5GRVK

Crystal structure of homo-specific diabody
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
106
Chain Sequence
DIVLTQSPATLSLSPGERATLSCRASQSVSSNYLAWYQQKPGQAPRLLIYDSSSRATGVPARFSGSGSGTDFTLTISSLEPEDFAVYYCHQYSDISPTFGQGTKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords homo-specific diabody heavy chain
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 24
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2016-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5grvK00
2VLKB 2VQ1B 3GJEA 4LAJH 4F7EA 5IROC 1PD6A 2ATKB 1GVIA 3S37X 4X7SH 2CRIA 3SGKA 1YEIL 2AK4A 4X7DC 4L8SA 4B50A 3VXRE 1MFEH 1RJYB 4GAJH 4ERSH 4OFIA 4JDTH 3ZKNC 3QDHA 1YDPB 3PHSA 2HLAB 2WM0A 1FJ1A 1QLEL 1G7LB 1KCVL 4FTVD 1Z6JT 4W4NA 4MXWH 3MACL 4NFDA 4AENA 4PTUA 1U95B 3MLYL 1LE9A 2FNBA 1P53A 1CFSB 2CIIA 3HE7A 5D7IB 3FRPA 3TO4A 4DN3L 3QI9D 4ZXBD 4P2QB 4Z7UA 3IDJA 5GS3A 2XA8L 1ZHBA 3P0VH 2X4RB 2AK1H 4M1DH 4FXKB 2AABH 3NACL 1R5WA 3WMSA 1AD9B 3GSWB 3EFDL 1RZ7L 5D6CB 4PREB 2H32B 3U48A 1F3JB 4OM0H 1DVFD 5DHYB 2VYRE 3E6HB 1KCLA 4P46D 4HCRA 2NY5H 1QBAA 4UQ2B 3V4UH 5HHOE 4OQTH 1EV2E 5EUOF 1ETZB 4LP5A 4MHHG 5IJKA 4JPIB 3U1SL 1DCLA 3HR5A 3U4BH 4WFFE 5DJDA 4GFTB 1B3JA 5ESVB 1YEKL 1IL1A 1AGCA 4K23H 1U2HA 2H1PL 5E1HB 3BPLB 2V9TA 1CL7I 5IFHH 3MJ9H 1SEBA 2ADFH 5JQ6L 1T22B 4OF8A 1O7VA 2O5XL 1U58B 2BOCB 4GRWB 4KJYA 5FUOH 2QSCL 2Z31C 1DQLH 3ABZA 2EXYD 1EFXA 4BH7A 3TJEL 4QRRA 4ENEC 3VFPA 5FIEA 1CI5A 4PJDF 4XVUC 1VACA 2HVJA 1KXTB 4KMQA 3QUZD 3PWPB 3QDJA 4K3JL 2P46B 3T0EA 5D7JA 1OAXH 1GPOL 2VRAA 4Y19D 1XF2A 3VG0H 3DLQR 3OMZA 5HHPB 2F74A 2IALA 3GRWA 3HZKB 1K85A 5LAXA 5AYUL 1I9EA 1E27B 4JVUA 2WK2A 1EAPA 3EDDA 1CGXA 1ACZA 1DUYA 1IC5L 5FHBL 5D7KD 2ED7A 1XGYH 3E0GA 1UM6L 3H9HA 4JFYB 4WGWB 4ZQKB 1I3GL 4XWGH 2VZOA 4QHNA 1S7RB 4KK8C 4PJIB 4NO2B 4QOKA 3LPGA 5ID0A 1CDCA 3IS0X 4NUJB 5ILTL 1KG0A 4U05A 4NKOA 1A4KA 1HSAB 3UZEA 2HG5B 1AC0A 2HKFL 3WEXA 1FAKT 3AS3A 4HBCH 5I8OH 4IM8A 2ADIA 5K9QI 2NPLX 2P47B 1A6WL 4FFVC 5E8DH 3KPOA 4Y4FC 4GBXA 4MVBC 1TTFA 3WIHA 4OCXL 3EOTH 3IGAB 3NCCB 1J8HE 5CFHA 1RVFL 2FRGP 2C3HA 4L4JA 4YDIL 4LCIH 4WW2F 4M6ML 1JGLL 1ORQB 4FS0A 1YEJH 4L9LC 5ERWB 3MLSL 1KXVC 1S9VB 3WNMA 2P8MA 1MJ8H 3QIBC 3WIFA 4LSQH 1TENA 1UEMA 2WWKT 1IEAA 5KVEL 4TUJB 4AH2B 2BVOB 4K8RC 4G7YH 3X13B 4WFEE 2Q6WA 4R4FH 5KSVB 2DDQL 3KPLB 3PWJA 4PJCE 2X41A 5IBTH 4DZBA 1IKFH 2F53E 4PJGB 5CKAA 2FH8A 1DQQA 3F58L 4LSTH 1ZLSH 2A6DA 3RUGB 1NGYA 2WUCH 3HNSL 1XFPA 5KAQG 2WV3A 1W0VA 4NBZB 3FB6A 1WICA 5I1IH 3GBML 4JJ5A 1QHOA 1LK3L 5FHAL 5HYQB 3HNTH 2NY7H 4BZ2L 1PKQB 1WCQA 4IMKC 4NQDD 5TQ2L 1MI5E 4IJ3C 1ZKAA 4RDQF 5C0AE 3T1WA 3I85A 4NQED 5A2IH 4OI9A 3BN9D 3FL7A 5L9DH 4JZJB 4RISH 3FJTA 1YMMA 1DLHB 1QQDA 2A77L 4U7KA 1FAIL 3LHPL 4BYHA 1BWWA 1AR1D 1YNKH 3GIVB 4Y5VC 1MY5A 4F7MA 2IPKB 4LMQI 3L1OL 3E2HB 2FJFB 5DWUH 1TPXB 4DGVH 4PP2A 1E6JL 1G9NL 3STBA 3C2AH 1QFWH 5DHVH 4YBQD 5I1HH 4M93C 2DKMA 1U2CA 5H94B 5I71C 3GSNH 1ZLVH 3NFSH 2QL1A 3QNZA 1GJIA 3AMKA 3PDGA 3O3BA 1TITA 4LDOB 1A21A 3X14A 1AJ7H 3VH8A 1M7IB 1BD2D 1MAKA 2J6EL 4Y16A 4M5YL 1WZ1H 4YFLI 2I24N 3UCRA 4JFEE 3TVMD 1CD1A 2BVTA 1C5BH 5IFJB 3BGMB 4O2CA 5F71A 4JHAL 3H9YA 1WCBB 4RQQB 2CD0A 5DEGA 3VGFA 1JYXA 4TNVF 2R1WA 1LO4H 3GMQA 4PRIE 1Q94B 4NOFA 3IS1X 2DLFH 2GITB 4TSCL 1UC6A 4UTBH 2ZUQB 4PB0L 3HI1B 5T5FL 1ES0B 1IBGH 4Z7QF 5LGHL 1VFAA 5FYJD 3DGGA 5FYJH 2C3GA 2XKUA 3R8QA 1CF8L 2E7HA 4WUUE 1RUQL 2IANE 3BP4A 1A0QL 2EDRA 4RAUA 1VA9A 3WNLA 4Q97A 1A1OB 3AB0B 3LKSA 4PIRF 3V4VH 1IM9D 2DB8A 2R1YB 3O2VH 4JRWA 1QLFB 1A14L 4FG6C 3ZTJG 5E08L 2VITA 3KPMB 4LNVA 4X6EB 3GDBA 1LMKA 3MRNA 5FKAA 1MFDL 1AO7E 1G7IA 2XYCA 3ZL4H 4YK4B 4AYFA 4OUOA 3GMPA 3PGFH 1YEEL 5J12C 4K55A 2A1WL 5C09D 4LHQB 5MHSD 3RWCB 1KCRL 4QCIA 4NC1C 2AXHA 4N0YH 4PJXF 1IGML 3KAAA 4F2MA 3PG2A 4OZHA 8CGTA 2R1XA 5BS0A 3I02A 1L7TH 1RZIB 4KUZH 1CD8A 1FC2D 3NH7H 3MBXH 4U2YA 3P11L 3REWA 4LEXH 2X9YA 1H3WM 5C3LD 3R8BB 5DSCB 1F00I 4QRTA 1IE5A 1I1AD 5IMLA 2IQAB 3EDFA 4OV6F 1TLKA 1F42A 2AW2A 5JW4Q 3LIZL 1C7SA 3ARDC 3VGAB 3BRFA 4CMHC 3B9AA 2R69L 2EE3A 1JYVA 1ONQB 3BDBA 4G6KL 1QSFD 1FGVH 4GG6F 3LN4B 4FQ1H 3QQ4B 4NRZA 2X40A 1CQKA 2OMNA 5L88L 4NQEB 1HHHB 3DV4B 2B5IB 2EDHA 3MOQA 1VKXA 12E8L 1QD0A 1PDKA 2WIIA 4JPKH 4E5XB 4Q9QH 3TCLA 1J1PL 3HPLA 1FORL 1XT5A 2A74A 4X6DB 2FWOA 4LSUH 4KK5C 1I7RB 4YEFA 4EVNB 3GIZL 3Q5TA 5I74B 1WAAF 1OHQA 3O11B 3NA9L 5GRVK 1C1EH 2VZTA 3ISWA 4XHJC 5DHVB 3BP5B 3I50H 4ZUWA 3WUWA 4R0LA 3TFKD 1R6VA 1ZVHA 1JUFA 1JHLH 3RVUC 2DI8A 1ZHLA 3ULVF 5FO7B 1EEZB 3LH2H 1NMCB 5CMAB 5E00B 3S96B 1VFBB 1X7QB 4OCSL 1BFVL 5IVXA 1URLA 1WBYB 4CVWA 1ITBB 4PUBL 2QHRL 4DKFH 1YN6B 1OD9A 3KPSE 4EEEA 4KTEL 4CDHA 3GB7B 4Q2ZA 2AJ3B 1MHPL 3C5SA 1N3NA 4LCWD 2CDEB 1JMXA 2IQ9L 1NUGA 1DBAH 3BP6B 4QHUB 4C4KO 1J8KA 3MNZB 1KIRA 1ZANH 2HJKB 4YC2B 2CLZB 3LQAH 1TZIA 43CAB 2Y7QA 3FRUB 3QEQE 4JO3H 4PB9H 4ELME 3FB7A 4G8FA 4AJ0A 1JNLL 5FUCC 3GKWH 1U8PB 1UB6B 5FGBA 3BKCH 1RK1A 3ZLQC 1WBZA 1B2WL 4Y4KD 4X6FB 1T21A 2A9ML 4JEGB 3WFEL 3S36L 5I15L 4XNUH 3SDAA 5D2NB 3DMMC 2JB6B 1F4HA 3QSKB 2ZCHH 4OAWB 5FOBA 3ILQC 3RU8L 5I6XB 1U8MB 1G9EA 1N0LA 3Q48A 4EI5C 