 2ZPKL 3NACL 4L3CA 4PRNB 3HC3L 4GRWE 3FB7B 2AAVA 5FEBA 4MWFB 2PO6A 4O5LL 1QEWA 3L3JA 4YBLB 5F1IA 5FHAH 4Z5RA 4NC1E 1KCUL 4GKSA 3T3MF 4XBGA 1S7VB 1VHPA 5D1ZB 1Q9WA 3TLRA 3BZEB 5BQ7A 4NRZA 2ILLA 3NN8A 3VFRA 3GMRA 3PP4L 4MS8C 4XPFH 3MMEB 4RGOL 2GAZA 4AIZB 4DN3H 4OGZA 5B39B 1AE6H 1CQKA 1C5BL 4O00A 3FFCA 4QTIL 5H94A 4Y16D 5B4MC 4G6AD 5SWQB 1UM4L 1NH6A 3PQYB 3SPVA 1B2WL 5I76A 1YN6A 1K5NA 1MWAB 3CMOL 3LKNA 3AB0C 3ABZA 3ESUF 3PV6B 5DC0A 5IVNA 4J1UB 3TVMA 1T1ZB 3FFCD 1M7DB 4RGNB 5HGGS 3T09A 2XWJA 3ARPA 4N0CD 1WZKA 4OLYH 4G8GB 1KGCE 4MJ6A 4Z7QF 5IK3A 4WI4A 3W0WE 4KV5E 3MV7A 3C08L 4NM8H 3LKRB 1JPSL 4WHCA 3LS4H 3IDXH 1JGVH 1RD6A 2BNUB 2F19L 4UV7L 1T1WB 3BIKB 3FAWA 3CDYA 5I1KL 1ADQH 1KF9B 3KPSA 2CLVB 1S7QB 2JB5L 1TZGL 2RAMA 2LV4A 3MRGA 4KROD 2AJXH 3HG1A 3RVUD 4MAUH 2H3NA 4LCIH 4N9GB 3OR6A 3IDYC 5B4MD 4RDQG 4HWUA 1BQHG 3SKUD 5F70A 1QYGH 3IU4H 4F9PC 4IOIA 1ZLSL 1A7PL 4N0UB 4Y4FA 1TCRB 3S35L 3T2QA 3GMPA 2AI0H 3BO8B 4FNLH 1EO7A 5CJQH 1R3IL 1T1WA 3U4BH 4LAQL 3QH3A 1G7LB 3G08B 5HGHB 5F7HA 5D6CA 4N90E 1FL5B 2PW1B 4ODSH 3BVNA 1MJUH 5EWIL 3U2SA 4ZUTA 4KHTL 4NQEE 2LAAA 1S7RA 4P9HC 5DD3H 3ZT6A 3K4ZA 1MCPH 1PG7L 3GSNB 3OKYA 3A6CL 1DL7L 3O4OB 5D7LA 4QRRB 3ILQD 3MFFA 4E41D 1NGZA 1IAKA 2AK4D 5ICYB 5BRZA 1A7QH 4PGDA 4GG6A 2FIKA 4GSDH 1W72L 4XNYH 3L3KA 4N1CA 3WBDA 2GJ6E 2YK1H 3TJEH 5DMIH 3UBXG 3WNNA 2A0LD 4F7PB 3DVNB 3QQ4A 5D70H 4JM2A 4JFYB 3EYSL 3QFJD 2AJVH 3CX2A 5I2IA 5LCVL 1NCCL 1JRHI 3KYOA 1R6VA 1UA6H 5C8JA 1FZMA 5KJRH 2OCFD 3BUTA 1LO2L 3VFSB 2YMXH 4X7DC 4FABL 3H9ZA 3Q5YA 4L9LA 3RGVA 5ITFA 3FB8B 1KPVB 4YDLB 1HINL 4P99A 1T3FA 2H2SD 2IMMA 1IKNC 2ZZUT 3C9NB 4HK0A 5FDWB 4U1SB 4YIQA 2C3XA 4X98A 1EEQA 3MRKA 1NSNL 4HK3N 1F4HA 2MNUA 2IG2H 3WIIH 1DQTA 4M5ZL 3TP4A 1T5XB 4P46C 1RIUH 4LSTH 1X5XA 5T1MA 1CDYA 5E6ID 4R7DA 3I50H 4HUXA 5IIEA 4S2SA 1IE5A 1X4YA 3E3QC 4J3XA 3S4SG 3V4VL 5DVOA 1KB9K 3WO4B 2ICEB 4X4ME 4YBQD 3MRIB 5F8QC 1IAMA 2KDGA 2DD8L 4MA3A 3TT3H 4AL8H 4YHLL 3EZJB 1YN7B 5F1NA 3KPNA 3WLBA 2P24A 5I1DA 2BVPA 4OCLC 4R4BA 2BOBA 1JF1B 1NC2B 5CEYA 5FO9B 4K55A 4P46A 1GC1C 5CEZD 1PLGL 4MA1B 4LLWA 1I8IA 1VGKA 1M6OA 5CZVL 3ARDB 4HKXB 2FSEB 4J8RA 1KENH 4Y4HB 1O7SA 1JF5A 4PJFA 2D7PA 3FQRB 4JY4A 4NZJA 1E4KC 3C60A 3MYJB 3HFML 2FO4A 2V17L 4LSSH 2VLJE 3QIBA 3BUYA 2HJFA 2YK1L 2RB8A 1GH7A 5F7DA 2NXYC 1A4JA 1D5BB 3QXDB 3TIDA 4XBPB 2P7TA 2C3VB 4GJTB 5IF0A 2BY3A 5HYQB 4OBSA 3SGJC 2EEBA 4ZNEE 4OJFH 2DAVA 5IB5B 5T3ZD 1A1MA 3CFJA 1JI1A 3SO3B 4OCXH 5CSBA 1I7UB 3IKCB 2HN7B 5FCUL 3SKOB 5JIIA 1M05A 1HHIB 2I9LA 4OF5A 5GSRB 1XF3B 5DJ6B 3GHBH 5KVDL 1ZMYA 3R8QA 3RZCB 5K59E 4OD2B 4EKXA 1TENA 4OF7A 1N5AB 4YQXH 3D2UD 3BDXA 1GOFA 3DMMC 2WMPA 1X5KA 4AEHH 3C5ZC 