2FLRT

Novel 5-azaindole factor viia inhibitors
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
200
structure length
151
Chain Sequence
TVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGDERTLVRRNNTFLSLRDVFGKDLIYTLYYSVQAVIPSRTVNRKSTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel 5-azaindole factor VIIa inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/blood clotting
molecule keywords Coagulation factor VII
total genus 32
structure length 151
sequence length 200
ec nomenclature
pdb deposition date 2006-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2flrT00
4NUGH 4CVZA 4HXBL 4FRWA 3FT4B 3DGCR 5F6IB 1K5NA 2AI0H 3QDJB 1Q9LA 3DIFB 2J8UB 3QPQD 5HVHC 4NQXA 4QWWD 2IF7A 5DGRA 1S7VB 3P2TA 4OZ4B 5ACMA 4K7FA 4OQTL 3RTQA 3NA4A 2Z91B 2G75A 1P2CB 5F9OH 1EZVY 4BKLB 5KS9B 2R4RH 3ULVH 1T66C 2NY4D 4LSSH 2GJ6E 3PL6A 1WT5C 3QWRA 4U1MB 4Z9KB 4YPGB 3K1KC 4O4YL 4XNQB 3N06B 1EGJH 3LQAC 3IKCB 4I0PA 4OIIL 1ZHLA 4PJFE 3L3IB 5TQ2L 4NFCA 4DN4H 4JHWH 2Y07L 3EGSB 5JW3H 3JV6A 4GUPA 5DLMH 3BPOC 4JFDB 5A1AA 4LBEA 4X7DC 3T1FB 3PL6D 3OB0K 4N8VG 3ZMRA 1FL6A 3SDCB 4GO6B 1LO2L 2Z8VC 1BF2A 5DI8A 4XNYL 1N6UA 4ZXBD 3FO1B 1CGVA 2EEAA 2UWEF 4Z7WE 1INDH 2V5SA 1DBKL 3U6RB 3MRKA 1PG7X 3RFZC 5CINH 4F80A 4K23H 2NXYD 1CGSL 2VITB 3CZFA 1CD9B 4YDLC 1MVUB 3HE7C 3S97C 1T5XB 2EEBA 4IOIA 4LCWE 3RVVD 1CI5A 5DEGB 4KK6C 2AK1L 3GK8L 2XFXA 2JJTC 3TH4T 2VDPL 1XR8A 1L0QA 4RAHA 3U36A 1FZJB 5TQ0L 2WBKA 3S4SA 4YBLB 5FYKL 3LMJH 4Y4KD 4OD2B 5LVEA 2VO5A 4WI2A 1WICA 3LQAH 5FHBH 3FL7A 1EPFA 3ZDZF 4HKXB 4UT7L 3GB7A 4ZFOA 1MEXH 1QHPA 2XXMB 1RZGA 2YSSA 3UZVB 5AG8A 2VB5A 4JG0H 4YQXH 3BVNA 5BXFB 3WJJA 4JAMA 3PIQA 5IFAH 1U8JB 2JB5H 1MRFH 1A9BB 4CADB 2DRUA 2EZ0D 3GBML 5EO1B 5H37H 3M17A 3MRBB 2A73B 4IRSC 3HG1E 2V9QA 1LEKB 1QP1A 2BNQE 4BK5A 5JW4N 3D3VB 4UOW1 5EZOH 3VXOB 4HBCH 3BD3A 4ISVA 1EERB 4MA8L 4LHUD 1NGXB 1RZKC 4L5FH 5IBTL 5E4EC 5KN5B 3ARFA 1OQOA 5ITFB 5CBEB 4Z7NE 2AJYL 2ZG1A 1KCRL 2IANB 2R2BB 3JWDC 5DJDA 3X14A 4MD0A 5J4MA 4HX1B 2R1WA 1AKJD 1KCSH 5KSBA 1QFWH 4JFOB 5E2UL 1ETZA 3O6FA 3IETA 1NKOA 5DMJB 4YUEL 4TN9A 1YEKH 2XNAB 3GMOB 5JNYA 3OR7B 3AB0C 5BJTA 4JFHD 2QSCL 3MRFB 4RBPH 4WFGD 2ZOKA 4LARL 5J6HB 3R06A 3AREA 5E99H 3TWCL 3TBWB 3D85D 3DECA 4HWBA 1KV3A 3KXFB 3W9EA 4DUVA 1BM3H 5BO1H 4NM8L 3BPNB 1INQB 3AM8A 3QJFB 4WI3A 1J5OH 3C8HA 3S3SA 4YDKH 3IB4A 1DEEB 1RFDH 2DQDH 1QFUL 2PO6A 1JNJA 4HXAL 3QQ9C 5DMGD 4HUVB 1WWAX 2HG5B 4TTGA 4GRWE 1I85C 2NX5A 4NDMB 5GS1B 1U2HA 3UTTE 1ED3A 3RTQC 3PWPA 1NANI 4JY5L 4KROD 3U7YL 1N59B 4NM4H 3KS0H 1MFNA 3RWGA 4YNYA 3E0GA 1ZT1A 5DMYA 2HYMA 2I07B 3ZTNH 1OSZB 4OCXH 5J1AA 2ADJA 1X6NA 5D7JB 2HH0H 4N0FB 2OI9C 1WZLA 2FD6L 4POYA 5J13C 4I0PC 2EYSB 2W0LA 4K9EC 2BERA 2XA8L 5D1ZD 1Q9KA 5ABDE 1EIBA 4HWZB 4OFPA 1FV1B 3RGHA 2EDOA 1CFBA 1IGIL 4YAQB 5AAWA 5IW6B 4J4PD 5B38B 4NT6A 3U2SA 1L7IH 4OSUL 5L7XH 1U3JA 2NXZB 4F37K 3GMQA 4U1NA 1VADA 4QHKI 4WI8A 3L5XH 3FN0H 3CCHB 4JZOB 3IFNH 1P84K 1MCWM 4GW1A 4HH8A 3QXWA 4EBQL 5E4IA 2VTFA 4YR6A 1KJMB 3Q1SH 3TZVA 3ZO0A 1EXUB 2VR5A 4U6VL 2BMKA 1EA9C 1PG7H 5IQ9A 4G8FB 5T5FH 4KKLD 4NQEA 3VGGA 1CICD 4AG4H 1HHJB 3HE7A 1IKFL 4BZ1H 5L9DH 3KVQA 3PWUB 4PJ7F 1MCFA 2EYTA 1L0XA 3SDAA 1R5VA 2JJTA 2VR9A 4EDXA 4F8QA 3ZDZE 5MERB 1AE6L 2P8LB 3QUMA 3U1SH 1Q9KB 4NCC2 1LO0H 3K80A 3TPUB 4NQSB 1QRND 1XGRA 2DQEL 3KJ6H 2VKWA 5LJYH 5C0BE 4Z8FH 3H9ZA 4OCRL 3U46B 4XVJL 1IM9B 5IUSA 1KYOK 2C26A 4RMWA 4PJGA 3RU8H 3RWGB 3ULUF 2XRAL 1YMME 5AUMB 3WV0A 4MX7B 1Z0NA 2J2ZA 4HW6A 1HHGA 3RWEB 1AHWC 1T1ZA 2EC9U 5DEGA 1P1ZA 1Q0YH 3I02A 4DAGL 1AC6A 2R1XA 1TJIL 5C2BL 5LGJA 2DQGL 4TUKH 5JHDA 5L8LB 4EI5A 1XZ0B 4J7RA 4QHKJ 1RD6A 2OK0L 1TPXB 1UM6L 4R90L 4X0KA 3VMNA 3CVHH 2A6JA 1FIGL 3HPJB 4MQ7A 3RAJH 5GIRB 1MRDH 3EDKA 1SJVA 2WMPA 3CK0H 4QRPE 5F7MC 1ZGLM 4HIHA 3MRRA 4MLSA 4MB4A 2NZIA 3LKPB 4ODTH 1FNSH 1HOCB 5IBUB 3TN0B 3KAAA 4U0RC 3DX8A 2CK2A 3H9YA 1DZBA 4D9RD 3V6OC 1JZ2A 5DVNA 4HWEH 1NDMA 3RHWF 3QDGA 3V6FA 1G0XA 2IANA 5IJKC 1OHQA 3DBXA 5F88B 5KTEH 4HJJH 1MWAL 4RWYH 1KCRH 5J0BA 4YDKL 4LLQB 1XF2A 4KTEH 1IFHL 4BFEA 3OKKA 3P77A 5DYOA 1U8OB 2NZ9C 3D3VA 2WBWB 3NFNB 1F6AA 1XF3A 3HC0A 4NRYA 3V7MA 1CLCA 4D8PB 1FNEA 4LCIL 5F1OB 2Z35A 3AM8C 3TNNB 2P1YA 3L5WB 2XG5A 5D9SB 4QNPE 3SCMA 3VXQA 1AY1L 1JYWA 3G6JA 5HVHB 2Q86B 5D1QB 3C9NA 4IDJL 2GSGB 5GGTH 5BQ7B 4IS6A 4NZTL 1ES0B 2APTA 1AGEA 2X89A 5E8DL 2QQNH 2HLFC 1BJ1H 4N8PA 4R0LA 3VG9C 4BFIA 5FUOH 2FEDD 4QXUL 5A2LH 5C08A 2VIRB 5I1AB 4OF7A 3B2VL 1T66D 2NY4C 3BW9B 3TBTB 3VGFA 4LLYA 3CDFA 5DJ2B 3WLBB 4CN1A 2Y5TA 4ZFFA 2X1XR 1JWSB 4N0YH 1F3JB 3DO7A 2IPTH 3P11L 3QQ3A 5CMAB 2XFXB 3D0LA 1MNUH 2VRAA 4LGPB 4D9QD 2MQ0A 3T77B 4M6NH 2PN5A 2A0LC 3QWOA 3MOQA 5MEQA 3UTSD 4EN3C 4ZUUB 4WWKC 4DGVH 3WFCH 4C57C 5CD3B 2O5ZL 4XPGL 4BQ9A 1CDJA 4N90D 3R0MA 4PRBA 1QTYT 5HYJA 2B4CC 4HS6A 4X83A 1VDGA 2VAAB 4GMSL 3PV6A 5D7KE 3AS2A 5FA3B 2VXVL 2WQ8A 2XWBA 3MBXH 4DGYL 3B9EA 1AR1C 3ROOB 1QG3A 3V7AE 1ZTXH 3X3GH 4JJ5A 3DVGB 4P57B 4Z0XA 1CDUA 3BD5A 3MLSL 1KSRA 5TE4L 5IVXF 4XC1H 2A6IB 4ETYA 2Y7QA 4P23C 3MCKA 3L3IA 2EIEA 4LSQL 5IBLC 3OXRA 5B38G 1FNHA 3MXVL 5FB8A 5DJ0B 5CIPH 2QR0A 