2FLRT

Novel 5-azaindole factor viia inhibitors
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
200
structure length
151
Chain Sequence
TVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGDERTLVRRNNTFLSLRDVFGKDLIYTLYYSVQAVIPSRTVNRKSTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/blood clotting
molecule keywords Coagulation factor VII
publication title Novel 5-azaindole factor VIIa inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 151
sequence length 200
ec nomenclature
pdb deposition date 2006-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2flrT00
3GKWH 2FEEL 2D03L 4MNGB 5T3XE 3LB6D 1RVFL 1KBGH 2IAMA 3UBXG 1F4XL 4L5FH 2LU7A 4YBQD 2DQCL 3EAKA 4U3XA 3QA3B 2VXVL 4P4RA 1MQ8A 1EXUB 3HI6H 5GZND 4OTXL 5B3JE 4ZSOA 4RMRA 4UT6H 3RJQB 1H3VA 4TNWK 1MCLA 3RIFK 3O9WC 1YEEL 4YHZH 2VDKH 4HH9A 4O51B 1M05B 1AGDB 3KWWB 5C6WH 3D9AL 2HTKD 1JPFB 4XNZC 1DTUA 5K33A 3SBWA 5I1LB 4P5MB 4TUOA 2AS5M 5BV7C 4DGIL 5BZDA 2L0DA 2W91A 5EUOF 4LGPB 3QHZH 1CGSL 2QSCL 4EI5A 1BJ1H 2ICWJ 4I4WA 4HJJL 1LDPH 3VMPA 1TJGH 2ED8A 3G6JA 1BVKA 3MRMB 2A83B 2YA2A 3LIZL 4JKMA 4RGNB 1BBJA 3QUXC 5GZOD 4U6TA 3G6AA 1Q1JH 1CQKA 1D5MB 1HINL 4JVWA 1A3RL 2L7UA 1G6RA 4G8GA 4YE4L 2ZCKH 3BWAB 3D39A 3HKFA 3P9LB 3QYCA 5GRXG 4XNYL 3VFGH 1HHIA 2VITA 5EC2A 4GG8B 3SQOL 3GB7A 5C2BH 4DN3L 5GS0D 4LU5H 3B9KC 3PWPE 1BGXL 3D0LA 4ZS6D 2EEDA 3K4AA 4YR6A 4CJ0A 2EYRA 1EGJA 5DK2A 5KN5B 2XWBB 3SGJA 1F8TL 5DC4B 5L2KA 2D3VA 3FN0L 3T04D 4FNLL 4MMXC 3UROR 3VXUA 3SPVB 3WIFA 3RTQA 5GGVH 1OAUH 1AC6A 1GGBH 2CRIA 4N90D 3CJJA 5SX5K 1XGYH 2ZSVB 1S9KC 4WW1B 4JFEB 4R97B 5FB8A 3T0VA 1U8HA 3LS5H 1M6OA 3HPJA 3HZKA 3WNKA 3B2VL 5KVDH 5HD8D 2NW3B 2AEQH 3P40A 4XC1L 1JPSH 2QR0A 1JZ8A 4F57L 3V6BR 5GGSB 3KYMA 1UVQB 1SBSL 4MNHB 5GRWA 4LCCA 4JY5H 4UB0L 4RFOH 3TT3H 3W5NA 5DTFB 3GSNA 1BVLA 3RGVA 3TBSB 3WHE1 3MBEC 1F4WH 3JV6A 2X9XA 2P47B 2IANA 4A6YH 3T4AA 2ICWI 4J6RH 3UAJD 1T0MB 3QIBB 5TFSL 3L3KB 5E5MB 3T65A 2NXYB 5EWIL 1N6VA 3IJSB 2Z4QA 2HTLC 4XNXH 3DUSA 2B4CC 5IT2L 4MJIE 3DX8A 4ODSH 5DMGD 4NQDE 1NFIA 3KYNA 4O02L 4QRTB 4HMDA 2VQUA 4Z9KB 4IIQA 1INDH 4LCWA 2LAAA 3DMMA 1FH5H 4WI3A 2DQFA 1G7QB 1L7IH 5KS9F 1MHEA 3QUZC 4PB9L 2EXWC 2FJFA 2ZCLL 2RBLA 5DRZB 3UTTD 4CVXA 4K3EL 2R1XA 1G7PA 2B5IC 1SEBA 1LO0H 1NAKH 1LO5B 3K0WA 3MV01 3GUTB 5D70L 4S2SA 2PTUA 4LCWD 2AAVA 5F8QC 5I73C 3UPCA 5J9PB 3RWEA 1CFNB 3QH3B 1YEDB 4GAGH 2E7HA 1S78C 3D87B 3UTZA 1FNLA 4WWKA 3CFKB 2IG2L 2J2ZA 3VFTA 1J12A 2ESVB 1RZJC 1C5CL 2VUOA 4PIRF 2BRRH 4APQD 1XGUA 1Z6JT 1FZJB 3DX9A 3KLHD 3L7EA 2R9HC 5BMFL 5DD1L 1O7VA 4PRBA 3KPLA 1P5UA 43C9A 4JKPH 4PJEB 3NAAL 5FDWB 5ADOL 3Q3GA 5CEYB 4KK5D 1M7DA 1EAPA 1RY7B 4PGBA 4LEXL 4ELMB 3HNTH 2VLRB 1R5WA 1HILA 2NY2B 3VJ6B 3BAEL 4JM4H 3NTCH 2FX9L 5CJ8A 3PQYD 3SGEI 3QHFH 4GRLA 5GISL 5L9DL 5T1KB 2HVJB 1H5BA 5F7WC 1BFOA 1UH4A 5SWQA 2P8LB 3RFZC 1QRNE 1YQ2A 3V8OA 1LP9F 3AXLB 1JYWA 4AQOA 2ZCHH 4PTUA 1IKNC 4MX7B 4HIEB 3MRHB 4IRSB 1G84A 5GJSL 5D5MB 4P4KB 1YPZF 2YMXL 4GAJH 1IBGL 5D7IF 2HLAB 1DBMH 5D7JA 1I85A 2L4OA 4OI7A 4TVSa 4EKXA 5KJRL 3C5JB 5B8CB 1I1FB 2Y5TB 1SJVA 2FB4H 3FB8A 1UH3A 3KPOB 5KSAC 1X44A 2Y72A 3IJHB 4X7FC 4U49A 5E0QA 3TWCL 5ESAA 4KKBD 1U91B 4OD2B 5DJAB 3PWUB 1C16A 5AZEH 2V5SA 4F7MB 3L5XL 1FAIH 2R0KH 2F74B 4HIIA 3MYJA 1MCOL 4P2RE 3CD4A 3Q2CA 1UACL 2X4OB 3WDJA 5DO2D 4WFFD 4ZS7H 5JOFA 4HLJA 5KOVC 1R0AH 3AREA 2FHFA 3VFRB 2BMKB 4JKWA 3NFSL 4P2QE 1QYGL 3QIUA 2IPKA 1LEIA 1VFAB 2J88H 4OZFH 1VPOH 3CFEA 5IVOA 1N4XH 3QPXL 4ZFGL 3QUYD 2ZKHH 2DAVA 4PJIB 4BKLB 5C0FB 1T1YA 5HYIA 4YUEL 3UTQB 3EO9H 1FNSL 1DLHB 4M6MH 4KAQL 2F54A 2Q7YB 4WU5B 1I7UB 3TNNA 3B2UD 4AENA 1GAFH 1MCPH 4YHLL 4TSBL 2X7LA 3FFCD 1UB6A 3S98A 5JXEA 4KROC 1ZHKA 1I8LC 3TFKC 3O4LE 1IAIM 5GJTL 4QRSA 1C5BL 4S1SL 3BDBA 4AMKH 5KSVA 4HH9B 4Y8AA 5HJ3A 1JNHA 4JFZL 5JPMA 4ZTPH 3LKOA 4QXGH 2CKBA 4H8WH 4MGXA 4Y19A 4U6XB 2I60H 4XNUH 3T2QA 5BZDB 2J8OA 1HHJB 4EI5B 4RFEA 3MLVH 3O8XA 4WEUD 3WJLA 1X4XA 2YD7A 1MFEL 5DFTA 3BYYA 5AWNH 1BPVA 1S9VA 2VR4A 1BBJB 3O3EA 1OTTD 4DZBB 1JNLL 1TNMA 4MS8C 5C6TL 3DOSA 4CN1A 1T21A 1WZ1H 2UWEA 1T66C 1GGIL 5HI5D 1U41A 1A9BB 3KYKH 5INCB 1OAKL 5D1QC 2H41A 4PYGA 2N56A 5LG1A 5I74C 4KJPD 4GG6F 3D3VE 1HHIB 5CBAA 2VITB 3QAZB 3GB7B 2DQEH 3HZYB 3DBXB 2ZSWB 1EUTA 1NFDA 3D0LB 7CGTA 3ROOA 4G8FA 5L2KB 1QUNA 1JMXA 1X5XA 1K5NB 1XCQA 4QRRA 3GO1H 1JGLL 1QD0A 4A6YA 1ZTXH 4JRXE 3IAGC 2XIDA 5CEZL 2EDDA 4X6CA 3IVKB 4TQEH 1U8LB 4GRWE 1A4KB 4KMTH 5F7DB 5FB8B 1U8HB 3RNQB 3OAYK 1M6OB 3HZKB 3M8OH 2DWEB 3T0ED 2QR0B 4H25A 3FQNB 4F8TA 2R69H 2ZUYA 5DC9B 2XQBH 3BUTA 2GSGB 3O2VH 3SN6N 3WIHA 5LGHL 5EULV 3EYQD 3OB0K 1FNEA 4PGDA 3VCLB 2DBLL 1X5KA 2VXQH 4R0LA 1DDHA 2LAGB 3GSNB 1BVLB 3RGVB 3JV6B 1SY6L 3LKQA 2IANB 2VRAA 1EO8L 1AGEA 1CN4A 4HUUB 1FYTE 4Q9QH 2F5AL 4Y7MA 1TJIL 1HQRA 5GS1A 4XC3H 3QZWA 3SDDC 4ZXBA 3RVWD 1ZHBA 5D2NE 3MLWH 1ORSA 3DX8B 3ZSTA 4X4ME 1SYSA 5ISZD 4C54A 2YPLA 4TVPH 1Q72H 4GAYB 2WZPD 1LEGA 4LCWB 2W0PA 3DMMB 5LGJA 3STBA 3BP4B 4M93C 3MA7A 4KDTC 1NCUA 3SKOA 5E6IC 3FO2B 4P46D 1MHEB 3KR3H 4YBLB 5L8LB 5HDBE 1E28B 5D2NC 5DJDA 2CDFA 1WFUA 4XPHL 2ITCA 3CU7A 3HUJA 4ZXBD 4JY4A 