1HYRC 2BNUA 1BBDH 3PF2A 3U4EA 5CIPH 1CFNA 4UUJA 4CGTA 5GS0D 1GOHA 5DK2B 3MRCA 2VKWA 5GS0H 1NMAH 3EAKA 2BVUA 4H8WH 3EO0A 3S97C 3QIUD 5D7IF 3VXTB 1MJJA 4MNGA 1GGCH 3SKMB 4DVBB 5E9DB 5GGUA 1S5IH 3KYNA 4MQ7B 1YPZB 4GW4B 4EUPG 5D2LE 1GGIL 5SWSD 3QUYB 5EZJB 1OGAE 5D1ZD 1C16B 3HRPA 1NGPL 4Z7WE 3MRRB 3EHBD 4HG4K 2VISA 3V7AG 3NCYP 4QWWC 4UB0H 1NCNA 5CKGA 4NKQB 5KBNC 5DDHA 4NQCE 3P77B 2JCCB 3ILPB 3KLAA 1GAFL 3DX6A 3IRZA 4D0DB 1JGUL 2MCG1 3W39B 1TTGA 3O41B 4MAYC 4M6OL 4S1SL 1NCAH 4KRPB 3U0WL 4JY6B 3O8XC 2DWEA 2G5BB 5AD0B 1J1OL 1LO3L 3CFCL 1JZ2A 1JHTA 2J6EA 4K9EL 3QO0B 4MMXC 3OKKA 4HULB 1B0GB 4RGND 4JGUA 3BPOC 1MIEH 5IESL 1BVKB 2GTWA 1OPGL 3BOVA 3PQYB 1XIWB 3AAZB 1FV1B 1U8KA 3TYFA 1QSFB 3C9NB 1P4LB 3NAAL 4OGZA 4CVXA 4XNYH 4GAGL 4GRWF 2P5WA 1LO2L 4PY8I 4HWZB 4K7PY 3N0PB 4UV7H 3S34L 5F1NB 3NBNA 1BQHG 1X4XA 5BRZB 1JRHH 2WQ8A 2F8XC 5J13B 2W9LA 1PG7X 3Q6FA 2JIXA 4ODUB 5EZLB 1FP5A 5E2UH 2XWBB 3SDYH 3H3PL 5HYJA 3C5ZB 4E9LA 4Y4HC 4NKMB 3RVVC 4GXVH 5I9QC 3F12A 2HT4D 4P3DA 2DAVA 2J2ZA 2VC2H 4RGMB 4GRMB 4F57L 1CVSC 3QQ3A 1BAFL 4OFPA 3OPZH 1RU9L 2R2EA 5GGTH 2LTQC 5EUOE 2A83B 4UU9B 4Y2DA 4ZUVA 5D7SL 2MKWA 1A8JH 2BVQB 1OAZH 1MSPA 2F54A 2HT3D 3NFPA 4J3VA 4PJIF 5T33L 2PETA 5KG9A 2APTA 2GTZB 3BFOA 4HDIB 4OD2A 4HG4J 2X1WL 5HBBA 1S78D 3U6RA 1LVEA 3K3QA 3ESVF 4ZPVB 3KYKL 3BO8A 2IGFH 5DJ8B 5DRNA 2D0FA 3IDNB 3OAZK 1S7VB 2V2WA 1NMBH 3O4LD 1U3HC 2CJUH 3SJVA 1A2YB 3D69A 2H2PC 3C6LA 4KU1A 4Q6IB 2G2RA 4Z95L 3VXQA 1Y0LB 4DJMA 4NJ9L 2MHAB 2VLLB 5EOCL 3O45A 4PJDE 3ES6A 3ULUL 5JHDA 1BJ1J 1FZKB 4GMTL 5EC1B 5FM5M 4XWOC 35C8H 4LASH 5CP3H 4CDGC 1R3JA 1NCUA 4EDXB 3VWJA 3ZKXC 2Z31D 4RMWA 3OJMB 3STLB 1J0ZA 3SOBL 3GI8L 2WANA 5HY9A 2CMRL 2XA3A 1BQUA 1C5DB 1J1XL 1YEGL 2WLZA 1EEYA 2VQTA 3WFHA 4NKDB 4LGSB 1W72A 1FPTH 1WZKA 4PJGF 4XP6L 4LHUB 1HOCA 5BW7A 3WFBL 3C09B 3RUGF 1K2DB 3QWRA 5C8JB 2Y06L 4YQXL 4XCFH 5CJOL 3PE9A 3SGJC 4O02L 5BXFA 1P4IL 3VFMA 4JM2C 2ZKHH 1YMHA 2FD6H 3FO0L 2P45B 2W0KA 3QA3A 3MRHB 4S1QL 1MRDL 1S7UA 4FQXA 4NO3B 4Z18A 2G75B 1MH5B 3GMMA 2D0GA 1N6UA 4AT6A 4MA1B 1MQKL 4F7CB 1S7XA 3TA3A 1JN6A 3KPRA 4KK8D 3RIAK 1HHGA 3TIEA 2Q7YA 4RGNB 4KZDH 3G04B 4YFEA 2ORBH 2QLVB 4XBPB 4HBQA 4RRPA 1RJZA 2R8SH 1MLBA 1JNNL 1EHAA 1KXQE 3BGFB 3BKMH 2FJHB 4W4OC 4WFHE 2MPAH 3AU1B 3HE6B 3ZE1F 2FZ3A 4R4NC 3LEVL 1LE5B 4P4KD 4L3ED 2X70A 4LSPH 2YXMA 4FFVD 4V2CB 5FYKU 3FQWB 1TCRB 4FQJH 3CZFB 3ARUA 1ZEAH 3TPUA 3HC4L 3AXLA 5FDYA 1FVEB 1T0NB 3VXOB 4NNXB 4ODHL 3NCFB 5JHLL 2QKIB 4LIQL 1R3IH 4FXLA 1Z9OA 1AFVL 1X5GA 1JGDB 3EOBB 4QHLA 2X10A 4NM8L 2AP2A 4WU7A 4PJBA 1A3LL 4NQVA 2AXGA 4HC1L 1F4YL 1I4FA 5A3IC 3MRBB 4MJIA 3M1BA 5HGBA 3IU4H 1FYTA 4K8RD 1O5DT 1S7TA 2XZQH 3MRPB 4K8RH 3TZVA 3MSPA 4PYHA 1A7OH 2FBOJ 2RB8A 3W82A 5CHNB 5ID1A 5SWZB 5M94B 5FA4A 3BYTA 4N8VG 5I18H 2BMKB 4GJTB 4JDVB 5FKPA 2IH3B 4NKIL 1J05A 5E03A 4P59H 2M2DA 3AREC 1HXYB 2WBJC 4JRYA 5MEOA 3GHEH 2J3SA 1OSPH 3STZA 5JLZB 5EBLA 3MV8D 1MFNA 3TT1H 4FZ8L 3WIIH 1PSKL 1KGCD 1UM5L 1ERNA 1GIGH 3DYPA 4NQSB 2BNRA 1JV5A 1R5VB 3H3BC 4RMUA 3NTCH 3TH3T 3U82B 3OF6D 2K7QA 3NABL 4LPVA 4OV5B 5EIVA 4RA3A 2OL3L 5HDLA 7FABH 5MERA 3LB6D 3P4OA 2IADB 5GHWL 2X6MA 4IBLT 1GZQA 3OX8B 1CE1L 2BNQB 5EZOH 2IPTL 3MRGB 3VFUA 5GRUH 4URTB 1H3UA 5IMKA 2BX5A 4XMKH 3OR6A 1H8SA 5GJSL 1RMFL 1UT9A 1TQBB 4ONFH 2OI9C 2DICA 4XP9L 2OQJA 4K3GA 1TVDA 2FHBA 2HKHH 3DETC 1MCOL 4JFXA 3RY6A 4NGHL 5JDSA 2BVPA 3S3JA 3QT2A 3R06B 4KTDH 2FO4A 3PUCA 5CGYD 1KJ3L 2EYRA 4NNYA 2UWEB 4J3WA 4F58L 5JXAH 5CJQL 2ZUSA 3LKPB 3MFFA 1N4XH 3GJFH 3QULB 4F37F 4BSWA 1G7QB 3W0WE 1T1ZB 3OJDA 5B38A 1GC1L 1KPUA 2DYPD 4X6BA 4HWBL 5SX4H 2Y23A 1XF4A 4N0UA 4I4WB 5C6TH 3OKEB 1HKLH 5E8NA 3KJ4C 4Z7QE 5ISZE 5L2KB 3K46A 4H0HB 4W6XB 5C0BA 4PGEB 3CVIH 2VJXA 3LEXA 4ISVB 2DBJA 3VJ6A 1D5BB 1V3LA 3HAEA 3OGCB 2UY7A 3PWVB 3WXVL 1H15B 3S3SA 4HUNB 2R56H 3R4DA 4QXUL 3TNMB 3MUGA 3GHBH 3V5KB 3TO2B 1A02N 1UJ3A 4JE4B 4X6DF 4ETQA 5CSGA 4LLUA 2WP3T 3EFFA 2FX8H 4KKCC 1AY1L 1F2XK 4U1IA 2ED8A 2FSEA 3SE4C 2VLJD 3CVHA 1T7WA 4XB8A 5FO9B 4Y4FB 2VXSL 3QEGL 4HXBL 3MRQA 1A1MB 3WO4C 5C0EB 1FH5L 3EYVA 4PJXE 4ZODA 4YHNB 5IHZA 4OT1H 2DD8H 1LEGB 1VFUA 4EUPH 3F7RA 3N1QC 3QDGD 3V79C 3QDMB 3DBXA 4L9LB 2YRZA 1DBKH 3F7YB 5DD0H 4JFDB 4H5SA 5KZCD 3T08A 1M7XA 3B9VA 3PWUB 1OAKH 3LKNA 4P49A 4OKVB 3QIBB 2ZJSL 4E41D 3CD4A 4C56A 4OBSA 4HIHB 4QRPA 1Q0YL 4JCMA 5JMOC 1R5IA 1RZ8B 4OJFL 5ICXB 3HS0A 4N5UA 4KXZH 3RNKA 3EBAA 1DL7L 4J1UA 4LSSH 1MUJA 1ZT1A 5C07A 4GG6E 1KB5H 2HFGL 4L4VA 4MA7L 4BFBD 1WTLA 2ENSA 1M6OA 1T1WB 2IPUK 3RKPA 5BVJA 5LG1A 2E7MA 1KNOB 2JJVA 1NC2D 1RUKL 1U93B 5B39B 1F6AA 2E27H 1FNAA 1U9KA 1UYWH 2X4NB 1U42A 3P73A 3VD7A 5HGDB 2EIZA 4HJJL 4J3UA 1QO3B 4LLWB 2CK2A 2MCPL 5T3ZD 2R2HB 4KDTA 3RZWA 1WAAE 5T3ZH 2XRAL 2QHLA 4H1LH 4XNMA 2YD6A 5EU6B 4IJ3B 3ARFC 3QUKA 3VXSD 1YJDC 3DROB 4LKXB 5IQ7L 3G5ZB 4IOSD 1FBIH 1CLOH 2PCPB 4FMFA 1WJ3A 4KK6C 4PRPD 3QH3A 1P7QA 5ANME 3SQOH 3ULVE 4JFOB 4I2XB 3FRPG 1P1ZA 3ZHKA 5FV2A 3CDCA 3DRTA 4Y5VB 4KK5D 3R1GL 2RCSL 1MJJB 5DJ2B 5J06A 5CBAB 5LGJA 1YPZF 5D6DA 5F93C 3HA0A 1KFAH 1T6WA 5DUBA 3VRJB 1QACA 4WEMB 3TNNB 1EO7A 4M93B 3RPIB 2O5YL 2R0KH 