5GRVK

Crystal structure of homo-specific diabody
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
106
Chain Sequence
b'DIVLTQSPATLSLSPGERATLSCRASQSVSSNYLAWYQQKPGQAPRLLIYDSSSRATGVPARFSGSGSGTDFTLTISSLEPEDFAVYYCHQYSDISPTFGQGTKVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords homo-specific diabody heavy chain
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 24
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2016-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5grvK00
4LRNL 3W39B 4F33B 4U6HA 3OKEA 3QUXC 3QR2A 4YXKH 4NCC1 3VXMA 3EYQC 4WI7A 2GAZB 1JUFB 4TSCH 3EJJX 1ZLSL 2XG4A 4A6YH 3HE6A 5AYUL 2GIYA 1ETZA 2FL5A 1H3VA 1TENA 4XNXL 1MCEA 1HIML 3ESUF 1CD1A 1MFCH 1FYHB 2FEEL 3NMEA 4LDEB 4G7YL 4HS6A 2P5EB 1QRNE 3CVHL 3CSYA 1OWWA 4MA1C 1XGRB 3U9PH 4PP1D 4X5LA 3JTTB 3WSQL 4TUJA 2NX5D 3QXDB 4H26B 1VGEL 3WNKA 4GXUN 4PGJA 5GIRB 3ZT6A 4YHPB 4O58L 5E24E 4UU9A 5FECA 3O2DL 4JRXB 1QKZL 4HXBH 4JFEA 5ANMB 4JFFB 3ARFA 2HP4A 3D0LB 3QEUA 3BDYL 1HYSD 1QBAA 3GJFB 4ZNEA 1V3KA 3BDXA 1Q72L 2NTFB 1I1YA 4OSUH 3O6FC 3MLRH 1BBJA 2EKSA 4NKDB 2YEZB 3QQ9C 1A6WL 4KTDH 3V6ZA 4AM0B 2FB4L 5I17B 1OAUL 4IIQC 1I8KA 3V6OC 4EOWL 4X98A 5E0QA 3B5TA 2IPUG 3X14A 2EECA 1J0JA 5GSVA 3EFDL 3NCMA 4BH8A 3V5DA 1CF8L 2FX7H 2DYPB 1BX2B 1HSBB 1UM6L 2H8PA 5E08L 3CLEH 5CJBA 2P5ED 3Q6GL 2WIIB 1OL0A 4AEIL 1BZ7B 4Y1AE 4LSQH 2ZCHL 4G43A 2CXKA 3VI4F 3VXUA 5HPMA 4CKVX 1X5LA 3MROA 5DD5L 5HYQB 1VFBA 2YMXL 4E0RB 2FEEI 4MDIA 3U0WH 1NAMA 4NZTL 5D8JL 3F7QA 3HS0A 3FQNB 2YBRA 2CKBB 1XR9A 2F19H 1S9WA 1U92A 3I02A 5FDWB 4JRXD 1K8IB 2OBGA 4JN1L 4R2GB 3DROB 4OLXH 1HEZB 1YUHA 4C59B 4EUPB 4U33A 5GJSH 5KSUA 5DK3A 4KVNL 1NCBH 2VZTA 5DHVB 2DQIH 3AREB 5LGHH 2DDQH 4CDHA 3T0EA 5IHUH 3LB6C 3WFHB 4JFXB 2NZ9C 1G9MC 1OF2A 4GRWE 5SWZA 2EO9A 4HAFA 3SGEH 1YYLL 3QO1B 3CAFA 4P4KC 3PP4L 3GSVA 3SDYH 4WUKL 1OVZA 5CEZH 5F1NA 4P2YA 3BP6A 5DC4B 4TTDD 2AJVH 3HR5A 3KPRA 2A73A 1T22B 2QQLH 2NNAA 4GKZB 4W68A 2DYPD 3GK8L 2ZOKB 5C0IB 3RVVC 5EUOA 4CUCA 3QDJB 4F58L 4DTGH 4BK4A 2VLJE 1V7NH 2VLRE 2AK4E 4LCUA 3PWLB 1CK0L 1IARB 2W65B 1MJUH 1FFNB 1T0NB 4NPYA 4LLDA 3T65A 2HT3C 4OFKA 3OKNB 2FH6A 4LGPB 1XH3B 3WS3B 3IFOB 4I18A 1IEAA 3S34H 5HHMB 5IW3A 4R2GD 3OL2A 3HFMH 5DT1H 1OAQL 4R8WL 2QKIB 2DTSA 4LGSB 5MERA 1WAAF 3ARED 5IFHL 4G9FA 2WLZA 2ZUVA 3EJZC 3MRCA 4LMQI 5MP6H 5IVXB 1EEYB 1SBBA 3L9RB 2ID5A 2QHLA 4EQ3A 3UCRA 3FB6B 2BSSB 1TCRA 1IFHH 4L3CB 4X7TB 1NC4A 4MS8C 1RZ7L 2R2BA 4WHDA 5L9DH 4LHUB 2MQ3A 5C8JB 1MREL 2ICEA 3D18B 1WVZA 1Y18B 2FCBA 1ES0B 5DUPH 3AUVA 4FZEL 1CFTB 3QDJD 4PG2A 2YSSB 1BZ9A 2R8SL 1NCCH 1RULL 3HI6H 2HTKD 3N9GL 4UAOB 4JY6A 3C2AL 3UAJC 1YY8B 5EBWB 3U7WH 1YMMB 5GRJL 3BOVA 5B39G 1MIEL 2FGZA 3AS1A 4QF1B 3WD5H 3I2CH 4PJIA 3DRQA 3NGBC 4PLKC 2J5LB 2RAMA 1N4XL 5HYSA 3G5ZB 5HHMD 2DICA 1KYOJ 2GYSA 4NBXB 3WKNA 3VWJA 5EUKB 1PD6A 4JO3H 5MI0C 4OLYL 2P8LB 3VXTB 4KKBD 3VE0B 3D25B 3DUSB 4H0HB 3REVA 4NC0B 5D2NE 3IU4H 4I77H 4M00A 2J2ZA 1OPGL 3DGGA 4K7PX 2GITA 4LHUD 3RUGB 2V2WB 4NQVA 4L8BB 3IXTA 3TCXA 2QHRL 3VH8B 3WFBL 3CFDA 3VXRA 4JZJB 2AABH 4XCEA 1M71B 1CIDA 4BA8A 4XHQA 1A6AB 5H94B 4BFBD 3N85L 3D87B 1IJ9A 1YMMD 3PNWA 4RSVA 3TNNB 3FB5B 3QDMB 2Y5EA 4DUWA 4Q0XH 4PTTB 1BEYL 4MD4B 2OMNA 3KPPB 3NTCL 4LU5L 4S1SH 2VRAA 3IVKA 2CDGA 3MPCA 1MCIA 3RTQC 4TNVK 1FO0B 2FEDC 1X7QA 4K71C 5I19L 3FQXB 1GHFH 1VPOL 5JORA 2KH2B 1JNNH 4Z7WA 1N0XL 1TFHA 5DZLA 4HUUA 1VHPA 3D3VA 1NDGA 1AKJB 4NO0A 3SE9L 1P69B 3QIWA 3QFJB 2VLJB 5HY9A 1A7QH 3ZT5A 3UPRB 2AK4B 5EA0L 1MWAH 5F1OB 5SX4I 5JXAL 1GGIL 3MLUH 3GI8H 2SEBB 3CVIL 3DMMB 4NQEB 4XNMB 3RZCB 5FYKL 3ARFC 4WI2A 4I13B 1QSFE 2D4DA 5BO1L 2VXVH 4M62H 5CD3B 4MD0B 2R9HC 3QDMD 2ERJC 3VGAB 4HT1H 5GRVK 1C7TA 4U3CA 1F4AA 5FV1L 4Y4HC 5TDOA 1NCUA 4P2QE 5E94B 4GMTH 2I26N 5TE7H 1QRKA 1MJJB 1F13A 3OGCB 3NH7H 4MZ3A 2CSPA 1RZ8B 4X8JA 1UWGH 3IS1X 4M6AA 1MCFA 1TQBB 5J7CC 4APQB 4M48L 4XBGA 1YEDB 5C09E 2DBLH 4RNRA 3A6BL 5EB9A 3RVTC 3BRFA 2DL9A 2V17L 2VLJD 2AK4D 4U1MA 1EIBA 3PL6B 1S7SA 3UJIH 1R3IL 3RHWK 3DMMD 1IGIH 3UMTA 4FQXB 5C7XH 2ZCLL 3CUPB 1KIRB 4XWGL 3U7AA 3MFGB 5I8CB 4P5TA 5DYOA 1W0YT 1EUUA 4U05A 1EJOL 3V8OA 4YUEL 4DVRH 4ODWA 2YD6A 4NT6A 1D5ZB 1EFQA 2W0KA 4WU7A 3UZQA 5D7JA 3BH9B 3H9HA 4Z7QF 2E7HA 2ZPKL 1N59A 2CJUL 3CMOL 4O2FB 3E6FB 2EDXA 4JHAL 1F00I 3F7YA 1T21A 4R0LB 1M7DB 3P0YH 1A9EB 1Q1JL 3VD5A 3OKYA 3BKCL 1KCSH 1U93B 3P9MB 5SV4A 1CDYA 1JPGA 4YEEA 1OGAA 1UKSA 4AH2A 5JQ6H 1BGXL 4F7MA 3KPSB 2VWEE 3L95B 1Z0NA 1ZKAA 3QO0A 3MRPB 4YDKH 4UBDD 5BVJA 5ADPL 1S78C 5IFJA 3DXAE 4K2UL 4FQXD 5FYLL 1Q8MA 3QCTL 2AXFB 4XBPA 3AY4A 1N5YH 1NAMH 5F44A 3MRBB 4UT9H 5KN5A 5KS9A 2QLVB 2ZZUT 4K7PH 1MRCH 3QXAB 4XB8A 4MAUL 2IGFH 4PRDB 5D7IB 1EDQA 1IMHC 3MGOB 4G80B 3E6HB 3UTTB 4HV8B 3HRPA 4M61A 4FG6D 1R3HA 6FABL 4FQ1L 5IWLA 3UTSE 2WW8A 3D6GA 4P2OB 2CUHA 4WW1A 1A14L 4H1LG 4KVCH 3OKOB 1A9BB 1RUQL 4HGKC 4BYHA 1S9YB 1F11B 1U8KB 2WQRA 4DW2H 5KVEL 1MUJA 2DWEB 4RRPA 1E4WH 3HHRB 4ONOA 1FVEB 4GSDH 3JTSB 1HYRC 1BAFH 1CXEA 5HSFA 4M7JL 4QXUH 2MQ0A 4LVOC 4XPAL 5C0BE 4WHTB 3TA3B 5E2JA 4NDMA 4HIXL 4IDJL 3BPCB 5K9OA 5DQJB 3RWGA 5DMGC 5FUZL 1S8DB 4PLOB 1DL7H 