4W81A 2FHBA 4APQB 3JV4A 4JGJA 3GMOA 4BFIB 3QG7H 3QNYA 4EVNA 5CCKL 3VXMA 5C0ND 2WLZA 4ZNEE 4F7EB 4IOIA 2O5XH 4HS8H 3UTZB 4L29A 3AY4C 3CLFH 3N50A 4LKXB 4TNWF 3OSKA 2HWZL 1S7TB 3STZB 3RIFF 3T3MF 4ETQA 1JGUL 1DVFC 2B7DT 2V17L 1I3UA 1XGUB 3UX9B 3PQYB 2YZ1A 1HIML 1OP9A 1C7SA 4C58B 4G80A 4U7MA 5BCAA 4OD3L 2GCYA 1NQBA 3PF2A 3EHBD 4FFYL 4KWUA 3LV3B 2A1WH 1WZKA 1FGVL 4PJ5E 1T3FA 4GS7B 1F2XK 1M7DB 3OB8A 3DVGB 1EAPB 4PGBB 1A7QH 1X3DA 3RJDA 1HILB 4JEGB 5MI0C 2JCCF 3VI4F 4RRPA 4U1HA 1INQA 4PJXE 4JFDD 3TBVB 1H5BB 4FFZL 1R3HA 1BFOB 3CFCH 4BZ2H 4Y5YA 4JRYA 1Y18B 1UT9A 1BFTA 4JFQA 5I1EL 2P5WA 4MQ7A 2JK5A 4FQJL 1JTPA 1S3KL 1WWBX 3EYUL 1T4KB 1HKLH 5FAAA 3DRQA 3HR6A 2EO9A 1I9IH 1BFVL 3C8HA 5JXAL 2IQ9H 1U95A 1E4JA 1HYSC 1A47A 2WLYA 4F9PA 4Y4HC 5C09E 4OV6F 2MQ0A 1J86A 4LSVH 1DE4A 1KEMH 3DV4A 5T3XH 3WFHA 4FQXC 1IC4L 3A67H 1ZWIA 4JRYD 5CP7B 5IMOA 4JDVA 3P4OB 1F4HA 2R0LH 4OF8A 1Z0NA 3FB8B 4R3SA 2DIJA 3AM8A 5ESAB 4M5YH 4OZFA 3RVVD 5BRZE 4NN5B 1T22B 1PG7X 1T20A 1II4E 3QBTB 3OZ9H 5I8CA 1C16B 3R1GH 2V7HA 2WBWB 5I1GL 1OWWA 4Z78A 1IRAY 3ARQA 2GJ6A 3F12A 2XG4A 2XA8L 4HIIB 3ARXA 5L2JB 3QUYB 5SX4H 4HUXB 3MYJB 2GJJA 4XMPH 1UWGH 4KV5E 2F5BH 1EH9A 1MRCH 1RZKL 5JOFB 1QHOA 3WLWC 4LDEB 5ENWA 3VWJC 3C6LC 3IDIA 4L4TA 4IRZL 1IKFH 3MPCA 1OP5K 2C4XA 1TQCC 1Q0YL 3QCVL 5ITBL 3FFCB 3C09C 3UTSE 4IMLA 5ID1B 4PY7A 4MA1B 2JELL 4JDTH 3HG1D 5GIRA 3OJMB 1H3TA 3MRPA 3GSQA 4YXLL 2YPVL 3C5SB 4ODBD 2VKXA 4FZ8L 1AHWB 2F54B 5DT1L 3T0XA 5GS3A 4UINH 4L4TD 3TNNB 4JY6A 4M6AA 3CDGA 3O4OC 3P0YH 1T83C 4JO2L 4QCIA 5K9KA 4U0QB 1VEOA 4K8RH 2NY5H 3BDYH 2FCBA 3TO2A 4NBYB 3WSQH 1MCRA 3ZYJA 1ZHKB 3MRDB 1QKZL 1K2DA 1FFQA 3L9RA 2NY7H 4AL8H 1DFBL 5F7FA 2BDNL 4NYLA 3D0VA 1RFDL 5KSVB 4ZOEA 5HJ3B 4FXLA 1KJ3L 2VN7A 4B53A 1OLLA 2AJUL 3VGDA 4DCQB 2VC2L 4B0MM 3LKOB 2CKBB 4LSUH 3OV6A 1YYLL 4C55A 1QEWA 3T1FA 5ALBL 1URLA 1S9WA 3VFSB 4Z7WA 3RUGF 1VACA 4RFEB 4MSWA 1UM6L 3O8XB 3ZYOA 3RWFB 4BK5A 3I6GA 1RSFA 5LQBH 4AJ0A 3W5MA 3MNVA 4Y16A 3SE9L 1S9VB 4OGAC 2I24N 3O3EB 2VLME 5C08E 5CKAA 3TPUA 4MXQC 1A7RL 1ZLVH 3QDJE 2BJMH 4X5LA 4YH6A 3QIWA 4U1IA 1DZBA 3QCUH 2HJKA 3UJTL 5TF1L 2AJXL 1S5IL 5T3ZE 4MQXC 1MHHA 1U3HA 2RR3A 4WHTA 2YD8A 1KB5L 1ZSDA 3O2DA 1U8QB 4PJAF 2JJVA 3F7RA 4NUJA 2CLZB 3C8DA 5JUEH 1CICA 4E42B 1IT9L 2AEPH 1TIUA 3F7YA 3MA9L 3BGFB 4QT5A 3KHQA 5CBAB 2Q86A 5E2JA 2CR3A 5JPNB 1T5WB 3E3QE 3RX7A 4X0KA 1YN6A 3CMGA 1WWWX 3FRPA 2MQCA 5JR1H 4PRPA 2PW2A 3T0EB 3EIFA 5IP4A 4KZEL 4JZOB 4V2BA 5DJCA 1MQKL 3PDOA 5J1AB 3MLRH 3E3QC 4HFUH 4ALAL 4U3HA 1F3JB 3QQ9D 4Y4KA 2NQCA 3OJDB 1FBIL 1PZUB 3CGTA 5DEZA 5DRWB 4XX1G 4ACPA 5CD5C 4DVRL 1OGAE 4HBCH 4GBXC 4PRPD 3IU4L 4H25B 1JYXA 5FUZL 4OT1H 5EZOH 3K8MA 4R7NA 4HWZA 1X5GA 1L0QA 5K9OB 2ZNXA 2QQNH 1G7JA 5KSUB 2HMID 1F42A 2V7NA 1J0ZA 2Q8AH 3D25A 4R0LB 3RWJA 2X4NA 4K23H 4WUUA 5ISZB 1A6TA 5CHNB 3E0GA 3O3AB 2AK1L 1N5YH 4FZEL 3T2NL 1AGEB 4O9HL 2R8SH 4JQVA 2V2XB 3RBGA 4Y5XC 3HNSH 4QHNA 2F8OA 3D69B 1C12A 1FPTL 5GS1B 5J89A 15C8L 4ZXBB 3UYRL 1CFBA 2ARJQ 2OTWA 2HJLA 4QOKE 5GS0H 5E2WL 3EW3B 3V7AG 3BXNA 1SYSB 1K4CA 2A6DA 3B5GA 3VMOA 4WRLA 4XPFH 1JI1A 4G5ZH 4BUGA 4XMKL 3A0OA 2IMMA 1DEDA 1ACYH 1ZA3A 3MA7B 1R5IB 1NCNA 5TE4L 3AFLA 5CBEB 5DJDB 4X4YB 4FP8L 3I84A 1RPQA 2ITCB 2YA0A 4OD1H 1CL7H 5BO1L 3TN0C 4JY4B 5IK3A 5I16A 3PL6A 3NFPA 4E41D 4Y2DA 5IQ9A 4DFIA 4QTHA 2WWMD 1UM4H 2FNBA 1J5OL 3JV4B 2HFEA 1T1WA 4M7JL 4YLQT 1CE6B 3STLB 3VXMB 4AEIH 1J9CT 4PS4L 4X5XB 1L7TL 3CVIL 4MAYD 5HHOE 3TVMA 3PXJA 4UILL 1YN7A 5FOBB 1GC1L 3NCFB 2L7JA 5AYQA 1CFVL 4OIAA 4HAFA 1FNGA 1T7ZA 2W0KA 4L29B 2Q6WB 2OSLA 4QXTA 1QLRA 2FWOB 4ZFOB 5ICXA 3ARGC 1RZFH 3MACL 5TPWH 1BLNB 4ZFFA 4PJHA 2XN9D 3HNVH 2AV7A 3M07A 4HEPG 2E27L 2VXTH 5DQJA 2X4SB 4HJGA 3G9AB 4N8PA 3S3JA 3LQZA 7FABH 1T3FB 1MH5A 4HG4J 1A14L 2DMBA 3EO1B 2P5EE 1QPXA 1A2YB 1FORH 2UVFA 1CE1H 2GAZA 2C3HA 3OF6D 5FM5M 3T0DA 4K71C 4N9OB 5F44A 4JO1H 4NNYA 1KG0B 1R3HB 4NC0B 4JRYB 1VA9A 4YO0B 2VN4A 5FF6A 3NCJL 4JFQB 2Q87A 3MGTB 2P5WB 3HFMH 4MQ7B 2JK5B 3DV6A 2C3WA 4KPHL 3BPLC 3F7VB 3EGSB 3O9WD 1IGJA 4PLJC 4YHPA 1LE5A 3DRQB 3EBAA 1WITA 2ATKA 3H3BC 5A2FA 1RJYB 4YHOL 2PR4L 1BD2E 1H0DA 3QUXA 1KNOA 1P6AB 1WWAX 3DHJA 2VDPL 3MJ9L 1WAAE 3O11A 1UFUA 4HGKC 5I17A 4JDVB 1FL3A 3BN9C 1MFCL 3TCLA 2JJTC 4R3SB 1DBJH 2V6HA 4WI9A 4JVUA 3VGBA 3GM8A 3HC3L 1EHLL 4LPWA 4PJ7E 2ZUTA 3KVQA 4MCZA 4CBPA 2V7HB 2B1AL 4Z78B 1KN4H 1JWSA 5IIEA 4NN6C 3F12B 5E2TL 1KJMA 3K7UA 5EUOB 3MNWB 3MUGB 3JZ7A 3N9GH 1S8DA 4UOJA 1LO3L 5TH2B 3MOAH 4PGJA 3KPNB 1MJUL 5ENWB 2DM3A 4P57A 3IDIB 4L4TB 2FLBT 3NA9L 4H26B 5GRUH 3WMSA 4IMLB 2F8VA 4TRPL 4EDWL 2G60L 2VWEE 4MDIA 3B9KD 5FKAB 1NAML 3GSQB 2MOVA 3OAUH 3R06A 1HH6A 3VU2A 5DGRA 1SEQL 2YHGA 3TO4D 3LMJL 3V2AR 2JB5L 1JP5A 4JQIH 1MRDL 2VWEC 1OD9A 4X99A 4IJ3B 1KUMA 3ZDXE 3PWPD 2CIIA 4QCIB 5K9KB 4LARL 3IXTB 3T3PE 5ALCL 3MBEA 3TO2B 1KJ2B 2PUQT 3WHXA 2H32H 2CRMA 5E1AB 3SDAD 1PG7L 4LMQE 1KIQA 4HKJB 3L9RB 5J13C 1IGFL 2GITA 1OAYL 3MLUL 3WFBH 3CZFB 4NYLB 2X4TA 1UZ8A 4OM0L 3THMH 3U36A 1TMCB 4MXWL 4HS3A 4NFDA 1ZT1A 3G9VA 4NNPL 3G6DL 1IFHH 3VGAC 4XVUC 4TOYH 3LN4A 3RGHA 3T1FB 3SE8H 4NKIL 3P0GB 5HGBA 3OKKA 3AUVA 