4PRBB 5IJKA 1UC6A 4PJIE 4WI6A 1FAIL 3FN0L 2R0ZL 4NYLA 1DTUA 4AL8L 1ZANL 2YRLA 4U6TA 3MLRH 3U7AA 1FYTA 1U8MB 5L8LB 2XN9B 3MA7A 4S1SH 3VDBA 3DUUB 1WUNT 3IFNH 3VI3E 5DQJB 1F13A 2ZG1A 3BKJH 3QO0A 5C3TA 1A6ZA 2Y07H 3LRGA 2ENYA 2CIKB 5D2LE 5E6IB 5DRWA 3LN4B 1NBVH 5IB5A 4M6NH 5T3ZE 4XMPL 3MGTB 1QSEA 4N0FA 5E8NA 3BP5B 1MFEL 2VLJB 3HNSH 4UQ2B 4KY1L 1AD9A 2OSLB 4AG4L 3S6CA 5I19L 4G6AC 3K81A 4PLJD 2CK2A 1EBAA 3S3SA 4HX1A 2DQCL 5ALBL 3BHBA 1I1YB 1QFWH 5HJ3A 4UQ3A 5KJRL 2DICA 4OZHA 2RFXB 1RZIB 3Q6GL 1SYSA 1ZHBB 5KBNC 2O5ZL 4OZIB 4OTXL 1KN4H 3WFHA 3OB0H 4FXKA 3HMWH 3W5MA 3SDDB 5HBBA 4PYGA 4LLVA 2GAZB 4Z77A 1BZ7A 3EOTL 1DVFC 2BY0A 3PGFL 5FGBC 3ZKNC 4JVPA 3SDCA 5A2KH 2NY6B 2Z31A 1CGTA 2C4FT 4NGHH 3RI5K 4YC2B 5IVXA 1P2CB 5KVMC 2R9HD 2NY4B 4MJIB 4O51B 2ICEA 1F58H 5GGSB 1CFTB 4WFHD 4HULB 1U8QB 3ZL4L 3H9HA 4PLKC 4KFZC 4OM0L 4R6UA 3L5WA 4S0TD 2AEIT 4X4XA 3EKCA 1BOYA 3IFOA 2COQA 2NY4C 3DX9A 2ZSWB 4FQIH 3LV3A 3CAFA 3OXRB 1AIFB 1G84A 2OTWB 2VABA 2V2WB 3QUYC 5FGSA 3DV4A 1Q9KA 4G6FD 4LARL 4ZFGL 4EDWL 3QUXD 3REVA 4ZUWA 4Y16C 3TCLB 1ZHKB 2BSSA 2YC1B 1S7TB 4GBXA 1LEKA 3DV6B 1P7QB 4WENB 4JB9H 1AXSB 1U58B 3D2UA 4MCYA 2N7AA 1B6UA 1FRGL 2VL4A 1ZT1A 2HKHL 4BFIA 1I1RA 2JLLA 3KPMA 4HKXA 5GGVY 3ILPB 5SWSE 4ODHL 5F7YC 3JUYA 4NHUB 5DXWA 2FCBA 4NKOA 3VXUD 3BJLA 4DKEL 2WBJA 3VGBA 1DBKL 4GAGH 3G6AB 1FG9C 1U93A 4OKDA 3LHPH 1OD9A 5EPMA 5T5FH 5CGMA 1MCWM 1Z0MA 2ITDB 3ROOA 1S5IH 1KIQB 2J3SA 3EO0A 3BP7A 2R0WL 2R4SL 1YNKH 4RSVA 2QSVA 1IKNA 4ZPTA 3JWOH 1DLFH 5HHXH 1VPOL 1IILE 3P9WB 3QDMA 3L7EB 3UTZB 1BF8A 2AP2A 2LFGA 1KJ2B 3CZFA 3D39D 5IBUB 2KUTA 3NFSH 4OZHE 2OTWA 3ZE2F 4PRDA 1J0KA 4XNZB 1B2WH 1Z6JT 3L3DA 1LK2B 5E2UH 1Q94A 3S36L 4YHKH 3SGKC 2F8XC 2XZCH 3S7GA 5K9QG 1H5BC 2F8OA 2IH1B 5I1AA 5EBGA 1KXQE 4LP4A 1J05A 3S8WA 1RK0B 1D9KC 4BFIB 3KPSD 1DR9A 4HIIB 5C08D 4IMLA 4HC1A 1CL7L 3FONB 4WU5A 1NAMA 4HKJB 4X7SH 2ORBL 3RGVB 1CR9H 3FQXB 4MNQB 3SDDC 2DMCA 3RWFB 1ZOXA 3CFDB 3MNVB 2F74A 2H9GA 4JR9H 1Q1JH 5I74B 3O11B 4FQIL 3ZO0A 43C9B 3HPLA 2YMXL 3KPSB 4RMRA 5DYOB 3HC3H 1ZHNB 4LAJH 2GYSA 2Z91B 4KC3B 1CICB 3JTSA 3QUML 1WWAX 2IQ9H 3QR2A 4N0YL 4W6YB 2AJUL 4MNHA 4HV8A 2BHUA 5C0RH 4NKOB 4LCWB 4OLWH 5IMKA 3L95A 3U1SH 3JSSA 3P30H 5DJ2B 1QG3A 2VDRL 2EXYC 5EO0B 4XAKE 1DEEB 5TQ2L 2R69H 1UQSB 1FORL 4U0RB 5EOQL 4C54A 3P4MB 2FR4B 4PJFF 4G80B 1EEZA 3DYPA 4UIMA 4YWGL 4U1MA 3U9UB 1TNNA 1IGYB 1K9TA 4MLSA 4HLJA 5J0BA 4PJ9D 3IVKB 3PWPD 2E7CA 4OZIE 3F7VB 3QFDB 1A4KB 4LSVH 3MLXH 4LSUL 1VFAB 4I8DA 2BOBB 3MRRA 4U6HA 3UJJL 2NX5B 4FQXB 2IWGA 3WFHB 1QLFA 3BO8A 1C5DA 1MJ7L 1TCRA 3WLBB 1FPTH 2ICCA 4XNQA 2C1PA 3D0LB 5DHVH 2A83A 2Y7QB 3T0VA 3R0MA 1XIWA 4Z0BH 1S7VA 2B7DT 4P5MA 3WXWH 