5CZXD 4NQVB 3VFUA 5AD0B 1CXKA 1NC2B 1X5FA 1ZLVK 4K8RL 2VE6A 2FX9L 4UBDD 5K9KB 1GSMA 1JPSL 1QD0A 5DFVD 1DJSA 3EO9H 4G80B 3T0VA 4DVRH 1LP9B 1DLHB 5IV2B 5E2VH 2FEEL 4ODWB 2HN7A 5JXEA 1O5DT 2BK8A 3BHBB 5F21B 3QUMH 4EI5C 3BEVA 2R2EB 3OHXA 4KXZI 4X4ME 2RHEA 2Q7YB 4WI9A 1FZMA 1YEEL 2A9NH 4PJAE 2CRIA 1H8OA 3QG6B 5MEPB 3RWHB 1UB6A 1NLDL 1U8LA 1QUNA 2VN4A 2KQNA 4F15B 4OZIF 3BUYB 4RFNB 4LRIC 4MX7A 1DL7L 1OGTB 2IQAA 4WHTB 1E27B 4LRNL 4YO0A 1QBLH 2ZUWA 2H6PB 4G9FA 5ACZA 4JG1L 1P4LA 3WNOA 3SBWA 2W92A 3ARBC 4S2SA 4RQQA 1TZIB 3GNMH 4DJMA 2F15A 4JFZL 4CVWA 3CZJA 2P24B 1DN0A 3O6KH 4U7SA 3BIKB 1X5AA 4NJ9L 5CP7B 3HC4L 4QRRD 4K9EL 1YMHA 4XGZB 1QSEE 1OARH 4JPIB 3UEZA 4GAGH 3FT2A 2R4SH 1I4FA 3VXNA 5FGBA 2I9TB 2MJWA 5MEOB 1IC1A 4M6OL 3PP4H 3DTXB 3DXAB 1EDQA 4ONHA 5C0IA 3LD8C 2LTQC 4Y19A 2RFXA 1QSFE 1ADQH 2EXYC 2EIDA 2HFGH 1BFTA 4MNQA 3O6MH 3WFBL 4PBVC 2F53B 3SCMC 4PJ7A 4U6TA 4LLUB 5LBSL 1AO7E 3SHSA 1EHLL 1I9EA 1U8OA 3GHEH 5I18L 1ONQB 1PJ9A 2J6EH 3RTQD 4PP2A 3UTPD 2ZNXA 1KPUA 4X4ZA 3TO4A 1MVFA 4LOUD 2F8OA 4PJEE 2Y72A 3JVGC 1YNTA 3QDGB 3V6FB 1RUKH 4F7TA 4RA0C 3HS0B 4AYFA 3GIZH 1NLBH 1B4RA 4K3HA 4OKVB 4W81A 3PGDA 3CIQA 5F9JA 3VFVA 4N0FA 2NY1C 3VFMB 1IT9H 3KPSA 3E8UL 5I1IL 3ARQA 3CFJB 1FG2B 2GAZB 4M61A 5IMMB 1AD9A 4U4BA 4YNYB 1BM3L 1DBJL 1UA6L 4R7NB 3SDDC 3QO1A 3HMXL 5B8CB 1KB5L 3C2AH 1BVLA 4OBRA 3D2UA 1G7HA 1QFUH 3WS3A 3MUY1 5IF0A 3QB7C 2PW1A 2AQ1A 2XT1B 4UT9L 5IVZA 5JTWA 3MGOA 1T7YA 5I73C 2YUXA 4NQDE 2XKNA 3LIZL 1A14L 4JFYB 4NKMB 2ENYA 3VXNB 3U7YH 5KSBF 3BP4A 1B0GA 1WCBA 1S3KH 4ZAKD 2C3WA 4QY8A 4JM2F 1IC5L 4YHIB 1MH5A 3O2DH 1HEZB 1MQKH 1R3IH 4TVPD 3EOAB 3O3EA 3FMGL 3B9DA 1RZ7H 4JM4L 3G04B 5C0BB 1U58A 3PWVA 3JV4A 3W0WB 4DEPC 2RCSH 2VLRE 1EFQA 2ZNWA 1CXFA 4OSUH 5L7XL 3QIBA 1KG0A 3QUMB 5E5MB 3UBXA 1YEGL 2CR6A 4GKNA 4OZFB 2QJDA 1UZ6F 3NGBC 4PRHE 3BKJL 3N0PB 3GMRB 1TVDA 4PJIB 2Z92A 4N8CH 5T1LD 2FZ3B 3UYPA 1JP5A 3JXAA 3NCJH 2DYPB 1RUMH 4JLRB 2CDFA 1LO4L 1U2CA 2FATL 2FEEI 2QV2A 4P9ML 4QTHA 1NLDH 5BS0D 3MV01 5C07B 1A3QA 3HNVH 5TF1L 2XY1A 5K9KA 4M9OA 4E41E 3O3UN 2BOCA 5KJRL 1D7FA 2MMXA 4NHUA 1I9RL 5GRJH 1NFDB 5ESVB 4UBDC 1N0XL 3N50A 4MVBC 1EMTL 4ODUA 4Y5VA 5EC2B 1GGBL 5B38A 1LEGA 3M45A 4LVNC 4LRIA 4GLRI 3WJLC 3HS0A 3S35L 3VXSD 1TTGA 1XIWA 4G3YL 4HKXA 3ZDXE 5JDSB 4X6DB 4MXQD 3SPVB 3CLEL 2QQLL 2OTWA 1A5FH 4KUZL 5GGRY 3GSQA 4DWHA 4EQ3A 4AEFA 1C1EL 4I0CC 1FZJA 5E8PA 5E70A 3LKNB 1XR8B 4HGMA 2YRLA 1F90H 4X98A 1ADQL 3P73B 4DAGH 3JWNC 4F3FA 1G7PB 4D0CA 1XGYH 4OF0A 2R0ZL 3FQTB 4LIQL 4ZOBA 2GJJA 5I1EL 3F7QA 4K7PH 1JE6A 3ORJA 3VXTA 5F1NB 1YYLL 2NTFB 1FYHB 3K46A 4NIKB 4JGUA 4BYHA 1S7UB 2JKXA 3BT2L 1E4XI 5MEOA 1PQZB 5I76B 1I4FB 2A74A 3BISA 3LRSA 3FAXA 4DOHB 2GW5A 4P4RA 1YJDC 2CO6B 2W9DL 4I3RL 3O45A 4OCMC 2EDEA 5K9OA 3FQNA 4TVPE 1DN0B 3KLAA 2JJSA 3BGFB 4LLVA 4HH9A 4XB8A 1UZ6E 4G8EB 4HHAA 4M9PA 4RIRB 1TZIA 4JGJA 4JN2A 2J5LB 5IB3B 1Q9WA 2EXYD 2VDNL 3JVGA 3LHPL 1MAKA 5DD1H 4X99B 4HV8A 3WS6C 4KK5C 3O6FB 5GRZA 1EHLH 3QEUA 5CFHA 1YUHA 5JOFB 5DWUH 5FF6B 1F11B 5DMIH 3SO3B 4LPCA 5MI0C 4WRLA 5EU5A 2YPKB 3UC0L 4F15C 3VXRE 3JUYA 4PG9B 4O58H 5FUZH 3AS3A 1NGXA 3HC3L 3X11B 2DQFA 2X09A 4EJ1C 3SDDA 1MJUH 5HGGS 3NACH 1VFBB 1WFUA 4S0SD 4JQIH 5GZNC 4G8GE 43C9B 1OQXA 1U6AL 1UYWH 5ISZB 3HZVA 3OKKB 3LKRA 1FVDA 3BI9X 3RY6C 1JZ3A 2BSRB 4NZTH 4NQVA 2OP4H 1PKQA 3V5HB 3I50L 1KCUL 1IBGL 5I16B 1CD1A 1VSCA 4KVNL 4L29B 2MOVA 1NANH 1NDMB 5HYQA 3GKZA 5F7FA 1KEGH 3VXUB 3GEWB 1OF2B 3S36H 1XF4B 4HV8B 3MOBL 3T0ED 4IOSD 2GK0B 1NH6A 3LDBC 3QIUB 4LKCA 1MOEA 4LAQL 2FWOA 4HDIB 1YN7A 2XV6B 1MCWW 2R1YA 5IFHL 4JY6B 4UZGA 1OAYL 2DAVA 3D69B 3CFEB 4DN3L 3V5KA 3QPXL 5AYQA 3FQNB 4BZ2L 3QIBC 2Z8WC 2DWEA 5SX5K 5DHVA 4EN3B 2QHRL 2OL3B 3VCLB 1I9IH 4RNRA 1HIML 3G6JE 5DQDH 1TDQA 1F4XL 3IFLH 4MNGB 5BZWB 2RCSL 4YDJA 3WUWB 4H1LG 2L4OA 1OLZA 2O5ZH 1C5CH 1NBZB 5D2LF 5HHXH 4XZUA 3DOSA 1EVUA 3QBTB 1VKXB 5CINL 5FIEA 3BJ91 2YA0A 3BAEH 4KDWA 2JIXD 2NTSP 3QEHB 4B50A 1MLCB 4S11A 4HJ0C 5DGQA 5TE7L 4N1CA 4UQ3A 3RWFA 2GK2A 5HHMB 4G3YH 5DRZB 5I6XC 2D0HA 5C6WH 1AHWB 3U46A 4QHUA 3GRWL 4J4PC 3WL9A 3OKMA 1XGRB 5D7KD 1J9CT 3BWAB 5HHNB 5D70L 4I2XE 2XZQL 4Y5VC 1HH6A 4X6DA 3SQOL 2J8OA 5C86A 4RISH 3LMJL 2XY2A 1XIWC 1I8LA 4YGAB 3W2DL 5DD0L 1A3LH 3QA3B 4M7LL 2Q6WB 3WJJC 3L7FA 2E8YA 5ECJE 4WUKH 2ERJB 4KRPC 4O00A 5I1EH 1W8OA 1OP5K 5ESVA 1WJ3A 3HE7B 2X1PA 4AJ0A 2P42B 2V2WA 1KLFA 4Y4KB 2I26N 4NHUB 3GSNA 4V1DB 3L5IA 1IEHA 3TZVB 1UGNA 3P9MB 4PRNB 1FRGL 3D0VB 1BECA 1T1YB 1QFWL 43C9A 2B2XL 3NPZB 1A7RL 1OW0C 2EDQA 4LNVA 5JIIA 3FFDB 3HAEH 1GGYA 1OTTD 3HAEB 2GT9A 4ENEC 3DETC 43CAB 1C1EH 1IL1B 3U9PH 5EDXA 1AXTL 4LLQA 1XF2B 2ICWJ 4OM0L 3UP1A 1R3HA 2NYYD 5BRZA 1SY6H 4HC1H 4X9GA 1DUYB 1JWUA 4WIQA 4YJZL 1F11A 1JYVA 4CUCA 3IDYC 1WBYB 1IRAY 4OZGB 4HIXH 1U3HB 4OGAC 3Q6FA 5TDNA 4Q9RL 4JM2B 3RNQB 4MJ6A 4FS0A 2JJSC 3DLQR 2IG2L 1UACL 4F7EA 2EIZB 2OXHA 3AREC 1QPXA 4K9EH 5AEAA 1AGCB 3EFDL 5EZLB 4PJBB 4M93B 3MRRB 1KXTB 5E6IA 5HHQB 5DA4A 2A1WL 3WS6A 1DFBH 4JRYA 4DKAA 5C1MB 1NSNL 1JHKH 1ZWIA 1MFCH 1BOGB 1VPOH 1YQVH 1M71A 5INDA 5BZDA 3E3QE 5FYLD 4PJXB 1H3GA 3BH9B 1JZ5A 3AGVA 3RGVD 5DD5L 