4JB9L 1S9WB 1PY4A 4Z7WB 4NWUL 3HMXH 2ATPA 5L6YL 2GJZA 3I6GB 3QUZA 1BM3H 5DUMH 4C59B 4PJCE 4OF5A 4Y16B 5GS2D 4NQDA 2GK0B 3ZTNL 3REWB 4DOHE 3DXAD 4FQCH 4URTB 4PGEA 2DWDA 2W59A 3QULA 3MLZL 4R26L 4D0CB 4OAWA 4MD0A 4M6NH 2DD8L 4NWTL 4N0UE 1OSZA 3KPQB 2AEIT 3UJJL 4OZHF 3NOIA 3VH8A 4P9MH 1ZE3C 2HJKB 5HGAA 4KRPC 3T77B 1T1XA 3BE1H 4WHTB 4POYA 1ZSDB 2VAAA 3GBML 5F7YC 5DHVA 4MJID 4TNVK 4J3UA 4NQDD 4XP5L 4J1UA 1DBAH 5I1HL 3F7YB 4OI9A 4WFHE 3LEYH 3KJ4B 4QT5B 4OF0A 5DJZA 2Q86B 4P59L 4IRJC 1NBVL 5ICYA 5IVXE 4X0KB 5KANG 3DJ9A 3PWNA 4BFBD 5I30H 3ULUF 4FQLH 4NRYA 2BNQE 2H3NA 4PRPB 2CRYA 2PW2B 4YDVA 3ARZA 1W0YT 4PB0H 4FQQB 2BSRA 2WUBH 1WFNA 5DRNB 3S37H 3ZKXC 4PJ9C 4F9LC 1DJSA 3PDOB 3D2UA 1QBAA 5GSRA 1CDIA 3MRBB 4Y4KB 3UDWA 3PGFL 3FTGA 1AQKL 1XIWA 3C5ZC 4KTDL 4XBGB 2A74B 5D7LE 3N85L 1X6LA 1LILA 4K7PX 3I2CL 2FHCA 2LTQB 3TA3C 3KPSE 3M1BB 5E7BA 5F9JA 4LHJB 1WFTA 4MNQE 1YYMH 4XHJC 3G5YA 1RZGB 2HG5B 2BVOA 2MPAL 1AC0A 3X3FH 5IW6A 2BVYA 4RAHA 1IKNA 2Y1VA 3SOBH 4LPUA 5DEGA 3ETBF 4OLYL 1BIHA 3D25B 3RWJB 5HDQL 4WUUB 1QBLL 4L8SB 5CZVL 3MRQA 3FQUA 1J8HA 4I3RH 4S0TD 3OL2A 4QRPE 2HKFL 1MJ8L 4NCC2 1IGCH 3MCLL 4Z77B 1KLGB 2CIKB 1F5WA 1INEH 5KVEH 2DLHA 2UY7A 5KSAA 5J11B 4LGSB 2DTML 5BOZG 3ZMRA 2G9HA 3KPPA 4E41B 2OTWB 1NMAH 2X70B 3RAJL 4NHUA 4YGVA 5I8OH 4OFKA 4WCYH 3BRDA 1MREH 1T5XB 3L3DA 5CINH 1QRND 3KHOA 3TBWA 3P9MA 3X11A 1U8MB 2ZUQB 1F11A 2E3VA 1RZ8A 4M7KH 2ZPKH 4OCYH 5FUOH 5L7XH 2DDQL 1D6VH 2W0FB 1DCLA 4LPTA 1RJLB 3WN5B 3OAZK 5I16B 3NFPB 5IQ9B 3IKCB 2EECA 3QRGH 4JHWL 2HFEB 2P44B 3RWHB 4P2RA 4OSUH 4KQ4L 1CDYA 5BW7C 3EFDL 5BS0E 5CLTA 3U4EA 3B3IA 1MIML 2KZ1B 3WE6B 3BN3B 3MO1A 4I9WE 4X9FA 1YN7B 3JWDL 4RGMC 3V5HB 2GIYA 1YEHH 4XWGH 4HQQH 1FL5A 2J3SA 1UJ3B 4P2QA 2AVGA 4KKNA 5IHZA 3E6FA 2OSLB 1QLRB 3EZ8A 4O2CA 4JPIA 1IAIL 1D5ZA 3ORJA 4YAQB 1IJ9A 1ULVA 2OP4L 3GMMA 1SJHB 4KVNL 3NCCB 3X3GH 4YDKL 2XICA 3WIIH 3F7QA 5J3HC 1I8LA 5DQJB 3QXAB 4HJGB 5IOPA 4U2ZA 1QQDA 1LVEA 4DKDC 3O9WB 3MOBL 1D5IL 1W0WB 3H8NA 5JLZB 2EDBA 4M1DH 5HY9A 2R0ZL 5IGXH 4NM8L 2IALA 1JUFA 4Z5RA 1CD1A 1PKQE 1FLRL 2GAZB 5BV7B 3INUL 3SGDI 4U1NB 3O4LA 4YZFE 4NNYB 3MLXH 5DD3L 4YX2H 3S35X 4J8RA 2ADFL 3FN9A 1Q9LA 5FF6B 5E2UH 3SDYL 1NGWB 5A16A 1BOYA 5GRVK 4LLWA 4LHUD 2AP2A 1P1ZA 3EYVB 4N0YL 5ADPL 1J0IA 2IFFH 3U82B 4NQVA 1F6AA 1TJHH 5D71H 3IT8D 4HC1L 3Q0HA 4IHOA 3V4UH 1H0DB 2VLKD 4JO3H 3K1DA 4HK3J 4WTXA 2QQKL 1A7OH 3B9DA 3BH8A 1TTUA 3O11B 4LPCA 5EIVA 3TYGL 3IDNA 2LQRA 4J3TA 1P4BH 3TCLB 3ISWA 5D1QA 3HMWL 1ZLSH 2Y25A 5IBUG 4YHMH 3C2AL 4UNUA 2VERN 4JJ5A 4NO0D 4H0GA 3T2PA 3O41A 1ZK9A 4OLVH 3WKML 1FL6B 4XVTH 2EKJA 1JWSB 4MS8D 2KUTA 4WUKH 2VDQL 4LLYA 3B9KB 4OCNC 3BQUD 5IJVB 5C0CA 5IM7A 1N8ZB 1S8DB 3KDMB 5KSBE 2X6MA 5C07A 1OL0A 5D1ZC 1U2CA 3WO3B 1HH9A 4CVUA 4ZTOL 1KBGL 2AJ3B 3GIZH 1M71B 4LFHG 5D72H 4NIKB 3PWPB 3VFWA 2F9BT 1UADC 3KPMA 1NSNH 2CLRA 4PJDF 4MDIB 3CAFA 4UQ3A 3PXHA 1YQVL 4GQ9L 4YHZL 2CGRL 2VDKL 1KCVH 3MLPA 3R06B 2XA3A 4JRXA 1HH6B 4LLVA 3NZHH 4I77L 3PHOA 4KKAC 2GFBA 3O6MH 3D3VD 5FYKL 1YMMA 1I7ZA 4OFPA 3HMXA 4GG6B 2X1PA 1ZEAL 1DSFH 1BF2A 4MMZC 4NQSA 2CIIB 3MR9B 3IAPA 3ECBA 3QCTH 3BKML 4GUPA 3PWLB 3WHXB 1EDQA 4B50A 1KIQB 3SDXA 1Z5LA 4EUPB 2CXKA 2ID5A 4JRXD 4OZGE 3OBAA 1BBDH 3QNZB 5D8JH 1UZ8B 4YIQA 3A6BH 1G0XA 3RY6C 3DXAB 3WKNA 2NTFA 2F19L 1ZT1B 3MRKB 3RDTA 5HYQA 4HCRA 1RULL 3LN4B 2V5YA 4L8CA 1TTGA 1FYTA 4KI1A 4OCMC 3OKKB 5M94B 1WBZA 1HDMA 4WNQA 3DRTA 5DZLA 1EBAA 2NPLX 1JHKL 1F2QA 2DOCA 4KDTA 1FZOB 3FQWA 4M62L 1YEGL 1E6JL 2GJZB 4NN7C 5D2NA 3UEZA 1EHXA 2X89A 4MJIB 3L7FB 5MENE 5CZXC 4NQDB 2B5IB 3SDDD 3GSXA 2D03H 3UJIL 2DYPD 3GSRB 2DWDB 1F4XH 3W0WA 1P4IL 5EC1A 2DQCH 5DUBA 1QR4A 1FYTD 2VXVH 1S7RA 1Q94B 2BSTB 3GM0A 5DJ0A 5I73B 1NC2A 2X4RA 3ZHLA 5E6ID 1T1XB 1YEEH 1ZGLP 2BHZA 1F3RB 2OYPA 2RQ8A 5DHVB 3AY4A 4NKDA 4J1UB 3RVXC 3PIQB 1OP3H 1DVFA 5AAWA 4N0FA 5DJZB 1X5ZA 4DGIH 4MHHG 5B4MC 4OZ4B 3CH1A 1N64L 5C92A 3PWNB 1AR2A 4NO2B 2Y36L 1CGSH 2QSCH 5DJ6B 5IB3B 2H3NB 3NABL 4IM8A 4HJJH 1DBKL 4YDVB 4RIRA 3VD4A 4EN3D 2DLFH 3PDDA 3ZT6A 3LKPB 5MEPA 3AS2A 3DVIA 4OBSA 3LIZH 3NIGF 4LDLB 5GSRB 5IBTL 1V3KA 4HKBA 1DVFD 4KDWA 3FTGB 3QDGD 4U1LA 1HINH 3V8CA 4YPJA 4PJ5A 3VXNA 4F8QA 2OCFD 5FK9B 1A3RH 3ZE2E 2MKWA 1TVHA 2K7QA 5TE7L 4YE4H 1S7SB 2BVOB 5BOPA 4LLUA 1N3NA 4ODSL 4XCEA 3MRGB 5EA0H 4HKXA 1BWMA 4HV8A 4PY8J 3SJVE 5DEGB 4PJXA 3D85D 3CZJA 1J0KA 1J1XL 3QZWG 1ITBB 4TSAL 2P42B 4DN3H 3ARDA 3FQUB 3CVHL 1BGXH 1VGKB 1PX4A 2XPGA 1QRNB 4UNTA 3TEUA 2HH0L 1EIBA 1MJ7L 3BRGC 1F8TH 3FN0H 1X5AA 4R90L 4FNLH 5FYJL 1ACZA 1WC7A 5KSAB 2GY7B 4Y1AE 3REVA 4KKLC 2G9HB 1QLFA 4WV1C 4XBEL 1PYWA 1FFPA 2VJXA 3L3IA 5GHWH 5EG6C 3BZ4B 4PG2A 1CU4L 4Y4HD 3I3EA 2X1QA 3F62A 3TBWB 1MLCA 3B2VH 4WW2C 2APFA 5J06A 4XC1H 4FQXD 1RZ8B 2AJVH 5BRZA 2HVKA 1JPTL 4F57H 1A7BA 5I2IA 4KC3B 1YDPA 1FRGL 4R4NC 4N5UA 1SBSH 2C1PB 4K7PL 3VWJA 3C6LA 5EO1B 1JGDA 3FONA 2H6PA 4UB0H 1YJDH 5FV1L 2VH5H 3DURB 5C09D 5BJTA 1A1MA 5HHPA 2PYFA 3U46A 1BEYL 1KCSH 4TN9A 4N8VA 3LKNB 3R0NA 3R0MA 3U4EB 2P1YA 2DIAA 2E9BA 4H0HB 5CMAA 5TFSH 1B6DA 3MO1B 1RZIA 2HKHL 5LVEA 3U1SL 4KQ3L 1XGQB 5EWIH 4TSCH 4P2QB 3E6FB 3NTCL 3IRPX 3C6LD 