4OB5H 2QSQA 1PLGL 4CU6A 3SDDB 2WIMA 4LGRB 2IQAA 4LEXH 1QSEA 1XAUA 2CRMA 4RMUA 5JIIA 5F88B 4DOHB 2AI0L 2GY7B 1XF5A 3CDFA 2BSED 1WUNT 1T03H 4OCSL 4ERSH 3UTTD 5I75C 4YE4H 2O5YL 5C9KA 1INEH 1BVLB 4BKLB 1QYGH 5E2UL 2Y36H 2Q7YB 2ADIA 1N5AA 5DK2B 2HLFD 4P2OD 5FO7B 3T2OA 4XMLH 5LJYH 4HEPG 2MHAA 4AG4H 4KAQH 1JVKA 4GW1B 3S88H 5F89A 2AGJH 1T83A 2YPLE 3LEVL 4MX7A 1FNAA 5LXGL 3M1BA 3G5YB 3NFNB 4M4RA 4M9PA 5CIPB 4JQXA 3BT2H 3O45B 4GXUM 3GSRB 3SDCB 4YIQB 1GH7A 5I1IH 3LRGA 4AJ0A 2WK2A 1HHJB 4PJEE 1XFPA 3MA9L 3QQ4B 4F15B 5HI3D 2QADB 2NX5A 2YK1H 4W4OC 1VA9A 5DHXB 3UO1L 2VXSH 4P2QD 2AJUL 4NNXA 3I3EA 4L4VA 3ME0A 2R39A 1NGPH 1FAKT 4JG1H 1BFVL 1XF1A 2QSCH 4HPOH 1C12A 2H45A 5F9JB 3G9VA 3QIWC 1NC2D 3MRGB 3JV0A 1MH5A 2BY0A 5C09D 3HC3L 3ESVF 3V4PL 4YR6B 4OUOA 4PUBL 4OCNC 3H0TA 3CZJA 1NLDL 1KJ3L 3O11A 3MV7E 3HNVL 4HK3N 3T2NL 4PJDF 2GAZA 5GZOD 1T7ZA 3KPOA 1HNFA 2A83B 1MCSA 5DMYA 3JUZA 1Z9MA 5FA4B 2W60B 1UH2A 4YWGH 2V9TA 5JW3L 1KXTB 1RMFL 4U1HB 1UA6L 4XP1H 1I8IB 3S4SG 1M7IB 4TSAH 4ZUWB 5C2BH 5I0DA 4M5YL 2JELL 4RIRB 3DV4B 2OLDA 2P5EA 3ZE1E 2R29H 3CH1B 3HCVB 1CDGA 3GSQB 3EZ8A 2QADD 3WN5C 5C92A 4K3EL 3D2UD 1CL7H 4MJ5B 1PX3A 4PJBE 4BSJA 1EMTL 4WV1A 4Q6IB 4FFWD 4ZG1A 1G7IB 1IAII 2P5WB 5E9DE 3NIGF 5KSBF 3I6KA 2YKLH 5FO9B 4H25B 1E6OH 1T66D 4N5UA 5B4MC 1T7YA 1QR4A 3S3JA 3QEHA 3D0LA 1R24A 1S7QB 2DJSA 1KLGA 2Y5TB 1FFRA 4J1UA 4QNPE 4ZFZB 2CK0L 4HJJH 3OAZK 32C2B 5KVFL 1UH3A 2YEZA 4O4YL 4TPRH 3FB8A 3PWPE 4P2RB 5I66B 2HN7A 1MFBL 2DN7A 2FDBP 3DXAD 4WVRA 1JIBA 3CXDH 4WFGE 1A3RH 2FJGB 1K3IA 1O7SA 2G2RB 3E8UL 1DVFC 1GSMA 4NZJA 2ENSA 5DQDH 5E99H 1CICC 1RHHB 4X9HA 4L3EE 3TT1L 5I71B 5C6TL 2EZ0C 3UJJL 3CU7A 2DYPA 1BX2A 4FQJL 1HSBA 1ZGLB 1T1XA 4MWFB 3CK0H 2A6IB 4ALAL 5D1XC 3C8DA 5E4EB 3RFZC 5L8JB 4E0RA 3UTSD 4MMZC 5DSCB 3QHZH 4X6DF 1BD2E 2HMID 4D0CB 1RUAH 4HIIA 5FDWA 4LP4A 3ARBD 3DROA 3N0PB 2FWOA 4JE4B 2F53E 1HEZA 4HXAL 1UEMA 4QXWA 1R3KB 1J1OL 3AREA 1QFPA 4XMPH 3HTLX 3LKNB 4HLZG 5C0BD 2Z92B 1Q0YL 4NWTL 4J3TA 4P2RD 3QO1A 3AY4C 3C08L 1HHKB 5CUSL 1WIOA 2XACC 2HTLD 1LP9F 2C1PA 3OTTA 4OCYH 5DK0B 1CE1H 4F7EA 3KHQA 1I3GL 1T04B 4XCCH 1OAXH 1NBZB 1T80A 1TJIL 4I3SL 4DZ8B 2AEWA 3VFPB 2YD1A 2ZOKA 5I16A 5KVMC 4YHML 5I8KL 5IWLC 3MODH 1C16A 3GMNB 3VFOB 3I9GL 5A3ID 3IJHB 2W65A 4JZNB 1T0NA 3TESA 3ET9F 5DO2D 3OKNA 1AE6H 5MEOB 2FD6H 1JL8A 1XH3A 4XCNB 3WS3A 5FUCE 2P8MB 2H2SC 1QBML 4MVBC 2Y9RT 3CPLB 3GJFK 2XTLA 5CINL 3SKJH 1VFOA 5AUMB 1H8NA 4HUVB 2B4CL 2YPLD 5ABDE 2QKIA 3F12B 4HMDA 5KVDL 3OKLB 1DLHB 3W0WE 1N2RA 2V9RA 3L1OL 5CILH 2F8VA 1DQDH 3MCKB 2NY4B 5IVXA 1EEYA 1T89C 3QUMH 4DGIH 2FHFA 1CFVL 3ZKNC 3BP7A 1P5VA 1UC6A 3FB6A 1Q9KB 3BD3A 1E4JA 2WP3O 4L3CA 1A0QL 2FGWH 1NDMB 2NXZC 1UGNA 4LHUA 4PJFB 4BQCA 2EDWA 1KYOK 3W2DL 2DQEL 4Y2OA 5EU4A 5E1AA 2OI9B 1TPXC 5E70A 3AFLA 2XYCA 2WNGA 3LS5L 3TBYA 1CFTA 3MCG1 5C0FA 5E9DB 2YSSA 3C6LD 4ZFGL 5E1HB 4QRPE 1KBGL 3RL2A 1UACH 5EZLB 5D93B 1GXEA 1YY8A 1SEBA 5EBWA 1S7VB 1PY9A 5GGVH 5GZND 3EYFB 4LAQH 1T83C 1AXTL 4GFTB 4QF1A 4Z95H 5DJZA 3KVQA 5GGRA 3MV7D 2ZUSA 3G5ZA 4F7CB 4C55A 3EO9H 4JQXC 5AWNH 1P4IH 1OP5K 2H3NA 3QDGE 5EUKA 1MFEL 1YEEL 1MCCA 5E2WL 2ADJB 4KKAD 1FDLL 1U8JA 2R0LL 3VXTA 1I3VA 2XZAL 3PXHA 3H7BA 3D25A 5H37H 4BELD 1A7RL 3AS0A 4PP1C 2CLZB 1EAJA 5B22A 3G6AA 3RKDD 1MCJA 5DVMA 3SPVB 4WEBH 1X5ZA 4YXKL 5K9KB 3F6IA 4ZPVB 1Y6NR 5E56A 1AC0A 1XCQA 2BSTA 4L8BA 3FONB 4XNYH 4TSCL 5DQ9A 3C5JB 4R7DB 4A6YL 4ZODA 2X4NB 5HGHB 4RFEB 5E9DD 1A6AA 1EXUA 4K8RC 1HYSC 5H94A 4FXLA 4M6MH 2F53B 1G7LB 1MFCL 4TNWF 1S7WA 3VJ6A 2EDFA 1H15A 4PTTA 3U9PL 3KPPA 2NY7H 3MZGB 3KXFE 1ITCA 3O2VH 2C1OB 4I48B 3QT2A 1FO0A 3UYRH 4WFGD 1TQCB 5IK3A 3QI9D 3HPJA 3FQXA 3S98A 1JPFB 1MF2H 1J0IA 2WM0A 1QZ1A 4HXBL 4L3ED 5C0JA 2V2XB 1XMWA 5EUOF 1JF1B 4PR5A 1BQSA 4BK5A 3K74B 3A6OA 3H42H 2VLJA 3UPRA 2AK4A 4OSUL 3EOAA 3WHE1 1NANI 2FX9H 3CFCH 2SEBA 3MLRL 2CIKB 4KTDL 2LE9A 4XNMA 3KPQB 1BD2D 3FKUS 3D0VA 2ZG1A 3DX9B 3P4NA 1FVCA 1ZTXH 4K55A 1YQVH 2J4WH 2OTWA 3STLB 2F53D 3GEWB 4ODBD 4GS7B 2A74B 1CLCA 4MD0A 2IADB 4XAWH 4IRSB 3VFSB 5AZ2H 2FX7L 4G6KH 3W0WB 2IBZY 3CLEL 3HNSH 1LWRA 5DD3H 4AY0A 4LSQL 3QIUB 4TNVF 1VKXB 1MJJA 3U0WL 1TVBB 5E6IB 1ZLVK 2F19L 1CZ8H 1QFWH 1YEDA 4YGAB 1D6VH 4OLXL 5FGRA 2FECL 5E5MA 4NCC2 4WEUD 1C08B 5GJSL 3I3DA 4KJQD 5C0CB 1MVUB 1NCBL 4QRPB 4DK3A 2DQIL 1OSZB 5LGHL 2DDQL 2VDOH 1UCTA 5IHUL 1MLCB 1V7MH 3P2TA 1XIWB 4XXCA 1J88A 3BKJH 5INDA 5C07E 5ETUB 2PO6B 4P3DB 3BW9A 4R2GC 1UQSB 4BH7B 4FQXA 4U1IB 4FQHA 1B9ZA 3RDTD 3ROOA 2BXYA 1NGWB 3SDYL 3CUPA 5CEZL 4NQDB 4LEOA 1NBVH 3AREC 5I8CA 4FFVD 4WI9A 5HDBF 2AJVL 4LL9A 4OIIL 4HJ0D 4YHLH 2QQLL 3QDGB 3D39E 3WNLA 2GK0A 1C5DA 3VFGH 3W0WD 3IDYB 2ZSVA 5I1LA 3TO4B 4DTGL 5JZ7D 2Z4QB 2J7LA 1V7NL 3H3PH 3BH9A 4XI5C 3QIUD 3E6FA 4ZYKB 1MJUL 3DSFH 1VSCA 4NQUA 1IAMA 5D2NA 3RVWD 3ZDXF 3DIFA 1NEZG 3VGFA 3BP4B 4QGYA 3S34L 3GSXB 4XX1G 2NMSA 4UQ3A 3UTOA 5IMOB 2HTKC 3HFML 4KTYA 3UROR 2IAMA 3L95A 2VE6B 2ICWI 3NCYS 4QRPD 3RHWF 5F8QC 2KZWA 2VR4A 3MRPA 1BOGB 4LSSH 1XIWD 4PTUA 2BOBB 4Y4FD 1A4JA 5MP6L 2YXFA 1B6DA 2PO6D 4HKZB 2FECI 4KUCD 5CP3A 2KBGA 3MBEB 1IFHL 2AKRB 5L9DL 4NQDD 3MRBA 2CDEA 