4DVRH 4I2XE 4QLRA 5LWYL 3WDJA 4DKEH 5C6TL 1E0OB 1LO0L 5T3ZH 2D0GA 4EN3D 3HR5A 2P8MA 3EOAA 2IANB 4IBLT 2BVOA 1IZKA 3ZSTA 1T2XA 35C8L 1JHLH 5GGVH 3P9MB 1DVFA 1NCBL 2B5IB 4X9IA 2GTWB 2DQUL 1ZVYA 2OP4L 3DPBA 5D6DC 1OVZA 4XP1L 4PRIB 1CE6A 3X3GL 2ARWA 4HF5H 2XICA 1KB5L 2EDRA 2XN9A 5BQ7B 3TO4B 4KK8C 3G6JF 4U1HA 4YR6A 3QJHB 2JCCE 3WIHA 5CHNA 3V5KA 3MJ9L 1UACH 2CLRB 3B3IA 2NY0C 3BGAA 2HYMA 4XI5D 3RVXC 1WCQA 3CMOH 1F6LL 4TNWK 4CADB 1OCWH 4EDXB 4X7EC 5F1OB 3MJ8A 3MRBA 1CK0H 1NAKH 5CEZL 1NGWB 3VG9C 1EIBA 3D69B 4OFYA 4OF3A 2DLIA 4LCWD 4PFEA 3LKPA 3PWPA 5EOCJ 4OF8A 4QRTA 5L9DH 3QWQB 4TQEL 2PO6D 2QEJA 4GS7C 1UJ3B 1FGVH 4RAHA 4JKMA 3QG7L 1ZVHA 1T04B 3IXAB 1YMMA 3RWEA 2FWOB 3QRFM 2W9DL 4LL9A 4BZ2L 3ZE1E 1F2XK 3F5WB 2VLMD 2HJLA 2APWA 1RK1B 4PJCE 2WP3O 4RAVA 1JK8B 2EKSB 2VLJD 2LE9A 3RWJB 4TN9A 2H8PB 4WHYG 3QIUC 3AAZB 4JDTH 1XFPA 2FO4B 2IAMD 4JRWA 1YEKL 4GQ9H 4GKOA 4N9GA 1OAUL 5EG6C 3DXAE 5GXBB 3MRGB 4YE4H 5IWLA 4OV5B 5CBEB 4V1DB 2HA1A 1G9EA 1RUQL 3GMQB 2PKDA 1S7QA 5GPRA 1S7UA 2IPTL 4PV9B 4MB3A 3T65A 1IC5H 1TZHA 4K7PL 3GMMB 4HC1H 5KG9A 4CRPA 3CX5K 3BESR 3QIBC 4P4RB 1AKJA 1CIDA 4XBPA 3IDJB 5FCSH 3A67L 5C0EB 4GXUM 4M48L 1MWAH 1H15A 4LCCC 1MFCH 2P45B 3EYQD 2JJTA 2VN7A 1MOEA 3C60B 3MYJA 1B4JL 4HXBH 1AQKL 4EOWH 1DDHB 4FG6D 1XMWA 5F96H 4DGVL 4MD0A 3D87B 3EFDL 3QNXB 7FABH 3SPVB 1RIHH 3QISA 1JWUA 1NJ9B 5E6IC 3OAYH 4G3YH 4BK5A 5GZOD 3K1KC 3IJHB 3B9DA 1IGML 5FHBL 5HDQH 4GG6B 1FZKB 3IXTA 1I7TA 5C08E 2XZQH 3BEVB 3SJVD 3U0WH 4IIQC 2OZ4H 1S7UB 1FGVL 1JZ8A 5DMYA 4QNPE 1LO4H 3KJ4B 1IGCH 4J3VA 4K3HA 5CSZB 1JPFB 3GHEL 1LK3L 3L9RB 4LIQL 4QHUB 5HHOE 3AMLA 3I6LE 4JVUA 4CL7A 3MACL 3FQTB 2VDNL 2X70B 2QSTA 4OZFH 1F4YH 4NBZB 1MVFA 3LVEA 3PL6A 2X89A 5DZOA 2FX8L 1NLDH 2V5SA 4JN2B 5T5NF 1A9BB 4YIQB 3G04B 5I30L 1YY9D 3LDBC 4EXPX 1LNUA 2KZ1B 2IANA 4BQCA 4JG0L 5E8NB 1F3DJ 5DUPL 4HKZA 1AGCB 5JPMA 2NZ9D 2H3NB 1KCRH 3LEYL 3IDGA 2G5BA 3C87A 3K7UA 2C1OB 3HFMH 4QCIB 5C0FB 5DD6B 3THMH 2GK0B 1A2YA 1CE6B 5FYLE 4Z78A 5GS3A 5IW6B 3RBGA 4KQ3H 4H0HB 4XC3L 5HDBE 4NKQB 5HY9A 5C0CA 2VR9A 3ZE1F 4NPYA 4LCUB 1N59A 2X9XA 4Y4FB 4CGTA 2IGFH 3GEWB 2DB8A 5CHNB 3VXRB 3QQ3B 5DMKB 4JPKL 3RTQC 1PZ5A 3WIHL 1A6TB 1G7HB 4DKAA 5J1AB 4U1NA 1BQLL 2E9IA 5M7QA 1MI5B 4OZGA 2JB5H 1UB6A 3IETB 5E2TL 4P48A 2KQMA 3QWRA 1KB5A 4HBQA 5DJYA 3EJJX 2R0KL 3OKMB 1MHCA 3P4OB 3G9AB 3KHOA 3H9SE 3CLEL 3IFLL 3PQYE 3WKMH 3G08A 1GZPB 1OW0A 5TE6H 2ID5A 1HINH 2VQ1A 4PG9A 3UJJH 1AP2B 3QCTL 4R90L 4AIZA 2E7BA 2PCPA 4H88L 1SHMA 2VXVL 4ESKA 4K23L 5CJXA 1JZ3A 3TZVB 2F74B 1ZGLB 3LN9A 1FFQA 4I0PA 4YFLF 3QXDA 1YEDA 3LKQA 1OM3L 5I1CL 2E6JA 3CVHL 5C2BL 1T66D 1A3LH 1MAMH 1FCCA 1ZVSA 4PYHA 1VA9A 3W11D 4FQ2L 1B4RA 