3WSQL 4ZSOE 2P5WE 2ESVB 1CD8A 1MCIA 3OF6D 2EDJA 2OP4L 1INQA 3I85A 3JTTB 3QJFA 2I60H 3O6ML 4OLVH 3VDBA 4Z7QF 4HUXA 5FO7A 2AERT 5ILTH 2VH5H 2BNRE 3MCLH 1BVLB 3WKMH 4ELMF 3OAYK 3HI1A 4WW1A 2J6EL 3AREB 3DARA 4YHKL 5D1ZA 3LKNA 2WIIB 4PJGF 1ZANH 4U1GB 1DBBL 1RSFA 3CFJA 2HT2C 4XTRC 4FABH 4OLEA 4JFEE 1NUFA 3BWUC 3KNBA 4OD1H 1DBML 3PGDB 4PLKD 3C09C 2BNQB 1GOHA 1KB5B 1X5IA 5E1AA 4X8JB 3Q1SL 2X40A 4MD0B 3FTGA 3UYRH 3PWNB 3MLVH 2HTLD 5IM7B 4PRPD 2R15A 3H9SB 3DUUA 3MBEB 3I84A 2YD3A 4KMQA 3GMPB 4BZ1L 5FOBB 1NGYA 2W65A 1I7UA 4MWFA 1SHMA 3ARDC 1ONQA 1JF5A 3DVIA 1QO3A 2R4RL 2BOCB 4XBGA 1N6QL 4XPHH 5DJAA 1LO3H 4ODBD 1RK0B 4ELMA 4KK8C 4R4BB 1T80A 4L3CB 4XAWH 2R69L 4L4TE 3DYPA 4OCRH 4PLJC 1OAUL 3SDAC 4L8CB 3DHJA 4QOKD 1MI5E 1QR1B 3GRWH 5D8JL 5B39G 1HQRA 2CKBH 1EFXA 3U2SB 3C5JB 4L3EB 2NMSA 3O2DL 5DQDL 3T1WA 3EBAA 3VH8G 1LE5A 3GB7B 4ZFOB 4WUUA 2WWKT 4K3DH 3C8KA 2B20A 3LZFL 5EBGA 3GSUB 4U7KA 5B3NA 2ESVE 4PTTA 2AABL 1OWRM 4G9FD 2AQ2A 4JFDE 1AHWA 5CEZL 2PKDA 1I8MA 4PJ5D 4Y89A 2EDHA 4TUOA 3BP7A 4M7KL 1I8LC 2P43B 5IKCB 4YDLB 4OD3L 5F9WC 4X6BB 1CBVH 3QEHA 4XBPA 3RKPA 2D7MA 3O3DB 3RU8L 2ATKB 2YUVA 4FQLH 3EKCA 2XZQH 2YZ8A 1T7WA 3O9WD 5DRWB 5ENWA 2R2EA 1JMXA 4PGBA 3GM0A 1JF6A 1MF2L 1U91B 4G6FB 5JLZB 4K3EL 1A3LL 4KK8D 4M00A 5IV2A 4KI1A 1GCFA 4PRDA 4OV5A 12E8L 3FO1A 3NZHL 4AEIH 5L2JB 3EW3B 4R90H 5FYJU 5KTEL 3HZKA 3TCXA 1UJ3C 3MACH 3BZEA 5GS2D 4N5UA 1AGCA 3A6OA 3VFUB 5DXWA 3RY5A 5E8OA 4JQVC 4P23B 3V6OA 3ZLQC 5C0GA 3H6JA 4NNYA 3WFEH 4K3JH 1FP5A 5IJKA 4MJ6B 5J6GB 5IMOB 3PWPD 4OAWB 4OZGA 1MFCL 4RDQG 3GMMB 3NPSC 3QFDB 2V5MA 3ILQD 4ZNEE 1S9WB 1C5DA 1FLTX 4DCQA 1J0KA 3GBLA 1R3HB 2YN5A 3F7RA 1T20B 3V5DA 5KS9A 2YC1A 5EOTA 2NY6D 4MA8H 4YHOH 4G6JH 2AJXL 5CSZB 1WZ1L 1AGFA 4I77H 1W0WA 1Q9LB 3DIFA 3QISA 1H3PL 2RFXB 5H35A 3QXDB 2FR4B 5HGAA 3DTXA 4ONHB 2IPUG 1SM3H 3AY4C 4PV8B 2AJ3B 1E6OH 1VPOL 3E6HA 1T1WA 2OZ4H 4R0LC 5E95B 2I9TA 5KVGL 3MA9H 2AKRB 3HMXA 3CH1B 5KAQF 3FO0L 1F3JA 2F54D 1WK0A 3SJVB 1J8HB 2UUDK 1KJ3H 2BVTA 3NOIA 5GJSH 1FAIL 4GKZA 1T0PB 4PJ5E 2JELL 1EJ6A 4DGVL 2DKMA 1CK0H 4XP5H 4NNPL 3T3PE 1MJJB 4X7TA 4UIKL 2ZZUT 1ZANL 3HUJA 3BPLC 4NBZB 3VRLE 5DFTA 3CPLB 3MV7D 4IS6B 1AO7A 4KWUA 1A47A 4H25A 1B6UA 4KHXL 4WWKA 3MX0A 5D1QA 4JO4L 2IPTL 3E6HB 1II4E 3P11H 3T0WA 1EO5A 4DKFH 4Y1AB 3MO1B 1IAKA 1HILA 3QXDA 3BKCL 4M6NL 2A77H 1MHHA 4HFWA 5T1LA 4OV6F 4ZFGL 1FNEB 4P2QB 5D93C 1BQLL 4HUNB 2BXYA 1LP9A 4X98B 5ALCH 4AEHH 1NAML 4G8GD 1QPPA 3MA7A 3OR6A 1G7IB 3KYOB 5K9JL 2IGFH 2YK1L 3CFEA 3KPRB 5T33L 3WFZA 3LQZA 5LGHH 1JTOA 2EH8L 1UM4L 2OL3L 2R69H 3R8BB 4ZFOL 5FECA 2BY0A 2AW2A 4GW4A 3MCG1 1GXEA 4G8GA 3MCKB 4ZO9A 1UVQB 4I0PB 4ZXBA 1UWXH 1KB9J 2VKXA 2Z4QB 4FQLL 3NMEA 2CKBL 3ROOA 2AXFA 4I18C 4LOUC 3Q5YA 2F74B 4JKMA 2OR7A 2I5YH 2VAAA 1P2CA 4NZRH 2IH1A 5C6PB 4JANA 5JW5B 5C7XH 3DVNA 1YYML 5I1GL 1WQVT 4EXKA 5JXEC 1F4XH 2C7UB 1T1XB 1ZE3C 3FN3A 1BFVL 1U41A 3NCMA 1JNHB 3UDWC 3WHXA 1I3VA 5HHXL 4ZO7A 4M62H 4LPUA 2B8OT 5ESQA 1E6JH 2NR6D 3JWOH 4EKXA 4ZPVB 1OSPL 3TESA 4YQXL 4R97B 3KPQA 4N90E 32C2B 3MJ6A 5IFAL 4Z8FL 2QKIA 4X6BA 1NUGA 3CLFH 1MHEB 2PXYD 1UJ3A 1BQHB 2DF3A 3G04A 4X9BA 4X4YB 2YXFA 3FHAA 2MHAA 4JQVA 4OGAD 1GVIA 2VR4A 4WO4B 4Y1AE 2HRPL 3ZHLA 4NQSA 3ZDYF 2JK5B 2YA2A 5EN2B 3F7VA 4OF3A 3PWLB 4OQTA 2JIXB 1TJIH 5C2BH 1D9KD 3O45B 3BPCB 3WFBH 4HWBH 2R0KH 2YKLH 4KZDL 2DI8A 4G8IB 3V6ZA 4AY0A 1Z5LA 2ZOLA 2AKRA 5C0NC 3BDBA 1UM6H 1J11A 2GY7B 2E3VA 4XX1E 3BEWB 3THMH 4ZMAT 2NY2D 4AH2A 1CFTB 3MV8B 3UTTA 2CKNA 2VSCA 4K3JL 5F3HB 4APQD 4BH8B 4NQEB 5F1NA 3WXVH 3A6BL 4UB0L 1QLFA 2YRZA 1RY7B 4HAFA 4D0CB 3TO4D 5F89B 5FO9A 1HK6A 1EHAA 2HVJA 1IM3A 1YEJH 1PX4A 3OG6B 4YXKH 15C8H 1JGEA 3S35X 4LSTH 1EBAA 5I8OL 5MENE 4WO4D 1VEPA 1XGQA 1K4CA 3T2QA 3AY4A 5FM4A 3LRGA 4NUJA 2V2TA 3OKDB 3ARSA 5E03A 5DS8B 3EHBC 5CILL 4U2ZA 1Q94A 5LAXB 5F44A 4P3DA 3SCMD 1LP9E 3DBXB 3LCYA 3P4LA 1G9MC 5EUKA 4EEEA 4FFVD 3SDYH 4HPOH 3T2NL 4X7FC 2YN3A 3AU1A 3TYGH 4K7PY 4MAYD 3ARGA 1A7NL 4KHTL 4H5SB 5B3JE 4QRRE 3LKPA 4KFZC 5CHNB 2DM3A 1MUJA 1JHKL 2A6DA 2AAVA 2WIIA 4GAJL 4HIHB 3IS0X 3BDXA 4OLXL 5JPNB 1JUFB 1FJ1A 5EOQL 3A67H 5D7LD 1DEDA 3QHFH 4XNZB 4DFIA 5D1QC 4HUXB 5FO7B 3OB0H 3C6LB 5FKAA 4PREA 5I1DB 4NNPH 3ZT5A 4OLVL 3S5LB 4QT5B 4WW2A 3LH2H 5HGDB 1GGIL 4PJXA 1J12A 2FO4B 2P5WD 1GAFH 1FFNA 3MLWH 5L0QB 2ZSWA 4P5KB 5D72H 1KNOB 2OL3H 3STLA 3LKOB 2NXYB 2W9EH 3QIBB 4C56B 3OG4B 2Z8SA 1XEDA 1T2JA 1P9MA 4KMTH 3BKCH 3RZWA 1Q72L 1I8MB 1I75A 2EH7H 2NX5E 1IGTA 1CE1L 4ZDHA 4AG4L 4EIGB 4JFED 4KJWC 3UYRL 1EVTC 2F53E 3FQWA 3WIIL 5F96H 4PJ9B 3AFLA 3EJYD 2KZWA 3TIEB 3C5JA 4L3EA 4XPGH 1EFXB 5LGHL 1OGAA 4MQSB 5KN5A 4P2CG 3U0WL 1I7TA 4N0CC 2GT9B 3F8UB 3QAZC 3QULB 2X4OA 2WWKO 1AQDB 5D7SL 3P3YA 1KJMA 2V7HA 1A4JA 4NQDD 3VD7A 4RGNE 2BSTA 4P9MH 4WFEE 3MLSH 1Q0YL 5D8JH 2YWZA 1FDLH 1TQBC 3O3AA 5DTFB 1I7RB 2F74A 1RHFA 4X6CF 2A2QT 5EBLB 3NIGE 3WJLA 1ZAGA 4ZUSA 2O5YH 3OXRB 2VN7A 4PB9H 4J3SA 4Y4KC 3G5VB 3LDBB 3QIUC 2GCYA 5IFJA 4Z6AT 5D1XC 4YAQA 4OB5L 4GSDH 2XPGA 4TULL 2WWMD 1TZGH 3L6FA 1HH6B 3GJEB 4XXDA 1WIUA 2E7LC 2J88L 2VLRD 3OKMB 3MNZB 3PQYB 2WNGA 3DPBA 3DX6A 4OUUA 1KOAA 2AEWA 2AJZA 5CCKL 