4WHDA 3UX9B 4R26L 3GJFB 4ONHB 5EU4B 4M6NL 3LQZB 2JCCF 2R9HC 3QJFA 5GSRA 2DYPB 4PRHA 1T83A 3DOSA 4XC3L 4TOYL 4U0QB 4L8BA 2VLKE 3J7HA 4HC1A 4KI5C 5TDNB 4WW1B 3ZHLA 1MIML 3QFJA 2R2BA 2GFBA 3MBEA 4J3TA 4Q7DA 3SY0A 4JFZH 2V2XA 5E8PA 4HMEA 1TZGL 3IDMA 3IF1A 2AV1B 3FT3A 1YY9D 3TCXA 3PP4H 5J7CC 5ICYB 1GGUA 1A6ZB 4D0CA 2YWZA 1GOFA 4PJ9C 2VN7A 3A6BL 5D71L 3VFGH 2CKBA 5DVOA 1D5XA 1BGXL 1IGYB 3U30C 3V6OE 3ZDYF 5JPNB 5D7IE 5KVMC 3IJYB 4OD1L 1MNUL 4P2QE 2A0LD 3CAFA 3GSRA 1AHWA 1JGEB 1HH6A 1R3KA 5C0FA 2VDOL 1UKQA 5HGAB 1DQMH 4P2OC 3DMMD 4HK0A 1G7JB 4UV4L 2AERT 1KELL 4RBPK 1MHCB 1CFQB 4C83B 5IV2A 3ILQD 4YO0A 1JF6A 4HK3N 4CADB 2OL3A 4A6YL 1A7QL 5AUMB 3B2UD 2VXTL 4U6HA 3TBWA 4LAQL 4L8CA 5JW4N 1JPSH 1FO0H 3KG5A 1FL6B 4X98B 1H3VA 5T1LD 3NIDF 1Q0XH 5EUKA 2D03H 3VXUD 3B5GA 4MLSA 5J12B 5DMIL 5FA3B 1TJIH 4IOFC 2QEJA 3EYQC 1PQZB 3UBXI 2XXCB 3VD5A 3BQUD 4N9GB 3WL9B 2EO9A 2J5LC 4UDUB 1N59A 1H8NA 2ITDB 2EDBA 2OJZL 3QCUH 5IEHA 3SDXB 3EYUL 2VNCA 1KB5B 3TN0A 1R24A 4JO1H 1T5WA 4GRWE 4ZUUB 5IW6B 1CICC 1MEXL 3K4AA 4JFPB 1T1XA 2E8YA 1J18A 5DS8B 2ZSWA 3MLRL 3O8XD 4HWBA 5ALCH 1NBVL 3N06B 2IAMA 2RFXA 3ARDB 4DKAA 3T8XB 1NCBL 4JR9L 2FBJL 3VXRA 4CMHB 2PF6A 4TULL 3QPXH 4R4BA 3U2SA 3PWPE 3C08L 4H1LB 5FO8A 4MCZA 4P9ML 3MJ8A 2IJ0C 1I1CA 1Z5LB 3MXVL 1ZS8B 1HINL 4XNQB 5SV3A 4QTIH 1I7UB 4I3RL 2V5RA 4PRPB 4OGYL 1NLBH 2P8PB 4FP8H 2XPGB 2CR6A 1EXUB 1WVZA 4M6AA 2APVA 1GH7A 4OB5L 4PJIE 4BELD 3HHRB 1EGJH 3BPCB 1Q9OA 3BH8B 4ZUTB 3MRIA 1OF2A 1NUNB 1MCQA 4X9FA 1KCSL 5HHOA 3QR2A 1NFKA 1TVBA 4BQCA 4MB3A 4LRIA 1CBVL 4ORGB 4OLZH 5EIIA 3TM6A 1CG9B 5I8KL 4HKJA 4YBLB 2SEBB 4H0IA 25C8L 1QRND 5ADPL 4D9LH 3LDBC 4AEEA 2YPVL 4HF5L 4U1NA 1BJ1H 4JVPA 3B9EA 3ULSB 4ZSOB 1MCKA 2VDKL 4G8GD 2IPUG 2BC4A 4JY4B 1QFWI 4JQVA 1UVQB 4H26A 5HJ3A 4ALAL 4WI5A 2M26A 4OD3L 1U3HD 4XC1L 2ARJA 5CJXC 5F8QC 3SDDA 5ABDE 4WRLA 2H2PD 2DJSA 4XRCB 2KH2B 1EPFA 1HHIA 2I9TB 2R4RH 4X0KA 5C0RL 3NCJH 1HDMA 3EOAA 4PJGE 3UTSD 1HYSC 2YN3A 1NCDH 5IGXL 3RUGE 4XWOD 3DMMB 3N85L 5C0JA 5F7HA 1UKSA 2OTPA 4HZLB 3VH8G 4WCYL 1NJ9B 3BKJL 3CGTA 3IFNL 1QR1B 1KV3A 5F3BB 4O9HL 4I5BB 5DUPH 3IAGC 4EI5B 3UPRB 3RDTC 3H42H 3QXUA 2UYLA 4F7TA 1D9KC 4JFQA 5KAQF 1RZFH 1IQWH 4D2NA 1QKZL 3H7BA 1K8DA 5C6WH 1I8KA 1A5FL 3FN0L 3WLBB 3MMEB 4KVNL 5T1LB 1PKQE 3MRFA 3MV11 3VFNB 3MREB 3MJGX 2YS4A 1G7MB 5J6GA 4L4TD 4AY0A 2E7LC 3L3GA 1CU4H 4PJFF 5HVFB 2DQCH 2VE6A 5BZDB 3LSOA 5E70A 3SKOB 3KR3H 1NCCL 3U36B 2PTTA 4KPHH 2Z35B 1JF1A 3K1DA 3SBWC 4BSVB 4JM2D 3BMWA 5CEZD 4KQ3H 5ICZB 3ARRA 3THML 5CEZH 3HZVA 5GZND 3V95A 4XXDB 1KN2H 2B1AH 1BZ9B 3CCHB 3ZT7A 5F6HJ 1HHJA 1Z2KA 5BOPA 3ZE1E 2NW3B 4UMGA 2NTSP 2P8LB 2VKXA 3QFDB 4MAYB 3OAZH 2FGZA 1FGNL 4HPYL 3O8XB 1XCQA 3F62A 4HUMB 5B22A 2QBWA 4XAWL 3RWFB 4FABH 3P4OB 4I0KA 1J8HA 5ADOH 1MHEA 2X1QA 4L29B 2P5ED 2NNAA 3HCVB 2OYPA 2AJSH 3FOMB 5L7XL 4UIKL 3RTQA 4NZRH 5TDPA 3WDHA 1F4XL 1JWSB 1M7DB 2F58L 3KWWB 2HRPL 1AD0B 4M7KL 4WI8A 1FG2B 4PJCA 5D7KE 4RAVB 3O3DA 4OZFA 1INDH 2K9UA 2L4OA 3MLWL 2UWEF 1N2RA 3PHQA 2J4WL 1I3VA 4GRLA 2FIKA 1QPXA 3CFEA 3PABA 4Y4HB 1S7QA 5CD3A 4ETYA 5I9QB 4KY1L 4Y5XA 5A43C 1ZOXA 5A3ID 4GAYB 3D48R 3VGBA 2LTQB 1YQVH 2EC9T 5BQ7B 1AKJA 4XI5C 5INDB 2ZUUA 1TZHA 4G42B 4XNZC 2ICWA 4XPBH 4YXHL 5JNYA 2BDNH 1DQJA 1TETH 2AK4D 3HMXH 1BQLL 2DIJA 2UV3A 2YBRA 1JI2A 4CN1A 3MJ6A 2F5AH 4HUXB 4I1NB 2GAZB 2WBJD 4WI4A 1C12A 1EMTL 4J4PA 1J88A 2V9QA 1K6QL 4G8GB 4N8CH 3ARWA 2ADJB 2ESVB 2P7TA 3SKUD 3EFFB 5E2TH 5ITBL 4AEHH 4Y7MA 3WS3B 1QOKA 4ODXA 5F7DA 3T0DA 1KSRA 1EVTC 3CPLB 4R7DB 5KSAA 4HIIB 1HH9B 3OXSA 3GBNH 2FSEB 4HWEL 1UADC 3ZT6A 3WUWG 3FZUC 5D8JL 4I9WD 3H0TB 5DQJB 1T03H 3S9DB 3WUZA 4LVNC 3BDXA 4LGRB 1P2CA 3SE9H 4N1HB 3QUML 5EU7E 3FQTB 5DD1L 1I7ZB 4ONOA 3P30L 3UTSB 3ALXA 3FFCA 3G5YB 3JBG7 2M1KA 2GYSA 1T0MA 4ZO6A 4ZNCD 4G43A 4MHHI 3K8LA 1HHKA 1KOAA 5IFAH 4WV1C 1P4BH 5F9DC 3ZKXB 3O6ML 4G6ML 1DANT 2QADD 3DETD 2G60L 3BRDA 2FR4A 2H26A 3QG7H 4JFEA 5E6IC 3TBVA 3MJ7A 2DKSA 5DQDL 3DURB 1J86A 2X4QA 4NQDE 3VFVA 2PW2B 4DN4L 4R96A 2YC1B 1C7TA 3TH4T 4L4TB 1RUAH 3QQNA 5DVLA 4NQEE 1E4WH 1J9CT 4NZUH 4YHOH 1D6VH 4YXLH 4EIGB 4PRIA 1YNLL 4R3SB 4GKZB 3C60C 4XGZB 3SN6N 4JY5H 3D39B 4PRNA 1LEKB 2Z91B 4ONGL 1A6UH 4X6DE 1PJ9A 1U6AH 1GZPA 1EFXD 4NPYA 1EH9A 4NM4L 3MNVB 2R0WH 4YLQT 4BQ8A 4AL8L 4WUUA 4IS6B 2IANA 3OKNB 1EJOL 4QRUA 4TYUA 4K3HA 3VXPB 2RIKA 1YC7A 3QUKB 2QQNL 2VH5L 4G80A 4TSBL 3T0ED 5AZ2H 4B41A 4OF7A 2X89A 3UROR 3VA2C 2J7LA 2V5YA 3MCLH 1DZBA 3RI5K 1MVFA 1N0XL 1AO7A 3HI5L 4X8XA 2CGRH 3GRWH 1FYHB 1NFIA 2EH8L 1PY4A 2YKLL 3DHJA 1EEUA 1U41A 1MF2L 3MLXL 4L8DB 1JNHB 3O6FC 4LP4A 3MRDB 1BD2E 4RGOL 4WDIA 2ZZUT 3I3DA 2NXYD 3L3DA 3AMLA 2NY2C 5EN2B 5J1AB 3DX8A 2YEZB 3TA3C 4U7MA 2W9DH 5JIIA 2HTLC 4QOKD 1MWAL 2I60L 3UDWA 3LKOA 1K3ZA 3Q1SH 1IARB 4K3DL 3D85A 4B53A 3BZFB 5MEQA 2YPLB 5HHVL 4YDJB 3S5LG 4GQPH 3D0LA 1LO0L 4JRXD 5M7QA 3LEYL 4DK6A 3OXRB 2J12B 2R0ZL 3DARA 3CMGA 2EEBA 2AJUH 1CIUA 1W0WB 4KAQL 4GBXD 4JPWH 2ITCA 2DQJH 3AM8A 4OZIB 5EPMB 1FVDA 2BSTA 1OP5H 3WIHH 5D2NE 1E6OL 3VDAA 5CWSB 4OSUH 2VAAA 1N5YL 3M8OH 1CVRA 1I1FA 4JANB 5JOPD 1JRHI 4P9HL 1SHMA 1OM3H 2BSRB 1FIGL 