4EIZC 4RGMC 2HFEB 3HNTL 2FJFA 3VXMA 4Z76A 3AUVA 1MHPH 4PV8B 5H94B 4ZG1A 4MA7H 1PG7W 3BIKA 2FHBA 1AI1H 3MV9E 4P5TC 4DVBA 4RGOH 4DN3L 1J5OL 2J88L 1MREL 4EUPG 4XCEB 1K4DA 4F7TB 1N6UA 5KANG 1IGYA 1YEEL 4G8EB 2GJZA 1U8JA 4Y1AE 4U1IA 4XH2B 4R96A 4K2UH 1UKQA 4X6CA 4OZGB 5L2KE 3RX8A 3MRPA 4AIXA 2DQFB 3EO0B 2EXYD 1NCDL 4TNVK 1U3HB 4BH7A 5F3BA 1MY7A 4F57H 2ZPKH 3NACH 4PJAA 2VZOA 3UTTB 4NN6B 1IGIH 4KI1A 1BOGB 1WT5C 2RGSA 3T0BA 3F7RA 2NPLX 3TN0D 4AEEA 5ILTH 4HS8H 3GI8L 4PJEA 4HSQA 4QWWC 2AQ2A 3MRQA 2X40A 1IEAA 3GBLA 2VLKD 4ZNCD 3ZT7A 7CGTA 3UJTL 3T0XA 1CK0L 3DHMA 1JL8A 3L3DB 1CN4A 4X5WB 5IT2L 4ZTOH 3WSQL 5IMMA 2XQBH 2A73A 4N8VB 3CUPB 1FGNL 1BEYL 1L7TL 4PJHF 5EH1A 5C0DA 4IOFD 5SX5H 2QV2A 2F58H 2EE9A 1C16A 1LO4L 2IADB 3VXUA 5C7XH 3TN0A 2DIBA 1JN6A 3O3BA 9CGTA 3QUYD 5DJCA 5DD3L 3V6OC 3FB7A 1J8HD 1F3DH 2C4FU 1IQWH 1Q9OA 1QRKA 3O6LH 1MCBA 1QHOA 3DX9B 3ULUH 3INUL 1MCJA 3H3BC 1ADQL 5EIQA 5HDBF 4M6OL 3ZKXC 3U83A 1W8NA 2EDNA 1LO0H 5D7SL 4R0LB 3S35H 4LPWA 1S5HB 4QGTA 2UYLA 5IKCA 4J6RL 2E8YA 3GRWL 3KYNA 1JHLL 4P5KA 1ZSDB 4P3WA 5ABDE 2XG5A 1FPTL 5FM4A 1XGUB 1QBAA 4WJ5A 4PTTA 1NGZB 5E2WL 5E5RB 3ARZA 3MLZH 1VEPA 4ZD3H 4ZXBA 2F54D 2K1MA 3WXWL 3O3EB 4WFGE 1JV5B 1OGAE 3QCUH 2J8UF 4JREB 3RWIA 3D3VB 3RUGA 4FQCL 4PIRF 4I3RL 5IHZB 4R9HA 3VXQB 1KTLB 1CD1A 3QHZL 3NA9H 1KB5B 4IDJL 1KJ3H 4O2CB 5EO9A 2VDPH 2YXFA 4J23A 2FJGB 1UT9A 3RUGE 3B4NA 2QHRH 4YGVA 4PJBB 3CFEB 2WIMA 1LDPL 3QO1A 1U8PA 1AI1L 5HVWA 2RIKA 5K9OB 2VJXA 4V2BA 1WBYB 5MEOA 5A16A 4MNGB 4QHNB 1UM4H 1FG2B 4LCUA 2CGRH 1ZEAH 3DO7B 3TEUA 3SE4A 1TZHB 5GZOC 2QBWA 1A7RL 3M07A 2P44B 4Z7VA 2LVEA 5L6YH 3BZ4B 3QNYB 3HPJB 1T0NB 3O8XA 1MLBA 3QUKB 4JHZA 2FECI 4FZEL 4W6WB 3BRFA 4OAWB 1FQ9C 3SDCC 3MV11 4MJ5A 4F37F 2XXMB 5E2WH 1GJIA 5IR1A 2J8UA 3GSXA 1H8OA 1WFOA 2D9CA 5E99L 5FYJH 4YDIH 5JW3H 5D7JA 43CAB 5MI0B 4RQQA 3ZHKA 3IJYB 4UINH 3VD3A 4WGVB 2R29L 1IM9B 4RMWA 2PN5A 4MCZB 3EHBC 2NY6C 3FFDA 2F53A 2X10A 3SDDA 1XR9B 4PP2A 3QDME 3HZMB 4X8JB 1G0YR 2Y5TA 2RFXA 1IMHC 3LSOB 2X9YA 3PWVB 2FX9H 1JTPA 4OB5L 2H26B 4KKLC 4MXQD 2Y23A 1BZ9B 3S37X 5CKAA 1T89C 2IC2A 4K3EL 1F90H 3K2UH 3RU8L 5D7SH 5F9AC 4HK3J 4AM0A 5CEZE 4Y5VB 1R24A 4JFDE 4PJAE 2GI7A 2QQNH 3G04A 2W60B 4R4FH 1CFNB 1X5GA 2KZWA 1JNHA 5GHWH 2IQAA 3U30B 4LBEB 4YHZL 2B1AH 3RZCA 5E4EB 1I3VA 1JF6A 4NQCE 1PY4A 3VXOB 4YLQT 3V7AE 1BLNB 1BX2A 1I7RB 3S97C 1IQDA 2BMKA 5A3ID 3BJ91 4HWBL 3EJYD 4LCYA 4QRPB 5FA3B 1N5YL 4RMUA 4G42A 3PWJB 4OAWA 4LRIC 2KL6A 1BVLA 4I1NB 1X6NA 2WWKT 5JHDE 1XF4B 4H20H 3UZVB 5HHOD 1LP9A 3S96A 4A6YB 5I66A 2OL3L 2UZIH 5KVGL 1FHGA 3QXUA 3KPRA 4JRXD 1VGEH 5C07B 1XGTB 1DN0B 3MXWL 1NC4A 2MKWA 3DVGB 4MDIB 1CXFA 2BOCB 4HS8L 4U05A 1WWBX 