4O2CB 3UTSA 3BDXA 4FQIL 4CRPA 3AMLA 5I66B 5IT2H 3QHFL 1JCKA 1D5ZB 3B9EA 1T83A 2C26A 4WI7A 4FFVC 4O02H 4Q58C 3SDCC 2X41A 2FRGP 1N7MH 4KROB 4Q0XL 2HLFD 5KTEH 4RRPG 2ZCHL 5IOPB 5F6HJ 3IFPA 2FSEA 2A6IA 3EYFB 4P9HC 4LHUB 2ZCLH 4K3EH 2VDOL 4JQXC 4OFYD 4WEBL 2ENYA 5T1DL 4H1LA 5JW5A 4GAJL 1CD1B 5GPRA 4LHQB 5D70H 4IS6A 5CJBA 3F58H 3HRZA 3O4LB 2FB4L 2Z93B 2A6KA 1P69B 2YD1A 4L8DA 4NQCD 3MFGB 5EZJA 2EH8L 2IG2H 3EDEA 4RX4D 4UUJB 3PV7A 1JGEB 1C5CH 1FAIL 4XX1E 1UEYA 3ILQC 4NO0B 1B0GB 2R0KL 1JHLL 3QDMD 4OZFG 3S88L 1UWXH 5F88B 4YHIB 3V5DA 3PABB 3JTTB 5DSCA 5BMFH 4M7ZC 3EDDA 1ADQA 5I9QC 2GUOB 4X9HA 3NAAH 5ADOH 4JFPA 5D1QB 4OQTL 1MFBH 3IFNL 5FGSA 1WBXA 4G42B 4LEXH 4XB7A 1U36A 5I74B 5CZKA 3BAEH 2D9QB 4OGAD 2FX9H 3OR6A 3O41B 4G7VL 1N4XL 1A1OA 5GISH 5L9DH 1TQBC 5TGBA 4LLYB 2CRZA 3AGVA 1ZHLA 1CD0A 2EYSA 3FO9A 5E4EB 4JFHE 1GAFL 3QO0A 2E6QA 3GMRA 2H45A 1HHHA 2R1YB 3D3VB 4JANA 4JREC 4AIZA 5C08D 5CEXA 3S35L 2BNRA 3QDJD 4K3GA 3VFWB 1EEUA 2YMXH 3BMWA 2XZCL 3UBXI 3BD3A 1IBGH 1IL1B 5JTWA 4WU7A 1R3IH 4HKZB 2IEPA 4H88L 2OMNA 4UQ3B 3NZ8A 5F6HI 5MP6L 4R2GC 4AMKL 4HUMB 5KJRH 4CU8A 4GBXA 4JRXB 4OFVA 4DEPC 5H35A 3TWCH 1TPXC 2AW2A 1FNHA 3SKNA 1E4XI 1NBZB 4GRWB 3EOAA 1Z2KA 1VADA 3VFPB 3HE7A 2I60L 3VD9A 4XNUL 4LVEA 1OGAA 1U8NB 1GCFA 3ECBB 2J12B 3U9UA 4GUPB 2ORBH 3MMEA 1P7KB 3MLYL 4J3XA 1CT8B 1YA5A 5CD5D 1Z5LB 5F7MC 5GGRA 1CF8L 4Y5XA 2MCPL 1VKXA 5DEFB 2Q3AA 4I5BA 4RAVB 3BH9A 1T03L 4I48A 2N4IA 4Z7VE 4YIQB 1B4RA 2PCPA 3SDDB 2DYPB 3NFSH 1QYGH 4F37K 1FV1A 5L8JB 1OGAD 1NANH 2OJZL 3KYKL 3F5WB 3QI9C 1FYTB 1A6ZB 4QTIH 5SWSE 1WBZB 3QPXH 3ULUD 1HDMB 4WNQB 1XGPA 4ORGB 3Q6GL 1MHCB 4YUEH 4M93B 1FNSH 5E6IB 4KAQH 3FQWB 4YNYA 3PP4H 1HSBA 4QOKA 2VLJD 1MHPH 3RWGB 3P0VL 4YHLH 1FZMA 4TSBH 1NUGA 1E4WL 2MKLC 2Z91A 1S7XB 1KPRB 3RVTD 1H8NA 2MMXA 1I7TA 5EC1B 1KIRB 5DUBB 1HQ4B 2YSSA 1EEZB 1NLBH 3QEGL 5T1MA 5GJTH 1TXKA 1C5BH 4S1SH 1I4FA 1CGWA 5GRVL 3FRPG 4R7DA 4NKDB 4JFZH 3NA4A 1MAJA 4AIXA 3TN0D 2EO1A 4KMTL 3ARGA 1DVFB 4Y0GA 2NW2A 4N0FB 4NC2B 3KXFA 4ELKA 3QDGB 4Z95L 5HHOA 4ZG1A 3CH1B 2R69L 5MEOA 5IQ7L 1PG7W 5ESQA 2UY6A 3O2VL 4EIGB 1ZA6A 3GRWL 4AT6A 4RIRB 4NPYA 1MFEH 4KDVA 4E0RB 4GKNB 4I0PC 4JG0H 4P99A 1CDCA 1XR8A 3DARA 3QO1A 3ARGD 2V2WA 3D85B 1TLKA 5FFLA 3RL1A 1JNLH 4YFDB 5C6TH 2E7LC 5MI0B 4L3CB 3BHBA 4JJHA 3VDCA 5K9QG 4Q9QL 3L95A 2DM2A 5HHOD 4Z8FH 4U1LB 1GGIH 3VXNB 1AR1D 1W72B 3AAZA 4M7LL 1OAKH 5GS2H 4PLKD 1G9NL 3KNBA 2P5EA 4Q9RL 4LLUB 2DB8A 1DUZB 5HYJA 2VDLL 1YC7A 3CC5A 5BVJB 4PJXB 4OCXL 4MAUL 3MRRB 4YPGB 4Y4HB 4OQ1A 3V6FA 2XPGB 4Z0BL 5AEAA 4FQXB 4ZSOE 3VG0L 5D96C 4XBPB 4JLRB 4PLNC 1C08B 1YY8B 4U33A 3CXHK 5F9DC 1JGLH 1WC7B 2JJTA 4X6DE 5KS9A 4GMTL 2P5ED 5CEZH 3UC0L 4PLJD 5I8KL 2WIIA 5CJXC 1QLFB 5C09B 1WAAA 1FFPB 2WBJC 6CGTA 5SWZE 3H3PH 4QYOA 5E8PB 1PJ9A 3JTSA 4Z7QE 5EOCL 5FEBA 1ZHNB 4EZMA 5BRZB 2HVKB 2VZUA 1XF4B 5I2IB 4PJ7A 4KY1L 3SBWC 4EQ2A 4LMQI 4RDQF 5LGHH 5BXFB 1BD2D 3VWJB 3C6LB 4MVBC 3FCTA 3C87A 3KJ6H 5EBMA 5BJTB 5HHPB 1A1MB 3U46B 1TQCB 1F00I 4YDIL 2LFGA 2VTFA 3C09B 4QNPE 4WTWA 5I1DA 2CJUL 4J2XA 2EDYA 3UMTA 2YA1A 3N1FC 5T5FL 4E5XA 1QSED 2D7OA 2F5AH 3MROA 5CMAB 5JHLL 4KI5F 4IOSD 1X4YA 3JWOL 4MD4A 4X4XB 1MEXH 5I76A 2HT4C 5IEHA 3FN3A 2NX5E 3PWJA 1R3JA 4ZPTB 4O58L 3IB4A 5EOTA 3GHBL 2X9WA 3O4OB 4HD9A 4RCAA 1NGPL 3LQMA 3U0WH 3Q1SL 2VQTA 3ET9F 2ARJA 3QEQE 4LPXA 2IMNA 4PJGE 5D6CB 5A2JH 1HKLL 5C7XH 3IFPB 1SYVA 4DK3A 3VXUE 2FSEB 2ZUUA 5IB5A 2XFXA 2VLLA 4OIBA 2AXFB 2J4WL 2NR6C 3BYTA 4H1LB 4UIMA 5T1LA 4CL7A 5JW5B 4KJWC 4LSVL 3QDMB 5DMYA 3ULVF 4XCYA 5EUKA 2EXYD 2IFGA 3BSZL 4IS6B 3A67L 5B38A 5CCKH 3K8KA 3HRZB 2R0LL 2FX7L 4AK1A 2A6KB 3ARBA 4K7FA 3RTQC 1BAFL 4M5YL 2HJFA 4D94A 1FSKC 4L8DB 2CUHA 1QFPA 3U7AA 1VCAA 4PV8B 5DDHA 4OUUB 2HWZH 4IEFB 1JGUH 4PJ8C 5J4MA 1GPOL 3BZEA 1UEMA 2YUWA 4XVUD 1HIMH 32C2A 1P53A 4HUVA 2F5BL 3U4AA 4OD3H 1L9MA 4YHYC 1HNFA 5EZLA 3FOLA 4LCYA 1BP3B 1HOCA 4PJCA 1FGVH 2VABB 3BP5B 4MB5A 1OTSC 5HYEA 3VFVA 4AG4L 5MEQB 4PJBF 4D0BB 1WBXB 2ZUXA 5C08B 1XZ0B 1F97A 1N0LA 3HS0A 3QDJB 4G8EA 3OR6B 2K3TA 4YHKL 1WCBA 4YHNB 5CIPA 5ACZB 1MVUA 2VXUL 4FFZH 5FYLE 1XF5A 1ZHLB 5IF0A 5I1EH 4NO5A 1LE9A 4Z7UE 4FQJH 3MSPA 3EYUH 3P0YL 4KRPD 1LEKA 1HHHB 5JMOC 4AIZB 2DQJL 1BFVH 2DJ4A 3KYOA 4K8RL 2NY5L 4PJ9A 4F7TA 4F9LA 2GTZA 5IVXA 1CLCA 4P23A 2EDQA 4LP5A 5SX5H 2X09A 3CX5K 2BNQA 3C5ZA 3QWOB 4IRJD 4AL8L 4PJFE 4PJEF 5EIQA 4BQ9A 1IC4H 3TA3A 4L8BA 3NZ8B 1U93A 4LSPL 5FM5O 4RMVA 3BESR 1D5XA 4GBXB 5H35B 4NJAL 3GJFH 4ELMF 3SQBA 1WIOA 3X13B 2EEBA 1V3MA 4WFHD 4LSUL 3SKNB 5I1AA 2YD2A 1ZLUH 4WY7H 1JPGB 1A3LL 2CDEA 4MD5B 4PJ9D 4Z0XA 1MCQA 5I1GH 1AGFB 2FEDC 1OGAB 3KPSA 2XA8H 1JGVH 4WWKC 4OCRL 2XQYG 2JJSC 2YUVA 3DLQR 3TA3D 5T5NF 1JL8A 5E00A 4PD4K 1RZKH 1BZ7A 3ARUA 4Y5XB 4KGLA 4G9DB 1KLUB 2IBGA 4I5BB 3BH9B 2VLJB 4BSWB 5CLWA 5JW3L 4IRZH 3SO3C 2PCPB 4Q9BA 1Q0YH 3E8UL 3QCVH 4QRPA 5D7LD 5ITBH 5EPMA 1FV1B 2JELH 3KPSD 3QCUL 4XZUB 5F3HA 4MNQD 5DZOA 1FNFA 4KK8D 4OGZA 3TCXA 3DUUA 3KPRE 1WICA 4FZ8H 3LDBC 4RISH 2MCG1 3Q5YA 1SM3L 2BY2A 4KJYA 2HT3C 2NNAA 5DT1H 2R29L 4QOKB 3VH8G 4CVZB 4GO6B 1IEAA 4Z6AT 4GRLC 3NIDE 3TN0B 4WFEE 1OGTA 1JRHL 3HAEH 