5DJ0B 1F6AB 3V79C 1QO3B 4KKBC 3CFBB 3JXAA 3QDGD 1CXIA 4PRDA 5DUPL 3SGEI 4G80A 3E6HA 3UTTA 3TO4D 4F37K 1NCCL 3BGFB 3FT4A 3HI6L 5D2LE 4JDZB 2O26U 1BJ8A 5KSVB 4UNVA 3U7WL 4P2OA 4PJHE 2PW1B 3OKOA 1A9BA 3OJ2C 3WD5L 1FSKB 3I2CL 1S9YA 1F11A 1U8KA 5DHYA 2ZKHH 4XNZB 4KMTH 1ZWIB 4N9OB 1MEXH 4UAOC 2N7AA 1QFOA 1KB5B 1DQJB 1FVEA 4L4JA 3FQRA 3O3DA 3MRQB 4U6VH 4YH6A 4BJLA 4QRTB 1QSFA 4WFEE 4JO3L 5DVNA 5FIEA 3S97C 4DN4H 2AVGA 4B0MM 2J5LC 4PJ9B 3KPNB 4HK0A 3PV6A 5CSZB 3MR9B 5DQJA 3QUYB 4JRYE 1VFAB 2IG2H 5ALCH 3SE4A 3MBED 1S8DA 3IU4L 4I77L 4OGZA 3O3BA 3U2SB 4P2QA 5D7LB 4KI5D 4AQOA 3U36A 1V3JA 2CUMA 3NCYP 4WI4A 4WFHD 1ZLUH 4BZ1H 1WCQA 1EGJA 2AABL 3Q3GB 2WMPA 4DQOH 4HIHB 3QWRD 1BVLA 1NC2A 4BKLA 3MUGB 5C09A 2DKMA 5J06A 4U0QB 1I85A 5FO7A 3ARGB 2BK8A 4NZRH 3KPMB 1ZVSB 4Q0XL 1TTUA 1KPVB 3IFLH 2YWZA 4JZJC 3VXSE 3EO1B 5C07B 1A6VH 3QCUH 3LV3B 4S1SL 2CXGA 4H1LB 2A6JB 1AIFB 3G5YA 3NFNA 2BVEA 4IMLB 4DVBB 5I2IB 2NXYB 2J88H 4OFDA 4DKFH 1QACA 3O45A 3UP1A 2BNQB 3LSOA 4YIQA 1UWXK 3G08B 3IKCB 4G8GE 1GHFL 4P48A 5LKNA 4LLVA 4OCMC 1JNNL 4PJ9D 3PQYE 4MXWH 1JNJA 4Y4KB 1HNGA 3QQ4A 1I9IH 2F5AH 3QUYD 4HAGA 5FKAA 2CO7B 1UG9A 1RY7B 4N0YH 4RDQG 4RMWA 1CQKA 1I8MA 1A7QL 3D2UA 4N8CH 1MWAL 3MLUL 3AU1A 3GI8L 3K80A 1JWMA 4PBWD 4Z7NE 4LOUD 3FRPG 1OTTD 3FAXA 3K2UH 4HKXB 5CHNA 2VXVL 3MRGA 3JV5A 4HC1A 4M62L 4A2LA 5BRZB 4YR6A 4EN3D 1WWBX 2GW5A 5CBAB 5HHXH 3S6CA 4HT1L 1QG3A 3DMMC 4ZOAA 3RZCC 2RHEA 5C07D 1A02N 1RZGB 4GMTL 3DXAA 5TE7L 1F02I 2NXYD 3NH7L 5J89A 2VZVA 4FN0A 3SCMB 2BNQD 1UWGL 1FG2B 3CDCA 3U9UB 3VGAC 1VCAA 4H8WC 2D2OA 4JFQB 4ZUWA 4NM8H 5KS9F 5IB2B 3RVUD 2XICA 4P5MB 2DBLL 3TVMA 2Z8WC 4Y4KD 1LO4H 3CH1A 5F7LB 3HCVA 2Z8RA 3GSQA 15C8H 1HCFX 3FO9A 1QVOB 4D9LH 3TNMB 3ZLQC 3PWJB 5D2LB 4KV5E 3UTSA 4Q6IA 1TQBC 4APQC 2APWA 3UJIL 4GQ9H 1ZHKB 1VACA 5GHWH 1IGIL 5C7XL 1DUYB 3ARBA 4GRWH 5GQBA 4MA8H 4K7FB 1BVKA 1EEQA 2WBJB 2DI9A 4YZFE 5BRZD 3LVEA 5DFTA 1Z9SA 1FO0H 2Y5TA 3PL6C 4QRUA 2FIKB 2G9HB 5C0BA 3BPLB 3CXHJ 3OB0H 5DRZB 3S5LG 4FQXC 2A1WH 3EYSH 3WLWD 1OD9A 4P2RA 1WFOA 5F7YC 3LN4B 2L7JA 1XGYH 4B53A 4QO1A 5HDQL 2FJGA 3P0YL 1AD0A 3SCMD 2G2RA 3O4LE 5KJRH 4U0RB 1KCSL 4WENB 1FL5B 4FP8H 5D1ZB 5EWIH 4RA0C 5T5NG 5GRWA 2X40A 5EFIA 5L8LB 4GQPH 4FG6C 4EI5B 3AGVA 5JQ6L 4MWFA 3HE7B 3IDUA 3W9EA 1KCUH 4R0LC 4LASH 3L3DB 2EC9U 3E3QE 5FM8A 5EOQH 4YDKL 4H8WH 4D0CA 1G7QB 3WUWG 3KNBA 3DNKA 5F7KC 2WBJD 3G6DH 2YPLA 3DHJA 4KFZC 1N5YL 4OZGE 1NAML 3C6SB 4UT9L 2H9GB 1R3KA 3ULUC 1WWCA 2VUYA 2BFVH 4K7PL 1MRCL 3LKNA 3R0NA 4P9HH 3MRLB 1HINH 3TJEH 3LN5A 2Z92A 4CDGC 4LBEA 4U7SA 1HHKA 4JRYD 1R5WA 3O2WH 2R2EA 5IESH 4KVCL 5DK0A 3K8LA 4R4BB 1PY4A 2V7NB 1T04A 3I6LE 1OD7A 1XF4B 1NBZA 2UY6A 1FH5H 1I7UB 4KK9D 1P6AB 3DGCR 4S0SD 4DW2L 4DZ8A 2D31B 1WZKA 1AD9B 5CZKA 3JWDH 3VA6A 4EI5D 1E4WL 1KJMB 3C6LA 4KDTA 3R8BB 1YEKH 1HK6A 3HE7D 3GMNA 4ZXBD 2HLFC 4GSDL 3VFOA 4P2OC 4HW6A 4JFZH 1BAFL 4QXUL 4ELME 4ODTH 5MEOA 1ED3B 3BUTA 4QOKB 2P8MA 3IKKA 1OP3K 1RUKH 2UZXB 3MV7A 1ADQA 3CPLA 1U42A 3VXSD 5AUMA 1DL7L 4HUVA 4OB5L 3BP5B 3TA3C 5F7WC 2R4SH 3OKLA 5GS1A 1FNGB 4NHUB 1UH4A 4V1DE 3MCKA 3ULVE 4HFUH 1T03L 4ERSL 4YE4L 1INEL 3SE4C 1QYGL 3DOSA 5FYKD 2Y36L 1RK1B 3ZTJH 3DJ9A 3BEWA 3SDDC 3OF6A 3B9KB 4PJFA 4L8SA 3BQUB 1CXLA 3SO3C 3LEYH 1NQBA 5JHDE 4AG4L 5F7MC 4KAQL 4PJBA 3S88L 2AGJL 4Q58C 5CP3H 4I2XE 1KPRB 2JJSA 5E9DA 3BN9D 2JE8A 2XWBA 2YC1B 3BT2L 1YJDC 1I85C 3MJ8A 5F21B 1S7VA 5I1IL 5GZOC 4IOSD 4AEHH 3ZKMC 2CLRB 5JLZB 1J7VR 1IAOB 3RNQB 1MRDH 3OGOE 3UTPE 2UWEE 3MV11 4F7CA 4JR9H 3H7LA 3T0VA 2YK1L 1AO7E 2O93L 3MUJA 2VXSL 3SDCC 4K9EH 4KTEH 4QRRB 2APBA 3G6JB 3U4BH 3QI9A 1OW0A 1Z0MA 1NGPL 2DM4A 4JG1L 5CSBA 5D70H 4G3YH 2YPKB 5IROA 2QSCL 4F15C 4HPOL 5BVPH 4Y16B 4L3EA 2QADC 3HAEH 5E7BA 4E5XA 2OTUA 4PRPE 8FABB 1KUMA 1MCRA 2NY3B 4ZPVA 4D0DB 4WI8A 4FFWC 2BZDA 3TH4T 1FL3B 2DLTA 4HDIB 4X7EC 4EQ2A 5DEFB 2X89A 2O5ZH 5IR1A 3GFUA 5A2IH 5JW4R 1FNEB 4XP4H 1BD2A 4OGAD 4JN2B 4YWGL 3HPLB 4RFEA 1ZHNB 5I8EB 5CP7B 1FORH 2CIIB 4DKDC 1NBYB 2F53A 2XWTA 4LRIC 4XP1L 2C3XA 5TQ2H 1FV1B 4TSAL 2IQ9H 5C2BL 1EGJH 3SEPA 2QEJA 5IMKA 3LQAC 2R29L 4NQXB 1L6XA 5F9WB 1YJDH 4Y5XA 1CL7L 5CGYD 2C1OA 4I48A 1YPZE 4EDXB 4QRRD 3L7FB 4MA7H 1TLKA 1J0KA 1AQDB 2YKLL 3T4YB 1E6OL 4Y16D 2V2XA 3QWOB 4LCCB 1FIGH 3I6GB 4MQ7B 1GAFH 1TNNA 4MNGB 1NLBH 4MCZB 3K4AA 2NY3D 4Q6IC 3TJHD 1JNLH 2Q76B 3LQMA 4PS4H 4HJJL 3TIEA 3L3GA 1EH9A 1GZPA 1RIHH 3WIIH 4TPRL 4WI6A 3RDTA 3DX9A 5HYJB 1A3RL 1VEMA 4NQSA 4ZSOB 3MRKB 4LVNB 4M1DL 5DQDL 5E99L 2IADA 2YN5A 2CPCA 4MYWB 4W6XB 3QIBB 3P73B 3W0WA 4X4YB 4WTZA 2X5PA 1WITA 4MDJB 3CK0L 1MCWW 4HC1H 5IVXF 2HTLC 5F7DB 3WIFB 1VKXA 3QNYA 3MNVB 3U30B 1JTTA 5F1KC 1WWAX 5DGQA 3QHZL 1I7TB 1RUAL 5I71C 4XP9H 3KYOB 3PP3H 3LQAH 1KPUA 3I6LD 4I2XB 5HYIA 2P24A 5JXED 5A3IC 5E4EC 1C08A 1CL7I 4QHKI 5F6IB 4N5ED 4QRPA 1CT8B 5DO2C 5MENE 1OSZA 4XMPL 2ZUXA 1IQDB 1MLCA 1XIWA 4Y4FA 3PUCA 2PO6A 1UQSA 4BH7A 1YN7A 4G42B 4KK8D 2VDKH 4U1IA 1NGWA 4WHYH 5HYJD 3V7AE 4LCWB 4NQDA 4OCYL 1CE1L 4B41A 3ES6A 1NAKH 4XCCL 1OAXL 3QDGA 3RJQB 4AIZA 2PW2A 1AJ7H 2VDQH 3EIFA 1H5BB 1AGEA 4V1DD 2Z4QA 3ULVD 5C0NC 3MODL 2Q8AH 5J6HA 1BVZA 4ZYKA 