3DGGB 4OLXL 4LPUA 3GMMA 4X6CF 5DJ0A 3MLWH 2Y36H 4TTDD 5I8CA 1BHGA 2HLAA 2CKBB 2VDOH 4LHUA 3G6DH 2ATPB 1ZWIB 3HE6B 4Y16A 4ZUUA 3U7WL 1T2QL 2HG5A 3GIZH 4XP9H 4KVCL 4XI5C 4S2SB 3PHOB 3RVXD 5I8OL 4OIAA 1AKJD 4E42B 3CVHA 4R7DB 1ZK9A 4MZ2A 4K94H 4F3FA 5LAXA 3P11L 1OWRM 3OAUL 5DQ9A 2HAZA 5ISZD 1DBBL 4MGXA 5FKAB 3O6KL 3T77B 2CDGB 3RPIB 3BEVA 3C60C 4WEUD 2VIRA 2NY5H 1JGDB 1ORQA 15C8H 2APVA 2J5LB 4XMPH 2GJ6D 5JW5B 5GIRB 3HZYB 3SO5A 4L4TB 5I1DB 3CPLB 3QIBB 4DK6A 3CFEA 5BV7C 5CGYC 4F58L 4XP6L 3TFKC 1A6UL 4R4ND 3P0VH 3KPTA 3HE7C 3K8MA 2MTPA 5EO1B 4M7JL 5TPWL 4E42A 3PABA 5EU6E 3TESA 4JM2B 5CIPA 5HTSA 4QHLB 5AZEL 2P5ED 1ZE3C 4UV4L 3FO1B 4IHOB 3WKNA 3P0GB 2JJWA 4O2FA 4OCYH 4XRCA 1XGQA 2E27L 2O61A 3CLEH 5MI0C 2EYTB 5T1LD 4FQQA 3LQAH 3TPUA 1YMMB 3RWEB 4YUEH 1NMAH 2XG4A 1UZ8B 3GJFB 4X6DF 1EPFA 1MRDH 3GJEA 2P5EB 4K94L 4RISH 5DK3A 4JM2D 4I3SH 1T6WA 1TJHL 5EBWB 4GG6F 4APQA 4OFVA 4EXKA 4HW6A 5IBLD 3VXNA 3C6LA 1TQBB 3WD5H 1MFAL 3FOLA 2ZWLT 1C12A 4BZ2H 5CKGA 5K9JH 2AQ3A 1P69B 1JE6A 5T33H 2WWMC 3STLB 5FOJA 1JK8A 1G1YA 4KK9D 3GFUA 4PJDF 3OZ9L 3BFOA 3UPCA 2V17H 1X6LA 3REWA 1RZKC 5I8OH 5ITFB 4L8SC 1MQ8A 4LHJB 3HE7B 4DQOL 4YDLC 1IRAY 1GAFH 1T7ZA 2A83B 2Y7QA 3I6GA 2Z35B 3V0VB 3HS0B 4PB9H 3LSOA 1ZT7A 5EUKB 5IHLB 4YHPB 5B3NA 3FB6B 1RUPH 4U1LB 2QQKL 1A3RH 4GMSL 4Z0XB 1UKSA 2Y6SD 3I2CL 1M7IB 3K8KA 2YWYA 4G8GA 3WHE0 2EO9A 3CFKB 3IJSB 1A22B 1GGBH 3EAKA 2JELH 3QEGL 3V52H 4CVZB 1TNMA 4G6MH 3IRPX 4OGYH 4NJ9H 5T1DH 3T0EA 4HDIB 5D1QB 4G9DB 3S4SA 1J1XL 1RU9L 3BIAX 2R0LL 3JV0A 3GSUB 3B2UD 1FBIH 1VEMA 2X42A 4I0KA 3SDAA 1A47A 1G9ML 3A67H 3HAEB 3RWHA 1QBMH 2BRQA 4OLEA 4P2RE 2CDFA 3RIFK 4L9LC 1CDUA 5DURB 3DARA 3I75B 5T33L 2ADJA 5TDOB 3VFTA 4FFWC 1EZVX 1WZ1H 1Q9LB 3FO9B 3FQXA 4L8CA 4WV1B 1NAMH 1JBJA 4PJBA 1YY8B 3BP4B 4EBQL 1E4XI 2ED9A 4N0CC 2XPGB 1T21B 3HHRB 4F7EA 3O6FB 4KKBC 2W59A 4HKBB 4JQIH 4X6FA 1FNLA 2PXYB 3O3UN 1MUJA 4Q9QH 4M9PA 4K7PX 4LCWA 1EGJL 4NUJA 3TJEL 1YEGL 5F72S 3T1FA 3MRLA 5HD8C 1T03H 3IVKA 5FM5O 1ZGLP 4BUHA 2EEDA 4N8CL 1HH6A 4KZDL 2C1OA 2NX5E 2Q7YA 3MLPA 3N1FC 1UB6B 1EEZB 2AJSL 1CGUA 1T1YA 3OAZK 4JFFB 1T1ZA 1YEHH 3BW9A 1QEWB 1NFDB 4Y19D 3T08A 3LKNB 4LDOB 5DEZA 1VADB 4NP4L 1ORSA 4X0KA 4U31A 4X7FC 1S7SB 2D7OA 3VFTB 1A5FL 1K8DB 1Y0LA 4NNPL 2NY1B 5JW4Q 1GGTA 5JUEL 3FQWB 5DHYB 5JDSB 1MJJB 3JWDL 5LBSL 2CIKA 1FVEA 5E6IA 2NY5L 1MLCA 3HAEA 1MCSA 3ILPA 4ONGH 2DLFH 5FDYA 1VKXB 4ONFL 4G9FB 1A8JH 2QHRL 5D96C 1TVHA 4OV6F 5D7LE 3AU1B 4HZLA 3P11H 32C2A 5FCUH 4M4RA 4XHJD 5GGTA 2NNAA 2ITDA 3DMMD 3GHEH 4FXGB 3SQOL 5H37G 3EOBA 1WAAE 3SN6N 1G0XA 3TBSB 4GRLC 1C8PA 1XIWD 1IL1A 1DEDA 1YUHA 1E6JL 5EC2A 3VMOA 1JWUB 1QZ1A 4HG4K 3SJVB 3VWKC 4PS4H 1UXSA 