4PRNB 4JO2H 5DLML 5SV4A 4QRPD 2FL5A 1I7TB 3FHQA 4ESKA 1SVZA 5E4IA 5BW7A 3SGDH 2QSVA 5T1MB 1DFBH 2VISA 1OLZA 2BDNH 1QO3A 1RFDH 1I4FB 1KYOJ 3MLRL 4HFUL 4PG9A 1KJ3H 4ODVL 4R7DB 4X7SL 2AJUH 5D7JC 3VXQB 2VC2H 3ARGB 1RUKL 1I85C 3NMEA 1YYLH 4AEHL 5BS0A 4PJIF 4HBCL 4J7RA 4PV9A 5HHOB 3SE4A 5TQ0L 5H94B 3WFDH 2ZNWA 3EFFA 4OT1L 3VGFA 4L3EE 1UM6H 3W39B 4FFWC 3RIAF 4NPYB 1JWMB 3FQRA 3SE9H 4W70A 1H8OA 1QLEL 4YWGL 3RY4A 3HPLA 3QO1B 5ID0A 1A7RH 5IR1A 1A6UH 2R8SL 4Q2ZA 4UDTA 4K71B 4I9WD 3GFUA 3MRIA 3AREC 1TITA 5FYKE 5TF1H 2AJXH 2EIDA 5J3HD 1S5IH 1Y6MR 2NLJB 4LVHC 1D3CA 4DAGL 3HA0A 1Q8MA 1KB5H 5GS0L 3QIUC 5EFIA 1RHFA 2P5EB 3BPLB 1X5IA 4CGTA 4V1DA 3GSWA 1Z9SA 1IT9H 1PKQA 4P2OC 2Y07L 5ABDE 3MA9H 5HHQA 1FYHB 4GW5B 2EKSA 3I75A 3NACL 3SE3A 1JYNA 5FIEA 2MHAA 1PGRB 4QXWA 1FO0H 1QSVA 5FV2A 1TTFA 3G6JF 1TNNA 4OZIE 1SY6A 4KZEH 1JNNL 1EO7A 1BD2B 1MQKH 1UM4L 4ALAH 2WIIB 5TE6L 5JXEC 1EGJL 1WISA 2C4FT 4RMSA 3X17A 2EIBA 4D0DA 1QSFD 2AI0L 2OI9C 4U7SA 4OUOA 3NH7L 4NN6B 4HF5L 4DVRH 2C5DC 1PQZA 1UB5A 2EEAA 1B3JA 3IU4H 3MV9D 3Q6FA 4PJ7B 1K3ZA 2DJUA 3B43A 5E8OA 5TPWL 4C56A 3HZMA 1KXQE 2BXZA 5DJYA 3K4ZA 3PNWB 4EEEA 3V52L 2VXTL 2AEWA 3MGAA 2AK1H 1CLZL 4LDOB 3WJLC 4FZEH 2APWA 5KSBA 3ZE1E 4O9HH 1CFQA 2EDLA 5LJYH 1R24B 5EU6E 4PBXA 3GSNL 5EORL 5IMLA 1FPTH 1ZOXA 4MD4B 15C8H 5D2LE 5D1ZD 3UYRH 2YR3A 3PWJB 4HDIB 1OHQA 5EOTB 4XMLL 2Y5EA 3BUYA 4RNRA 4ZO7A 4CUCA 4J23A 4CKVX 1IEBA 3QXWA 1RIVL 5ANMA 4JFXA 2QBWA 1NFDE 3K2MC 2JCCA 4F37F 2EC9T 4XMKH 3BT2L 3QQNA 1H3UA 5TE4H 5J13B 4J3VA 3ZO0A 2OQJB 2YPKA 4RBPH 4FP8H 3MRLA 2Y6SC 5EBLA 2DF3A 2VLLB 4KKAD 4WO4A 4X6CE 4UIMB 3W2DH 4Z76A 2NY4C 3ZZ1A 1NC4D 5EZIL 5EUKB 3VXTA 3VGAB 1J5OH 3CPLB 4M7JH 1A22B 3HB3C 1VFBA 4OZGA 1U2HA 4K7FB 4PS4H 4X80L 1ZVYA 1L7TH 2HJFB 2Y9RT 1KB9K 1GC1H 5FGBC 4UI2A 1CFVH 1KT2A 4V2CB 1MCFA 5JZ7C 4S1RL 5DDHB 3FHAA 2X44D 3T0WA 2N7BA 3MACH 4G43A 1SMOA 4LIQL 1A21A 3GSUB 4I2XB 3S3PA 3DETD 1SJEB 3BVNA 3S96A 2E27H 2OMBA 1DN0B 1TZGL 5JW4M 3FOLB 3RWIB 1HOCB 4PJCB 3SKJL 4DOHB 4KRPB 4PRHE 4JCLA 4KGJA 1A14H 2DJSA 3J8F7 5CZXD 1PKOA 5TDPA 4HK3N 1WIUA 3OKMB 2M2DA 3GJFA 3ZKSD 3EYOA 1IAOA 1UCTA 4N0UB 5F70A 1I3RA 3SCMA 3BIKB 2YPLE 1WCBB 4IRJB 1R6VA 4IOFC 5CIPB 2QTEA 5C0IA 3ARWA 1KF9B 5EOCJ 1XF5B 2EC8A 1E4KC 3I6KA 1J11A 1JTOA 2XG5A 1LE9B 1A9EA 4BH8B 4JQIL 5MEND 4KPHH 4MJ4A 1LEKB 4LLDA 1PD6A 3S97C 3HUJE 3LKSA 3RZCA 2X4UB 3T4YA 3ZKXB 3KYOB 4XPTL 4PJ9B 4YHOH 1RUPL 2LU3A 1C5DA 5IVXB 4FRWA 3T1WA 5JOPE 1YUHA 4NGHL 4LCIL 2VDPH 5CAYB 1OOAA 3C5ZB 3GSOB 1IGIL 3QWRA 5B4MD 3VWKD 3WEXA 4BQBA 3WFBL 3TA3B 1A4JB 1AFVL 1U93B 5HVWA 2DMKA 3MCG1 4LSTL 1MFCH 3RVUC 1DEEA 1S9YB 2Z0BA 1UXSA 2Z8WC 5CSZA 3HC3H 1EHLH 1RK1A 2A77L 1JZ3A 1EERB 3SE8L 4LOUD 3ARFC 2EIZA 3OB0H 5D7LB 4FQ2H 2E9IA 4Z0XB 2B1AH 1I3GL 3QFDA 5FO7A 3MZTA 1AGCA 1J05A 3KPSB 5E2TH 2W60A 3CDCA 1KENL 4MNQB 1NBYA 3ZDZF 4LBEA 1DQJB 3WBDA 3U2SA 2I9TA 4HWBA 3CFDB 2V5MA 1BZ7B 3EYSL 2NXZC 1MJUH 3SJVA 4HUWA 3TIEA 2APVA 1U0QA 2G2RA 3DGGA 4U6HB 1NDGB 4F7CA 3MV8D 2XKUA 3QWQB 2QJDA 2G5BA 2XXCB 1N2RA 3AU1A 3NA9H 1G9MH 4QRPB 3QG6A 5C0BD 4TRPH 4EDWH 3IDMB 2G60H 4QHKI 1N5AA 4X6FA 5F3HB 3ALPA 2PKDA 4GW1B 5DQDL 1NAMH 3BE1L 3CX2A 1X7QB 4WW2A 4Y1AA 3VDBA 2Y7QA 2OZ4L 1DBAL 4MJ5B 5JNYB 2C3GA 3LMJH 3SJVD 2JB5H 3LOWA 1MRDH 3V6ZB 1IEAB 4M8QB 1OGTB 4PJAA 5ECJE 5JORA 4KKLD 5J8OA 4Y5YC 4U1MA 4LARH 4ODUA 1MCSA 3IRZA 5ALCH 2CQVA 4XNMA 3NIFE 1JZ4A 1PG7H 3LEXA 3LSOA 1IGFH 3MLUH 2VISB 2V9QA 4OFIA 3OKNA 4RGMB 3U6RA 4MLSA 1XCTA 4F9PC 3MRFA 1FFOB 4HHAB 1WV7T 1EMTL 4UTAL 4NNPH 3K2UL 3G6DH 2NZ9C 3KGRA 4PRIA 4LQFL 4BQ8A 2X1WL 1KB5A 3MNZB 5BS0B 1VENA 2GJ6E 4NKIH 1G7LB 1VHPA 3SDCA 3MFFB 4HFWA 3IJYA 1QOKA 4KK9C 4NWUH 3X3FL 3LN5B 1T04B 3UPRA 2EDOA 2E9WA 5L6YH 5D6DC 4KK6C 2Q7NA 5CWSB 3FQRB 2I07A 4JQXA 2WINA 1T1ZA 2C1OB 4GW4A 1CIDA 3WUZA 3C6SA 1UZ6F 3MLZH 4R26H 4FFVD 2DD8H 1KPVA 4NWTH 4UDTB 5BZWA 5KVEL 3UJJH 4HULB 3FT4A 3MRIB 4MB3A 2EYTB 1JWUA 3FT3A 1U92A 3BPNC 3GBMH 4GOSA 3LPWA 5EFIB 2WNGA 3GSWB 1MWAA 4XP5H 5DFVC 5I1HH 1LMKA 1IGML 2MTPA 3MLTA 3I75B 4U0RC 5HHXL 1QSFB 1NBVH 3GI9H 1YNTA 4OCYL 1JN6A 5FUOL 1GZQA 2MHAB 4JPKL 4WHDA 1WZLA 3UPAA 5AUMA 1NJ9A 5FYKU 4M5ZH 2D4DA 1JPST 1JZ5A 2W9EH 4XP9H 4HZLB 4CADA 1HHKB 4KRMB 3QRGL 2VDRH 3BD5A 3PGFH 2UWEF 3ILQD 4OSUL 4D0DB 1AQKH 4KTDH 1WBYB 4K7PY 3N85H 3I2CH 2DQIL 2FYYA 3TJEL 2XTJE 1QFOA 1PQZB 1EHAA 3F8UB 5IFJA 3LAFA 2VE6A 3Q6FB 2ZUSA 4QF1A 4JHAL 4N8VG 4PGZA 4S10A 1QZ1A 3U7WL 3VGEA 4MXVF 5E9DE 1ORQA 4XVSL 5D1ZB 3B6SB 1OTUC 5DK3A 4RWYL 1L0XA 4XPBH 3UYPA 3HZMB 3RPIB 3X3GL 2XTJC 4K9EL 3OQ3B 5HDQH 3ULVD 3DWTA 1XR9B 1QBLH 5CZVH 4JM2C 2D7PA 1H9VA 1P7QA 2HKFH 1MJ8H 3QIBD 2WBKA 3MCLH 1FVCA 3WIHL 4PP2B 3L3OA 1WTGT 4EJ1C 4PBVC 3GK8H 4O2FB 3ME0A 4M1DL 4X6CF 1BQUA 1SBBA 4NDMA 2DTMH 3WO4C 4J3WA 4Y4FD 3BP7B 1G7MA 1YMHA 3QIWC 1NC4B 4RNRB 5KVGH 4H1LG 2PO6A 4OFDA 4TUKL 1U3HC 1H15B 1AD9A 2FATL 4I18B 2PTTB 35C8L 4WGWB 2PW1B 1SVCP 3DPBA 1CICC 2K9UA 5DFWH 2IFFL 2DDQH 2YPKB 1TJHL 3WNOA 3MRLB 4POZC 4R9HA 1GYAA 2D31A 4ZQKB 5J0BA 2JF1A 1R5VB 1UC6A 1IGYA 4ONGH 3VXTB 4RGNE 4JHWH 1QPPA 4KQ4H 1FCGA 3EFDH 4OZGB 2FX8H 5F7EH 5IMKA 1KEGL 