1NC4B 5BS0B 4H88H 4KTDL 3QUML 3EDFA 4TQEL 3TT1H 1Y0LB 4Z7OF 3MRDB 4HEME 1N59A 4TNWK 5FGSA 1DCLA 1OAQH 4OZIA 1F3DJ 1S7XA 3B9KB 4LHUA 3WNPA 4X4XA 4Q74A 1OD9A 1KC5H 2JB6B 3EYSL 5JO5B 5C0IB 3FQRB 5DVLA 4LIQE 3BX7C 1A1OA 5F7WC 3LHPH 3SE3C 3FO2A 4N68A 3ARZA 4QOKB 1N3NA 5JHDE 3UTTB 1FL3A 3MQIA 1TVHB 1RMFH 3MLZL 5DWUL 4L1DA 3V6ZB 3STZB 4UILL 1JHTB 3HG1D 4PJAA 5JR1H 4WO4A 3HC3H 2C3GA 3OJDA 2IAND 4GAGL 4YE4H 5ACZB 5FA4A 4Z7UF 1FLRL 1HDMB 4YHLH 1YEJL 5AYUH 2NY7H 3MROB 3O4LE 4RGMC 4FG6C 1HZHH 4JZNB 3CFKA 2R1WB 3MLTB 2LABA 3NZ8B 1NCDL 3CGTA 3QXAB 3BRDA 3ARGC 2R2BA 1PGRB 3VDAA 2FB4H 3BFOA 1J5OL 3MMEA 3VH8B 4G6AD 3PJSA 2VLKE 3QCVH 1P5VA 3OKOB 3G5YB 4WHDA 4Q9CA 4IM8A 3DSFH 1PZ5B 4OLWL 3WIHH 1MI5D 1YPZE 2WLYA 3DXAE 3RY6A 4OZ4A 3WMSA 3MOBH 5D96C 3LD8B 1DSFH 1T1YA 2EDRA 5FKPB 3QUZC 5EOTB 1K5NB 3VGHA 3PQYE 2OZ4L 1QFOA 1NAKH 4OLXH 3SY0A 2DLTA 4XVTL 3DNKA 3MRGA 1EO8L 3M8OH 4QHLB 4PJGE 2CSPA 3HKFA 4KGJA 4I18B 3W39B 4C55A 5K59E 1EFXD 4Z95L 4FQCH 4GKOA 4JREB 1K6QH 3MZTA 1QBMH 4GFTB 3FJTA 1CT8B 5FDWB 3ZKNC 1E4WH 4PGDA 1KPVB 2XG4A 3MLWL 4QRTB 2Z31A 2ID5A 1YMMB 3GJFA 3NVQA 5FAAA 1W8NA 2P4AB 3ARYA 4HMCA 1RULH 3VXSA 4MAUH 4PJEB 3UTSA 1MCPH 1T03L 4FZEL 1A0QL 1UWEL 5BV7B 1HXYB 4Z0BL 1MCNA 5HI3D 5F71A 2CIKA 3LN4A 4XMPL 3T0DA 2NNAA 1GYAA 1EUTA 3UJTL 1IGML 1H3UA 2LAGB 3TBVA 3VGAC 1MHPL 4HF5L 4WTWA 4RFOL 4TUJB 4RAVA 4WENB 3H7BA 5MHSE 4M1DL 3SKMA 4PB9L 4YK4B 1G7PA 4IJ3B 4Y5YB 4LKXB 1IEAB 1HKLH 5J57B 4L3EE 2GI7A 3VJ6B 5M7QA 4ZNCD 1RHHB 4J4PA 1NGZA 5DRNB 1BBDL 3QRGL 3B9KC 4H8WC 4HUWA 1KFAL 3VFOB 1KN4L 1F8TH 3TBTA 2D9QB 4XVJH 2FH8A 5E6ID 4Y2DD 5FCUH 4JPVH 1GGUA 3QIUA 3GI9L 2V17L 4QTIH 2DL9A 2P8LA 1EEYA 1FDLL 3L3HA 1PD6A 3LSOB 1J87A 3QHZH 4NQDB 5CZVH 3VXUA 5IQ7H 5EC2A 2E7LA 4GRLB 4QKXB 1ZSDA 3UTQB 4AM0B 3ZYZA 1HNFA 4ZUSB 1AXTH 1LD9B 3UPRB 3RGVB 4L8CA 3EO1B 2DQTH 1T0NB 4MLIA 3OWEA 1OW0A 2ADFL 1CZ8L 3BOVA 2CPCA 1M6OB 3BO8A 1FYTE 1N0XH 4UILH 3U79A 3KJ4B 5EUOA 5SWSA 1T2QH 3NGBB 5DHYA 3SE3A 3X11A 3HFML 3QQ4A 2EO1A 2XKSA 5HHVH 3GMRA 3BZFB 1M1SA 4LSUL 1KC5L 4KK9D 5J3HD 5HY9B 1L9MA 3NCFB 1YUHB 4J3XA 2CUIA 5IHZB 3DI3B 2NXZD 4FN0A 3TBSA 5E1HB 4LSPH 1F90L 5E6IC 5LBSH 5FA4B 5L88L 4E41B 5FK9B 4X6CA 2XZAL 5TPWH 2VZTA 5GGVL 1WF5A 3CSPA 1S5HB 5ADPL 4Q97A 5D1ZB 4P3CH 3F12A 4G7YH 4F33A 3THML 5BMFH 1B2WH 3VGDA 3GO1L 4YFLF 5F6HJ 4OFYD 3DV6A 1HHIA 4FABL 1MIEH 3DRQA 4LU5H 1MFEL 3GSNL 3O11A 5FYKD 2EE2A 1NAKL 4GRWB 3R8QA 1AY1H 4UAOB 5B22A 1HHIB 1YEIL 4OCSL 1G9NC 5FKAB 5D1ZC 3F65A 3MRLB 4RGOL 1DBJH 1BOGA 1MFAL 3ESUF 3MLVL 4Z7WA 3PDGA 3QO1B 1FFPB 1VFMA 3QUZA 3VRJB 2QQNL 1HYRC 2OJZH 1Y0LA 3RVWC 4PJBA 4ZOEA 4B0MM 4WNQA 4XP4L 2CK0H 4PJ7E 2ZOKB 3VFTA 4PJ8B 1DDHA 1ZHNA 5FK9A 4FQ2H 4MJIB 5C0DA 4K3GA 5E00B 4Y16D 3GHBL 3RVXC 2BJML 3IJYA 4MDJB 4O2CA 5TQ2H 3AB0B 5L6YL 4J6RL 5IHUH 5I1JH 2LAAA 2KPNA 5DJDB 1FNGB 3S7GA 3ARDA 2H32A 4DQOH 5FYKU 2Z31C 5F1SA 1PW3A 3RQ3A 4EDWL 4OLYL 2X4RB 3MLYL 5LG1A 4HIJB 4UDTB 4APQB 1MRCH 3OKLB 1ZLUK 2A0LD 4GRWF 4YPJA 5H94A 1NL0H 5IB2B 3EYVB 4FQCL 1JMZA 4EN3D 2HVJB 4MXQC 1PFCA 3S88H 3VRIA 1KBGL 2R2HB 2Y6SD 3SE8H 4I2XB 1A7OL 5IB2A 1W2KT 3P4OB 2XA3A 5C3LD 3TPKA 2XZCH 1UENA 5A2JH 1BIHA 1XMWA 1CICB 2V5RA 1CLZL 4KI5D 4HJGB 1OPGL 3PE9A 1U95B 5FOBA 4GG6A 1OGAB 3GK8H 1KELL 1P7KA 1IQWL 2FBOJ 1CBVL 1BOYA 2PXYB 3V7AG 3CJJA 1G7JB 1OAYH 4WU5B 1UG9A 1HYSD 5IQ7L 2X4PB 2EYSA 2BNQA 3PWLA 2P8PB 5KJRH 3NH7L 4UUJA 4ZDHB 4FQHA 2HMID 1CFVH 4HUWB 1FNFA 2G60H 3L3DB 3LZFH 4HWUA 1IAIM 1WBZA 1UQSB 2JCCE 1IEAA 2DIJA 5IW1B 4NQCA 3U30B 4YDIL 3BKML 4RAVB 4X7SH 3J7HA 4B7LA 3ZDYE 4MNQE 5FCUL 2G2RB 4O02L 4EVNB 5CEZD 3S6CA 1A5FL 1IGFL 3E3QC 5BZWA 4X6FA 2VDMH 2IH3B 3CVIL 4YC2B 3MR9A 4F33B 2ZCLL 3GSWB 4H20L 2O26U 5CEYA 5LKNA 3HPLB 5ICZA 2O5YL 5EZIL 3MNVB 4KC3B 4ZAKC 4N0UE 1YYLH 3MRIA 5F9DC 4FA8A 1NBYB 3JSSA 5C6TH 5KSBB 2X70B 4YXHL 1Q0XH 1EGJA 1JWUB 2BVEA 3KPOA 3AS0A 5C0AB 5JHLH 4JFDD 1FRGH 2DLEA 5HYEA 4ZG1A 1K8IA 2AEQL 2DWDA 4KMLB 2R0WH 4F58L 4TPRL 3QQ4B 3V95A 2CJUH 4FFYH 4YWGL 5TDPB 2NY3D 3D48R 1N5YL 3L3KB 3P4NA 5SWSB 5T1KD 2H3NA 4CMHB 1P69B 5CLWA 3FFDA 4OBSA 1OTSC 3WD5L 2CUMA 4GT7A 3VWJD 1RJZB 4QYOB 1OVZA 5F89A 5T1DH 5BVJA 3O6LL 4U33A 3MRJB 5E0QA 3QH3B 2YD2A 3HNSL 1QFPA 4HIXL 3QDMD 1RMFL 1UZ8B 1FGVH 1NMCC 4HIEB 5BXFA 2HT2D 4XTRD 5FV1L 1AXIB 3AC0A 4H25B 2F8XC 3MREA 4YLQT 1XR9A 3SGJC 2ICES 4XP1L 1BZ7A 4GQ9L 3WYRA 4X99A 3CH8A 2DS4A 2A1WH 3C5ZA 3ARBB 3CC5B 1QHOA 4EUPA 5GRXG 3SN6N 4HHAB 2V2XB 5AYUL 2B5IC 1ITBB 1WZMA 4ZS7H 5I1AA 1KJ3L 3B9VA 4G9FB 4HJ0D 1KB9K 5ALCL 5CWSB 4LKXA 3O4LD 1CL7H 2BSED 5MENA 1HHHB 3HHRB 5E8NA 3I75B 4I9WE 3WKML 1MVUA 1B0WA 4K8RC 2N4IA 2L7UA 3DX9B 4PYGA 3BJLA 3MPCA 3G5XB 1U93B 3V0WH 4JO4H 2MPAH 3D85B 3C2SA 1DBBH 4JKKA 4JDTH 3IVKA 5DMKA 2CRMA 1R3JA 3CSYB 5FM5O 5IMKA 3GUTA 5GQBA 5F7LB 5J9PA 4KK5D 3BP6B 5KS9E 3ZHDA 3E6FB 2CLRB 3MNWA 4N5EC 5ID0A 3KPTA 4EIZC 3H3BC 1F3RB 4XVTH 2A9MH 3C60B 2KKQA 4KDVA 3GBNH 1I8IA 4YEFA 2IGFL 2FWOB 2P49B 2WUBL 3RDTB 3L6FB 4HLZG 2DTSA 4ZXBC 1BFVH 1ZT7B 4I18A 4GW4B 3BRFA 1RK1A 2VXSL 2AGJL 3HI5L 1TZHB 1LO3L 4P9HH 5DFVC 4QHMA 1RULL 2NY5C 1YZZA 2HP4A 4GXVL 1IGFH 1T03H 1GHFL 