4OFYD 4FQ2H 3AREB 2WBJB 3UC0L 1T5XB 1CFVL 1NLDH 3FO2A 1FFPA 4MD0A 3PWNB 3HUJB 5BCAA 1MJ7L 5IK3B 5LVEA 2DQGH 3ARBB 5F9JA 3SHSA 3MV7B 2VDMH 5HYEA 3X11A 3L5WA 1YPZE 1JP5A 4ZO9A 1NFDA 1T7ZA 3IFPA 4JKLA 4M8QA 3IXAA 3EDEA 3VW3L 3BZ4B 2EYTA 3BDYH 4U33A 2DJ4A 2UY6A 2D7MA 3LRGA 3UYRH 3R0NA 3DSFH 4KK6D 3PGDB 4D0BB 5EDXA 3F5WB 2GEEA 2YPKA 5I1AA 1EZVX 2NXZD 4LLQB 3S37H 2X4PA 1QBLH 2Q8BH 3IAPA 4JQIH 2APXA 4R8WL 3ZKQD 4AG4L 1MCEA 2DLTA 1FZMA 2JCCE 3BE1H 1T04B 3DX9A 3KPPA 2IMMA 2OI9B 1NBZB 4LLAA 3GMNA 4JHWH 3ROLB 4LSRH 3HPJA 5I1LA 4HQQH 1YEFH 4UQ3A 2AJZA 4OLYL 5I0DA 3TWCL 1MPAL 1BFSA 3BP7B 4JFFB 5E7BA 5IQ9A 3MGTA 3S35L 3U0PA 3PQYE 2Y36H 3UXFA 2A6JB 3O2WH 4LOUD 4OLUH 1CDYA 3VXNB 1YMMD 1QSFE 2BY1A 5DRXA 5HDQH 3SDXF 3T1FA 1T89C 5GXBB 3D6GA 2LU4A 5JOEA 1IVLA 3QEQA 3RWHB 1XCTB 4ELMA 1SY6L 5LQBH 5BMFH 2OM5A 3OB8A 2F5BL 4J7RA 5H35A 4LK4A 4G9FA 4HS8L 4Z7OF 1OP3K 1NGQH 1N64L 2YD3A 5BRZE 4UDTB 4NO0A 4XPHL 3H2WA 5F89B 2VMFA 3KJ4B 2Z93B 1UENA 4Z8FL 4CN4A 5CZXC 1SEQH 1B0RB 3CLEH 1J5OH 1CTOA 2GT9B 4ODVL 5DR5L 4JN1L 4MNHB 5FK9A 5JW3H 3VDCA 2N7BA 2OXHA 2R0LH 4WIQA 5I1KL 4YR6B 4XBGB 3V8CA 5DRZB 1F90L 3PNWA 5D1XA 5A2LH 3IYLW 2YXFA 4LCCA 2APFA 1FNEA 4XCCL 1JPFA 1QLEH 2XN9B 4M62H 1UACL 4MD5A 4ZYKA 3NIDE 4HUUB 5AZEH 5TQ0L 5IR1B 2B20A 1OARH 2RGSA 3LS5H 3MACH 4FFWD 4J12A 2H9GA 3MLYH 1OGAA 2D7QA 4P2OD 3RIFF 2FGWH 4Z7WA 4QF1A 1JPST 3HI6L 5C0IA 1D5IH 1OB1B 3P4NA 4NUGL 3EW3B 2AV7B 1PZ5A 2W92A 3WO4B 3P40A 2AEPL 4U1SB 1NSNL 1WBXA 1NBYA 4IIQA 4UZGA 1OAQH 3QUMA 4ZFOB 3FMGL 4V1DD 4YAQB 2EDFA 4NQCA 1SM3L 1P6AB 2Q86A 1AI1L 1VGEL 1WWAX 3OV6A 1CFBA 2KKQA 4ZS7L 2PXYA 4XCNA 1H3TA 1U91A 1RIUL 3SKNA 4JRXB 2FX7L 1SVZA 1G6RL 1ZWIB 4APQA 1E4XI 1AXSB 2GJZB 1T2JA 4JG0L 1A9BB 1B6UA 1NGWB 3RL1B 3TBTB 2OZ4L 4RRPG 2DM3A 5KN5B 2PTVA 4Q6YA 4FFYL 1KN4H 3HLAB 4XHQA 6FABH 5DFVD 2VDQH 3ARGB 1WZMA 5F1IA 4R90H 4EDWL 9CGTA 4NNPL 1ZGLM 3UJTL 5C2BL 4JDZB 1CFTB 3OR7B 2FLBT 2HJLA 5TF1L 4PJ5A 1JTOA 5JQ6H 2I9LB 1KJ2A 3CMOL 1KEGL 4Y0GA 2O5XH 4GW5A 4IRSA 4MSWA 2XZAL 1MAMH 5IMOA 4P5TB 1IC4L 3CC5A 4NSKA 3ARFB 4JN2A 5EOCJ 3GSVB 4WWKA 3OKMA 3MLTB 5CCKL 2X5PA 3WNKA 3RI5F 4GKSB 1R3HA 1XR9A 2EDXA 3VE0B 4K3JH 5K9OA 4JO2H 2VDRL 3K8KA 4IOIB 1VPOH 3QEUA 3U7AA 5I19H 3BD3A 2PYEB 3GM8A 2VB5A 1Z9LA 2B0SL 3WE6A 1RFDL 4DVRL 5AYUH 3FHAA 1KUMA 3EJYC 4CNIA 5EBWA 3L3GB 2EE2A 2W0FB 4MD4A 1IC5H 1OP9A 2CIKA 2ADGA 4RGNE 1LK2A 2Y4SA 3FQXA 2LAGB 3KPNB 4GUPB 2Q7NA 4Z78A 2WP3O 4U6XA 5B21A 4KVCL 1MWAA 1NAKL 4HJ0D 3S4SA 1CL7H 1Z3GL 3DXAB 5T3XD 4WU5B 4I77L 1A47A 2BHZA 5ILTH 4FNLL 2AQ2A 1KTDA 5T3XH 3EDJA 4U1HA 5T1KD 4NQTA 4QRQA 4UOW1 2UZIL 5GS1A 5L8KB 4ZG1A 5CJ8A 1FN4A 3D5OF 1PGRB 2VLRB 4QRSA 2Y5EA 3V7MA 3QCVH 4PJDA 1IGCH 4JZOB 5EFIA 4MDIB 1GHFL 2XQYG 4EJ1C 3H9SB 1WC7A 5JXEC 5FCUL 4PJ7A 4ZTPL 4UOW0 3P2TA 1JHKH 1Z9MA 4PJ8A 3MROB 2IWGA 3KPQB 4OZGF 4YEEA 1QBML 5ESAA 5C08B 4PJ9B 2D4DA 4JQXC 1PY9A 4W68A 2ID5A 4WI2A 3HZYA 3U30B 2V7NA 2MMXA 4TUOB 2F53B 1R0AH 3C6SA 4QT5B 3KDMB 2I5YL 4NP4L 5SX4I 5TDOB 2RBLA 1HYSD 2V5TA 3QNXB 5B38G 4P2OB 4PJFE 2HJFA 1T3FB 1UZ8A 1H8OA 3RA7L 2DDQH 4L5FL 3NFNA 5F88A 5ACZA 3BHBA 2ZOKB 3VD9A 3HC0A 3ZSTA 4M4PA 1G9MC 3B2VH 4FQIH 3WHE0 3FQNB 2PO6C 4J2XA 2DQTL 4A6YB 1D9KD 3SE8L 2W1NA 4V1DB 2PN5A 3DECA 1KIQB 1DUZB 3FOLB 5MENA 2EC8A 4IRJC 4ZDHA 3JV6A 1MI5B 3HAEG 4P0DA 2NY0D 5C0AB 3G5XA 2MOVA 1RZKC 5DVMA 4ELKA 3MNWB 4ZPTB 3CX2A 3FB8A 3IU3B 3SDAD 3ULVL 4H20L 3V0VB 4I3GA 2YD9A 1CYGA 2OLDA 2NTFB 4LDEB 2FEDC 4YHZL 2BNQE 3Q0HA 3VXMD 2YR3A 2J5LB 1HZHL 1I3UA 5IB4B 3QCTL 1I9RL 1XGQA 3DUUB 1FL5A 3F6LA 4D94A 5T1DL 2JB5H 2C3XA 5JORA 1QA9B 1UWEL 4M3KB 2JF1A 1DBBL 1CICB 1ZMYA 3O2DH 5DJCB 1FAIH 1SY6A 3LHPH 3K2MC 1P9MA 3RWGA 3CNKA 4NWTL 4EZMA 4EN3A 3H3KA 2R39A 3L1OH 4UIMA 1KTKE 3BJ91 1XF3A 4WO4A 2UWEE 3DRQB 3GGWB 1G9NH 1T1YA 3W9EA 3CFJA 4PS4L 4M61B 4OUUA 1RHHA 3CSYB 4LCYB 3BIAX 5HTSA 1QSED 1P7KB 2IG2H 1L7IL 3WLWC 4RA0C 2YSSB 4KXZI 4QXWA 5IF0B 1HXMA 1MRFL 4WUKL 4D9RD 2NY6D 1T2QL 2JK5B 5TE7L 3FAXA 5IJVB 3TBYB 5IBUG 4HKXA 1JGVL 2RR3A 4HLZG 1CGWA 4IHOB 4F9LA 2DQIL 1ZTXH 5EWIH 5H37G 2A73B 3DV6A 5DJYB 2YMXH 3JV4B 2GSIB 4YHPA 2HFEA 1I7TB 4JHAH 4Z0BL 3JWDL 2GCYB 2Y07L 4Q74A 3QWOA 5D72L 2P5WD 4RFNC 4JM2F 2FIRT 1TJHL 1MCWM 1OGTB 2J8OA 2EICA 3X12A 1T4KA 4MB4A 4HUVA 3KNBB 4P4RB 1JPGA 4OLWH 4TN9A 3L9RA 4GMSL 3VCLA 3GSUB 2WUBL 3HRZB 5T1KB 3O3EA 3QYCA 3RNQA 2LV4A 3VFOB 3OGOE 3GO1H 4RZCB 2OTUA 3UJIL 3WD5H 5H2BA 4KGLA 4XCYA 3TJHD 3LDBB 1ZGLB 2R4SL 4LLYA 4HEPG 4QY8A 3A6OA 1RUQH 1N8ZA 4EBQL 3OKOA 1IKNC 4QTHA 2OZ4A 3WN5A 1RIVL 3QDME 3EO9L 1U8NA 4NWUH 4JFDE 1J0IA 3QQ9C 4XMPL 4X9GA 4BFIB 5FECB 1YYLL 1A14H 4R7NB 3LKQA 3U0TA 4Y2DD 1ZLUH 4EOWH 5F7KC 1MFDH 4DKEL 5F9OL 2CDFA 3HG1B 3QUXC 4AM0A 5BV7C 5C0GB 3SKJL 3U7YH 4O4YL 4KFZC 4LCUB 1EVUA 5I1DB 3T3PF 2NW2A 5K93A 2AGJL 4K94H 5IG7A 1BLNA 2V17L 5CD5C 2N4IA 4FQQA 4X5XB 4NN6C 3W0WA 3GSXA 2FJGA 1KCRH 2W65A 5GGQH 1F13A 2IH1B 4UNUA 3T3MF 1EBAA 1CIDA 1I8LC 1TIUA 4LSVL 1Q72H 4KDWA 3MV8E 3RDTB 2EDNA 4O58L 1KGCE 1D9KB 2FL5B 5AYQA 2DQHH 3SJVD 3MA9L 5LBSH 1I9IH 2AS5M 3C6LD 5E6ID 1EO8L 4LFHG 1AGEA 4KZEL 4OZIF 4LNRB 4P2CG 5E2WL 