2CH8A 1MRFL 2AKRA 2COQA 4Z7VA 2ED9A 2WV3A 3JWDH 4RSVA 3X14A 1KT2B 1KJVA 4NN7B 3DROA 4KUCF 4GKSA 3MRJB 4RGNC 3CFBA 2HAZA 4XVTL 1JK8A 2HRPL 3VXRA 1BWWA 4GQPH 1K4DA 2OP4H 3IXAA 5SWSA 4RZCA 4KVNH 1JV5A 4PFEA 1ZLVK 3U0PA 1VESA 1T6WA 1BJMA 1J7VR 1AKJD 3QI9D 4ZFOL 2JB6A 4NRXA 2OL3B 3S96B 2W92A 4LPYA 2DKUA 2XQYK 4PR5A 5MENB 3TJHC 1GOHA 3MJ9A 2OS7A 3MOBH 2NY2D 1MLBB 4LVOC 5EU4A 4UIKL 2H2PC 2R0ZH 2R2BB 4XNQA 4NM8H 4U1JB 3EYOB 1FLRH 5SWSD 1I3RB 2BNUA 4JQVC 3L6FA 1KCVL 1RUML 5E1HB 5FYJU 1NH6A 5SV3A 2P8MB 3NZHL 3FB7A 5DD3H 2NCMA 2ADFH 4WIQA 2IF7A 3I6KB 4F33A 1IQWH 3MODL 3SDYH 2HFFA 1A9EB 1B88A 4UZGA 1I1YA 9CGTA 2A6JA 1YNLL 4N0YH 5ADPH 2FJHA 1DQML 3LKSB 4P4KD 3ZE0E 4I0PA 2LE9A 2R4SL 3QCTL 4HC1H 5HGHB 4NQEE 4R97C 3AB0C 4UU9A 4XXDA 3L5HA 4ONHB 4BFEA 4WVRA 3WEXB 1AXTL 2IH3A 2ZP0T 4LEOA 3PL6C 2VDNL 4Y2DC 1ZGLA 1AIFB 3HMWH 1LO4L 1Y6KR 2D0GA 3NPZB 1NAMA 3C2AH 2QQLL 1S5HA 5IMMA 2LABA 3O45A 3MV8B 4I0PD 4OIIL 2AQ2A 4D8PB 2YN3A 1G7IA 2EIZB 3PGCA 2WP3O 3UTPE 5C0BB 3WKMH 3AROA 4WHYG 5KW9L 3TVMC 1J05B 2VDQH 4ZYKA 5B39A 5KG9B 2NY3D 3U2SB 2I9TB 1XGRB 4JRWA 4YXHL 4HBQA 4ZTOH 3SJVB 3QUMB 2A9ML 2CLVA 1NUDA 2MFNA 3BPCA 3ALWA 4F7CB 4JKKA 5CJXA 1N59B 3BEWB 2G5BB 4WV1B 5TF0A 3AU1B 3MGOA 2WBJA 1WEJL 3O0RL 1JF6A 2R2HA 4LKCA 3QEUB 4JCMA 1N5AB 4X6FB 4XI5C 1YQVH 2FBJH 2XXMB 4GQ9H 1MCEA 3RHWF 2CGRH 1HSAB 4WW2B 4X6DA 2ZWLT 3RNKB 4P5KB 1P7HL 4Y1AB 4I77H 4OZHA 3RKPA 4F2MB 12E8H 1WSST 4XP4H 1B0WA 5FYKH 4JR9H 2IAMD 4NC1E 3DX6B 3C60C 1ZEAH 2V2TB 5SWZA 3V0AC 3C08L 4ZFZA 1BZ9A 4ODUB 4HWEH 4UV4L 3BKMH 5LBSL 2GYSA 5DD6A 1BQLL 3QXVA 5E94A 4U1KA 2DLFL 5KANI 5EIIA 2QSQA 2BCKB 4NC1C 2OXHA 3GMNA 1DUYA 3OKNB 5JHDA 4YDJA 1XCTB 1KJ2L 3TNMB 2F19H 4OM1L 3BGMA 3W9EA 4DVBA 4X6EB 3WL9B 1RULH 3VFNB 1DLFL 1AO7A 5DQ9A 4EI5D 2PTVA 1ZKAA 2BY3A 4MYWB 3BKJH 4HZAA 5JOEA 3SDCB 1YY9D 1JHKH 1KPUA 2A73A 3BKYL 2NX5A 1YEGH 4M62H 1E6JH 4FG6D 4X98B 5EA0L 2J6EL 2BK8A 5HHME 3DTXB 4HEME 2HT4D 2I07B 2WINB 4GW4B 3UJIH 3AS1A 1QBMH 5DHYB 3QEQA 1P4IH 5IJKC 4PJGA 5D5ME 4K8RC 1KPVB 2NY5C 2GSIB 1OWRM 4G8GD 2X4PA 4QHLB 5TDOB 3D39D 1S7QA 3FT3B 1DP0A 5DXWA 1RV6X 5GHWL 2DI7A 1MWAB 1ES0B 1F90L 2NR6D 3LCYA 4AYFA 4PJ8A 4KJWD 5E7FA 3KAAA 1YNTB 2AJVL 4Z7WF 1JN6B 1N64H 3O2DL 3LN9A 1GZQB 5L2KD 4M7ZB 2Y36H 5AUMB 3VXUD 4C57C 3D18A 1TVDA 2BSSB 3NABH 1T0PB 5I9QB 3RTQD 1DBKH 3WS3B 1ONQB 1YJDL 2VH5L 1VGEL 4JN1L 4CADB 2FECI 1JNJA 1OW0A 1QA9B 1FJ1B 1KCSL 5IBTH 4K3DL 1KXVC 1LQSR 4JDZA 5E5RB 1T7YA 1GVIA 4OF7A 3BPOC 1TQBB 1A3QA 1I1CA 4P3WA 1YEFL 2DMCA 4TSCL 3MYZA 5IFJB 2VE6B 4K94L 1BREA 1MI5E 5TE7H 2IC2A 5GGSY 2EE2A 4QF1B 1OF2A 1OTSD 1ORQB 3RGVD 1EJOL 4Y4FB 4JREB 2VYRE 4UOW1 1J88A 3BFOA 3CFIC 1J1XH 1N7ML 2IAND 3M45A 4G6ML 4RMUA 4TSAH 4P5TA 2XV6B 5KTEL 2O26U 2LVCA 3CVHH 1P7QB 2WWKO 1OB1A 4Z7UA 1FVCB 2HH0H 4PTTA 5DS8A 1MJ7H 4JO4L 1W8OA 3K81A 4R90H 4NRZB 5FYJH 5C2UB 4DEPB 5ITFA 4PJBB 1I8MA 5DUPH 1TPXB 2HTKC 3RU8L 1FG2B 1RAMA 3QXDA 4JAMA 5IW1A 1G7MB 4XBEH 4HIHB 4M61A 4R96B 3F58L 5ESVA 3PV6B 3QJHA 4PJFA 3DMMD 5FYLD 1CU4H 3GJEA 4GXUM 3LD8C 1NUFA 5GSVA 2JJSA 1JPTH 3S3SA 1ND0B 5J1SC 5B38G 1KELH 1A6AA 1V5JA 1OCWL 1FRGH 5IB2A 1A6PA 2W38A 4K7PH 4KUZL 3N1MC 3VRLF 1QG3A 3U9PL 1CFSA 3VXPA 1BEYH 3ZL4L 4KFZC 4C83B 1S7WA 2FEDD 3DVNA 5FCSH 1J87A 1AKJB 4NO3A 4XRCA 3QI9B 2UYLB 4QHMB 4WWKD 4YFLF 1MFBL 2NY6C 4QGTA 4QRUA 2HKHH 3U1SH 3MRNA 4Z7VB 2CUMA 4KQ3H 5C8JA 3OPZL 3O6FC 2IADA 3L3GA 3X14B 3UDWC 2WSKA 3DROB 4QY8B 4OF6A 2ZJSL 1XIWC 4GKSB 2E5EA 4G9FA 1FLTX 5AYUL 4FQIH 3CFBB 5C0EB 1JK8B 2K1MA 1K4DB 5GS0C 2WANA 5SWSB 2OXGA 4RZCB 1JV5B 4ZS6C 1J8HE 3K3QA 1AJ7L 3CX5J 3KPRA 3N1QC 4Q0XH 4FABL 3LZFL 2JB6B 4HC1A 4NRXB 1KCKA 5F1OB 3X12A 4PR5B 2X1OA 4NFCA 1KCLA 1FVDA 1A7NL 3D5OF 1M7IA 1UXWA 2VDOH 4PLOB 5CP3H 1KIUA 4WEBH 5T1DH 5EU4B 2IQAA 2X2YA 2FZ3B 1HKFA 4XNQB 3G08A 4GRLD 2OR9L 3EKCA 4H20L 5I75C 2ZOLB 1R3IL 1Z3GL 5IHBA 1CDHA 4HXAH 3OKDB 2O5YL 1CVRA 5DJ8B 3FB5A 3S36X 1P2CB 3UZQA 4ONFH 4F33B 3DYMA 4Z7NF 2CK2A 2HFFB 2EH8H 1FN4B 2YBRA 5GGUA 5AAMA 3WFZA 2C3XA 3WDIA 5BV7L 1ZT7A 2FJHB 1CGVA 5EBWA 2EE9A 4PJHF 4I0PB 1DBBL 4KTEL 2VL5B 1JHLH 2ORBL 2PXYA 3S88H 5D7JD 2J8UE 3EUUA 1IZJA 1KCRL 5E8DH 4UU9B 4L3EA 1LO2H 4XXDB 2ICEA 3FO1B 3LEVH 2D0FA 1GGTA 4QRQA 2NY3B 5F1NB 1EA9C 4LEOB 1HXYB 1ZGLB 2O93L 2IGFL 1ZS8B 4OQTH 3AC0A 4FFWD 3IFNH 3NGBC 3ZKMC 2E7CA 4LLQA 3VFOA 1S5HB 2IBZX 5IMMB 3O45B 3UTTE 1RUQH 1G1YA 3O3UN 4P2OA 3VFUB 5B3JF 2BVUA 4G7VH 4QTIL 4GKOA 3FFDB 1MFAL 2AK4A 3BWUC 4G3YL 5F7KC 4HK0B 3I02A 3WHE0 4Z18A 3PP4L 1ZT4A 3H9SA 4HLZH 5EN2A 4R4FL 3ARED 1MHPL 1CWVA 1DQQA 5D96B 4NQUA 2GT9A 1NGXB 5DK0A 5E6ZA 2CLVB 2IAMB 2PYEA 3QIUD 2YZ8A 3S35H 4P2OD 3OKEA 4P4RB 2XZCH 2WBJB 3K74B 1NLBL 4LKCB 4ENEC 4TTDC 4ZSOB 4H88H 3V9FA 4LFHD 5MP6H 4C4KT 4OZIA 1IC7L 2F54D 1C1EL 5CGYC 4LAJH 4LIQE 5BQ7A 4D9RD 5KAQG 5DMIL 1HCVA 4TUOB 4G6JL 3OAZH 2CDGA 5JXED 5SWZB 2PNDA 4ZFZB 1RJCA 1EAJA 2DLTA 1U58A 4GLRH 1V7ML 2XWTA 4MHHI 5DD6B 4I4WB 3S37X 3MLYH 4U1KB 5JIPA 4K3HA 5TQ2L 3G6JB 1BVKB 1CF8H 4JG0L 3OG6B 2MCPH 3GMNB 1DUYB 1QSZA 1T03H 5A2IH 4Y19D 2EZ0D 3G6AB 3BGMB 3V0VA 3W9EB 4DVBB 4Z8FL 2BOCA 4HSQA 4PRDA 3VE0A 2OJZH 