4QCIB 3NZ8B 4CVXA 2NW3A 1OT1A 1AE6L 2FD6L 1TCMA 3WL9B 4Q74A 2EIEA 3BP4A 3RI5K 3RUGF 4R26H 5HGBA 3GSXA 4JG0H 4XGZA 5JHDD 3SKJL 5TJWK 1RJCA 1NGYA 4S11A 3WDHA 2VE6A 3FOLA 3MUZ1 5GZNC 3JWNC 1DQDL 5JDSB 5I15H 1UB6B 3EOBA 1B6UA 1H3WM 5I1KH 2OR8A 3QUML 1XGUB 5D7KE 4DGIL 4OD2B 2JCCE 1J0ZA 1FYTB 4X99A 5A16B 5ITBH 4KKCD 3QB7C 5CJQH 3MBEA 2AKRA 4Z7VE 5HGAB 4LCWD 2FGWL 4N8VB 3U0TB 2DTMH 4HD9A 5IMMB 5DJ0A 3ZKXB 1AO7D 3LIZH 3KXFA 4KKAC 1QO3A 3NIDE 3CFBA 4N0CD 3VRJA 2V2TB 2NY4C 2UUDH 4JVUA 2HG5B 3MNZA 3RKDC 4YDVB 4MA3B 1BM3H 3QWRA 4JDZA 1UACL 4N0FB 3LKQB 1MJ8H 2NR6D 2B20A 4LFHG 4MXQD 4DN3H 3BXNA 5GGVL 1AHWB 2OX5A 2PW1A 4PRPD 3V0WL 1AGFB 2J8UB 2OI9C 2YA0A 3D85B 4ZUVB 4LAQL 4Z95L 2JJSC 4X0KA 4QHUA 2MTPA 3QRFM 3EO9L 4RMSA 5AWNL 2P48B 1P4IL 2A6DA 4NQCE 1KB5A 3KLSA 5D93C 1DQJA 1CTNA 1E4XH 3T8XB 1OGTB 3PWNB 5C08B 3ZDZF 2BMKA 3FB7B 5F96H 5J1TC 4PJ9A 3BIKA 5CSZA 3QUYA 2NLJA 1VFAA 4WEBL 5HGDB 4M7LH 2VIRB 4ZO7A 3U2SA 1EEUA 4IRJB 4R90H 1INDH 2BP3A 1OW0C 1PZ5B 1T6VN 4OV5B 1YDPB 2DM3A 4O2EA 4XNYL 4JB9H 1MCPH 2JTDA 1ADQH 1G7MA 1OP9A 1X5YA 3SGJA 1MCKA 5C9JB 2E9IA 1HQRB 4M6ML 2BC4A 3CDGB 5C0EB 4KWUA 4EN3A 1E0OB 1U8MB 5K59E 3L7EB 3D85D 3KPMA 5MENB 1ZVSA 1KPVA 1QA9A 5TFSH 2AW2A 5IVZA 5JPNA 4BFEA 5C07A 4JJHA 1HOCB 2GFBA 2NY7L 3O2VL 4IMLA 4DVBA 4DFIA 2YD8A 2XFXB 5IQ7H 1TJGH 4LPVA 3UYRL 4GW5A 4F9LA 5DMKB 4ZO6A 3L6FB 1T5XA 3P0GB 1GC1C 4G9DB 5IHLB 1MF2L 4UZGA 4TULH 4PLNC 2VTFA 4Y4KA 1G1YA 5EBLB 4L5FH 5HYSG 3B83A 3H42L 1T1YB 1TQCC 5ICXA 4PJ8B 2AJSH 1EO8H 3OX8B 2FX9L 3CFCL 1CD0A 1N6UA 2VXTH 3MFFA 2XNAA 3DO3A 4J3XA 4HCRA 4MNHA 4KJQC 1ZTXL 1YQVL 5BRZA 4C56B 2J4WL 5F93C 5IVOA 5HD8D 5GXBB 5IBLC 4XAWL 1S7RB 2UVEA 5AZ2L 5FCUH 4G6KL 3KWWA 5MEND 4JJ5A 4PG9A 5ICZA 3HNSL 2QTEA 1G9NC 4NJ9H 4YJZL 5DD3L 1P53A 1DDHB 5TGBB 5C70A 4XPTH 5HHPB 1A6PA 1U8QB 2ITCB 4FFVC 4J2XA 1IAIM 2LV4A 2BOCB 4GS7C 5DC9B 4HJ0C 4KJPD 3VMNA 3SCMA 2DMBA 3TZVB 4IRSC 1F3JB 3LKSB 3UYPA 2HYMA 1CZ8L 1IC4H 1QFWL 1D6VL 3UPAA 5FYKU 4P5MA 4M5ZH 2GSIB 3QIUC 3RPIB 1WWWX 5D7IF 1R0AH 1CE6B 3TNMA 2A6KA 5DJ6B 3RVWC 4E42B 5D2LA 2YUVA 4OLWH 4TUOB 5E6IC 2VDOL 4PJ8D 1V7ML 3BKJL 4PJHA 5C0DA 25C8H 1GC1H 5FF6B 3BUYA 5E5UB 2XTJB 2WBJA 3SKOB 4G6MH 4L8CA 4HPYH 4Q9RH 1CLOH 3SKMB 1NBVL 3L5IA 1I1AA 4YHLL 5J1AB 1BREA 5IFAH 4NO2B 3FO2A 4PP2A 2PO6C 2G9HA 3VFGL 1HQ4B 4XH2B 4WCYH 3QXUA 1FPTH 3H3PL 4OKVB 5D7KD 3DSFL 3KYMB 4JRYA 1IL1B 3HZMB 3PWUB 3TZVD 2HKFH 4OBSA 3JZ7A 3L3JB 1FL5A 2APTA 5DJAB 2PXYD 3IDYC 2VABB 3TO4C 3HUJB 4YXLH 2CQVA 4EI5A 4OM0H 1HKLH 1PBYA 2X1PA 3HE7A 1P4BH 1LEIA 4ZXBA 3QNXB 5LGKA 2PYFA 1T3FB 3MV9B 3L3DA 5EN2B 4YAQB 4JKMA 3T0XA 4LSSL 2FBOJ 2Z9TA 3VXQB 1JGEB 1G7QA 4X80H 2V5YA 2VDNH 4FMKA 2NY5H 1F6LL 1C1EH 3VXSA 2XTJD 3MUHL 2Q1EA 2W07A 1DEDA 2H9GA 3QNZA 5E8EB 4NQCD 3VFWB 5GISH 2ORBH 5GGTH 2PYEB 1RD6A 1EVUA 4QT5A 3VDBA 1ACYH 3BHBA 3VD9A 2EDNA 3MBEC 2OSLB 3PQYA 3X3GH 4OD1H 2IMMA 4XPFH 2EC9T 4HHAB 4KI5C 4RFNB 4TVPE 4Q97A 4R4BA 1J1PH 5I1HH 2MOVA 1XF4A 1ZT1B 2D31A 2ZKHL 3BGFC 4AL8H 2HT2D 4KMTL 5A2FA 2MMXA 1MEXL 1KJMA 5DI8A 1K4DB 5ID1A 2KQMA 5AYQA 5IF0B 4U6VL 3V0AC 4OLZH 3UX9B 3N1FC 5IEHB 1X5HA 5DJYA 5JW4Q 1CDJA 2W91A 3TV3H 1FSKC 4DN4L 5ACZB 1N64H 3BKYH 1RAMA 3B8SA 1SEQH 4Y5VA 5DRNB 3VXPA 3D69B 4XNZC 3DX6A 1DE4A 2IG2L 3V7MA 1R5IB 1K2DB 3FQWB 5ALCL 3RWCA 1F97A 4WDIB 3BP5A 4FTVB 4MJ6B 1KTLB 3GMQA 1IEBB 5H2BB 1X4YA 3CFJB 3UTQB 1KLUB 5CEXB 3T2QA 1FNGA 4NHUA 4PJ9C 1RUPH 3AAZA 2PYED 4BZ1L 4RMTA 5EU5B 5T1KB 3QUYC 4NM4H 4DQOL 1NFDE 5K9QI 4NKIH 1KTDA 4JO2L 5F9OL 4NO5A 1SJHA 2C3HA 1IGFH 3P11H 2Y72A 1KG0B 2BY2A 3TYGH 1CLYH 4NZRL 4UOW1 4GO6B 3IFLL 1OTTC 2Z91A 3U6RA 3SGJC 1A6VL 3QCUL 5J9PB 3TO2B 2YC1A 2D7MA 4FNLH 2J88L 4DKFL 3B5HA 5I1CH 1TZHA 3ARGC 3RY6C 3RVXD 2C7UA 1QBLH 3FQTA 4U6TA 1XR8A 4NRYB 4MXWL 3RNQA 1I9IL 2F5AL 2EDQA 4HMCA 3IF1B 4W4NA 1R3JA 4N0YL 5FYJE 2NXYC 2W0PA 1F42A 4FTVD 4RRPG 1IGYB 1TVDA 4N8CL 4F9LC 4YDIH 1WF5A 2GUOB 4U4BA 2MWCA 3RVUC 1FNSH 5DEGB 4Y4KC 5T1KD 3K2UL 1UJTA 2X1QA 1KB5H 4F8TA 1MNUH 5CJOH 4ODXA 2CLVA 1KSRA 5D1QB 5CEZD 4D0DA 1J8HB 5HHXL 4G8IB 5J1SC 4HDIA 5KZCB 2HVJB 5DEFA 4YO0A 4S0TD 3VG9B 4HJGA 4GLRH 4JDVB 1FNEA 4WHCA 3QA3A 3ZHKA 3U7YH 2D7PA 3BGMB 3HPLA 1OAKH 5ESAB 1Z5LA 1ZHNA 1JE6A 5ELIA 4AEEA 2L7UA 4NNYA 3FOMB 3SE8H 3I50H 1WBZA 3Q5TA 4OZGA 3P4LA 4NM8L 3MCLH 2X4SA 4A2MA 2NY6B 1LO4L 2Z8VC 4NQXA 4NKMA 4JO1H 1BQUA 3FFCB 4D9LL 4GXVH 3SCMC 4DGVH 4W6WB 1B88A 1I7RB 2APVA 4F7PB 5DTFB 5T1MB 1INQB 2BNUB 4YDJA 3BKMH 3DVGB 3L3KB 4GQ9L 5T3ZE 2VO5A 5GHWL 5EU6E 3KLHD 4ETQB 2ICWJ 3T4YA 4MA8L 4FQ2H 1MHEB 5JXEA 3I6GA 4N90D 4F3FB 1CVSC 1NL0H 4MNGA 2COQA 4N0UE 3T77B 2CKNA 1FO0L 2DQGH 1G7HA 2L0DA 3GB7A 4CVZA 1J8HD 4YXHH 3GGWB 2Q76A 5D5ME 4KDVA 3ZYJA 5KZCD 2DQTL 1B3JA 5EU3B 1DJSA 1W8NA 4WU5A 2V6HA 2A1WL 3EYSL 2VZOA 2WBJC 4UQ2B 5IIEA 3T3ME 1KNOA 2QQQA 1XGYL 35C8H 5IB4B 1RVFH 5HYJA 3QXVA 3B3IB 4RQQB 5EIIB 5KJRL 3MRKA 4KXZI 4FP8L 2C4XA 5EWIL 1V05A 3SQOH 3BPLC 3V0VB 3NACH 1W72A 1V3MA 2R1WB 3P73A 2ZG3A 4HCRH 4X4YA 2NY6D 4MDJA 2I25N 3HZYB 4V1DA 2F74B 3BVNA 4XCFH 1KCUL 1NFDB 4U1LB 3WIFA 4LASL 4ORGB 4U0RC 5D1ZC 2VQ1B 3ARSA 2H1PH 5EOQL 2ED7A 