1XGPA 5CUSL 1MCDA 5EU6E 5JHDD 4HSQA 4GO6B 1JZ5A 2CK0L 4X6CB 3IT8D 3NOIA 4GG8A 2FYYB 5J56B 3C60D 3VXMB 5D96C 4G3YL 4I2XE 3VWJD 4H88H 4U1GC 1JPTH 1MJUL 3HUJF 4OM1H 2R2CA 4YHLH 4J3SA 12E8H 3O4OC 4I3SL 3X3FH 4UTAH 4ZS6C 4PRAB 1J1PH 4DGIH 1PVHA 5F44A 1MREL 2HH0L 4AIZB 4Z7UF 1W72H 3OAYH 4WFGE 1FL3B 2AEQH 3G5VB 4PJXA 1RURL 4LLMA 4PJEB 4DZ8B 1QNZH 4UT6L 3RKDD 2MTPA 3QXAA 3CSGA 4NZTH 3C5JA 3RGVB 5DK0A 4HFUH 4KROB 1SYVA 3FQUA 1KB9K 3I6GB 3MOBL 1MCLA 1RAMA 1HSBA 1MCPL 4MCYA 4WJ5A 3SCMC 2P48B 5GZOD 3OKDB 4MNQB 1QSEB 1JK8B 3KPSB 4X7SL 4YDLB 4FQXD 3I75A 5IB3A 2FHCA 3C2SA 4LGPB 3CDGB 3RWJA 4GAJL 3FO9B 4ERSL 1RSFA 2NY2D 3TV3H 3U7WH 4JDTL 2ZSVA 3UZQA 5IHLB 3S5LB 3TA3D 2CXGA 1YN7B 3DVGA 5C0DB 2E7CA 3MRMA 4GG6A 3L6FB 4MXWL 1RUMH 3RWEB 3SDCA 3DTXA 2CO7B 5D9SA 3IETB 2N1KA 3A67H 3UO1H 5JUEH 2DRUA 2APBA 4P5MB 4CAGA 1RIHL 1SYSB 4XNXH 3P0VL 2ILLA 4M1DL 3QI9C 4ZXBC 5DC0A 5HVGB 1BMGA 4WHYG 1TQCC 4UT9H 1H3XA 2CRMA 1JNLH 2Q76A 4S2SA 1X5IA 3VWKC 4CMMB 4OM0L 5ESQA 4XNZB 4N0FB 2CPCA 1VCAA 4U4BA 1XEDA 3TPKA 3M45A 5FYKD 1DVFC 5FYKH 1CXKA 4P46C 2NY5C 3BESR 1K8IB 3V4UL 3IJHA 1FLRH 5ANMA 4UI2A 3V5DB 5A1AA 4PY7A 3BUTA 3B9KA 3O9WA 1IQDB 1PX4A 1F97A 3UTTD 1IAOB 4M7LT 4MJID 4OZ4A 3FTGA 1FYTD 5CLWA 5LGKA 1DANU 5IVOA 5IT2H 5F70A 3TZVD 1H0DA 5D2LB 5DJ6B 3PV6A 4E41E 5C0CB 5IFHL 1KT2B 4NRYB 1NDGA 2VABA 5FF6B 5IVNA 3LPWA 2MKLC 1EEQA 1MLCA 3MCKA 4NC1E 2K7PA 5IW1B 4OF3A 2X7LA 1CK0L 3GSOB 4KC3B 4G7VH 4JRYD 5FUOL 2C3VB 3SDXE 3MRKA 1PG7H 2ZG2A 1DQLL 5HHQA 3G08B 3UP1A 2DI9A 3Q3GA 4XXCA 2YA0A 2EXYC 4M1GH 2BNRD 2NX5A 1HNGA 4WV1B 2VLKA 2VQ1A 4Z7OE 2W91A 4GSDH 1T20B 2ATKA 2ICWJ 4TVPD 4TVPH 5E6IB 3BAEH 3ZTNH 1OAXL 1FDLH 1RJYA 3QUZC 3RBSA 1CXLA 5D1QC 3VG0L 3CSBA 5T3ZE 3U0WH 4OLXH 3BIKB 4HUKB 4OCYH 3CFCH 1YDPA 2HLAA 1G7LA 2Q20A 5DURD 4R97C 1U95A 2YZ8A 5L0QC 4PRPE 3C60B 3SPVB 1XGYL 3G6AB 1BOGB 1WFOA 5FGCB 3V6OA 1CFSA 5D7IA 5I2IB 4P2QA 1HQ4B 1KLGB 2X4RA 4FXKA 3L7EB 4M00A 1AD9A 1EHXA 4IMLB 1BJ8A 3GSWA 5D6CA 4PREA 2H32A 4Y5YC 1F3JA 5DHYA 1PG7W 3E6HA 1AGDB 4LPWA 1JBJA 4MZ2A 4UQ2A 3INUH 3H3PH 4HBCL 3BVNB 5I8OL 1GSMA 5EUOB 1ETZA 5ALBH 1FFNB 4JPIA 1F58H 5E8DL 3VFSA 3S3PA 3O6FB 15C8H 3EOTL 1IFHH 4OIIH 5ESVA 5C0BD 4MGXA 1DTUA 3ZE0F 4X4XB 3LMJH 1YEJL 2NY2B 1LO5B 3HAEH 5D7SH 4DGYH 1SMAA 3RVTC 1SBSL 1T22A 2HA1A 4DTGH 1FNHA 1MJ8L 3Q5YA 5HPMB 1D7FA 1K3IA 4ZD3H 3T77B 4TUKL 1U58A 2BOCA 4Z77B 4LQFH 4ESKA 4Y2OA 2JJTC 3MRLB 2FECI 4R4FL 1EHLH 1IGTB 5FUCE 5IBTL 2VN4A 5C70A 1REIA 1IKFL 4KI5F 1BOYA 4LSTL 3DJ9A 1ZLSL 4BK5A 3CVHH 4QHMB 2WUCL 3KS0J 3PWPA 3FFDB 4MWFB 4I48B 1FNLA 4Z95H 4NJ9H 2GUOB 2VDNH 3P4MB 4FZEH 5HHPA 3MRJB 3AS2A 3HZKA 5EOCH 2B2XH 1F11B 1MCFA 2EDTA 1E27A 3N1PC 3HNTL 5JZ7C 2NY7L 3PP3K 1FHGA 3U83A 4OZFG 1NGXB 3UTTB 3W9DB 2GJJA 4JFYA 4QRPD 4ZQKA 4XBEH 3E1F1 3VXUE 5L9DL 1UA6H 4RISL 3VU2A 1S7RA 4PJIA 3BN9C 4NO2A 3GZKA 5TJWK 2LFGA 4PFEA 5C07D 2CRZA 1YNKL 4NUJA 3JSSA 4HLZH 2WINB 3LRSB 4L4VD 1FZOB 2H3NB 1T7XA 1HSAA 1AR1C 2HG5A 3C8DA 2DI7A 5H37H 2KQNA 4GS7B 5DWUL 4DGVL 2Y06H 5KOMC 1Q9KB 3Q5OA 3C2AL 5BVPH 5I1HL 1P4IH 1A1NB 1F3DJ 1MFAL 3GSNL 2BK8A 3IGAA 1PKOA 4CUCA 1FIEA 1OTSD 2OTWB 4HIJB 1M05B 4WW2B 1ORQA 2PR4H 3ALWA 4KWUA 2DL2A 5ERWA 2E8ZA 1AJ7L 3JXAA 3NPZB 1S9VA 3O3UN 2KPNA 1YEHH 3AY4C 5FAAA 3N50A 1WZ1L 1VADB 4OZGE 3GNMH 5B8CC 5J9PB 4TUJA 4I18C 4AH2A 2BVOA 3X13A 2C7UB 4BFEA 5ELIA 5KSVA 1YEDB 3KPLA 3HZMB 4PLKC 4PJGA 1UEYA 4LVHC 2C26A 4OF5A 1F8TL 3CDFA 5DI8B 5CEXB 2GK2A 3RUGA 4O51B 3NZHL 4OCWL 1I75A 3TP4A 4PP1D 5JXED 4UTBL 3E3QC 4WNQB 3C8HA 3HC4H 4GW1B 1IBGL 1P7HL 4M7JH 5HYQA 1V5JA 5EZIH 3U9UB 3BZEB 4PRHD 2DQDH 4WHTB 4JLRB 2JJSA 1OAYH 1PKQA 2D3VA 5C71A 4U0RC 1XR8B 3QFJD 4HC1H 3MBED 4POZC 3V4VL 3UPAA 1BQSA 4PG2A 3O2VL 4FQHB 4JZJA 4LFHD 5DMKB 1QRNE 1DLHA 2LU3A 4TRPH 4LARH 5DRWB 3ARTA 5HHXH 4FXGB 3IKCB 4PLNC 3GIVA 4DAGH 1G9MH 4G8GE 2ESVE 5IP4A 2IPKA 4NKIH 1GXEA 3MO1B 3W5MA 1OAUH 2CKBH 2FJFA 4YGAB 2PYFB 4IRJD 3B43A 1AGBB 3K1KC 5E8OB 4N0YL 4YDKH 2AEWA 5DA0B 1RZKH 3S7GA 4OCRH 5H94A 5DC4B 1G6RB 5E95B 2FEDD 3NH7L 3P0YH 3MBXL 1IZKA 3UTSE 3ECBB 4LEXL 5KVGH 1JYNA 4KQ4H 3MLUL 1F3RB 1A6AB 1NUDA 3QHFL 1M7IA 2QSVA 2EYSB 4LRNH 1CT8B 1I1AC 3P9MB 2Q3AA 3JVGC 4D3CL 5IFJA 3H7LA 1FGVL 2EEDA 3BGMA 3V52H 5I17B 3FB5B 1WCBA 4RQQA 1IJ9A 4L4TE 4HAGA 4JPKL 2ICEB 4Q9QL 1LEIB 5K9JH 3MYJB 3B4NA 5IBUB 1Q94A 4LSUL 2GITA 3TN0D 5GIRB 1ZT4B 4KRNA 3D39E 3HI1A 4F58H 5CEZE 2D7OA 2WBWB 1ES0A 3WFDH 1D6EB 5ISZB 4L1HA 3TF7C 2KBGA 1XF5B 2P24B 3BEWB 1DBML 3WNNA 1C1EL 2ZP0T 4MMZC 1DFBH 2IAMD 5CZVH 5F9AC 3MX0A 3MR9B 4UILH 1A1OA 5E99H 2B4CC 4DQOH 2CSPA 3TFKC 4HK3J 4XP1H 4X6CF 4WHYH 3IKKA 2R1YA 2CUIA 1MELA 3BSZH 4KHXH 4BK4A 1QLFA 4WTZA 3KPMA 1NUFA 2P5EE 2FB4H 3JV0A 3WS6C 1SJEB 1UWGH 3LRHA 1WT5A 4HV8B 3VI3F 5GRJH 2EDEA 1NEUA 1NQBA 3DO7B 5INCB 1DBAL 5DD6B 3OSKA 3RWCA 3MLZL 2B7DT 4UT7H 1CCZA 4LF3B 1AY1H 4PJEF 4NN7C 4GT7A 1CLCA 3MOAH 3LQAL 3T3PE 1HILB 1RZIA 3LQAC 1RUPH 4JO3L 4PB9L 4ZFGH 3GKWL 3BKCL 3H6JA 5HHOD 3AUVA 2YPLE 3MV01 3T3ME 3RY4A 5DSCA 4YNYB 5L6YH 2AXFB 1OL0A 2IQAA 4Y4KC 3RZCC 4WFFD 5IWLA 3OKLB 3QUXD 1ZT7B 1ONQA 4MJ5B 5BV7H 2ZCHL 4OZIE 1K4DB 