2YPVH 3QAZB 3UDWA 3KYOA 4ONGL 5HGHB 2C1OA 4FOMA 4PJ5A 4OZHB 4I3SL 3U7WL 1I8KA 1IAKB 5C8JB 3PJSB 1CIUA 3PHQA 1FSKB 2DJ4A 5I1HH 4MQXC 1CQKA 4FNLH 4ALAH 1L7TL 1G9ML 1OP9A 1FIGH 1F4YH 3MGTB 5L8KB 4N5ED 1Q1JL 5IW1A 2GSIA 4JHAH 1NAMB 1A6WH 2ED8A 1VACB 4YXHH 1LQSR 1WSST 5LWYL 5AUMA 5HJ3B 4NRXA 3EDJA 1JTPA 1MFBL 4PJGB 1A1MB 4ZAKA 5JW4Q 2E8ZA 5EO9B 5EU4B 1FORH 3SGDH 4U1JB 4U1HB 3CU7A 4ZTOH 2MCPL 3EOTH 2PYEE 3F58H 5F1IB 1CXHA 4QY8B 2W0FA 3OZ9H 2WSKA 4WUUB 5KW9H 2QQKH 4ZPTB 1H3VA 3TT3H 1DQQB 4Y4HB 4PJFF 2CKBB 1OCWL 3DXAD 4LLDA 5HI4C 1CU4H 3KPLB 2GQHA 1MWAB 3EFFB 1TETH 4KTEL 2CRZA 1MCCA 1TNNA 2X9YA 5IBTH 1KIQA 1BQHG 4OI9A 2I24N 2OTUB 2FECI 4AQ1B 4Y4HD 5DK0B 1CXLA 4XRCB 3BD4A 1NGPH 4R4BA 3RJDA 3IDGA 2HJKB 3F6LA 1AP2A 2CLVB 3ILPB 2GJZA 3DV4B 4QHNB 2V5YA 3C87A 5BS0A 2E9IA 1F6AB 5JMRA 3P4MA 2XQYK 5ERWB 2M2DA 4KQ4H 3DX6B 4NN5C 4AIXA 4U1SB 5HHOE 4NKOA 3CAFA 3GGWA 1UB5A 4TSCH 3MUHL 3BQUC 4M4RA 3VFWA 4HIIB 4MAYA 4XNUL 1OWWA 4FXGB 1B90A 1JGUH 4CN4A 2HT4C 4L4VD 4R4FL 2WV3A 3FB5B 4QXGH 4PYHA 3VFWB 5EFIA 4LVNB 4JFHE 4Z7UB 3S3JA 1NBVL 1XGQB 4Y16C 3NAAL 1ZT1B 2Y07H 3VXRA 1UKQA 2PW2B 4PJBF 5E24E 4DW2H 1VA9A 1MNUL 1K4DB 3E1F1 4A6YA 4WW2C 1Y6MR 4LCCB 5HYSB 4QTHB 4XI5C 1DVFD 5C0CE 4X0KB 4YZFE 2VZUA 4NSKA 4AT6A 4OCSH 3I9GH 3EO0A 2FD6H 4JVWA 3ZT7A 8FABB 1N8ZB 3GBNL 1TCRB 3VA6A 3I50H 3QNYA 1CFSA 1NCBH 1P9MC 2ITDB 3RL2A 4XP4H 4TNVF 4R2GD 1A7PH 4UIKH 3MV8D 1B4JL 3QUYC 2DD8L 5AWNL 1A6UL 2OR9L 4ACPA 3HLAB 5IFHH 2NXYC 4PUBH 7FABL 4JO3H 1HEZA 3GZKA 2WP3T 4CL7A 3MV9E 5E4EB 1T5WA 1WFNA 1PG7L 1IQDB 2ZSWB 3MLYH 2X2YA 5DJ8B 5JORB 3MXVH 4TVSa 3MLUH 3T4AA 2FO4A 4MCZB 1N8ZA 1IKFH 1XF5B 1U95A 5E2WH 3T0EE 1D5ZA 4PJCA 2F19L 2LFGA 2HMIC 2KUTA 3ZL4L 4NSKB 1TJGH 1SBSH 5DZNA 2H41A 1K2DA 3SKJL 2C1OB 4RBPK 5B8CA 4JHAL 3MUJA 3LAFA 4LL9A 2PW2A 3OTTA 2FJHA 5IK3B 2Z93B 3CCHA 4MZ3A 5HDBE 5A43C 5C0EB 4Y4KA 4GAYB 4NZUL 1KIPB 5FB8B 4XVSL 4HMEA 5D1XA 2XRAH 2DQJH 2L0DA 3DWTA 3PV7A 4I3SH 4NT6B 4X7EC 1FNGA 3WN5B 1J0YA 2APBA 2EDWA 4NFBA 3VFRA 5HHPB 4YHZH 4EUPH 5T5NG 4N9GB 2XQBH 5LAXA 3MFGB 3VXMA 3ECBB 4XAKE 3WO3B 2A83A 4GJTB 2APFA 1G7IA 2ZCHH 2Z9TA 4WGWB 3DV4A 3P0YL 5A2IH 1RJCA 3K2UH 5IVXA 4PG2C 1ED3B 5B3JF 1CS6A 4OFKA 1WBXA 5I30L 1QSVA 3HB3D 2AEPH 2VQ1A 2H9GB 1VKXA 1GPOH 3BKYL 5D6CB 4YK4C 3KWWB 5EBMB 3QO0B 4CRPA 4HPYH 1S5IH 3BH9A 1FO0H 1UKTA 4H20H 1TNMA 4Y4HA 3RNKB 4WFED 1H8SA 3CX5K 1M71B 3JTSB 4WO4C 1EHNA 1AH1A 4LASH 2JIXA 1YECL 4PBWD 2PCPB 2YMXL 4U1LB 1BX2A 3NCBB 2X9XA 4MAYC 4CVXB 4HDIA 4X4YA 1JF1A 1PEZA 4LSRL 1D5BB 4K71C 4YO0B 1MHCB 5KG9B 5IJVA 5SX4H 5KSAC 2UZYB 4OCXL 4OZHF 3A6BH 2RGSA 4UB0H 2CJUL 3IDNB 4FFYL 4NWTL 5IHLB 1G1YA 4JVUA 4S1SH 4FG6D 1A7BA 2BRRH 4MA3A 5H35B 1UEYA 3NABH 4CMHC 3FCTA 2JJWA 3HAEA 5CKGA 4D8PA 4MXVE 4ZSOA 3HE7D 2RIKA 1NCCL 3FB6A 4JKPH 4CN6A 2IBZY 1WAAF 3RVVC 4YFLI 3ES6B 3SGEI 5A16A 4WY7H 5FYLE 1LE9B 1FC1A 4WTZG 1G7MA 1RZ8B 4GQ9H 4U6VH 4KPHH 3IJSA 3M1BB 4DGIH 5I1CL 4JM2C 4I8DA 4JQXA 4OAWA 4JRXD 4E42B 5IJVB 5JOPD 1IGMH 1LO2H 1HOCA 3TN0A 2ZUQC 3IXAB 1Q9WB 3K1DA 1MHPH 3QHFL 5CIPB 3IGAA 5EU3A 5CUSL 1TJHL 1F4WH 3ZZ1A 3OKEA 3WNKA 4DK6A 1S7WA 1A7PL 5EPMB 2HWZL 5A40E 1RZJH 5HYJB 1ZA3A 2NY0D 3TVMC 1TCMA 1LK2B 2YPLA 2J8UE 4RRPA 2C1PB 4JHWL 1JRHL 5F3BB 4U7MA 2NY2B 1SJHB 4FTVB 2ZPKL 3WHE0 1DANT 4XC3L 1NDGA 1HN1A 4WI6A 3WXWL 4YDJB 1RIUL 3QDHA 3FZUD 4NFDA 5ALBL 5B8CC 3B9KA 4HUUB 2BHZA 4NOBA 3FFCB 1A6TA 1PKQE 1XFPA 4TUKL 4GLRH 4LPTA 2Q3AA 2OK0H 5CD5C 1J0HA 1ND0B 4UUJB 4M62L 2DLFL 1E6JL 2W9LA 2OCFD 5GGQL 1A6ZA 4ZD3L 3RAJL 4LBEB 1KT2B 3STBA 3IDMA 4FQ1L 2AK4D 4U1GC 3JV6B 5E7FA 5DEFA 4LDLB 1N26A 2KQMA 2PR4L 2ICCA 4XVSH 2EDKA 5E2TH 2GSGA 3IJSB 3M1BA 5GHWL 3RL1A 1GHFH 2YPVL 1UWGH 4J3TA 1K8DA 5IQ9B 2X9WA 4FQJH 4K94H 4N1HB 4ZUWB 3VA2C 4K3EH 4PG2A 1RK0A 3OXSB 4K7FB 3RTQB 4YBHA 1JNLH 2KL6A 1DL7H 2UZXB 4Y4FA 4JEGB 3BYTA 1FBIH 2AJSL 1QR4A 2X4SB 2XN9B 1IFHH 1QO3B 4ODVL 3L1OL 3MUZ1 3QIWA 3T8XA 2HFEA 4IBLT 3P4NB 2DL2A 3UJIL 4FNLL 1MFDH 4GG8A 2YMXH 1JHLL 2VXQL 4JHZA 1G6RH 3IAQA 4OF8A 3CXHJ 5C9JA 1T2QL 2IPKA 3T4YA 1MI5A 2VDRL 3OPZH 3KYAA 3CFKB 1KG0B 5E5MA 4PJFB 3UTOA 4I5BB 2Q1EA 1C12B 2L7JA 3ZE0F 3FKUS 1FPTH 4WUUD 2GITA 4K2UH 4RGNB 5EZOL 3TWCH 1JZ8A 4K8RD 2I07A 4OCYH 5H2BB 5IB1B 4FP8H 1FL5B 4P4KA 5DDHA 2PCPA 5MP6H 5EIVA 2GUOB 3KLAB 3VI3E 4HBQA 5FUOL 5L2JA 3FO9B 4Y5XB 5EC1B 3ARGD 3B2VH 3SGKA 1I1RA 1WAAA 2OSLB 4Q6IA 4G6JL 4OI7A 1RPQA 2B0SH 4GOSA 3UMTA 1EO7A 4GXUN 1R5WA 3KPSD 1X4ZA 5I74B 1UM5L 3NCCB 4YX2H 3FO2B 1DQML 3HR5A 4MDIA 2QQQA 4V2BA 4XCYB 2IMNA 4JCLA 4NWTH 4WJ5B 5CAYB 5I1JL 3UROR 5JR1L 2SEBA 4XBPB 5HYSA 4OZIB 1FJ1B 1J05B 4YE4L 5ID1B 3EIFA 4MS8C 2HH0L 5E6IB 2R0LH 2D2OA 2AJZB 1CTOA 1UKSA 3LPGA 5BO1L 1TITA 5BJTB 4NYLB 1FAIH 4PJHA 2OJZL 3SQBA 2VMFA 2CD0A 1TVBA 3GSUA 3ARGB 4X7CC 4F37F 1HINH 3D39E 1FYTB 2I25N 4N1EA 4ZUTA 3IFOB 4JM2A 1VB9A 4JQXC 5M94B 2Z0BA 4M7JH 4MJ5B 4U2YA 2HFFB 3TN0C 1DUYA 2VXVH 2CRYA 3QZWB 3B4NA 4H26A 5CBEA 3IXTA 4KRMB 3X3GL 5IHUL 3MTRA 4KPHL 4GW5B 5GGSA 4XXCA 1FH5H 1I1AD 4O51A 5E8EA 2OBGA 4O2EB 2BMKB 2VABB 4WHCA 3NFSH 3RX8A 5J7CC 2R2HA 2DQIL 3JWDL 1BPVA 3QEQE 2WWMC 4RMSA 1HIMH 1JGVH 