3D3VD 2KKQA 1KPUB 1I3RA 1QFHA 5CUSH 3L6FB 1HKLL 4R26L 5DI8A 1R3HB 1JIBA 3D18B 2J6EL 3NH7H 2VYRE 3R1GH 1R3LB 4RWHA 4TYUA 4ONOA 3P0YL 1HWGB 2BK8A 4LVNC 1KV3A 4MAUL 5C0JB 2FGWL 4N90D 1NCBH 4HHAB 3MLUH 1I1AB 3D6GA 4YZFE 3RVTD 3D9AH 1EHXA 2HKHH 2ERJC 3QHFH 5KANI 2QQNL 4DVBB 4FXKB 3MUJA 3HI6L 2GCYA 3L5WB 4JFHE 3QZWB 5MENA 5IG7B 1CXHA 1Z5LB 2AJZA 5E8EA 3TBYA 5FB8A 2X4SA 3BPNB 3LKSA 2MOVA 4O2EA 2R39A 4OSUH 2EZ0C 1U8KB 5IBTH 4O5LH 3RWGB 1RUMH 4ZTOL 1I7ZA 4TUJA 1N3NB 3RX5A 2HMIC 5C0AA 4ZXBD 2B4CL 1I4FA 4D0DB 3FRUB 1A6WH 2CR3A 4OLWL 1AKJB 1QPPA 5KSBB 2VITA 3VFGL 2NY0D 4X9GA 1HN1A 5TE4H 1DP0A 1KEGH 4ODTL 1BQHA 2IALA 3OKLB 3O2DH 1IGTA 2X4PB 2NY1D 3P9LB 4HZAA 1S78C 2C3GA 2WSKA 1KCSH 1AO7A 5DJYB 4G5ZL 4Y2DD 5DFVC 1FYTB 1OY3B 4M8QB 5JXEA 5KSAB 5E8PB 1FZJB 4PGBB 3LIZL 1G0DA 1MCRA 3JV5A 4HGMA 4UB0L 4ORZC 3C8KB 1ES0A 2P5WE 1NEZB 1KN4L 4CW1B 3MX0A 5IGXH 4E5XA 4OCWL 1B0GA 4Y5VA 4XAWH 3QQ9C 4KK9C 4Y2DC 1ZHLA 4TNWF 3HZVB 1DSFH 1T5WB 1HQ4B 1CGYA 1S3KL 25C8L 3O4LE 1A6ZB 4HWZA 4NNYA 3QDGD 4G7VH 3CVHH 2YSSB 3BQUC 4N1EA 1IGJB 1KEMH 4S1RL 3BKYL 5ELIA 3O6FD 5HHOA 1BD2D 1VSCA 5DJAB 3WN5C 1KIRA 1KYOJ 4KKCC 1FL6A 4X80L 3DI3B 2YA2A 4I3RH 4XCYA 3ZKND 2AK1H 3EDFA 2FZ3A 3W9EA 4Y5XB 3GI9L 3OR7B 1EGJA 2FIKB 2VDML 3TZVD 3WCYA 6FABL 2F19H 5F71A 1KFAH 5HGBA 1X7QB 4Z7WA 3PF2A 1FVDB 1QYGL 4YXHH 2WUCL 5IT2H 4FA8A 1U0QA 1ND0B 5GS0C 4ZUTB 3P9LA 2BNRD 4YBLC 4XPHL 5DK0A 5J06A 4LU5L 4PRHE 3EO9L 5ACZB 1I7UA 3IKCA 4FN0A 1NGWA 2ZUWA 1OAKL 2V7NB 3DLQR 1J0YA 3SKMB 1YDPB 3WJJC 1FH5H 3QFDA 4OLZL 1HYSD 3WXVL 3BGMA 3LH2L 1OHQA 4P2QD 4UV7H 1GZQB 2EYSA 3MUZ1 5FECB 1B6DA 2EXWC 2R1XB 2VDNH 5ILTL 2NX5D 5IEHB 5FYJL 1D6VL 4TPRL 5CZKA 3DETC 5B8CC 1TVBB 2IBZX 1IGJA 4WCYL 2V7HA 2XKSA 4FQXC 4M6ML 4D0BA 4HUMB 3W39B 2AEQH 4HAGA 2YSSA 5I0ZA 1KUMA 2B1HH 4LRNL 5FHAL 3RHWK 5JXAL 5EU4A 1SEQL 1OP3K 1X5IA 3RWHB 4UIKL 3BQUA 1FCGA 1WISA 4ELME 4XAWL 3PHSA 5F7LB 3SDAB 3O3AA 3ARWA 4ONFH 4WTZG 1NKOA 1JPTL 1I3UA 1KELH 1I9JL 2IQ9L 4OZ4A 4Y4KB 4HJ0C 2AJSH 5TF1L 2BSRA 5SX4H 3F12B 4ODVL 4NNXA 2D7QA 3RWGA 4LPVA 5DJDA 2AJYL 2G60H 3BPLC 4LPYA 1DBJH 1WC7A 3DRQA 4X9BA 2W0FB 3G6JB 4MQXC 3IU3A 4C4KT 4Z8FL 3KG5A 2OQJB 4TSBL 3W0WA 1IM3B 2Q3AA 4R0LA 4WI3A 3TH4T 5JOEA 2GT9B 2EICA 2FEEL 4QOKE 5T3XD 1G9MH 4P46B 4JQIL 4ELKB 3HMWL 4CNIB 1GGCL 3NGBB 1SEBA 3QCTH 4MVBC 2N4IA 3EJZD 1SVZA 4NQVB 1NLBH 5TDNA 5J12B 3OKEA 1MPAH 1QFWL 3QFJA 1MCLA 2CKBL 3GKWH 3KJ4C 4WU5B 5D1XB 2CMRH 2X89D 5IQ7H 3GSNL 3F8UB 2DYPA 1X5JA 2A6DB 3DRTB 3DX7B 5ISZA 5I1CH 4NN5B 1IKFH 1A7OL 4NZRH 2CR6A 3MJ8B 3QZWG 2E9JA 1YEFH 1HXYA 2GT9A 5JA8B 4YNYB 1QQDA 5T1KD 3S3JA 3ZMRA 4Q6IC 1IL1B 5JZ7D 2GSIB 3SGDH 5D2NE 2F8VA 2PYFA 4X5XB 3PIQA 5I6XB 