5DQ9B 5IFAL 3O8XD 1G6RB 5GRZA 5EU6A 1MFDL 4G8GB 5C0CE 3Q6GH 4DUWA 1KPUB 5D2LA 3D39B 5FGRA 2AGJH 3PGDA 2A73B 2B4CL 5C07E 2NX5B 5DURD 2AJZA 1I75A 3UZVB 2YD6A 3P0VH 5EC2B 4ZODA 2FR4A 1E4WH 1KTLA 1U8KA 1AQDA 5FA3A 4ZUSA 5DYOA 3IGAA 4YR6B 2EYRB 3QEQB 2JKXA 3D6GA 3T0AA 3EOTL 4CMHC 3TH4T 1BX2A 5DK2B 4UMGA 4NSKA 4OV5A 3ZHDA 3WFCL 3VXUB 3QEGH 2X4PB 3WIFB 3RTQB 1UH2A 4XHQA 1FSKB 5FGBA 1A5FH 3MOQA 2EDXA 4JZNA 1YMME 2BVTA 5A43C 3P4NA 1TENA 3H3PL 3HPJB 2NY4D 5IFHH 4Z95H 2FBOJ 3HB3D 1EVTC 1J1PL 4JFOA 3SDXE 4HIXH 5IQ7H 4ZO6A 4QRRD 4YHYB 5DO2C 3KYMB 1WGOA 1RZJL 3GRWH 4LCCB 3HR5A 3CVHA 3QEHA 3KJ6L 2YWZA 3PHQA 1GRWA 1MCHA 4XP6L 1AD0A 5JZ7D 5E99H 4UV7L 5HVGB 1YEIL 3T4AB 3BW9A 5J12C 4W6XB 1NBQA 3T65B 4PRHA 1UCBH 2GW5A 4NFBA 1MEXL 1UKTA 1E4KA 4M7LH 2WW8A 2AABH 1DL7L 1U3YA 2UUDK 3MQIA 3TLRA 5CD3A 2Z4QB 1G9NH 4L1DA 3DUSB 1TCRA 3RDTC 4HWUA 2ZG1A 1MPAL 4Q9RH 1OF2B 3B5HA 4X7DC 3E1F1 5IKCA 1NFIB 3KYNB 2VDLH 1LNUA 4IIQB 1MF2H 2QV2A 3BP6A 4FN0A 4WI8A 3U0WL 4EBQH 4UDUA 1HN1A 4OCXH 3W0WE 4MAUH 2X9YA 3CH8A 3HC0A 3OKOA 2DQFB 3HCVA 4Z0BH 5C7XL 1OB1B 4PTTB 5D4QA 3VG0H 2FJFB 1NPUA 5DS8B 5DI8A 3L1OH 5F1SA 4CVXB 2R1XB 1G7PB 3DSNA 5IB4A 3K4DA 1CGYA 1SEBB 1EO5A 4MCYA 1KB9J 4GMTH 4KUCD 5TDNA 3UC0H 3RP1A 4OLWH 5I8KH 4D9QE 4JAMB 4XCCL 4BSVA 2YPLD 4S2SB 1AXIB 4JHZA 3ARFA 1LHZA 4OCLC 2XACC 1UENA 2R23A 1G0YR 2QLVB 3FQTA 3RWEB 3GJEB 5EOCH 1IC5L 2JTDA 4WWKB 3R8BB 3MV7E 3ZTJH 3VFTB 1A6AB 2RB8A 4KY1H 2YC1A 5C0JA 3RVUD 5IB2B 1JI2A 1CK0H 4MJ6A 3V6OE 5I1IL 3DX9B 3SO3B 5JOPD 3L7EB 2R15A 2IPTH 1CFSB 1AE6L 1JFQH 3VXPB 3NBNA 4YDIH 3ARFD 3VXMD 5JO5A 3DI2B 4PRBB 3MC0A 2XYCA 3AS0A 3KPLB 1IE5A 1L9NA 1S7WB 3DVNB 2CJUH 4DFHA 43C9B 5T5FH 5HI5C 4NO3B 5F3BA 4XRCB 3Q3GB 5K59E 1V05A 1BQHA 4ZPVA 4Z7OE 4KHTH 2EDKA 4QRUB 5JHLH 3V6OC 1P6FA 4LRIA 4LNVA 4U6YA 4XXCA 3GMLA 5C8JB 1R5WB 3JWOH 3LDBB 3L3GB 3ARRA 4FQ1L 2DRUA 2NXZD 5HI4D 1LWRA 3A6CL 4O58H 5JIHA 4OKVA 4GRLB 3GHBH 1NGPH 5SWQB 4AH2A 2N1KA 4PGCA 3Q1SH 2BP3A 4HMCA 3B5TA 3KPRB 1KGCD 1A6WL 3S4SA 5A2KH 5MERA 3EOBA 3X12B 4PTUB 3V5KA 2DQGH 5KOMC 3EDKA 2E6JA 5ETUA 2J4WH 3ARDC 2IQAB 3RWCA 3G5VA 4XGZA 3FO0L 1OP3K 5D7JB 5A3IC 2ADIA 4OQTA 3BSZH 3P77A 1BOGA 3LKRA 1MCJA 1OSPL 3IF1A 5D1XA 3TBTA 2FX7H 1TZIA 2P5WD 3I9GL 3HE6A 4CDGC 1BAFH 2C4FU 1JTTA 1QACA 2GQHA 2Z31C 4NQXA 2YBRB 5GGUB 4WY7L 5D6DA 5C9JA 2CD0A 4PG2C 5IVZA 3V7MA 1KFAL 4HT1L 1GPOH 1JGVL 1JIBA 1FZKA 2NZ9D 4HS6A 5IBUB 1YECL 4KMLB 4N9GA 3EJZD 5HBBA 5ISZE 4ZUWA 1XEDA 4QRQB 4X83A 3AREB 2XNAA 4KK9D 4OLUL 4AG4H 1GXEA 4LVHB 3HAEG 1X5LA 2VR9A 5GRJL 3DYPA 5ELIA 3QIUB 4TYUA 2IPKB 1NKRA 2FIKA 1LEIB 4LSQL 5K93A 3VFOB 2GJ6D 1EV2E 4X5WA 1KXTB 4P2OB 1E27A 3CFEB 4ISVA 4YHKH 4NZRL 3MBXH 3VMNA 3ZDYE 1T1YB 1S7UA 3MXWL 2G75A 2VXUH 3ESUF 4RISL 3I02B 2XY1A 4P46C 5HYSA 1ZT4B 3U79A 2HT2C 1I1RA 2Q76A 4AENB 2GT9B 1WLHA 4GRMA 3NPSC 5DRXA 2DQJH 2X7LB 2EC9U 4M1CC 1UB6B 3LH2L 5DFVD 3S36L 3OKEB 3QQ4A 5C0NC 1WT5A 3H3KA 4A2MA 2VB5A 3TGXA 2Y23A 4QRSB 3L3JA 4OZIB 4LSPH 1T0NA 3U48A 1JNHB 2BVPA 4NJAH 4U1GC 5JPMB 4IDJL 5BQ7B 4FMFA 3U7YH 4Y19B 3NN8A 1A3LH 3EOYG 2CDGB 3ILPA 3WFEL 4CJ1A 4ODHL 3VRIA 3WFDL 5IG7A 4ZO9A 4JM2A 3EHBC 2XWTB 4OCRH 4CW1A 3DX7A 2WQRA 4LF3A 5E9DA 4U3CA 4JFDE 3VI3E 1B4JH 3QFJE 3B83A 5DURB 1RQ5A 5F6IC 5JW3H 4DQOL 1I8KA 1CXIA 1OTUD 1A6UL 3E8UH 2BZDA 3V0VB 1Q9KA 1T21B 2UWEB 3IS1X 5GQBA 3WD5L 2XTJD 5J56B 2YD3A 3QA3A 5K9QI 4JG1L 5FOJA 1NL0L 5EU6B 1AY1L 5A40E 3H9YA 5E9DD 5D2LB 4F58L 4Y16D 1TETH 1SM3H 4GRWF 1M05A 2R29H 3KWWA 1JPFA 1JRHH 1PVHA 1KTLB 2BNRE 5I1LA 4P5MA 5DLMH 1AQDB 1NFDB 3GRWA 5FA3B 4YFLI 3CSGA 3QIWD 2NY4B 3ROOB 2BY1A 1FO0L 4G8FB 6FABL 5GGQH 4XVJL 5F9OL 1OD7A 1U3HD 1XCQB 4QRRB 3MJ6A 2ILLA 4A6YB 4AZ8A 2H1PL 5F72S 1CICD 4WI2A 4X6CB 4I3GA 3RI5K 4ODVH 1FC1A 1DQLL 4POZD 3MRMA 4X7SH 2A83A 1ZXQA 1CG9A 4GSDH 1RUKH 3P4NB 3QJFA 1MCWW 1UWXK 4AEHH 2VNCA 2GEEA 2MJWA 4OI8A 4QLRA 5AG9A 1D5MA 2KH2B 5TQ0H 4JFOB 3HG1E 3MXVH 4DW2H 3EJYC 1X5YA 3HR5B 3HE7C 1FNEB 4PGDB 3BWAA 1A7PL 3LQAH 1DDHB 4Y4KD 3P9LA 1QLEH 1O7SA 4O4YL 4YWGH 1RUAH 3LKQB 2D0HA 4FQPA 5HDBF 4X8XA 2I5YH 3BW9B 1H3WM 4TVPD 1HQRB 4PRHB 2XWBA 4P48A 4EOWL 3QZWB 4TULL 5HHVL 4DAGH 5CD3B 4NCDA 3SPVA 1ZHBB 3DVFA 3TJHD 1MAMH 1ORSB 3GIVA 2VSCA 4M48L 4WUUD 2Y07H 3VW3L 2YPLB 1LNUB 2H2PD 4UDUB 1LEGB 1W72L 5LGJB 2ZSVA 3NACH 4WW1A 3QDAA 2DI8A 3SKOB 5L8KB 1UWEH 2CDFB 1FC2D 4JE4B 5DI8B 1EFQA 3HUJB 5IB4B 4FTVE 2DL2A 3W2DL 2EDFA 1JNNH 4M1GL 4MNHA 4NQEA 5J6GA 5TDNB 5TE6H 2UZIL 1EGJH 4BSVB 3GMOB 4NP4L 3QNYB 4EVNB 5DTFA 1JJUA 1QNZL 3ARFB 2P8PA 3KXFE 4X4ZA 2AI0H 2R23B 4Y88A 5SX4I 3P30L 3HI5L 4IOIB 3NH7H 4HF5H 1LK3L 4BQ6A 3UO1L 2W9DL 4G6KL 2P7TA 3MCKA 2WQ8A 3PL6D 2YC1B 4O5LL 4Y2DD 1F4AA 4ETQB 3S7GA 4PJXF 2NXZB 4NQED 4MJ6B 5FKPA 2H2SC 4G80B 4JPVL 2GCYB 4QRTA 3SKUD 3V52H 5D7KE 4HH8A 3TVMD 1CLZH 2GHWB 4ZPVB 1G7QA 5KBNC 3GSNH 5EORH 5DRZA 5I6XC 3UTPD 1F3DJ 5HYJE 1LO5A 2QADC 2YUZA 1B9ZA 4U1HB 5F21B 1INQB 4OKVB 2UV3A 4XMLH 4NOFA 3C60A 3GUTA 1F45A 1RIVH 3ESVF 3FAWA 4Y5YB 3TH2T 4AH2B 4X6BA 5CFHA 4EXPX 3BT2H 5J9PA 4XI5D 4CVWA 1CFNA 3QH3A 1YEDA 3EOBB 1QFUL 5T3XD 3NVQA 4CNIA 3QT2A 3CFKA 1HHGA 5KS9E 3TC9A 5FDYA 