1RIVH 1XT5A 4M7ZC 1K2DB 3M8OL 1TJHH 2Y06H 4O51B 5E8EB 3TJHD 5KVFL 1JIBA 1KGCD 1VADB 2V9TA 4EI6B 3EFFA 4MCZA 4QXTB 1DQLH 2YSSB 2ED7A 3RX5A 5I19H 1IQDA 1B4JH 1XH3B 2VDOH 1A6AA 2NW3A 4NBYB 4RZCA 1W0VA 1A6ZB 1NUDA 5GHWH 1YNKH 5ICYA 3WL9B 4QRPD 4L9DA 1CGUA 4NN7B 4FQXB 4Q9QL 1ZHNB 2BHYA 2VWEC 5HI5C 4JR9L 3UJTH 2ITCB 4D0DA 4QCIB 2I9LA 4JPWH 2OLDA 1MH5B 4PLOB 5DD0H 4C56A 4HEPG 4IMKC 3LKOA 4PJIE 2VDQH 5GZND 4OI8A 4ODVH 4NJ9H 1VEOA 4FTVA 3SKJH 3O2WH 1I8KB 2VZSA 2NNAB 4XCFL 2HN7B 5AZ2H 4P2RD 1KEMH 2DQCH 3HB3C 1KFAH 5H37G 4BSVA 3C6LA 5TE6H 1JNHA 3GI8L 4PJ5B 4Y4FC 5DC9B 3LV3B 4G80A 5HGHA 5EC1A 4HMDA 1S7WB 5BV7C 3C5ZD 4KRLB 1O7SA 4UV7L 3TVMB 5H2BA 2NXZC 3NBNA 4X6CB 3S96B 1IE5A 3KPSB 5L2KA 4P2RA 5T1KB 3T0BA 4JFDA 4HWEL 2XTLA 3CFBA 3QG7H 3T3MF 5ADOL 4KU1A 2WM0A 4BZYA 5IHZA 3I6LE 1HHKB 1OT2A 3L1OH 2Q8AH 2XQBL 1P4BH 4UT6H 1ZLSL 2O61A 4KAQH 3RJQB 3WFHA 2A6IA 2Y5EA 3FHQA 1AFVL 4XNQA 2M26A 3ULSB 5ETUB 1M4KA 3DVGA 4P57A 2F5BH 3KPNB 4UI2A 2IPKB 2X4TA 3ESVF 5FUCC 3SGDI 2G5BB 3EFDH 3RIAF 3JBG7 5C0CD 4P4KC 4WTZA 5SWQB 5JHLL 4ISVB 43CAA 2G75B 4PRIB 1X5XA 3F5WA 2J3SA 3BQUB 3SGKC 4HK0B 2BVOA 3EJZD 4GH7B 2O5XH 4Q6IC 4KKCC 3PXJA 5FO9B 2YBRB 3IDGB 4PRNA 1CCZA 4HPYL 2EYRA 3ULUC 4U31A 4MA1B 4Y8DC 1MAMH 3RVWD 2YD6A 1JPGA 4C83B 3QWOB 3U4BL 5E8DH 4URTB 3SGJA 1X4XA 5EZJA 3GIVB 1J86A 5F9OL 4UMGA 5E2JA 4MCYB 3PXHA 3C5ZC 3QA3A 2Q6WA 4Q6YA 4JZNA 3H0TA 4NKIH 3UXFA 5GGVH 3PHOA 2NQCA 5SX5H 2WBJC 1MHCA 1QNZL 4IIQA 4K07A 4MNGE 4PLNC 4RDQF 1X7QA 4FFVC 4GS7C 3BN3B 4Z7VA 1MCJA 4JN2B 4NGHH 3T2PA 5JXAL 2IQ9L 4LCUA 1U8PB 1KJ2A 1R3KA 3ULVD 2CR3A 3FT3B 2QL1A 5CSBA 1MIEL 4WCYL 4MJ2A 1PLGL 1IM9D 3IDYB 3FQUB 4S0TD 5B39A 1JHTA 3ME0A 1S7QB 3H0TB 3N9GH 2R29L 3RNKA 3MREB 1YEHL 3B8SA 4M1GH 3D18A 2IJ0C 1H5BA 4Z95H 1CFNB 1INDL 3PDOA 5EZJB 1FHGA 3MJ9A 1IJ9A 3WLWC 1OAXH 1JPGB 2Q7YA 4J2XA 1NBZA 3DETD 4UIMA 5HYSG 4Y19E 1YEGH 5DJ6A 5DUML 3MRJA 1BVZA 4JPKL 4X4XB 1CE6B 1GAFL 4F3FB 1U8IB 1HI6A 5C08E 3RIFF 2MPAL 2VLKA 3HC0B 2VDOL 4FZEH 5E8PB 2BVYA 1V8HA 1FN4B 4J6RH 5D7IE 2RQ8A 3TN0D 4RX4D 4DEPB 4FFWD 5CIPA 5EU3B 1TTUA 1BZ9B 5E9DE 1RVFH 3I6LD 3Q5OA 2UWEB 2GK0A 5IBUG 3QIBD 4MJIE 5I8EB 1MY5A 4R26L 1XF4A 5KVFH 2XYCA 3W5NA 1I9IL 4H8WL 3KYMB 5IMOA 1A9EA 3IFLL 2Q20A 2VDQL 1C5CL 4O5LL 1EMTH 5EBLA 3G6JF 1YN6A 1WGOA 1M05B 4NKDB 5CEZH 3VU2A 1WWWX 1RZJL 1F8TL 4JKWA 2DJUA 3MRNB 5A16B 5BRZE 3EOYG 2Z8RA 4L9LC 3KLDA 2CLRA 5ID0B 1FCCA 2QSVA 4IMKA 4QTIL 1DE4B 4LVHB 4ONFH 2IH3A 1U8IA 4BSVB 3RZCA 1UCBH 1BVKA 1IQWH 2A9NL 4P3WA 4TNVK 5DT1L 4E5XA 5HVWA 5F7EH 2R2CA 2FJFA 3F6IA 2P45B 1XF5A 5IR1A 4XWOC 5JORA 3C6LC 3WBDA 3TM6A 4O9HH 5IOPB 5KW9L 2AK4B 4LRNH 3LPFA 1JPST 3W2DH 3WE6B 2GJ6B 3TT3L 3QEUB 3L7EB 3MRPA 1ZLSH 4WEUD 4WUKL 4M8VA 4OB5H 2PUQT 1A1NB 2LVCA 4XCFH 1B9ZA 1S9YB 2V9RA 1A6WL 1AGDB 4Z7VE 2R23B 3ZSSA 1NJ9A 4LCUB 3U48A 4X9IA 3WFEL 5E08L 5C0ND 2H45A 3WKNA 3TPUA 2NY3C 1AIFB 3QPQC 4X5WA 1F02I 5JIKA 3VFPA 5FOJA 2K9UA 4KH2A 3TT1L 3JTSA 3QR2A 3STLB 3MODL 1ZA6B 5I15H 4MQTB 1B0GB 1RAMA 2XWJB 2DKUA 2VERN 4MNQD 4UQ2B 2OR8A 3KPPA 5FGCB 5GGUA 3SDAB 2VWEE 3ZKMD 4R9HA 2MWCA 2WBJB 4DZBB 2GYSA 1P4IH 2APXA 3KWWA 3WNNA 3ZYOA 4NN5B 4NHCL 4PLJD 4PREB 4KAQL 2NY0B 5SWSD 5I1DA 5HYJD 4XPTL 1TETL 1EXUA 5BVJB 2DQDL 4Z78A 4GMTH 1DN2A 3QDJE 4LHUB 1LEIA 4J3VA 2E6JA 3GHEL 4R3SA 1D9KB 4BSWA 1HSBA 3BQUA 1L6ZA 1G6RL 4BK4A 2H3NB 4PJIF 4X80H 1MUJB 4YBQC 1QSZA 2DM4A 2DICA 3RVUD 3ZE0E 4G6KL 1QSEA 1F4AA 2BVQA 4MJID 5ICXA 6CGTA 1MELA 2WIMA 3HZYB 1V5JA 6FABH 4CMMA 3PP4L 4OFVA 1VESA 2WQRA 1NSNH 2EDLA 1D3CA 4YHLL 2FX7L 3FTGB 2IBBA 3ULSA 1AO7D 1NGWB 2O61B 2OMNA 5AZEH 4FXGA 5J6GA 5I9QB 3WCYA 1CGYA 1CVRA 1UH2A 2OQJB 3OMZA 4Y16A 4HIIA 5ITBH 1QSEB 3MSPA 5LQBH 2H2PD 3IAPA 4XP5L 1DDHB 4FQ2L 2I60L 5ERWA 1A02N 5CGMA 4NO3B 2LTQB 4F2MB 4LSSL 5I71C 4V2CB 4PRDB 4OV5B 1H5BC 4N0UB 1MCHA 3IFPB 5I8CB 2E5EA 5F1KC 3DVFA 2D7TL 1FVEA 5DHXB 1RZIA 5K33A 4YEEA 2NY1D 1Y6KR 2CMRL 1CFTA 3MV8A 2AI0L 2R1XB 4W6XB 2XICA 4M8QB 5KZCB 1EUUA 1I1AC 3KPMB 1KENL 5DJ8A 1FVCA 4FMKA 2FECL 3OV6A 5C0JA 5INDB 1RUAH 1BBJB 1BD2E 3KXFA 3QUYA 3W9EB 1YMHB 3CDGB 3TFKC 5DZLA 4H8WH 1CLYH 5JPMA 4WWID 5I66B 1NCBL 4XMLL 1H15B 3JV4B 1ZT4A 4HZLB 4P99A 1F00I 1AQKH 2RBLA 3BE1L 5IB1A 1NJ9B 4RQQB 3HR6A 3V2AR 4Y0GA 5JUEH 3UAJD 1H15A 1N6QH 1A6UH 1EGJL 4MSWA 4OIIH 3S4SG 4YXLH 5BOZG 3BIAX 1A6AB 5E6YA 3QUYB 4ODHL 4HX1A 4KKBD 3B3IA 5DJCB 4R96B 1CFSB 3BP4B 3FB7A 5EIIA 5ITFA 2ZUXA 5IR1B 1XGPB 5EUOE 5KANG 4LQFH 4QT5A 4YIQB 1AXSA 1NEUA 1WIPA 5EU6E 3VGAB 5IIEB 5GS2H 1OM3L 4LCCA 5D1XD 5FHAL 2IH1B 3U4EA 1EEZB 3B83A 3MRMA 2XQYG 5GSVB 1CFQA 3X12B 1T0NA 4HQQL 5CHNA 5BW7A 3R4DA 3NIDE 3WHE1 2X4RA 3NFPA 3RL1B 3CX5J 1JWMB 1K3IA 3H9SA 5IM7A 1YEFL 4F7CA 2ZUQB 1WTLA 4HK3J 4P9HC 2FATH 5I30H 5IG7A 2EE9A 4ERSH 3V4VH 3BP5B 4C4KO 4YFDB 1G7LB 5JQ6L 1LDPL 5JDJA 4UOJA 3NCYS 4GG6F 1QLRA 4PP2B 1OL0A 2WK2A 4NYLA 1ND0A 1KCKA 5GGRA 4M6AA 5CKAA 4LEXH 4HBCL 3U7WH 2OZ4A 1NGZB 3QXUA 2R0KL 2YKLL 3HRPA 4HWBL 4UU9A 2VSDA 1LNUA 3JZ7A 4P2QA 4W6WB 3TJEH 3OJMB 1MHHB 5T1LB 3FZUC 1GL4B 4G43A 4WVRA 4ZUUA 1L6XA 2X44D 1BP3B 1KEML 1ZHBA 2BHUA 2DQCL 4Y4HC 3OAUH 3SDCD 3QHTC 1U8HB 