2YRLA 2K1MA 4K3EH 1GGBH 3LN4A 3QQ4A 2AK4E 4NQEA 1HHHA 3DV4A 1BBDL 1DQDH 2OBGA 3RBGA 1CGSH 4X80H 5GS0L 4OJFH 1NMAL 4E5XA 1FE8L 4H8WL 1WWBX 4U1MB 2NY3C 3QXTA 4PJ8C 2VO5A 3PDOB 4X6DA 3VFRB 1I7RA 1S5IL 2PO6B 3QIUC 4EVNA 3HUJE 1QEWB 1ZE3C 4MA3B 3SDDD 4MA7H 1NAMH 3O0RH 3MV7E 4TTDD 1V05A 1HQRB 4IRJB 3HNVH 3O11A 1JWMB 3CIQA 4Z7UE 5DHVA 3BP5A 4I9WE 3JWOC 2XOTA 3EHBC 4FQPA 2XTJC 1BP3B 2Z9TA 2FATH 4UB0L 3BWAB 1EUUA 2MCPH 5FO7A 1EEZA 1YUHB 1BFOB 2V7HB 3O6LH 3NVQA 4KTYA 4YGVB 5SX5K 2XRAH 5CMAA 5E00A 4D9QD 3PHOB 2X4TB 3S96A 1OSZB 1VFBA 1W8OA 1X7QA 1WBYA 1IMHC 1NCAL 2NY4D 2R15A 3QBTB 1YN6A 2DIAA 4ZS6D 2A38A 3GB7A 1MIEL 2XY1A 2AJ3A 5EIQA 2D31B 2CDEA 3BP6A 4QHUA 3D9AH 2H2SC 2Y9RT 4JFFE 4J3OC 5MI0C 4S0TD 3MNZA 4K7PX 5TE4H 1I85A 3MUHL 2HJKA 1A4JB 1G6VK 2CLZA 2OJEB 4ORZC 3UAJC 1U8QB 1A3RH 43CAA 3FRUA 1J0JA 3ALPA 1V7NH 1U8PA 2AI0H 1UB6A 3ZKSD 1S8DB 2EDQA 3MXWH 2MNUA 3MV9D 1W0YT 4PGDB 2JTDA 3S98A 5F3HB 4I0PC 4X6FA 2DM7A 5E2UL 3SDYL 1P9MC 1VHPA 3NA4A 5HVHC 1BF8A 1N5AB 2BSSB 4GXVL 5D2NA 3RWIB 2JB6A 1JZ8A 4OAWA 4AZ8A 1B4JH 2VC2L 5F7FA 1U8MA 1P84K 2HT4C 3OPZL 1S5HB 5GGTL 4GKNB 4X4ME 1G7PB 3RTQD 5DK2A 3T0BA 4YIQB 1JNJA 1TZGH 4RFNB 3VXTA 4DVBA 3SKMA 3QO1B 2XN9E 2VWEC 5E9DA 5IM7B 3NIGF 4MQ7A 1WZLA 1YPZA 2DWDB 1NH6A 4GW4A 1INQB 5CGTA 4HHAB 5D71H 3QUYA 2HT2C 5EZJA 2HT3C 4MX7B 3VWKD 1C16A 1BGXH 4HS3B 3MRRA 4TNVK 4GLRH 1PAMA 2Y72A 3PWLB 1S78C 3GMLB 3GEWB 2VDOH 2J8HA 3WFZA 1OY3B 4KDVA 2UUDK 4U6VH 1NMBL 2D7TH 2CJUL 1KELH 3T2QA 1ZHKB 2JCCA 3ILPA 3P77A 3F7VB 4D0DA 3W39A 1QYGH 3O41A 3VFSB 1A7QH 2AJXH 3KYOB 4JY6A 2G5BA 1AKJD 2OS7A 5AD0A 4JRXE 1U8LB 3QO0A 1B0GA 4HUWB 3TC9A 3QHZH 4MQTB 3QUXB 1BVKA 2P42B 35C8L 4LASL 4KUCD 4M8VA 3PQYA 5BV7B 1XIWA 1X4YA 3AAZA 1FV1A 4QO1A 1QSFA 2EKJA 3C9NA 3S4SG 1P4LA 3L95B 3VFWB 4NN6B 1DDHB 5JOPE 3MQIA 4HWZA 4HIXH 5F1NA 1GRWA 2ED9A 3K2UL 2OJZH 4LQ1A 2ZNWA 2CH8A 3BW9B 2FDBP 1WEJL 5DXWA 5BRZA 5KSAD 1NAMB 2A6IB 1ODAA 3G6JB 1MEXH 4NT6B 4ODUA 3JUZA 5EZLA 1KTLB 3V8OA 1I8MB 1QTYT 5D1QD 2XWBA 3C5ZA 4XCFL 3MLRH 1S9YB 4NHUB 1JI1A 4NKMA 2XV6B 1FNGB 3FFCD 1IGIH 2OSLB 4GRMA 4JR9H 1O7SA 4DWHA 4TULH 2ENYA 3S88H 5D96B 4U1GB 3U9PH 2PYEE 1ORSB 5TFSL 2A83A 4UU9A 2EECA 3PL6B 3O4OB 4KK9C 4I3RH 4JFED 4CVZB 1YNTB 2DN7A 32C2B 2BVQA 4XVJH 4KZDL 1DLFH 2GTZA 3ZE0E 1XZ0B 4HDIA 3L7FB 4LLVB 4BSJA 5F6HI 3BKML 1OTUC 3ORJA 4ZOBA 2MPAL 5C6PB 4ZPVA 2E9JA 5DJZB 5DJ8A 4M1CD 1UWXK 3IDNA 4LSPL 3DXAE 1S7VA 3AS1A 3ZYJA 2DMCA 3SCMB 5HYSG 2WLYA 1A2YA 3BUYB 4P4KC 4FQJL 4Q6IA 1ZEAL 2HN7B 1Y0LA 4JREC 1KCSH 1RK0B 3BXNB 3M07A 1QVOB 3MV9B 1U3YA 4WUUD 1SJXA 2MHAA 2VLRE 2IAND 2VLLA 4KI5E 1QFWM 1FZKA 5HGHB 3D1MC 5EC1A 1QHPA 3KS0H 2CLRB 3RVTD 5HGGS 5KS9B 2EH7H 3H9SE 3A0OA 4OLVH 2GKIA 25C8H 4EDXA 2XNAB 3BT2H 1ND0B 4FTVB 2CXKA 2QQKH 3CLFH 4PV9B 3CU1A 4K8RL 3STLA 5C08E 3VG9B 4U1KB 2OR8A 1C5DA 4PV8B 5GRZA 5F7WC 4NKDA 3D3VD 3QI9B 4ZXBB 5I18L 1E4KA 4ZUSB 5ENWB 1VEMA 1H3PH 4LHUA 5K9KB 1R3LB 1TQCB 1X5LA 4G6JH 4P59L 4JFHD 1U8IB 2B1HL 3KVQA 4NYLB 3VWKB 1K2DA 3PJSB 5C8JA 3GHEL 1OSPL 1AQDB 5CS7A 3FCTB 3BKYH 3TT1L 3WIIL 1DVFB 4DOHE 4P46B 1NC4D 3D85D 1X5HA 5JZ7D 3NTCL 5IB5B 5E5MB 1HEZB 3FAWA 3MRHA 4V1DE 3GSQA 3REVB 5DLMH 4NO3A 1H5BC 4RDQG 4G6AC 2G75A 1MH5A 1QP1A 4OQ1A 7FABL 3SO3C 4F7CA 4FOMA 5EZOL 3LB6C 3FONB 3I2CH 1BEYH 5GRUL 2P43B 1JL8A 1NDMB 3G04A 4Y8AA 5IIEB 5CEYB 3BRGC 4XBPA 4ONFL 2CDGB 4XZUB 5A40E 2FJHA 5F9WC 4F80A 2BJMH 1UXSB 3AU1A 3MLPA 3HE6A 3UPCA 4M43H 2HKHL 1D5ZB 1LE5A 1RI8A 1OQOA 3FQWA 1TCRA 2BCKB 5F7EH 3CZFA 5IROA 4FHBD 5CGYC 1N4XL 3SGDI 4P48A 1FVEA 1S7SB 1T0NA 3VXOA 2DKUA 2N56A 3V5HB 3IDGB 2BSED 4NNXA 5FM4A 2XACC 3QUZB 4HKZB 5D1QB 1FGNH 2QKIA 2X42A 4HPYH 1VDGA 3L3HB 1RZJC 3QIWC 4XAWH 4Y19B 1JGDA 3EOBA 5J4MA 5C6TL 1HKLL 5DMYA 4R97B 3TBSB 3MRBA 5L0QB 3CH1B 1A7RH 3CVIL 4IRZH 3MRPA 4LLDB 4BUHA 3PP3H 4P2RD 1F4XH 5CHNA 4PLKD 5SWZA 2VAJA 5E8EB 2BMKA 2R56L 4JDVA 3EO1B 2O5ZL 2IH3A 1J0KA 3GHBL 1FCCA 2HRPH 4Y5YB 1HXYA 5FDWB 3ZO0A 5F97E 4J6RH 2H6PB 5JLZA 4IEFB 2FX8L 4JB9H 2NZ9D 3OBAA 1BBJB 3UBXB 3I9GH 5ACLA 4XPGH 5DT1H 4U1JB 4NQSA 4ZMAT 1R5VA 4G9FD 1RULH 2KQMA 4KY1H 5T3XE 4NO0D 2CQVA 4POZD 3X3GH 4OV5A 1S9XB 3V9FA 4OT1L 5T5NF 3F65A 3LVEA 2IADA 3OX8A 4HJGB 2BNQA 3FN3A 3MUY1 3HKFA 2H41A 3MRGA 3EYFB 3OG4B 1DBKL 4HGKC 3E6FB 1K5NB 5DD0L 4X7FC 3EYSH 1OAKL 4PJHB 1UZ6F 5KSBB 3ZYOA 1Y6NR 4ZFFB 1JFQH 4LL9A 3LS4L 4K2UH 1QBBA 2ZUYA 1EDQA 1K9TA 4OF0A 3HB3D 4Q9RH 3HG1E 4LSSL 3R06A 2QQLH 1OGAD 2YA2A 3D3VB 1KB5L 5SV4A 1X5FA 2UWEA 3LKPA 5IOPB 3QULA 4XCEB 3T2NH 1X6NA 3IDIB 1G7QA 1T1ZA 1KENL 4S10A 5LKNA 4WI7A 1X5XA 4PGBB 3QUMH 1UYWL 4KKAD 2L7JA 1NC4B 4I4WA 5A16B 1KBGL 2BOBB 4X4YB 3OKEA 5GGVH 3ZZ1A 5FYLE 1BECA 2PXYD 4S1DD 5L2KA 5T3ZL 1Z0NA 4HLJA 4PGEA 3EZ8A 4ISVA 4NQDB 4H25B 1D5BA 3OGCA 1FBIL 1CLOL 3PWVA 4PLOB 3DUHA 3SQOL 1H15A 1MVUB 4G6FD 1UCBH 4NC2B 4X6CE 3TNMA 2G5RA 1MCCA 3VRIB 3DVFA 4NCC1 1D5MB 1MCJA 1CN4A 3VXME 3V5KA 1VESA 1BIIB 3TO2A 2X09A 5J1SC 4NN5C 4MDJB 4F33B 4TNWF 4QYOB 4PJ5D 1KFAL 5KJRH 4CL7A 4RFEB 1KJ2H 1YNLH 3VI3E 3OHXB 4PR5B 5FGSA 2Q1EA 4ONGH 5FO9A 2R0KL 5DUMH 4Y4FA 3DSNA 1KJVB 2D7PA 2B4CH 5C0EA 1A1MA 