2A2QT 4YLQT 4H8WL 3H9SE 4YHIB 4HUNB 4PJFF 3CX5J 4XZUB 4TVPD 3OXSB 5EC2B 4EI5C 3QWQB 5DJXA 5JHDA 5MHSE 1QR1B 1ZA6B 1JFQH 3HE7C 4XPGH 3G6DL 4I2XA 1OY3B 1D5MB 4QRSB 4R4ND 4MLSA 1I1FB 2BSRA 1B0RB 4NN5B 1CT8A 3WNOA 2BFVL 3IRPX 4P59H 4Z0XB 1A4KA 1MWAB 1IQDA 4P9HL 5DC0A 1HINL 3TJEL 1P1ZB 4G6AD 1I7ZB 1PKQE 2X1WL 4G42A 1HHGB 4J7RA 4LCWA 3O2WL 2FH8A 5IESL 5I1DB 1LO5B 5C3LD 1AO7A 1TIUA 1FH5L 4RAUA 1GGUA 4WFFD 4LPTA 3JWDL 1H5BA 3R8QA 1WICA 1AGDB 1ZANH 1YEKL 4U6HB 2A9MH 1LILA 4JFZL 5TDNA 3GBMH 1MQ8A 4X6CE 3NZ8A 1RIVH 4ODTL 3VXMB 2ED8A 4PRPA 3MRFA 2DD8H 2I60H 3D9AH 2ESVB 3WL9A 3BH8A 4DK6A 1RUKL 4OZIE 1IAKB 2GJ6B 2NQCA 3HE6B 3X3FH 3H3BC 2E27H 3MMEA 1DEEA 1NGZA 4PV8A 2R4SL 1CD1B 4WW2A 5GS3A 4XRCB 5K9QG 3ROLA 3WKMH 4JM4H 1A6TA 3BRGC 4HFUL 4MXVE 2AV1A 4WUUE 5A16A 2W9DH 2NYYD 4FQLH 2IWGA 5HGAA 2ARJA 4PJXE 4N8VA 1N0LA 4LLAA 4JFPB 1EJ6A 1ZHBB 5IMMA 2RJMA 3LEYL 3LMJH 2NPLX 5HVHB 5FECB 2RCSH 2V2TA 1YPZA 5F1SA 4YDVA 4MA3A 4ZS7H 1ZA3A 1DBAH 1GVIA 5HTSA 2FLRT 3LKPA 5DRWB 3B9KC 1YEHH 3BQUC 3NA4A 2C4FU 4AEHL 2J8UA 4ZUVA 2ESVD 2EKSB 3V6ZB 2CH8A 1MRDL 4OGAC 4LPCA 2DIBA 2GJ6D 3HE6D 4JR9L 1I8KB 2YD7A 4X98B 2W92A 5LG1A 1NGXB 4K9EL 1UXSA 3X14B 4KTEL 5I1EH 4LIQE 2GJJA 4KGLA 3T8XA 1OGTA 3U4BL 1E4KC 5GSVB 3WO4B 1LO3H 3V5DB 5D70L 5KANG 1Y6KR 3FB7A 3U46B 4G3YL 5BVPL 3BYTA 5GSRA 5HPMB 3CNKA 4MZ2A 2FR4B 1VFBB 1NJ9A 5CCKH 4MDIB 2WBWB 4TTGA 1YN6B 5TPWH 1PZ5A 1XR9B 1K3ZA 4OV5A 4YBQC 1YDPA 2O5ZL 9CGTA 2JIXA 3HI1A 1A7NH 1S9WB 1U92B 3I02B 4XP4L 3B2UC 4RGNB 4Y16C 3INUH 5EU6D 1KF9B 3O4OB 1FORL 4AENA 1HSAB 2NY3C 5HPOA 1HQRA 4PB9H 3TJHC 3RNKB 5C0EA 5TQ2L 3RU8H 1U8MA 1GOHA 3L7EA 3T0EB 2IQ9L 4KJYB 3OKMB 4LARH 5HI4C 5MENA 4LHUG 1EGJL 3BWUC 3PDOA 1DFBH 1JHTB 1HOCA 3HNTH 4M7ZB 2AEQH 3IDMB 4KUCF 1JZ4A 3RL1B 1YJDL 3ILPA 1ZVYA 2XFXA 1LNUA 3HR5B 3KPRB 4WWKA 5DMKA 4MA7L 2A73B 4N9GA 3WNPA 2NNAB 4G9DA 5A43C 4PGEB 1A64A 1OWRM 2K1MA 3CH8A 3BWAB 2KQNA 1FIGL 1GAFL 5DD1H 1NLBL 5F9WC 4U1KA 1BQLH 4NPYB 4LLDB 3T65B 1JNLL 1T1YA 2EE6A 3B9AA 3KYNA 4PS4L 4PJ8A 3TIDA 2I24N 4X6CB 3IDJB 4KRLB 4J8RA 1U8LB 1RIHL 3OX8A 5FHBH 3ZTNH 2X4OB 1MHHB 4OZHE 4UMGA 4I18B 3SDXE 4LCCC 1YQ2A 3ZDYF 3QHFH 5MHSD 3QQ3B 5FYLE 5MERB 3DV6B 4G9FB 3TBVA 2ADGB 3T0ED 3MRCB 3O3UN 4MHHI 2CGRH 1U8NA 3TFKD 4LPWA 5DFVD 1QLEH 4KROD 4R4FH 4KK8C 3F8UB 2GKIA 3SJVE 4HC1L 3WDJA 3L5WA 5HHPA 1NC4B 2R2BB 1M6OA 4NO3B 4LVNC 2BOCA 4Z7UE 3NVQA 3TZVA 4PJ5E 4Z7VA 1F3JA 3KPRD 3QIBC 5IP4A 3M07A 2E7LC 2PXYA 4XP9L 5L2KB 4KI5F 1L9NA 3LQAL 4XVUC 1BZ9B 2GSIA 3B6SA 4HMEA 3MJ9A 4JY6B 3U30C 5ID0A 2OXHA 4NHCH 3PDDA 3QJFB 4D8PB 4PJIB 3DRQB 3BIBX 3DPBA 5CZVH 3MZTA 5FF6A 5HYSB 1AY1H 2VDKL 5F6IC 2PTUA 3SKMA 3VWJB 1CBVH 1DTUA 4NQCA 4JFHE 3W9DA 1NAKL 5DD6A 3OJMB 4NO2A 5ENWB 4D9QE 1AJ7L 2VDQL 4GBXA 4XH2A 3U1SH 3REVB 5ICYA 5E5RB 4OD3H 3BRDA 4OKVA 2Q8AL 1RI8A 1NC4D 3MRDA 3DGGB 4RAVB 1IL1A 2GITB 2P7TB 2VSDA 3PWUA 4GKOA 4N0CC 4NQVB 2CUIA 1I3UA 3L3JA 1UJ3B 1P2CB 4R26L 2VABA 5L2KD 3N1PC 1H5BC 3VXRB 3FT3A 4JG0L 4XCEB 2IANE 2J6EA 5INCA 1MPAH 3WIHA 3EUUA 3VI4E 5D6CA 4LPYA 4PYHA 1BFSA 3PNWB 4WGWB 5EN2A 4YAQA 3RGVC 2IEPA 5I15L 5J12B 1W72H 3IAPA 4HBCH 5I1KL 4HUWA 2WANA 3V5HB 3ULVH 5ITBL 5DS8B 2EDRA 5CJQL 2AK1H 2IBGA 1TTFA 3IVKB 4R7NA 2CDGB 3VWJD 4YQXH 2DTML 2IBZX 3LIZL 5E8EA 5C1MB 3VFWA 2NTSP 3PIQA 3B4NA 4JQIH 5JDJA 2PYEA 2P45B 3ZYOA 5JORB 4Z7WB 1CTOA 1BM3L 3C8HA 3D3VB 4NO0B 1NDGB 2OSLA 4TSBH 5L6YH 1MJ8L 2E7BA 2ZUYA 4C83B 4DN3L 4OF6A 3ZKXC 5HY9B 4HHAA 1QPPA 4OZ4A 3F58H 2X2YA 1JPSH 3S37H 4G6FB 3DVIA 4PY7A 3GKWH 2XKSA 4RMRA 1U8OB 3GIVA 1ZT1A 4QKXB 1BF8A 2R23A 4ZOBA 4KI1A 5IF0A 4UV7L 1AHWC 1E4XL 1SY6H 3ARQA 3DX7A 2DI7A 2VKXA 3MLZH 5F96L 4R3SB 3P4MA 5DRNA 3D69A 3OV6A 2K3TA 3LY6A 4AT6B 1R5IA 1K2DA 1WGOA 3FQWA 4M7LL 4WDIA 3GDBA 1WC7B 4FTVA 4MJ6A 5JIHA 1A1OA 5C0AB 1FZKA 1WAAE 4R90L 1IEBA 1INDL 3ARDB 5H2BA 3ZTJG 1F4HA 5C71A 2VLKE 4JB9L 4Z7UB 1MCPL 4YHKH 2EEDA 5EU5A 4XBGB 1ADQL 2RQ8A 5T1KA 4IM8A 1KN4H 4ONFH 5FCSH 4Z76B 1JYNA 4KKLD 4IRJC 2XI9A 1KG0A 4U1MB 4K3DH 1G6RB 4D9RE 1IM9B 5D2LF 2EYRA 5K33A 2HRLA 5TFSL 1REIA 2FZ3B 3O3AB 3TBSB 2VZ1A 4RMQA 3TC9A 5J9PA 2HKHH 4IRZH 3SOBH 3SE3A 5HD8C 4LLMB 5IQ7L 1TJGL 4P5TB 5B38B 3M45A 5DYOB 3KPTA 5E95B 3GSWA 1UM4H 3ECBB 2EDHA 4PRIE 5GRXG 4ODWB 2IFFH 4TULL 1BLNB 4IJ3B 4Z77A 5D7JB 3IF1A 3H9HB 1Q0XL 4L5FL 5IB5A 1KB9K 4KJPC 1E4XI 2H26A 1ND0B 2EDYA 5C0AD 1GZQA 1T21B 2AJSL 3ARDD 4PJAE 2BVQB 1EO8L 3ZT7A 1JPGB 2VXTL 2J8OA 5DEGA 3FHAA 4XX1E 4QWWD 3QUMB 1P7QD 1T7WA 4MHHG 3B2VH 4P46B 1I9RH 3JV6A 4PJ8C 1J8HA 4G8IA 1NSNH 2AQ2A 1U91A 5FCUL 1IM9D 5BVJB 1JMZA 1XF3A 5LCVH 4NJ9L 4JGMA 3WXVH 1PFCA 4XPTL 5ESAA 3RP1A 1WEJH 1Z9LA 4GAGH 5KN5B 2X1OA 5KS9B 5J11B 1PKOA 1TJHH 3JV4B 1IC4L 4Y2DB 1RZJH 2PTTA 4JFHD 1BPVA 1L7IH 4M5ZL 2YA2A 5EBMA 5BMFH 4LNVA 1G7PB 4D9QD 5D7JD 1R3HB 5F71A 3UBXA 1R0AL 1IGCH 4H0GA 2RR3A 3TZVC 1YY9D 1I7RA 3IFNH 5DTFA 1YC8A 3TH3T 5T1MA 1EERB 4PV9B 2DLEA 1INQA 2BNUA 25C8L 1GC1L 3L3KA 1UADC 3UC0H 4ETQA 4HWEH 1MUJB 1N26A 4HGWA 4NYLB 2F5BH 1LE5A 4G6ML 1MHEA 4HPYL 4Q9RL 1CLOL 3AM8A 3DTXB 4FABH 3T77A 4Z7NF 4P46D 5BV7H 4HIEA 2XRAH 1NCWH 2QSTA 4XP6H 3V6BR 4NDMB 1RSFA 