2Y6SC 4HKJA 3HN3A 2ICWB 4OLUL 4UQ2A 5I8KL 4J8RB 3D0LB 3TH3T 5FO8B 3GSXB 3HUJE 1IEBA 3MRKB 1SYSB 4KKCD 3DMMB 5C09A 1WWCA 2BVPB 5F1IA 1XGYL 2JK5A 1BMGA 3QFJB 4XT1C 3ZKSD 1FL6B 3H9HA 3SDCA 2YD1A 4YHMH 5C0FB 1AGDA 5KSAA 1P4BL 3VW3L 5FDWA 5BOPA 1ZEAL 4ZAKB 3G6AB 3C5ZB 2YRPA 5EU6B 5C07E 2D31A 4YHOL 1BQHA 1ULVA 2XKUA 4HKZB 4I5BA 1YA5A 4WU7A 4WFGE 3Q6FB 5TDNB 3WO4C 1C16B 1ACZA 2QKIB 3OSKA 3TYGL 3ZTJG 4KV5F 1S9XA 1DBAL 4I0KA 4XMKH 1RZ8A 1FZMB 1TPXC 4ELKB 5C9JB 3LRHA 1J88A 1DVFB 1MJUL 4F57L 5GGSY 1E6OL 1Q9OA 1FFQA 1OB1B 3QH3A 2EYRB 4KDTC 4Y2DC 1D6EB 3DYMA 3K81A 4UNVA 4S1SL 4M3JA 4D9LL 3NCYP 5HBBA 2VDLL 4XCCL 2FO1A 3VXRD 3F5WB 3OXSA 3P9MA 4S1QL 4U1KB 3SE4C 1OGAE 2M8XA 1AQKL 2UY6A 3BE1H 3OAZK 3PUCA 1RURL 1S9WA 3RWDA 2PYFB 4P46B 4EQ2A 4Y2DB 5CEXA 4P5TB 5AAMA 3GHBH 4UNUA 3DHMA 3MLPA 1G9EA 5E9DB 3RVXD 1AJ7H 4JY5H 3EZJB 3MROA 4FHBD 5D2NE 1I3UA 5IW3A 5JXAH 4M93C 2ERJC 3SO3C 4DN3H 5C0GB 4DW2L 5GRYA 5T3XD 4DKFL 1I3GH 2WINA 4JGMA 4RGMB 3V0VA 1BZ9A 4CVXA 1PLGH 1BX2B 3TVMA 4MMZC 1MRCL 5T3ZD 2B39A 1CF8H 1P5UA 1RHHA 5L9DL 4JJHA 1L0YA 1P6AB 4BUHA 2RR3A 1WV7T 1IAOA 5DMKB 3S88L 4JHBA 3P40A 2HKFH 1FZKB 1HXMA 1A7OH 3MO1A 1HSAB 2DBLH 2N56A 3CDCA 4KY1L 3RBGA 3D18B 2DD8H 5AWNH 3N1QC 1IAOB 2K7QA 2CGRH 4N8VA 4PB0H 4QCIA 3TV3L 3ZE1E 4LQFL 3RHWK 2YS4A 3OKEB 5BW7C 3S9DB 4DUXA 5GGRB 4FQHB 1U8PA 5ACLA 4LLYB 2C3VB 4JKLA 3VXMB 4QRUA 3NIFE 2FL5A 4FXLA 5DR5L 2WINB 3V0VB 4JE4B 4KI5E 1AC0A 2ZSVA 3BP5A 1WTGT 3AXLB 2DQGH 1S8DB 3MV9D 2NY4B 5IHBA 1I1YA 4D9RE 1E28B 1NQBA 1AGEB 1P84J 1Q1JH 4P59H 1ZHLB 5IB4A 4ZO6A 4FQ1H 4QXTA 4RRPG 3BKMH 4L4JA 1T3FB 2OYPA 1PG7W 3LS4H 3UTZA 1QR1A 1MRDL 2APWA 5I6XB 5D2LB 3SCMB 4OGYH 5ANME 5KVEH 2FJHB 5BRZD 3U4EB 4ONFL 4ZS6C 3L5WA 3TYFB 2X4UA 3QIWC 3OZ9L 4RISL 4LQ1A 2X4OB 1KIUA 4PJXF 4HC1L 1I7TB 1DQTA 4JZOA 1B88A 1IZKA 1V3JA 4UDTA 2DYPA 1U9KA 3T65B 4APQA 4MA3B 4MGXA 4FP8L 5TDPA 2AJSH 3MGAA 4UOW0 2EDNA 3O9WA 4TRPH 5GZOC 1BIIB 4Z77A 4LFHD 5C0AA 1MWAH 4HWNA 3B5TA 4G42B 3EOBB 3VFSB 3MLXL 2R8SH 4BQCA 3UBXB 3VXUE 4RMRA 1X5GA 1Q0XL 3SDCC 3W0WA 1U58B 1JF1B 3PWVB 3HLAA 3MRIB 5T1KA 4NO5A 4XAKD 1D6VH 5C0FA 4GXUM 1F13A 4RIRA 1BJ1J 3C08H 2MFNA 2BVPA 4RAUA 3MYJA 3HI6L 4PJDB 5EWIH 4P48A 3I6GB 2QADC 1KTLA 4NPYA 5GISH 2SEBB 3STZA 1G6RB 2VDLH 4XCCH 2ADIB 4KK6D 5DUBA 3RVTD 4P2OC 2HFTA 1ZLWH 2EKSA 3JTTA 1ZEAH 4M8QA 4PTUB 4ZUVA 3O11B 4KDTA 4WW2B 5D6CA 5DRWA 5ENWB 3U30C 4QXUH 1NC4D 1FVEB 2UVEA 1EHXA 3KJ4C 3G6DH 4NKQB 1OLLA 5HI3C 4XP9L 1Z9SA 2ATKA 5TFSH 2XTJB 3ULUL 5I74C 1G9NL 3TP4A 3IF1B 4DKEH 3GSVA 5DDHB 1S3KL 4KRPD 2JCCA 3OGCA 1FH5L 2B7DT 2R0LL 2B5IB 3V4PL 4AEHL 3AU1B 3GMLA 1ZMYA 3RNQA 1PZUB 2X42A 5HY9A 5ILTL 4XXCC 4AL8H 4L8SB 4CMMB 4YGVB 5E6ZA 3ZSTA 2CIIA 4FTVD 2V2TB 4U6XA 5DD3H 3OQ3B 1EZVX 5FGCE 3MRCA 1K4CB 4D9QE 4WV1A 3UAJC 3P4MB 4OD1L 1H9VA 2F53A 3SKNB 4U3HA 3MXWH 4ZO8A 4BSWB 1MPAH 4MNQB 2A73A 1T22B 4U6HA 2AQ3A 4OGXL 1J0ZA 2H1PH 5BV7L 2VQUA 2IWGA 2FGZA 2VABA 1XGTA 2BNRB 2CXGA 3MRCB 1CE1H 4YIQA 5I1GH 4JR9H 2P7TA 1D5ZB 5FYKH 4DZBA 3K0WA 5F7DA 2K1MA 4PJBE 1I9RH 3QZWA 3VXUD 5T5NF 4K23L 5CUSH 2IFFH 2CO7B 2VLMD 2KDGA 4PFEA 4G7VH 4P49A 1FYTA 2DQUH 1FGNH 4C56D 1JPTL 3TEUA 3C6SA 2HTKD 1N4XL 1UFUA 3RDTC 4DGYH 4MJIA 1IGTB 1OSZA 4IHOB 1A1MA 4M6ML 4U05A 2IALA 2H2SD 1A6TB 3IKKA 2GJ6A 3D9AL 1MCOL 4L4VA 3INUL 4J12A 3SKMB 4WJ5A 4P5KA 2NX5B 3SGEH 3WUZA 2EE6A 1G0YR 4QF1A 5TDOB 4B53A 2ESVA 1ZHKA 2MKWA 4XZUB 1T0MA 2PO6B 3IRZA 2LU7A 3CZFB 1HSAA 3RVUC 4LCWB 2XKNB 1A21A 1QBLL 1JI2A 3H7LA 1Z3GH 3EAKA 1CZ8H 1BVKB 1FSKC 1K3ZA 1CLOH 3QWRD 4W4NA 3GNML 4RNRB 1H3XA 2DLFH 2DBJA 3K2MC 4GSDL 1Z9LA 3PWJA 5DHVB 1J1PH 1KACB 5EOCJ 4LDEB 5K9QG 3BPOB 4EI5D 3I2CH 1QRNB 5JQHC 3D69A 2YD8A 2Y23A 4NO0D 4QRQB 3GBMH 3O9WC 1M05A 4NKDA 2DYPD 2YD5A 4G5ZH 4UNTA 4ZTOL 2B4CH 1C12A 2JCCF 1MF2H 4LEOB 1LDPH 1ZS8A 3H2WA 4KUCD 1QQDA 1U36A 2CDGA 1WBYA 1SYVB 2B1AL 3R1GH 4KJQD 1A6VL 4F9LC 1S7RB 3P9WB 4L1HA 2QQKL 5L2KE 4P2QD 4OQ1A 4YPGA 3G5ZB 1U3ZA 2P5EE 5L0QC 3LB6D 2FX8L 4TRPL 3H9SE 1PKQB 4LSDA 5FA3A 1KN2L 1MREL 4OZFG 4PR5B 1IL1A 1GGCL 3PWPE 3HZVB 3MLZH 4P23D 4X8XA 5J1TC 3ISWA 4AQOA 1MLBA 3L3JA 2GJZB 4QHNA 3PDDA 4P2OA 3M17B 5DURD 4KQ3L 4DVBA 2VDRH 3C08L 1VFAB 2X89D 3D39A 3GSNB 4AIOA 4OM1H 2CLZB 2BOBA 3DI2B 4G6FD 4TSCL 1MWAA 1S9XB 4U3CA 2WBJA 4IIQC 3QCTH 1HZHL 2XWJA 4HGWA 5I1IH 4CGTA 5IP4A 1Z5LB 2ZOLB 2F54B 1WIOA 3CSBA 4JPIA 3QSKB 2C3XA 3BPCA 5DK2B 2CK0L 2D7QA 5CP7A 3BIKA 1HQ4A 1KEGL 1IGCH 2BCKB 3QEQB 5F8QC 3B6SA 4JO2H 4J3UA 2BCKA 3QEQA 1NCAL 5IVOA 3VWKC 3D5OF 2P5ED 1P4LB 4UT9H 5JMOC 1HQ4B 1T89A 4IIQB 1E27A 4AIZA 1BWMA 1IILE 1RUKL 4KHXH 4BELD 2VLJE 4P4RB 3MJ8A 2AP2A 3BUYA 3QXVA 5I1CH 1T83A 1QRNE 1XR9B 2ZKHL 4L4VE 3QDGD 4GRMB 3KPSE 4ONOA 1WISA 3QFJD 1C7SA 1N3NB 3IYLW 5T5FL 5TGBA 5DZOA 2VLKD 1X5HA 3VXTB 1H3TA 4FXKA 3IDXL 3I9GL 1MQKL 4NZDA 3LEYH 4R26H 2Y36L 4NZJA 1T04A 4MVBD 5DK3A 4R4NC 3P9LA 4Q9BA 2YK1H 3UTTD 1RU9L 4QRSA 2NYYC 1T1XA 4ZTPH 3VFNA 5KOMC 3V0AC 4E41D 2MKLC 3EYOB 3CUPB 3IFNL 1CLZH 5D5MB 5GJTH 1A14H 2FJGA 4EBQH 1MCBA 1FZOA 4YDVA 1G7LA 3VXME 2H1PL 4MB5A 4AMKH 5BV7H 4JFXA 3GMMA 3K4AA 2GHWB 5ALBH 2CDGB 3N1GC 1M7DA 3TCLA 