3ESUF 4YHNA 5EBGA 3RGHA 3GSNB 2VL5B 4PJEE 4X99B 5DVNA 3RVXD 1LEGA 3L5HA 2OX5A 3P4LA 1YYMH 3QDMA 4L9LA 4P5KB 5EBMB 1JZ4A 2VIRB 2GJ6D 1DEEB 3F7YA 3ET9F 4JFDA 3SE3A 3PWUA 3K4ZA 4TSBH 4OKVA 3S8WA 1LWRA 1UXWB 3QIBA 1BD2B 1N6QL 4MNQE 1OCWH 1QSEE 1G7HB 1U8OB 2AJVH 1X6LA 5B8CB 4HIHA 4KKLC 1UB5B 4I18B 4JFZL 2EH8H 3KLSA 5LCVH 3V0WH 1RZ8A 5ICXA 3TVMB 3MLXH 3EYOB 4P2RB 4HPOH 1SJHB 1BIHA 1Z9SA 4LVHB 3PP4L 5E5UB 1B9ZA 4MAUH 1PYWB 1YY9C 2C4XA 4TPRH 2DQUL 4O2FB 1T1WA 1KNOA 4JPVH 1U93A 2WQRA 5B39A 2GQHA 1U8HB 5KVFH 2NY1D 2X4NA 2P5WE 3RZCD 4K3DH 5HGDA 4FRWA 2A0LC 1DQML 1QO3A 4LLWA 2R2HA 4N5ED 4IMKA 5CP7B 4XX1E 4XPAL 4U0RB 3RL2B 5EU6A 5EU3B 4PBXA 1RHFA 5KSUB 2L7UA 2DLIA 4JG1H 3DROA 4LMQE 4LKXA 2DLEA 3DIFB 3G5ZA 3EDKA 1IM9B 2PCPA 4JFOA 1FO0L 3B2UC 4I2XA 2NY3D 1NBQA 4NJAH 1E6OH 1HE7A 2XI9A 1Q0XL 4PJ8D 1WIPA 3IJSB 4Y5VA 1TXKA 5DJ2A 4P9HH 5CBAA 5IMMB 1TJIL 2GHWB 4ZAKC 2VSCA 5C09B 1KPVB 5C0CE 2APWA 4NDMB 3VRJA 1E28B 1I1YB 5B3NA 3BQUC 3TNNA 1G1YA 2XTJD 4U3HA 3JWOH 3BISA 1YY8B 3QPQC 3RPIA 4YUEH 3QCUL 1VSCA 4JO1L 2HFFB 2D9CA 4OIAA 5TE6H 3GJFA 4ONHA 3V2AR 5EU4A 3LQZA 5ALCL 2DYPA 3QJHB 3S36X 5MEND 4JHBA 1I1AB 1V3MA 4N0RA 4WW1A 5TDNA 3TEUA 3UTZB 4AG4H 4HH9B 2H2SD 3OG6B 5E6ZA 3CUPB 3AS0A 4QTIL 1ZLWH 3UAJD 2AV1A 4U1LB 3SGEH 2HVKB 4OLYH 5ICYA 4DEPB 1A6ZA 1NLBL 5JIKA 5FM5O 3BI9X 4FP8L 1FNSH 5TH2B 3GMOB 3NCEB 1XGRB 1IGYA 5FGCE 3P0GB 5JPNA 4GXUM 1MCIA 3IJYA 3JTSB 4I0PD 5GPRA 1JGEA 3NIGE 3G6JF 2Z4QB 4EN3D 4R9HA 1EGJL 5HGAA 1QLRB 5D70L 1G7JA 4XP5H 5HI4C 4F37K 1QR4A 4B0MM 1MHCA 1CFQA 4C83A 4XPHH 1IGJB 3MZTA 4O5LH 4CADA 5LJYH 2K3TA 1ED3B 5JA8B 3ETBF 5DJ0B 4Z8FH 4AIXA 5AUMA 3MGOB 2WWMD 1RJCA 4LPXA 1Y18B 4E42B 2XFXB 5JO5A 4JJHA 4AEIH 1IT9H 4OLZL 1FL6A 2GJ6B 2LE9A 4X98A 4JGMA 1LP9B 5EORH 4WHCA 1IEBB 1L9MA 5FA3A 4D9LL 3TGXA 2HT2D 1PQZA 4G9DB 4ZFZB 3UTOA 4LCWB 1SVCP 4PRBB 4N9GA 3WL9A 3RY5A 1A6TB 1ZA3B 4NN7B 4UDUA 3IDYC 4KH2A 1A7NL 2ITDA 3OQ3B 5J6HB 5TGBB 3L3IB 3SDXA 5I8CB 1KB5A 2OXGA 1KLUB 2A6KB 4QGYA 1OLZA 4HAFA 3KLDA 4ZUUA 5IW6A 3QZWG 5DGQA 4X7TB 5FV1L 3FT4B 4JFPA 1C08B 4NZJA 1Q9LB 1A7PL 2AEPH 5DS8A 1A7BA 2R4RL 3DO3A 1XGUB 3NCJL 4Y4KB 1YA5A 3BH9B 1NCDL 3ARDA 2EIEA 3QXDB 3T8XA 4KKBD 4P23C 4X5WB 1ZLVK 1FFQA 3LKRB 5KS9F 4H1LA 1Z5LA 1FVCB 1ZS8A 4JG0H 4XNQA 1KACB 3H42L 5FYKE 5TF0A 1LNUB 1M4KA 1I7UA 2OZ4H 3CFBB 4KJPD 1RZFL 1IQWL 5CIPB 4PRPA 3CFDB 2QR0A 1NEZG 2NY3B 1AP2B 1S3KH 2G9HB 2KDGA 2ZCKH 4JAMB 2P8PA 2XPGA 1OW0C 4NNPH 2XICA 1EXUA 3QIUB 3UJTH 5C2BH 5EC2B 3UTTE 1FYTE 3VGAC 2BFVH 2DQCL 2DOCA 2YA1A 4YXKL 1HKFA 3KR3L 5SWSB 5GGSB 1BM3H 3B9DA 5D1ZB 3GUTB 3BPCA 5DEZA 3BH8A 4ZUTA 2XTJB 4Q58C 5CEZL 3CSPA 5HI3D 3W0WD 1KN2L 2B1AL 1LHZA 5GZNC 4B7IA 1CLZH 2FHFA 3GSQB 4KMTH 3ARSA 4ORGA 3G6DL 2Z8WC 1MCRA 1IM3B 3OJVC 4KK9D 1BX2B 4FABL 1CG9A 2BNRE 1HWHB 3IDUA 2SEBA 4RNRB 2FECL 5DMJB 4FQLH 2AJSL 4TVPE 5HYSB 3ULSA 4ZSOA 4KUCF 5MI0B 1OTUD 4NZRL 1E4XH 1SBBA 4JY4A 3IFOB 5SWQB 1UVQA 5B4MD 2VSDA 4PYGA 3ZTJH 3FQRB 4GKOA 1N7MH 1KC5H 3K8MA 3TT3H 4XRCA 3WHXB 2BY0A 4KVCH 5C9JB 1INDL 2I9TA 1I9JH 4O2EB 2HAZA 3DUSB 4AMKH 4I0PB 5BJTB 5HVHB 3W2DH 4MJ6B 1JCKA 2HMID 1WSST 2DQEH 3DMMA 3B8YA 2DBLH 4LPTA 4HZLA 1NJ9A 5DMGC 1QR1A 5E24E 3IVKB 5F3BA 4I5BA 1B4RA 1ROWA 4EI5A 3UPRA 3VGEA 1NANH 4N68A 1VFOA 1YQVL 4P3CH 5FEBA 2MQ0A 1AXIB 4XPBL 3NZ8B 4ZTPH 2BDNL 1TETL 3WLBA 3MMEA 3HMXL 5T1LA 3VFNA 3MREA 4KRLB 5KW9H 3RJDA 1G7MA 3SGKC 5DD3H 2OK0L 2F5AL 4L8SC 1J0YA 4PRDB 4HW6A 3ZMRA 5I66B 5C0BE 4PJFB 5BZDA 3MFGB 3DVNB 4Z76B 3SKOA 4TSAH 3U36A 4N8CL 1WQVT 3SDCD 2Z35A 4BSVA 1CXIA 4NP4H 4AEHL 2CO6B 5ICZA 4YPGB 4XXDA 5J8OA 3K74B 3GBNL 1BZ9A 3CCHA 4E0RB 3RA7H 2EDLA 3HE7C 4G6AD 1PLGH 1EBPA 3O4LB 2NW3A 4QXTB 2HFTA 2P8LA 2Q8AL 3TO4C 3QFDA 1T03L 4MAYA 5JW4R 3ARXA 2DQTH 2V9RA 3O8XA 3SE9L 3SE8H 3RWFA 1JJUA 1ZHNB 2ZWLT 4L29A 5CAYB 3HCVA 4F7PB 2VXQH 3IXTB 5IHUH 5I1CH 3FOMA 4FN0A 2AEIT 2YD1A 4PJHF 1EFQA 1ZK9A 5IFAL 1P4BL 4CW1B 5KSBF 1JWSA 2HTKC 5AAMA 1M7DA 2Z31B 3QG7L 3RHWF 5IJKC 1HZHH 4CJ0A 2QADC 4Y1AD 3KWWA 5GISH 4KRPC 1AD0A 2AJYH 3HC3H 1FG2A 3LN5B 4RAVA 5T1DH 3C8KB 3LV3B 1E4WL 4I13B 4JM4H 4QRPE 4NZUL 4U49A 4YHOL 5I30H 1D6VL 4YJZL 4P57B 1XIWC 4RMVA 5E2JA 2R23B 3V0AC 4JY5L 1EGJA 4Y4HA 4LKCB 3QIWD 1RZJH 1CE6B 1A6UL 5C07E 1ZSDB 1U6AL 4XH2B 4IDJH 4EI6B 4NO5B 4P2YA 4GAYA 3MCG1 4XPFL 2W0PA 5BQ7A 2NX5D 3CFKB 2FEEI 2VLKD 5INDA 4NHCH 4G42A 4POYA 3DI2B 1UCTA 3RVWC 3JTTB 5F7NC 5AZ2L 1U3JA 5DD5H 3W81A 4L3CB 3D18B 3MCLL 3UYOD 5EO9B 4HUXA 3T0EC 2VUOA 2GAZA 2HP4A 5D7JC 2CGRL 3GRWL 4JO4H 1JGVH 4JKKA 1F4WH 2QTEA 4G8GA 2ADJA 2ESVA 1UZ6E 3WS3A 5T1MB 2JKXA 3CPLA 4L3AA 4R7DA 1II4E 2XIDA 3OAUH 4HIIA 1HH9A 3JWDH 4MS8C 2X4SB 4P2QD 4ODTH 3RWDB 4P4KB 4L3EB 3H0TA 3MODH 5DQJA 2NXYC 2W9DL 4JREB 1TJHH 1DQTA 5C86A 5LXGH 4RWYH 4G8IB 4ZFOL 1NFDF 4K71C 3FQTA 5GSVB 1I7ZA 4JKWA 5JPMB 3UTSA 5I73C 5HD8D 3G5YA 2X4OB 1MAJA 5I1JL 2Y5TB 5BO1H 5JW5B 2DJUA 3BWUC 5E4EC 1IGFH 3OL2A 4EBQH 3KXFD 3E8UH 5FB8B 4JPWL 2ATPB 5DK3A 4HWNA 1NCWH 4GBXC 3DURA 3M8OL 5DTFB 3ARZA 4RWHA 2H8PB 4UINH 2PW2A 3QFJE 1OM3L 2YC1A 4L4TA 1IAIH 1MRCH 4FQ2L 3M17B 3QEHB 1L6ZA 2DTMH 4PPTA 5J11C 3FN9A 1U8JA 