5IFAL 4PGCB 3BZDA 4WCYL 5EU3A 2MSPA 2XZZA 4U3XA 1FPTL 5K9OB 4BQBA 2XTJC 4UQ2A 1AXSA 2HFFA 3SGDH 3CX5K 1J5OL 1S5IH 1OTUC 3B3IA 2IQAB 1QSEB 2HKFL 3EDDA 4OFYD 1J12A 4Y2DD 4XC3H 2R1WA 2HFEA 2OQJA 4JAMB 4YXLL 1F4WH 1ZHLB 2C3WA 3AMKA 4Q9QH 1OQXA 1A7PH 1T7VA 2FBJH 3FAWA 3HZYA 1HKLL 3IU3B 4OM0L 1P4BL 5GPRA 2F74A 2ADIB 2BHUA 3FN0H 1F3DH 1NFDA 4OF3A 1BOYA 4ORGA 2VQ1A 3MV8E 4YHIA 1A7BA 4X80L 5H35B 1I4FA 5F89B 2VDNL 2NY5L 3OXSA 4WI3A 3BDBA 1C1EL 4KV5F 1ZA6A 3MOAH 4YFEA 3VFNB 3BZ4A 2EXWC 3M1BB 4OZFA 1SJXA 4LNRA 1H3TA 1BF2A 1KFAH 1I1FA 4OF0A 1FVDA 1B0RA 1NMAH 5GISL 1MRFH 2P8PA 4WHYG 4Z0XA 5GGTL 5DMIH 1KACB 4WI5A 2P44B 1X5FA 1WSST 4NUJA 1P1ZA 1DUZA 1I7ZA 2XG5A 4Y8AA 1ACYL 4URTB 1L6ZA 1HHGA 3X3GL 4U1SB 3MJ9H 4OD1L 4XPFL 4GRMB 2V5SA 3HB3D 5BQ7B 5LVEA 5I1DA 1LO5A 3LPGA 3S3SA 2BY1A 4L4VB 4PJCE 3T0WA 1J1PL 3N1GC 3DI3B 5I1HL 3HLAB 1HXMB 4CGTA 4PJAB 5ACLA 2AP2A 4AL8L 4MJIE 2DIJA 3G6JF 43C9B 2DQHH 1AGDA 4Z7QE 4RISH 1A6ZA 2CR6A 1MH5B 2EDTA 2XWJB 4OLZL 2BVOA 1KCVH 3QDAA 4PJGB 4RFNC 5LWYH 3H0TB 3TV3L 1LHZA 4ZPTB 3O11B 3BKYL 2ESVA 3GMOB 1H3PH 1SEQL 3KPOB 4D9RD 1IAKA 2YD2A 4KRNA 2GJ6A 4XMKH 3MLTB 2WUBH 2LU7A 3MBXH 3RVXC 3NN8B 2WAHA 4XRCA 1F2QA 2XZQH 1RUPL 2M26A 3IJYA 3HG1E 4NM4L 2J6EH 3WIHH 4OKDA 4PRID 3TBWA 4NKIL 3EBAA 3K3QA 2EC8A 1JN6B 1IGFL 4OGXH 5JOFB 4ZS6D 3P11L 3K4DA 4JFPA 1ZHBA 3TYGL 1CLYL 4WV1B 4L4VD 3MRIB 4QHNB 3W5NA 3RWHA 1WBXB 2EH8H 5CEYA 3G5XA 3I6KB 4FA8A 3GM0A 1EV2E 3EOTH 5EU6A 2EIDA 1X5AA 4FNLL 3QEHB 5I1CL 1R24B 5DRWA 1KLGB 1F4XH 4J1UB 1ZEAH 4O9HL 4N0UA 3LHPH 1QBLL 2KDGA 4IS6A 5D5MA 4NP4H 4XWOD 1QSVA 4YNYA 1CS6A 3FB8B 2JB5H 1CDCA 3MLYH 2HN7B 1DBKH 3SE3C 3RY4A 4XVJH 5F7EH 1NGXA 4YDIL 2Q87A 3EYUH 1KCLA 1EA9C 4AIOA 1ITBB 3TBTA 1FNSL 4XCYB 3U46A 1T1XB 5T1LD 4QLRA 1KB5L 1MNUL 5CJOL 1U8PB 1RURH 1OAYH 3RIAK 2FR4A 2C4FT 3C9NA 5SWSE 3IT8D 3V6FA 1YN6A 1CGYA 4HIIB 1AH1A 3U7YL 3H9SA 2FWOB 1OAKL 5FK9A 1V8HA 5HVGB 1AR1C 1HSAA 5D1QC 3CGTA 3WJLA 3SE8L 3I50L 2EDEA 1FN4B 3RNKA 4KJYA 3DUUA 3MLWH 3OKMA 3VG9C 3MCLL 2IH3A 4Y8DC 3MOQA 3BMWA 4JO1L 1JHTA 3NABH 4JKKA 4G8FA 4LQFH 3GUTB 4GXVL 1L7TH 3IDMA 3EJYD 3RL1A 4DGVL 5AAWA 2FRGP 1UXWA 3WFZA 4HH9A 2C1PB 5IGXH 4F7EB 4JLRA 3V6OE 3BKML 4PJCB 5B3JF 1MAKA 3U0PB 2NY6C 4PGEA 1M05A 3BWAA 5I16B 3DRTB 4U1JA 4MJIB 1FGNH 4P57A 1HDMB 5GGVY 3OJVC 1C16B 1IQWL 1NL0L 4RGMB 3I3BA 4FXGA 1FNFA 2DQGL 1YNKH 4S1DD 3GMLA 4GRLB 4YXHL 4KY1H 4POYA 1TZIA 3MYJA 4X6CA 2KZ1B 3IDJA 4ISVA 3PHSA 1U8LA 3JSSA 4M1CD 2X4OA 1MHHA 1NUDA 2UZIH 1K6QH 4R4NC 5CJXA 4OZIA 4PGBB 1P7KA 1RVFL 2CRIA 4KDWA 4LAJH 2W9EH 3QQ3A 3O3EB 4H88H 4JPWH 3DV6A 1N2RB 2ADGA 3SQOL 3QUKB 3NACL 4G6AC 1HHIA 2FO4A 1T2QH 4HCRL 5BZDA 3BP7B 5KOVC 4NUGH 4WUUA 4XCFL 1QRNB 2NY0B 1RHFA 4NO3A 5J56B 3DHMA 2H1PL 5EU4B 1QUNA 4PJXA 1IT9H 5E1AB 5L2KA 3GM8A 3TBYB 5C0FB 4XPGL 1JFQL 4XT1C 3WXWH 1YPZF 4MJID 4LF3B 4XAKE 3KG5A 3RL2B 1VFMA 4JQVC 1SEBB 1GOGA 3F5WA 4GRLD 3QJFA 2EE2A 4D8PA 1EHNA 3EDJA 4P59L 3VRLF 4MLIA 1JF5A 5DJZB 1PSKH 3NIGE 3RWIB 5KSBE 5GGRB 4JFDE 1YZZA 2J8UF 2LU3A 5L88H 3P3YA 5SWQB 4E41E 1PYWB 1LO2H 4NN5C 2H3NB 3PF2A 3S36X 3ULSB 4HS3A 1U8JB 5ENWA 5JA9A 4TVPH 3DVNA 5MEPA 1MSPA 2GSGB 3H7BB 5KSAD 2E8ZA 1EAPB 3WEXB 2NYYC 1ZANL 2UZYB 3PGDA 3G6AB 5T33H 3HG1D 2A9ML 1QRND 2NY0D 3GBML 2F15A 3RBSA 1RIVL 5KTEH 4RAVA 4Y1AB 4KQ4H 5FKPA 1OSPH 2P7TA 2DD8L 2I60L 1XCQB 3D9AL 2BSTB 5C6WH 1UJ3A 1P2CA 2BDNH 5DQ9B 4M93B 1NH6A 3X3FL 2E27L 1U95A 1EXUB 3CD4A 4LQ1A 5FAAA 3C5ZA 4WTZG 2X4UA 1OOAA 4ZNCD 4GG8A 4OLUH 5LBSH 1G0XA 1S7WB 5FOBA 3VJ6B 1BJMA 1H15B 4X6DE 3WKML 4JM4L 4W70A 1R3LB 2EYSA 3HE6C 4DKEH 3V5HA 2XN9E 2W9DL 1MQKH 4GRWB 3S3PA 4FQLL 5DS8A 5FGCE 2HFGH 3EYQD 3LMJL 5IK3B 4X9BA 3HPJB 2RCSL 3BE1H 5C0JB 2XA8L 4ZS7L 4OZFH 2PCPA 1DBAL 1JMXA 3U4AA 5HXMA 3QG7H 1OB1B 4PR5B 5T5FH 1YEHL 2I07B 1LP9E 4HWNA 4C83A 4Y1AD 2VLRB 1MCDA 1MIMH 5HVHC 3EOAB 1G9EA 4QGTA 1RJZA 3GRWH 5H8DA 2IFGA 1U8OA 3K7UA 1Q9OA 5IKCA 3N50A 4OZHA 2BNRE 3D0VB 3P4NB 3MJGX 4MNQE 1FVCB 3SDXA 1EFXA 2B5IB 1NMCB 3EKCA 2D7NA 2OTWB 1CF8H 5FYJH 4NNPH 5I1EL 1L0YA 5JUEH 1LO3L 2P47B 1DANT 4OCLC 1T0MA 1P84J 4S1RH 4R3SA 2IJ0C 2MCPH 3J8F7 3OJDA 4AT6A 1UWEH 2VISB 3F6LA 5DEZA 2X1XR 1WC7A 5CCKL 4C4KT 5C0AA 1KIPA 3ARDA 5TPWL 4LLUA 3WO4C 1ZV5A 3MLXH 1XEDA 1A7NL 4Z7UA 3W82A 4PJ5A 3INUL 4KVNH 1DQQA 1YMHB 3MREB 2HWZH 5E5MB 4Z76A 1P7QA 5GJTH 4G8EA 4PB9L 3FHQA 43CAA 1DBJH 2E6PA 3RU8L 2VLRD 5F3BB 3EYOA 1G6RA 5JPMA 1AQKH 4LARL 1IM9A 5INDB 4RGNC 3THMH 1DFBL 2VLME 3BW9B 1WTLA 4WGVB 1JZ2A 4E9LA 2FZ3A 2X10A 3O3AA 3TBSA 3O4OC 4FQHB 3ROOB 1JHLH 3HNTL 4XNQA 5TF1H 2AEQL 5E8OA 4JEGB 1S7TB 3WJLC 4JFEE 4RDQF 4LEOB 4LLMA 4QHLA 5B38A 3CJJA 5JOEA 3GK8H 3T0EC 2VXQH 4WJ5B 4HWZA 3TF7C 2H32B 3ECBA 3TFKC 5DFVC 4NQTA 1UKQA 2GK0B 1C5DB 5T3ZH 2ZSVB 5I1LB 4ZFFB 4UDUB 4WTXA 4MCYA 1BLNA 1ZT4A 2X4PA 4M7ZC 2M2DA 5DD1L 4XPHH 4WY7H 1BQLL 2FJHB 4B50A 2NCMA 2NZ9D 3EAKA 5D2NB 1ND0A 3DIFB 2BVQA 4GKSA 5J4MA 3CFEB 5FHBL 4X6BA 2V7HA 3ZTNL 2VOTA 3WNMA 4P4KD 1IGTA 1U0QA 4UQ3B 3QUMA 3QHFL 3E2HB 3OSKA 3FCTA 2XT1B 2IAMB 3VI3F 3HUJF 1MJ7H 2OM5A 4P46A 2HAZA 1KJ2A 3QXWA 4TUKH 3VFMA 4PTUB 2CGRL 4J3WA 1A4JB 1WISA 