2AJVL 3D9AH 3LKQB 3H9SD 4YBQD 1ZT7A 4BQBA 4DK3A 3LKSA 3NFPB 3RDTA 5JW4M 3ULVE 4L9LA 4OT1L 4P2RB 5FYJH 4JO1L 1YYMH 3OF6A 1V7NH 1CF8L 3KYNB 1KCVL 2X4NB 4MQXD 4JZJA 1AE6H 4F8TA 5ISZA 3PP3K 4RFEB 3RZCC 2HT4D 1WC7B 2DB8A 3FB6B 5DC4B 5A3IC 1L9NA 1BBDH 3QRGH 1KJ2L 4P46D 4NQXB 2EECA 2CDFB 3MOAH 5I19L 4QWWC 3FOLB 5E2TL 3ULVF 1KGCE 1KTKE 1XGPA 1FE8L 4HCRA 1UCBL 4ODTL 2YPKA 5F6IC 2V17H 3SDDD 3U9PL 3TIEA 4LVHC 3U4AA 4NP4L 4R96A 3K7UA 1T1ZB 1JL8A 4L4VB 4NRZA 2Q8BL 4TOYL 4MZ2A 3HUJB 5GZOD 1QACA 1F58L 4PLKC 3FQUA 1JWSA 2IALB 5EZIH 1BFOB 5GRJL 4NHCH 5J56B 1CLOL 3QWQB 1ZLVH 1X5ZA 1NEZA 3EOAA 3O3EB 4OJFL 2FRGP 4XPTH 4LIQH 1ZT4B 4OLZL 4P59L 2FLBT 3W11C 2PTTB 1R5IA 3DGGA 5F7YC 1JK8B 1ORQB 5C09B 2BVUA 2D03H 4F9LA 4NJAH 1XH3A 2ITDA 3RL2B 3ALPA 3FB8B 5FYJE 2WW8A 3LVEA 1KJVB 4J8RA 4PIRF 1LDSA 2A74B 4P4KD 1WCQA 1RJLA 3MRQA 4QOKA 5FFLA 3BQUD 4IRSD 4C54A 5CD5D 2EXWC 2NY6B 1ZHBB 2FX7H 4YXKL 4L3CA 1T2XA 5CJXA 4Q58C 4P2OB 5IVXB 3SKOB 3TBYB 2BNUA 3CFCH 3TO2B 5DJAB 1SVCP 3MCLL 4MXVF 3MLRL 2IEPA 1KCLA 3RY4A 5DYOB 1KPRB 3WEXA 1QLRB 2C3HA 1OP3H 4YX2L 2KZ1B 1K8IB 1D5MB 2UY7A 1DSFL 3GJEA 4X80L 4W70A 3KPNA 4P5TD 5FUZL 5HHPA 1E0OB 1S7RA 5MEND 5E5RB 4HG4J 2GCYB 5IFJB 4ODUB 4Y5VB 2A6KB 2QSCH 3DX8B 4LARH 4MAYB 2N1KA 4LP5A 1JBJA 5D7JA 2J7LA 4NC1C 4NN6C 3VWKA 4GS7B 1QEWB 4D94A 1T89C 5GRUL 4R8WL 1NPUA 4NO2A 1LK3L 1U8QB 3GSVB 3OAYH 1T83C 1KCUH 3D87B 1U8NA 3LH2L 3BYYA 3LV3A 3WLWD 3S34L 4HXAH 1U8KB 3K3QA 3G6DL 1I1AA 2V7NB 4FFZH 2GIYA 4S1DD 4PGBB 5JUEL 2PNDA 3DRQB 4XAWL 3KPLA 4LLDB 4JRXA 3QDMB 4UAOC 5L6YH 1SY6A 4KMTL 3O3DA 5DD6A 3OB8A 4XGZA 1U6AH 2UYLB 4NQCE 3QNXB 1JGVL 4KZEL 5DF0A 1EAPB 5FM8A 4PS4L 1UEMA 1N2RA 1IGJB 1V05A 3BGFC 3UJJH 1RZFL 4P5MB 2VC2H 4RX4A 3VRLF 1MAJA 3IETB 3MJ7B 3C5SB 4FQXC 1W0YT 5EA0L 1RQ5A 4PY7B 3EO9L 1XAUA 4K94C 4X9FA 4M7KH 3T0EB 1G84A 1AI1L 4NC1E 5CP3H 4JRXB 1JRHH 3GI9H 4ODHH 4HS8L 3GJFH 3VFGH 3NN8A 4JDVB 4HJGA 4LCCC 1DUZB 1YDPA 3QHZL 4JZJC 5CJ5A 1I1AB 4KGLA 1FE8H 4ODWA 3FQXB 4DZ8A 1I9JL 3P4OA 3JWOC 4ORGA 1K4DA 4A6YB 3MRBA 1J0IA 3MJ9H 1YEDB 3O0RH 4RFEA 3MUGB 5E94A 4XBGB 3EJYC 4NO2B 3N85L 2X4NA 4U0QB 4M7ZB 2OX5A 5D2LA 2YOCA 4K8RH 4PGCB 1K9TA 4NQUA 4L9LB 4GW5A 2OXGA 3ARBD 3GMQB 2CIIB 4OJFH 4U1NB 5JOPE 4XCEA 3G9AB 3MBEA 4O5LH 3U0WH 1LO0L 4XPFH 1E28A 5EUKB 5I8EA 4JJ5B 5D1QD 4Z0XB 4EUPG 1P7HL 4X5XA 4YDVB 1JNNH 3LQZB 5CCKH 4NN7C 2FL5B 2QTEA 5ICXB 3S37H 3SDXF 1FAKT 3X17A 3OKDA 1QSED 3OGCB 3C60A 5DHVH 1KPRA 4KK9C 5J3HC 5J8OA 3BRGC 1MCOH 2ZWLT 3RP1A 1BGXL 1FFOB 3B9AA 3ROLA 5DRNA 5JIPA 1F58H 3AS1A 5ADOH 1OAZL 3RWFB 5EBWA 3TO2A 5I1KH 4IRZL 5D7IB 2VUYA 4R3SB 1R3JB 3CSYA 4HFUL 2Q8AL 5JA8B 1GIGH 3CFCL 3IVKB 4JFZH 3H7BB 4IOIB 1QFWI 3SDXB 4LVOB 3RWJA 4IJ3C 4Y1AA 5GRVL 3UJIH 3ARWA 5F3HA 3FRUA 1DEEA 1B6DA 2ZG3A 5DQ9B 2IG2H 1BEYL 3LN4B 4NNXA 3KLSA 4Q2ZB 2BNRD 3FFCE 3RI5F 3FB8A 2OSLA 3MJ8B 1ZA3B 2FBJL 3UO1H 1ZLUH 2XTJE 1DBAH 5DC0A 2Y5TB 4ZFFB 1CDGA 3CXDL 1JK8A 2PTTA 3DGGB 4UDUA 1U3HD 4NO0B 3GJFB 1PDKA 5I75C 2V2XA 2EDYA 2R1YB 1KIRB 4D9LH 1YJDL 2NPLX 2VL5B 2YUWA 1JGUL 1ZGLA 1CYGA 3KR3L 1OTSD 1CK0L 1NMBL 4CW1B 4KJYB 1ZVSA 4PJDE 2MQ3A 2Q76B 2BJMH 1RUPL 3NA9L 4Y2DA 5D7JC 5CEXB 3O8XC 2BOBB 2FIKB 1LE9A 4HIEA 4OLWH 3WIHL 5SWSE 4TYUA 5C8JA 5HYJE 4U6YB 4AK1A 1U3YA 1INEH 3GIZL 2UZIH 3T2OA 3R0NA 5FKPA 1CWVA 5CSZA 2JLLA 1FLRH 2GJ6D 5CGYD 5D71L 2JJVA 1EJOH 3SE4A 4HK0A 1IGYB 5F9WB 3N9GL 4XPBL 4LHUG 3P77B 4ZUWA 1NL0L 1B0RA 1PYWA 2XWTB 1QLEH 4S1RH 5SWQA 5J1SC 2J1KA 1R0AH 3RKDD 4XVUC 5F88A 5BS0E 1MCSA 1LD9A 3C2AL 2E27H 2F5AL 3QFDA 1NFIA 2FEDC 3TLRA 4CVUA 3U83A 1C16A 1RURH 3O8XB 1U3HC 4FFZL 3CU1A 5DUPH 2AV1B 1HNGA 4NNYB 4O4YH 1D5BA 5KG9A 3T3ME 5EU6A 2IAMA 5DEZA 4DN4L 5KSAB 3P0GB 1FZOB 2XWBB 3OJDB 1KF9B 5CJ8A 3B43A 5B4MD 5CP3A 3BZ4B 5EORH 3EYOA 5FDYA 3U36B 2CGRL 1LHZA 3VFNB 3ZYJA 1VERA 3WFDL 1NFDE 1ACYH 1QVOB 4NWUL 3V52H 1CDIA 4ZYKA 1J1OH 3IDXH 3D85A 1A2YA 2WBJD 4TUJA 2DJSA 1IZJA 1RZFH 1G6VK 1HYSC 1U0QA 2VC2L 2Y36H 3ZL4H 5IESH 5LGJB 1A1OB 5F97E 1SJHA 1FCGA 4TNWF 1RZJC 2W38A 3FQTA 2E6QA 2IADA 5F3BA 5I2IB 3PGCB 1DQLL 3EYUH 4LGRB 5CWSA 2OL3A 2UV3A 4GMSH 5GJTL 1S7QA 3VXSB 5EBWB 2Y1VA 1BD2A 3EYFA 3KXFE 3RWIB 2D0FA 2LU3A 2VLLB 5HDLA 3PGFH 3RWCA 3BZ4A 1FC2D 2QQLH 1I9JH 1JNNL 1X5KA 1J7VR 4G6AC 3VXPB 4MD4A 2PTVA 3MBEC 2LE9A 3QRFM 4X5XB 1SMOA 2ZCLH 4POZC 5TQ0H 4BFIB 3BESR 1E4XH 5F6HI 2F54A 1TENA 2EYTB 1NFIB 4UT7H 4OTXH 4U1MA 5GPRA 1RV6X 1JTTA 4GG6E 4GAYA 3Q48A 2GTZA 5I1HL 4HAGA 1GH7A 3SEPA 3MRMB 1BEYH 2NY2C 1W0WB 1KJ2H 1F45A 5DO2C 3CLEH 1T4KA 2BSSA 4XP6H 4APQC 3T08A 4YUEH 2JB5L 3B8YA 5I15L 1MFBH 1PZ5A 2D7NA 5MHSD 2WZPD 2J8UA 1YEFH 1D6VL 3O2DA 4PD4J 2Y25A 1FORL 1OB1A 1BREA 3V4VL 1S5IL 2LVEA 4LSTL 5GGVY 1UH4A 5EU7C 1C5DB 2VDNH 4TSAL 3O6LH 1F2QA 5HVFB 5GISL 1SEQH 1ZVSB 1UH3A 4KJYA 1SYVA 4GMTL 3O41A 3S3PA 4X8JA 4LEXL 4XB7A 3IFOA 3PABA 2F54E 4ORZC 4PGEB 1JVKA 5E5UB 4A6YL 5I75B 3UPCA 2HVKB 3J8F7 3BT2H 3VGEA 1KTDA 3GMNA 3MBED 4MA7H 4JFPB 1KCSL 3JUZA 5GRWA 3VFTB 2D03L 5J13B 4LHQB 3UO1L 2PYED 1QRNA 4KVCL 4LMQI 1NGPL 3HZMB 4KHTH 4M5YL 5CEYB 3HRZA 2BNQD 2OM5A 1D5XA 2QHLA 1QYGH 3DMMA 3PWPB 4UTBL 3ZTJH 3PWJB 3ILQC 5HD8D