4R3SA 1NLDL 4GKZA 4KV5F 4XGZA 3D39A 4LVOC 1LEKA 4Z0XB 1AE6H 2Z91A 2AGJH 3MV8B 2V17H 2VTFA 4GRWH 1L9NA 4WY7L 2DQGL 5IUSA 1JVKA 1RJLB 1HWGB 3MNVA 5BZWB 4IS6A 2WBKA 1H5BB 3GK8H 3OKNA 3BDYL 3VXPA 1YJDL 3SO3B 3UYRL 3DSFL 5CZKA 4KJWD 3PWPD 1PFCA 3S37L 1QBLL 2J8UB 2Q8BL 4JQIL 4NQXB 2Z92B 2NXZC 4N9OB 5E2WH 4MB5A 1ULVA 2F8OA 3BE1L 8FABB 2JELH 1UG9A 4HX1B 1A9EB 4JHWL 4W4OA 5F9WB 3Q6GH 4L8DA 4LSRL 5CILH 1JNHA 3KJ6H 4GLRI 4ODWB 5FM8A 3MRDA 4HQQL 4LU5H 5HYIA 3P9LB 1YEFL 3I6KB 4YBHA 4G3YH 1IC1A 1INEH 1ZVSB 1T0PB 4Y1AB 3AC0A 1MJUH 2Y36L 3DX7B 2XWJB 2XKNB 5EN2A 3O2WL 4OLUL 3VD3A 5KOVC 3WKMH 5E6YA 5J1AA 1GOGA 2YEZA 3K81A 4QXGH 1B0WA 5FGRA 5HDQL 4C58B 5I71B 4LOUC 5LQBL 3FT2B 3HFMH 5BMFL 2EXWC 4JZNB 4DW2H 5F96L 3BZFA 2ICWI 2YPLA 4G5ZH 2W60B 4YDJA 1KEMH 4JKPH 1VB9A 2AKRB 1NGQL 5JIHA 2YD2A 3OXRA 4KKLD 1G0DA 3GFUA 3CXDH 1LDPH 1SEQL 1MHHB 2Z8SA 3CLEL 1J5OL 1W0WA 4HIEB 2GY5A 5KTEH 4B7LA 5JW3L 3W11C 3T4AB 4OZIA 1PEWA 5EPMA 2R0LL 2XG5A 3VGDA 2HWZL 3UJJH 3UYPA 4HWUA 3IFLL 3HMXA 5CWSA 5D7LD 1JWUB 4HS6B 4JANA 4PTTB 2BSRA 1C5CH 5GS2D 1WITA 4Z7VB 3AREA 1MFCH 2WBJA 5GS2H 3KYAA 1V8HA 1T5XA 4QHKJ 2CUHA 4M62L 4KHTH 5AZEL 1JIBA 1P5UA 1TCMA 3PWNA 3HUJA 4A2LA 1OARL 4Y16C 3LS5L 5IK3A 5EO1B 3ARBA 1DE4B 1UQSB 3MV7A 4FFWC 2FGWL 3TYGL 1RIHH 1D5IL 4OF6A 3ROOB 1PZUB 2VLJB 4N0CC 4Q0XL 3BZ4A 3L3KB 1N6VA 4LEOB 5I76B 4EXKA 1OAQL 3UTQB 3PGDA 1ADQH 4D0BA 3F5WA 3VRLF 4EUPB 4LLQA 5JO5B 3QDGB 2NYYC 1T04A 2AVGA 5KZCB 4EKXA 3KYMB 5D5MB 1LP9F 3O6KH 1KJMB 1NBZA 4ZAKD 2XY2A 4E41B 3ROLA 3V4PH 2MQ3A 4LBEB 3KXFB 5GGRY 1KN4L 2FLRT 43C9B 3PGCB 3BP7A 4JFFA 6FABL 2VDQL 3QPQD 3WJJA 4Z6AT 4PBWD 4NCDA 4R90L 2A6JA 5FUZH 4FFZH 5DFVC 2VR5A 3VXNA 4OI7A 4MXQC 2VZVA 4CVUA 3RWHA 1XCTA 2NR6D 2DQFB 3VMPA 4L1DA 2ZCLL 1TQBC 1NC2B 1CK0H 3D0VB 5EO0B 2I25N 4M02A 4UDTA 1DN0B 1MAML 5F89A 2Z93A 2GK0B 3D25B 3G6JE 1B0RA 1VEPA 5GJTH 2GT9A 1BQHB 2YHGA 4MNHA 5IVZB 1X3DA 2OR9H 4XBGA 4YR6A 3VXSB 5DRZA 1XH3B 2IBGA 4RFOH 4JO2L 4X4MA 3U46B 1VPOL 3WSQH 5I19L 1AXTL 2QR0B 4PJ7F 3QG6B 2ZOLB 2A9NL 4DCQB 4D9QE 2O61B 1TJGH 2E6JA 3EZJB 5EU5B 4TQEH 4NN5B 4LHUG 2QV2A 2XN9A 1FSKC 3B3IB 4HUUA 5IR1A 1GL4B 5E2VH 3SE4A 5HI4D 5JR1H 2Z8VC 5B3JF 1OB1A 5ETUB 1AIFB 2AV7A 4U1SA 1CL7L 1OD7A 4ZFOA 4G8EB 2EE9A 4YAQA 5T3XL 4HJ0C 1EO5A 3O3AB 1XGTB 4D8PB 1JTPA 5KVDH 2EEAA 3QCVL 4JRXA 4YHMH 1ZWIA 3TIDB 1IGCL 1VENA 1AXSA 2GJZA 3MV9E 1A9BA 1NGWA 3RL1A 2KZ1B 5GGRB 3TBTA 5DQ9B 1S7WB 3QZWB 5DJAB 4NRXB 3FO1B 4YWGH 5KN5A 4R0LC 4CKVX 2MQCA 1CWVA 1V3KA 2XWTB 3HLAA 5KS9E 2WSKA 1JHKL 3ARGA 3ZE2F 3CFIC 4X9BA 5D7LB 1I8IB 4JDZA 1CFTA 5E94B 3VFTB 3OR7A 4OFYA 4FTVE 3SE3C 2I9LA 4MA8H 3T0VA 1SBSH 4K7FB 1CDIA 3D2UD 5CBEB 1R0AL 4TUKH 3LQMA 1CDBA 2X4UB 2C1PB 3V6FB 3WXWH 4P23D 2BP3A 5IKCB 4P5TA 1NEZB 3GJFK 5MP6H 3ARFA 4PJAB 5TPWL 3B2VL 3GSVA 4FQIL 3MLTA 1L4IA 1UH2A 2P44B 1BVZA 3EJZC 4GKSA 4F9PA 5L2JB 5FYLL 3VE0A 3SEPA 3DGCR 1FZJB 1I3RB 2ZNXA 1WISA 4IOIA 2PW1B 1FO0B 5FGBC 2PYEA 2E5EA 5DJXB 5I1GH 3MLVH 2JJWA 2NY0C 1MCNA 3VXUB 5MEPB 4ZAKB 4XVTL 3MTRA 1KIUA 1FCGA 3T4YB 2W0FA 3SDAC 2DMBA 4HGWB 4MYWB 4JGJA 3BQUB 4BQBA 1M71B 1Q9WB 3KPNA 4GUPA 4HT1H 4OTXH 2JB5L 3O2DL 3OZ9H 3DXAA 4RIRB 4WU5A 2ZG3A 2IFFL 2FX9L 2W07A 4YX2H 3L3OB 5F1OB 2VLRA 4CBPA 4U7SA 4JZOA 3B6SB 5ITFB 4MDIA 3BPOB 1JMZA 1G9NC 2UZYB 4WEBH 5CSZB 1WGOA 1AQKH 3HTLX 2YD7A 3IRPX 3H9SA 2GSGB 1MFAH 2IG2L 4X8JB 1FFOB 4Y19E 1MOEA 4XMLH 3MROA 2YK1H 3FFCE 5DYOB 5EULV 3KPQA 1ZA6B 4OZGB 5C08A 4PJ9A 2VXUH 2XZCH 3JUYA 1DBJH 2NY6C 2EKSB 1TVHB 1U92B 5IEKB 2NLJB 1ZTXL 2V6HA 5EWIL 2BRRH 5JOFB 4TUOA 2F53A 2RHEA 4QT5A 3KDMA 4FA8A 5TDOA 2YMXL 5IB1B 1IAKB 3N9GH 2VUYA 3QNXA 3B8SA 4P2OA 4HKBB 2VXVH 3L5XH 4A2MA 1T3FA 1DSFH 4CRPA 4YFDB 3DHMA 5DMGD 3BEVB 1LDSA 2ZOKA 4N90D 4W70A 1F8TH 4N8VB 3FQNA 1W2KT 4YDVB 5EOTB 1S9WB 2WZPD 4A6YA 3NZHH 4OCWH 4OLWL 4V1DA 5IB2B 1KIQA 1DUZA 3FOLA 3LAFA 1F4AA 1MI5A 3GO1L 5C0AA 2IBBA 3WD5L 5EOQH 2Y6SD 3A6CL 2UZXB 3MNWA 4ZPTA 2J88H 3IU3A 2F19H 2C4FT 1HI6B 2I07B 3V0VA 1QRNB 5DEFB 4B5EA 5EA0H 2NTFA 3TJHC 4DFHA 4NWUL 4F3FB 3RAJL 3IDYB 4X5LA 5IB4A 3DUUA 3WNPA 4PJHE 1MFBL 2CLVB 3T65B 5KSBE 2GI7A 1QA9A 4EOWL 1CICA 1NKRA 3HE7D 3TO4D 5E1AB 5DJCA 1U3HB 1PEZA 4Y2DC 5E9DD 3U7YL 2JLLA 1KIPB 2P4AB 3D2UB 3RIFK 1VGKB 2W9EH 3QUYD 4K94L 3D3VE 5FOJA 4K94C 2VDLL 3DRQA 3GGWA 3GMRB 4P23B 4BH8B 4C54A 5GGQL 1BWMA 4AIOA 1KPRB 4JFHE 4M61A 3CSYA 4LCYA 1KCUH 2R29L 4HCRH 1Q72L 2BERA 1P7KA 4Q9CA 1E0OB 2YSSA 4J8RB 2HTKD 2DQHL 5LBSL 1I9IL 3VI4F 5IF0A 5C92A 3L3JB 2NCMA 4BKLA 3QNYB 3C6LC 4KRPD 2JK5A 2C1OB 3MLUH 5IJVA 3TBYA 3QHFH 3VGGA 3GM0A 2VZUA 4IHOA 4GQ9H 1IC7H 2EDJA 2A73A 3PQYD 1XIWD 3CU7A 4BJLA 5DJYA 3JV4A 4ZTOH 4OGXH 2GSIA 5B39G 4D3CH 4Z5RB 1U8JB 4H88L 1I7TA 1JPTL 3ARPA 1V7ML 2GCYA 3VWJC 4OM1L 1IILE 4JM2B 4YHLL 4POUB 1CZ8H 4WTWA 3IDXH 3X3FL 1OGTA 4W6YB 4UTAL 3LZFL 1FRGH 3EGSB 3QRGH 4DGIL 3KNBA 4P4RA 5C7XH 5I16B 1BZ7B 1W72L 4QRRD 5BRZD 4WWID 3GSUA 2AEQL 3HRZA 3RVWD 2V2TB 5T1KA 3RJQB 1LD9B 1UM4H 4JVWA 4ZOCA 4M7ZC 1QNZL 3VFOA 4RZCA 5BW7C 4MQXD 4HFWB 1BVLB 3QDJD 6CGTA 1CLYH 3C5ZD 4NZTL 3NIFF 1DBMH 1NFDE 2J8UF 5D7JD 1ZGLA 4HFUL 3RKDC 2P5EB