3NCJH 2AABL 4ODVH 4BZ1L 2NNAB 3FRPG 4YXLH 1TQCC 3KXFE 5FUCE 3GDBA 3MRMB 4MNQE 3QFJB 2D31B 3TIEA 4DN4H 2ITCA 4PRIE 3REVB 1XGPA 5EIIB 2IFFH 4NC2B 5EOTB 2EIDA 2FHFA 1F4WL 1VFBA 3EJZC 2V9TA 4JFQA 2NQCA 3O4OC 5CSGA 4NKMB 3FO1A 4IHOA 3PDGA 5CINL 4NC0B 3MO1B 3DO3A 3DVNA 3QQ4B 1BOGA 2VLLA 3L3IB 4JZNA 1GAFL 5L0QC 2DYPB 3NZHL 4LF3A 3MNZA 4JCMA 4P2OA 4X99B 3L7EA 5DK2A 4XMLL 3BAEH 4GUPA 5FF6B 5FHBH 3OWEA 4P5MB 5C0DB 3WN5B 4L8CB 1KJ2H 2FL5B 4YUEL 4G3YL 4HQQH 1ZGLA 4OCYL 2YN5A 1ONQB 1GYAA 4G43B 1YDPA 3KLSA 4KU1A 4TVPH 1QR1A 2E6QA 4X4MA 3JXAA 4JKWA 5D96B 3O4LD 5H2BA 4PUBH 5AEAA 4PGCA 3MRDA 1NCTA 4M3JA 4PJGB 2LU3A 1YPZF 3T0EC 2JK5A 3ULSA 4Z95L 2O93L 1NFDA 1EJOH 4HH9B 3K2MC 5KSVB 2IBGA 4QY8B 5FB8B 3BH8B 2WW8A 4DWHA 2R2CA 4OM1L 3LZFL 4G8EA 2I27N 3DECA 2ZCHH 3HI1A 1A02N 4E9LA 1IGMH 3EYUL 1P7KB 4HG4J 3V6FA 5FGBA 2E5EA 4EEEA 4OFYD 1X5ZA 1NCAL 3B43A 1BD2A 3ARUA 4HJJH 4U1KB 5A40E 2Z31D 4CVUA 1F8TH 3CFDA 3MNVA 3QXAB 3U7WH 4HDIA 1RU9H 2XTJB 2W38A 1BFOB 2YBRB 1OWWA 1B4JH 4LRIA 1BM3H 3U6RB 3UTSA 5DGQA 3UDWC 4GAJH 4WUUA 5D7IB 2AJUH 1V3LA 5MHSE 4U1JB 2KQNA 3DURB 3VD9A 3M45A 1BGXL 2FJHA 3V5DA 2W92A 1W72A 1OTSD 4XVTL 5CD5C 4HWBA 4GRLD 2CIIA 4LDEB 2DQGH 2VMFA 1OT1A 1J10A 2YWZA 1I1AC 4JFEA 4NNYB 3VH8A 5A2FA 2AEWA 4OCRH 4LNRA 4WIQA 4F8QA 1U91B 3I02B 3N9GL 4U49A 2AV7B 4FP8L 4ODUB 1KIQA 5C0RL 1A6PA 4M7LT 3QEQA 4CVZA 5IMLA 3WEXB 3CVIL 5GGRB 4XRCB 3O45A 2Z8WC 3BKMH 3A6OA 1ZLUH 3ARQA 5EA0H 4KK6D 1UWEH 1RZFL 4PRHA 1N5AA 5D6DA 1CD8A 3LB6D 4QHLA 4UDTB 5L7XH 4YK4B 5KN5B 4GSDL 1H0DB 3EDDA 2XFXB 3FN3A 3QNZB 3QQ9D 4U6VL 1HDMA 1I8MB 1VPOH 4M1GH 3EW3B 1DQQA 1JFQL 3HLAB 1DFBL 2B1AL 3Q5OA 2MMXA 1OP3H 3RL2B 1K85A 2WUCH 3SGEH 4I3SL 4XXDB 4NDMA 4MAYD 1JNLL 1BD2E 1L4IA 2WINA 3LOWA 1MIMH 1CFQA 4D94A 2B2XH 2EIBA 5E4IA 1KNOB 4ZSOB 2AK1L 2VAAA 3OAYK 1FH5L 4WV1C 3STLA 1JMZA 1RZGB 2XTJD 4JY6A 3HB3D 5C0IA 35C8H 2X4OA 4Z9KB 2ARJB 1SJHA 1JZ6A 2EE6A 1T20A 4XP4H 4PJFB 3QFJE 2YEZA 3VFMB 5EULV 1J18A 1V3KA 2QADC 3G5YB 3L9RA 2VZVA 4M4PA 3S5LB 3BN9D 1TJHH 4Z7OE 1I8IB 1VGKB 4G7VL 1CG9A 4LEOA 2JCCF 3CU1A 4ENED 4KKAC 4WY7L 4G8FB 3D3VA 4PREA 1UEYA 1MCEA 4GMTL 4FFVD 4UUJA 5GRVK 1QRNA 2YRZA 2HT4D 4OIIL 3U79A 1Z0NA 5KOMC 5EU7E 4F7CA 5K33A 3CXDL 1MVUB 1QR1B 3PL6C 4WWKB 4WI9A 3TIDB 5KTEL 3WO4C 5F7FA 1RULH 2HRPH 3BUYB 2D3VA 4MD4A 4JM4L 4R3SB 5KSBF 4V1DA 4FFZL 4FQHA 1DQQB 3U7YL 5I1JH 4Y8DC 4L4TE 3PHOA 3QCVL 4P23C 3B5HA 4N0YH 2LU4A 4Y0GA 3TBTB 5EOQH 1ZWIA 5I2IB 2MFNA 1E4XL 4YPJA 4BQ9A 3SE8L 2EC9U 2BFVL 1F45A 3RWJA 4NBXB 4ZFZB 1IM9D 4NO3B 4ORGB 4JR9L 3TCXA 3HZYA 5ACLA 1U92A 5BZDB 4FZEH 4JHAH 4PTUB 4HK0B 2NY3B 3QHTC 3AS0A 4NT6B 4P4RA 4XCYB 5MP6L 4OTXH 4DGYH 3MGTA 3O6KH 2IFGA 