4I18C 3JWOC 3S36H 1QLEL 4R4FL 3GJEB 1YEIH 5CJXC 3REWB 4PYGA 5DGRA 2ZCKH 2X4TA 5I76A 2Z8SA 2CDEB 3A67H 4OFYA 3W5MA 1DQTA 2Q3ZA 3JV4A 4Y2DA 2BJMH 3SHSA 5KG9A 5L8KB 2AJ3A 3FT4B 1G7PA 5SWZE 2DLGA 1X4ZA 4CU8A 2PN5A 4YHNA 4FXKA 4PJ7E 4NHCL 1ZMYA 1FJ1B 1J9CT 3D5OF 4PV9A 3QQNA 4HGMA 2GTZB 5IHBA 2DAVA 4OF7A 4OIBA 5CZVL 5DHYB 3P9LB 4PG2C 4MS8D 1AY1L 4NYLA 1J18A 2R1XB 3HAEB 1QLFA 3AMLA 4OI9A 5EUOE 1U3HB 2IAMD 4HULB 3DTXA 4D2NA 3FQRB 3O3DB 1CBVL 4MNQB 2XPGB 1QSFB 4KMQA 3NOIA 3RWEA 3QUZA 3QEQE 1A6UH 5T5NF 2FHCA 4PGCA 3UDWA 4RX4D 4HK0B 2JB6A 3U1SL 3PV6B 2UYLA 4OD3L 1K85A 3VWJC 5B3NA 2YRZA 2QHRH 4KUZH 3O3BB 4P2QB 4UUJB 4TQEH 4PLKD 3U36B 1XGTB 1F8TH 1LE9B 4MB3A 3JWOH 4JAMA 3UZVB 2BY3A 1MPAL 1ZHLA 5EO0A 4MSWB 3IU3A 1NC2B 3VGDA 2B8OT 5C09B 1R5VB 3WV0A 3RWFB 4Y19E 2JK5B 1BIIA 1UJ3C 1W72L 1RK0B 3QFDA 4HBCL 1FC1A 4M1GH 5H35A 3T0AA 5CZXD 5JOPE 3ULVL 4H0IA 2AK1L 3VFNA 1VEOA 1U3HD 4YQXL 1WIUA 1JYVA 1SMAA 4MNQD 3LSOB 1QSFD 4FZ8H 5J12C 5HHVH 4JQIL 4LLVB 1EEZA 1T5WA 3TCLA 5ITFB 3O6LH 2AEPH 4PRIA 5FKAB 3X11B 4TSBL 4U1SA 1FAIH 3EDFA 5L6YL 4M6OH 4NFCA 1X5JA 1I8MB 3D2UB 4K07A 4GRMA 5BQ7A 5HDBE 3C5SA 2GY5A 3F58L 2JJTA 3AU1B 5M94B 3S37L 1JPSL 4Z0BH 1JWMB 2AS5M 3HLAA 1HXMA 3GKWL 4PJAA 4OCRH 1UENA 4HUMB 2VR9A 5J3HD 5E7FA 2GTWB 43C9A 1JZ6A 2V5TA 4EBQH 3RTQD 5CHNB 4KKLC 2XWJA 4ODSH 1MI5E 4YC2B 1JGUH 1SY6L 4PJGA 2DWDB 2YA1A 3QCVH 4GUPB 3MLZL 4ZPTA 4LIQH 3GMOA 1Z9OA 4V2BA 4KKNA 3VDAA 1A5FH 4HX1B 2VLMD 3DXAB 3MLTA 5D9SB 3JVGA 4OCXH 5DJDA 5ESVB 5AG8A 3NN8A 5DRXA 4ONHA 4YHKL 1KN4L 3TVMB 3WS6A 3FO1A 4JVWA 4ONFL 5T1LA 1GGCH 3FO9B 1QNZH 3VMOA 2B39A 1JN6A 5JOFA 2IALB 3ARDC 3MC0A 2Q8BH 4FQQB 4K3DL 4I9WE 3UTSB 3MRIA 4QHNA 4PJ7B 1I9EA 1T1ZB 1WBXA 4Y4HD 1Q9WA 1VACB 4QWWC 3B9EA 1CI5A 3ARBB 5FM5O 1BVKB 3F7PC 4TOYH 2HKHL 4ODHH 4IRZL 3SOBL 4GMSH 4AZ8A 5EZOH 4X4ME 4KC3B 1IGJA 1UM4L 2HA1A 5CMAB 1HH6B 4QRUB 5C0BB 2Q6WA 2IFFL 4JO4H 5FOJA 2DMCA 1FGVH 4X7CC 2NW2B 3SBWA 4AYFA 3WDIA 5KOMC 5GGSB 3NFSH 2BVPB 4JFOA 4P5TC 4BQ6A 4UT6H 4B5EA 1AD0B 3CDYA 2FO1A 1W2KT 4LCIH 5IW1B 1AFVH 1GOFA 5EFIB 4XCYA 4IJ3C 1K4CB 5HHOE 5D7JC 3TVMD 2X9WA 3LN9A 4YEFA 2PUQT 1BWWA 2MCG1 2W9LA 2OL3H 1H3XA 3W9EB 1A7OH 1U8PA 3B2VL 3H6JA 1I9RL 4LLWB 1NSNL 1NFDF 3RX7A 4Y19B 5IM7B 5LCVL 5IJVA 4YHYB 3WXVL 3KNBB 4UOJA 5I30H 2ICES 1FFOB 1LVEA 1J86A 3RRQA 1UYWH 5MEQB 2YPLB 1WEJL 4LLQB 3FT2A 4P46C 4UNTA 2ZWLT 3QXTA 4GAGL 2WSKA 3BN3B 3MNWB 4LVHB 1FN4A 1TJHL 3OQ3B 4Y5YA 8CGTA 1RZJL 1JNHA 3I75A 1KN2H 2RIKA 3LN5B 4DUXA 5BMFL 4PJEB 3DBXB 1IGCL 4LBEB 3HN3A 3GUTA 2QV2A 4NC1C 1R5WB 2R2EB 2W1NA 3IFNL 5J11C 1EVTC 1G6RH 3ALXA 4Y2DC 2F58H 5KW9H 1PGRB 2YRPA 4PJCA 3UC0L 4QHMB 4HWEL 3U0PA 2MPAH 2YRLA 2F5BL 3RIAF 3C6LB 3DRTA 4FRWA 4MJIA 1HDMA 4FABL 2N4IA 5BV7L 2XRAL 1NCWL 4XP6L 4GRLA 2AERT 4QYOB 1C5BH 2O61A 5D7SH 4CNIB 4PRNB 3VRIB 2FHBA 4Y19D 2OXGA 1DBBH 4PRHE 3BJLA 3P4OA 5BOPA 3MV7B 1GJIA 5DF0A 1FLRH 5HYFA 1Q9LA 3GMRB 1L0QA 3PGCA 4L9LA 2CD0A 4LPXA 3U4EA 4PGBA 3A0OA 1OGAE 2YR3A 3NFPA 3O3EA 4F9PA 5GS1B 2X70B 4JM2B 4K94H 3UDWC 3QUKA 4XC3L 3IGAA 5EO9B 3ARPA 1F4WL 3VCLB 5KSAA 5K93A 2AXGA 2ZUQB 1A7PL 2FBJL 1DBMH 2X6MA 4JCMA 1QQDA 5AD0B 5LQBH 5BS0E 3HG1A 3TM6A 1JGDB 3FN0L 3BEWB 1QRNA 3HB3C 4EIZC 1KJ2H 3SY0B 4L8SB 3V2AR 2E7CA 4PRBA 1WCBB 4PJBB 4DKAA 3P9WB 1ODAA 3DX8B 3MOAL 1KXVC 2Y1VA 2XWBB 4LF3A 1KFAL 2YS4A 5FA3A 3MJ8B 1NMAL 3ZHLA 1IAIH 1MRFL 1MI5D 5DMIL 4CRPA 2R56H 4JKLA 3QRGH 3I85A 3RWIA 1IM3A 5SWQA 3MJ9L 1PYWA 3HZVA 3PWPB 3UYOD 1QSZA 1BECA 3PHOA 3GZKA 3ZYIA 4P49A 4JM2D 3QI9B 3ULSA 5JW4M 3ZE0F 2GSGA 4RWYH 4NOFA 1EAPA 3WEXA 4L3EB 3SGDI 5M95B 4RISL 1ONQA 4E5XB 4ZS6C 2OTUB 4LDOB 2OMBA 1KCVL 2LAGB 3OF6D 4Y1AA 2JJTC 5LWYL 2VB5A 5DJ8A 4GH7B 5IR1B 4MB4A 1FNLA 1H3PL 4Z8FH 1LD9A 5E8PB 1BD2B 1GRWA 4XMKL 1AGBA 2WUBL 1DR9A 3MBXL 2XXCB 2XWTB 1ZLUK 3BO8A 2A9NH 2XZQL 3RWDB 3MQIA 4XWOC 1V3LA 5BZWA 1R3LA 2J6EL 5EOTA 3WIHL 4NCDA 2VXUH 3IS0X 5IMKB 1QFHA 4S2SB 4P4RA 4OGXL 4QTHB 3PWPD 3ZYZA 4Y5XB 3ARTA 4NN7B 3LZFH 5AZEH 1CGXA 3O6FA 2R4RH 4P2CG 2EH8L 4NRXA 5CLTA 1T0PB 4IIQA 3WS6C 3V6OA 1SJVA 3EOTL 1DQMH 1P84K 5HHOD 2LVEA 4F7TA 1OB1A 2I07A 4WV1C 1F4XL 2VLRA 1ZEAL 4PGDA 4PIRF 3LHPL 3TIEB 3L3GB 2X89D 2YOCA 5D6DA 1MFBH 1GZPB 4NP4L 4X6CF 2JB5L 4PRHB 2CR3A 3RDTB 1DBKL 3KLAB 3BPOB 5DDHA 4KH2A 4XVJL 3LQZA 5F7EL 4OLEA 1ZGLM 4NQSB 3EYUL 4JKWA 5F70A 2ICCA 1IC7H 3D1MC 2W0LA 4MMXC 5B4MD 2I9TA 1A8JH 4JANB 3SBWC 4X6FB 5ILTH 2Z0BA 5D96B 2VISA 3EJYC 3UTZA 1RURL 1OAYL 1I3RA 3QNYB 4TTDC 1MAMH 4MXVF 4H5SB 1RZIA 4P4KA 3PDGA 4U31A 4ESKA 1KPUB 1YMHA 3MREA 5HBBA 3GSUA 2P24B 2BHYA 1DVFD 3IB4A 2QBWA 1AGCA 2FIRT 5F3BA 4UV4H 3QEGH 4M1CC 4N8VG 4UIKH 3MLWL 1KJVA 1SYSB 3CLFH 5DLMH 4Y4FB 1OQOA 1W0WA 2MKWA 4ZFOA 1TITA 5HVFB 5D1XD 1YN7B 3NABL 1CGTA 4LQFL 3C87A 4PRHD 4JRXE 4PJIF 1L7TL 5KSBA 3P77B 1J11A 4U6XA 1R6VA 1S7TA 5CFHA 3ZKQD 3HMXA 5ANME 4I0PB 4KK5D 3IAGC 5IGXL 4JFFE 4XPBH 1KXQE 4EVNA 3ES6B 4WJ5A 2H32A 4AIZB 2PW2B 2YPVH 4ZFFA 1AGEB 1AI1H 4UDUA 1FGNL 3X12B 1JWUA 3WFCH 5J6HB 1FL6B 1YNKL 2FJHA 2OJEA 4CVXB 5IQ9A 4KY1L 2NW3B 3OB0K 3VWKB 1LK3H 1KCRH 4LCYA 2E7MA 3OAYK 3CFEA 1ZAGA 4IHOB 3T4AB 5HGBB 