1U95B 4M4PA 2ESVA 4WI5A 3RWCB 4XGZB 3E6HA 4KV5F 5EZIH 1DE4B 3DV4B 1YJDC 4MQSB 3BZFA 2NTSP 3WFHB 2ADIB 1CGTA 2YS4A 1ZWIB 2VSDA 5IMOB 1BOGB 1MFNA 3TBTB 3TT1H 1TZIB 4X80H 2YRZA 4OZFB 4PJEA 4LLMA 1T20B 1NCCL 4E9LA 5I8CB 1J1OL 4YC2C 4FQ2L 4S1RH 3QUXD 2VLRA 3T2OA 2GJ6B 1MCIA 2DICA 5IVZB 3VJ6A 1T7WA 3RA7L 4LIQH 2VO5A 1KACB 4HS6B 2LU4A 5IJKA 2HVJA 4F15C 4N9GB 5GGTL 4ZUWB 1TZGH 3SKJH 2DS4A 3AXLA 4DZ8A 5B39G 2HN7A 3BPNB 3HTLX 1G9ML 4HIEA 3MRHA 1KC5L 5HDLA 4PY7B 4X5WB 5D5MA 1ADQL 1OAQH 3A6OA 5GIRB 4BK4A 5C0RL 1A6VL 1V3JA 3MRPB 4U0RB 2HLAA 1S7UB 2E6PA 2G75B 1FGNL 4YXKL 3KPTA 3VXSE 4RGOL 5J7CC 4GFTB 4JPWL 3C5JA 1I1FA 4OF3A 5HHMD 1EJ6A 3KPOA 1YNKL 2Q76B 4NOBA 4JY6B 3CDGB 2OLDA 5M7QA 4HG4K 4GRMB 1U91A 4PP1C 3U30B 1LP9E 4OD2A 5DJAA 2AJYH 4XPTH 1RUPH 2WWMC 1QFWI 1K2DB 4LCIH 4NGHH 5EB9A 5I1KL 2F74A 5F9WC 1IGIH 1YPZE 2XN9E 2E7MA 4MAYC 3ARPA 5JA9A 3D0VB 1AFVH 4NZTL 5D7IE 4LSTH 8FABA 2X4OA 4DTGL 25C8H 4B5EA 3QXUA 4ZO8A 2YRLA 1QEWB 2A77H 1FE8L 3OKYA 3VFRA 4NT6A 3OGCA 4ERSH 3MBED 3ARBC 1I3GH 2XTJB 5DVMA 2CK0L 1VFAA 4W4OC 1KENH 1VACB 4JM2B 2OJEA 1SHMA 4MSWB 1MI5A 3UTQA 3MNVB 5E9DB 3EYSH 2Q7YA 2HTLD 3NCEB 1I7UA 3WO4B 5C86A 2I27N 3TPUB 3V0WL 3ULUL 2P45B 5JW4Q 3IYLW 1Q9KB 3SGEH 1NCAL 3QIWB 4U1IB 1DQDL 4UT7L 3DGCR 2O61A 5DQDH 1MHHB 1MI5D 1O0VA 1U3HB 3QUZD 5IROC 2EXWD 4NUJB 3VG9C 3BD4A 1CICB 2OZ4H 1CL7I 4LNRA 4W68A 1CVSC 3L5WA 3ULSA 3GI9L 3E2HC 3GHEL 4MJ2A 1YN6B 4DGVL 2BERA 5HGDA 3C9NA 1ZVHA 4M5ZL 4U6XA 1I9RL 1QRKA 3B9AA 5DF0A 1CLYL 1HHJA 3IFLH 5E2VH 5JA8B 1S78D 4IMKC 4K3JL 2W9EL 4XP9L 1V7NL 3EDJA 2Z8VC 4XTRC 4KHXL 5DJCB 1Q38A 3O6FA 4S1QL 1E4XL 4QO1A 2VDRL 3QXTA 4P23C 4J3OC 1EMTH 2ERJC 4UTAH 1CG9B 2YD9A 3K2UH 3L3HA 3QJFB 4LQFH 4JKLA 4DZBA 3B8YA 2R9HD 4UTBL 1A9BA 4R7NB 5INCA 2D7QA 1BJ8A 4HWZB 1CXLA 2CKBH 1PLGL 4NHCL 2NY6D 1G7JB 5F7HA 4KZDL 4XPBL 1RURL 3PHSA 3D2UD 2V7NB 3CMOL 3O6FD 2X4NB 1A6TB 1EPFA 2AV1A 4LVOB 1XIWD 3TF7C 4QHUA 5GRYA 1Q0XL 3HZYA 3DBXA 2VAJA 2ZSWA 2VMFA 5I18H 2VIRA 1BZQK 3GK8L 4QHNB 1C12B 2P24A 5I19L 1B6UA 2ADGA 5I8EA 5H37G 5DVLA 1K5NA 1WK0A 3SGKC 2FH6A 2VDML 3TO4C 2HJLB 3TM6A 2R2CA 2W9LA 3BXNB 3GIVB 1L6XA 1K4CB 3IVKA 2A6DB 3PUCA 5KVGL 1U8LA 4WJ5A 1J8HD 1IGMH 1A4KA 2RGSA 3IDYC 5HHXH 1OT2A 4GG6E 3SDAC 5F7DA 3V4PL 1ZA3B 3RNQA 3AB0B 4JPKH 3UTOA 2MSPA 2DL9A 2DWEA 4ZUVA 2XRAH 5KSAD 3GJFK 3FQNA 1Q9OA 1OAXL 1HWHB 3W11C 5IK3B 3PL6B 4Y2DB 1ZGLM 1KN2L 1OQXA 2DIBA 4NQEB 2GSGA 1H3PH 1ZLUK 5J6GB 4QTHB 1WQVT 2J8UA 2VZVA 4ONGL 3VCLA 4CDHA 1T1WB 1MELA 2FX8L 2P8PB 3DXAE 5F7EL 3TVMB 4R4BA 2DQIH 1SQ2N 3TJEH 1I9JL 1IARB 3BKCL 4JGMA 1CDBA 4HUUA 3OGOE 1M1SA 1FNGB 4QXTB 2EE6A 4BYHA 2P7TB 5ICXB 3MCKB 4JHAH 3U7WH 3UTTA 4XVSH 4RWYH 1MSPA 4PJHB 3ZKMD 3PP3H 4ZFFB 4S1DC 5FKPB 2AV7B 2Z92A 4K9EH 4P2RD 3SE4C 1ETZA 2A9NL 1KULA 2FO4A 4GAYA 5CEZE 1E6OL 1NMBH 2E7BA 3LQZB 3BP4A 3WIHH 1U8JA 2CMRL 1MH5B 3FO2A 4P2QD 3RY5A 2DN7A 1E28A 3GSVA 4OBRA 3B4NA 4XNZB 4V1DE 1WAAF 2FD6L 4LQ1A 4MA7L 2HRLA 4APQA 3C60B 3IDJA 4KROD 1G9EA 4BFIA 2WUCL 4Y2OA 5F9AC 4HX1A 1IQWL 2YOCA 4TUKH 2FATH 4X6BB 4ENED 35C8H 2CPCA 3D1MC 4TTDD 3TFKD 3DV6B 4PJ7F 4F7EA 1IGJB 4YHPB 5C0AE 1V8HA 4CNIB 1LE5B 1JF1A 1HHGB 2ATKB 2ICWA 5CGYD 3QUXB 2EICA 1QVOA 4LKXA 3SE3C 3STZA 1S7TA 5HTSA 4JFYA 1KNOB 3E6HB 3O4LD 3BZFB 3PQYA 3J7HA 2CUIA 2R0WL 5I17B 1FL3B 5IHUL 3LV3A 1KEGH 1BQSA 4P2CG 1L4IA 1MRFH 4LLMB 2B1HL 4NZJA 5FHBL 1Y6NR 4MCZB 3LRGA 3RQ3A 3DVGA 4YQXL 4NCC1 4C56E 3F6LA 2HRPH 5IIEB 3RI5F 1KJMB 4EQ3A 3T3ME 1T66D 3L5JA 5JIIA 2UZXB 3TBVA 1VB9A 1Y18A 5D1QD 2H32A 5HHMB 1OAZL 1MIEL 4P57B 3ZDXF 1QTYT 1GIGL 4DZ8B 4POUB 3T3PF 1T4KA 3GBNH 2HN7B 1W8NA 4Q6IC 3QDHA 1UJTA 4UIKH 5FM4A 3BO8A 4NM4L 2FBJL 2QSTA 5ANME 1RUMH 5C0CD 2JCCE 3VI4E 1T6VN 4QXUL 12E8L 3IAQA 5C07D 5CP7A 1KCUL 4XP4L 1GSMA 1F58L 3MODH 2WAHA 3P4OA 4L4VE 4JR9L 4G6FD 1YNLH 4X99B 1T22A 5HPMA 1DQMH 3P11L 1IAMA 3ZT5A 2R4SH 4HWEL 3MBEB 2RIKA 1RIUH 1UQSA 3QRFM 1WZMA 4JZJC 2GITB 4PJCF 5L2JA 3QUYA 4R6UA 4HUXA 1AXTH 3BPOB 2X4TB 5I1CH 4WO4C 2KDGA 4MZ2A 3U36B 2VDNH 8FABB 1YMMD 4HS3B 1WIPA 1LO4H 4P2YA 2BSED 1X5FA 2QQLH 4GXVL 4BELD 4OIIH 3MTRA 4NT6B 3OGCB 4DN4L 5HGBB 3BKJL 2OZ4A 2VKWA 3FFCA 5ID1A 5KW9H 4R8WL 2OJEB 1P9MC 2R4RL 2ATPB 1MI5B 3QUZB 3C5SA 4ZUUA 5IUSA 1AHWA 2AERT 3SY0A 3UP1A 4YXHH 3ABZA 4PGEB 2HFGL 2A9MH 3TPKA 5INDA 5IVXF 1QBML 3RDTD 1JF5A 3QULB 3N0PB 3W81A 4OAWB 1UGNA 1OT1A 2H9GA 4MD0B 5D7SL 4HXBL 1NDMA 3Q48A 1OSZB 4GH7B 3O0RH 1WEJH 2GKIA 3VH8B 2RCSH 3K80A 2ZOKA 2VLKE 5HGAB 3MRDA 2O61B 3LD8B 1LGVA 2VAAB 2X89D 4RBPK 4HUKB 3RPKA 4LNRB 1YEJL 3T08A 4ZOAA 3SCMC 1U42A 3W0WD 2X1XR 3L5WB 3ULSB 4DCQA 5ICYB 2FLRT 4DUXA 3C08H 3LRHA 5HGDB 3TYFA 4UV4H 5LBSH 3C9NB 4NRYB 3MV7A 1BQLH 1NC2D 3WS6C 1ITCA 1WCQA 3VFSA 5AZ2L 3RZCC 2BSRB 3RWFA 2NY6B 4AEEA 1XAUA 3V6OA 1O5DT 4MA8H 1R3LA 4D9QD 3D2UB 5FA4A 3O6FB 1RZKC 2ZG2A 3HHRB 2FH8A 1KJ2H 2B39A 4AY0A 3H6JA 5EOQL 4OM1H 1XIWB 2N7AA 3L3HB 1A64A 4WWID 2XZQL 1DLFH 2YXFA 1K85A 5F9JB 3MV7D 3BQUC 3G5YB 2DLGA 1FIGH 5IW6B 3BKYH 3RUGE 1U8QA 2J6EH 5IWLC 2CLZA 3DO3A 4U4BA 3RZWA 4E42A 3SKMA 2AV1B 5K9JH 3MRQB 1J8HB 4U7KA 4QHUB 1U8PA 4TTGA 1ZAGA 5I75B 4K55A 5JPNA