4MXWL 1EMTL 2B4CH 3FCTB 4WEMB 4YWGH 5GRUL 4Y4HC 5CD3A 1TTUA 2OL3H 2UZIL 3D18A 1Y18B 2GQHA 4NO0A 1RUML 3NA9L 3HUJA 1SEQH 2B8OT 2D31A 5IOPA 4W70A 5FV1L 3OJDB 3NFPB 2R69L 4JZJB 4N8PA 2R2HB 3KXFA 3V8CA 4NSKB 4X8JA 4ODTH 5E2UL 1M71A 1EBPA 1KLUA 5DJXA 3LQZB 3DURA 1D6VH 3DBXA 5HVFB 5EDXA 3CXHJ 4LLMB 4WVRA 3QHZH 5IWLC 3I3BA 5HYJE 3WHXA 3GZKA 5ICZB 3BGMB 1Q0YL 2WBJC 2NLJB 4WUKL 3SY0B 3IRZA 4C55A 4MVBD 3NTCL 5EBWA 2H2PC 1U6AL 4MQ7A 1RZKH 4F2MA 1TIUA 3TM6A 5FA3A 2FX9L 2GIYA 4EQ2A 3TBWB 5L2KD 2IALB 5HDOA 1IEBB 1RULL 4PRAB 1MI5D 3V5DB 4WWID 4LASH 4JO3H 2GUOB 4N0UA 5KSBA 1XGYL 4UBDD 5MEOB 3LKOB 3KLHC 3FRUA 1QFUL 3BZFA 3PDOA 4OQTH 4QNPF 2CXGA 3O41A 3PE9A 4HXAL 2AEPL 4I77H 5SWSA 4HWNA 3UBXB 4TUOB 2BP3A 2WQ8A 2XQBL 5DVKA 4M1CC 4PJ9B 5E9DD 2BY2A 4NN6C 5EO0A 3ULVC 5MEQA 2BSRB 4AEHL 1MQKH 5C7XL 4G8GD 4WNQA 5HYJD 3VW3H 3SCMB 4OD1H 3DIFA 5ESAB 2YPLB 5HGHA 4HIHA 3FFCB 3KPPB 4YK4C 1WT5A 4U1LA 3O3DB 4BSVB 1HI6A 4KZEH 3MOAL 1A14H 1MRCH 1ONQA 2Z91A 4NNPH 2B20A 3NCYP 4E5XB 2H2SC 5AWNH 2GK2A 3NN8B 4IRJC 1HSBA 3ECBB 3GNMH 3VMPA 3UJTH 4D0CA 5HI5C 1NEZA 5AYQA 5TGBA 3L5JA 1XF2B 1TZIA 3KNBB 4OM0H 1AGDA 1R3LA 1YY8A 2VTFA 2HTLC 4Z5RB 1WTGT 1CE1L 3DX8B 1N4XL 5FYLD 3ULSB 2MPAL 3P30L 2E7MA 1KIPA 5JTWA 5IIEB 4DK3A 1QBBA 1T2JA 1N26A 3CCHB 1QACA 1ZLWH 5DS8A 4XPTL 2NW2A 4WDIB 4LARH 4ZFGH 1CXLA 2AQ1A 1FIEA 4QXGL 5L7XL 5D7KE 4R8WH 4Y1AB 2OL3B 5T1KA 1UWEL 2IH3A 2R56L 1IARB 1U3HD 4GXVL 1D9KD 2ZCLH 3MV7B 3RBSA 5HHVL 3SKMA 5EIIA 4M6AA 3SGDI 3TT3L 1O7VA 5J89A 3F7YB 1OTTC 2ZOKB 1XF1A 1I4FB 2HVKA 5E2TH 3TIEB 3S88L 1U3ZA 3V4VH 4AG4H 1M7DA 5C0NC 4K23H 1U8KA 4NKDB 4JLRA 1JZ7A 3DXAD 5EPMB 5ICXB 2XOTA 4JRYA 4O2FB 4KI5E 5T1LA 4YHML 2GSIA 4Y2OA 5IESH 5IB1B 4N0RA 3ULUF 5I1LB 3CXDH 5F88A 1FDLL 5I17A 1PVHA 4K9EH 1OT2A 3NVQA 4D3CH 2Z8VC 3QCUL 1NUNB 1K8DA 5TPWH 5DMGC 1HXMA 5J1TC 4AM0B 5ISZE 1II4E 1UCBH 4PGZA 1ZHNA 5SX5K 1OAQH 1EK3A 2NY5C 3K3QA 4F58H 2QQLH 4HMDA 3QAZC 1XGPB 2R2HA 1MCKA 4JREC 1P4BH 4NZUL 4APQC 3MBED 5ICYA 3OJDA 1WGOA 3OSKA 1U8JB 3BMWA 1OLLA 1WVZA 4BSWB 4X6BB 1MCCA 3C2AL 4KJQD 2AVGA 1J7VR 1GGUA 1RHFA 4LLUA 1W0VA 1AD0B 3U36B 1XCTA 2FX7H 5INDA 1CTNA 1WWWX 5DQ9B 1WFNA 3CVIH 3IU3B 4G6FB 4HT1H 4UT9L 4Z7UA 3V6ZB 2MHAB 4QOKD 5T3XE 4P2RA 5ICXA 4KUZL 3QDGB 2ZSVA 3ZTJH 5E70A 3BKJL 1IGCL 3SJVE 1NBZA 3HTLX 2DWDA 2DIJA 2X2YA 5F93C 2P47B 1S7TA 2CD0A 4R96B 1NANI 1JWMB 4ELMB 5LGHL 1JNNH 1S9XB 3D39E 3HRZB 2DQJL 4WW2B 1OB1A 3UTTE 5I73B 4JFXA 4YFLI 3OJVC 4NQTA 4S1QL 1A7PH 1BFSA 2VXQL 3WE6B 2Q8AL 4NQDD 2FATL 3IF1B 4P2OC 2PO6C 4EI5C 2VSCA 4PREB 2J4WH 4DJMA 1Y6MR 2C3WA 4KJPD 4R2GD 4BQ6A 1J0IA 3IETA 4KHTH 3K4AA 1MCNA 2IQAB 1AR2A 1TQCB 2EDOA 3LKQB 2RCSL 4HD9A 1Z5LA