1NCDH 4XGZB 2UZIL 3WUZA 1K6QL 4J3VA 4FMFA 5DT1L 5EH1A 4D3CH 4FHBD 4RGMC 1HN1A 1NGYB 1F90H 3HZKA 3LH2H 5B21A 3X13A 2W9EL 2DIAA 4GRLC 3FOLB 3LS4H 4H88L 4JPWL 3GMMA 3GO1H 2X44D 2D03H 3EOBB 4MQSB 4RX4A 5I74B 1T2QL 4KPHH 4X6DA 4X99B 1NKRA 3GJEA 1WTGT 4NUGL 3REWA 2H2PD 3WO3B 4WO4B 2D9CA 2XN9A 2FLBT 1L9MA 4AMKH 3C09B 4I0PD 5IUSA 3B5GA 3KXFB 5GS0H 2LTQB 1IT9L 2YZ8A 3PHQB 4ZUUB 3VRJB 3WNNA 1FQ9C 2DJ4A 3MNZB 1N8ZB 4CJ0A 3WXWL 2NY0C 5ALBH 4Z7WF 1CDIA 4DZBA 1WFTA 3L3HB 1CXHA 3BXNB 3EDEA 3VWKD 1FJ1A 1LP9A 1E27B 3ZKND 4JPVH 2GTZA 1PSKL 4X0KB 4D0BA 3P9LA 1GGBH 2M1KA 1F45A 5L88L 4QHUB 1MCNA 2AQ1A 1ACZA 4M6NH 2DL2A 1LO2L 2DQUH 2R1XA 2A6DB 3HAEA 4YPJA 2DQDH 1U3HA 3QDJE 4NJAH 4MNQA 2XPGA 1TVHB 1DN0A 2B1HH 2VJXA 4TVPL 2BMKB 4XC1H 4Y0GA 3BIKB 4U3HA 3GSNA 2IH1B 5T33L 2NLJB 2Y06H 5E6YA 1OTSD 2CDFB 3V52H 1ZXQA 2A77H 4WO4D 2D0HA 5HHME 1KELH 5KTEL 4KQ4L 1YEFH 1D5IH 1OSPL 5DA0B 4UUJA 3KXFD 1CR9H 4O2EB 1XGTA 1LE9A 3LRSB 2BDNL 4G7VH 3EO0B 1G7MB 2NY1B 4HIJA 4Z7UF 4MSWA 1G6VK 5IVXE 3RTQA 4IOFD 2BC4B 1R5VA 4OLUL 3RWFA 2AQ3A 4ZAKB 5LBSL 3VDCA 2JK5A 4EN3B 4HWUA 4DCQA 1VGKB 5DVOA 1RK0A 3GHEH 4NKOB 2JF1A 1D6EA 4M93C 1QA9B 3VXNA 5JPNB 5IVZB 4DKEL 1Y0LA 2ZOLA 1MQKL 2HFGL 2VN7A 2GFBB 2Q7NA 1OLLA 3TP4A 2VSCA 3P0VH 4OGYH 1OLZA 3AB0B 5TE6H 3MACH 4NRZA 4GW5B 1KT2B 2PF6A 3BSZH 4O2CB 1T5XB 3BE1L 2VR5A 1YMME 4DAGH 4K8RD 1EHAA 3UBXI 5ITFA 4KHTH 3D39B 1F2XK 3CFKB 3X11A 1CFBA 3A6CH 4TN9A 3QG7L 5T5FL 1IZJA 1X5IA 5ICXB 5L2JB 1MIML 3T1WA 2LABA 4Y4HA 2R0WH 3GRWL 3MFFB 3KS0H 1CXKA 5I8OH 1B0GB 2XNAB 1PAMA 2NY1D 4IMKA 2GTWA 4MNHB 5J0BA 4WRLA 5FYJL 4NNPL 2C5DC 4ZAKD 5JUEL 2DWDA 2GI7A 5D6DC 1UVQB 4GUPA 2ENYA 3KWWB 5T3XE 1J1XH 4JJ5B 2VL5A 4PG9B 4S1RL 3RUGE 5ICZB 3WHXB 5F7NC 5E6ZA 2MCPL 2G75B 4BQ9A 1L4IA 1UWEL 1VENA 4HX1A 4H20H 2B5IC 1NMCC 5D9SA 2JKXA 5K9JH 5JO5A 5ESVA 3AXLA 1YYMH 4PREA 3MLXL 1JWSB 3FRUA 5EOCH 1N3NA 3LEXA 3WYRA 4JFFD 4UIMB 3R0MA 4Z78B 4LLYA 3QDME 1ZOXA 2HWZL 3D39D 1I9JH 3T3PF 1J0HA 5GJTL 2VH5H 2HLAA 3TT3H 2A6KB 1DBJL 2ITDB 2IALA 4L4TE 5ESQA 1BFTA 4FQQA 3K81A 1AQKL 4LP5A 1KEGH 4PJ7A 4PJHB 1T1ZA 3THML 4POUB 3RGHA 4P9HC 5C0DB 1IZKA 1RU9H 3BUYB 2P46B 1JHLL 5TF1L 4OIIH 3E1F1 4L8CB 1HH9A 4UI2A 1FIEA 1UCBH 1T2JA 1I1AB 4UTBH 4HUKB 2VXQL 1HE7A 3ZO0A 2P4AB 3QFJE 4UBDC 4XXCC 5CMAA 3VFTA 1HH6A 4DVRL 3FO2B 4PP2B 5I6XB 5CWSB 1S7XA 1IC5H 4HH8A 4X6EA 2X4QA 5T3ZL 2H6PB 3QEQA 1E6JH 4LKXB 3OAYH 3JWDC 2NW2A 1IKNA 4ZTOH 5GGSA 5GGQH 1D5BB 4NQEE 4XPHL 4WY7L 2BVPA 4PLJD 4JRYB 1HI6A 1D9KB 7CGTA 3O41B 4JHWH 3MLPA 4EI6A 5IW1A 3BZEB 3ZDZE 1T2XA 4U49A 1CIUA 2DBJA 1K4CA 3FQUB 3ZKSD 3IETA 2WP3T 1A22B 5E8NA 4FOMA 1LEIB 4ZXBB 5TH2A 1MJ7L 3OKDA 5D2NC 2PYFB 5CS7A 4J4PD 4LLWA 4TUKL 4Y19A 5IM7A 5JR1H 3S36L 4XI5D 3GNMH 1YEIL 3E2HC 4KQ3H 2ZCKL 5D71H 1LEKB 2IAMC 3VXSB 1FFOA 5MEQA 4LLQA 4WEMB 1LK2A 1G9MH 1J05B 4OBRA 1I1AD 2X7LB 3A67L 3MNWA 3QNZB 5IW6B 3FJTA 2D7QA 3PP3K 2BJML 3ARUA 2IGFL 4WFED 4F2MB 5F3HB 4G8GB 4QT5B 3WHE0 3BHBB 4PJEA 3DBXA 3STZB 4X4XA 3PQYB 1SBSH 4TNWK 1JK8A 1D9KD 4J3UA 1M7XA 2Y23A 4ZO9A 5J13B 1EBAA 4QHMA 4PJAF 5DI8B 3IDGB 5ID1B 4N68A 1T20B 3HMXH 4KJWD 4K9EC 4ZQKB 4QYOA 5DJYB 2H32H 1A6UL 1MI5A 4CNIA 4I5BA 2CRYA 1UZ6F 4PRNA 4WWID 3VRIA 4FQPA 4PJGF 5CZXC 3SO5A 4Y5VB 3VXPB 2F54E 3DX6B 1DE4B 3BD4A 3FN9A 1U3HC 3GMRA 3RWCB 1LO0H 4KUZL 5I1JH 2EIZA 3GMQB 4CN1A 1SHMA 1T4KB 4LEXL 4YGVA 1VADA 4TQEL 3KPSE 5HI5D 3G04B 3B43A 1F8TL 2X70A 4JM2A 5EO9A 3AAZB 3JWOL 3ULUE 4G8GD 1B90A 4NGHH 2E5EA 3VCLA 5KVGH 4RFOH 5AD0A 5HI3C 1KTDB 1X5XA 3PQYD 1JGDA 4NO5B 1SJHB 3AC0A 1KGCE 2ZSWB 1LDSA 3SY0A 1Y6MR 4XMLL 4L4TB 3E0GA 1WCBA 4M1GL 2Z91B 2XOTA 5J3HC 3U6RB 1A3QA 4HWBA 3DX8A 1CFNA 3VFUB 4W4OA 3RA7H 3R1GH 5D7IE 1P9MA 3OR6B 3UTTE 2XQYG 3UBXG 1TZHB 4RBPK 2UUDK 4FZ8L 4V2CB 5HHVL 2C7UB 2UY7A 1Z3GH 3FQTB 4X4MA 1ORQA 1MCLA 1XR8B 4PRAB 3O6LL 2AEPL 5T3XD 1R3JB 1FAIL 5EO1B 3LRHA 3WCYA 4M6OL 3PWPA 2VDMH 4BSWA 4Z0BL 4WIQA 3Q1SH 4Z7OE 3O4LB 4OCRL 1FCCA 4CW1B 4NSKB 3BAEH 4EBQL 1BQHB 3FMGH 5HHOA 4ODSL 4ODXB 1UB5B 2F9BT 2CLVB 5CAYB 1SJEA 4K23H 4RGOH 1JGUL 1XZ0B 4JKPH 1CFQA 4FFZH 3QCVL 4LIQL 4L4TD 4YO0B 3MXWH 3VGHA 1NUGA 4HJGB 3GSNH 5E8PA 4IMKC 1T66C 1EX0A 3QA3B 3WN5A 1A5FL 1FG9C 1AP2A 1FBIH 1DCLA 4DOHE 1NCAH 1Z5LB 4FFYH 4OCXL 2FSEA 2HH0H 5I0ZA 4YC2C 4NNYB 2BHZA 3RWJA 2VWEC 4FQIH 1WBZB 2ATKA 4OZGB 1QEWB 2EYTB 1QP1A 1JGVH 1AKJD 3RWDA 2J8HA 2X4SB 3QZWB 3QFJD 3L3OB 3NIFF 4NKMB 2GCYB 1GGCL 4S2SA 1QNZL 5DR5H 4QTHA 2Q8BL 4HFWA 1K5NA 4NQED 4OZFG 2VLLA 3RZCD 4ZUSB 2Q86A 4YDJB 3H9YA 3SKUD 4ZOCA 3O4LD 3TVMC 1S5HA 5IMLB 1FFQA 2AJYH 5CBEB 1S9VB 2VAJA 4PJCF 4TOYL 4ODHL 1DVFA 1CICA 4GMSL 1G7HB 5EZOL 3GB7B 4CVZB 4GOSA 3LAFA 2QR0A 2HMIC 1GYAA 4ELMB 4JO4L 4WU5B 1FGVL 3ARBC 4I0CC 5HDQH 5D1XA 5EC1A 5IIEB 4PRHA 4X5WB 5CGMA 1KNOB 4HKJA 3KLAA 2F54B 3NFSL 3CXDL 4UT6L 4ZDHB 4APQD 4CN4A 3ZHDA 5J6GB 4LCIL 1FZOB 1AFVL 1W72B 1U6AH 4JANA 1IKNC 4X6FA 4Z9KB 4V1DB 4Y89A 5A2JH 2OL3L 3O6MH 1ZS8A 4JZOA 3BVNB 1A7OL 3LPFA 3PL6D 1XF2A 3AROA 5BS0A 3GSOB 3HKFA 4H5SA 4LSPH 4S1QH 1IVLA 1MLBB 1IRAY 5GGTA 4I3GA 1JGLH 3SGKA 4L3AA 5DJXB 5JHDB 5I30L 3GIZH 3UPCA 2DM7A 2N56A 4HKBA